1CZUA

Refined structures of oxidized flavodoxin from anacystis nidulans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Refined structures of oxidized flavodoxin from Anacystis nidulans.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czuA00
4OXXA 5LJIA 1KBQA 3JSXA 3TZBA 3OWXA 1TIKA 1DXQA 4U7GA 2B3DA 1C7EA 3LT5A 4D02A 2BMVA 3QE2A 1OBOA 3F6SA 2A5LA 2MWMA 1AKTA 4ESEA 1JA0A 4HS4A 5NLLA 3GFRA 3KEGA 1XT6A 1AKQA 4QOEA 3U7IA 1QBGA 3NHRA 2R96A 3W78A 3NHWA 4PU0A 4M0CA 1ZX1A 4YAOA 2GSWA 4U7HA 5FX2A 2R97A 1SQSA 1YCHA 3FVWA 1AHNA 3U7RA 1I1OA 1J9GA 3ZHOA 1DXOA 2QMYA 4FGJA 4CETA 4F8YA 3FJOA 5LBTA 1QR2A 1CZOA 4ZVKA 3R6WA 4DIKA 3W7AA 3W79A 3B6MA 4N9QA 4GR9A 3EDOA 5EA2A 5LMCA 4BMPB 3OJWA 2MOKA 4Y9UA 4YAUA 2HNAA 4YAFA 1FLDA 3L9WA 4FGLA 4QODA 1ZWLA 1ZWKA 3QFCA 5ULLA 2FDXA 1YCFA 3NHFA 1QHEA 5EMNA 2QX8A 2QX9A 1AKVA 2OHIA 1RTTA 2Z9CA 3TEMA 4LTNA 4XDGA 2FZ5A 1FX1A 5B3KA 5FA6A 2Q9UA 1J8QA 1CZNA 1TLLA 4NULA 3UXHA 1H66A 4C0WA 4H2DA 2XODA 2HNBA 3QFRA 4HEQA 4PTZA 1CZLA 3EYWA 3TE7A 2ZKIA 3KAPA 3K20A 3HLYA 4GI5A 3F2VA 3NHSA 5LLDA 2X2OA 2Z9BA 4S24A 3HR4A 5NULA 3N3AC 3UXEA 3NFRA 4XDHA 1H69A 3FW1A 3L9XA 2Z9DA 1T5BA 3ESYA 2X2PA 3D7NA 5F4BA 3F90A 1XI2A 2XOEA 2QX4A 4DY4A 1J9EA 4NLLA 3GFQA 3KAQA 3P0RA 3OJXA 2QR2A 1YRHA 3OWHA 2FCRA 2OYSA 3NLLA 2MTBA 1CZKA 1C7FA 3GAMA 3OX2A 2V5VA 4GQIA 2FX2A 3RPEA 4QOHA 1QRDA 4ICIA 3K1YA 4R81A 1FUEA 4Y9RA 2WC1A 6NULA 1E5DA 2BN4A 3FX2A 5TGZA 1AKUA 2FLVA 2RG1A 3NHKA 4N65A 5A4KA 2F1OA 1WSWA 4Y7CA 4ZVMA 1CZUA 3OX1A 2Q62A 4C76A 4PTYA 2BPOA 2FOXA 2KQUA 1V4BA 1AKRA 1RLJA 2BF4A 4BMOB 3O73A 2QWXA 3NHPA 2FAXA 1B1CA 3ESZA 5FUQA 3ESXA 2FVXA 1CZRA 5BUCA 2BZSA 3NHUA 4LTMA 1YCGA 5LBUA 3OVMA 3B6KA 2AMJA 4QOGA 2Z98A 1D04A 3ES9A 2ARKA 1F4PA 3N39C 1NNI1 4ZVNA 4C14A 4LAFA 1GG5A 1AMOA 2MT9A 3G5MA 1DX9A 1VMEA 4H6PA 4YALA 3B6IA 3OX3A 1YOBA 2N1MA 4LA4A 1YDGA 4QOIA 4FX2A 1OFVA 1T0IA 3NHJA 4ZVLA 1BU5A 1JA1A 2KLBA 2V5UA 3NHYA 4C0XA 3F6RA 3SVLA 3O2NA 3W77A 3N3BC 5B3LA 3S2YA 4U7FA 3LCMA 3NHLA 5LVAA 2D5IA 1FLAA 1D03A 4FGKA 4N82A 1X77A 1FVXA 2W5UA 3B6JA 1FLVA 2M6SA 1OBVA 1AKWA 5EAIA 1FTGA 4LTDA 1AG9A 2V9CA 5F51A 1SG0A 2OHHA 1J9ZA 1WSBA 1D4AA 1AZLA 3GFSA 3KLBA 2OHJA 1YKGA 4DILA 4QOJA 4CF6A 4J8PA 2QMZA 5JROA 2QX6A 5F12A 1CZHA 3FNIA 4YAWA 2FZVA 5LJLA 4QOFA 1XYVA 1FLNA 1RLIA 2M6RA 4YQEA 1BVYF 3HA2A 1RCFA 1XYYA 2HPVA 1KBOA
chains in the Genus database with same CATH superfamily
1JF8A 1L4HA 1NRXA 4P2BA 4C88A 4TOIA 2FUNB 4NMLA 5C1BA 3I6IA 3K16A 4Q00A 1B16A 1FZTA 4YVFA 5G0TA 3SEZA 1LNQA 4ZHSA 3Q5EA 3U3JA 1WMDA 2ZRNA 3KWLA 2WG0A 1F38A 2HXYA 2XITA 3G9UA 3C6XA 3GJRA 4BX3A 4URUR 2WJVA 3MCZA 3OF2A 2YFKA 1DAMA 1X1AA 1O0SA 2J0VA 4QXQA 2GASA 1QIEA 3FF1A 4TKLA 4BV2A 1GSAA 1DJPA 1J2RA 1CQJA 2EGHA 3WADA 4HNRA 3R75A 3O94A 4KX5A 1CUFA 2H06A 1DKUA 3RUCA 1CUYA 1XT6A 2Y66A 3DM9B 4GMHA 4MRPA 1Y6RA 4Q4AA 4QOEA 2PQ0A 2I22A 5F9FA 2X86A 5U4QA 3SFTA 3OFND 3R3VA 4TTTS 2A14A 2XYRA 4TZTA 4I1YA 4OIMA 3ZDQA 4UNSA 4KPYA 1EWTA 4WN3A 4EW2A 4OKSA 3BZBA 1T2FA 3F96A 4K0RA 2GPAA 4TTIA 1M1YB 5BN4A 5BSFA 2RH9B 2OQ2A 3CINA 4XIIA 4DDUA 1FRQA 5KPDA 4TKVB 3NOQA 3AVYA 2G63A 4OBXA 1MG5A 1G291 1ONSA 3MQFA 4MW4A 2NUTB 4G4SO 4UARA 5J2UB 3FZGA 3KFXA 2ET6A 3CSUA 3V8PA 5FX2A 5JFTA 3UWOA 5LWHA 1J8MF 1F2TA 3E2IA 1NC3A 2ODBA 2WHYA 4HN9A 4D9MA 1M6YA 3SS8A 1UR5A 4I6JA 4QPZA 5FLKA 1UJCA 1T36B 1YOVA 1IY2A 1ZK3A 2CWWA 2HJRA 5BOVA 5AM1A 3WLRA 3OJOA 4PZUA 5HUHA 3LT1A 2F9LA 3GLHA 1FOEB 1LLCA 1RWKA 1XBTA 1JJ7A 4ECEA 1JXOA 4REMA 1NJSA 2GBFA 5LNK1 1UBSB 4RZ2A 4JC4A 3I05A 3Q0IA 3DOFA 1T9GS 3VZSA 2JIDA 4YNBA 1EX6A 1W0JA 5BR1A 1KO4A 5FTWA 3AVWA 1WZNA 3HA3A 1RD4A 2A30A 2AQ8A 3B1YA 4X54A 3SF8B 4C2TA 3KYCB 2C7RA 2AQKA 2XGSA 1EPUA 2G83A 3FYSA 3ZQUA 2JAUA 4GR9A 1JIKA 2XNSA 3LM8A 3GJZA 3VXKA 5LMCA 3HRHA 1Q20A 2AOVA 3CEHA 1V5GA 3C45A 5KYYA 4ROSA 4Q7JB 4EHLA 1HSOA 4XWAA 1WU8A 4ZYXA 1M2WA 1X7YB 1J49A 1R0CA 1TF5A 3FDXA 3PENA 5JCZA 3H8SA 2ZYVX 3EFEA 4E5UA 2RGXA 3IAS6 1N9GB 1LA2A 2DUUA 2EDAA 3M81A 1XPOA 2B94A 3UBTA 5LZ5A 1XL1A 1J25A 1T8WA 1YCFA 2I2DA 3A9UA 3PI7A 2ZTMA 3FYDA 1CRPA 4RLQA 2O9JA 4Z7OB 1BCRB 2G7MC 2QAJA 3ZE7A 4N5LA 2OGWA 3IIEA 5DMXA 5A3QA 1BWQA 4PC1A 4HNVA 2F6RA 3QXCA 1BH2A 3KUCA 4PLFA 2XZDA 5H8WA 2XB8A 1TK3A 1V47A 1NQVA 1DIGA 1QDEA 3AWDA 3LFTA 5DGTA 5LU8A 3RFCA 2EYUA 2CXNA 1XZJA 2PS3A 3S4YA 4NJMA 3DCYA 4IH4A 3WE7A 2CMKA 1Y5MA 1YL7A 4XWTA 5A7HA 3CXRA 3GCWA 2NU9B 4HEA6 3B3FA 3G9QA 3I9V6 3JQEA 2PLFA 3NKVA 1O8CA 1ONNA 2GJ9A 2Z2KA 3I64A 2VF5X 3WIOA 4I5EA 4LZWA 1GLVA 1D2AA 2HUNA 3O82A 4G63A 3E5NA 3NM5A 5EOVA 1QHHB 5EWJB 4EQZA 4E07A 3FMGA 4GM4A 2IXDA 1D2GA 1M7BA 4I1RA 1VMIA 1G3IA 4UAJA 2A8YA 3KV1A 1KJNA 1OFHA 1ULZA 1HPLA 3DDUA 4RU1A 3WMEA 3OOEA 1RU3A 1U11A 1TUIA 5B3JA 4OM8A 4X6XA 3HN7A 4R8KA 4E5NA 1P6XA 2Q5JA 5K3BA 2HL6A 1QAMA 3LLCA 4HQFA 3OA0A 4LE2A 3VH4A 2F3PA 3FOCA 4IJQA 3GDOA 1RHKA 3DYIA 2FJUA 4DR3B 1F7VA 1S9HA 3VUFA 4DUPA 5EYPB 4AUMA 3JAWB 1UOPA 5EZYB 3EULA 5JCJD 3OEHD 4EY7A 1VPEA 3B2NA 2FN7A 2Q4OA 5M29A 2AFIE 4PZDA 2C3PA 3C74A 2PJUA 4RIFA 4ZAGA 5FWXA 4JXXA 4YP6A 4MV3A 4KNYA 3U9LA 2OFPA 5ICGA 