5D51S

Krypton derivatization of an o2-tolerant membrane-bound [nife] hydrogenase reveals a hydrophobic gas tunnel network
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
264
structure length
264
Chain Sequence
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uptake hydrogenase large subunit
publication title Krypton Derivatization of an O2 -Tolerant Membrane-Bound [NiFe] Hydrogenase Reveals a Hydrophobic Tunnel Network for Gas Transport.
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Oxidoreductase
total genus 77
structure length 264
sequence length 264
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5d51S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5d51S02
1UBTS 4U9HS 4UPVA 3ZE9A 5D51S 5JSUA 5A4IS 4UD6A 4UCWA 4CI0B 1YRQA 2WPNA 4UQLA 4UE3S 4UE6A 3USES 1WUJS 4KL8S 3USCS 5A4MS 1H2RS 1UBKS 3UQYS 1WUIS 3ZE7A 4UPEA 4IUBS 1H2AS 1FRFS 4URHA 5JRDS 3ZEAA 3CURA 4KO1S 5JSKA 1YQ9A 4KN9S 1UBHS 3ZE6A 5A4FS 3RGWS 5ADUS 4IUDS 1UBLS 4UCQA 3H3XA 3AYXB 4UCXA 1UBMS 4IUCS 5JSYA 1UBJS 1FRVA 4KO3S 1CC1S 1UBOS 1UBRS 4TTTS 4KO4S 4U9IS 2FRVA 1WUKS 1WULS 4UE2A 5JT1A 4UEWA 4GD3Q 4UQPA 3ZE8A 5JSHA 1E3DA 1UBUS 4KO2S 1YQWA 4OMFG 4UD2A 4UEQA 3CUSA 1WUHS 3AYZB 4C3OB 3MYRA
chains in the Genus database with same CATH superfamily
3DFUA 3QVGB 1Q1NA 3NEYA 1W88B 1A5ZA 3MWDB 5IEJA 1OBCA 2OSVA 2W83A 4NQRA 5CA0A 1N0VC 1PO7A 5KB3A 2UXBB 4MX8A 2C0PA 3ZDYB 1AUOA 4YCDA 1OX4A 1YR9A 4B31A 1C4XA 1ZCFA 2FYTA 3TLEA 4ZV9A 3IO3A 2WB4A 1FU4A 3Q5DA 2RG1A 4LBWA 2AYZA 3STTA 5IJ0B 2WYVA 4P4UA 4RV9A 4HTAA 1BNCA 4FCTA 1UMCB 2HHJA 4CCWA 2WWRA 3QU2A 1PEDA 5TMPA 2RGEA 1DJMA 4XZ3A 2ZYVX 2OCYC 3D3WA 5ILQA 3DLPX 1LFDB 1XE3A 2XR1A 3TE6A 4DBLC 1FYEA 3DUFB 4GECA 5JRDS 3EW9A 3F7NA 4FHGA 4BB5A 3E1GA 1YIAA 3LBHA 1MAVA 2AHRA 4XE5A 5KNDD 3SX4A 4V2IA 2I6FA 3F3MA 3AF6A 5FUMA 3LYHA 4ADSG 3ND5A 1E9BA 4FYJA 1WA5A 1IHUA 3B6ZA 4OL0A 5EVJA 4GBGA 4QAJA 2IUEA 1JAXA 4EJ2A 4NLLA 1MPXA 3ZHRA 5CFRA 1D2NA 3ZW8A 1LU9A 3D2AA 3CZ5A 4M6WB 5F3DA 5K8CA 4CVNA 3I73A 4EH1A 1JR2A 3B7PA 5L51A 3BFVA 2H57A 5K8VA 5DNAA 2C7GA 2O2GA 1N4DA 4BCDA 1H9BA 5E7MA 1BA2A 1EXNA 4ZCPA 2EX0A 3OJEA 5BXYA 5E2AA 3QNWA 3W3AA 3DMHA 5JIBA 1T9GS 1ZO8A 3RAEC 1J07A 3NALA 3OCUA 4CL2A 2EFGA 4X8OA 2PZEA 1L7XA 2PBLA 3LXUX 3UT5B 1NI4A 3ZU6A 5ICMA 3EDOA 2NTYC 4ENRA 1SKYE 3OJXA 5CLJA 3PEYA 5IKEA 1U2QA 4JUCA 5HMLA 2BTQB 2O54A 3AUUA 4DMHA 4BJHB 4CKCA 4E2WA 2OKGA 3AMVA 4FYXA 4G9GA 3U6KA 2X76A 1FFGA 2OBNA 3T34A 4JDUA 1FRNA 3TLYA 1GJRA 1GNRA 4M9SA 1NYRA 2FRVA 3PT9A 5AR1A 1EE9A 5LB4A 3VZSA 1THTA 2IIBA 4ICIA 2B25A 4L9AA 1EJ2A 1NAHA 2ZQ5A 4FPXA 4D9BA 2ZRLA 4D9MA 4L2IB 4OATA 1DTEA 1B3BA 4XLZA 3RSHA 1KJQA 3TNDA 2D3WA 2WJJA 4B83A 2GKGA 1WD5A 1T5LA 2HF2A 1XCJA 1DLIA 2JK0A 5CYPA 3KOMA 5KIAA 1QRDA 2OAQ1 1A0OA 2H5LA 2R65A 1Q1AA 3BD8A 3EB9A 2HIGA 4IRMA 1SBHA 4N3NA 2HSJA 4Q9IA 3OLZA 1B0PA 3PPIA 2QRMA 4P53A 3I9NA 1V8FA 4QTXA 1NC1A 1IOVA 1OZGA 3UZUA 2EJVA 1E9SA 2ZI3A 2BDUA 3OFVA 4QUAA 4CPDA 3IE1A 2Z1DA 4KFRA 1JYFA 3ROXA 1DWUA 2XWPA 3II6X 4CDNA 3ZDXB 1PG0A 2HA2A 5DE3A 4NFLA 3FPBA 4EB0A 1CUYA 1ULZA 2QTGA 4G5QA 2J6BA 3UYKA 3V4SA 1JNYA 1ULAA 1ZJZA 2VEDA 1M72A 3DW1X 1M2VA 2OO7A 1DOZA 2WSMA 3KD3A 5EJ5A 1ZD3A 3NATA 3PI7A 4MUAA 1LWNA 4M1MA 4U5QA 4BASA 4DIMA 3N2YA 1ELOA 5KTNA 4KXYA 3VSDA 4TZTA 4DM3A 1G7CA 4DSTA 1NXTA 2CSUA 2P9EA 3BYZA 1WVMA 1MKYA 2X1MA 3HEMA 3M6MD 1ICIA 4PQYA 3TQRA 3VU3A 3VR6H 2DFVA 2A5GA 3AHHA 3BMCA 2AUMA 2P8JA 1Z16A 2HZBA 4C06A 1PS0A 4MQFA 4B6GA 3DLBA 3ZY6A 3ZCSA 4IMPA 4FD3A 3I5YA 1HZJA 3F7MA 2AKAB 1XVUA 3AERB 2CJWB 4NHEA 1I33A 2WUGA 4EMTA 2ANCA 4LBYA 5BRAA 4X45A 1UIMA 3KSMA 2FSIA 3OLYA 2ESRA 4BFWA 4XYEA 4BP3A 4EQ6A 5L7TA 5JO0A 3ZHTA 4BMVA 3RIXA 2FDXA 4GR4A 2Y0BA 4MVJP 1MH1A 1E9RA 5CBPB 2UUPA 4M9XA 3HYTA 3A32A 1T10A 3IDOA 4CMHA 3LFUA 4LHXA 1LRLA 2XMDA 1Q0QA 3QXJA 2XMBA 3K9BA 3DTTA 1KYXA 2I7TA 1C1XB 1OA1A 4XDGA 4XIIA 3QLJA 5DXFA 2YJ3A 4W9NA 4CM3A 4DQVA 3AIKA 5JEEA 2YV3A 3WLFA 4AJEA 4X41A 1IN5A 1M0SA 5CDHA 2B99A 4Z4CA 2QOEA 1QP0A 1QTIA 1VJ0A 5C37A 4CETA 4JJ8A 3KETA 1JGTA 1XNGA 4LY6A 1JG7A 4YVFA 3FBWA 1PR1A 5K3SA 3TTYA 3LCMA 3EIWA 5ELXA 1Q83A 1AS0A 5C2JB 1I5OA 3U7EB 2EJTA 1U11A 2GAOA 2X2PA 3NJ8A 1BHO1 1GTMA 3TGPA 5EKTA 1L6IA 2LNDA 4GGMX 5BSRA 2WSSD 1NUAA 2LDXA 2CUZA 1HT1E 1GAQA 3EZXA 1V4VA 3NVMB 3OPQA 4U2KA 1P4AA 3E4DA 4QE3A 5FYDA 2JIMA 3D6FA 5T6MA 3TVDA 4CMBA 5LXTB 1GU0A 4B3GA 3HCAA 2YHAA 2CDBA 1H6DA 4AWXA 5K03A 1KIAA 5GGYA 1HI9A 2QD1A 1T2NA 1YUNA 4RY2A 3THSA 4DS3A 1KGSA 2X19A 2P1RA 1KH3A 4IIFA 3FOEC 1HQDA 3LVFO 5K4AA 1QGUA 1YRAA 4C7OA 4A92A 3ESQA 1F6BA 2ODWA 3CPSA 4G09A 5K2OA 1QNFA 4MH0R 1MABB 2HWKA 4ZOCA 3MJEA 4WAUA 2A35A 2X4LA 4MUGA 1ILWA 2IDMA 4JI1B 1G4AE 5L3QB 4EGSA 5I8ZA 1DKLA 4UU8A 5ECGC 4OVKA 2J3JA 4JI7B 1DAOA 1P7VA 1QV9A 2NZXA 1VJTA 4J6FA 1F5SA 4DG5A 3AOEA 2CN1A 4C4AA 3KT3A 2J0QA 3E5MA 4G0YA 2FY8A 2W2OA 4B4DA 4ENTA 2OORA 1XU7A 3OAAA 2DCUA 3STVA 4J0IA 2DBRA 1WDTA 3CLRC 2M2IA 2OUIA 1FP1D 1CQIA 4FNMA 3L01A 2AD1A 1ZIDA 3RSLA 1FFCA 1WCIA 1HFEL 1YULA 1Z74A 3TQCA 2GM9A 4BE9A 3OIWA 2Q3LA 3PUKA 4HHEA 3P2IA 2PKQP 4HNGA 4IWNA 3PXXA 1QIEA 5GOTA 4ZOQI 1JHDA 