1CZUA

Refined structures of oxidized flavodoxin from anacystis nidulans
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
169
Chain Sequence
AKIGLFYGTQTGVTQTIAESIQQEFGGESIVDLNDIANADASDLNAYDYLIIGCPTWNVGELQSDWEGIYDDLDSVNFQGKKVAYFGAGDQVGYSDNFQDAMGILEEKISSLGSQTVGYWPIEGYDFNESKAVRNNQFVGLAIDEDNQPDLTKNRIKTWVSQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structures of oxidized flavodoxin from Anacystis nidulans.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 58
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1999-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1czuA00
2QR2A 5ULLA 3F6SA 3R6WA 1XYYA 5EAIA 3NHRA 1FUEA 2X2PA 4Y9RA 3OX3A 4U7HA 1SG0A 4QOFA 5LLDA 2MOKA 3KAPA 1J9EA 3GFRA 1AKVA 1FLNA 2XODA 5B3KA 4C76A 1JA1A 4U7FA 2V5VA 1AG9A 3KLBA 5F51A 3NHKA 3B6IA 1XT6A 2BF4A 4CF6A 2MT9A 4ICIA 1QHEA 1YCFA 3FNIA 1FLVA 2R97A 3FVWA 4DY4A 4YALA 3QE2A 4N65A 4ZVNA 5TGZA 4LAFA 4J8PA 1WSBA 5FUQA 2FX2A 4QOJA 2RG1A 1X77A 1AMOA 1CZHA 1TIKA 5LMCA 4QOGA 1B1CA 1KBQA 4XDHA 3F2VA 4C0WA 1YDGA 4D02A 1XYVA 1VMEA 2OHHA 3SVLA 3QFCA 4S24A 4Y7CA 3W7AA 1QRDA 1YKGA 2M6SA 3F6RA 2OHJA 1WSWA 1RCFA 1XI2A 1KBOA 3O2NA 2QX4A 1ZWKA 2Z9BA 4YAFA 3U7RA 3GAMA 3NHPA 2KQUA 2FAXA 4N9QA 4DILA 1BVYF 3FW1A 3D7NA 3OX1A 3L9WA 4GQIA 4H2DA 4YQEA 1CZOA 4ZVLA 3NHFA 3HLYA 3EYWA 3GFSA 2MTBA 4BMPB 5FA6A 1DXOA 4ZVMA 1RTTA 2M6RA 1E5DA 1J8QA 3G5MA 3U7IA 4GR9A 3RPEA 1DX9A 3W79A 1AKRA 1I1OA 1T5BA 3O73A 4HEQA 1CZNA 1AKUA 1YCHA 3B6KA 3JSXA 4H6PA 3TEMA 1YRHA 2Q62A 2Q9UA 2HPVA 3K20A 3UXEA 5EA2A 1FX1A 3OX2A 5LJLA 2FVXA 5JROA 4C0XA 4ZVKA 1DXQA 2FOXA 1TLLA 5BUCA 1NNI1 4QODA 3UXHA 2ZKIA 3FX2A 2B3DA 1D04A 1H69A 2A5LA 2F1OA 4LTMA 4PTZA 1J9ZA 4LTDA 4FGLA 3KEGA 1OBOA 4N82A 4XDGA 2V5UA 4CETA 2Z98A 2BMVA 1T0IA 3NHJA 4YAOA 3NHSA 5EMNA 2QX6A 1AKQA 4QOHA 4GI5A 3ESXA 5LBUA 1CZRA 3ES9A 2QMYA 5LBTA 1FTGA 3NHYA 2HNBA 2WC1A 4LTNA 1GG5A 2FDXA 5A4KA 5B3LA 4FX2A 3LT5A 2QMZA 2FLVA 1OBVA 3HR4A 1AKWA 3OWHA 4F8YA 1J9GA 1V4BA 3HA2A 3ESYA 3NHUA 3NHWA 4QOIA 5F4BA 3EDOA 4FGKA 3W77A 1CZUA 2GSWA 1FVXA 2AMJA 2OYSA 2QX8A 3OVMA 1C7EA 2FZVA 3B6MA 1FLAA 2Z9DA 3OJXA 3OWXA 3P0RA 4YAWA 5LVAA 2N1MA 2XOEA 5NLLA 4YAUA 3F90A 5F12A 4U7GA 4BMOB 6NULA 1RLJA 3ESZA 4LA4A 1FLDA 4DIKA 3K1YA 2KLBA 2R96A 3OJWA 3GFQA 3NHLA 3S2YA 2X2OA 1AKTA 5LJIA 3L9XA 3QFRA 1CZKA 1RLIA 2FZ5A 4OXXA 4PTYA 5NULA 4NULA 3B6JA 2HNAA 1BU5A 4ESEA 2ARKA 4M0CA 4QOEA 2D5IA 4C14A 3N39C 3TE7A 2BN4A 1JA0A 2FCRA 2W5UA 3N3AC 3NLLA 4NLLA 1YOBA 4Y9UA 1F4PA 3LCMA 2MWMA 2QWXA 2OHIA 2BZSA 3W78A 1QR2A 1QBGA 1CZLA 1C7FA 2Z9CA 3FJOA 3KAQA 4R81A 1D4AA 5FX2A 1ZWLA 4PU0A 1OFVA 1AHNA 1D03A 1SQSA 1YCGA 1ZX1A 2V9CA 4HS4A 1AZLA 4FGJA 2QX9A 2BPOA 3N3BC 3ZHOA 1H66A 3NFRA 3TZBA
chains in the Genus database with same CATH superfamily
1UC9A 2BSXA 5JMOA 2COKA 2UZ0A 2VNAA 1SHKA 3A1SA 3IQXA 3L6DA 2OGSA 4FFSA 3V8PA 1Y9EA 4QVIA 1RIIA 1VKRA 3GNTA 2ZB7A 1E1RD 3QJYA 4L73A 3UMSA 5BWCA 5JAUA 3KRTA 2COUA 1XTQA 2FPSA 1YJAA 4FFLA 4LY0A 4A5OA 1NYRA 4XB2A 1SWVA 1PVDA 3DZFA 1L7BA 3KJIA 2WK1A 2GR9A 1FMJA 1TMOA 1T4CA 2ALJA 2GXAA 2HRDA 3EXEA 3G68A 2ZAGA 4U63A 2IP4A 4UDOA 4X71A 2O57A 1C9KA 4GYYA 3UJ9A 1PV1A 2XTZA 3B8EA 3MW8A 1I7SB 2VJYA 4URWR 3LVQE 4MA0A 1O96B 2PX0A 4QOJA 1G7TA 1R4NA 2SCUB 2FWRA 2IYEA 4LRYA 5JDCA 1YS2X 2LIPA 3U7HB 1R9JA 2PX2A 1I3KA 1YV9A 2QMOA 5DNAA 6YASA 1JEEA 1PL0A 3Q7RA 4GZLA 2KS6A 3GGJA 5TQJA 5CA1B 1WUJS 1CUYA 4I9UA 4LBZA 4H0CA 3IAFA 4X91A 4D46A 3RVDA 2HQRA 1H8HD 2HN9A 2YMPA 2Q2OA 1DAKA 3A2KA 1HEYA 4DUGD 4Q4DA 2IXEA 1UBFA 5GVRA 3T15A 5FA6A 3TVTA 4MB6A 4PPGA 2I91A 1VRVA 3H2YA 4UHEA 1JGTA 5DRYA 3WC4A 4QGSA 3IEIA 2R79A 3T41A 1Q7GA 1Y3AA 3B6KA 2B2NA 1YD7A 1LBIA 3TNFA 4RLQA 2C8KA 4TUYF 5EA2A 5K3OA 3HBFA 1XL0A 5CH5A 1N2JA 2J3KA 1N4DA 1NXTA 2CHUA 2Q07A 3FCAA 4UUOA 3WISA 4ARSA 1VSBA 2IOQA 4BO2A 3VSDA 3LYLA 3E4CA 4GNKA 5CITA 4H3KB 3H1GA 2I7XA 1O58A 3FR8A 1F1BA 3K15A 2A14A 3MHTA 1CCWA 3H9CA 1ZOPA 2IJGX 4BQNA 1ZEMA 1QAOA 1M33A 2R8OA 3BJIC 2H9AA 4US0R 4FYMA 3PTAA 3AR8A 3O4HA 1VLJA 3A06A 3C5EA 4KN8A 1ZSVA 1JA9A 5BVGB 3BQNB 4ZT6A 1MAUA 3OLVA 3O2QB 4LJKA 3QGMA 1O89A 4P0QB 1L4HA 2MU1A 5IAJA 4YUYA 4OHBA 3NVKI 3DBRB 4I50A 1JR2A 3ILYA 2Y67A 4Z9AA 4C7KA 3CLTC 3K9LA 3KEMA 2O7RA 3A1CA 4IYJA 3AVOA 1H0RA 2R00C 3DEIA 1QUFA 1VBKA 1JDVA 2XOEA 3QHQA 4NAUA 4PZ9A 4EYKA 4O3MA 4JI3B 1BAPA 1P31A 2YN4A 4YPFA 5AVZA 2X15A 1RRCA 2FWPA 4B6PA 5IAAA 3BX1A 2LDBA 2RGGA 2REQA 1M2OA 2J07A 2OQRA 3IVXA 4WUTA 2HRBA 2V7VA 5EKTA 4OGGA 4BGIA 4GI3A 1GLGA 1XXLA 2FN3A 5JSYA 4YAKA 2DG2A 5AI4A 1PDWA 5J2UB 2RB5A 1B41A 2GLXA 5I47A 2CT8A 2PAFA 4IJVA 4OB8A 4PAOA 3R9IA 4CIBA 3D6JA 4FUQA 4ER7A 1WZEA 1GKLA 2H2DA 3CMCO 3LHDA 4BXOA 2FLKA 2W6JD 4H0NA 3RFCA 4Q3OA 1FXWA 5IDWA 1WCIA 2W2MA 5J5AA 5KMGA 2HQBA 4QYIA 1L5NA 3BN3A 2ZRFA 1L4LA 2QX9A 2ZYUX 4QDKA 4WA8A 4KODA 2W2OA 2LP4Y 4D56A 4WLVA 4G0VA 2YHUA 4CMEA 1V1MA 2OCGA 2WJGA 3CLSC 3E1SA 4N76A 2I54A 1VE9A 1MB0A 1Y7TA 3WLRA 3PHCA 4ZQCB 4X66B 1QU2A 4EJFA 3BICA 1XRQA 4J0QA 4TS9A 3VPAA 3T7JA 4NYJQ 3G2MA 3D8HA 4EHHA 2IEAA 2QRVA 4EW2A 1MH9A 3EJ6A 3VC2A 1EXNA 1E1CA 4I81A 1T10A 5LB4A 1D6SA 4GWLA 3M5CA 1KORA 4TZ6A 