5D51S

Krypton derivatization of an o2-tolerant membrane-bound [nife] hydrogenase reveals a hydrophobic gas tunnel network
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
264
structure length
264
Chain Sequence
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Krypton Derivatization of an O2 -Tolerant Membrane-Bound [NiFe] Hydrogenase Reveals a Hydrophobic Tunnel Network for Gas Transport.
pubmed doi rcsb
source organism Cupriavidus necator
molecule tags Oxidoreductase
molecule keywords Uptake hydrogenase large subunit
total genus 77
structure length 264
sequence length 264
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2015-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5d51S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5d51S02
1UBJS 4U9IS 3ZE8A 3USCS 3ZEAA 1UBHS 4IUCS 4KN9S 4UE3S 1UBOS 3H3XA 4URHA 4CI0B 1UBRS 1CC1S 1UBMS 1UBTS 5D51S 4UE2A 3ZE7A 4OMFG 4UD2A 4KO1S 4UCQA 3AYXB 1UBLS 1YQ9A 5A4IS 1WUIS 1UBUS 4U9HS 3RGWS 5JSYA 1H2AS 1YQWA 4KO2S 3ZE6A 1H2RS 4KL8S 4UCXA 5ADUS 1FRVA 3CURA 5JRDS 5JSUA 1FRFS 1E3DA 4UEWA 5A4FS 1WUHS 1WUKS 1WULS 4GD3Q 3MYRA 4KO4S 4UPEA 4UPVA 4KO3S 4UEQA 3ZE9A 5A4MS 3CUSA 4TTTS 1YRQA 4UD6A 4IUDS 2FRVA 4UE6A 5JSKA 4UQLA 5JSHA 4C3OB 4UCWA 5JT1A 1WUJS 3AYZB 1UBKS 4UQPA 2WPNA 3UQYS 3USES 4IUBS
chains in the Genus database with same CATH superfamily
2JAHA 3K8YA 3KEOA 2Q07A 1ZUNB 1SFRA 4I36A 4P81A 3KOUA 1HBJA 1G7RA 1EVEA 1Z62A 1XQ6A 3OBIA 3SXUB 1VDMA 2C5HA 4ZVVA 5CP8A 5DGIA 3SY8A 3JD1A 3EIWA 1CR0A 3BWCA 3GVPA 4ALNA 1KRHA 1NM5A 2QZ4A 5ARDA 3N53A 1C30B 4KQMA 1F48A 3AEUA 3M4JA 3ICQB 1CDDA 1RQ7A 2GZHA 3O26A 1ECCA 2X1LA 3TWOA 2BFFA 1DAKA 4P34A 3OPQA 5ILGA 1C1XB 1KK0A 4JUFA 5IKMA 4RD6A 1FL9A 2DBYA 2G40A 3QLTA 4NYMR 1YC2A 2BONA 4XYBA 5AKYA 2H92A 4CTKA 3ZV5A 