3I01M 5JZOA 2BISA 5IJXA 3AOGA 5DP2A 2HLDA 2VNSA 3K20A 5FOWA 1L5WA 1MO4A 4EHHA 2XCQA 1V39A 1CUZA 1MQ9A 1CY4A 4YP9A 2QGNA 1P4SA 4FT4A 2H1VA 4NL4H 1RQ2A 3C6KA 4JLMA 3C3XA 4DUZB 1VGVA 1SVLA 4J0CA 1H8HA 1XDZA 2JH9A 3CR7A 1WF3A 4K9RA 5LA6A 3RW9A 2Z9BA 2QPOA 3IX7A 4A16A 4M8SA 3P0EA 4WESB 4CR6A 3DL7A 4E4TA 1JG1A 4OHRA 4KE7A 1KI1A 2E18A 4HFRA 5HJEA 2IBMA 2I9PA 1RYMA 3H04A 3L9XA 3RIXA 2FFBA 5JJIA 5KOIA 2AX3A 1CJSA 1O9GA 4N0QA 3LOPA 2UUAB 1ENPA 5DBEX 3OQIB 2YHBA 1PGPA 4W7HA 4E21A 1AXEA 4GZLA 5LXTB 2F3UA 3W9BA 4KXNA 5HGJA 5H02A 1I94B 4JUFA 1EGVB 4YUYA 4LOKA 2FQXA 5L7YA 4EKNB 5I7WA 4ZDJA 1R0YA 2GRAA 1SXJB 1GPLA 1OI3A 4LZLA 4RL4A 3RWMB 2BL4A 5EZQA 3VR6H 4IGFA 4TXLA 4LQCA 1CU1A 1P5ZB 5ALKA 1TM7E 1CF4A 1BXRB 1GZ5A 4HPXB 1VHDA 4AP9A 2AN3A 5IYZB 3HU5A 3EJWA 5KWVA 4GX2A 4WA8A 4ZO4A 4Q4HB 2C59A 4S2UA 4DR7B 1RLUA 1JMYA 5HF6A 1EFUA 3AIOA 4UUMA 2OZPA 4RJKA 1DUIA 4BQOA 1N2CA 3HP4A 2C4UA 5AKEA 2E4YA 1H9CA 1J56A 1E5TA 3WP1B 2JGFA 2RK4A 2WWTA 2GN6A 2ZTUA 3H9QA 4GZ6A 2QW8A 5DTRA 5HIJA 5J5AA 1Z0SA 4CDRA 3TNJA 5HFJA 1Y6GA 1DX6A 1WG8A 4C07A 4D0NA 3ITKA 5BV1A 4HBZA 4P84A 4C06A 4DXDA 2R751 3AJAA 3GWGA 4Z0PA 1DV1A 2EQAA 1CQWA 4MIOA 3FCAA 3KQSA 1SC6A 5DI3B 4G1MB 3VISA 1G5TA 5JARA 1YK0A 4ZQBA 5KTSA 2DKOA 1NMXA 4OI4A 1U28C 1UXHA 1PUXA 1VMKA 4JB8A 3PCRB 4U2EA 3VPGA 4Q1CA 1NI4B 3D54D 2VDMB 1DFGA 2AFRA 4G1EB 4YJ2B 3K3PA 5D6NA 3URKA 2MINB 1YC2A 2G6BA 2P35A 4OHVA 5HQTA 5HQ3A 1ZH4A 3L7CA 3A1TA 3N87A 2C7VA 1QG6A 2VSOA 1JFVA 3MINB 4MXDA 3BB1A 4GXNA 3C7AA 3QPAA 3T3OA 1USVA 1QHFA 2WHQA 1OZFA 1SKYB 1QE3A 3FOBA 2IELA 3GD5A 1Z9BA 1EDOA 1IOVA 1YJ5A 2G88A 4QOSA 3B9PA 1L9KA 1JPNA 5AK0A 2FLVA 3IESA 3Q11A 3HSSA 3R20A 3ASZA 4KOAA 4LZPA 4X7BA 1PG2A 1L7AA 2JDIA 4BBPA 4PSDA 2A0UA 5JSUA 3BWDD 2QTVB 1UKCA 3GELA 2H9IA 1SRRA 5ERXA 3PSHA 1RDFA 5DYWA 2Q62A 3PP8A 5K6TA 4QECA 2YHIB 3G8CA 1O3YA 4R9SA 4FGZA 4R6WA 3A10A 2P91A 5JSKA 3TCXB 1DKLA 4LYEA 2ZYRA 1UDXA 3WMWA 4ZV9A 2OO5C 5DYIA 4CU5A 3DL0A 3M6WA 2WF8A 2ZTLA 3U80A 2FW0A 4A8PA 4WLUA 4MPTA 2IEBA 2GJ4A 3K9CA 5KKNB 2QPTA 5DBFA 1JFLA 2ODQA 1AS3A 3QVLA 1AUOA 4M36A 2XVMA 5C35A 1AKYA 3ZGYA 5H4HA 4PIVA 2HA0A 1IMJA 1F0PA 3ILSA 4KXWA 4ZGWA 1B1CA 1LPBB 4AYTA 4NHOA 4ZYUA 4KUGA 5JLJA 2CK3D 1ZGBA 2R1VB 3LH5A 4YJ3A 4YDRA 3V3KA 4H7JA 1XVUA 3OUZA 2ZJBA 2HIGA 3M5WA 2WNIA 2BZSA 2HBYA 3CLSD 1DTWB 4RZIA 1T5HX 1UXKA 4KB5A 5D3ZA 5LQRA 2PSJA 1TAUA 3O74A 1SEVA 2HPAA 1C41A 5JIBA 4LY0A 4NS1A 5AWFC 3SOZA 2V6GA 3KIPA 1JI0A 2P3OA 2RKWA 3L7AA 1VQ1A 4XQ0A 5DSTA 5HJ5A 1U3DA 3V8BA 2W4MA 4IX1A 4MRVA 2PE5A 1U8XX 3AEUB 3GR6A 3CO0S 3ES9A 3MELA 3MUNA 4K7JA 5AVVA 5KBYA 3HCDA 1R0XA 2VT2A 1BN6A 3OTIA 1A76A 3N39C 1OH7A 3V8RA 3OEED 2HO4A 4RLSA 2RGNC 1RXVA 2AOUB 2J9FB 1R16A 1Z06A 2Z2IA 3A1NA 3CG0A 3O3CA 4JYPA 3TK1A 3V8NA 3TKAA 1X80B 4TGLA 1YHZA 1B93A 1Z7EA 3FUWA 4K3UA 1CY2A 1Q3HA 3QVWA 2VYVA 1EFHA 3W9SA 1R18A 4RKEA 4EA9A 2R7NA 1KR2A 2CVZA 4L28A 3VX3A 3FRHA 4N40A 2R5FA 3ZV3A 4NFYA 1VHLA 1YCDA 2ENWA 1DBQA 2QV0A 3QOYA 4FE4A 3ZBQA 4HV4A 1QYRA 3HFRA 1EFTA 3HDHA 1YKFA 3HKBB 4X45A 3TJMA 4YXWA 1WUKS 3D3KA 4EYQA 4AKSA 3CR8A 1WETA 1J06A 3ZY5A 2PRZA 1SIOA 3FTNA 3JRNA 3NYWA 1WPQA 3KL4A 4BS9A 2AYYA 4JJZA 4RY0A 1HRKA 1MTOA 1WEHA 1YR1A 2DFLA 3ACBA 3ZWDA 1JBKA 4QXAA 3T9AA 5K7SA 1FJGB 1CY6A 2D06A 3V9AA 3L7BA 1VI5A 1O6BA 4IIUA 3MMPA 3DPIA 1OLXB 1U2QA 3TNDA 4QUAA 4UCFA 3WDKA 4ZC8A 2VHXA 2J3IA 5DFAA 5A5EA 4KUHA 3Q8XB 1C1DB 4FE3A 4U7FA 2YW9A 3RRMA 3QXSA 1RXCA 4RVDA 4B82A 1VSUA 5CW2A 4EF5A 8MHTA 3GLQA 1TJ3A 1JHMA 6AT1A 3W3AA 1G59A 2VSNA 2PMWB 2XYPA 1N4AA 1OX5A 1RHUA 3JVDA 4R1NA 5F7XA 1SZPA 2FX5A 3D5QA 1N6RA 2BGLA 3KOZA 4TQUS 2CFRA 2BI7A 3TOVA 1X86B 2J0UA 3TRIA 5JD5A 4LF7B 1V26A 3T7SA 1SEPA 2I29A 4MKXA 5MGBA 121PA 5JJBA 2XTNA 1X6VA 1YV9A 4KIFA 1AKWA 3DM5A 3AF0A 1BRTA 2P5SA 3L84A 5EJ8A 1QSGA 4JBGA 1EGQA 2OFXA 2BFOA 2GESA 1QUFA 2IPNA 1XK6A 5IG2A 1XF9A 3EG9A 2WP8J 1W88B 5BNFA 1UMKA 4GPD1 2P62A 4GWLA 1K6MA 3N8NA 5CW1A 2XCLA 2QL7A 4PGFA 3GXBA 1P1CA 2UYCA 2C5SA 2FKNA 4DCMA 2BCGY 3EUEA 4YJGA 3WGNA 1KVTA 3LY7A 4JC5A 2HO5A 2LPMA 3AK4A 4AO8A 3DUWA 2QBYB 3KJIA 1TI7A 3DJFA 2OBYA 5K0NA 4EW1A 2QM8A 2I7CA 3PV0A 2QM3A 3WK5A 3L6DA 3WB1A 1T35A 1N5IA 1QTRA 4F12A 3CF0A 3JZMA 4GGMX 2GD2A 4ZKDA 3B89A 4MHOA 5FBQB 3UGQA 2ZANA 3JVEA 3KD3A 3DS8A 3QYJA 2BKLA 3QE3A 4Z1MD 4EAQA 1OAAA 1QF7A 2O0MA 2BBTA 3PJDA 3ZLUA 4EUEA 3G59A 1KMCA 1Z5UA 4QNNA 1XYVA 2VYND 1O4WA 1SHZA 3STWA 2BR3A 3W8RA 1SVUA 2AWNA 2XYHA 3BULA 1B2RA 1E62A 5ALPA 3VR3D 3ICEA 3QFHA 3EMBA 4MVWA 3CZRA 4FMBB 3UJ6A 3LPNA 1KBZA 4EO7A 4Y9SA 1AF4A 3UOWA 2O7QA 2Z30A 4J07A 4V0KA 3MTBA 2PKCA 3GN2A 2O0JA 1XYYA 4WE3A 3VYTB 4KDFA 5I7FA 1A9QA 3F5QA 5FAXA 2FSVC 1UH5A 4TS4A 4AQDA 2ZRKA 4NOJA 1N6LA 5JHGB 4PR3A 4PXSA 3V8EA 1OW3B 3KVYA 5KDDA 2ZATA 3TIXB 2NO9A 2H4JA 2NYVA 5L3SA 2G4CA 1SM4A 4XGNA 1A2KC 1WZUA 2A9VA 1TW2A 1C3XA 3T3EA 1A2OA 4WNYA 3G6WA 1FUYB 2HH9A 3INRA 1U8ZA 2R8ZA 3K35A 1LXCA 3THRA 1GQRA 1OBOA 3ZJ5A 3G68A 3ADKA 3PEVA 1KWKA 1XLUA 1S8AA 2PLRA 2WU3A 4J9UE 4CQLB 4D9NA 5B2FA 3IKTA 3A14A 1GFIA 3OP1A 2E0IA 3KEMA 5LBIA 2RC6A 4II3A 4HDKA 5NLLA 5BSHA 3S2GA 4C7XA 