3W5IA 3AFOA 3R0ZA 1QIJA 1JI3A 4RTOA 1MC4A 1L5MA 1DFGA 3QPWA 2NZYA 1AF7A 1R0LA 2QS9A 2X40A 3HDQA 3KHTA 3PJFA 4DGSA 3PUXA 4FKMA 1V25A 3CA8A 3HBJA 1V41E 3UMRA 4IRMA 1XVIA 2PO5A 1E1QA 1FP4A 1PUXA 2P9JA 1SXJB 3BORA 4DB4A 2X3FA 1IY0A 3DL4A 1GGKA 4KXUA 1HC7A 1NBMD 5GINE 3AWDA 4IHJF 3B9PA 4V2UA 3FFWA 4K6FA 2QX4A 2FLWA 4LOAA 5IJ0A 2ZP1A 1DUVG 3WAGA 4ZVTA 2BEVB 1SBCA 3M4JA 4LNAA 4Z5XA 5A4KA 3G0GA 3H0CA 2W2TA 1I36A 2ATVA 2JFXA 3EZ9A 1V0JA 3P0EA 4HVAA 4RVOA 5A4IS 3GLGB 4AKGA 3EODA 1WRBA 4PW0A 1LEHA 5IEJA 4U02A 1UKYA 1OGYA 2HMSA 5ADVA 1EFPB 2AXNA 4NYIR 3PGMA 3CRQA 1TCUA 1Q0UA 3Q9SA 1VJTA 4MCIA 4RM3A 1WSAA 4UBJA 4YA6A 5JECA 5AIBA 2B1JA 4WBNB 4L72A 2AHRA 1G2IA 1R1DA 3GVPA 3ZEAA 1DINA 2H1CA 4HB0A 5K9ZA 4TT3A 3A1EA 1EFVA 4JJIA 2A0FA 4CPDA 1WVGA 1MW9X 3C4QA 1P2VA 3OCWA 2I2CA 2H0AA 3RAJA 3WICA 3RODA 2W2XA 4C0KA 4HQ0A 1JDSA 1KMMA 2P2DA 3W34A 3KJNA 4DV5B 4U3JB 1KJ8A 1OV6A 4GXRA 3LMKA 1KVQA 3MFYA 4M86A 2WU3A 4G0UA 1BMTA 1CJVC 1T2AA 1DDOA 3W6ZA 1P0MA 5CP8A 5GV7A 2EIXA 1KXJA 2R751 3DFFA 3MRVA 5EE3A 3ZJ4A 3SYNA 2A0YA 4ALKA 4DNOA 2C61A 3DOFA 3I6MA 4X1YA 3ZX4A 3DOCA 4LBYA 4WY8A 1BFUA 1E59A 2O50A 5A3SA 3ACBA 3JZMA 3S2FA 1C7QA 3F8WA 4GP6A 3IBFA 1IHOA 1SO8A 4P35A 3IAEA 2MJLA 5ED4A 1M0EA 4ILEA 1DTEA 3TSWA 4A6EA 2R96A 2J9YB 4QT4A 1UOEA 2WSIA 3PCRB 4O4HB 1SIWA 4OB6A 1VI6A 4DREA 5BRAA 1QHSA 2O8EB 4CN9A 3RBZA 1XEWX 2QD4A 3PHGA 4FD2A 2BLNA 4Q7JB 2IU6A 3R5HA 4BFVA 1H2BA 2FCRA 1C0KA 2NVWA 5DTIA 1RAGA 4TQGA 1L8AA 2TMDA 3N2KA 3WB9A 5B6PA 2DFVA 3O8OB 5K7SA 4MQEB 1KU0A 2GBGA 1II8B 4MKRA 1NP7A 3IEUA 4Q6WA 4BFWA 5AVWA 2Y1CA 3VAYA 3ZS9A 2XA9A 4MQFB 2I2FA 2PJUA 4RLFA 5CJJA 3DM9B 4LRTB 4EK9A 2GUGA 3ZWBA 3WYNA 4M49A 5HTOA 1KZ7B 1ISIA 3ZE9A 4OI1A 3OX3A 4DCGA 5IJ9A 2H1LA 1SOAA 1SCQA 3NKFA 3K35A 3U2QA 5CA1A 3ZZMA 2HV9A 4DQDA 4QPZA 2C7VA 2ECPA 4UCFA 5A9SB 1F5SA 1U5BA 7MDHA 1D09A 1T9GS 2CJPA 5L7WA 3A1NA 5MFZA 4NYIQ 2OC4A 3PFCA 2C9BA 1T6BY 3BDIA 4GEGA 2DGDA 4IDEA 2EU8A 4LZNA 4A6XA 3D1JA 3G6WA 3RSZA 4PRKA 4CL2A 2QD3A 2JFBA 3VJKA 2HXYA 5I7HA 5LP6F 3CUWA 2C31A 2HV8A 2W6QA 2ZVJA 1SXHA 2CJYA 1Y7PA 5BV0A 4IO1A 1T5IA 3PNLA 1TIKA 1P1CA 1UEXC 3VYVA 2R87A 3A0RB 2C8JA 2XDWA 4NBVA 3M8KA 3QVWA 1V8DA 1SKYB 1UZNA 1QAMA 2XOKD 1RNLA 3M6WA 4G4JA 1M75A 1XWWA 3P8ZA 5BN5B 3UB3A 1XLTA 3RIXA 3RTGA 3UMBA 4EJMA 3O2NA 1Y82A 3ENZA 1NQOA 4NATA 1KZ6A 3COJA 4A16A 1WW3A 3RU2A 2VJOA 4R1QA 4XUGB 5AVKA 5MFPA 1CJKC 2O23A 1P1IA 3ZHYA 3N8NA 1A1VA 4PNEA 1EXVA 3BFKA 5A3JA 3JW8A 4L75A 2DR2A 3DFMA 1CQJA 4BOYA 4CG1A 3RTEA 1X7HA 4GOLD 4MQLA 3KYIB 2G6TA 3TG2A 1BEZA 5KX5A 1ND5A 2P91A 3W5DA 3NCHA 1GXSB 1RAHA 1HO3A 3FX2A 2HQOA 4MSUA 1W85A 1KTVA 1QHIA 4BNUA 4BFTA 3DOIA 5CB4F 1UBCA 1YQTA 3W5VA 3WWCA 1ZAKA 1ML4A 3NETA 2P3QA 2FSVA 5DN6A 2NVUA 2X8LA 2R4QA 3AHEA 3OF5A 4JJ6A 3W4IA 3WLFA 3UBMA 1GV0A 1JWBB 1ZD9A 1GJRA 1ZH8A 2ZSKA 1XJ0A 1EG7A 4H1TA 3S2ZA 3M2PA 5FLXA 1MOZA 1F2TA 1ZI8A 1G7SA 2HA7A 2GPBA 4L28A 3A58B 4UXIA 2FLVA 4W6ZA 1WD5A 2VZ8A 5IZCC 4EGQA 1XTPA 3OKPA 4RENA 3GJ6A 4QTXA 2GZAA 2OYSA 4PGMA 3B6MA 1OD6A 1RQ2A 1J8VA 3O8CA 2G4LA 2GOYA 2PX4A 4J16C 3N1UA 1BA3A 2PGLA 3GUUA 3LHIA 5BYJA 3INTA 5L45A 3V4ZA 1Z0SA 4POOA 4A2PA 1JLRA 1KQNA 4EY5A 3DCIA 3IA2A 1CDDA 1OWMA 5JO9A 3T61A 4B5KA 4WESB 5I8WA 3WADA 1EM8B 3HM2A 2XWPA 5KCMA 2AR0A 3PD7A 1KMIY 2XY4A 4RJIA 4V39A 4EL0A 1FP2A 2NZXA 3MMSA 4JT9A 3WB1A 5JD4A 4EW3A 4IH1A 2B6HA 2FEOA 4E94A 1HMPA 4DDMA 1A7UA 3HXOA 4LV8B 3SM9A 1T4CB 1ZH0A 1NWHA 5E6SB 3U26A 1V4NA 2VNHA 1ZIXA 4RTKA 1WW8A 3EIXA 2CLHB 2OGZA 3G5UA 4OXQA 3OA2A 1DV2A 4OCZA 2ZLBA 5AW7A 4DYHA 4XASA 3RUPA 1OLXB 4BVAA 1JDBC 3QVXA 3HTXA 4HI0E 1JZSA 2FN8A 3H5NA 4X8HA 4Z0PA 3HDGA 1YKSA 5F2OA 4AUEA 5HSGA 4NQZA 5D51S 3B1ZA 1PIWA 1XQXA 2FSVC 4HFRA 5CX1A 1ZVJA 1N2GA 1MPTA 3SKYA 1L3CA 2BF4A 1AK2A 2HLDA 4XIJA 1X7ZA 2F43A 1FMTA 2R84A 2Y93A 4U2DA 1XZMA 4L8LA 3HYRA 1FYFA 3IELA 3ZY6A 1TW2A 3WRYC 4JGGA 2JLSA 3AESB 3CT4A 3H18A 5GADl 4OXYA 4HDMB 2VYVD 4UCQA 5BSTA 1UKAA 4UM9D 2VYNA 4G8CA 5FAKA 4ND7A 3H04A 3SVLA 4WJKB 4F1JA 1U3VA 1L9KA 3UANA 3QYFA 5HKKD 5LU9A 1T0UA 2WMDA 3GBVA 3TD2A 1SB8A 5I7FA 5AK5A 3KCQA 5HF8A 4DIEA 4MYSA 2A5DA 1GN9A 3T9FA 3IDFA 2PNJA 3WNQA 2P79A 4KVFA 3MTBA 1C3EA 3OECA 2HREA 3VR4H 4ZVMA 1E4EB 4M9QA 2HW8A 1JLLB 2OCAA 5GY7A 2Q2WA 1GWNA 2PSHA 4MR8A 1M0TA 4DJ5X 5EHGA 2GEKA 2ONJA 3JSXA 4AAYA 3PQ4A 2VXCA 5CPBA 1ZUIA 1OWPA 1XZFA 3FCEA 2EZ9A 3R77A 4KRYA 4UTXA 4QBTA 1H9AA 3NDRA 1PHPA 1D2HA 2IYRA 3MF4A 5C18A 5T6MA 1GQFA 3HE3A 4JR0A 5JPIA 3AM3A 4IDPA 3LTEA 3F3MA 1U3DA 1B93A 4Q00A 4L50A 4NFSA 4PYLA 4E3WA 4YMUA 3PX2A 4BMNA 3SJZA 3ANMA 2G07A 1BOOA 3QHPA 1WUIS 5LP6B 1IHYA 1IEWA 2PUBA 4LC0A 4ZZ1A 4JJ8A 3G0HA 2E48A 3JSAA 1FS4A 5F5NA 3ZWWA 3D9QX 1U2GC 3LY7A 1PG5A 2DM6A 4DVGA 2N0SA 3ZJTA 3CLRC 4WBSA 4BKQA 3CV3A 4ZOAA 2CXOA 1CR1A 4H6WA 4TLDA 2RONA 4F8YA 4QUEA 1RPZA 2LKDA 1GNPA 2K2WA 4EGFA 3GVHA 3Q1LA 4FFOA 3RUEA 4NYMQ 5BQXA 4KSCA 1EDBA 4EG8A 1A5ZA 1XDUA 3Q2KA 5CDSA 3TDMA 4ENRA 3Q8MA 2VS1A 3KBBA 4RVDA 4YJFB 2F67A 5F78A 3J81k 1B26A 1TZ2A 3CJQA 4PLTA 4KBFA 1P1RA 3WKCA 2AOTA 2J3IA 1QU3A 1IUNA 3U3KA 2NP7A 2VSFA 3AUXA 5KAMA 4BIMA 3I5XA 5FO0A 4INOA 3WRWA 1BOFA 3DZ8A 2PKXA 4HDSA 