1VB3A 4KCGA 3QKIA 1V9LA 5CA0A 1C3XA 3VUFA 3JYPA 4DLVA 1AJEA 3GFRA 3PT5A 5EIBD 3UJ6A 1VM6A 4RS3A 1Z6PA 4RJKA 1WCV1 4J3JA 3R5HA 1OF1A 2OQRA 5KYGA 1EU1A 1JV2B 3X1DA 5KTYA 1JSLA 5BW6B 3I45A 1UT6A 1XEAA 2I3DA 3NRJA 3ZJ5A 2I2CA 4YH1A 1A7UA 1DOHA 3EYAA 4GOLD 4PAWA 4I7EA 2Q5FA 3G7UA 1DXQA 1G5FA 1GTJ1 2JGJA 4Y9UA 3OOWA 4ANFA 5ITVA 3BB3A 3FWPA 1SD5A 4IS3A 4PZPA 3U37A 4JLJA 2J30A 3ZHOA 1QSGA 3OCWA 1ZVJA 1X2EA 3ODGA 2HHJA 4PG7A 5COQA 3WIVA 2PKQP 2Q2WA 2IXGA 3EFOB 4INAA 1LLCA 2C58A 4GKBA 5HGJA 4WKNA 1QONA 4IHJB 2BV3A 4JS0A 4MUBA 4B6JA 5JZVA 2PQ2A 2ACVA 3UUGA 3I6BA 4UTRA 1NW3A 2O0HA 2FUG6 4ZC8A 3ROPA 5JYEA 4J2OA 5NULA 2Q7OE 2V4MA 1TUIA 3GVCA 4YUZA 1W73A 2OVFA 2X9NA 2V7TA 3DQPA 2BHLA 5AM3A 1JR6A 3KELA 4TKVA 3IP9A 3L1UA 4CGYA 4EBFA 2CKMA 2WV9A 2ZB7A 4ZP1A 5JLJA 4EZEA 4U39A 2Z4RA 4ZVRA 3WYNA 3ZY5A 3ASUA 4B17A 1U7TA 3H2SA 5I48A 3WIEA 4MR8B 2UDPA 4C0HA 2UAGA 3A9RA 4ZI3A 3BRCA 3ZG6A 2ZTUA 3IERA 1B6TA 2JC3A 1W6RA 3KE9A 3IIMA 4GWGA 4MPJA 1TE2A 1AQJA 2BZ1A 4MGZR 4IXNA 5EJGA 2G4LA 3LDGA 2Z98A 3MJRA 4MROA 2ARKA 3VDNB 2QAGA 1EJBA 3WGLA 4LN1A 2DKOA 5JASA 4OLAA 3EXAA 3S29A 1ORWA 2CJYA 5GONB 3JQ7B 2XNSA 2DCMA 4BU1A 2DERA 2VK1A 1PQPA 1C9MA 2BHSA 2AT1A 1UMBB 3R23A 3TRDA 1GTZA 1V4BA 2JARA 4I3HA 3PQ3A 2ODWA 1AHPA 1LDNA 3HU3A 2AK2A 3OU2A 5MHTA 4ZV4A 4NENA 4I9NA 1AKYA 3MXOA 4OLJA 1P6QA 3G2NA 3IPAA 2ALJA 5DEIA 3VPSA 3GCXA 3HXLA 3VJRA 5DYYA 3SVZA 4ZHSA 2WPDA 3B3AA 2VATA 3E7WA 4H7JA 2HPVA 3EXHC 4PYIA 1OXSC 1WIWA 3ZE1B 5TQ0B 5BQXA 4Z4GA 2MINB 1IM2A 2H3EA 1W0KD 4PBTA 1TM4E 1UJ2A 2IL1A 1H4VB 5EKTA 3SC2A 4RCYA 4ZCSA 3TBHA 3MCTA 3WLSA 4BWVA 1QIIA 2CVOA 5IJ0A 1B2LA 2XECA 4PN3A 4TRNA 3BULA 3MRXA 4MV1A 2QMYA 4LZNA 4ZJYA 4D4JA 5HFNA 1KDRA 3NWPA 2NADA 1W5TA 1LX6A 1O9GA 3OQIB 3GAAA 1NF2A 1E1QD 1YXMA 3EJ6A 1XZHA 2GNAA 2ZEJA 4IIFA 4R1OA 2JF0A 