3MFQA 1S0UA 4F92B 4JYZA 1MB0A 1UZNA 2ARKA 3LX6A 4MW2A 5KNCA 1B76A 2WM2A 4EIWA 3U9TA 2HU7A 3PNKA 5HIAA 3V4RA 1G9TA 1T9BA 5CIWA 1KI6A 1X7XB 3F49S 4Z7OB 2ZIEA 4NULA 1ZAYA 3ER6A 2GN6A 1GKYA 2OHHA 2Z0MA 3IQGX 3JYPA 1UMDA 5C4MA 4KTVE 3AESA 5DM4A 5KTOA 4E5MA 4ZQEA 4GL2A 3OZGA 6ADHA 4BWVA 5J47A 1RJFA 4D44A 3CV3A 4K1LA 1R00A 3HUEA 2J3IA 3DR5A 3PFCA 1R88A 4U6NA 3EQ7A 3VVMA 3AQIA 3RB8A 5EKXA 3CO0S 3FYUB 2XB4A 4OBBA 2CKMA 2HU5A 3QF4A 2P9ZA 4K6HA 1E0KA 1L7QA 2PQ2A 4P7FA 4NQZA 3KWJA 4LZNA 2D54A 3WMWA 3W2FA 3LWNA 3R7DA 4QLBA 3OG9A 2FKNA 5ARCA 5LU9A 1IUNA 1TEXA 2V59A 1GNSA 4NVRA 2VRBA 4C7BA 4OHWA 4YT2A 5AHOA 5A62A 4RF2A 4OQDA 2J3EA 3WBJA 3KFVA 4QYXA 3TDMA 1SZJG 2XYRA 4NEQA 1AF7A 4HNAB 1V96A 1G66A 1PVVA 2IDKA 3IHLA 4CLHA 2JCXA 3Q3IA 1ZAKA 4RZUA 2O0JA 3PHJA 3D3WB 4G9BA 2C0QA 1U2DC 4IIHA 4NCHA 3VC7A 3WWDA 1EDOA 4ZZ0A 2FSFA 3MC1A 3GXOA 1AXRA 4YAFA 4B9EA 1DUSA 1MMFB 1R5NA 2ZSUA 1N0WA 3B1JA 1EXDA 1SXJC 2ECOA 4BE4A 5FDFA 5GONB 2IYXA 1AKVA 5JD4A 3H9JA 3TJMA 2I76A 1B6SA 3TQTA 5INTA 2WU8A 4HS4A 4H6XA 5G3YA 4BUZA 1GQYA 5JAOA 4HLCA 1MC8A 1PF7E 4D8XA 4ZJYA 1KBOA 3RTAA 1LBIA 3MCVA 1HMPA 3FVVA 3SR3A 4D8WA 1YQEA 2ZE5A 1FFEA 1QBKC 2J0VA 1L5MA 4R1OA 2ZRJA 3SQDA 3PJFA 4NG5A 1T0IA 4TMTA 3WQSB 1DRWA 1YIDA 4R41A 3H4IA 2ENUA 2ZWAA 1Y3HA 3A6KA 3HWRA 5HKLA 1PG5A 1RHMA 1AGXA 4XTRA 4REQB 2NUBA 3C5VA 4DARA 3HWWA 5KOIA 2H08A 2CV1A 1R9NA 5H1YA 4BNDB 5HOQA 1EA7A 4LCEA 4ZVKA 5CGZA 1CFJA 1QS0B 3MCTA 5B55A 3F46A 2AJBA 2JCYA 3B1VA 4CKCB 4G1MB 2GPYA 1VTKA 4QU9A 4Z9YA 1FS4A 2NUAB 3JQ9A 4QYMA 3NM5A 4YRMA 1QONA 3CLTD 4IOLA 3RFXA 3ZI4A 2WR8A 2HBRA 4TLCA 1AUVA 5FOUA 4MV3A 5P8WA 1XZ8A 2VA8A 4QBKA 2IHTA 1XAJA 4BTVA 5AICA 4QOEA 4F3YA 4HAUA 5CH5A 4X6UA 1IUPA 5M7EA 1N2IA 2X0NA 2I87A 3SWWA 1L4NA 3E27A 2DB3A 5IKXA 2ACEA 1NVBA 3Q7SA 2H2WA 1E94E 3A3OA 4LSGA 6YASA 3AVXA 1SVIA 3Q3JB 1UZAA 2GZ3A 4JR0A 1Y5IA 4EWLA 3UJPA 1RZUA 3FSGA 1QIIA 1FYVA 1Z29A 2H2HA 1OAOA 3QVLA 2FP4A 3ZDRA 4I14A 2VZLA 1SR8A 4J9UE 4UE3S 5JSZA 1WMSA 2AK2A 3O94A 1C3XA 2IOQA 1BJTA 4GYKA 4I4IA 4QD3A 3W6OA 4TT8A 1R6UA 1Q12A 2PWPA 4JT2A 4P3PA 3PI6A 3CNLA 1N0IA 3R5HA 1N6IA 2VSFA 3BDVA 4BNJA 2B8JA 2XNSA 5AHKA 3ST7A 4XIGS 7REQB 3WRVA 1PDVA 2OESA 1DFHA 4B75A 1TZKA 2QD2A 1NN5A 3SBOA 1BMTA 1XELA 4F97A 5I7VA 2LUOA 4DBLE 3BMOB 3E8MA 2V0CA 4MQEA 1FP4A 1H8ED 1Z6GA 3RIGA 1SQ0A 3ZZNA 5GMOA 4Q00A 5F3WB 3VPBA 4PSVA 5C8XA 1BHQ1 1JFFA 1W85B 2GXSA 3INNA 4NYJR 4QTUB 4F3RA 1NSTA 1BYUA 1WS6A 1I1NA 1XEAA 3JQDA 3ITEA 3QFHA 4R2JA 2PA3A 1XVTA 1TM1E 4WLNA 1PW5A 5ALQA 4K86A 4DCTA 3F8WA 1EUCA 1DVRA 5GM2A 2R86A 4PY2A 4ZU3A 1L4KA 4XVUA 5SZHB 1WXGA 5G1PA 4DNPA 1VBNA 3A4MA 4IHJB 3WY9A 1Z9BA 5AVXA 1SHKA 3PNOA 4BNLA 2XSZA 1VHDA 2DOKA 4RF3A 4JIGA 3KYDA 2W6CX 3TXAA 4E5PA 1IBLB 3I9JA 3QNMA 3K9QO 5E8RA 5BWMA 3VO8A 4QOGA 1CS4C 3S7TA 3QI7A 1OX6A 3NPAA 3LKDA 3O93A 1G8PA 2B3DA 1Z5UA 4FEAA 1BXRB 2EC5A 2MJLA 2E89A 4DUGA 4BQEA 1SCNE 4OHVA 3UV7A 2LV8A 1Z6TA 1VL8A 3DGEC 4RXTA 3HHEA 2WG1A 3OE7A 5EZYB 1Z17A 3WLPA 2O8DB 5LYJF 4ZOBA 3S7ZA 1OTYA 2BHNA 5A1JA 1TZBA 3EPKA 1O6CA 4XR4A 4L16A 2C7QA 2Q1TA 2DR2A 1ZNWA 3FVWA 5EHZA 4M0LA 2IBTA 5B6IA 1CERA 4UUNA 3DLAA 3GQBB 3VHQA 1QYWA 4O2LA 3O8OB 4WA8A 3GFQA 2NVBA 2W6ID 5JS6A 3R9XB 1NQOA 1BMFA 2CF6A 2NYRA 3AXSA 2VF5X 2QL5A 4B34A 3EG9A 4YPVA 1U7UA 3AEZA 2V55B 3CW8X 1WSBA 5CP8A 2ZIVB 4Q19A 3KKMA 3WLTA 5KYXA 3PV0A 4FGLA 3H7IA 4OU5A 3NHSA 1HY3A 3TQSA 1TTPB 3ZWWA 4B6JA 5LP1A 3BJRA 3CWQA 4OP3A 3L1JA 1G3QA 5FI0B 1KKLA 2A59A 3HV2A 5H16A 1MOZA 2P4HX 2ZRQA 3S99A 2QTFA 3AG5A 4RO0A 2PGIA 3VI4B 3C98A 2HYIC 4U02A 4OIMA 4X1KB 1P7YA 4ETNA 1ND5A 4B2PA 2Q4EA 3H0EA 4ZVPA 1E8NA 5SY6A 2G71A 2NP6A 4N65A 2PUTA 3SDBA 4MLDA 1C1DB 3CZAA 4R05A 2F17A 4CM8A 5LQDA 1ORRA 5FT9A 1CJMA 3GB9A 2FLKA 1DSSG 3LUDA 3I12A 4RE6A 4ZMRA 4PG5A 4HQFA 1KJYA 3AEQB 2O3SA 3S8EA 2PX2A 3BL5A 1ZH2A 3NTUA 4KUHA 4UAGA 4CCSA 3K0FB 3U44A 2P77A 2XCIA 1K1EA 2WKRA 3I6IA 2Q50A 3PNVA 1Y7HA 3UJCA 1Z08A 1RJDA 4EHFA 2CEKA 2V5UA 1GFWA 4UUMA 1JYSA 3K1YA 4UHBA 3TIIA 1U1DA 1QZTA 3EDYA 4U7HA 1K8YB 1T4DA 3D8TA 1LK0A 1W87A 1R66A 5CM9C 1SVNA 2JI9A 3RC1A 3U3XA 5JI2E 3T1OA 1PHPA 3K73O 3PE4A 2Y67A 4O3FA 3P0EA 4XXHA 5EIXA 1F38A 4HX2A 2A9QA 4V3BA 3A6PC 3B82A 4LF7B 2XY4A 2G70A 2MINB 5JBQA 1DG3A 4W9RA 4UTZA 1FTNA 5H68A 5LUAA 1NQ5A 1FW8A 3H6HA 3KUUA 3W05A 5K0JA 2G4CA 2W93A 4HGNA 4MWSA 2AXQA 2AMVA 3DNMA 2WFMA 3M4XA 3QF4B 4BAGA 4B3FX 4K28A 3VPFA 3IL2A 7AT1A 1EJ6A 1U9ZA 3ORRA 4G1UC 3ZXYA 4OI0A 1PNRA 2IEGA 3MQFA 2C9ZA 2Y1KA 1DT5A 1YO6A 3MTJA 4JA2A 4KGDA 3W5BA 3AF2A 5WRFA 3IAS6 1B8PA 1OIWA 2KM1A 1D0SA 3MAGA 4D25A 3LF1A 1SKQA 3LT4A 5TNXA 4WCFB 1GDDA 3C3YA 3D4LA 2V0NA 3IOEA 4CEHB 1PYOA 2IYLD 2ERYA 3S68A 1I4WA 1OE0A 3JALA 1UBCA 1TMOA 2AE1A 1FLAA 1UBOS 2PXHA 4LZZA 3AM5A 5E3HA 4E7OA 3IA7A 4IDEA 2P35A 3GG9A 5JZ9A 1VZ3A 4CU5A 5KNDH 5AUOB 1UJ4A 1AT1A 3RC2A 3GLHE 3I8XA 3JD4A 1IN1A 4Q4JA 4W82A 1OBFO 4GOJA 4HLUC 2JLWA 3TLBA 2GEJA 1FDTA 4CGZA 4TXMA 3VO9A 4EO4A 4MUHA 2YCBA 1I7PA 4QOFA 5CD1A 3A3PA 4DUPA 1QSGA 1PUJA 1I13A 1RPAA 4EX7A 5EXEA 2I2DA 1TM5E 1FU7A 2Y77A 4MTCA 4F8EA 1F8YA 1NVDA 3MBKA 5ENZA 1GAJA 4IDAA 3U0BA 4F06A 3SYLA 3HB1A 1T2VA 5ALOA 3NAMA 