1RMTA 3E2MA 4UULA 2NGRA 4IIDA 4UKDA 1N6LA 2VJAA 2Z9CA 3I2HA 3ZK8A 1WZNA 5A4JA 5AI8A 1YA4A 4QQNA 4M0DA 2BP7A 2JLQA 4L6AA 1S96A 1W5AA 1KIMA 1KYIA 3I28A 5IPFA 1UP6A 3ONVA 1KY2A 4K46A 4CQJA 2QAJA 1DLIA 1T2CA 2QRHA 2ZB3A 2ZYDA 3S70A 3UG6A 1HWYA 1JQKA 5KYTA 4Q19A 3TQTA 3HXKA 5AVVA 4WNCA 3I62A 2UAGA 3TL3A 1PQPA 4CKWA 1RPAA 3H75A 3P9YA 4PR3A 2Y76A 4ID9A 4RVGA 2V5VA 3KXLA 1IK6A 1ZGAA 4TS3A 5G1OA 4C7XA 1XCMA 1NE7A 5DCLA 4UHCA 3TM5A 1DCTA 1BXRA 2YYSA 3EVDA 2XMZA 3FOEC 4N7MA 1GILA 1SK9A 3FOCA 1EVEA 1YIAA 3H0EA 1NBWB 2WM2A 4LMRA 4RJJA 3ZWAA 2DQYA 4X24A 3K4QA 3WGVA 1QC5A 4DR4B 3L01A 4W63A 3DWFA 5TE9A 1I51A 5F64A 4WX2B 1J7KA 3L8YA 3QP9A 4K6HA 4M8IA 2Q5CA 4Y2RA 3WFIA 5BN4A 1AQJA 2JRLA 3JQ7A 1XZPA 4IIGA 4JNCA 1DC3A 2G7MC 3AVUA 1OAOC 1QIDA 2ZPUA 1KZ9A 3ZU4A 1BS9A 1N2CA 4X64B 4NEHB 3RO7A 1HBJA 2PAAA 1UMBB 4PXYA 3AL0C 2OBNA 1NVTA 1JHUA 4MI6A 5K45A 3JQAB 2RHLA 3I5UA 2DFNA 3ND8A 4AZ0A 1YJ5A 2BVNA 4CF5A 1Y80A 5IK2D 2P9TA 1OASA 5AJWA 4BCDA 1DWOA 1FQOA 4NE9A 5KPJA 4CLDA 4AZSA 5PNTA 2RJOA 2QPTA 2Y4NA 4N0EA 3VGJA 5JQGA 5CFMA 3M1IA 2GD6A 1LK5A 1UFQA 1V3QE 2RK6A 1MKYA 1P3JA 3NT4A 2AE2A 3FPKA 1C41A 1AT1A 4BVFA 3G9XA 2Q1YA 1D2MA 2R00A 4IHJB 1W73A 4RPKA 3F49S 5HBRA 3UQYS 2E1RA 2GRUA 3K1ZA 2HEIA 5IYZA 2XVYA 4YPOA 1POWA 2ZSAA 3UAGA 3IVRA 5BSHA 5AOVA 2HZBA 3VNQA 2VA8A 3H7IA 3NHJA 1WL8A 3ABSB 2CLSA 1E1KA 2BL4A 1TPYA 1U2EA 4HEA1 2FUEA 1C9DB 1DJOA 1K8XB 4KE7A 4KYVA 2NSJA 2MYPA 3LNTA 1K75A 2VZ0A 1SBQA 2ZU0C 2R6DA 3HS3A 4Q16A 5DMHA 2OY0A 1X87A 2XBMA 3ROXA 4XVQA 4C1BA 1I3OA 2XF8A 3NWEA 2HHAA 3A1WA 4PYIA 4DQXA 3EA5A 2RGRA 4RSGA 1GZ4A 3WDKA 3DZGA 3UATA 2I80A 2CXQA 3VHRA 2ZYVX 3BGOS 2A9JA 1HXHA 3NC1C 3R5SA 4OHPA 4MRNA 3HCNA 1TT7A 1ADYA 3B5JA 4O8ZA 5FOUA 4D4IA 4UCWA 5KVCA 3EY4A 4ARCA 4CTKA 3NT2A 3TIFA 2HA3A 1VL8A 3BMNA 3RVQA 6ADHA 4TMZA 4PTYA 3O2JA 5ALPA 5HDBB 4OUDB 1Y8QA 2JHGA 3QSGA 3BULA 3CG4A 1VRCA 4AY4A 5DSTA 2HA2A 1F4PA 3GJ8A 4YP0A 5CX1B 2VVTA 5BSKA 2EKPA 3OCJA 2IPAB 3QENA 4ANFA 2C3PA 4DT1B 1H6CA 2E5FA 3CUEF 3JAWB 4XWAA 4DUGA 4KXVA 2B30A 3QUTA 5ALRA 1F5NA 2OBLA 2GYVA 4KMOA 4AN0A 3DZCA 1LBEA 3TDNA 2R11A 3FPAA 1OTHA 1ZCBA 2PMFA 3JQ9A 4QDXA 4Y98A 3RG8A 3VC1A 4ASUD 1ZLXA 1Z39A 3PNKA 1FDRA 5ANRB 3F7OA 1MEOA 2ZU6A 5JLJA 4JENA 1S3FA 2O1XA 2HF9A 5FO1A 1DJPA 1JQBA 3HEBA 2BOVA 4LK2A 1IHUA 3CRRA 3MTGA 4UUMA 3UWPA 4EFKA 2GN8A 3A05A 1MAWA 4M37A 3HB1A 2JH3A 2P4EA 3OIVA 5L51A 1WMBA 1X1SA 3JVUA 1IWPB 1QVVA 4MVJH 3WGIA 2JLUA 3NANA 4GKJB 3CUYA 1ID8A 2P2ZA 4PYQA 2XQIA 1UBLS 1B1CA 1MT3A 1ES9A 3MCZA 2CZCA 4ATNA 3VYWA 1LDMA 1V1RA 1XHFA 1YUNA 5TSDA 4O2AF 5EKSA 1KOJA 1KGSA 1O94C 5AIAA 5KX5B 9ABPA 2JAWA 1I6KA 4HLUC 4PZLA 1KFBB 2FZWA 3AUYA 3G5LA 3QXGA 2D5LA 3IYLW 3T7AA 2QN7A 4ZCPA 1JJFA 1Y1PA 2IPXA 3EDMA 4J0DA 4NE7A 5AJTA 3IBCA 4IL5A 3KDSE 1QS0A 3Q9NA 3WI7A 1PEAA 3EXG2 5F77A 1Q1AA 4C2TA 4WCDA 2IUSA 2JIBA 5AI0A 3TM4A 2FPMA 5P8WA 5C4GB 2H4ZA 5AJYA 2PKRA 1JG1A 2JLZA 1PFGA 2ZRLA 3PFFA 2VP0A 1UFOA 3KTAA 3PDHA 1Q1NA 2DERA 2VRCD 2HA6A 5IYZF 1FP6A 1JFRA 2IHYA 3E4DA 2GERA 4AULA 1LWOA 4O33A 1YHNA 3E3AA 1KJZA 2AVNA 2ORVA 4C2BA 1DIAA 1QCYA 1R6VA 2B8WA 3GFBA 4CM3A 2FSIA 3U1VA 2DCUA 1WWKA 1PZEA 4FKBA 4OHYA 2C94A 1SUBA 4NCHA 3SX0A 4Q7KA 1ZIPA 2HF7A 2H7CA 1K7YA 3U13A 4DL9A 3KR0A 1KC1A 3K9FC 2ZCJA 4XX0A 4GLJA 5AJZA 2H8KA 1N57A 3IEXA 1WU8A 3R09A 3ST7A 2C0CA 2IH2A 4EABA 1ZMXA 3KZXA 3I8XA 1G3QA 2H6EA 3OQIA 1VGVA 2FZ4A 3HB5X 2EAUA 4RFSB 3T5DA 4DS3A 3COZA 1JIXA 2C5HA 4CEHB 4MAMA 5F12A 3OM0A 3FYTA 1O57A 4QIHA 4UUQA 1YDWA 5LJIA 2I3DA 2OHXA 3V7FA 1OB5A 3RKRA 1VDZA 1NLUA 4BN5A 1IM2A 1UUFA 4M8SA 1UXGA 3DZIA 4GLFA 4QA9A 4C14A 1C2TA 2PBFA 1UODA 2GRAA 3CQ9A 5DEIA 2YY7A 3S1AA 2FKNA 3U7JA 1LZLA 4JJGA 3IUYA 3TLEA 4TMKA 3QYAA 4V0RA 3OC0A 2VR1A 1X7ZB 2F43B 3CFYA 2YQ5A 5IARA 4AZWA 3EXEB 3BM5A 3UY4A 5C4IA 1K1EA 4UUNA 4HMOA 2Q3EA 4IIJF 3X43A 1BD4A 4UOQA 3DBHB 2W6PA 3SGLA 4S1VA 2XMQA 2VYND 1CY4A 5EAIA 2CYAA 4O2AA 1QQ6A 5BN4B 4Z53A 1A04A 1YUMA 2GDJA 4FQ7A 4MRVA 5DBHX 2YIJA 4GS5A 3VPBA 1JQDA 5BQPA 3IP3A 1JA1A 2QROA 4PLVA 1G5FA 2VPQA 2KW5A 3GZNA 2HEGA 1DAFA 3QFTA 4OGKA 4CF6A 2C20A 1H93A 3P4UA 2EQAA 2W6JA 1YR1A 4AZ3B 3TZLA 2HX1A 1QPGA 5LUBA 4B7AA 2BF7A 4M1ZA 3VI4B 1RYYA 3K1AB 4WK4B 4YRNA 1I6MA 2FX2A 1CY1A 2QZSA 4HGYA 3WIVA 2QRUA 1OYVA 5IT5A 4J0FA 3KQYA 2OTCA 4NJMB 4G0ZA 1YDGA 1YB6A 2W90A 1J42A 2HDNB 4DSOA 4F6RA 4BGDA 4IHJA 2I5PO 2QZJA 2Z4RA 2ZTVA 3L05A 1WTCA 4DMRA 1ESMA 1GA6A 3VDQA 1EFRD 1U4SA 2W2LA 4I1IA 3FZYA 1MFPA 3D4NA 2VSNA 3BKXA 5G1NA 3RC3A 1Y4UA 2XECA 4QEKA 2C9OA 1NDUA 1DV1A 2HK9A 3KUDA 2ZRJA 1QIEA 2OZLA 4I19A 4Q7MB 1QFJA 2O8FA 3SDSA 4BNLA 1ZVKA 5LP6A 3GDOA 3RREA 1QVRA 3M5DA 5IAEA 2GLTA 4R2KA 2CDAA 2VNIA 4EMUA 1TTTA 1K9SA 2IITA 3LUCA 4HB2A 4C78A 3IP9A 5FYDA 2P4HX 5H81A 5DI9A 3VO9A 3EZNA 3JWEA 2XRMA 4L0DA 5H70A 1U0EA 4IIUA 1JXQA 4EO9A 2DRIA 2CFTA 1NZDA 3LA6A 4LXQA 3CEMA 3O03A 5HJEA 4RSMA 5EMMA 4BNZA 3TX6A 4ESOA 3H1BA 1SELA 3T9AA 1QZZA 4YI5A 5YASA 4MS3B 2JC3A 2CC2A 4ZYLA 4ZANA 4P4NA 3B6ZA 1G21B 2AWOA 1XFAA 2VCYA 1YHYA 3WG9A 1L5RA 2BMAA 3GH3A 3L5KA 4ACBA 1JG3A 3JWJA 4Y0AA 4KQCA 1Z2NX 3ZGYA 4RPHA 3WZLA 2X6TA 5DX0A 2NUTA 3BAFA 3H2SA 4HRXA 