1ODTC 1BN7A 3HWWA 3DE4X 1NVUQ 1S8FA 4IZOA 2R1TB 3SYTA 3WRYC 4R4JA 5JDIA 4ENVA 1TA4A 1WQ3A 1W9HA 1WBJB 3E23A 3QY9A 4BQQA 2E4XA 4F46A 2KPOA 4BO3A 3PXBA 4YPVA 1QUEA 2F59A 3LMKA 2WD7A 4IIHA 4DLZA 1RE1A 1YDGA 1EI9A 4EDHA 2XWSA 1UOQA 1UOOA 4UJ5A 5CYFA 3AFOA 1L4LA 1E3JA 2IZ5A 3C3KA 3C98A 3G0DA 4NI5A 3K0FA 4UUAA 1B76A 2FN7A 4MQ6A 3JYQA 3P5SA 4FGKA 2ZIFA 4NZ9A 4TTIA 3ZE6A 3M1IA 5KOHA 2H1LA 3ORSA 2EFDB 4D82A 4Z1OA 1K1EA 3CJTA 3CZMA 1EVKA 2VAPA 4PLWA 1ABFA 2WJHA 2GJAA 2DR0A 3C74A 4RKEA 1ZIPA 5TARA 2QG6A 1G5PA 4YIKA 3SLRA 2O8CA 2ET6A 5J47A 2HEGA 1NRIA 2A7QA 1OZAA 2IH5A 4A10A 2CEKA 2EIHA 2P2LA 3Q3VA 2VJYA 2PH1A 2QNIA 3V4VB 1A9ZA 3D0KA 4DHWA 1G7TA 1GYRA 1OT5A 2WU3A 2PUTA 4QQ8A 4HDSB 1MVLA 5C5EA 1SURA 1RKVA 4X1KB 3DDZX 3UB4A 1U9CA 1UJ4A 2VDNB 2AW5A 2XMDA 4URWR 3MTEA 2OBBA 2GXUA 4YRCA 3JY6A 4Y98A 3SF8A 3ND6A 2MMGA 3L0YA 3X2EA 2IS4A 2WHEA 2XCIA 4EYQA 4DDHA 1JKFA 3NT2A 4AJNA 4DQUA 1OVGA 1Q20A 2OM6A 2X0JA 3KEQA 2UVDA 4WFQA 1O54A 4TSKA 1LFAA 3DH0A 4G2TA 3LPCA 3AHFA 3DLTA 4GLJA 3TEFA 1KZ7B 3F3MA 2GCOB 2ZYGA 4R8MA 4YP5A 4EG0A 3MC1A 3HN7A 1JEYA 3Q5DA 4OAQA 1FTGA 1CZNA 4U8GA 2L18A 3FYUA 5KUTA 2OHGA 3FSRA 3U80A 2ZLBA 3NT4A 5LM3A 1EWQA 2GO1A 4JT2A 2PKCA 4D9NA 1H1LB 4EUFA 2E48A 4CR6A 1I2BA 1KEPA 1YVUA 3KZMA 5FNZA 5KYNA 1YCDA 3TCXB 3WWEA 4DLKA 5MF6A 2VRCA 1GLGA 5LMNB 2ZYUX 1DADA 3H4MA 3Q7QA 3WYCA 2B8NA 5JS7A 2R2AA 4L3WA 4RVCA 2Y6UA 1ORVA 3DMYA 1UMCB 2PBFA 4G01B 3RRJA 1ZUIA 1RPTA 4BNJA 1GVNB 1KH3A 4GBGA 2YL2A 4KQGA 3VR6A 1RZ3A 5EZQA 1B73A 3I4FA 4ZT2A 3H7AA 2QRVB 4MKGA 4FHZA 3Q88A 2H5IA 3F6RA 4IX9A 2DUMA 2QTVB 2RHTA 1ZVMA 1F5SA 3ORYA 3V8EA 5FUMA 4H4EA 1WS6A 4MUGA 1FFBA 1GXSB 1V39A 3KQWA 4X20B 4ZODA 3S2UA 1JR3A 2YIJA 3OIFA 2GT1A 4M54A 3L1HA 1OJ7A 1XHEA 1Z7BA 3ROMA 4J90A 3I37X 1VYHA 1DQPA 1R12A 3AETB 1QPGA 1P2UA 2XTNA 2V7WA 