4DPLA 1Z0DA 5ALXA 3RFFA 4XFDA 4RXTA 1AKQA 2XRZA 1P6QA 2XXJA 1OFUX 2E5WA 1HE5A 3CG4A 4F91B 2QZSA 3A1DA 2C1XA 5EWMB 1O94A 4WL0A 5HCUA 3FNQA 3RVLA 2JA2A 4KSYA 3WO1A 3TFOA 1G20E 3C4VA 4UEJA 1EEXB 3BGWA 5HQJA 1SURA 2RGRA 1KEUA 2LKDA 3FYHA 1R0ZA 1S2IA 4P4NA 4IEEA 4DMFA 3V5NA 2GSWA 3R4CA 3ZD6A 6Q21A 2PMKA 3PPWA 4AJEA 2R97A 2YJGA 1MO3A 1PYOA 3KVRA 4W1QA 3PU6A 1SUBA 2PL9A 3QXXA 1EE1A 2C4WA 4BNHA 1Z28A 3I73A 3PC8A 3B9BA 4DF3A 4ETWA 5C9ZA 1KA9H 1HBJA 3FHCB 3QKSA 4J0FA 4FSHA 2Z08A 1QPGA 1E2DA 1L4LA 1QH8A 1JKMA 1KI6A 2EBFX 2H8KA 3WL4A 4DM4A 3EFOA 2EF1A 5IX8A 2VUTA 3UJ3X 4BP9A 4ER0A 3I28A 1NN0A 3OFKA 2WB4A 2AG0A 1HQKA 1J42A 4WN9A 3K8YA 4PBSA 3RS2A 1Z56C 2J87A 3EEIA 2EL9A 2X58A 4CJXA 2Q0SA 4RWZA 3I6YA 4JR0A 5ITZB 3P4YA 2LIPA 4CG1A 4M60A 1DQRA 3TW4A 4Z7QB 4DV7B 3HTXA 4F2WA 2WJ4A 1E3SA 5ICCA 1FMTA 3DO6A 3OZBA 1Q6YA 2XE7A 4KGVA 2IA5A 1WXFA 1ZVMA 3B82A 5FA5A 5I5EA 4N8EA 4H0FA 3T38A 2MJLA 6REQA 2XE8A 3DOUA 5A5FA 5IJ0B 3RBVA 4EZBA 2C9OA 1YZLA 2WR8A 4NWIA 4OIFA 3GY0A 2V74B 1JPJA 4B87A 3AXSA 1ZCZA 2FDXA 3EASA 4RZXA 2XZLA 1HQYE 4LXUA 1Z4NA 2F4NA 1A0OA 4ALJA 1CRWG 2IDMA 3FETA 3LDFA 4KQCA 3TCKA 5A9SA 3O92A 1VLLA 4RPIA 2HWUA 3O9MA 3K9NA 3SD7A 3LSYA 1EG7A 1KVQA 1GKUB 1CUIA 1JSRA 2WA2A 4XJTA 4AKGA 1M0TA 2YYZA 2Z5VA 3E03A 4UFNA 2H17A 2X8JB 1M72A 2Q50A 2PS0A 2QXYA 2B30A 3OU7A 4RHEA 2D2IA 5LYJF 1NBIA 1NZFA 4GRAA 3GRAA 2P5UA 3NUGA 3TUZC 1YE5A 1DBSA 4IINA 4Z4IA 4JLNA 1SCBA 3TPCA 2NU8B 4FDVA 4HUJA 2AFHE 4E22A 1PWYE 4R40A 2BUBA 1OX4B 1MJHA 1QIFA 1JLSA 1X1BA 3GEBA 3PKZA 2HK6A 5K0CA 2E85A 5K4AA 2HA7A 4M54A 1IY1A 1UP7A 3DUFB 3FLBA 1L4KA 4P1ZA 1GL9B 1ECCA 4JVMA 3FCSB 4RHTA 2VDKB 3S70A 4QE3A 3ZZTA 3HDTA 1JEEA 2AC2A 1KJIA 3IMCA 3GYBA 4AX4A 1T1IA 4QXRA 4KQJA 5E2BA 3T5PA 4MCHA 2G7ZA 2HNBA 1U0RA 2VP5A 3OCWA 4HGZA 3SIPA 4TZKA 4GC9A 3UJ7A 4O4HF 3ER8A 4BX0A 5EJ5A 3GRKA 1TIBA 4TYPA 2ZIUB 1NF3A 1UXIA 5EIOA 2QTRA 2VLBA 3K0AA 2D54A 3CE9A 3CUWA 4YPOA 1T5LA 3WLQA 3OZVA 3CW2A 1TKAA 4QYTA 1H5QA 4QATA 4B4DA 3TE7A 4YRDA 4Q9DA 3IB6A 3LP6A 1EBFA 1YH3A 1TQ2A 2KHZA 3AETB 1IIRA 1Z8NA 3PDCA 3REFA 1REQB 3KAPA 1RI1A 1T5TA 1YONA 3ED1A 1R6XA 3IP7A 3OC6A 1RT9A 4FWBA 3H6GA 1TXGA 2IPOA 2EBWA 3U39A 1J7JA 1VTKA 4TSFA 2HXSA 1R9MA 5AKXA 4X5OA 2EERA 3U62A 2AJCA 1Y3DE 1M1ZA 3ESDA 4OOEA 3RTEA 3JW8A 5FUXA 2DOKA 4OI2A 2WPDD 1Y1KE 3OE7A 5J4YA 3TQQA 2I1QA 2NXEA 1Q16A 1Z0IA 3HB5X 3RTDA 4EG3A 2F8TA 3D4IA 3X0DA 3PA8A 3ZHVA 1I2MA 1AF7A 1A69A 2EKQA 1R0WA 1U7UA 3C3BA 1H69A 1NBWB 2R7MA 2CL0X 3A9VA 4BU1A 4DIDA 4RPKA 1Q0QA 3ZWNA 2PGDA 2Q5LA 1XLTC 3OLWA 3TZ6A 3WYNA 5EJ9A 2WZDA 2EKDA 2JIOA 1DG3A 3H8JA 4KMSA 1NVXQ 4I55F 1R3DA 3R23A 2VHJA 2PBFA 5JADA 3AR4A 4Y2UA 3QX9A 1JNXX 2P9CA 3T06B 4J90A 3USCS 4RANA 4QNRA 4NDAA 1TMYA 2EEZA 3TIFA 3UB3A 2P77A 4LFBB 1R9GA 3V1LA 5ITVA 2Q21A 3WGIA 4NBNA 1UPUA 5CXQA 4JASB 1YXMA 2ZUWA 3EQZA 3OLCX 4PWZA 1PLKA 3SBOA 1WPGA 2WHPA 3V2UA 1AUXA 3D6MA 4UQLA 2JGJA 4JJFA 3TMKA 5JH7F 4TTQA 2W48A 4AZ0A 3S8EA 3PIDA 2W6ZA 2VPWA 1CX9B 1YRHA 3LUBA 3NBYC 1GZDA 2YW2A 3P8ZA 3QLVC 4LDQA 3TVTA 2FPRA 1N1EA 2WZQA 3Q41A 4BQIA 2YDYA 3V4SA 4EYGA 4HAXA 4F7WA 1HG0A 1C7FA 3OEYA 3R7NA 2BR4A 1SCUB 4D9BA 4O4IF 2PL1A 4KWCA 5CT4A 3GAMA 4BNMA 4BFZA 4CM8A 2IU4A 4K9KA 3PGJA 1M8PA 1DCMA 4A8JB 2JLSA 2CGEA 2IUSA 2Q9AA 1E2GA 3GLGE 4COOA 4EP1A 1KJJA 1HEUA 1T4BA 1XEWX 2VSXA 4N7RA 4XGRA 4RVGA 1RQRA 4DE5A 3DNMA 3HFSA 2Q3EA 4G0NA 1V8BA 1YF3A 1VE6A 4LWOA 2D2VA 4AW9A 1EDDA 2H7XA 3THOA 3FJYA 4KXQA 1DG9A 5IJ9B 1EVLA 3TD2A 4CFYA 1XQWA 3WGZA 4BQNA 4WY5A 2PUFA 1SQ5A 2J5QA 3UK2A 3GB9A 4ZU1X 3V1MA 2J8ZA 5T4BA 4DJEC 2CNNA 2P6OA 3P9CA 3R8CA 3VTFA 4FZ5A 3VNAA 1XNGA 3D8UA 2JCYA 3ADDA 2I3ZA 1XN4A 1J7KA 2HRQA 3IFSA 3H05A 4LQLA 3TOXA 1C7IA 2WNHA 2CUNA 5HFNA 1PR0A 3EYAA 3L0ZA 4TS1A 1U0GA 2C5AA 4BZZA 2B4YA 5G1PA 3B20A 8GPBA 1GVNB 2W6IA 4FGUA 4D3YA 2P5YA 1HLDA 3SNKA 3OX1A 1IM5A 1U98A 3QE4A 1HE2A 2D74A 1IH8A 4QRDA 1UJBA 2W2PA 4FMDB 3L41A 1P7WA 3N6VA 1MV8A 3FXAA 4B8ZA 1IK6A 2V9ZA 4DRYA 4FXPA 4E1VA 3A25A 3UJ9A 4A6XA 4RIHA 3TBKA 4CQMD 1YD7A 3TM4A 2ZYWX 1XPRA 2E4UA 2J3QA 5DM0A 1TPZA 1BFUA 2DQSA 3NDIA 3KE9A 3OPXA 3INNA 3EY4A 1YFJA 4KZPA 3L6EA 2HSDA 4OI1A 3RKRA 4QRIA 3I9FA 5JTTA 3UNXA 2RHBA 3R5XA 4I50A 4TROA 3UJPA 5HZMA 1IBSA 4BMZA 3U3XA 3E0QA 1Z82A 1CDEA 1CZRA 3JYOA 4NOKA 3ZN2A 4PO1A 1FJ2A 2DPGA 3I1YA 4H7IA 1ZO8A 1C1HA 1Z6GA 2FWNA 4KPUB 4RCVA 3UICA 5JXGA 3WJ2A 2X8BA 5CD1A 3BEOA 4RKYA 2X1VA 1VJRA 4OQEA 5EXSA 5JAIA 3SPXA 3DDHA 3NH9A 5DWDA 3ANTA 1X9GA 4OHKA 1RMTA 2A1TR 5D6OA 1EXVA 1HG1A 1NVGA 2PX4A 3SFZA 2OV4A 5JSZB 1JSCA 1FDRA 2J3EA 2ZBDA 2R6GA 2WSSD 1HT0A 2L19A 2XX3A 4FNMA 4OB8A 4Q39A 3P5BA 3TVDA 4MDEA 3RWBA 1FTWA 1PBNA 4QRHA 3CRVA 3F8WA 3ZU6A 5A62A 1SKAA 7REQB 3Q3JB 3QUAA 4A5SA 1GQOA 4H3KB 2YOHA 3WMXA 1E1YA 2HWWA 3PC6A 1IEXA 2OOKA 2CWDA 4CEJB 1RCTE 2NUAB 4GE3A 5JSFA 3GRVA 3MSXA 1E0JA 3EDRA 5F73A 1TU4A 3THXB 1MKYA 2HA3A 3C3CA 3DPUA 1N7IA 3OQJA 5JWHA 1RRVA 3KD2A 4EKIA 3LK7A 2EFJA 3H5TA 1K2WA 3WGUA 3B7WA 4CDGA 2GBPA 3OCZA 3A3YA 2I71A 3UZUA 1C29B 2EXXA 3IUNA 5KYXB 3CZQA 1V1MA 5AHKA 5TPZA 1U2GC 1OI2A 1P62B 2PMDA 1PIWA 2XMSA 3B1WA 