1INLA 2RIRA 1S2OA 10MHA 1B8PA 5KI6A 1JYSA 4B1FA 2AYZA 2C99A 2OCIA 3L4SO 1T5OA 3OURA 2CE7A 3K0CA 1R10A 3HZRA 1QRTA 2I33A 3K9NA 4PZEA 4GF5A 2JHCA 4O2BB 4DLYA 3RI3A 4KWEA 4LECA 4HC4A 3PFIA 5GM2A 1E6KA 13PKA 1LBTA 2JIZD 3ZE8A 1SVKA 2HMAA 4ZREA 4MVJP 1YC5A 3B7PA 1RXVA 3LCMA 1P45A 3EB9A 3D3NA 2IY7A 3QXHA 5LP6C 3WLKX 3AI2A 1OIXA 5K6AA 1KI9A 1OFVA 1SUDA 4GAEA 3WHPA 1PR4A 4FGJA 2BLLA 2FR8C 2HKIA 1FQJA 4CDMA 5FPTA 3BAZA 2P65A 4RUKA 2NU8B 4HDQB 4QPNA 5AHOA 4HB4A 1H5QA 4YN3A 2O2EA 1UZAA 3A3KA 3M83A 4XGQA 4BV9A 5FAXA 4KXFB 1S8FA 3PV0A 3GFRA 4GMKA 4OL9A 1AS0A 4NJOA 2FFJA 3ORSA 4LDJA 1H4TA 1QH1B 1IN5A 2A35A 2VN8A 5JMWA 1LPMA 4S2EA 2X0EA 1V5IA 1YCFA 3ZCTA 3NC4A 2IU4A 3L0BA 3KTDA 4HGRA 4F38A 3MFQA 1QGDA 2HU5A 9LDBA 2OV4A 3C6BA 1W36C 2VDPB 1P19A 3MOSA 4DV2B 3IDQA 4N0MA 1WSBA 1QDUA 5B58C 2R6ZA 1V48A 3K8ZA 3WA6A 5JYBA 3GFPA 2VHEA 4ZOCA 4LZPA 1I9GA 2YHIA 4KYUA 4X1KA 3V8MA 1GIAA 1M2WA 3OZRA 1N7HA 5KCZA 4IR7A 2B6NA 3UFBA 4H3HB 4IHKA 3W7AA 5BP7A 3IKLA 5KHAA 4Q18A 2GCPA 3TZKA 5AUNB 3SR4A 2CJFA 4IZIA 1FYXA 3VU0A 5M29A 2WJPA 3DGFC 4EELA 3CKLA 1IQPA 3FW1A 4JYAB 2JBAA 4URHA 3C5HA 2BMEA 4AN1A 2C97A 1NPTO 4TV9F 1RKUA 1S2IA 2BFCB 3L07A 2WU8A 3OIFA 3ENQA 2ORWA 1EP9A 4B17A 3EOBI 1X14A 4XE5A 3WHKA 5DO9A 3WNBA 4K9RA 1SHZA 4FINA 5IKEA 2FPLA 1M0SA 2G67A 3EZ2A 4HZGA 1ZKDA 4LJLA 4IQGA 3SFVA 4MVWA 3PI6A 4BJ1A 4B3BA 1TZBA 4E3ZA 3PDJA 2A0XA 1F3LA 1J9ZA 4QYTA 4HTFB 5K8CA 4EUSA 1N0VC 4EHAA 4B40A 2AW5A 1S01A 2JGLA 4Q1AA 4RGBA 1VSUA 1JBKA 4KRGA 2RKBA 2ZIGA 2PJRA 1IBKB 2VA9A 5J2TF 4W1SA 2ECFA 4DDUA 1P0FA 1A9PA 3IQGX 1UC5B 3NHBA 4FWBA 4MVCA 4NENA 1KFKB 3WLLA 1OBVA 1US8B 3LO5A 4HXYA 3TLGA 3V48A 4BIIA 3H5OA 1HORA 4KE9A 4YHHB 1C4XA 1NQUA 4O02B 1Y5MA 2D2XA 2W0SA 3CH7A 3FAKA 2RGNA 2Z9DA 4OI4A 4C0AC 3FMVA 2WILA 4XYLA 3HU1A 1ZD2P 4TSFD 4NV0A 2BRUC 3HCRA 4XUCA 3DHVA 1QXSA 4ZK2A 5AKKA 3NGXA 3MS2A 3G59A 2JG3A 4QHTA 2B2CA 2PD4A 2RHDA 4QICA 3EGEA 4NNJA 4CXMA 1T2VA 2X77A 4M9CA 1WE2A 2G09A 3DE7X 5E7IA 5IKOA 2BCEA 2J0UA 5B37A 2PZLA 2B0CA 2CNLA 2DT8A 3FXAA 4QBGB 4N8EA 4TWAA 2IIQA 3QM1A 4QL3A 2Q6VA 4UE3S 1OZAA 3EGDA 1QAQA 3HJNA 4NMLA 4YCNA 4FYWA 4OLHA 4YRMA 4KFUA 1T5TA 3NAGA 1MRZA 3PUHA 5TIIA 1ZWLA 1AHNA 3BFXA 1N2EA 2DY0A 2ZBGA 1YASA 3DVQX 4C87A 1NX6A 2BR4A 3BSYA 1SCJA 4LE1A 5BSRA 4ZWNA 3DTYA 2QR2A 2NMVA 2H4WA 1SN7A 2X2PA 1GP2A 2XKAA 1PR1A 4GXTA 3HBLA 4CODB 4DIBA 3EW7A 3E27A 1W46A 1EUZA 4RCVA 5T6BA 3W2FA 4S0XA 3L8ZA 2BBWA 3QKUA 3A04A 1BW9B 4II7A 2GTIA 2ZUWA 1RABA 5AK6A 2NV2B 5IH3A 4AY6A 4NI5A 1B6TA 2N42A 3OKAA 3LIIA 3M3HA 4BLTA 1XF1A 2DBVO 2I7TA 4NTZA 3CHYA 1D07A 2CSXA 5A5DA 4TM7A 1P2FA 5C0OE 1KI1A 1NHGA 1C7IA 1WDWB 3FGPA 4HK4A 2W22A 3T7KA 5J9FA 2OFXA 4R1MA 3Q7TA 4QOGA 1XF9A 2QPOA 3RROA 4B48A 4JFRA 4LMPA 4OMDA 1BE0A 2UYHA 4D02A 3OIYA 1KDOA 3DL2A 1ZQ1A 2CDCA 4HXEB 5HZKA 3LNCA 2XYPA 3EXHB 3I9NA 3GC6A 1AN9A 2AEMA 2O8VA 4JB3A 1OW3B 1F3OA 1R74A 4F72A 4AQDA 3A70A 3VR6D 1CUZA 4ZARA 1KJIA 3G2OA 4D4MA 2EKZA 2OV1A 3M6XA 1XRRA 3DUFB 2WF9A 2JAPA 3BXZA 3EVAA 3COYA 1ZA1A 3GEPA 1REQA 1C3LA 3X1XA 5F2KA 4U2EA 1NI3A 2XE6A 5THKA 4QJ3A 1CRQA 4PGAA 2XVXA 1KO1A 2FSFA 4ALJA 5IM4F 5K3FB 4O25A 3TEFA 2ZANA 1HT3A 2KLHA 1ECLA 2GM5A 3QKSB 2JZNA 1HT1E 4FS8A 4P3NA 1NONA 1G2PA 4OBXA 1IJBA 4P3KA 1HYHA 1L5KA 1UPUA 5E4FA 3IBTA 5T3UA 3TI7A 3TW4A 4P0PB 2VKQA 3C70A 1Y7IA 2QZ9A 2JHFA 4BNMA 3TOVA 2A88A 2YDYA 1PLKA 1YRQA 3KLNA 3TLXA 1RI2A 3VMFA 1OIVA 4FGLA 5KWIA 3F3YA 4IFTA 2EYUA 4DRZA 1TTQB 1UBNA 1W9MA 3KSDO 5CVJA 1AKQA 1DKRA 2I1LA 2WTXA 3WGUA 3EIFA 3RVRA 4JI4B 4C5AA 2YVAA 1XA0A 1CUUA 2PT5A 4BATA 4BO9A 2A57A 3ZDXB 2KX7A 4EUFA 2X22A 2Q4DA 5JH7B 3E9QA 3CCCA 1W4BA 2HK6A 2VZEA 4URUR 3ESRA 3I5AA 1S2LA 4MGKR 1ZOSA 2O0JA 3F8SA 1HI9A 4GMDA 4O08A 4O2BF 4W9RA 3EIHA 3SLRA 1AUPA 4C01A 3C98A 2RHRA 1I10A 3CGWA 2G9NA 3CONA 4Y9SA 3GPBA 4D9JA 1RHMA 3VSAA 4RIFA 4EW6A 2EKQA 4R31A 1O1YA 5AK3A 4B83A 1MGOA 5A0TA 1W8DA 1X80A 3TE7A 2J31A 1JA0A 3BS4A 1N6IA 4OJQA 3RWMB 5JZSA 2H4XA 2P6MA 2Q8QA 4RKEA 3GLFE 2HXGA 1QH1A 2DHQA 3GJYA 1P1FA 1GEGA 4MVJA 4OGWA 4R81A 1YZTA 3S8MA 3E5RA 2X2FA 2HSZA 3K1TA 1NMSA 1NW9B 2X3UA 4HLCA 4JLUA 3STXA 2WG1A 5KTOA 1RFLA 3JD0A 4MUBA 2ZT6A 1Y42X 1N3BA 3F6SA 2NUPB 3Q5GA 2D1YA 5M7EA 4RSRA 1ZAYA 1DS6A 1NLMA 1KAQA 1D6MA 2QW8A 5H1YA 4MITA 4ZO7A 5TPZA 1GRRA 4WUVA 1AGPA 4FOOA 4HQ6A 4ZO6A 3AKZA 2ZJ4A 1SU6A 3FWYA 4BO5A 5A9TA 1VYVA 2VC2B 4JEUA 3OTWA 2VP6A 4X6UA 3MLAA 3ESCA 3AM5A 1HGXA 1K5GA 4NQRA 3KV1A 1VIMA 2OXEA 3T9BA 3U19A 4NS4A 1P4SA 3GA5A 4PHTA 5HE8A 3PZBA 3G7NA 5EJ4A 3U81A 3VQTA 1WSWA 3PQ7A 1V96A 4X3CA 3F5QA 3UM9A 1T4DA 1NW8A 4YUVA 3VOSA 2X8JB 4H7DA 4Q21A 5JVDA 3H3FA 4EKYA 2CY0A 4B0OA 2WFLB 4GQIA 1JX6A 4FX5A 2YASA 1N6HA 2AN5A 3KYCB 3K2EA 3HI4A 2E4ZA 1MC8A 4QNRA 1EA5A 1Y9JA 4IM7A 2NTEA 1JE0A 4XQ0A 3U4HA 4BNYA 3QVSA 3PE6A 2RC5A 5JALA 3STYA 2G1KA 3D3KA 1YONA 2Q29A 5JNRA 3C7CB 3T5BA 4B33A 2AR7A 2R3SA 1DARA 3G0OA 5L3ZA 2FSPA 3FPHA 3GVXA 2YNMD 4BO3A 2PRZA 2YUTA 4YIHA 1SXJE 2CVFA 1QTNA 1R7RA 3B1VA 4WOKA 5C7LO 3CSUA 1Y8QB 2YXEA 1UWKA 4CF4A 1FUUA 4RV5A 3UJPA 1K86A 2N75A 1A8IA 1PS0A 3KO8A 2P27A 4R0NA 1SQ0A 4DMHA 2VP4A 1FFWA 4HAVA 2QQ5A 2HFKA 3KXPA 1JDTA 3QEOA 