1GGHA 4QREA 3WNCA 4OB8A 1K5DA 1QIHA 1SRRA 4RLFA 2AN5A 1C30B 2KB0A 3RDPA 1KEZA 3F73A 1TRHA 1RWPA 3FN4A 1T24A 2VLBA 1N5LA 2PJRA 4RKRA 5H02A 5KWJA 3RWOA 3AKZA 2WIDA 1R0LA 2XUFA 3G2HA 3U4GA 2AQIA 5HCUA 2AF3C 5K6AC 3GCGA 3SMVA 4OH1A 4MEAA 5LOVB 5KTTA 4MKXA 2BR3A 2AG8A 3CNOA 3RVJA 4O2AF 1ZICA 3QOFA 3ORSA 2DUJA 5IJZA 1QQAA 2GN8A 2XX3A 1QK4A 3MS7A 5FBRB 2BHSA 2OV2A 2V45A 1YI1A 3IUNA 3GEBA 1GHTA 3KHSA 3QQPA 5FUVA 4DIOA 1NW3A 4ZZ3A 1ID1A 5B1EA 2CXNA 1KQGA 1G21B 5ISMA 1L5LA 2ZR0A 1GSAA 3IALA 4ZVNA 3ETGA 1SU6A 1I2CA 1W19A 1QORA 3QE2A 4HZIA 2X4DA 3EFOA 3AL3A 1F8GA 1W4ZA 1C1HA 3L5OA 3V7NA 4UU1A 3K8YA 5CVCA 3OX4A 1DMSA 1VE3A 4JC8A 5AKHA 2D0OB 4BNNA 4ZHQB 4KREA 1ATIA 3LUFA 2HJ9A 1GZ7A 2J8ZA 3FYSA 3IPLA 4H2DA 5TMEA 5ES4B 4HNVA 3IH5A 3O4JA 4PGFA 2GJ4A 4LJLA 1KSGA 1LQUA 4I4TB 4JENA 3UQZA 4MCIA 2V1XA 3CZRA 1ZUIA 2P9GA 3R44A 1JU4A 3HP4A 3T38A 5AVSA 2A86A 2Y3IA 1H2ZA 5ALZA 1NVKA 3CCCA 1W44A 4G56A 3OT1B 5E2IA 2OAGA 4JL6A 1KYIA 1SXHA 1E9AA 3VH2A 1JDBB 3N0WA 2ZUFA 1VA4A 4JGIA 4KYTA 4IJWA 5J4HA 4BV3A 1GA4A 4D9IA 4ONEA 2B5WA 3R4VA 1YQQA 1T36A 2AUNA 2FN4A 4H6VA 4Q3EA 3JRXA 1UT6A 1E3IA 1SQFA 2QK4A 3IP5A 4YRJA 1Q7EA 4DMRA 5KOJB 1KMMA 1SXJE 1IJKA 1VHTA 1JFFB 5EQDA 3SPXA 3U48A 5CITA 3OWOA 5KPJA 4KLCA 1JHZA 1PLKA 1XZEA 3WWOA 1N25A 4G1VA 4CN9A 2ZB7A 3HZHA 3P96A 4FHCA 5IAKA 4DRYA 4E14A 3EVCA 2I2AA 4XAQA 4BZPA 1UC4B 3ONDA 1O7JA 1T6ZA 4GGPA 1LX6A 4LHYA 4R3NA 4XFKA 1M6HA 5L6MB 3ZV3A 1KOJA 4D9JA 4EGAA 1MOSA 1OT5A 4F38A 3HI4A 4YRDA 3CLKA 2A0UA 4RY9A 4U4AA 4BX2A 1FY2A 1GZHB 3KAKA 4FYWA 3KYDB 1D6JA 2WKPA 2LBPA 4WY5A 3T1TA 3H97A 4LC0A 3FWHA 2B1GA 4L22A 1GPAA 3T7AA 4DN6A 4E70A 2PT5A 1WKCA 3C7DB 4AC9A 4AY5A 5AFSA 3HR7A 2ZDHA 2VEOA 4EPXA 4Z9FA 1QFYA 1KS9A 4UOEA 4Z3OA 1PGOA 3ZVRA 3HK2A 4B80A 3A36A 3SZUA 5IKOA 5MHTA 1YC2A 2NNWB 2CFRA 3IUYA 1BGWA 3UVEA 4DR1B 1C81A 4AW9A 4Z53A 1X6VA 4IH1A 1E8MA 3HYSA 1UIRA 1BEEA 1AQLA 2OYSA 1ZK0A 1XDZA 1Z13A 3H2KA 4C2TA 4LF8B 1QPBA 3ENQA 1P9NA 3FUCA 3O73A 4YK7A 2P2DA 5D86A 3N9IA 2IXGA 2P3SA 3E2MA 3NOXA 4N6OA 1I8TA 1NXSA 2IDZA 3OX1A 1WUHS 3CNBA 2A2ZA 3CXRA 4IDCA 3NUGA 1GPH1 3GOQA 1ZOPA 3RRMA 4L8YA 5THQA 3W79A 1VC2A 5C8ZA 1QC5B 2A14A 4DR4B 2WMNB 1D4AA 2ZIAA 3QX7A 3DDWA 4FP9A 1KAOA 1NN1A 4J49A 4QXMA 4D1YA 4Z6KA 3IP9A 1SD5A 2CWWA 3QV2A 4ZYZA 1VDZA 3EEFA 3IGFA 1NXQA 2CMDA 5E7QA 4BKRA 4RPLA 2PUAA 2CFIA 4EGJA 4DWJA 3Q0EA 2C04A 2JLRA 1GUBA 2WHYA 4LNUA 1GO2A 1LPOA 1NLFA 2AJCA 2XAAA 2D8MA 2JI7A 4LX8A 4EKNB 1OZFA 3HADA 1B2LA 1P4JA 5HUQA 5JJBA 1PW7A 3DVSX 1M75A 4AZWA 4MW5A 5DW3A 2VHCA 3WSVA 2C8JA 2R8ZA 3DZDA 1TIBA 2EFYA 3OX3A 4P7BA 5EMJA 4IFEA 4KBFA 5BY2A 1W0JD 4R6WA 4XCVA 1SVMA 1IIBA 2PU7A 2O1SA 3SEQA 1NOJA 4ZDKA 1QDEA 5E3JA 2EF0A 5JLJA 3G0HA 1JQAA 1X8LA 2Q6LA 3MS2A 1SEPA 2X9LA 4QOSA 3TB4A 3U44B 4P3NA 3L8GA 5KVVA 1H22A 4AJIA 4X7MA 3TNFA 3OPNA 1QZUA 5ITSA 3WAGA 1T5DX 4G0PA 4GOMD 2XZPA 3IBYA 4D9FA 5JJ5A 2FWAA 3GFOA 2YIVX 4F9FA 3OLQA 2YHUA 3RARA 4XW2A 2XCOA 3NM6B 2GILA 4O2RA 1K5PA 2MU1A 2QA5A 3BIFA 4WKNA 2DZDA 2GYUA 1NM5A 4OA5A 1STOA 4JJKA 1DAPA 4FTWA 4NE9A 2FMTA 1N8TA 4O0MA 4NOMA 4POAA 3V2IA 4UC0A 2I3GA 2Z98A 4N41A 5IN5A 3EN0A 2FR1A 4DRXA 1JQKA 1N2XA 5A2QA 4WZ6A 3CCFA 1DADA 1NLMA 3G9UA 3QLVC 1QHGA 1INLA 1OV4A 2QTRA 1ES9A 1JHXA 1JEDA 1YJXA 3H2YA 5AI6A 3DH0A 3M49A 4WZBE 5A0FA 4YYZA 5IT9A 4OYYA 5AXDA 1U8AA 1JWLA 3DEKA 3L0BA 2Q2OA 3E9MA 3ENNA 2EIXA 1KJZA 2NV2B 2HQOA 3DDZX 3OQJA 5GIOE 2JFWA 2ZTHA 1QH1A 4LYAA 1B16A 1DOAA 2NU9A 1XA3A 4O5AA 4RVHA 4DABA 3BJMA 2GN9A 4BNTA 4FYIA 3BSFA 5ESRA 1NKVA 1K3FA 1RYZA 4HXGA 4PX2A 4QICA 2YN2A 1LBTA 5FIUA 5FOVA 3GLFA 16PKA 4ZI7F 1GFIA 2HMUA 1DX6A 5ANRB 4PPFA 1TT5B 4HYYA 4G23A 2HBQA 4L0CA 4RD1A 2N42A 2EJCA 1XNHA 3P1JA 4LRXA 1VCIA 1ZK1A 4HRVA 5KREA 3R20A 5IZCA 3CLTC 1QV6A 3MJRA 5JBNA 1DKRA 4EYEA 5LWHA 2GWRA 3IMCA 1E5XA 2IKQA 2BD0A 1U3UA 2IXDA 1RADA 1DJQA 1NBEA 4RDCA 2G1JA 1YDMA 3RIMA 1CLEA 4MPJA 1UINA 1FYFA 4YLGA 2C00A 2NT4A 3TM5A 1OX5A 1J06A 3DT8A 3WO0A 5K3CA 1MX9A 3NBUA 4HAXA 4TTRA 1N2CA 2QV7A 1DO2A 3FKJA 2VDUE 3CVUA 3PQ5A 1W0KA 2VQDA 1U1CA 2I2BA 3BBPA 3LVRE 5FUXA 2R48A 1BWPA 1PFYA 4QVGA 4R2MA 1KAHA 2I2WA 2Q2QA 3RKRA 1JU9A 3IOBA 1B6GA 4MO2A 5A6SA 3C8DA 3HM2A 1AV6A 1U31A 5EMHA 4OL9A 2ZDQA 2FEAA 1EXVA 1RLUA 5CLHA 4B7ZA 1JQ3A 1VGQA 2MR6A 4MA4A 1FJGB 4DJJA 4U8GA 4L57A 2RAUA 3CUWA 2GS9A 3OU6A 1RAAA 4OHKA 1CS0B 2A9PA 3T54A 1J5EB 4PO9A 4AYTA 3LKVA 2HRZA 3C7AA 2PWYA 1NJFA 2HA7A 4AUEA 1G4UR 2TSYB 2PMKA 5C8DA 1RIFA 1V5FA 2Z4RA 4G5RA 5HZGA 4CKWB 2Z4TA 3GNQA 4YALA 4AO7A 5GINE 3VPAA 1F3LA 3ZWAA 4IH9A 5JC1A 5EEGA 2Q6VA 1YK0A 1IHPA 5I3CA 3LDUA 3IUJA 1TM7E 3P9QA 1D3AA 4J0FA 3FF4A 3F8TA 4R2KA 3WWEA 1HL3A 1G42A 3PGLA 4EFDA 1UL1X 4YJDA 3V2HA 2WTNA 1CXZA 2AJTA 1WNTA 4RWEA 1WB5A 2D0PB 3L3BA 1KYWA 4RXUA 2O0LA 1ISJA 1PSZA 2CXTA 2RIRA 3BXOA 4UCXA 4DY4A 1W76A 1GZ3A 1EWRA 2G5TA 2YXLA 4YUZA 2BR4A 3NTVA 3UOGA 1Q0RA 4QUBA 1U8YA 4Q1VA 3TSOA 1MJHA 3UGQA 2V7TA 3GJQA 4J0KA 1K8QA 2ODBA 3RBXA 4R1UA 1IQRA 2O23A 2P27A 1JILA 2Q9BA 3KUDA 2EQAA 4JGGA 4R7ZA 4DILA 4F1JA 5LVAA 4GM1A 2X9GA 2GAJA 3E8SA 1A72A 2AWNA 4I4LA 3WKCA 3OFKA 4HDRB 3P94A 1SUFA 4YRFA 5CAEA 4HATA 3THWA 1H1LB 1SUWA 4CEJA 