4DQKA 4B74A 1E9SA 2O57A 2D5BA 1UWLA 1ZBDA 3O4IA 2I8CA 1YL5A 4ETNA 3QPCA 2JD0A 2QP3A 3ICPA 3QQPA 1VC2A 1KVUA 4X1YA 4BN4A 3UBMA 3OMWA 4HAUA 2K7ZA 2HGSA 3K2BA 4MCAA 4D3XA 3D9QX 2DF8A 3CNBA 1R6VA 2AKYA 2D5CA 2ZIXA 2WAOA 3F49S 4M88A 1M0WA 4BV8A 4LZAA 3DFIA 3G89A 3N07A 4C04A 3F6RA 4MHTA 3SVLA 7MHTA 4ILKA 1H6DA 3GLVA 2FE1A 3RK0A 4CRWB 1J21A 3L7NA 3T35A 2JLUA 1E2QA 1Y81A 3C41J 4WD3A 5E4FA 4EGFA 3ORFA 2DLNA 1HORA 3QITA 5AOAA 1N92A 1UBTS 3R3SA 1HWYA 1MNAA 4L57A 2PKQP 4QSMA 4IVRA 4BN0A 4N1AA 3CT6A 3FPEA 5F76A 4E5SA 4LEIA 1XEXB 5DHUA 2R00C 1WZ2A 3BT7A 1QQBA 2XYQA 2H5EA 2YL2A 2PJDA 4OQLA 2C1EA 4PPNA 4X90A 4WBNF 1GPKA 1BEEA 3WV4A 4CMAA 4BGIA 5JPCA 1E1NA 2XRFA 4LBVA 3TNYA 3A58B 2EJTA 3QVKA 1KQOA 1XCMA 1CKEA 1H4TA 2M6SA 4OQPA 4GPEA 1FVHA 3R5JA 2GHRA 3ZCVA 4IKOA 4FDUA 4OREX 4WCVA 2PZFA 2PMBA 4X6UA 3MJ4A 1D7OA 5B2EA 5GJCA 3Q3IA 4P54A 3BWYA 1NDQA 1LZKA 1ML4A 2XTJA 4YRZA 2L17A 3NVMB 3FDJA 4ZU6X 2YHUA 4PSVA 3P9NA 1I6LA 3H2ZA 3PC7A 4MO9A 4Q4DA 1PN3A 1XMSA 1ELOA 5A5DA 4HYQA 1J2UA 3W9YA 3L4SO 3LC2O 2QQEA 4UVGA 2OYCA 2QTZA 1ZU5A 1M1YA 5L4NA 5A4DA 5IWCA 4XGKA 4R1LA 1RVV1 3UMBA 4TKVA 2QN8A 1JDBC 3CLVA 5FI0B 1PNRA 3MBKA 2NUTA 3GLFE 1Z4OA 2X7HA 4ZARA 5F3DA 5J2UA 2DX7A 2GXAA 4DG5A 3I62A 4OX9B 2JB9A 4C4TA 1RIIA 4PQRA 2OHJA 2V5AA 5M3BA 1T36A 2ZDGA 3C6MA 1E3IA 4FUTA 4XEUA 4HUQB 1WDWB 3ZCQA 2EHJA 3QVVA 5DSXA 4EG5A 5KNBH 2C84A 1JVNA 2WMDA 1JG6A 3FTCA 1I2ZA 3BA6A 4L9RA 3GF4A 1RRPA 5G0SA 4PHCA 3CVXA 1DWUA 2H4HA 2BVNA 3N5CA 3CN9A 4OYRA 2ZT6A 4QOFA 2PQMA 4Y98A 3OZ7A 5DHQA 4DSAA 3GZ4A 4ZZ1A 1KYYA 1TZCA 4RS4A 5BWLA 3RRFA 2YMLA 4FN4A 4BXOB 2M6RA 1MABB 1A9RA 3PXUA 1R15A 4YQEA 3SF8A 3KYCA 2VSYA 1LK0A 3IH5A 3PXBA 3JQ9C 1MFPA 3D0QA 2QG9A 3FPKA 5F64A 2VRBA 5FFNA 1OREA 1SFRA 5FI1B 4DA0A 2JI4A 3FYTA 1MGPA 3HZRA 4FYIA 4D46A 5BY2A 2HPVA 4H6XA 4KAFA 4J43A 4L0DA 1X7YA 5K0FA 2NO4A 2XZTA 1RJ9B 4ALMA 3AMVA 3GJSA 3RD5A 1NUSA 3U5TA 4HVTA 1Q91A 4YRPA 4OGFA 5IT4A 1N9GA 1KP9A 1V5EA 2LW7A 2HAEA 3DBRB 3FI9A 2FJ0A 1N36B 4N3NA 2P1RA 1GTSA 1BCRA 1RWXA 3W8NA 2OD7A 3PYLA 1RP7A 1Z73A 5DNEA 4GHWA 1FEZA 5EQDA 1WJGA 3PQ8A 2V96A 1N2ZA 3L82B 2DUJA 2HQRA 3O4FA 4IG4A 3EGVA 4AVYA 1E58A 3B5EA 2ONYA 1KYWA 2WHRA 3D6AA 3FPBA 1TF7A 2IVFA 4P7GA 1WW8A 4N7JA 3QPBA 1W4LA 3U31A 3BD8A 1W0KD 1A27A 1JT9A 4P3KA 3MERA 3PQ2A 2NU9A 4WBSA 3RANA 4OUKX 3O4RA 2ZUSA 3NT5A 4PPGA 1U4OA 3U7IA 2JZOA 3D3EA 4B3RB 1YTLA 3WB9A 1KFJB 1O0BA 3OO1A 4LNUB 3D6VA 2R96A 2YJNA 4KN8A 4CCYB 4Z0NA 1OBCA 2CXQA 5EWJA 4GFDA 4D6XA 1QHHA 1GPWB 1GT6A 1Q83A 2F3TA 4KGZA 1X7HA 4F60A 4IGEA 1DOHA 1TUBB 4HWPA 3ELDA 1PGQA 1R10A 1T6BY 5BRNA 1XQ9A 2B3TA 1N3BA 1QYVA 2XCRB 1ZH6A 2IX3A 1F8YA 4DAEA 1R27A 2EDCA 1LPNA 4D45A 1P5RA 2JIZA 2XRMA 5KWJA 1B8PA 3GRFA 2G9ZA 3Q9SA 4C7VA 2H2GA 1UEJA 4OXYA 3MJEA 3W6OA 5CNJA 4WIAA 2CKDA 4B4KA 1H3EA 2E55A 3LPDA 3EAFA 3JAWA 1ULSA 1QGZA 2ANCA 1GTVA 4HLQB 3A1FA 4O2LA 4WZAB 1P9OA 3VPDA 3VU0A 1VBKA 4FGJA 2J4FA 2HJGA 3F7TA 1O8BA 2PWPA 4JLJA 2PRIA 5JFOA 1XZAA 1GLGA 1Y89A 1WMFA 2GAAA 1GYRA 3CZCA 1GZ6A 3BA1A 1F5NA 2OP1A 1VLVA 4JSTA 5D5HA 1EQ2A 2Y1FA 1OI7A 2CE7A 3ROPA 1U9IC 2NXNA 2V7UA 3ME5A 2VQ3A 4YHBA 2EZ8A 4GI3A 5IEJA 4TYQA 2FPMA 4HL6A 4BX9A 2VRCD 4BVEA 1W0CA 1OLUB 4Y2GA 2HUPA 2RHRA 2ZUTA 1IOWA 5DE3A 3EVEA 4C1BA 1RYEA 3DE5X 3K4QA 3PHLA 3CV3A 1B26A 4WESA 3T7RA 4FZJA 1E1RA 2C82A 4HGNA 4ZPXA 1GUFA 2G0TA 3E2MA 5FYDA 5BN5B 1Q3KA 5CCBA 1KQPA 4C2BA 4TXHA 1ISGA 9ATCA 3EXIB 1B0ZA 2C8JA 4GX1A 1MPXA 2CXPA 4X91A 3H5WA 4UATA 3QKRB 4XCQA 3OQIA 1B42A 1M2OB 2YIVX 3DGFC 2JGLA 3TO5A 4CG0A 4C2AA 1ZOPA 4NCJA 3NHZA 5LXTA 5ECDA 3BL8A 2R7LA 2ZM5A 4HWRA 3EEFA 1NJ5A 2OY0A 2OHIA 3PRJA 4ZXFA 1SXJA 2R47A 4RKWA 3MTEA 5EGNA 3BXOA 2O8NA 521PA 1YB5A 2VPQA 4GE0A 1VPVA 1D0IA 4PANA 3ZCSA 2JANA 2PBZA 3ER9A 1MMFB 4PINA 4MUGA 1BXRA 4NZ9A 3TDMA 4CMIB 2Q45A 1YRLA 5I4KA 1T3SA 4KX3A 2CL7X 1GGVA 3IUQA 4AN0A 5IYZA 4O2RA 4J1SA 4QUBA 2EQ5A 3FNEA 1G38A 4ZANA 4HDQB 1ZJZA 5F7ZA 4Q4HA 5EIBD 2G5CA 2PT7A 2AEFA 2GF9A 1VKOA 2Z2ZA 2DP4E 3BCSA 3ZNOA 4DB4A 1XMJA 4QSHA 2XWBF 4KDEA 4OO3A 3T5BA 621PA 4N03A 3AHDA 3UPDA 4M46A 3ZGNA 4B6QA 2DCUA 3EXG1 4PCAA 3OFJA 1C9JA 2YWDA 3H65A 3QFRA 1WDLA 1XDSA 1OZHA 1KKLA 2YN4A 4QQRA 3C8ZA 1LEHA 1Z8HA 3UMRA 2VS1A 2A3NA 2X41A 4MAFA 2AN1A 2OCYC 5CTAA 5DI3A 1JJIA 2W9XA 4F3RA 3IALA 3NTRA 1FBNA 5ER6A 1G9XA 3BIFA 3L07A 3L4EA 3UW3A 4RENA 4EGJA 4DKJA 1HUQA 3HYNA 1U0BB 1NI4A 1U4SA 3DT8A 3A6HA 4L9SA 4YJ2A 4B3SB 1GNVA 5JEDA 2MINA 1JG7A 4BBZA 3TF5A 3WS7A 4N3BA 1Z6XA 1KMIY 4QA9A 3TH5A 1SHJA 2NO0A 4UXHA 1BC5A 3SQDA 2H29A 1QH9A 1LC0A 2PZMA 4IVQA 2CB9A 2FZGA 2WWRA 5FFMA 1XTVA 3MINA 4AJJA 4V3CA 3H1EA 4RV4A 4WOPA 4GL2A 1GAXA 3HXOA 2YBDA 1OYWA 3S44A 3ZHBA 4DMUB 5CPBA 5GONB 4GQAA 5A2QA 1N6KA 1V5IA 1RZUA 3QTLA 3NHSA 5EUMA 2OXEA 3BF7A 3BTOA 4RIGA 3FCXA 1MU0A 1XEAA 2C9BA 3QWIA 4KTVE 4DR6B 4MUJA 2GRUA 3WYBA 2HK8A 2WIDA 4UE2A 4BWFB 9LDBA 2WHEA 3NONA 2B83A 5IM4F 4BNNA 2QTVA 1AGPA 1EZ4A 4J1TC 3OAAA 3LC1O 4BDTA 1N9ZA 4CZ2A 5FNZA 4K2AA 2YHIA 2AMVA 2Q4DA 2ODPA 2QZ9A 2ZJAA 3FE2A 4K81B 1ORDA 1O89A 2QA5A 2WM3A 3JQCA 3UWDA 3GGSA 1FNNA 1Q0PA 3IODA 2JGMA 4ZOEA 