1D5WA 1EZZA 4ITUA 4FLFA 4UHBA 1AQIA 1T5LA 5DN9A 5LA6B 1AJEA 1E0KA 4HR7A 3E9DA 2GFIA 4P81A 4ZAFA 16PKA 1R88A 4MA5A 5E0OA 4LHYA 1PYOA 1T1GA 1N2IA 4MUJA 1OBFO 3BUSA 3TMYA 2Z3WA 3TNJA 1AKWA 3UJBA 3ZR4B 1P7ZA 3MWLA 4BAUA 5EJ6A 2PKWA 2XLCA 4PWZA 2GVDC 3RVMA 4GMFA 3FTDA 1M67A 4MV4A 3WS7A 2JCVA 3FPSA 5I4CA 4RMJA 1NU8A 1T3TA 4Q3NA 4U2FA 4CG0A 3I23A 2OP1A 621PA 5H4HA 4NESA 2ID8A 4DA9A 4ENUA 3AHGA 2AWNA 1N2HA 3MAJA 1E5TA 4AECA 2NU8A 1ISRA 1ZGGA 3GJ0A 4GPD1 1RRVA 1SU4A 3DAYA 5H80A 3IAUA 4R51A 2AJLI 3VPFA 3WMXA 3LUBA 3UWOA 5LDDC 3MMXA 5A4FS 1YOBA 3IE0A 3QFSA 3QKWA 3E7FA 3F74A 1C3XA 1WXHA 3CLVA 1RYNA 4X1OA 4BVHA 3BSWA 1K98A 4HNSA 4ROTA 1XTUA 2PY6A 1KDZA 3FETA 1WZ2A 3AGPA 3SJ7A 1N7GA 1Z5GA 3PQ3A 1A95A 1FDSA 3B3FA 4RVSA 3HKDB 4MUMA 4KO8A 2IHJA 3AOEC 1MJ5A 1U94A 1KYQA 4JBLA 2G71A 5JSQA 5JLAA 1TT5A 2E5LB 4PFJA 2ZYTX 3B9RA 2EOAA 5EIOA 1B0UA 1LBQA 1VIVA 1YJCA 1GU1A 1IUPA 2HOQA 2XMSA 2ZE5A 4NBSA 1FJGB 3GAAA 3R6TA 4J6EA 1CT9A 3HJTA 3VMMA 3L41A 3WGOA 2QTMA 3NP9A 1CS4C 4H7EA 2FP3A 5CEJA 5JAOA 5ALQA 4DY4A 5TJHA 1Q6YA 2PZJA 3S44A 3I6QA 4IOLA 3ZD8A 4PFKA 4KL8S 3SXPA 2GDZA 4DCNA 1DBQA 2NVBA 4Q7LA 2VJCA 2ZIAA 3TW6A 1LSSA 4EHFA 4EJSB 2WEKA 4CJXA 4G36A 4IF6A 2XYQA 4MMZB 1QFXA 1TU4A 1WDTA 1A7KA 2YMLA 3BXGA 2FOLA 3MYRA 1QTRA 3NASA 4QU0A 2D5AA 5ITZA 4Q3CA 1QCZA 1BJKA 1QMPA 3DVAB 3HLTA 4RY9A 2CCJA 3AVWA 1CUXA 1VL1A 3TLAA 2WDPA 4XX0B 1ZMOA 1X1AA 3WV4A 2Z2YA 4TQ9A 1N3IA 2VUUA 2TS1A 4HAUA 5DTRA 5FFFA 5AUPB 1LC3A 3P2EA 5LQSA 2MR6A 2YWFA 3WWYA 4I1PA 5BOSB 1ZSYA 2O8NA 4FGZA 3VU1A 2DUMA 1Z47A 5AKJA 3S27A 3DTVA 3NIDB 4TYMA 4JSRA 3A36A 3DC7A 3PXBA 4X63A 2I1VB 3NEPX 2B4KA 4RS4A 4ZEXA 1WUHS 2Z0MA 4YJGB 2EJBA 1WCYA 1FW8A 2IYNA 3PFWO 1K0FA 1RQXA 1NI4B 5HOQA 3AW9A 1YS1X 1FP1D 3R4CA 1YFJA 2WU4A 2C2KA 2D2IA 3FYSA 4TVOA 4FNGA 4I5FA 3VC7A 3KEFA 3HCFA 2WSSD 2X5JO 2WTAA 3K9WA 2GEFA 2JAXA 5T8KA 2P6NA 4KR2A 2H54A 4XYGA 1C8VB 1M9NA 1U8ZA 1YE3A 2P1RA 2YJ5A 2P9QA 5C3UA 4LYEA 2Q8PA 2UZ1B 3HU2A 3E5HA 1R8QA 3O4RA 3G7UA 3VNUA 5K6AC 1Q19A 3D1LA 4FHCA 5FWAA 1W5BA 4A8HA 3L0DA 1Z6QA 1L4UA 3HVKA 3ETNA 3O3MB 1L0BA 1U3WA 4LJ7A 4ENVA 5DOVA 1YR3A 1YR6A 3D1VA 3HA7A 5CH8A 4TKUA 1OTXA 1D1QA 4KSYA 3D8TA 4UBIA 3R8CA 4F5WA 4Y2JA 3IJEB 4BP3A 1B6GA 1O94A 1ZUWA 3C2QA 4GZ6A 2M2IA 4PPYA 3JS5A 4WA7A 2X5NA 4XD7A 1Y6GA 2EJTA 4LI3X 2W6IA 3VDRA 3T9DA 2I4RA 1XTJA 3NYIA 1NY6A 2EL9A 1L8LA 3VO1A 2Z57A 1NBAA 3P19A 1XEXA 3DE2X 4UHJA 4FMCF 1HG1A 1UPXA 4NABA 3RBAA 3S2UA 3WK5A 2BGGA 1P60A 3RADC 1ACMA 4D0NA 4BPBA 1IXYA 4EZIA 1RC8A 3BWVA 5EP2A 1RVV1 1SKQA 5HUJA 1WXFA 4Y1FA 1G4AE 1OC2A 3HWRA 3P45A 5KBYA 1CFZA 2IYYA 4LKRA 1Z4MA 2OYCA 4ZZ0A 2AFIA 2YV4A 3O90A 1D0VA 1ZH2A 4BQRA 4C0SA 3LK6A 4G1CA 4W5RA 4JXXA 4Z3KA 2ZI6A 1U7UA 3C85A 3AFNA 1PL8A 2CEAA 2B21A 2HSEA 4N5NA 4NZOA 5TS3A 4MPTA 4W9MC 1OGIA 2PKEA 3IUSA 3AERB 4F60A 3JASA 3EBPA 1H2EA 3IO3A 1L8QA 3PPYA 3SEQA 4JELA 3IFSA 2IC5A 5H9VA 4MPRA 2ZB4A 2OCKA 5DWDA 3OQPA 3WGGA 4UFPA 4HNRA 4CEIA 3DR5A 4G65A 3C97A 1EVJA 3K09C 5K09A 3WOHA 1MO5A 1QRSA 5CFQA 3GPIA 5ICEA 3N2NA 5FOWA 1C8BA 3OOWA 2I4TA 3ZE2B 4DBZA 4LFAB 1R2QA 3N28A 3AHDA 3TNDA 4EVIA 2BI4A 4Y1RB 1M1NA 2ZYIA 1M1YA 1ML3A 3OZIA 4G56A 5AH0A 2J3LA 1NNEA 2PUAA 1II0A 3V3TA 1ENYA 1B0ZA 1UBUS 1BCSB 4Z54A 3PPXA 5BUZA 2ODEA 5CDHA 2CBXA 1U80A 2WG2A 2JGEA 5IJ9B 1AQNA 4C1NA 4R7ZA 3K8OE 3KTAB 1DKMA 2ZWMA 1GKYA 3FCOA 3H9QA 5AXBA 3ZXSA 3RYTC 3AF6A 1YQUA 1G8MA 1TRKA 3A1FA 1NQXA 4MWGA 5JR3A 2WVAA 3ZV4A 2CLKB 3IUEA 2O2JA 5H82A 2R5NA 4LS3A 3G1UA 2PYZA 4LHZA 5F5LA 4DA6A 1MOSA 3MILA 4GX0A 2V7XA 4KPYA 3OUTA 4NZMA 1N8TA 4HPWA 3JYQA 1XX6A 1TJNA 3F0TA 1OI7A 2W83A 2HMTA 1VJ5A 3L8FA 3QA3E 4Z3DA 5DX1A 2F4VB 3KSRA 1ZXLA 4KVGA 1VA5A 3ENKA 5LOVA 4D4LA 4U0JA 4ZZIA 4AO6A 4L6CA 4D0LB 4ERNA 2FQXA 3H5VA 3TQSA 5G0SA 4B9AA 2JI9A 4FILA 5BR4A 3W9UA 5EZYF 1MG5A 3MPUA 3AV0B 4M1QA 4YX9A 5A7HA 3REQA 1RWXA 1U6JA 2AF4C 5GM1A 4HX5A 3NJ4A 1E2DA 4ME6A 5BMOA 1MLDA 3E7WA 4L3OA 4R2HA 4P2GA 1RP7A 4CIYA 1E7MA 4IO0A 5JCJA 1HMYA 2WI8A 4Q66C 2VTBB 4IXTA 5I9NA 3ZOKA 4CLRA 1KYTA 5K2MA 1H2HA 1ONBA 3IESA 3DVSX 1RRMA 5E0KB 3U31A 5EL0A 1MO2A 1M74A 3P9SA 5A6SB 4NCJA 4XWKA 1OFIA 2O7VA 4Z3OA 3GUVA 3KWMA 1HSOA 1TMYA 4GX2A 3SC4A 1QK4A 5B1EA 1U2RA 2QE6A 4V03A 4ZVQA 3G02A 4HS9A 5E9JA 3RVJA 1EU1A 1A2KC 1L5GB 2CXSA 3UGJA 1DG9A 3W6OA 2O19A 1EFAA 1RHJA 1Y9AA 5FL7A 2C2WA 3S0JA 4QBKA 4PZYA 2WVGA 1JYFA 3MUOA 1PEDA 3V34A 2D1FA 3Q0IA 1LQUA 3FBGA 2ORED 4WBNA 5CVTA 1EUYA 3QU4A 3VA7A 2QQGA 4JJEA 1S8AA 3MJEA 1W96A 1EXMA 1MXHA 1XALA 3VZDA 4EI8A 1RJFA 1T8PA 1LD3A 1ZIYA 5CDTA 4MULA 3MPOA 3LBIA 4KO4S 4WHMA 5DBOA 4K86A 1CF4A 4B6QA 2W42A 2GBCA 5JZVA 3U09A 1XZ8A 2Y9MB 4RMHA 4IS3A 3OUZA 1COWA 1V8OA 4MUKA 5AM3A 4LCBA 5C8YB 1M3SA 2RHWA 1IK4A 1NBMA 1R0RE 1NVBA 2YC2C 4UMFA 3TLMA 4CF3A 1YI8A 5HR5A 3C6YA 1NRJB 3DQPA 3OO1A 4YECA 3T1NA 3MTDA 1UOPA 3EXIB 3VKWA 4B3DA 2X6RA 2FQYA 2VCHA 1QV7A 3S2EA 5AK4A 1GR1A 2C5GA 4OH7A 1A8HA 1CP3A 4P3PA 1KDYA 1C8KA 3TF5A 3CCBA 2BBSA 1P8JA 2FZEA 2GYUA 1GZ6A 2EBHX 1WXEA 1DCMA 1ORRA 4I3HA 4MR9B 2A67A 3BGSA 3LCRA 4H3VA 1NVUQ 3I45A 1K8ZB 1MB4A 1TM1E 1VJCA 3NYRA 4IGIA 4RPJA 4KP7A 4Y6GB 5DHUA 4REMA 5UKDA 2I7CA 