2DBZA 1PK7A 1SQFA 2GEFA 1VPEA 3SICE 3UV6A 2WA1A 2WKWA 3K1ZA 3DEHA 2JLQA 3B8HA 4DVGA 3R3JA 5B6JA 1G2PA 1DC3A 3U1BA 5A9SA 4JXJA 1LEHA 1NR1A 4KX5A 4X95A 4LYDA 2HJHA 1JB1A 3KYDB 1CR1A 4XJXA 3EK2A 3MMXA 5KJ1A 1T24A 4FZ5A 2VI5A 5MN5A 1L5YA 1TJPB 4ID9A 2NMVA 1OZGA 2WJVA 2QS9A 4IZIA 5A06A 3TQRA 4B1FA 4E4YA 1JAYA 3EGEA 3AINA 1XUOA 4BNDB 5L95A 2W6ID 4Y2QA 5F7XA 2G70A 2RHLA 5BW4A 5JHHB 2GEUA 4WLOA 4OXNA 2N3ZA 3T3GA 1SELA 1QGOA 3LPAA 1BO6A 2VDVE 4O25A 4B33A 5KWEA 3C7DB 1FP4B 1TEHA 1TDJA 2I9PA 2JHGA 3LUGA 1XCOA 4HMPA 1Y9JA 4TTSA 1TJ3A 1LI7A 1MG0A 1EWYA 1XZCA 2B1RA 3V2HA 2ZIUB 2QD1A 2YBEA 4PWZA 4JP5A 4HV4A 4RTNA 4BEVA 3O9ZA 5KINB 1O8BA 3HKEA 1NJ6A 3E9QA 4XRGA 1Z2NX 1OA0A 3GAZA 2NIPA 3I9KA 2WM3A 4U7FA 1H9CA 1JVSA 3PUZA 1NSTA 1FVXA 5CIYA 1KC3A 1ONBA 3RAPR 3VH4A 3DW3X 2CNOA 1X3LA 3NTOA 3ETEA 1SOMA 3RYTC 2ZAIA 5AKJA 3VM6A 1GNRA 2PVCA 2MJLA 2YVQA 5DTEA 4CL3A 4DQVA 5LD2C 1KMCA 2IYFA 4PC7A 5JPIA 2QMUA 3C5VA 1LLQA 1YBVA 2X0NA 2GI4A 3AR4A 3E9MA 3HM2A 4J0DA 3STYA 1NOJA 1KO4A 1H66A 3L2OB 3ENVA 1XZLA 1BFUA 1SO8A 2A14A 4X7BA 3W8FA 4C3OB 3ANNA 5JQGB 2HHHB 5KYVA 3PDJA 3RFUA 3OLCX 1RTTA 1K89A 4UU1A 1P5HA 3FA2A 3GAFA 3EDYA 3WLOA 5AESA 5DBIA 4C7MA 2EFJA 2EJCA 3W3AA 5A0FA 1KZHA 2H59A 4AX8A 1VL6A 3A70A 4X97A 3OC6A 3KXLA 3OQNA 5I5GA 1WW3A 1KK2A 1ID8A 1KJIA 4R9RA 5T8KA 3COZA 3CZQA 5KYXA 2ZUTA 1Z5VA 3L8HA 1BU8A 2JANA 3DDWA 1MN6A 4IIGA 3B7WA 1E4OA 3OG9A 1FP6A 1ADFA 3A6LA 4I3GA 2IV3A 3PP8A 4BU0A 3F98A 3OQOA 1N6RA 2OCIA 2WD9A 1BW9B 2VHTA 4GVPA 8ADHA 1C7JA 4I14A 2REBA 1AMUA 4M0KA 3USZA 1QRTA 1QH0A 2J85A 1P3DA 5FBQB 3R0VA 1XF9A 2PBLA 3C6ZA 3UWKA 3CG0A 4A73A 1PBNA 2PSFA 1OBCA 2WC1A 1EESA 4CVNA 3UKOA 3RBAA 5AT1A 1PR6A 4REQB 4O4IB 1GGVA 3WNCA 5DN6D 2O0LA 1YQ9A 3TCNA 2CVZA 2O54A 4IOLA 1PJ4A 3TIGA 1R0BA 4ARBA 1FFAA 3D4LA 3QHQA 1JDZA 1AE1A 