3BDVA 3C16C 4ZV4A 1JMKC 2X2PA 2QE7A 4MVJD 4B6FA 3MT8A 1DAFA 1JAHA 1SWVA 1QYWA 2PIAA 3BXZA 5E3JA 5HRAA 2RGBA 2ZRGA 2MYNA 1AHPA 4KK3A 1SBHA 1Y3HA 1JHAA 3MAJA 2C3OA 3NEYA 2LDBA 4HB4A 4KMOA 5DGCA 4PAWA 4MA5A 5KC8A 3TG2A 1QJ4A 3KT0A 2R1VA 5EE5B 2P4UA 3GPLA 4D9EA 4F9GA 4Q9KA 1C5KA 4TL7A 1UMBB 3DZCA 3PGKA 1FSPA 4B0PA 4BJ3A 3LW8A 1E96A 3M6UA 4GS5A 5CVVA 3ASYA 4CM5A 5IAOA 3VJKA 1DTWA 1QFSA 3M4YA 3LNCA 4BNFA 1MX5A 1PWEA 1UZAA 3I2JA 5DKFA 3GROA 5CH3A 4KSBA 1UJ2A 2BJVA 1U2DA 1I10A 1PQYA 2PWYA 2PM8A 4QGFA 2Q2NA 5CP8A 3T1NA 3ZXIA 4AURA 4DIOA 1FFYA 1X8LA 3K1AB 3SHFA 3PFNA 4KVZA 4UW9A 3SXUB 1IHUA 5FBVB 1OH5A 1GA4A 1AB5A 4LXXA 4RDCA 3HCAA 5CTJA 5LQNA 3F97A 1H5UA 4J0DA 1F1JA 3CEMA 1FYWA 2HKIA 3KJHA 3AEUA 3NRCA 4JYBA 1VBMA 4MJ3A 3WK9A 1M54A 3R7BA 3QUCA 5AJVB 2OG1A 3KQYA 1YDHA 2JIBA 2YJ5A 3QIVA 4PN3A 4JQSA 3LQYA 2UU9B 5HKKD 1GD1O 4FHZA 4ZRMA 1ZA1A 2AOUA 2J9FA 4P2GA 4PQFA 3OURA 2IOYA 5ESRA 1KETA 5D8DA 2A9QA 4GOLD 3ROEA 5IP5A 1X80A 3IVCA 5EE3A 2KJQA 3L0PA 5EN4A 2QXUA 4EZIA 1XD8A 3U09A 3I58A 4BC1A 3SVZA 1O08A 1ZCBA 2I2AA 4IKEA 1K9VF 1KK2A 4P7JA 2RG7A 5AHOA 3K9FC 1FNBA 5DX8A 5AUNB 1Y6JA 5B4VA 1FJHA 1E9BA 1JHXA 1O5OA 3O0DA 4LJ8A 2P4SA 1ZIOA 4M2LA 3RUHA 1ILEA 3MLEA 1JV2B 1EVZA 3FFBA 1KYTA 1EVQA 1GNRA 1I80A 2IEAA 4JL5A 4DNOA 3VV3A 5KSYA 3DBVO 1PJBA 3TX2A 3HKBA 1T34A 4RJTA 1PUJA 4N65A 3OQ1A 1IJBA 4KWTA 3GN1A 3UUWA 4B6SA 3BGDA 4BU0A 4Q7LA 1ODCA 3G2JA 1A8UA 1XKLA 4IWNA 4J2OA 3VVMA 4BDSA 3MEQA 1Q15A 2A9OA 1IHOA 5BQPA 5IBRA 2ZRLA 4IJUA 3RSFA 5ANRB 1Q11A 1W34A 1YQGA 1YUMA 2N46A 3E9MA 1GG2A 3AFGA 3JYLA 1L4EA 1KH3A 2OGUA 1KS2A 3IUYA 4LS3A 4FBGA 1OLXA 1PYGA 1ZAKA 2Z57A 5DTJA 2QIOA 4XR4A 4CVNA 2IZOA 3CXUA 1ORRA 2ZR9A 3GGDA 3BHMA 1IQUA 1W1UA 1XQ1A 1K3TA 5H82A 4XWYA 3TPFA 1C1DA 1LDBA 5L53A 4F5ZA 3TD9A 2IQIA 5FQOA 5A0VA 4ZFNA 3AVOA 2NX2A 3VSBA 2H92A 1MAVA 3TNFA 2QWXA 5A7FA 3W1EA 3ZW8A 5FUQA 4NJEB 4ACAA 1B73A 1ZR4A 2FVXA 1TVKB 2YFHA 2GTHA 2HBQA 2TMYA 1ZM9A 5KX5B 1XVAA 2OSVA 1F20A 2DFVA 3K6KA 1X7ZB 4B3HA 4IIGA 3AVVA 1RM3A 4ACBA 2CVQA 2QTHA 2XZOA 3P96A 4OCZA 1E3TA 2FN9A 3P97A 4JHXA 4PFJA 4IGIA 2CYAA 5KNBA 1Y7LA 3WTBA 3U4IA 3UHFA 1P7ZA 1YR9A 2AMJA 1H3NA 4FDTA 2NU6B 3VC3A 2H54A 1SB9A 1HTTA 4XLZA 5E7IA 3JYQA 1PZNA 2DE0X 2OXRA 4C4RA 5LUAA 1W88A 4DNPA 3KALA 3RT9A 2XMDA 1P2FA 3PGMA 1FTQA 2DHQA 1QIGA 3PK0A 1Z8FA 2H11A 1DC5A 4J49A 5F5LA 1D04A 2IP1A 3LY9A 4X93A 3VAYA 1LDEA 3D4OA 1FRZA 5KTMA 4HZGA 3NKLA 2W2KB 1O6FA 3B7PA 5CM8B 4F3CA 2ODTX 5JY6A 2CLHB 1PFGA 1UBOS 3AEXA 4FQ5A 2QBYA 4C1NA 1E1DA 5CJPA 3LLSA 1U1IA 1W581 4J1QA 9ABPA 3KQHA 1K6IA 1GG5A 4L15A 1R8YA 4QJBA 1C0EA 3G2KA 4TS3A 3F74A 3G0CA 2YMQA 1YBAA 5JNRA 4AI6A 2EP7A 4JB3A 3NWPA 1R0SA 1QC5B 5KYUB 4BO9A 1XIVA 1B0PA 2AXEA 3KOYA 4TWZA 1VL1A 3QPDA 4KH1A 2DERA 1CS0B 1QONA 4G8JA 2FG6C 3IOMA 1YOBA 3L6UA 2C2YA 2QU8A 3LCJA 1I0LA 2A86A 3M3PA 4GWGA 1WCIB 2EU8A 2JDID 3IAAA 2VDNB 2JFOA 3L8FA 3DDOA 4BX2A 3AF6A 4UE6A 3B85A 1QH0A 1OD6A 1CB0A 5EJ2A 4ENTA 3WYAA 4O2AB 3GI1A 2RGAA 4ONEA 2A9FA 2QORA 3DDNA 3WGTA 1TO6A 3LVRE 4QBIA 1ID8A 4NYJQ 1TYEB 2YZMA 3DHYA 4XOUA 3A7EA 1L4UA 1FW6A 3WQRA 2DPLA 2HSEA 4FWTA 3M33A 2HDHA 3WIEA 4DCTA 4LHXA 4P93A 3WFIA 5LZ9A 1DHTA 1Y4ZA 2GPNA 4ZOBA 3JYHA 2A3RA 1M2JA 1F6WA 1ZK0A 5FI5A 2VNKA 3KXLA 5TX7A 4PHFA 4EZEA 3B3GA 4D4LA 4EO4A 3HJNA 3DGEC 1ZUHA 4E3ZA 3W6NA 1PR3A 3VAAA 1IRIA 3DE0X 4QWWA 1ZH2A 3A2NA 2Q1WA 5F3WB 2D0IA 1WXXA 2GYWA 2O3UA 1E3DA 2JJYA 2YRXA 3L1JA 4IS3A 4TMKA 2HGZA 3OCXA 2Z95A 4WCDA 3SZRA 4IZIA 5EJAA 4RHFA 4CMJA 2YIDA 3DVRX 1FVXA 2HJHA 2JFBA 2W5UA 4EKGA 4O59O 4PE5B 3EW7A 3R3UA 4OQNA 2ZYGA 4Q24A 5JR3A 1QQAA 2WSIA 4HLUA 5FBLB 4CQLA 4P92A 1DAEA 3AILA 1KO5A 4PAGA 1CT9A 3S2ZA 5G40A 2HT6A 4LTDA 2WDPA 2DGDA 4MWZA 2CJFA 4O0LA 1K5PA 2PX2A 4LXGA 2OHHA 4WLEA 1NE2A 3USES 4PW0A 3I8OA 4M0LA 3NTXA 3CH6A 1HOTA 4TQ9A 1WB9A 5EWMA 2QL6A 2EZ9A 2BHNA 2I4MA 1EQAA 1WO8A 1Z0FA 2XMCA 2RAPA 5B1EA 4MW6A 4ASUD 3H4MA 1CQZA 1XZLA 1PZGA 1E6LA 2EKPA 3CONA 3CURA 4PV7A 2ZBQA 4WKBA 1M33A 3STXA 3PJRA 2VVTA 2Y1XA 1V25A 4DC0A 1L5SA 3DV9A 4IJWA 3L7MA 4G24A 4RH3A 4JWTA 2RI1A 1KAGA 1BROA 1HETA 3RAGA 1AS0A 2IL1A 2H65A 3DBLB 1XZDA 3FSGA 4H6WA 4L72A 1FNCA 1I4WA 2ETXA 5BR4A 1F8UA 3CUVA 3ICCA 5BR8B 2VTVA 4JYMA 5KJEA 3SX0A 4TXMA 4B7XA 1B6SA 3MWLA 4HMOA 4MYSA 3MCUA 3GAZA 4MNTA 3GT7A 3VC2A 1QV9A 2W6JD 1PV1A 3T54A 3OLVA 4U2DA 1JQAA 3KXKA 4DMGA 3HA5A 3D8RA 1FYVA 1LF0A 4Q01A 5ES3A 3SG0A 1QRAA 5ITZA 1Y42X 5LFAA 1YACA 1SG6A 2DPYA 2C8LA 4G5FA 2JARA 1QKJA 3HEMA 4UZFA 4BLOA 4TXJA 1PEYA 1NONA 1BYUA 2ZITA 2JEYA 3W04A 1JXMA 4ABYA 3QHQA 1ZY2A 3NIWA 5FTMA 5EC8A 5JVDF 3DLCA 1M5UA 4ZT6A 1A8QA 1BQ3A 2PIDA 3M82A 2MU1A 3ZCTA 4EJSC 5M5BA 1YMVA 1T3LA 2XVXA 2ZI5A 2VOJA 3QLEA 4OTZA 1AXGA 4Y7DA 5G2OA 4YRAA 5IJ0A 5I4IA 3OIWA 4L6AA 2WF9A 1HLPA 2HDWA 3F0TA 1NJFA 3WMFA 5CYOA 3FNFA 3H19A 1BJRE 3TZBA 4F56A 1MO5A 4ZCTA 1V5WA 3WY9A 4J2TA 3C3AA 5HMMA 3PEWA 4RO0A 1AHIA 2B5VA 3FWYA 4E5YA 3WTCA 1ZG3A 4AJHA 5LP6B 4IIVA 1D4FA 1M73E 1GR1A 1GSHA 3RTGA 1MEOA 4HZUB 3HMQA 1KDOA 1CVIA 1UZLA 1MLDA 1OTXA 1SD1A 2NGRA 2A5LA 2OKCA 2VHUA 2X8JA 4ZAZA 1CSEE 4BLPA 4WZBB 3MGAA 