3QA3E 2GDZA 4YRAA 5HWSA 1FLNA 2Q62A 4FDVA 5A3SA 3NBQA 1SC4A 3C8ZA 3QXGA 4YACA 5FOXA 2IE0A 1RM5A 4BO7A 4DDMA 3TK1A 1V3VA 4C78A 1VCHA 3WK8A 4PX5A 1P0IA 5F33A 2W2MA 4LWOA 3ZH2A 1AG9A 3L0PA 4F6CA 3KPYA 3NJ4A 4FR5A 3FYCA 4EB6A 1CUGA 1H5QA 4C22A 3EPLA 4L75A 4TLDA 1XI2A 3IAM1 2V3CC 4R31A 2Y05A 1QO7A 3FUTA 1PI3A 4GD3Q 4INAA 4EPTA 5F4ZA 1XA0A 2OEPA 3LO8A 4AX4A 1M2NA 4IZHA 4TZ6A 1ULBA 3FXAA 5I01A 5LN1A 5AUQA 1WIWA 1XTQA 2FRXA 2J30A 2ZYDA 3BAZA 3MXTA 4G4IA 4TX1A 4CLXA 3WLSA 1SOUA 1M34E 5K8LA 2R6HA 1HUQA 3QBJA 1UPCA 1VFNA 3NGXA 2RFLA 3C7KA 1EX7A 1W4BA 4MK4A 2JEYA 1Y6QA 4M98A 2GZ2A 5I9MA 4KXXA 3H5AA 2IUSA 4WN9B 4P4GA 1RLIA 4NMHA 1JXOA 2XWBF 3NCTA 5JCXA 5KKNB 3I28A 2GUGA 1ESDA 2XYPA 5I7EA 3WAJA 2WV7A 3LCVB 3NTLA 2AJLI 1GGVA 3ANTA 2BVNA 4EBFA 4Q3DA 3RG2A 5BSWA 3HPQA 3QELB 3DPUA 2H92A 2PU5A 4QASA 2ONCA 1GG5A 1P81A 2V7UA 1CRZA 4L0DA 2ZRIA 3KXIA 2PUFA 2IYSA 1OU0A 2BDTA 1R7RA 1RWVA 1SVKA 2JI4A 2Q2NA 1Y81A 3AR4A 4INZA 4WDQA 1HQKA 2DETA 4FD2A 5CU7A 1JDJA 2VJDA 4D3FA 1T91A 3GRPA 2PQ6A 4MJ7A 4KMSA 2VAPA 4TVOA 3WBKA 4DQXA 2FXVA 3H9QA 3WGIA 3IIEA 1CZOA 2VPWA 3DNFA 4H7FA 2ECQA 3R3JA 2I99A 4HQ6A 2IWHA 3ZI7A 2FK7A 1YOVB 2BJWA 3EXFA 4AKTA 1SCUA 3HYCA 2R8EA 3JAKB 3T5AA 5L9AA 4PAWA 2B1QA 4BV8A 4HDKB 1NRXA 2C9CA 4IUBS 5EP4A 4PHFA 3SS9X 4B3HA 2EX1A 1ECLA 3UMBA 1HA3A 3HCPA 5MGBA 3ETJA 3LOPA 2QZPA 2BHRA 4LDZA 2ETXA 3L04A 4M8SA 3RPEA 4CTJA 1LV7A 1CU1A 5KVSA 4YXWA 4ZEVA 1X7WB 4AKIA 2EL7A 5A0TA 4NMMA 4OK6A 2I7DA 2X58A 5KYVA 1G0NA 5I7RA 3R9WA 3ABIA 4BZXA 1UM8A 3VZDA 3ZE6A 2MOKA 2I6GA 2CVQA 4R81A 4MS3A 3MN1A 5ADUS 2ZTVA 1CULC 3HBFA 2BYTA 2HSEA 2UZ0A 1XCMA 2WIKA 2H6EA 3K8OE 3P2KA 4FT4A 1OKKD 5REQA 4KQMA 3KHUA 3NUQA 1F0YA 1Q7BA 3UF0A 2ID4A 2ZSAA 2J48A 2OO5A 2UVDA 3ISVA 4FZJA 3MGKA 1OXTA 2A7XA 1E7SA 1HG1A 4OA8A 1FTWA 1O1YA 4X8MA 3QVKA 5LB2A 4MVJM 5DGXA 5TB5A 4AURA 4YCCA 4WDRA 3PJRA 2ZJ3A 2ODEA 1CZHA 3D6HA 3EEBA 3GJRA 3GY0A 1G7TA 2IEBA 5E95A 1XQXA 1FZQA 3QE0A 4JA0A 2OSBA 3RUAA 1QO9A 3UJ7A 2RKOA 4EZIA 1QGED 4WCDA 4QM7A 1QBGA 3BIXA 1NXPA 1U4NA 3AUXA 3DTNA 4P7JA 1DCFA 4QJBA 3UAXA 1I1OA 3R3YA 5C3MA 1G6Q1 1QMPA 3CSUA 3DVQX 1RHQA 3PHGA 4CR8A 1PFQA 4OREX 1PT5A 3VDNB 3DTVA 1T1IA 4OQZA 4ZOEA 2BRUC 4QL3A 1ZL2A 1Q7TA 3Q7QA 3LSTA 5FPHA 2J7PD 5KS2A 1AKTA 3WV5A 3E7DA 4LF5B 3RC7A 5JATA 1XOIA 4NTZA 1SA0A 1Z2OX 4U9UA 4CM5A 4XARA 5HP4A 4EJ6A 1P62B 4NE7A 1WZIA 1P18A 4UXIA 4AMZA 3JY6A 3STHA 1Y5MA 1VRWA 4HH3C 3BERA 1PFKA 3RVLA 4DFDA 4DDWA 1IM8A 2QY9A 1L7DA 3KEMA 2R4TA 3KEFA 3ZZTA 2QBYA 3HLKA 4GEGA 5DB4A 5DEIA 2WFAA 4INOA 3WNQA 3F6SA 1I1QB 3E7FA 2E48A 3LXMA 3MTGA 1PJZA 3LL4A 1KPHA 1SBZA 1GEEA 1V11A 3T3MB 4U7WA 4QZVA 4W7SA 5JARA 3AF4A 3DLCA 3GLFB 1W5TA 3LT1A 3T7EA 4F5ZA 2XMGA 3WICA 3LHKA 1C0IA 2CFTA 2QRHA 4B7AA 4Z2AA 5C80A 5FA5A 2R2GA 4ZA2A 2BF4A 5H80A 4G84A 5ALVA 3Q1KA 3GLHA 5J4KA 2JLXA 4ARZB 2ZOSA 3QMPA 2C3UA 5HE9A 2PUHA 2WM3A 3K9HA 2GSDA 1XPOA 5ECWA 2BEUB 2V9ZA 3ZNOA 1OLXB 4AKSA 3W5CA 2HWWA 3PD1A 1IZZA 3I53A 3HVRA 1D07A 3LXRA 3N70A 4CN8A 2I29A 1K27A 1TECE 5CLIA 3TLKA 3A6EA 3FLBA 3R77A 1OYVA 1BX3A 4PXYA 4R7GA 5BOSA 2WNHA 2AVNA 4IXMA 3JARA 5TQ2B 5EPUA 2BGLA 3KR0A 3I2JA 3K0AA 2Y6UA 1IM5A 1MDBA 4PVDA 2WVJA 3DL0A 2QI9C 4KOAA 4E03A 1KMIY 1PFVA 2WZDA 3MLBA 1ISGA 1CEQA 2DHCA 1GYPA 2EP8A 3K32A 5AKEA 3WLMA 1BAPA 2BKUA 1DI0A 4ENQA 1QHXA 1ZRNA 4OQEA 3TI9A 4ZI2A 5KYKA 2O0MA 3OPYB 1GGFA 4CQMA 3CURA 1F2VA 5T3YA 1CIJA 1YJAA 2VDWB 4TM8A 3JRNA 3L0CA 4K81B 4UTVA 4KN5A 1XLTC 2WA2A 3A6DA 3WIDA 1ZOSA 1W4RA 4WKCA 5EWMB 2VYFA 2VPXA 1IOLA 3BEDA 3NAZA 1TM2A 2BFMA 3BFJA 4B5LA 4F5DA 5JU6A 5A4FS 4LRTB 2YVUA 2ZJ1A 2AX3A 5LYJA 3RGWS 3ND8A 3LT2A 5AVYA 2RGYA 3IKMB 2XYHA 4YP0A 1RLOA 3BJEA 4LS3A 4EHKA 3O8CA 2OD2A 4CKXA 1HDIA 3U80A 1EESA 4V1CB 3L7IA 4BWYA 3S81A 3ACCA 3OA2A 4NY1A 5E6RA 4PZ0A 3KXKA 2IYWA 5GJWC 2MHCA 2YMPA 4B3JA 4F6RB 2EARA 1TOAA 4PAGA 3RTEA 1CC1S 4H15A 3ZVKA 1AKUA 1CJKC 4C0XA 2B98A 3R3HA 1SVOA 1NQTA 1KZGB 1GZUA 1MO4A 4Q1AA 1O2DA 4M87A 1E0DA 2FZ4A 4KKVA 5TPWA 1VDMA 3AB8A 2IX9A 3CEHA 4LCJA 2AFHE 3T9AA 3KTAA 4XA8A 3WJAA 4WI1A 2Z2JA 2OG2A 1D4OA 1T1GA 1WLSA 4J91A 4OYHA 2GD0A 4JYAB 5LYYA 1YRLA 5DBFA 4YP5A 4QKQA 2IHBA 4PICA 2QRLA 1JKJB 1UDCA 3KDPA 3PUWA 3AF3A 5CVUA 3RFTA 5IHPA 3C3XA 1A7JA 1XROA 3FSEA 3WB2A 1X1SA 4EJSB 3JR7A 2ERXA 2IP1A 5CAEB 4BP9A 4AJOA 2PWAA 2XKAA 1QJCA 1LW7A 2IHVA 3NEPX 2WPDA 4CEJB 4PN3A 4WA7A 3RVMA 3K6SB 1KWGA 2QD4A 1TJ5A 3OD5A 1KU6A 2Z3VA 1OV6A 2O7QA 3DDNA 3M70A 2XXAA 4IKEA 2P1ZA 3ICCA 4YDSA 2CB9A 3PQCA 4URYR 4BCCA 2C4HA 4DRZA 2L17A 4TLAA 5G1OA 1RI2A 5FH9A 2BC9A 3LHSA 2P91A 4FU0A 1G60A 1L5VA 1OWPA 2GO7A 4LMRA 3TR6A 1IK6A 4OFZA 3QTLA 5AYVA 4EKIA 1QIKA 3X1YA 1G2IA 2ZP1A 4QSMA 1RYHA 3E7WA 1E2PA 2P6OA 4H1HA 2F43B 2NO4A 3HYRA 3N2IA 1MQ9A 2BH2A 2AR7A 1G291 2JFOA 4J0GA 4RK7A 3RRZA 1WF6A 2H11A 4UMVA 3MTIA 1UK8A 2EU8A 2IA5A 3VHLB 5P21A 5JQGB 4MQMA 4YMIA 3CR8A 4RX1A 1VXOA 3FFWA 3O8BA 2N0SA 3FGNA 1EQ2A 1Z38A 3F5DA 4G9EA 4HUQB 1E1YA 2F59A 1M8FA 1UEJA 2QTLA 3H42B 4X0EA 1OLSB 4Z9AA 5LQSA 5JFOA 3FTCA 3EXG1 2NUPB 2FSPA 4Z9XA 4BKOA 1R1DA 4FMDB 1X1AA 3BSWA 3JQ7B 3HJAA 2KJQA 2NQTA 3NG1A 3I1FA 621PA 2A1UB 5EHIA 5FKJA 1Z88A 2LD4A 