1N3IA 1NUAA 3G0CA 3H5TA 3ZHCA 2Y9PB 2NZ8A 4NMHA 4H0CA 1M1NB 2CUZA 4JNKA 2BP7A 3UFBA 4C4SA 4F4UA 2D8MA 3LT1A 3M5PA 1R4NA 5KYKA 2ZUCA 5LDHA 2JHAA 1XDZA 3QX9A 2PKRA 4P3PA 4GO1A 4P38A 5A7FA 3OQJA 1T4MA 3L02A 3W0LB 2YIDA 2IRWA 3ETLA 4S1TA 3GEEA 4DQKA 2ACKA 2Q3EA 2BSXA 2PRSA 2WZCA 4BMSA 1U7WA 2ZKLA 3O75A 3GN2A 3E4DA 4XFJA 1TQHA 1CUSA 1EE1A 3OECA 4JJZA 4WXHA 4CF3A 1DHTA 1IUKA 5T8KC 4CGZA 1L7BA 4NS1A 5JE8A 4BVLA 3PJEA 1E3QA 2JBAB 5GADl 5EMHA 3DUFA 5KHAA 2O2ZA 2BI7A 1E66A 4QBFA 3N58A 3QU5A 5D3KA 2Q3HA 4GS5A 4IOJA 4R9NA 3RFVA 4CM6A 1JIKA 2D2IA 4HD8A 1OH8A 5HG0A 3KD3A 1QHIA 4Q02A 2HFKA 1J39A 3U81A 1O6BA 3SZUA 2HOQA 4F3TA 2R8EA 3GA7A 1YFLA 1C0EA 1IXSB 4LISA 3VHRA 3HJNA 3VPAA 2H7YA 1RJFA 3IBFA 3TN7A 4US2R 3H0CA 2QNBA 2WHXA 4QBHA 3TD9A 4B43A 3LBAA 5DM70 2PZMA 3BE5A 3Q3IA 1VI6A 5FOUA 5KVAA 4QOIA 2HA3A 1RZUA 3I1YA 4EKYA 2C98A 1VKJA 2BGTA 2J8ZA 2XXAA 4K46A 2V1XA 2EGUA 3FW1A 1IZZA 2R6GA 4RY9A 2ATCA 4DCPA 2HTEA 1E7YA 1U3WA 3CG4A 2YW9A 4FKZA 1KI6A 4PYOA 2GSWA 3AY6A 3AG6A 3V1LA 4OMDA 1ZM4A 2Q3JA 2YQZA 3BGOS 5FYQA 5F3RA 3SE0A 3V80A 4JH0A 3W6OA 2V0GA 1C81A 1WF3A 1QF7A 4W5RA 2X4DA 1FMLA 2XVAA 4L08A 1E2EA 3U6KA 2J46A 4Q3EA 5CVDA 1MRZA 3VSCA 3LTNC 4WJLA 4FS3A 4KKVA 1EM6A 2RG7A 4NBTA 1KEEA 3PUJA 3SQOA 3T7SA 1JHYA 5GONA 1TX4B 1FRFS 4L9AA 2MDTA 4YJ3A 1CUHA 3MYRA 2AJLI 4CN8A 1GPKA 3UMYA 4MQFB 5KTSA 3E8SA 5A6SA 3MJVA 4QO8A 2FFQA 2XTZA 4DLUA 1Z3IX 2QRQA 5E7QA 2JD0A 5CURA 1IXKA 2HRRA 2PH5A 4CF6A 1TGVA 4PAMA 5GV8A 5HIJA 2EXXA 4TYYA 3GNQA 4QVIA 4AW9A 4KXNA 1P4JA 3FNGA 2W8BB 3ORRA 1PJZA 4IAOA 4HZIA 5IJAA 4U6NA 4DR7B 1GKKA 3PD1A 3WGQA 5CXQA 1FLDA 2BW0A 3M6MD 4G0XA 4HKTA 2P9BA 3KR0A 1CUJA 3S2GA 4HP8A 1XQXA 1ZNYA 1VOTA 4PLTA 1GCUA 3LFUA 4DR4B 3NBKA 1TU4A 3FYDA 5FHRA 4JI1B 1K68A 4BZXA 4JNCA 3HXOA 3ZKWB 3GLIA 4L57A 3PK0A 1KJQA 2GZ3A 