1SCIA 4IOMA 1C0PA 4AY4A 4Q1DA 5DT2A 2PTGA 4H3HB 2NU8A 3OIFA 3T0GA 4HJRA 1OX4A 2VT7A 4HRYA 4RF4A 2QVBA 1R4ZA 2AEEA 4WT7A 2IRWA 4HCJA 2V4ZA 3OE1A 2ZIWB 3U6KA 1NAHA 2W58A 3DUFA 3BYZA 3AFOA 1V8DA 1W6RA 3EN0A 3L06A 4R8MA 3FOFC 3CX3A 3ENWA 1CW2B 2ZBRA 3SKVA 3RNLA 2C77A 1IYZA 2PGJA 1VPLA 3KBOA 1T1JA 2WK1A 1WULS 3ED5A 3IV7A 1G8SA 4Q5IA 4U6QA 3H3JA 3P19A 5B6PA 2BY4A 1QH1B 2P1DA 2IHJA 4ZHQB 3LA8A 2FNAA 2ORWA 2QVLA 4P3PA 2HSWA 2IYUA 4OAOA 4F9FA 4YT8A 3B1XA 2EG5A 2HV9A 3H0EA 1B6GA 3KQMA 1JFFB 5CLIA 2HEGA 4GPTA 5IMSA 5KSPA 2WOJA 1ZLYA 2ENUA 2FWRA 2ZB2A 3B70A 3CTMA 4G5QA 5HM6A 3TYXA 2XBUA 5JS1A 1QE0A 3KEOA 5GV8A 3AETA 4P33A 4TRRA 3RAFC 5KSOA 1REQA 5IH7A 4J0IA 2NQ8A 1A2QA 4D8XA 4FI3F 2GWHA 5CT9A 4EQ6B 3GAFA 1G60A 4LG1A 5CB4B 1RC8A 1G8YA 2NXWA 4XTRA 2IV7A 1U8EA 4D81A 4ENUA 3GLSA 4GX5A 5AK4A 1LRLA 2ONKA 4F86A 1ZN8A 4NRDA 2RKOA 1KSGA 4P32A 3W4IA 5LQUA 4D8VA 5EA2A 1RRFA 3VPAA 1JDZA 2B4KA 3ETGA 5TVGA 2VHCA 4LRTB 2ZJZA 4AU1A 3KTFA 4KIWA 2AWOA 4G6ZA 3F98A 2GNOA 3G82C 5F35A 1NGSA 1XDGA 2JAHA 2PKWA 2YHSA 1CUJA 3A2MA 3EXHB 4QODA 4D8WA 5LL6P 1E2FA 4LFCB 3BL6A 5SY9A 4JVSB 3DE4X 1C3EA 2NNLD 2P27A 3ZHQA 2MSLA 5LOVF 2RJ3A 1L4MA 1PNTA 5JJ5A 3ONWA 5BV0A 4K1LA 1USUA 1S7GA 3FUTA 3NC4A 1QG4A 2UVPB 3J7TA 1F7UA 2BMWA 3VR0A 4NTZA 5DHAA 3ZWYA 2WJHA 4BTEA 3W3ZB 4JK3A 4JUIA 1W5SA 2KM1A 3BFVA 4RKFA 2XOKD 2WI8A 2REBA 5A6SB 5IVKA 1Z07A 1TZMA 5AKYA 5G53C 1TO2E 1N57A 2J41A 2O3JA 2Q9UA 2F1IA 1VDZA 1KXZA 3BHNA 4JLKA 3KP1A 4NIMA 4RPLA 1XVVA 5DCUA 3OUUA 3GUVA 1W36D 2JIRA 5BV2P 1Z5GA 1R50A 2IS6A 3DTNA 1UWKA 3KJFA 3LC7O 4COKA 1N2BA 5C3MA 1GQ2A 1O58A 3WO0A 2HA2A 1B8OA 2I6XA 4O08A 1MGOA 2QMHA 5LNK6 3WXMA 4RJIA 4C0WA 1DDOA 1SCUA 1IVNA 3IPCA 3D6NB 1TEXA 5TB5A 2LDXA 3E7WA 1UBJS 1IM2A 1BKYA 4BIMA 4UTNA 3B6ZA 4PTLA 1ODJA 4G1VA 4R83A 4UPEA 4FYHA 2AC7A 2GZ2A 3U6BA 3C3YA 4G0YA 5B2ZA 4M0EA 4UHFA 3C5CA 1BS2A 4A8JA 1RZ3A 4IIXA 1NSFA 2GR9A 3E70C 5IN5A 3SJ7A 3TTSA 3I42A 3AVXA 2RHGB 4PIPA 4ZYZA 2NMVA 4H1TA 4O1IA 2ZW9A 4D8TA 3TECE 4EX6A 1UBCA 2XSZA 3PE6A 2JJ8A 4LFAB 4MW9A 4LSMA 1F2VA 1ZGAA 4BFCA 1UXOA 1DCFA 1XXLA 4GNRA 5HSGA 2VXYA 3ZH2A 1TVMA 4F9EA 2X3UA 4YCMA 1USGA 1YUBA 1BFDA 2V58A 3QUQA 2BHTA 1YJ8A 4OGWA 3I0ZA 1NHGA 1GITA 4NFHA 5IJ9A 2A0WA 2GT1A 3EGDB 3HDJA 1NQOA 1I7QB 1MNQA 1KDVA 3VR6D 3STVA 8LDHA 3AL3A 2BEWB 4MIEA 4YCNA 2XBLA 4P6VF 4UNRA 1G9SA 1N2GA 1K63A 2PZAA 2V7GA 3IAEA 1NI3A 2BSXA 3UUEA 2C2KA 2OAP1 1J99A 2CD9A 5KJ6A 3NYQA 2SECE 3DMYA 5IXYA 5H9WA 1G4HA 1PD0A 2BKUA 4CLOB 3GRZA 3PLNA 1OTYA 2GEJA 1DZ3A 4G5OA 4OHPA 3CSSA 2BBOA 2OBBA 4RY9A 4Y1RB 3NETA 1U7TA 3PFCA 2PZLA 2QLLA 4H17A 1RFGE 1WQ4A 4HB2A 4D99A 1ILWA 2YWCA 3H17A 4BPRA 4N0PA 5CEEA 3EEOA 2ZU6A 3AG6A 4HI0E 3EZXA 4G4IA 1KDYA 3ECSA 4B73A 4GBJA 3FR7A 4YAEA 4K9LA 1P1KA 2E7ZA 3T7EA 1VLHA 2MYUA 3B48A 3D7NA 3GLTA 4L9AA 4Q12A 4L78A 2W4IA 1QB8A 3QFFA 3WSTA 1YB7A 1BSVA 1KZ1A 1IXRC 1YFZA 1N4DA 1PJ2A 2A2ZA 4GXTA 4DMKA 4D0SA 1XI2A 2GN0A 4MVJE 4C5AA 2JIMA 3R44A 2IUUA 3T9BA 1DKPA 2QLFA 3RHTA 5JSQA 3V6MA 4DY4A 5JAOA 2EZTA 1XQVA 2G1AA 2YWGA 3LTEA 3MT9A 2UXDB 5LA6F 3GC6A 2J7PD 4YMSA 4YQYA 3BXHA 4CODB 3N86A 4KPUA 3HUTA 4QHSA 1PFUA 3RBAA 4KGDA 3WR5A 3HBLA 3ZQJA 2OYSA 4C4AA 5SZHB 3K8QA 4DG9A 1SBQA 2PT9A 1V16B 3K0CC 1NKSA 1CZKA 1KO1A 1GEGA 3REGA 2ERCA 1AVTA 1JS1X 1NFFA 2RBEA 2AR7A 1MJNA 3MWEB 4N49A 3CCFA 2FMUA 3OX2A 2X7JA 2G06A 4O2BB 2X0EA 3PDJA 4QC2A 5JSZA 3JYPA 3TSWA 2GN1A 4AZ3B 4JXJA 4GQIA 3SR0A 4KQKA 3NRBA 4DEVA 5AM4A 3AFNA 1Y7TA 3T3GA 3DMRA 3P9YA 4NU5A 4BLUA 1TQ8A 1U8AA 3IEPA 3EMVA 2O1WA 3FMVA 2YFYA 3IMGA 5I4CA 4HH0A 7REQA 2X0KA 4W5WA 1ICEA 3KWFA 4CLXA 3ORYA 2HMSA 2ECFA 3IQDB 4MV4A 3BRQA 4JOSA 5T64A 1JI3A 1KK1A 4BNKA 1ZIDA 4CEJA 3BMCB 4F71A 3S40A 2BDEA 2NUAA 4WQMA 5DCWA 4MKZA 3BHJA 2F9MA 4R8VA 4RLFA 3FOEC 1L5OA 4WKCA 1IXKA 1T0JB 2DVMA 2JGAA 3GYGA 2ZAGA 4ECAA 3THXA 1YBFA 3GWZA 4NQRA 3UK7A 5DIZA 5HIIA 2XKJE 1APBA 1CIPA 1MD9A 4FTWA 3T9CA 1E5DA 2C3UA 4FEAA 2IYTA 3QTTA 5KYXA 2C3MA 2XUKA 2Z2XA 4WKNA 4XB6B 4AM8A 5CEFA 3AOEA 4LVUA 3Q0TA 4MGEA 2Q6KA 3LIPA 1P2TA 1Q21A 3QYPA 4MROA 4R1UA 3VKWA 1YS2X 1P45A 1AKUA 2ADFA 1J5XA 1VSQA 2Q3HA 2Q99A 2XDQB 3L7YA 3MGBA 3AUSA 4MULA 4P34A 4RPCA 5HG0A 4QJ5A 2GTPA 3UMFA 3D3JA 4UUQA 1UBUS 1PL7A 4DJTA 1IG0A 4DSNA 3BFKA 2HI0A 4FJ2A 1G8MA 2IE8A 1YJAA 3I52A 3PITA 1T8TA 5IKMA 2Q8PA 4ARVA 5EUBA 3GJ7A 3RAEC 3D0OA 4JI4B 3MJFA 4PR0A 1TVEA 3M89A 3VH2A 3ETLA 2I7VA 3RGWS 1G5QA 1H9AA 3MOSA 3AUJB 2F1HA 2VBCA 3LLVA 1NNSA 3CLRD 2CBZA 1BH6A 2OE2A 1INLA 4FYYA 2BCEA 5GM1A 2NNWB 3F73A 1G3RA 4HPJB 1JLMA 3FKQA 4LJAA 1N5KA 1UDAA 5G4KB 3S27A 5HUQA 4YH1A 4F97A 1XEXA 4UDYX 5G0VA 5AVZA 1ZVKA 5BYAA 2PRSA 1K98A 4LQDA 1VMDA 3K4PA 4W9MC 4BCBA 1T3HA 1AH2A 1KOLA 3I3SR 1V2GA 1OV4A 1YRBA 3HY3A 3PFFA 5BUCA 3KKEA 1CJBA 5KVAA 1YMQA 5ALLA 4KO8A 1P9LA 1VKRA 4N7BA 2FRDA 1PKXA 2A88A 4CKZA 1G1AA 4YAGA 2D0DA 2QOEA 3H9GA 4BYMA 5LQKA 3WDLA 3B6KA 1R2QA 4E2WA 4YP1A 3Q3GE 1LVGA 4ARAA 2YS7A 3NIFB 4XPZA 5BSWA 4XYMA 2WJYA 3CH7A 4PHGA 2R4TA 2ZVPX 1DLIA 1JYEA 4RYDA 5F1YA 2OV3A 1ZOOA 3N2LA 4YJKA 2OTCA 5LUBA 3W2TA 5IJWA 2CNWD 3WNZA 4EF4A 4WK6A 2H4ZA 