2P6OA 3D8RA 2MIIA 3O9MA 2PT6A 1VMEA 4WCFC 4EYSA 4HT3B 4ZN6A 1AO0A 1GLVA 3DMTA 4E14A 3HU5A 3OFKA 1AH2A 5HKOA 2WKWA 1AGYA 1N0IA 1L7DA 3JVDA 1M6WA 5ITSA 4MRRA 3I61A 4Y2YA 3E2IA 4MH0R 1TC1A 1HYQA 2VXYA 2B7CA 4C0JA 5HRUA 3IVAA 1J0EA 4OEHA 4IXNA 4UXHA 1T1IA 3AESA 2HPHA 3GGPA 1W5FA 3JYOA 1M1UA 4K9KA 4DA0A 1JHDA 4OQMA 2GPYA 3UTCA 1VPWA 3N0TA 3DJFA 4CMIA 5IZCA 3UH0A 1AK9A 4MLCA 1SVLA 1EWKA 4V0KA 3LLUA 3SYLA 4EKNB 4E22A 3ZN2A 4BQSA 3LDUA 1FQKA 1TD9A 4NG4A 1Z4OA 5DGTA 3TLBA 1LB1B 1TUEA 3D6HA 4DEVA 4WZAE 4X3OA 1IMJA 1FVFA 3D0KA 4ZYXA 3PWKA 5B30A 1BFKA 4KFTA 3HZHA 5CVVA 1MHPA 3TRIA 4BNXA 4DANA 5BMVA 1L7NA 3F3KA 1KI6A 1MQAA 1K6IA 4EHKA 1L3IA 1NW4A 1QO0A 2AFHA 1YQWA 4RD2A 2OZKA 5TEWA 3KOUA 5EZQA 4RTJA 3STTA 1TEVA 1JHRA 3KT3A 2HBRA 3ILXA 1QTQA 2D5CA 1V2HE 4ND8A 2JIQA 3I4CA 2FPXA 2RH9B 4MWCA 3GMIA 1XLVA 3GR6A 4LQDA 4MR8B 4BX0A 4INZA 4JVSB 4GH5A 5FUXA 4DLVA 1CNFA 5A7FA 2PLAA 5JNLA 3WIDA 3AZPA 3UB4A 1JHAA 4I6EA 4AIIA 1K6MA 3KTFA 4N6GA 2ZWPA 5DTJA 3WB2A 3IMFA 3PEUA 2J3DA 1G55A 1YZLA 1E77A 1VPTA 3KB1A 2W2VA 4K3VA 1M0WA 4FU0A 2R25B 3MG9A 3S2YA 4JC8A 4A0GA 2IZ1A 3HKDA 4JVLA 1KEZA 1ZI9A 5IVPA 3OZFA 4OA5A 2VRNA 3ZV6A 2Q99A 4EJ6A 1JSXA 1UT5A 2BGIA 1CQJB 2LBPA 4ZODA 3UCFA 2YJ4A 1Z75A 3BHJA 1UXJA 4L5YA 3NVDA 1CUIA 2ZI5A 5FT9A 1V8FA 1XYGA 2DQZA 3ZDZB 3IUQA 1XMSA 4ZYWA 3BGIA 3OMWA 4UNRA 3ZHZA 1E9BA 2AMLA 3TQHA 1AUVA 1I7PA 2XE8A 5DISB 5IAOA 3RR2A 4TV8F 3C1UA 2Y99A 1DSSG 2H07A 1H05A 3ZE7A 2IZ5A 2YV3A 3MBIA 2BZ1A 4K6KA 4MQ5A 4S2UA 5KINB 5B1IA 4DQLA 5HRCA 3A1UA 1VB3A 1B16A 2CL6X 2VAPA 2W6MA 1VMIA 2IYFA 4CUKA 3ILSA 4DYDA 1CEXA 2L82A 2R6FA 4EJSA 4EKIA 1CEYA 5FL7D 1S4MA 4LXYA 3LUDA 4KN5A 4KPGA 3JR7A 1MX1A 2HRQA 3IT2A 2XGJA 5HFAA 3R40A 4V1CB 3F2IA 3FMFA 2XA1A 3SMVA 4RZ2A 1ZD1A 3GXBA 2WUEA 3K9QO 5IHPA 2O8CB 4PFSA 3V4LA 1D9XA 2Z95A 5KJ1A 4PG8A 1JYEA 3WBKA 1EGAA 4OUKX 4GU5A 2CVPA 5AHKA 3B85A 4B0PA 5BOSA 3B48A 4DJAA 1ZR4A 1X1BA 4BVLA 2GD2A 1HFKA 3GOHA 3QFHA 3GBPA 2J59A 3IRUA 4WESA 4LF4B 2GCGA 2R48A 1PQWA 1UC8A 1Q0PA 3GCZA 3ZZ0A 3ZV7A 2DYKA 3SHFA 4E1VA 3DLCA 1HETA 1JR6A 1XMXA 2IYSA 4J03A 4FLMA 4KMRA 4X20B 1K2VN 4TMFA 3A9SA 1QE3A 1U8YA 1Q2UA 3TX2A 1FP7A 1BNCA 1QBKC 4AC9A 3W06A 1MZPA 3DT8A 4GBJA 1R5BA 1EFCA 3M4XA 3T7SA 2XH8A 3JQ8B 5CA0B 1MJFA 4EYQA 4AY2A 3NHZA 3DEKA 4OYLA 2V5AA 1WX1A 4ARVA 4DC1A 3IEVA 4M53A 1GZ5A 1YRHA 2Q62A 4KUHA 2W7TA 3SZRA 2VF2A 4GX1A 1S89A 2I67A 3CX4A 2ZWVA 3T12A 4BLSA 5TPWA 5KNLA 2Q5OA 3H6HA 4EDFA 3T54A 3BB3A 3QMPA 1SC9A 2Q27A 2Q28A 3AB8A 3CF4A 1P81A 2KB0A 2IP2A 2P3SA 3C3XA 5SYMA 1S7GA 5AESA 4XIIA 1THMA 2IV7A 4X7MA 2FB9A 1O94D 2VXOA 1YU9A 1E8MA 4GD3Q 3VR5H 1W4RA 4RBNA 2DEUA 2N9UA 2G9VA 3MD0A 4C5CA 2WTNA 3T35A 2HMWA 4PAQA 4Q34A 3PEEA 1TUIA 4JGBA 4PHFA 5J23A 3NUQA 1A27A 4P0TA 4OLJA 4LXXA 2JGJA 4FCWA 5BWOA 4Z4QA 3JQPA 3E2PA 3W2GA 5KVVA 3T1QA 2OG1A 2JCYA 2X41A 2TYSB 2BKLA 3L7NA 4MV3A 3VUEA 5E1BA 3WLJA 5ECGC 2GSWA 4Z6KA 1X2EA 4MRPA 4HWKA 3L92A 4ON9A 1U9ZA 2E1PA 3DDHA 4HG2A 4MHOA 2GJ8A 1VMDA 3WXMA 4QAQA 1PJQA 3U4GA 2BE9A 3HYNA 3ZGZA 5KKNB 4HMPA 4D5GA 2Y05A 4EY3A 3H6KA 3WLIA 5LB2A 4OX9Y 4JX9A 3G0CA 2GH1A 3SNHA 4GC9A 1Q7CA 2PSSA 3TJMA 1WAMA 4MV1A 4XWYA 3BDVA 4YRJA 1RM4A 1RPTA 4CM6A 1ISJA 3C6MA 3CNHA 4FCCA 3HRKA 2VPIA 1C8LA 3QV2A 4KV7A 1GZHB 4I36A 3ZQKA 1PBTA 3HUTA 3KAJA 4EY6A 5BORA 1SKAA 3FCUB 4FFWA 4I99A 4F46A 2A9FA 3EXIA 2VQ6A 1NZJA 3TRFA 1QR2A 2OZEA 1A8QA 3E81A 2XMCA 3L6RA 4QC2A 5T4BA 1JXMA 1U1EA 2NXWA 3HG7A 1ESNA 4HWTA 2RHOA 2JEYA 3RSGA 1FDWA 2BPOA 2SNIE 2X8JA 3N8IA 2OM6A 4ZAZA 3TAXA 1NT2A 2GPNA 3LD9A 3KNZA 4TYPA 5J4YA 1LS6A 4KDRA 2GK3A 2O7QA 2OV8A 1EB9A 2SKCA 3AF5A 2VHZA 3TLZA 4F9GA 5CXXA 1U04A 2QF7A 3IOEA 3TNYA 2QT0A 4KFRA 1UBGA 3EPRA 5AK0A 3SYKA 1V5EA 1D6JA 3KOZA 3QF4A 1XR3A 3LDFA 4H27A 2NO1A 1NVKA 2VQ3A 5EJGA 2EQBA 1CIJA 4KXXA 4J2HA 4FR2A 3AJ8A 1ACJA 3AF1A 4JDPA 1GV1A 5MN6A 4MOWA 2HJSA 2PLWA 1EGHA 1Z73A 1TMGE 5A71A 1RBMA 2OB1A 2VTEA 4JB2A 4QUDA 2B1QA 1UXIA 4IDFA 3TQRA 3ZHSA 2VP5A 4YRZA 3KP1A 4XDHA 3FI9A 5KYUA 3RDPA 4JBYA 1DTWB 4D3DA 1JR3E 2HLPA 1OZGA 3AF4A 1EJ2A 1DCFA 3F9RA 3HU3A 3RTBA 2RARA 4HVLA 5B7PA 2WYHA 4EPXA 5FTMA 1AZSC 4RXMA 5EFZA 2AKEA 1I2ZA 5C2JB 3ZBUA 4ZGWA 4FQ8A 4DNQA 4RL4A 4ZJYA 3WNDA 2RAFA 4PNHA 3EIUA 4DQKA 4CL0A 4FB4A 1E32A 2FZLA 2BKUA 3DGEC 4FDUA 4HDRA 4BLWA 4QNMA 3W2HA 2QQ0A 4Y9TA 4ZMSA 4ZAYA 4LSGA 2DCMA 4D2IA 1NUPA 1EVQA 4K03A 1EWTA 5JAPA 2H08A 3CR8A 4NG5A 3PHHA 3OX2A 3SHTA 3QKTA 5CCXA 3RYHB 2EJCA 4HGQA 2ZJAA 1RAAA 3BD9A 3KCNA 4AWXA 2PSEA 1DXQA 3IOCA 4RNCA 2QSYA 4YC7A 4Q3KA 2HWWA 4WN9B 3JAKB 3CC8A 1KHHA 1GVNB 4JNKA 1V1RB 2GZ1A 2VF7A 5EXXA 1K66A 1Y5IA 3Q5EA 5CM2Z 1CETA 3E84A 2CFIA 4ZT3A 2PS0A 3DBLB 4IRXA 3BWYA 4OHFA 1WEKA 3CISA 2VP3A 1RC0A 2ZK7A 4N5DA 3R3HA 5BRNA 4C4OA 1XN1A 2C7RA 3R5FA 2FXVA 4Q1BA 2X1HA 4YUAA 4ZV7A 5I5EA 2WE7A 1FFXA 4OVKA 2XHEA 3OQJA 3WMEA 3G9TA 1XJCA 2O2DA 1V26A 2WC1A 3CJTA 3EZLA 2PT9A 3PXXA 5CNJA 3RWBA 4OM7A 5GIPE 1LK7A 1YGPA 1H2WA 5KTRA 1T3LA 5LDHA 1PK8A 1W581 4KW7A 4PSAA 4WCVA 4I9HA 1CZUA 4OYHA 2XD9A 3RRYA 4W5QA 2H57A 1C7EA 1QB8A 1A2QA 1JALA 1N9GA 1WCXA 3JQ9C 1C3JA 3TQIA 1F0PA 1PJAA 1N5IA 1UMBA 3AEKA 4JASB 5I7SA 5KNBD 4FYKA 