5ALHA 4D8XA 1U11A 5JD5A 5JJKA 3L1IA 2X7JA 2P62A 1H6CA 2D8AA 2FSVA 3ND8A 1CIPA 5H3LA 5CDTA 3LLSA 2C92A 4OAOA 1GNSA 1MVOA 2EWMA 2WSSA 1HL3A 1HQYE 1QK3A 2EZ4A 2ZIWB 2IUSA 2HU8A 1J9EA 2ECPA 3NM6B 3GEIA 2HA5A 3NP9A 3AF0A 1HRKA 1JHUA 3ETNA 4NP6A 2NM0A 1IVNA 3BIFA 1XCPA 5H68A 4B4DA 3TLZA 4G41A 3ZI4A 4B5LA 4K6GA 4LDQA 1I4LD 1Q7TA 4NCJA 1X9IA 1VI5A 3JQFA 4W99A 3TOZA 3ZK7A 4CLRB 4DLNA 5KWIA 4I9UA 3U09A 4TKMA 1RADA 3IESA 4BAZA 4TTPA 2PHZA 1ZEJA 5JQWA 2GKGA 2CMFA 4J75A 4WN9B 1UC8A 3PC8C 1PNTA 5C0OE 2NU9B 3R75A 4RLFA 3EYWA 3S2EA 4TMZA 5FKJA 3RANA 4YGYA 3SC4A 3THSA 2J0EA 3U3XA 2RHJA 3WS7A 4MSUA 1P31A 5FI3A 4B6SA 4DQDA 4PCUA 1QP7A 1ND5A 3RU3A 1EX9A 1M2FA 3GBSA 4PG4A 2YZMA 3IB3A 1QVZA 3L8DA 4WJKB 2WUGA 2H16A 1X2BA 5ETJA 3EC1A 1E8MA 2EKLA 4UM7A 4FJ0A 4QG7A 1TKBA 2QLJA 4F56A 1DGQA 4KAFA 2VIIA 4QU9A 4ZTZB 3ZDDA 5HDBB 2FPPB 3B8EA 3G0OA 3I9JA 4ONEA 1U8AA 4YCNA 2OXRA 1ZUNA 2ODBA 5GOZA 3BQMB 5IT9A 2AX4A 1PI3A 1RI5A 2E4ZA 1F2TB 1QHXA 1MGPA 4MKFA 3HI6A 2HJSA 3B1XA 3WWYA 4OJQA 1DXHA 1QRUA 4I4TA 1TAQA 4F4JA 3VH1A 4G5FA 2FMKA 4EITA 4A9AA 3CX6A 2JK1A 3EC7A 1PE0A 3DVQX 4TUYA 5CPFA 3NI2A 4UXJA 1SIOA 3WJAA 4ER5A 1QIGA 1RYDA 3WL4A 4J94A 2ZQ5A 2VP4A 1N9GB 2GA8A 4EI2A 2WMYA 4IJMA 5BV8A 1ZGZA 1CUVA 4KO4S 1WTCA 5FLYA 3ZGOA 5TPZA 5TPWA 4R9VA 3AKZA 4EI9A 3FPKA 5AW4A 5BXYA 1AB5A 3R4CA 5K01A 3OUUA 2O05A 4YJDA 3L0PA 4GUDA 4BVJA 5LUAA 2BFEB 2PRIA 4NOKA 4XR4A 4ZIRB 4ZI7B 2BI8A 1H6DA 5KSOA 4PGAA 1TVCA 2EG5A 1D2MA 1L5GB 1T1EA 1PX0A 2QTGA 3BJIC 3IT2A 3WRYA 2WLSA 4ERNA 1P74A 1E2DA 1H8HD 3LX6A 1TT7A 5D86A 5JXJA 3FOZA 1Q7RA 1YQUA 1XMIA 3A1FA 5DVZA 3OTOB 1LC0A 2O1XA 4J0EA 4N8EA 4OL9A 1GGMA 1JXQA 5A9RA 4HAXA 1I1OA 1V3QE 3QHAA 1M73E 4ITVA 5LQSA 5LZ4A 4F1JA 3WHKA 2JLVA 3V97A 4UEQA 1JKJA 3FBGA 1I51A 4WXRA 4YJFB 2QRUA 4HFMA 2FJPA 1AA9A 1PW5A 1XZQA 