3DC2A 3W4KA 4HADA 2C94A 3QPVA 2FUNB 3HB0A 4X85A 1Z82A 2DTXA 3TZEA 4KJXA 5BORA 5DMXA 1TK9A 2IZOA 3LX4A 5M5BA 3ZEAA 1U7DA 2R8YA 3DF7A 2GNAA 1R74A 1YRWA 4MUJA 3WLLA 1GGEA 4P86A 3PXGA 2CD7A 1Y4ZA 1TC2A 3E9DA 3F2IA 1P8JA 3INGA 3NUZA 4PCUA 2XOKA 3LBYA 1R0SA 2ZXFA 1E5DA 4NCNA 2YRFA 3HI6A 1DDGA 1TKAA 4ZIRA 4C4RA 1W4CA 5B2FA 1SB8A 3EC2A 4FKMA 4ZVTA 3AVYA 4TYYA 4M8KA 4RQTA 2ZRPA 3UENA 3R8FA 5FAKA 2DFTA 2X2OA 3IAFA 5DYNA 4JJ6A 5FEMA 3EIXA 4B6SA 2JIZA 1MV5A 5BR8B 2BUAA 2EW1A 2VHZA 3TLCA 5J5AA 5L4LA 2WIFA 4Y9RA 5CG2A 3PUJA 4N7BA 4O6VA 5ICSA 2JLZA 4KB5A 4K9KA 4QVKA 2QW8A 4B4UA 3SR0A 3DVAB 3H7AA 2FOXA 2CHVA 2VDPB 4I50F 3D43A 1UXIA 1PEKE 1YUMA 3KYIB 4ISBA 1PD0A 4K46A 3SZGA 1YCDA 2ZANA 3W0LB 3P9KA 3LVQE 4WZAB 4BNGA 1AHIA 2JLUA 3S6JA 3MXOA 1VLVA 3SY8A 1PV4A 2XDQB 5LP6B 4WVLA 2P2NA 4OGLA 2JVKA 2FWBA 1S2OA 3NHAA 2KHZA 4GF5A 4O2AA 4QRDA 4N5LA 4ZT3A 2G4VA 2AMJA 1BH6A 2H51A 4BXOA 5EAIA 2QD5A 2ZPTX 2JGIA 4JQYA 5T4EA 3OPYI 3EASA 3PXDA 5TDHA 1GPUA 3PZRA 3E6AA 4L5JA 5TJHA 1QDUA 3GVXA 3KZKA 1GXSB 1JVSA 2J33A 1MRSA 1NDHA 3KDAA 1AK2A 5LQAA 1WBJB 4LTNA 3D4OA 2X0RA 5EIWA 2QI9F 1ZD1A 4D3YA 1UOPA 1OGYA 1NZDA 2VTDA 1KZHA 5FOSA 2G09A 4YMGA 2AN1A 2GPWA 4UNIA 3V1LA 4Q4DA 2ILTA 1TUEA 3W9BA 3NH9A 4GOOD 4XM1A 1U3FA 3FDIA 1WU7A 1JPJA 5EIFA 2PFSA 3QX9A 1KK1A 3U62A 1MZPA 5KJ1A 5M34A 1PWHA 1EP2B 4ZT4A 1ZOIA 3NPMA 5BW6B 3L7DA 5B7QA 1JQJC 5IC4A 4WTOA 3I1YA 3GRFA 1FJXA 3VYSB 1FFWA 4J1QA 2NNLD 3S8YA 4K6MA 4MP3A 1Y34E 3ZU5A 4BNWA 3LX5A 3QWBA 4BL5A 5IJ9B 4II2A 2WUDA 4R2LA 4X97A 3U7RA 3AR6A 4KITB 1DIBA 4YMSA 2QLLA 1KJ8A 4KI0A 3L02A 4FT2A 1P45A 4WOBA 3OCCA 5EIBD 3RNOA 3IJRA 3AWIA 5AJXA 3AUFA 5DT2A 2VO1A 3VO1A 2QYHA 3Q85A 1XYGA 3TOXA 4OMDA 3F5MA 5IVDA 3WJ7A 3IAUA 1G7RA 2PLNA 3K5HA 4IO0A 3VNRA 4CV0A 5BV7A 4WASA 3Q3EA 1Z68A 2JBWA 3R9KA 3VFDA 1XF1A 3WRYC 2Q0XA 4BO8A 2R87A 1IXYA 2E21A 2E1PA 1H3FA 1K98A 1MXFA 1Y5NA 2GERA 3G0DA 4U2EA 4EA6A 2RKBA 4BRWA 3UJ9A 3IPXA 2NSHA 4HGOA 2W98A 1UK9A 2JFBA 2DHQA 2XUJA 3KE8A 1IJEA 3JARB 1V3TA 4FQ5A 1MXHA 2QAGB 1P77A 1T3TA 4LJ8A 1NN3A 5JAQA 3TM4A 3BZWA 4RTRA 5AXAA 1XSEA 1QGAA 3IEPA 1Z73A 3LU1A 3GEDA 1T5SA 4IUDS 5CB4B 1L7VC 4AIRA 1K2VN 1P0PA 1OZAA 3DQQA 3I1IA 4L9RA 2E4UA 4CDRA 2CF5A 3K3PA 2UXDB 1ACLA 4R2IA 1W30A 3ED1A 3P2JA 4UM9B 2HFJA 1QCCA 4E5VA 3IQWA 1FJ2A 1YDGA 5FAXA 1L5OA 1PGNA 1ADCA 5DGCA 3TAUA 4XWWA 5GADl 2QTBA 3X1XA 2IY8A 2IV2X 4RZSA 5JXJA 4IDHA 3RS2A 5LYJB 2Q3FA 2BI8A 1V3QE 1KVRA 3F4LA 3UH0A 4HB3A 1ONSA 3KJFA 4OP2A 4B8ZA 4PE5B 3MWKA 2MTBA 4O1IA 1OFGA 1FX0B 2F8MA 1UBRS 3GWZA 1GQFA 5E9WA 1EWYA 2CL0X 5J40A 4GYWA 3EVEA 4PYIA 1DC5A 2BFNA 4KN6A 4X61A 5AKXA 4KPFC 3ROZA 2R6CA 4C5AA 4ZZIA 3MWYW 3B6JA 3JZIA 4RTPA 2DEUA 3JQ6A 1EK2A 1M2HA 2SKDA 2ZJYA 4FKZA 4OI2A 2X2EA 4I3FA 4G5XA 2VZ8A 4E1BA 2FWMX 4XPIA 3OOEA 3R0IA 3UMCA 2QE7D 1OI4A 1F06A 5TPWB 3B36A 1IG0A 1KZ7B 2XZOA 3CGGA 3LCCA 2HTEA 1RS0A 1GUAA 3BICA 1TO6A 3ETNA 4DPKA 4RL4A 4C14A 1XHLA 3HUUA 4G37A 2W90A 4NX2A 5D1HA 2JFYA 3R7AA 3U37A 2P78A 2ZLBA 4URZR 1IBSA 1EKXA 1TYDE 3BMNA 4Z86A 5FI1B 5HQTA 4I8XA 3QFCA 1W94A 4DEVA 3NMUF 3IIMA 1G8YA 1XALA 4I1PA 3G1TA 4OG2A 5E4TA 3I23A 2PUCA 4Q37A 1GRQA 5SZIA 3OM8A 4N0EA 1YB1A 3DE1X 3PXCX 2XW6A 2XKJE 1RMQA 1LTHR 4YJ3F 1EVJA 1ULSA 2Y1WA 3WKEA 4EHLA 3HCNA 2XXAB 2BKAA 3VOTA 3BD6A 4TQ9A 1RSZA 3E3NA 1ADYA 2VK4A 2EBWA 3JQGA 4FX2A 4GMGA 3G5UA 3KJXA 4OFWA 3IVMA 3NBMA 4QFBA 5KJEA 3OQHA 4B6PA 1XEXB 3I34X 4GOLD 4QYIA 4S1TA 2OQVA 5C18A 5CDUA 3FTEA 1ZVQA 5ESWA 4RCVA 4B6OA 3C3PA 3VC1A 3WLNA 1MTZA 1JPUA 4A4DA 9ATCA 2YTZA 3OZCA 1G5FA 4D46A 3Q41A 2X5XA 2P0YA 1D2EA 1YT5A 2BFDB 3OM0A 1XZHA 2FW9A 3F98A 4DEXA 1DUVG 5D8DA 1TUIA 1UC9A 1J0AA 1J8QA 3HJRA 1NKSA 2Q9CA 4QSHA 1Z35A 2FDRA 2V96A 1KO8A 2H16A 3AWDA 1Z5NA 4LJSA 4JN6B 3WOHA 1S3IA 5LL6P 2G5CA 5HKOA 3BIWA 4JOQA 5TVGA 3MWEA 2NU8B 1TUBA 2PUGA 1QHEA 3LPCA 3TBKA 3L40A 4OJTA 3RHFA 2JS7A 2DT8A 5H83A 3RYFB 3WSWA 3OTGA 1XTVA 2OV4A 2I55A 1M7HA 3OHMA 4GXTA 1A7AA 3D3EA 5BW5A 4KXVA 1UANA 3HKEA 4XQGA 4MQBA 1XD2A 2HHLA 1V8OA 2O2JA 4TTIA 1EFTA 1RYBA 2WEKA 4KE9A 4ZWNA 3DKPA 2WIGA 4W8GA 3FNBA 2ZB8A 1WXIA 1J0EA 1JBQA 2FI1A 2XUDA 3SHQA 2DBZA 1SUDA 2WW8A 5JJLA 1WDMA 3ENKA 1EZ4A 4KZPA 2IHNA 4MQLA 5GOZA 2GJAA 1B73A 1PZGA 4Y2PA 1KVQA 4DCUA 3W4IA 4JY7A 1C50A 1TLLA 4C0LA 4DEYA 3F90A 2PE5A 1QOPB 3QIAA 2DR3A 3GAZA 2I3ZA 4KH0A 4LRQA 4FW8A 2AMLA 4WZZA 4CMJA 1QV7A 1W6UA 1AKYA 2I8CA 4NPAA 3V33A 2PSJA 3C15C 4ZI7A 4G0UA 1M74A 5T8KC 3TLGB 2C92A 4BNYA 1CUUA 2BM0A 5JS2A 5C7IO 4PEVA 5IK2A 3BGOS 5KNBD 2I1QA 4TUYF 1BTOA 1P33A 1L5SA 3ZDDA 5HTKA 1VPLA 4RIHA 4EBBA 1NSFA 2VSOA 4JITA 5SYAA 4O4IB 1XDSA 1SPBS 3CFYA 5LR6A 3JQAA 2RK6A 1RMTA 1JMVA 3CW9A 4IHAA 2FSVC 4CUZA 4ZAZA 1X8KA 1NYTA 2AOUA 1VBFA 3C3EA 3FWZA 5FWAA 3UHOA 1CBUA 4M9UA 1A4UA 1J5XA 3GT4A 5GJCA 1U0JA 4ZJUA 5B64A 4X7PA 4RVGA 5GIPE 2PL9A 4E0BA 4BVJA 1NJ1A 4C5BA 1L7RA 1NONA 1ZJ6A 3BWXA 5AVKA 3UKJA 1RRCA 1DEOA 2VYVA 1Z8NA 2PTGA 4X64B 2W43A 5ALDA 1YJQA 1QG6A 4B17A 5M2QA 2P7IA 3ONEA 2DKOA 4BE7B 2RKWA 3NAQA 4JX8A 1C4WA 3FIUA 1I7LA 3BTSA 3CWCA 3V34A 3ZX5A 2GFQA 1XLWA 2D00A 1MAAA 1U0HC 3DZJA 1XRNA 3U4AA 4Z54A 4TT3D 4YQFA 13PKA 2AOVA 4R84A 4ZGBA 1A27A 