5LZ7A 1ZDMA 2IWRA 3OESA 2G5GX 4KE8A 4PNPA 1VFNA 4XRGA 4LWPA 1ZK4A 3C3MA 1GR0A 2O14A 4E51A 1GTSA 4NZ9A 1JDPA 4TN1A 3CCFA 1ENZA 2TECE 5JV5A 2AE1A 5ELMA 1SA0A 1XZIA 2P0AA 2X0RA 4ZT2A 4CR8A 3Q3EA 3R3ZA 2C1XA 2OG2A 3HWX1 4OQEA 4YUZA 1E5QA 4K0KB 5I9TA 2FMIA 4NCAA 1NM5C 3P9PA 3PVSA 4GNRA 1X6VA 1YCGA 2V7PA 1Q0QA 1GD1O 4Q02A 5EUBA 1ZK1A 3N6XA 5ARCA 4XTCS 5DASA 2X7XA 1XNQB 3BBPA 1NDQA 3TTXA 4G5HA 3RWOA 1OT5A 1VYHA 2OCYC 3H97A 2P0EA 4IPTA 1FNDA 4DLXA 2R6JA 1QF9A 1EVYA 1AO3A 1GU7A 2B1RA 3A4NA 4BAZA 3CLSD 5MF6A 4PGHA 3B38A 3PCXA 5LN1A 3TOSA 2C04A 1H8HA 2EJVA 4PG5A 2W4QA 1N33B 3ULKA 2OO5A 2PFKA 2V7TA 1J00A 2RDMA 4IMPA 4B31A 2V4UA 1X94A 3AKDA 4GGOA 4TUYB 3K4PA 2F3SA 2WTMA 3B7WA 3LVFO 3UMFA 3DMPA 1J7JA 1D1TA 2NSHA 2A92A 5IM4A 1NX9A 3CLRD 3L1KA 5B1HA 1MO4A 3M81A 5T3YA 4YYZA 3PHBE 3EASA 1ZK0A 2ZRIA 1RP1A 3M6IA 1PGOA 1RLUA 3LYUA 2APJA 2RCNA 4ZRDA 3HSYA 1PKXA 1CC1S 2WF7A 2ZRHA 1JEOA 2X5KO 3IHTA 4LF6B 3Q12A 3M89A 3DBHA 3BIJA 4PSCA 4MUAA 4RABA 2DHDA 3O8BA 1L1QA 1QONA 4A8JA 1W29A 5TB5A 1XLWA 3U6BA 2NACA 5A2QA 5ES4B 1PF7E 3AGQA 2P35A 3IT3A 3H4MA 3NNNA 2IEIA 5EI5A 3VTFA 1SCIA 3S40A 3H6GA 1E5VA 1QH9A 5DM60 1TMKA 2PD6A 5ADHA 3O4IA 3K73O 1GSAA 3NBUA 5K6RA 2FETA 1JPJA 4R8MA 3BILA 3MRTA 1VYTA 4GYKA 3INYA 1Z8DA 2P3LA 3AP2A 3FB4A 1EHCA 4ZO4A 3PFKA 1FJXA 2CLOB 3EG9B 3HKCA 3DE3X 5AHRA 3RARA 4M7WA 1UMDB 3UT5A 5K0BA 2C3UA 4S1TA 1NMYA 4BRSA 2BM1A 3JQGA 2WM9B 4HEJA 4DLPA 3FG9A 3GG9A 3PG5A 3W5AA 1SCUB 3UHFA 2N46A 3DNFA 3KEGA 2PVPA 1SXIA 3M3DA 1GKUB 2VBCA 3AFGA 4O3FA 4UVHA 2VP9A 2FZCA 3OEWA 4M0FA 1CLEA 4GM0A 3KXDA 4IHAA 3WO0A 5IKMA 3VYRB 3KKLA 5F2NA 4G5FA 4LDZA 4Q4HA 2QAGA 3AQ4A 5JAZA 2FDXA 2LGJA 3H4TA 3VKVA 3ZWVA 1AMUA 2CHVA 3HA5A 2WP0A 3FMIA 3L7DA 4Y0VA 2O07A 4D9IA 5HRAA 1O8CA 1Z4PX 4MRMB 4WECA 3UKDA 5KTTA 1N5LA 3DPIA 2PMBA 4TXLA 2HUPA 1AUOA 3L8DA 5HBGA 5CB6A 4QQKA 1OZ0A 2VTVA 2YQZA 1R66A 3KEOA 3OO0A 5SZHB 1OLUB 4J7XA 1HZZA 1P8AA 3DZBA 3RHFA 4YXFA 1RS0A 3LC0A 4OP3A 3L1HA 5JJBA 3MNFA 2XEXA 2FG5A 1BWPA 1J5XA 4FCTA 1AXEA 3C45A 3D8UA 1F4LA 2VDQB 4HDNA 4IAOA 2DWQA 3EEYA 3M6UA 3CX7A 4MO2A 5HJ5A 5DU2A 2P9YA 5HQTA 4N47A 1X2BA 4P9NA 5EEGA 3N7AA 3CVJA 5H59A 1HZJA 2DJIA 2RHGB 3ACCA 3BWCA 1TVMA 2P1ZA 2YJ3A 1SVOA 4RF5A 1DE0A 2B5OA 4M36A 4UU7A 1P6QA 5F35A 4XVUA 3H5IA 4IDBA 3UEOA 2PMDA 3CM0A 3DDWA 1OC4A 5DP1A 3VC3A 2QMHA 4ZP1A 3TQFA 1LRJA 2QUBA 2WRZA 3T4UA 4E5NA 5FDFA 2PZKA 1U2ZA 4ITVA 2I1WA 2C2YA 3W1EA 3LUJA 2XDQB 2Z83A 3I9JA 2O8BB 4TTAA 1I6WA 1QO0D 3K92A 1QV6A 3OT1A 4P82A 2CYBA 3L7LA 3HB7A 1RDFA 4ILKA 3RVLA 4DWOA 4OI2A 4PAGA 1M7HA 2W6ID 4H7PA 4HUQB 5I3CA 1EQAA 5G0TA 4BEWA 3P2IA 4OHKA 3WK8A 5FLEX 4QOFA 1VSTA 5ER6A 4Y9DA 3FZNA 1VCHA 1V35A 1UJ4A 1NQTA 2FEAA 5EWLA 4YUWA 1TM3E 1G8YA 1J56A 1Z29A 2PS9A 3PL5A 3RYCB 1AG9A 5TQ0B 1VIDA 3H0KA 4JJ4A 3UICA 4Y3UA 4AF7A 3PVCA 1G3MA 1VBMA 3C7DB 4ICIA 4OMCA 5CTJA 5DNUA 3DO5A 5L3SA 4HXFB 5T5QA 4LDQA 1ZUNB 3K53A 1RC1A 5ED0A 4QBHA 3ITDA 4QJIA 5IAKA 3MJHA 1PS8A 3NTRA 5G0UA 4XEHA 1YZVA 2ZJ1A 2RH8A 3KL4A 2ZRNA 2XMGA 1FFYA 4HJXA 4PYJA 4NDNE 3IDZA 1RFGE 1TKRA 4LX8A 2YC4C 5JAQA 3C6XA 2W9XA 1H0SA 3JD1A 2UVPB 1UXKA 3F5MA 3TZ6A 5IT4A 4JVNA 3JQAD 5TPWB 1XFDA 1Y9ZA 4ID3A 1X9IA 3FY4A 3JAKA 5KAPA 3T0FA 3TIIA 2X0FA 3KOOA 4G0YA 1PTJC 2YV5A 2R1UA 3TAHA 1ENPA 1EFLA 2CDBA 3ICPA 3PSHA 3ONNA 4IWYA 1DT5A 1IZYA 2RSLA 3KWLA 2ZCUA 1NQ5A 3H9JA 3W79A 1G2OA 3GGSA 1DLJA 3EISA 3RD5A 1SUIA 2DECA 1LLFA 4LRSB 1R5NA 5D6OA 4BGEA 4PPFA 2PM8A 1JIQA 5IDQA 1GZSA 4QPPA 1ZJ5A 2XVZA 2QTGA 4N3NA 5K0TA 3O4JA 1Z33A 5EQJB 4AJIA 1H6BA 2F3PA 2H00A 4HH4A 2JPDA 4A8PA 4DIUA 1DZIA 1A4IA 1RXCA 5HYVA 3DE1X 3FMOB 3KJGA 3RGGA 3UPTA 2ZUEA 1XSEA 1N9GB 4KTVE 2HRCA 4P3XA 4RJTA 5KYYA 1SUEA 3EPKA 1OBOA 2G80A 1SIOA 2BEWA 4KAAA 3A9RA 4MEBA 3VNAA 2IKSA 1QJ4A 4TV9A 5HPYB 1CRPA 4BVJA 4F4IA 1ZRMA 2GCNA 4RPLA 5KJCA 1BIFA 4TWIA 4XJSA 1ZGHA 1HYBA 2QL5A 4PLYA 4UPDA 5EPEA 3RK0A 5EJIA 3UT0A 1UJ2A 1I33A 3TD9A 4RVHA 1XJ5A 4AKEA 2M98A 1E0SA 1L4EA 1NBEA 3GARA 5B3AA 4BFSA 2Q6KA 1J33A 3KYDA 4CKCB 1PR9A 2WWRA 3ADPA 3BA6A 4GL2A 5GAJA 2AD5A 3CO5A 5JU6A 4Q3DA 2ZUVA 4LA4A 1EWRA 2F7SA 2AEJA 1MW8X 5I7UA 1QO7A 3I9LA 3SQNA 3RYIA 3ANXA 1X7GA 4AL4A 2HNAA 2RJNA 2SCUA 2AZ4A 4UREA 2ZXFA 3E9EA 2ZAYA 3CH6A 2I65A 3CJRA 3W8NA 1TEHA 2FUNB 2MWMA 2EKDA 1C7FA 2P5UA 1HFEL 1YQQA 2WSMA 5JQWA 1OWNA 1XVTA 2GM3A 1RWMA 5ALIA 4LOLA 1BDBA 3T1YB 1TK9A 1T9AA 2CKDA 8LDHA 2WDZA 3UAVA 1VGRA 3E82A 3U7QB 4FJ1A 5CW2A 1L4MA 1ZJYA 5JXHA 3OEYA 1XD2A 5DW0A 2BIFA 4MW1A 4IIFA 3SF8A 3UENA 3GN1A 4D4JA 1P33A 1XCGB 1PJ4A 4NU0A 1L5OA 2NO0A 3M1LA 3LHFA 5GZ3A 1OIWA 1F6BA 1TIBA 2JLWA 8MHTA 3RV3A 4Z9BA 1DU4A 1JNXX 1I5RA 4YJ2F 3ZEIA 3LG2A 4E6PA 1E2HA 1PQYA 1SOWA 2QRLA 4N48A 1DFIA 4QASA 1YNSA 2QNRA 3QPCA 2XGOA 1NP6A 1TIPA 4JI5B 2YVLA 1XKTA 2Z5GA 3EGDB 4RHXA 2X1VA 3HZOA 4JP2A 2GKOA 2GT1A 2JFOA 1U1CA 3IKVA 4TROA 1RI1A 2BUBA 4JB8A 4P4SB 2H1RA 2XGMA 1E61A 1KI6B 1QANA 4GC5A 3JQ6A 4RANA 4KTTE 3P0HA 4HL6A 4RZHA 1O95C 2HADA 1P7YA 1GPMA 1SXJC 3IIEA 1VLQA 3GUYA 4BWGA 2E49A 3THXA 4WKCA 3IO5A 1V6SA 1XEFA 2VSXA 3F6RA 3EG9A 3F98A 3HKCB 4PPNA 4ARAA 3OTGA 3DOOA 4BDSA 5CB4A 3MRXA 4OXNA 4MWEA 1UDCA 2JGKA 