4FMCB 1U1IA 4NMMA 1X8KA 4YV1A 4MP6A 4YO8A 3U61B 2QX4A 1SOUA 2ZJ1A 1QQ5A 5AW2A 4GWKA 4KMRA 3A1UA 1D09A 3TQQA 2GSDA 3WMEA 5A2QA 3I0ZA 3KPWA 3L7JA 3OZUA 1GILA 3QKSB 2VXOA 2HB6A 5CDFE 5AKGA 3V5NA 1OPRA 1QKJA 4IR7A 1K4KA 4MKXA 4OO3A 1R1DA 1SPBS 4I2VA 3ADDA 5LWHA 3W2TA 3UWDA 2PYZA 1FLVA 1GJRA 1YHZA 2I6SA 4JJGA 5JADA 2C7QA 1ZJWA 2GPYA 4KMOA 3VKUA 1GG8A 3SKXA 4X91A 1FSGA 4QDXA 1SZCA 5JNSA 4B40A 1Y3FE 3TRKA 4BN0A 4ND8B 3DR3A 5CA0B 4EIWA 1Z88A 3STXA 1H1TA 4QEZA 5LB4A 2NZJA 2QN3A 3Q15C 3U7QA 1VGQA 1J0CA 1XOIA 5HMMA 1F8GA 1QC5B 2P4UA 5K3BA 1JF8A 1VE7A 3FUUA 1WBDA 3ND7A 1AHIA 3AXTA 1ITZA 3AG5A 3VU1A 4D96A 1Y80A 1Y1TA 1NYRA 2OO3A 1F3OA 1F8FA 2ZJAA 4XGQA 1T9GS 3QVTA 4EHFA 2L19A 3PF9A 4RPKA 4CIXA 2X7XA 4CNQA 3M34A 1H1LA 1QRRA 1ZCFA 4FHCA 3HDGA 3TNYA 2LKDA 1P72A 2O7NA 3F8SA 5FWXA 4Q66C 3PWSA 2I8LA 4TUYB 3UKDA 1Q1NA 5BSHA 1NFRA 4BN5A 2DLNA 2Z3ZA 2Q3LA 4ZMRA 4X65B 3RUCA 4B4UA 1MOSA 1ORIA 4QM7A 2GEJA 2RKBA 3PXEA 4FWIB 5E0KB 2LV8A 3KLPX 3R0QA 5I45A 3OPYA 1N0VC 5EIOA 3FUCA 4AWAA 3LWBA 3RS8A 2GHRA 4HWRA 5GZ1A 5IVKA 3EVAA 3H2GA 5KOHB 3PEYA 1QOPB 4S1VA 3U2QA 4I81A 1ZWKA 1SCAA 1TU3A 3AF5A 4YRTA 2YTZA 4WKOA 2YRXA 4M1TA 2GN6A 3G13A 1AKEA 1HYBA 4YCJA 3VR3D 3AERB 4F2DA 5EQJB 3OO0A 3ZE0B 1YUBA 3C16C 2GPAA 1KMMA 3DWEX 4QEDA 3BGSA 1KVRA 1XVIA 3SX0A 2W2NA 4CL8A 5FA8A 3OCYA 1U98A 2GGSA 4JBWA 4P82A 4F3NA 1NDUA 1V96A 4IFTA 1X1AA 3IIKA 2Q5JA 4OQLA 4XD7D 3WE7A 3KSZO 5M7EA 3DV0A 1EXWA 2CJFA 1KYYA 3U0VA 2MMCA 1TCAA 3Q8WA 4RVSA 3ROTA 4EH1A 3L0CA 5IDWA 1XFAA 1OA1A 1YZGA 2XQVA 1W8DA 3DKVA 3QNWA 4QNMA 4ENPA 3FBWA 3R8FA 4NATA 3VKVA 4C7BA 1JEQA 2QVZX 1T0BA 1GD1O 4X1YA 3SJAA 3BAZA 1NNUA 1NDQA 2YJ3A 3L0SA 4QICA 4AF7A 4R81A 2D5AA 2ZGVA 4O1MA 1USWA 2IZ7A 5ALLA 5L6LB 1U2GA 3G3EA 2AN3A 3E3NA 3TJMA 3VQTA 4R0NA 1ZOLA 4NOJA 1VIVA 4NYIR 3H42B 4IH1A 