1E9DA 2XB9A 3GUCA 2BGTA 3QMWA 4LNHA 1UAAA 4NMLA 3U13A 1UZMA 5E7JA 2GZSA 5KPDA 2VNIA 1XFDA 3F0TA 1I2BA 1PT7A 1XKQA 4U0KA 2FB9A 3A1VA 3GJZA 3EQ2A 4B40A 2WNSA 2XWSA 2OZPA 2XEDA 1DV2A 2UV8A 1ZGHA 5HRCA 3O1HB 4BO2A 2YV4A 4R9RA 1OLUB 1AQNA 1I3KA 3HZZA 3IIIA 3Q4GA 1BKDR 5LLSA 1CW2B 4QDUA 2OENG 2RC5A 2J3DA 4Q16A 1GL7A 4ENWA 4P5PA 4DJTA 4BIIA 3DAFA 2VJBA 2VS1A 1SZCA 5DTRA 3WGMA 2F3QA 1BKYA 1YFZA 3A2LA 1WM1A 4ZHSA 2W8ZA 5AJHA 4M8LA 3BVPA 3C7TA 1UKAA 2CXUA 3AC0A 3GD5A 3H8SA 3OFND 5BN3B 1W9HA 2FFQA 4F4HA 1AXEA 1IYZA 1HLGA 1YI0A 3GXBA 4FKBA 1TZMA 4EMBA 1ZD4A 2XUIA 2ZJFA 3NASA 2X3YA 5ELLA 2Y27A 5KTPA 3FM9A 3QEOA 4BV2A 1RXEA 1KK0A 2ZTUA 3PDWA 2NO9A 5D3KA 1RKVA 4RMGA 2XZLA 4Q1FA 2JFXA 2ODTX 1J9GA 4FEEA 3TEMA 4C0JA 1NJ5A 2IYUA 5JJCA 2BTEA 1G5IA 1X7YA 1EFPB 2PKXA 2Z3ZA 3MOSA 1Q6YA 3M8KA 3L92A 4Y6QA 2JIPA 4FYVA 4US0R 4LOIA 1XV5A 1PLJA 3RVRA 4FM9A 4N3CA 3LBIA 3X1MA 3PCRB 4WOKA 2ZYGA 2FMHA 1SVWA 4IOKA 1MC4A 4PC6A 3MILA 2QLTA 4FLFA 1XCBA 5K1ZA 3E3LA 2DRIA 3DBOB 1UFVA 1BHSA 1U8CB 1TU4A 2W6PA 1P9WA 4PZEA 3EAQA 4V03A 2IBSA 1ID8A 3L7AA 4QGSA 1DKOA 2NZ2A 2HADA 2VF8A 3PXAA 2QP9X 4NYMQ 2I6UA 3N28A 1CZNA 2Q5HA 1XJ5A 3O82A 1KEKA 4FB4A 1RIIA 4YJFA 3ELUA 4L50A 4P38A 2V7BA 4GKJB 5HIKA 2V6JA 4L78A 4V38A 4FHZA 4D8UA 1BG6A 4RHYA 1CUXA 1XXLA 4KSYA 4DSNA 5B6PA 3MGCA 4ARBA 5AW4A 5E9JA 1IAVA 1N9ZA 5GY7A 2ECPA 4GX1A 4PNPA 1C9YA 3PGMA 4J9VA 3DOUA 4NCXA 5IU6A 1BW9B 3RCBA 1NP6A 4ZO6A 3PGKA 1VMIA 2BONA 3BHNA 1TZJA 4HAYA 4TRMA 1V0JA 1X80B 4UFPA 4LYGA 1BDMA 4CG1A 2G82A 3DMDA 2AYYA 4CT4B 2RGUA 2P3QA 3O2NA 4TYNA 3AEYA 3RI3A 2ORYA 2GBPA 1KO7A 3A1FA 4ECEA 2C31A 4PZLA 4ILEA 3ULKA 2Y0EA 2BZ0A 2JC3A 2OE2A 2W2LD 2X5OA 2FJ0A 1H5NA 1PGJA 1YGYA 2QNBA 1UADA 3K4HA 3ML1A 4UU7A 3FKSD 4LYJA 1RBQA 3ANXA 1ENOA 5CTAA 4R98A 5AP9A 1A8PA 3GARA 3RT7A 3B1YA 1NNUA 3FRIA 4DIDA 2RHHA 4W5OA 2VJCA 5T6BA 4RKFA 3RVPA 1OC2A 4QIHA 2VT2A 1TM3E 2ZQZA 3NORA 5BR1A 3QLVA 2I4MA 1NUPA 1KOFA 1LV8A 1G20A 1YNOA 2I8AA 3GNTA 4RSGA 4Y3UA 3V7YA 1K06A 4PC1A 1LQ2A 4F91B 1U9JA 3NNSA 4CQLA 5IUKC 4ERNA 3W8EA 5BV1A 4IJMA 1K5GA 3H9EO 1YL5A 5AVRA 3PVSA 1QH8A 2P4QA 1UM9A 5B2EA 3IEUA 3M3HA 1D2MA 4NBSA 2RG7A 4EZEA 3ZE9A 3AI3A 3OKPA 1SQ5A 2GUWA 3L4SO 4GRIA 2VT7A 4KC0A 3ZYZA 5I9LA 1JG1A 4Y0VA 4I66A 1O6BA 1KQNA 3RGGA 2J3QA 4D96A 1M67A 4BATA 2F4VB 2X6QA 721PA 4DLRA 2QQ5A 3V2GA 4IZIA 4RK1A 5EZSA 3X1JA 4C1NA 1VMEA 2HLNA 2BGMA 4LFAB 1YDHA 2E49A 3JQGB 2OMKA 3CLUD 5CVEA 3ASYA 1MDFA 4RACA 3WHLA 2DPHA 1JR6A 4YN3A 1RLJA 2G4LA 3AILA 4Q9NA 4BLWA 3U60B 2PQMA 4JFAA 3J7AC 1H9CA 1VYHA 2LPMA 2BELA 2PCJA 2XUHA 3IURA 2OHJA 4N0PA 3U9LA 1MG0A 1ML4A 1AB6A 3LT5A 1YIOA 4XLLA 3T3PB 1X1DA 1HV8A 1RFLA 2R5WA 2XD4A 3EPPA 2IOFA 3GG2A 3OE5A 4EYSA 4M22A 1G1MA 3S2EA 2BUCA 1SIUA 1EFRD 2FOIA 4GI3A 2QVGA 1XAGA 2BGRA 1XNRB 5TMDA 4FJ0A 4IIVA 2FPXA 3KJNA 3EYWA 3WMXA 5F3RA 3UXMA 5A5GA 5LD2B 1E2DA 5FFFA 3JQCA 2VYNA 3ZV5A 2IHJA 3PQDA 4ZT6A 2OKCA 3JATB 1DS6A 4PZ9A 4JVSB 3ZLTA 2NO7A 2IPMA 2OC4A 3WBBA 5IVKA 5I8WA 1LF0A 4RIFA 3G2NA 1X1RA 2B4KA 4HI0E 3I2KA 4JODA 4NH0A 3VPHA 1AHNA 3WK7A 4BMXA 1F2TA 1QCYA 2YZGA 4NU5A 3W6NA 2WUFA 5CT8A 4BLTA 3CPHA 3VR0A 1VI5A 3B2QA 2B61A 1II8A 2WJPA 3FCAA 2WFLA 1YDEA 1MW9X 1I0LA 4TVBA 4UASA 2NN3C 1E1QA 1TK3A 1PQYA 4NV3A 4JB3A 1ZX1A 4WNAB 1IEXA 5EXXA 1XRSB 2AI3A 2IVFA 5AOBA 5GWXA 1Y37A 3O0DA 1DEHA 1U0NA 4RHUA 1WKBA 1VQ1A 8MHTA 3MUOA 1JLLB 3CUUA 4QJ5A 5DDIP 4M0FA 2PJZA 5CW1A 2WE7A 2R79A 1EJ0A 1QYXA 3PFNA 1ISIA 3DZCA 4OD0A 2ZVJA 1H6CA 1YZVA 3KTOA 2OV8A 1NNSA 3OQPA 3OIFA 1ZS9A 3TIXB 1U2SA 3A6HA 5FULA 5JYDA 2ZJ5A 4WBSA 1LLQA 3TW8A 1NBOA 3LK7A 3C8UA 4IDQA 3JQAB 1ZIOA 3W78A 4QATA 4GE3A 1ZW6A 5AW8A 4BIMA 5JSHA 2XVAA 4M8NE 3B1KA 3Q8MA 1FDIA 2YR0A 1ZXXA 3DHEA 2V1UA 5DBEX 3X3HA 2P2LA 1G5RA 1OREA 3QUCA 1CR0A 2CUTA 2AX4A 4E32A 5ALMA 5A1TA 4A8JC 1SD1A 2R1ZA 1BN6A 1MHTA 2FZLA 3C74A 1QRAA 1Y42X 2GJSA 1EWQA 1AZSC 4LYEA 2JCGA 3O4RA 1EXMA 1V95A 1OPXA 2VOJA 2XECA 3NIDB 3NIWA 4FDLA 4I1VA 4LOJA 4MGZR 4Q15A 5CNKA 4OXQA 3JSXA 3R41A 2VQEB 1F0PA 1O97D 4XB6B 1T0JB 3D31A 2AQ8A 1PQWA 1K92A 4AWBA 2L18A 2E4AA 3M6LA 2OQ2A 2QE6A 2QRVB 3OZTA 4LOAA 3PJDA 1NZJA 2WYHA 3UXHA 4A26A 1Z6ZA 3OJ0A 5C46F 1J25A 4I9UA 2NACA 4E5UA 4R2WA 4BLPA 2ZIGA 4N8EA 3FTDA 3NV7A 4NEGA 1SUPA 3RU2A 8GPBA 4N76A 5EC8A 4LN1A 3GDOA 4OQQA 2DHRA 4L4SA 3N74A 1QK3A 3ZHSA 2JJ2A 3DFIA 1P91A 1CVIA 2B4TO 1GRCA 2V6IA 3GMSA 4F3TA 3HRIA 3OPMA 5JYCA 1COWD 1VECA 4Q7KA 4D8TA 5KQRA 1WU8A 1DC8A 2PUBA 2X1VA 2QMHA 5DNYB 4TKUA 4M7OA 1C7RA 5TPZD 1MF7A 3D3KA 3AQ4A 2FXIA 1KMHB 5H70A 2HJGA 1Z39A 1Z6PA 4OXIA 3AY7A 3BQNB 2A94A 1XIVA 4O4HF 5EE1A 1GN8A 4FYKA 4EG5A 1B8NA 1C7JA 5J2UB 1XFAA 1V9SA 4CTKA 3CNQS 2QX6A 1J0XO 2P4SA 2WD8A 3K9CA 5KWSA 4FWBA 1T5BA 2X14A 2P9CA 3Q7TA 3NTXA 3DV0A 4G0QA 2G9QA 1T2EA 2B7CA 2RGXA 3LDGA 3M2PA 2PRSA 3CEPB 1YACA 3HU2A 4IJUA 2NVUA 4LISA 3VX4A 4CT5A 3GEHA 1L4YA 3AHJA 1CUHA 1KNXA 1NFFA 1U9CA 3QPDA 4ND3A 1EXWA 3TZHA 3ZE1B 1JRLA 4ZVLA 1DNPA 3QMVA 4PGAA 4MKRA 1DJOA 1QHHB 5HNKA 4YDHB 3D7NA 4LDAA 4K9DA 1SC9A 3R2JA 1JA0A 3OY2A 4Y1FA 2XT9A 4EW2A 2XRFA 4HH0A 2O06A 4QWWA 1KWKA 1UFRA 1EVIA 2C9YA 2A5FA 1Q1QA 1U2GA 2GJ9A 2QN6A 1N6RA 4IEFB 