2GBPA 3IGFA 2OA0A 3KQWA 1HDGO 4HLNA 3PE4A 1NA5A 4JU9A 3RHTA 2WAMA 3L1JA 1BTOA 1UMCB 3FSGD 4G8BA 4S1OA 1OOEA 1FFEA 2GHIA 1SAYA 3RS0A 1RYBA 3WMFA 4Q4HB 4A2WA 1ULSA 1JMKC 2HPVA 3ADOA 2J9FA 2JGAA 4B7UA 3FNRA 3I09A 1W47A 2QL6A 4CVNA 4HZIA 5KYWB 2JCXA 5FV4A 4PIMA 3OCXA 2I34A 3OM8A 7AT1A 4DR5B 3A6GA 3AJRA 3NDBB 2J46A 3EGIA 4ZFNA 4PZDA 4YRQA 4KR9A 1F12A 2Y6UA 3O83A 2WD7B 4NNOA 3EXHA 3RUFA 5A62A 4D3ZA 3FB1A 4MIKA 1CULC 3NHSA 1CUWA 3NC0C 1PZXA 2REBA 2FY8A 3PNSA 1JKXA 2Q3DA 1L7QA 3GEHA 4AS2A 5KYXB 1CS0B 5JATA 4WPGA 1U90A 3U3XA 1DBRA 3T3MB 3KB6A 3IMKA 3QWAA 4FE3A 1GL3A 3UJAA 8AT1A 5AVQA 3E7DA 5K3BA 4F84A 1G66A 3QW4B 5EP1A 2L19A 5TPZD 1U0LA 1A8SA 2ERYA 2VAVA 3INGA 3JD3A 1R00A 1IFXA 1QDLB 2P5SA 1I30A 2QTVA 3NV7A 4NOMA 5IU6A 2TSYB 3CYFA 5KQLA 3A14A 2MMCA 1SG9A 3KPYA 5ALXA 2PH1A 5H0IA 4PRYA 4ER3A 2XAUA 1OU4A 4KQIA 4IH4A 5EXDA 4HUQA 5NULA 4XDYA 4MYHA 5I9MA 1C4WA 2QR5A 3B6EA 4YJ2A 3GCDA 2ZDQA 2HZ7A 1W75A 4CDRA 4OKNA 4P7GA 4LBVA 5BY2A 4RWZA 4AG6A 3ADKA 3WK4A 2BI8A 2Q7XA 4RVCA 4ZPXA 3TVDA 2A1TR 1SZDA 1VMAA 1F8GA 3NRCA 4LDNA 5EN4A 5JNWA 5AM5A 2FW1A 4B87A 4AD8A 4TV8A 1OT3A 1MP0A 2AQIA 2RAPA 2PWZA 1J23A 2ZIFA 3GPCA 3N3BC 4LYYA 4N8SA 1W0KD 1Z5OA 2OOKA 1V16B 4BO8A 1FFDA 3BB4A 2C8LA 3ROQA 3TLYA 2Q6TA 4P4TA 1XPOA 1QH8A 3O3NB 2VWPA 1MFZA 2IFTA 3WDMA 5CT6A 2C57A 4NBNA 3BWBA 3KTOA 2FXIA 4XWTA 1USWA 5DZSA 4CLXA 4IIVA 3C6KA 1X1TA 3ZCVA 5FH9A 3LQQA 3VTAA 1L1EA 3ORRA 5CIYA 1YJBA 4C4TA 1P2BA 2LIVA 4G0PA 4TL7A 5LYJB 3BEOA 5K8VA 1FVHA 3ER6A 3VKUA 1TB4A 1XQ1A 5JMPA 1E69A 2NAFA 1ZI6A 5K99A 2EIHA 1VGQA 1E20A 4WXRA 4Y2HA 1ONSA 3SE0A 3BMQA 3GWGA 3VV3A 2JFPA 3ENNA 1PJRA 3AMVA 1KWGA 1NJ2A 1U2TA 3UWMA 5I9SA 1ECBA 3LT1A 1UMDA 4B7XA 3P5SA 4RIIA 4JLAA 3Q2OA 3QVGA 4ZXPA 5BVHB 4YDSA 2JATA 3FCCA 3QX3A 2FMTA 2DBZA 2C2XA 2G3YA 3M0EA 1A88A 5ARDA 4EG6A 4ERXA 2FN9A 1Q3KA 1SVNA 2VLIA 3K30A 4L02A 1EIWA 3TRHA 1JFLA 4NBUA 3TZHA 4BU0A 4JH0A 4QTUB 2G0NA 3BHIA 3LSTA 4EECA 5LQCA 4KK3A 3ORQA 2ZXUA 1G41A 5IDVA 3GNQA 3NTLA 1YO6A 3OA0A 3OBBA 4PO9A 4WFKA 1BN6A 1MR3F 3EMDA 5JVDB 3SXUB 3TLCA 3BD6A 1UJ5A 3GW8A 2DPGA 3DE0X 1QIMA 1UPCA 2EC5A 4KQXA 4UMVA 3H42B 4M0KA 3C24A 3PQEA 2J3QA 3B5IA 2DLDA 4TRNA 4DMFA 3QEMA 1P2DA 3H2ZA 2YJZA 2QVLA 2AFIE 3IAXA 3SBXA 1B43A 5A1JA 5IG2A 1ULTA 1R9NA 1ZM4A 4L7QA 4YBZA 4EI9A 3TQOA 4J43A 4LZLA 1NULA 5JAHA 2IHZA 5FJIA 1NXXA 2F8MA 4RORA 1K88A 1H0HA 2FUKA 3LK7A 4RJLA 4DFDA 1IQ0A 4ISBA 3U5TA 1Z2OX 1E9AA 5F4BA 3ASVA 3ZQJA 1FNMA 2WOOA 1JLSA 4XGIA 5F23A 4LV6A 2NQ8A 1ODKA 2BBOA 3FGZA 2DFPA 2HCFA 1HQKA 4YK7A 3BK7A 5DEOA 3T3DA 3RRNA 1WJGA 3E18A 1M5RA 4BO6A 1JNYA 4DSZA 1XXHE 2Q4OA 1DADA 1LF0A 2J32A 3EZXA 3ZW7A 1WOYA 2WIFA 4JDUA 2O4CA 3K0FB 3ML1A 1A4RA 1BHO1 2O2GA 1V1MB 1EJ0A 2AG1A 3HWWA 4X6LA 1JI0A 5E3IA 2CNWA 4MS4B 1GRVA 3N3AC 3W2IA 1D7AA 4YMSA 2VDUE 4ZKEA 1XKLA 2QTAA 1K63A 5D8DA 5HZMA 3IVCA 1G9TA 1F2DA 2H59A 2WW8A 3GJZA 5AICA 4DNPA 3PXAA 4D98A 1CUSA 1E92A 4IUYA 5I51A 1P1HA 3GRAA 4X85A 4DDVA 3FH0A 2G5PA 2JIPA 1OI3A 3RVOA 3RC7A 3F78A 4CR6A 5ITVA 4GWKA 2NG1A 3EAGA 3RHSA 3ESBA 4JBXA 1H5NA 3KYBA 3QLUC 4JL5A 4CQNA 3H3JA 3KVOA 4RXUA 1ZNXA 2ECOA 2QT9A 3D02A 4IEFB 5LQKA 5LIRA 3NHKA 2A0WA 3ET5A 4H7HA 4QFCA 2XXAA 1ZW1A 2ZBUA 5FBLB 3SC2A 5AVRA 2BUAA 1WF3A 1SG6A 2W6ZA 2RHMA 3K9HA 3OLYA 1QYWA 1ZSNA 3A25A 2KBFA 3ZNOA 4L9RA 4PE5B 5DI3B 4IOJA 3RBVA 4LMAA 2WLTA 2VZ9A 1U5CA 1UJNA 2J7KA 1WR8A 4YXWD 1NSYA 3AKYA 4AJHA 4ZCQA 3FVRA 2V59A 1S02A 1Q7EA 2CNBA 4E46A 4ZJUA 1HQCA 3K0EA 1T36A 821PA 3CUKA 1Y3HA 3PC6A 3ZJ5A 3UPUA 4I14A 2XCUA 4TTRA 3U7IA 1NAIA 1TZMA 3LECA 4II3A 5C8DA 3OLZA 4GUAA 2ZT7A 2WJIA 4PS1A 3MJCA 3QIAA 2J30A 4M2LA 3IAAA 2P2NA 3NIFB 4UC0A 1NU6A 2XYVA 5KNCH 3DOHA 2FPIB 2PGXA 3FUCA 5JDCC 2VK4A 4NVRA 3TWOA 3V4FA 4JLSA 4KHZA 4P1ZA 4B4DA 3FRIA 2VPZA 1PGQA 1ORDA 1TO2E 2QMUA 3EUFA 2QZPA 3KSMA 3ONEA 4IXDA 3TSAA 3KYDB 4CKCA 4YP9A 4W99A 4QYXA 4AM8A 3I6YA 1YZHA 4RV4A 1EE1A 4H4EA 3WB0A 5KU1A 5JO0A 4WKBA 4G23A 3VVCA 2OZVA 5EHNA 2IOHA 3R7BA 2IT1A 4BC0A 2IGBA 3FPBA 2IX9A 1G0NA 4V24A 4CM4B 3UFXA 1DBVO 2OEPA 3RS4A 1XZDA 1ZEJA 2VQEB 5LNK1 4E21A 5ALFA 2O8EA 1M6YA 4BL5A 4V3CA 2WFMA 5EIFA 3QXJA 1WXWA 3EFBA 4ZYUA 4YT4A 3HSSA 1GNVA 4RA9B 3QG5A 1FPMA 1LFAA 1NQWA 1SCDA 4F21A 1ANKA 5ILOA 3QPVA 4X93A 1J8MF 2QYTA 3EOAI 2EW1A 3OU6A 3HJFA 4GOJA 2A5JA 4M6WB 3AR2A 4AXXA 5DIFA 3KJEA 5JY6A 1XD2B 1J6UA 4GPBA 1NMQA 4M88A 1OX5A 2W8BB 3OLCX 4O4JF 3OPNA 2FPKA 4RWEA 5EYPB 1SNYA 2EV9A 2G1AA 4G5YA 2PL3A 3GZNB 4WLFA 1AM4D 2WF6A 1RJEA 2NU6B 3LLMA 1P9LA 4MVJG 3WQQA 2XJ9A 2JFUA 4K2HA 1GQQA 3K0BA 4W6QA 1WU7A 1T2EA 1WB4A 2AV6A 3BRCA 3DULA 3QF7A 4RDIA 1TEZA 4Q4AB 3ICVA 5B4VA 3USES 5BV2P 2FHSA 4X7RA 4MUHA 2D0DA 3UGKA 4ZI7B 1TJ5A 1H2RS 2B34A 1ST2A 2CXXA 3GZJA 1BS1A 2RG7A 3IKMB 3NHRA 3QTTA 3SLKA 3AB3A 3AR3A 4NJMA 5IS2A 4MGEA 4UEWA 3TVYA 4RPGA 4O1HA 2PZEA 5CK5A 2UKDA 1Y6JA 3ASUA 3IURA 4DIFA 1G8JA 2NLOA 4NONA 4DLNA 7ADHA 5L4SA 1D2RA 5AXAA 3N6VA 3O8QA 2J9GA 2IW1A 1NN3A 1GT91 4ZVNA 4WJLA 1IOZA 4J8PA 4XUDA 2V7BA 1KRXA 2H51A 3JQCA 4PHCA 3TUIC 2O1SA 1JKFA 4LOKA 4OOEA 5BV7A 4JHLA 3TSCA 4C04A 1SZCA 1Q74A 1I4OA 4G81A 3R0VA 1GCIA 2ETVA 2QXYA 5IBPA 5JCJD 1JXOA 1MQ8B