3GVPA 5CLHA 4DV1B 3JYNA 3KVOA 2R8RA 1OWPA 2OLJA 3MC1A 1CUCA 1D2HA 1KJQA 3KZ1E 3USZA 5JD3A 1BS9A 5K4HA 2QYTA 3BDIA 2WBLC 5T57A 3KKQA 1F14A 3LWZA 4FDMA 3GMTA 4FP9A 2ZUDA 2ORVA 1BD4A 1JILA 2F67A 1S89A 5ECWA 1OB5A 2XF8A 3ROMA 1XVIA 3DEHA 4K6MA 2ZCJA 4ZGBA 1YVUA 5LIRA 3WL8A 1U0JA 4HUQA 2F1RA 1DX9A 3AHGA 3KYIB 1K6EA 2GPWA 1VMEA 1MJGM 1X87A 2FG7C 3G7SA 4UAUA 5BNTA 1BKDR 5EEHA 3D31A 2E4VA 3CUSA 4ZU3A 3NTOA 3DTVB 5FD8A 3PQEA 3AU8A 4OJMX 3VO9A 2E48A 2A6PA 2C88A 3RE1A 2H00A 4M53A 4BXOA 1MABA 2FK8A 2ACWA 2OAQ1 2W6ID 3Q5GA 1THZA 4LE0A 2QDXA 1U1FA 3AIKA 1F8GA 4OEHA 3U13A 4N5DA 5EJ6A 3OETA 1VA5A 3KJXA 1VCOA 3I53A 2WTMA 5IDYA 2ZYAA 3OWOA 2WQ7A 1XSEA 5EMMA 2J6CA 3PPXA 1NXQA 3U4MA 4GDMA 5TR9A 1T4GA 3WWPA 2PUVA 1GZ7A 1RJ9A 4IOLA 1B76A 4KIJA 2J9GA 3BGIA 3E9ZA 3F1LA 4LDJA 3WRYC 4BLTA 3DBRA 2E2WA 4QYMA 2JRLA 4D4GA 3KKKA 1PTJC 1PFWA 3L7DA 3DC2A 4BZPA 2OBFA 1W76A 2JATA 3H1AA 4NAUA 2FDCA 1OC2A 3IHTA 1D6NA 5DULA 1FBTA 2RGWA 4CNBA 2HFJA 1WUIS 2Y93A 3AQIA 4ODIA 2DQZA 2REXB 1EX9A 3M9WA 2ATCA 3KZNA 3QG1A 1GTL1 4YK7A 3UMYA 3O2QB 3GH1A 4A0RA 1LPSA 1M7HA 1RS0A 3BERA 2CJWB 4ZICA 3TN7A 3HGMA 3FPAA 4DWWA 5BRAA 5JJKA 2ZSHA 4QO7A 4ZYVA 2CEAA 4KV9A 4LJ7A 4ZQGA 3HUDA 4RK4A 1L5LA 1KSJA 1P0MA 3CW8X 3JZAA 2GERA 5AKKA 4HQ6A 4LXTA 4OSOA 1EESA 1JP7A 3ID6C 5EHGA 4GIBA 4RCZA 1RTKA 1X1QA 3GJ5A 3GRYA 1YULA 4LJYA 3RF6A 4G1BA 3RYCB 2UZIR 3DOEA 1EWKA 4H18A 5MHTA 4MAMA 1DT3A 1SCQA 1XMXA 2HEIA 4LNUA 4QGGA 4WLNA 1NVFA 3SKYA 4CCYA 3BILA 4Z54A 5EXEA 3QPVA 4KQ6A 4GR5A 3PA6A 1C9NA 5KCZA 3ROXA 1TUBA 1WZIA 3DFKA 4ZAVA 2ZI4A 1G17A 4RK0A 4IAOA 5PGMA 1N0VC 1QIMA 4R5HA 4CKEB 4KTTE 1SU8A 4RHCA 4XX1A 1ABFA 3N0WA 2FPOA 4IQFA 1VGRA 1AZLA 4M1EA 3ZTWA 5BUQA 2ZP1A 2V0NA 5EQJB 2OZLB 4W6QA 2O3TA 1Q17A 5JZSA 5FWDA 5EJGA 3SLKA 5KU1A 3JZFA 3UF0A 4BAZA 2EJBA 3G0GA 1FMFA 1IN1A 1ES9A 4WZAA 2VPXA 3KQPA 3UJBA 4BVLA 4CF6A 3NGMA 3OZDA 2WFLB 1M2FA 3Q9UA 4LDNA 4A2QA 4POOA 2B61A 3DLTA 2P6NA 2QX6A 3LW7A 3HLTA 4ASUA 4IWXA 1TM4E 2DWPA 4XYLA 1OV6A 3BK7A 2PGLA 3S2IA 2NPOA 1TAGA 4A3SA 1EHIA 4M0FA 1H2WA 5I5GA 4HWTA 3U3KA 3NHMA 1TQ6A 4IEIA 3STHA 1BE6A 4EG6A 3DPSA 2GRJA 1P81A 1KDTA 3EPRA 5FWNA 2JW5A 1FP1D 2D4HA 1OLUA 3BREA 1ZD1A 2AXPA 1IQ0A 3JPYA 1FU7A 3OPVA 4IMPA 4KR2A 3DULA 3H1GA 2PBLA 3C6ZA 2N3ZA 4MINA 4CYMA 4AJ2A 3TKYA 3HYCA 3VNUA 1E2NA 4A2WA 5DXAA 5BN5A 1CV2A 5J4VA 4JWKA 3H5IA 1K6JA 4FHGA 4RVNA 1RSZA 3LE8A 4EMBA 4F93B 1GGNA 3WLIA 2RHJA 2HU8A 3PCXA 1KBQA 3EXIA 4MX8A 1J07A 4D80A 4F21A 1FMLA 1W30A 2B4AA 4OLAA 3AJEA 4A4DA 3ZD7A 2ETVA 2N9UA 3OBBA 5DTMA 1F0NA 2V0GA 5DISB 3QKRA 1M2OA 1NRIA 1SY7A 2J32A 3MG9A 1ZD3A 3HJTA 5L7TA 4GEGA 2Z6AA 5IK2A 3DEZA 4H1WA 3L3BA 1QHSA 1UM9B 1NXXA 1B6TA 5IUKC 3T34A 3F6SA 1NR5A 2WD9A 1C1XB 1V7PC 4DLKA 1E32A 3ETDA 1HK7A 4ZREA 2CNDA 3DC7A 4ZMSA 1YB6A 2ZI3A 3B36A 2AZXA 3RYHB 4CMIA 3R2JA 3BJEA 3PNMA 2AYZA 4DV6B 1O9BA 3KYDB 1EBBA 3OSUA 4TL6A 2DHCA 2J45A 4U39A 2Q6IA 4RZ3A 1M1UA 4C0HA 5CA0B 1KSHA 1UT8A 1JZQA 2UVQA 3TD6A 3G17A 3WGGA 1TECE 4IJ6A 4LQ4A 1Y34E 3WGQA 3RYIB 1F51E 3WIVA 5C7OO 5F33A 1GCAA 1Y98A 2VCEA 3OX4A 2FDRA 2YZ7A 3HJHA 4M0CA 4TMFA 5CH8A 4ZQHA 3LKVA 3Q7EA 4Q9LA 4YJ3F 6PFKA 1ECGA 1US8B 1YIOA 1MX3A 1Q12A 1W48A 1KH2A 2CHGA 3DAOA 4XLLA 5B1DA 4E2ZA 1PD1A 4G65A 4JC0A 4X20B 4D0LB 1R74A 1ZD5A 1H2EA 4KAJA 1K8YB 2DY1A 5CVUA 4F4DA 4TRNA 5BQXA 3EIHA 1F3OA 3Q7RA 4OHWA 3WIBA 1YCHA 2QUJA 3UXYA 4CUJA 4DIEA 4E1BA 2OC9A 3LT0A 3FVWA 2FMTA 2OLEA 3PNYA 3UMJA 1I1OA 3B1KA 1M10A 2VLIA 3CVYA 4P3NA 1L7QA 4LY3A 3IP9A 4WEQA 3E6AA 1UP4A 5E1OA 3ZC3A 3FJOA 1LTQA 1V3QE 1C2YA 4JLAA 1UP6A 4F3NA 4JVLA 2IZ7A 1I0IA 4LBZA 3WGVA 4MIKA 1IDOA 1HXHA 1JDPA 3KSRA 1JDSA 3TXAA 4KKVA 4RTQA 5C53B 4RA6B 10MHA 1UXGA 2XNHA 2ZYIA 4KU4A 2COKA 3LP5A 3P1JA 3JASB 4A0FA 3AYZB 4GKVA 1QCYA 4IHJB 5TV2A 4X63A 4PYOA 4BE4A 1EIWA 3HKDB 2PO5A 3K4HA 2IIQA 4MR9B 1P2VA 1PX0A 3A05A 3Q8MA 2P41A 3D7RA 3T3MB 3DDSA 3ROTA 2MR5A 4AG3A 4NDZA 4MVXA 1GUBA 2MYTA 2C2ZA 4I8IA 5EMKA 3TMAA 1ESMA 2A0YA 1EU1A 1QIHA 3K0BA 4TT3A 3ZK8A 1FLDA 3ZVLA 1HZJA 4IXDA 1GFWA 4B7ZA 3QI2A 1O6CA 2J9ZB 3ISTA 4MVJI 2QP4A 3AGQA 2RMKA 3EVCA 4DDTA 1X7GA 5C5CA 5DEOA 4D5EA 1E0AA 3SHVA 4JUCA 1KRXA 1OY1A 3MFYA 4QDXA 1T10A 4QBFA 1ZK2A 1FS4A 5AI0A 3RS4A 3SIWA 5CG1A 2Z0MA 4Z53A 4GKJB 3SR3A 2ATXA 1WVIA 5D1NA 1NY6A 3A1UA 3L79A 2RHOA 4ALIA 2WJPA 2ADOA 2ZM6B 3LBAA 5JAZA 2JVJA 2UDPA 4E0BA 4U6SA 4DGQA 3SHTA 3BE8A 1AU9A 1ULHA 4GOXA 5EIBC 4E12A 5B4TA 5HJ2A 1ANKA 1UMBA 4KQ9A 2IOFK 1AQUA 2ZE8A 5K0EA 2DWOA 1P1IA 5MDHA 2PH7A 4LBWA 3ZG6A 1ODTC 2NV6A 3QV2A 1H66A 3TQOA 4OL9A 4KDRA 3N9IA 3MCVA 1JKXA 1MC8A 4UASA 1KYQA 3S0JA 5JCOC 4RTPA 4B3GA 2QTMA 3K1AA 3RM3A 3SXUA 2JFYA 3NRJA 4DWJA 2JIZD 3D8NA 3HR7A 4WZZA 1X0XA 3LOQA 1T8UA 2XT6A 1PDOA 1UF9A 2DM6A 2DPXA 5EXTA 3KV3O 2R9VA 5C1IA 2DY0A 3QU7A 421PA 1JDJA 1UBMS 4AS1A 3P2MA 1VBFA 2AMFA 5ED0A 4Z5XA 3P2EA 1BQ4A 1TQ4A 1LRJA 1QFJA 4NZPA 1XZBA 3DMTA 1NKTA 4O4LB 4TUYF 1U3UA 1Z22A 4HFJA 2BGNA 1I9GA 4AAYA 3PJFA 4AWAA 2WMNB 3RSLA 1GNPA 4JR2A 3OY7A 3JZIA 1Q0LA 4CL2A 2DJIA 2XXAB 3V55A 1KI2A 3IOBA 2GLTA 4M1QA 1H4VB 2PTHA 1FW8A 1LU9A 2Y9MB 3OCCA 1CRZA 