4WESA 2A1IA 3FYDA 1DRKA 3RYCB 2JEZA 3P20A 4JR1A 4ZCQA 1D5CA 2GI4A 2W8BA 4FFOA 2XXBA 3TH5A 4Z4EA 1P0FA 1E96A 1Q19A 2HA3A 3QIVA 3EWSA 4UHKA 4BAUA 3WGUA 4BB9A 5JMTA 4EYKA 4PLVA 5KQPA 4ALNA 4O63O 4X20B 1UBGA 4J1SA 4TS9A 3K5WA 3QFSA 3KR2A 2I4OA 2O8CA 4YAGA 2O5RA 3AF1A 3W5UA 1LPNA 4J0CA 4Q47A 4V0MA 3UV6A 421PA 4EA9A 1YB2A 1NY6A 1C14A 2DPMA 1KYQA 4KPUB 5DTJA 1FNDA 2YV5A 3P0HA 4CR7A 1K9VF 1U2PA 3LPAA 3DDUA 1V2HE 2ZQYA 5IG2A 1XJ0A 2CMGA 3DBRA 2FZEA 1G8MA 3W3AD 3WMEA 3S2FA 2B36A 2DBVO 5B1SA 3SJCA 3GPIA 4KNYA 5BVGB 3QWHA 1HWYA 4B09A 1XDUA 2QD3A 3U4CA 2CFOA 2HV8A 2AI1A 4KWTA 3WL7A 1U7WA 3JYLA 3U7FB 3TQHA 1AB5A 4KQWA 2UVPB 3CZ4A 3KFLA 1SUCA 1HTWA 2FJUA 2GK7A 2J5KA 1A2QA 3PDIB 4I6EA 4PLPA 1KZ1A 4J7UA 4QQ8A 4CHTA 4HNTA 5MN6A 2NTNA 5JG7A 1NOKA 1CUIA 2XNHA 3FUXA 3HDYA 2GM3A 4JLAA 3FGZA 4RJKA 5EEHA 4ZKEA 3IT1A 2XRMA 1HYEA 1ZNXA 1YFKA 2IS2A 2AEFA 2HCJB 5T57A 3S55A 4ABYA 3PFWO 3ESXA 1AS3A 1QGDA 1YE5A 2J0EA 4KCGA 3FWNA 2Y2VA 5HKBA 3V9AA 5KSYA 3L8CA 3OLXA 1Z15A 4QO8A 1RJ9B 3RQSA 4GPD1 1WF3A 2EEZA 3D1LA 3LT0A 4CFYA 3FH0A 1A71A 2AG0A 3HN7A 1F8FA 2MSLA 1TYZA 2FE1A 4I55F 5THXA 5BSFA 3KBOA 1ORWA 1U65A 4DVGA 1FZTA 1NP7A 3O7WA 3BWEA 4NCAA 3ZWPA 3ND6A 4Q4AB 1R9JA 3WLKX 5IP5A 1YJBA 2CMKA 4AJ1A 5CXUA 1ZI6A 2XE8A 3ELWA 1AZWA 4I50A 5BWLA 2G9ZA 3MTEA 2X0FA 3GPDG 2W2PA 2B4QA 3H2GA 3GCZA 4UMFA 2VDKB 3SBEA 3ZWBA 2Q3JA 4BNVA 3UT6A 1KC1A 2A9OA 2O2EA 1CKEA 4KN9S 3UGKA 2JZCA 5CVDA 1EA5A 2VDLB 1FXWF 1U98A 2RGCA 3NH6A 4N3GA 4B6RA 1AH2A 4J6EA 3E82A 4WK4B 1KI4A 1TTHA 2O7RA 1PKEA 3FFTA 4S1NA 4CIDA 3CVXA 1EFVB 2PM8A 3MT9A 6CHYA 4DLWA 4QG3A 2QSUA 2F48A 1B26A 4XYBA 3GP5A 4DA4A 1VG9B 3JV7A 4DV1B 2ZW9A 5A7GA 1B1AA 1U5CA 2RBGA 2F3UA 5DN9A 1D8AA 2WMYA 3HJBA 1RVV1 2QGNA 3EXHC 4F7WA 1TQ4A 2ZXEA 5EJ9A 2CYCA 3R9IA 5EL0A 3G6KA 3PNBA 5C31A 4LJ4A 1WXEA 3FCOA 1YS4A 3KXPA 3WLJA 4WLUA 1XZJA 3RJ5A 3HE3A 3QK7A 4GLJA 2BLNA 1XZMA 2ZU0C 2FHSA 4WCVA 5JAPA 5LQRA 2OVFA 4X9XA 3EIUA 2XGJA 3SFVA 1UMKA 1MAHA 2BJVA 4QUGA 3KSRA 2XYVA 2ZSDA 2H4YA 2H7CA 4NDNE 1NW5A 1XLTA 1II8B 2CYBA 3EOBI 2VDVE 4N01A 2BEWB 5BN4B 4HLDA 4RTSA 4F4IA 1J2UA 3K70B 4Z8YA 3M5WA 1SXGA 3A1WA 2I7XA 4RFSA 1QVAA 2FCAA 4F11A 1ZONA 3DDCA 3WNZA 1JMYA 2R7MA 4WFQA 2OK7A 3K94A 3WGZA 2VQFB 3P0IA 4OY3A 1BIFA 5COQA 3ZTTA 3HCFA 5JY6A 3MGGA 4MI6A 2Z8ZA 4J8PA 4GSKA 2GEDA 4G4JA 4E5YA 3M34A 5ALPA 4Q1EA 4E13A 2FZVA 5KNBH 3VU8A 1SCAA 1TQDA 4JCOA 3KKZA 3SHWA 3F71A 2H52A 3F6BX 1M2EA 1QIGA 4YV0A 2E37A 2GHIA 1RQLA 4HFMA 1VXRA 5LBIA 3W2EA 1CIPA 2BFFA 2H85A 1IUKA 1E59A 3ZOKA 2RGRA 1PP4A 1JBEA 3BK1A 4Z2YA 3MQ4A 4KE6A 4LY3A 4UVIA 1EUZA 1CRQA 1X38A 1GTVA 2BISA 1PZMA 4MVCA 1HYBA 2Q6TA 2YMLA 4ER6A 4GNKA 1TIPA 2I3AA 1D5WA 4YXFA 1PR2A 3T7RA 1EWKA 1XTSA 2OVBA 4I9NA 4M2LA 2PUEA 4GLLA 3MM4A 1GGKA 1KC3A 2ZE8A 3GVIA 4IAOA 4X6YA 2H1CA 5DBIA 5BRNA 2IUYA 3WFIA 1IXRC 1QU3A 1YUBA 1KQFA 4M76B 4XCXA 1X1TA 4H4DA 1MJNA 2GETA 2X9VA 2C29D 2ZJ8A 3EHDA 3PRKE 2E3JA 1MFPA 3EH2A 2YICA 1IU9A 4KYUA 2IUTA 5H82A 1Z26A 3GLGE 2WAXA 2P6UA 3GC6A 3BH6A 1Q22A 3NYWA 1TVEA 1VZ2A 2G67A 3B48A 4N6GA 2M1XA 4L5BA 4XWYA 3Q9SA 3PSHA 4JLBA 5FORA 3VKGA 4TL8A 1M8GA 2BT4A 5HQ3A 4R01A 2LE0A 3ZWDA 4B33A 2QSZA 4FZVA 4DYVA 2NZJA 2ZBPA 4JBNA 1QQTA 4XR9A 1E5TA 1WCXA 4P92A 1SVSA 1A8HA 3RYIA 2HEIA 5E1DA 3OIYA 5EZQA 4YCMA 2CLLB 2BGNA 1GUDA 3DEIA 3RG8A 2ZFUA 1CY4A 4UFOA 4BLOA 2VP2A 3T7TA 1H2XA 5KNCD 1EFCA 2P0AA 4FEGA 3L82B 2P3OA 3BGDA 1OFHA 2CHEA 1VI6A 3K35A 4TKUB 1KHTA 4NL4H 1LBSA 4H4CA 4OK3A 1GL6A 1HEUA 1EFLA 1D7AA 3HA5A 1Z7BA 4JFRA 4BJ1A 5CLFA 4YDQA 4O1MA 5JNWA 4EGCB 1J8FA 2YY7A 2Z09A 1GG2A 5EG5A 3ZEIA 2R25B 3DPSA 3SEFA 3QU4A 4TL7A 4IXDA 1MFZA 1Z4JA 3A6LA 3R4CA 2J3KA 3PJEA 1DMRA 4JC5A 1EK6A 3T8YA 1GNTA 3L7MA 4PWZA 4C4SA 2YZMA 5AI5A 1B1CA 1J1IA 1S8OA 2YVAA 3DMYA 1W0JA 1SC3A 1QFSA 2GHQA 1NW4A 1MP0A 3M2TA 5H5JA 5BSTA 3W8RA 2HR1A 2ZM5A 2YQZA 1QYIA 1N2HA 2NVUB 1GTG1 3B89A 4BTEA 1RAGA 4NAUA 2QR2A 1PLLA 3KT0A 2PXAA 1I2DA 4K9NA 2AL7A 1SKYB 1MT3A 4F4DA 1F2DA 4YJ3A 3RSSA 4L9WA 4N54A 2ZUSA 4YJ2F 2XD9A 3L49A 2ZTSA 4WT7A 3EVZA 3G88A 4KODA 2PRZA 4LGVA 1SOVA 4B4OA 2D5AA 1AK9A 1S2IA 1IMJA 1SOWA 2HEGA 2OV3A 2ODQA 2VNSA 1E63A 1FOEB 2X0KA 1GCIA 2XCUA 2EDAA 2FG7C 3SK0A 4G07A 4UBOA 1WSDA 3TSCA 4BDSA 3VNBA 4C2BA 1V2GA 4ZEOA 4C6HA 2JJQA 5F4BA 3F74A 3BQ9A 3HLTA 1LLDA 4JVOA 1I4OA 3JD3A 5E3IA 2A1TS 2W8BB 4DA9A 5DHRA 5HF6A 1AMUA 4CIXA 3GAAA 3SVZA 1P2GA 3CZCA 5EJAA 2IYAA 2D5CA 5KHAA 1JTFA 3T7KA 5KMGB 4MIOA 2YXPX 5J59A 1LTQA 2NWQA 1D04A 4LJ9A 4PX3A 4K0KB 1IXZA 5E38A 3CX4A 4WKBA 3NIBA 3SSMA 2IZZA 5F7ZA 2GARA 3PNQA 2I0FA 5KTKA 5HF8A 1OI2A 1OVMA 2BFPA 2LCIA 4Q0MA 3EJ6A 4MP6A 3ABQB 3HJTA 1UBSB 2QORA 2YXDA 1ZY2A 1EX6A 3HNPA 4PIVA 1WZ2A 1R8QA 4NZMA 3RU9A 2FWPA 4HEHA 4C6RA 3GLIE 2MYTA 3I72A 2GTIA 2Q3HA 1DO0A 3EA5A 1E6LA 3CF4A 1WUYA 4JK3A 4W1RA 3VSCA 1DQYA 1FC0A 3P9PA 4BTLA 3S2GA 4DPLA 2J09A 5FWXB 4UQLA 2YC2C 4HD8A 1Q14A 4O4LB 3BCRA 1C9DB 2HJVA 3Q7PA 5U4QA 4MI9A 3B3GA 2DBYA 3GK3A 4RJJA 2B8WA 4CWAA 4RMHA 3EQ9A 1XA4A 4RTQA 4BUCA 1BOFA 1R6BX 1Y9ZA 1ZMTA 2VR1A 1GQRA 4D4JA 1P80A 5E4FA 4A1FA 5AHRA 2R1VA 4JP1A 1Q11A 4PYNA 2WJAA 2BKXA 4KUEA 5AHXA 3CRZA 2BMEA 4IJQA 3AONB 1A82A 1CETA 3DO6A 1USWA 3D2LA 3ZTWA 2FPMA 5FA8A 2ZIWB 1NG9A 4P4SB 4TUYA 1KI9A 5KYGA 5ES3A 121PA 2QHXA 1ISHA 1AUQA 2Q1YA 3RQIA 3QX3A 4KR7A 4BPRA 4DSUA 5DW0A 2B9VA 1HETA 1YOBA 5LM3A 1M76A 4NFYA 5HFAA 1PN3A 4KUGA 4R8MA 4WNYA 5JD6A 4MB6A 2X40A 4RK6A 2QV0A 4I3HA 1PTJC 1V39A 5ALWA 2JK1A 2WHXA 5G0WA 3TG2A 1F4PA 2CDRA 2G08A 3AUKA 1DTSA 1NBWB 4X60A 5EPEA 3FSGD 2D1RA 2H4WA 3SKXA 3E58A 2HJHA 3I04M 1A96A 1S2DA 3I9MA 3LVBA 4H7PA 1XXHA 1CR4A 3NBFA 2W00A 1GKUB 4PG7A 4AX8A 4U00A 1JEQA 1T5IA 4XQCA 1NQAO 2C96A 4XIYA 5IYZF 2ZRMA 2VDOB 5F2NA 1UQTA 1L9XA 2JGFA 4D3SA 2B92A 3KB8A 3K1AA 3KKNA 4AU1A 4CTOA 1OXBB 3I6YA 3NQ41 4KQ6A 4A0QA 3BWDD 2RGNA 3CN9A 4KQ1A 5I8PA 4DB2A 5LZ4A 1U8TA 1MPTA 4L08A 1J22A 5AOCA 1P7CA 4L72A 1JIQA 2VP5A 1V8BA 1BROA 5CT5A 1GGJA 3T0GA 4XWAA 4H27A 3JAWA 1KFCB 3O4GA 1V1MA 2YX1A 4J2HA 1UP6A 2JGNA 3FCUB 2RI0A 3PPXA 4E46A 4IDBA 1I0ZA 3V7FA 2D59A 3HXLA 4I1RA 3MUFA 4UE2A 1VSVA 3TIGA 1S2MA 1JR3D 4XVQA 4B7CA 2XTNA 1LWOA 3PDCA 1T1EA 1S8FA 2ATCA 3IODA 2H06A 2GXAA 3MPOA 4J16C 4BO6A 1XTZA 1Q44A 4AN1A 4BKUA 2C20A 2PZLA 1GLGA 4D9KA 1SQ6A 4V39A 1NRJB 2OOSA 1MO3A 1XGKA 2UYGA 2XSZD 4KWEA 5ALIA 5TY0A 4RIIA 1OA0A 3PG5A 2ECKA 1BYIA 2YL2A 4KOEC 2UUOA 1YRHA 2X3FA 3NC0C 1XMPA 5JPDA 3DE0X 1XZAA 3LQFA 3H2JA 1A4RA 3FOAA 2JD0A 2VTVA 4TTVA 4WWHA 2IPNA 2ZS8A 4ZV7A 1FMTA 2EG5A 3MCZA 1RC8A 2C9MA 1U9YA 1ZJ5A 2PMDA 3ED5A 5C32A 3Q6MA 3RW9A 4ZFNA 1V6AA 2D2IA 3MWFA 4U5XA 1M6NA 2VJKA 4UHCA 2VNHA 3OE7D 3W7AA 1O97C 3A9TA 2ZWPA 1OFTA 4HJXA 2E0IA 3RSCA 1ECJA 4CMAA 3O26A 1R4AA 3PKIA 4H6WA 3WOVA 4HBZA 5HX7A 3N8KA 4Q9KA 3DWEX 4GO1A 2C3PA 2Z6QA 2BBSA 2I67A 3HY4A 4OMCA 1JEEA 2COEA 2BFFB 2Z04A 3A31A 4PFQA 3ORFA 2V9PA 3HDHA 4UHHA 2P40A 4MV6A 4ZRNA 5ILOA 1BMFD 4KG7A 1JTEA 1TKBA 3B3FA 1UODA 3PWTA 3A1UA 3A3KA 3OJLA 2ABWA 3H0CA 4KDCA 4KLZA 2G9NA 3THXB 3AGQA 4FVTA 4FFBA 4CMCA 1EHIA 2XTMA 4MOWA 4B1FA 3O8DA 4ITRC 4PYLA 2Y76A 3A11A 1O96A 2ES4A 4YV1A 2GKSA 4RMNA 4FYPA 1N2GA 2SNIE 4PSCA 1AA6A 3BD9A 1MQSA 1KFBB 1DX4A 1KO1A 1QM5A 1RAHA 2RHDA 3QVOA 5HGXA 5JZOA 2RE8A 3CH5A 1WHSB 3KAQA 4E33A 1HNXB 4UUPA 4RADA 2Q2WA 4DWWA 3AHFA 3ADCA 2YOFA 5L40A 3V4PB 3ADDA 4DDVA 1VRVA 5KNLA 2FFAA 1FB5A 2GRUA 2DLNA 4A9AA 2DGDA 5AI0A 3TKYA 1VCNA 3KHTA 1H66A 4I1YA 3G2PA 1VE7A 4HBGA 1MC5A 2REOA 3WS7A 1L4BA 4E7PA 3H11A 2R6R1 2D1QA 3BXXA 2AFIE 1XQ9A 2GZHA 3H3XA 1LDGA 4AMUA 3AHEA 2RH8A 4V0RA 5IANA 3RYIB 3EIOA 4ZTZB 3JD1A 3K16A 5J63A 5NULA 3S8MA 1EE1A 1ODSA 1S2LA 4FMCB 2AFRA 4EKGA 2O8EB 4C0KA 1DRUA 4E08A 4YP9A 4BAZA 5AW0A 1DCTA 1U7ZA 5CCEA 1MGPA 3H16A 3DD5A 2R6JA 5HXAA 1C8KA 1O87A 1JAIA 4UVEA 2I4NA 1Q0HA 3OJFA 1B8VA 4E3WA 1V5GA 2HB6A 3O31A 4WJZA 2VJPA 3GJ8A 4G85A 4IIGA 2PX5A 2Z6VA 1DOHA 5JISA 1GRRA 2W5UA 2XNCA 4RH3A 4HWPA 5DYYA 4QC2A 2OGWA 3G7NA 1NKTA 4NJEA 3U9SA 4CLRA 3HJNA 1UT8A 3FZNA 1Z0ZA 3IKTA 2C1XA 3NP7A 2Z83A 3ZGXA 2IHZA 1K0UA 1ZGZA 4PVCA 1KSFX 3HH8A 2HCTA 3MSXA 4TKLA 3A3NA 2VRCD 3M89A 4RORA 3F6PA 1JH8A 1U3CA 2Q5CA 3OJCA 5BN1A 3I6MA 2ASVA 3SQMA 2W42A 3THYA 2J7KA 3RWMB 4JUAA 5HDBB 4IFBA 1DC7A 4XVHA 5J2UF 2GZAA 3D4IA 2YOGA 4DGSA 4A0SA 5K0SA 2DLCX 1SCDA 2H31A 4JYMA 3KPWA 1YQWA 4N3AA 4R3WA 1JB9A 1KYVA 1ZVJA 3QXSA 1HC7A 4NCIA 5I9IA 3R0XA 3OOYA 1A8IA 5T8KA 5DK6A 4IJVA 3OP1A 4QBIA 3I45A 3FCYA 1Y8RA 3FPHA 3KQYA 1NR1A 3QEKA 4DSAA 3SBXA 2Q5LA 3FMPB 3ZIDA 1P9RA 1V6CA 3PGA1 3BGSA 4KWHA 5LUBA 3SZLA 4B73A 1P73A 3DF9A 1U1EA 4NBWA 1RXWA 1XQ6A 3SX2A 2XQJA 1Q1BA 3IVAA 3UAGA 4R1SA 3H9CA 1MZVA 2VDRB 5I5GA 1G2QA 2DMRA 1ONPA 3LQKA 1YAJA 3MEQA 2JBAB 1QIMA 2TMGA 1NGSA 3HA2A 3T41A 5KX5B 3K53A 2CK3A 3G5LA 3OOHA 3S28A 2BEVA 5KJ6A 3R3XA 1MUUA 5ALJA 3DULA 4IHKA 4QJ3A 1J1ZA 4OPMA 4I4NA 3ZGOA 4FE3A 4CIVA 3V32A 1M6VB 1K4YA 2J7PA 3ZWXA 5JXIA 4CLOA 5J1SB 1L6RA 1IRIA 2I9PA 1XTPA 3H6GA 4KQFA 4COOA 3JW8A 1HG0A 3HEAA 4KL8S 5FA6A 1N92A 5EIOA 2PX8A 1WO8A 7YASA 1O5TA 1TI7A 3AFMA 3NANA 1PJ3A 1SG9A 3IPCA 4IO1A 1Z7WA 5DLPA 5G0UA 3RS5A 3W3AH 2HGZA 2PSEA 1GG9A 3CF6R 4B3CA 4BNHA 1QJ4A 1RKUA 1GNQA 1XB2A 1YV9A 1URPA 1M2GA 1PJQA 3EXEB 3M1AA 4KK4A 4KQEA 3AETA 2FZCA 4G3XA 4RS4A 1YC5A 2D7DA 4KFCA 3OIGA 3QYPA 4HSEA 2OFWA 4KQJA 3LGXA 4FNOA 3UWPA 2XUAA 1L5QA 2WUEA 3A25A 1EAMA 3LD9A 4FOTA 3ZBPA 3CLVA 3ZCUA 4NBVA 5BPFA 3RSQA 2OK8A 3LGSA 4DLSA 2ZYRA 2EKLA 3K1ZA 3LECA 2ZRHA 3V8NA 3I76A 4B76A 1NLYA 3ASZA 4HC4A 4OOEA 5JC8A 2OGUA 3OKCA 2KBFA 2A58A 4US1R 5DNUA 3Q8KA 3A37A 5DOVA 5IC6A 5LXTF 3VPXA 3UW1A 1ZGGA 4H08A 4MSUA 4FCVA 4JJEA 2WWHA 4L4UA 3L77A 4QHSA 5KEIA 4EG3A 2XV1A 4ER5A 3GA0A 2I2CA 4URVR 1XQVA 4NZZA 4U2CA 1ENPA 4IINA 3VVLA 4O59O 1GRVA 4G97A 3K0SA 5M3BA 3I39X 3LAWA 4MP8A 2PS9A 4E2FA 1OFUA 1NR7A 1YHZA 1YSCA 2WILA 1K7CA 5JSYA 4BBAA 3F7TA 1KXJA 1ML3A 4C30A 3HMKA 2EKZA 4H77A 1NT2A 2XT0A 2FPIB 3BCHA 3CH4B 4J43A 4WERA 1XO1A 3H4MA 4MICA 1T8YA 2JDIA 2OZKA 5EJGA 1KPGA 1S3SA 1SUBA 2BKEA 2H8KA 3CVOA 4LYYA 5ICFA 5TR9A 3B53X 1S2NA 1FDRA 1K5HA 3P9YA 1X13A 5DTQA 3T1VA 2G6TA 2IZ6A 3UMRA 1DELA 3ZK7A 5DHFA 1K97A 2I71A 3WADA 3ZXSA 5IC5A 1KDZA 1DBIA 2X8AA 2XH8A 3I2GA 3TOVA 5JAIA 2JAWA 1H05A 3BE8A 3HO6A 4KGZA 4JH0A 4OHCA 4RPJA 5BOVA 2PNJA 3LY7A 3RYHB 4Q24A 2R8XA 4Q9HA 2WRZA 3ABRB 3AFOA 2W2KA 3IAS1 3JQQA