1GADO 2GVNA 2MIIA 3HDQA 2E6KA 4AECA 4BNTA 1E4YA 5AUPB 3AYXB 3FLAA 2I6FA 4BN5A 5G4LA 2NXCA 5E4YA 1H2YA 2C03A 2CUTA 2XR1A 1S6YA 3PQ4A 3U7HB 1KVSA 2VJKA 3DLHA 1T1EA 2D5LA 2Y1EA 3G02A 1SC4A 2EX0A 2MDTA 5GJBA 2CEKA 1BW9B 1NVMB 1U8UA 2WJWA 4M0DA 2R1UA 6LDHA 5GGYA 1Z35A 1KQNA 3RC8A 1K7XB 2VR1A 3N3AC 3UXEA 4ZODA 1SUCA 4IP0A 3FUUA 4G67A 2YYSA 1H2FA 1VHTA 1SU7A 4GLJA 4RMJA 3H0KA 3KSZO 1EHYA 4S1VA 4MW0A 4F5DA 5AESA 5AW2A 3UANA 3IE1A 3OLXA 3BXEA 1SB8A 2H7CA 3VH1A 2I99A 5E9QA 1VG0B 1N5LA 2X2FA 3GMIA 3LT2A 1M1NB 4X8OA 4XCXA 3JD3A 3GO4A 3NALA 4EWLA 4P4TA 3KXPA 4IZHA 1MFZA 2CZCA 5AKHA 2PD4A 4FIDA 4KH0A 5HR5A 4B6EA 5C8YF 2Q8NA 1TJYA 2XUPA 3JD4A 2JH3A 2X2EA 4XD2A 4ESVA 4ZTBA 3IUSA 1Q19A 4RZUA 4NJEA 4JBWA 2KSQA 3PGLA 3VGJA 1PI3A 1AURA 5AVQA 1TVKA 1HYGA 1XTRA 4OMDA 4TV9B 3ETCA 3ZWXA 4E70A 2GCNA 5KX5A 1O5IA 4R1TA 1X7ZA 4UMFA 3KB2A 4YEDA 3QXHA 5FOUA 4YRTA 1F4VA 3O3MB 4RVFA 2Y1CA 4LYAA 2G9VA 3VPBA 1Q84A 3H9EO 3NIBA 3UOAB 3ZVMA 1LQTA 2L2QA 3JQ8B 4IHQA 3S2EA 5C1DA 1T3TA 2H3EA 2NU6A 2XNCA 2W6PA 4Z9FA 1HSZA 1CR4A 2LP4Y 1NX9A 1KZ4A 4D9HA 2EP8A 1E6WA 4KEAA 3UM9A 1XUOA 1DIAA 1UMDB 4L4ZA 1MN6A 4DNXA 4Q4CA 1EFPB 5JZBA 1W35A 2B37A 1Y9JA 4X8HA 3BRCA 3RH0A 4RACA 5AW7A 2Q3FA 2SHKA 3GG9A 4ND8B 1AQLA 2IGBA 2W2KA 5AO9A 1SQGA 2XNDA 5K2OA 1Z2PX 4ABTA 2JBHA 2KW5A 4Q3AA 1TJ5A 3G5LA 2O1XA 4FOPA 4M0KA 3TLEA 4BFVA 4R81A 2JLRA 5JY1A 3IDFA 5AVWA 2GEKA 4J4TA 1IHYA 1L5ZA 2AKAB 2FR8A 2NYAA 2WC1A 4MKRA 2C9CA 1Z2OX 2CVHA 1MXHA 3NHAA 1BZYA 4BNGA 4H59A 1BD3A 6NULA 1QC5A 3G8AA 5KYUA 5IPFA 3EIOA 1WZCA 2XT9A 3NT2A 2C20A 1N5MA 1CS0A 3BSYA 3DEFA 4GRIA 3WRXC 1CJKC 4DBVO 2YQZA 2WSYB 4A27A 3ADBA 3UT5B 1JR6A 2M32A 1WCIA 3KOXA 2XTAA 5A6VA 3N2IA 3L6BA 3V34A 4DV0B 3VR5A 1BE1A 1G55A 2PH1A 4J2HA 3NUZA 4K88A 1G66A 1E7WA 4O2AA 4YBZA 3PD0A 1P1HA 2IHBA 4EELA 5AJUA 1J0CA 3EGEA 3KZOA 4EI2A 1UBHS 3MIZA 3STUA 1AUPA 3UN1A 1M2NA 2BT4A 1HL3A 3DAHA 4D8YA 4DGSA 1IIBA 3I30X 1RZRD 2DHDA 5IHPA 1P9NA 2QE7D 2OKGA 3FTDA 2XOXA 4JP1A 4KYTA 2H2IA 3OT4A 2JK0A 3NXSA 1JQLB 2C29D 3AHEA 1NBEA 1RLJA 4G1FA 5SYMA 3LF1A 4K6OA 1GM5A 3CTPA 3MJSA 3CX7A 4KSCA 5T5QA 1P5JA 3PEYA 1I3LA 1SUAA 1KFCB 4KR3A 5GWXA 1Z0ZA 3ESZA 5FQNA 3ANSA 2AFIB 2IK8A 2WSMA 3RG8A 4EBFA 2BFAA 5HILA 3TVYA 4EVRA 2WWYA 4Y2XA 5BN1A 1EXWA 2OXCA 4L7VA 2I2FA 4WXPA 5K3FB 2O2GA 1PS9A 3CFYA 5ALVA 2IHUA 4LF8B 4PZEA 4ZDKA 3TZHA 1WCYA 2Y2UA 3TCNA 3JAKB 3KDPA 1HE8B 1W46A 4AB1A 3I6QA 2IUEA 4AF6A 4EA7A 3IKJA 2HNKA 1MR3F 4RS3A 4DQLA 5DM2A 3WNCA 1P8JA 2P69A 1RYNA 1A72A 2W83A 2OM6A 3GDWA 5J1TB 1EVEA 5E8JA 3TBHA 4JVOA 1TYDE 2IC5A 1B3RA 2DWQA 1ZJJA 1QR6A 1TX4B 2Q0QA 4H1HA 3WAJA 2HQBA 2ZQYA 3ABSB 3AM5A 1F4PA 3BIXA 5JSYA 2RFLA 2W98A 4HAOA 5CIWA 2YX1A 5D1HA 3A1VA 5H7XA 2JGKA 3FAKA 4JI5B 1CY7A 4J3NA 3R74A 3TE6A 5BXQC 1USKA 4YPFA 1UBRS 4ZDWA 3ELYA 4BC0A 1D1QA 1SCNE 2OMKA 2YUTA 2VDLB 3DBLA 3M1YA 3V8QA 2P6UA 5HP4A 5C8ZA 1OGJA 2FGJA 3G0OA 3I1JA 3LIIA 4BOYA 2RHDA 4KN9S 3SIRA 4D98A 3RVRA 5CGQB 3HNPA 1IVYA 2VZ0A 2X8AA 4LJKA 3DFMA 5GIPE 1YFKA 4N18A 4MHSA 4XIFA 3C5HA 5CXXA 3SDBA 4BUZA 4Z51A 3C3KA 2ZUEA 3D3WB 2UZ0A 3ZH9B 3IAXA 1QGDA 2GN4A 4KUEA 2DFDA 2XHEA 5I01A 2WU1A 1HF3A 2I8AA 3L46A 3C3EA 3IYLW 1KJYA 6ABPA 1QRSA 2IHKA 4CFZA 1WL8A 1QCCA 3WGKA 2PLWA 5LB4A 1QYXA 1THMA 3HWSA 4KI7A 1DT5A 4DA4A 4HH1A 2BIFA 2RB4A 4MRSA 5ICFA 4HQLA 2JC3A 4Q3DA 1YK1A 4KXYA 2I4LA 3BWEA 3N3BC 4GM0A 4PQGA 2J3MA 3V00A 1D07A 1H42A 4BO7A 3N5KA 2OBNA 5T8KA 1BRMA 4RYLA 4GSYA 4UVHA 4JBYA 1RRGA 3ND5A 4WGGA 3RRZA 3WLTA 2Q3LA 1G2QA 4RDIA 3H8VA 3DEIA 2HZ7A 7GPBA 2RI6A 3A28A 3IEMA 1CUWA 3AJ8A 5BYKA 5B7PA 1K92A 3ANLA 1BMQA 5IZCC 3WNVA 1OH6A 4MRRA 3CWCA 1BOOA 4HZUA 5AW5A 3ELUA 4Y8VA 2BE7A 4TMYA 5D2CA 3LLMA 4AULA 3WSWA 4WZBA 3QUSA 3KKLA 1K4KA 5LZ8A 1UPFA 4RH0A 1OBVA 3EBLA 2UUBB 2Q5FA 3TX6A 3ZDYB 2BFDB 2VAXA 1GNQA 4B83A 2NQ2C 1IAVA 2XNKA 3R0QA 4QPJC 1EA5A 2B25A 1II8B 1YBMA 1JEOA 1JKFA 3WICA 5D5QA 4I8XA 5CG2A 1QIIA 1JTVA 4D4HA 1T2NA 2I3BA 4WFKA 1WLYA 1K7EB 2PUEA 1KZYC 4D2IA 1DOZA 1AN9A 1HOXA 2Q5QA 3ZHYA 1TO1E 3DB2A 5D84A 1QH1A 2X8WA 3F67A 4ZHQA 4PGGA 4LJSA 1W73A 2B35A 4J0KA 4OMFG 4WEOA 4GBMA 2OCLA 2HY7A 3KDAA 1KZ6A 5JNSA 4B40A 3WGJA 4OHZA 4CM6A 1JFFA 2PUWA 2SKDA 4R9VA 3ESCA 3COPA 4RMGA 3S28A 4Z4QA 3V4PB 1ISRA 1G8HA 2VRWA 3H13A 1YHYA 2Q0HA 3FVTA 2BH9A 3L0YA 2X5KO 1ESEA 1L6IA 3IGFA 3ZY2A 2CLSA 3G1TA 1STOA 5E1DA 3HUEA 4BCCA 1PJTA 2V7QA 3QTBA 4WOCA 4EQ6A 2HPZA 2VH2A 3AF1A 5CB4A 5DSZA 3DWGA 1CDZA 5DXFA 3P0IA 3AI7A 3VR1A 3CNHA 4XIYA 3B12A 4AWXA 3BWCA 2XIJA 4RK7A 1RAFA 3L7LA 1OXKB 1CNMA 3TQTA 1L7OA 2OB2A 3HMKA 3NR2A 4L6IA 1F60A 2OECA 1WA5A 2A9KA 2BFBB 4PBTA 4HKTA 3T5CA 1JIVA 1P61B 2WZCA 3L4BA 2H85A 1H85A 4MGKR 4B6OA 1YIDA 2RHCA 4G25A 1JWAB 1LBTA 1QQTA 1O95A 3EXHA 2G40A 4OXXA 3L49A 4CMEA 3FGNA 2H7VA 1EB8A 3H5VA 4UCXA 2C2WA 1Q7RA 2VHZA 2YY5A 4RHXA 5CVEA 1HE3A 3GA0A 1K7CA 2CLIB 2J3JA 3WK4A 1CUBA 2PX5A 2ECPA 3EOBI 4MUAA 1ZKMA 1HDIA 2R6JA 4PPYA 4X61A 5ICMA 2BM8A 3EHEA 1CEYA 2UVPA 2NZVG 2GXUA 4K40A 2BMVA 2IEZA 3KSMA 3UFBA 3VO2A 3VZDA 3RSZA 1G8AA 1AKTA 2Y0CA 4LMBA 4OM7A 1A88A 2HCFA 1GGFA 4MYDA 5A6SA 4Q15A 2ZE6A 4QRE