3RRNA 2GYYA 2A5JA 1DLIA 1CERA 1EEHA 1W29A 2ES4A 2OCBA 2PXHA 4G5YA 2QL9A 1S2OA 2IBMA 2OTCA 5JS2A 2V7QD 2XQIA 3UIEA 1EUZA 4WNIA 2J5QA 4FE3A 3HXPA 3VYSB 3VZPA 4UHCA 4NF2A 5F7JA 4JT9A 2JFPA 4V0QA 1YB6A 2G71A 5FLEX 4NPAA 1I01A 4EX7A 4WBNB 3L49A 1SKUA 3UCFA 2NU7B 1IM8A 1KEVA 2IXBA 4LNUB 5E1MA 2ZREA 1TYBE 1H2BA 1J24A 2KLBA 3ROZA 3JD4A 3TSZA 2O52A 2PX6A 2KM1A 2VHEA 1O6ZA 3T9AA 3HJCA 4YGXB 2G82A 4L4SA 1R10A 5K2MA 3ZDFA 3I04A 2EVWX 4TQ9A 3L1KA 1T91A 4LY3A 2JIDA 3A1DA 1P18A 3NWOA 1WY5A 2OCKA 5HW0A 4IKPA 2XMSA 1SCKA 1SXHA 1SH7A 4FMPA 6ABPA 1A1SA 3I53A 3RM3A 2C7OA 1H8HA 1SB8A 4WNYA 4KSBA 5LZ9A 1LPAB 1PK9A 1SY7A 2AG1A 3NHKA 1UFVA 4YJKA 5AVRA 1QIDA 2FR8A 3PGLA 4M0MA 3V8MA 4D5GA 4G1EB 3F1KA 3KT0A 5FO0A 3PWKA 3LQKA 4OHKA 4IMPA 1PKEA 4ZI5A 4KPYA 2OXTA 3VKWA 5CITA 4Z4EA 5FPPA 1A2QA 2KHZA 5KIAA 1KFEB 2XXJA 3TR6A 4PSCA 5LU9A 3LY9A 1LPNA 3WAKA 2AK3A 2BEJA 5CAEA 1QHEA 2PZ8A 3LCCA 2MTBA 4IGFA 5DLQC 1NUPA 3P32A 5EJ5A 3FROA 5LZ5A 2C96A 1ZQ9A 1BX3A 3F6CA 4GNRA 1UKAA 1KI6B 2X14A 5CM2Z 5KMGB 3LPDA 4RHXA 2WJPA 4YQZA 1YGYA 2ORIA 2HU2A 2XOEA 1RXEA 1S2MA 1G4UR 1ULUA 5CB0A 5JLAA 3C6QA 3QW2A 3HR8A 3AR3A 2O7RA 4HB2A 5DHRA 1VLHA 2CNLA 5I6DA 5IF3A 2ODNA 3OJEA 4ZVNA 3MCVA 1MR3F 1VL1A 1JDSA 3T1QA 1Y8CA 1HQCA 1O94D 1J5XA 3B7GA 5DT2A 3JZDA 1CRQA 4RV4A 4M76B 1KMNA 2A57A 5I7UA 1E2BA 2PE5A 1R8YA 4UU7A 1SOVA 4KDRA 4ACBA 5AW1A 2I54A 1AK1A 3WNDA 1PNQA 1U5BA 2WLTA 1VG1A 2B83A 3FSEA 4B79A 4NBUA 3KFLA 3A6PC 2I6QA 3LQYA 1UKYA 1NYLA 1PFQA 3EWAA 3LXMA 2R6ZA 2FGKA 2BFFB 1Z08A 2JLSA 2NO7A 2PUJA 4JBGA 3VZQA 1KR2A 1TFRA 3W2GA 5JJCA 1WXIA 2W22A 2Q4RA 4BFXA 4PANA 2OFWA 4M9SA 1XMJA 3GGCA 4H77A 3TCKA 4DZZA 4OHBA 1OY1A 3DL2A 4WEOA 1TK2A 2DHEA 4IXMA 3MGGA 1M2WA 5B53A 4EWLA 4HQOA 2V9ZA 4HWSA 4N8SA 2Z2IA 1J21A 1VG8A 3AP3A 1KAOA 3SSNA 4QUBA 3GQBB 4NWIA 2I91A 3CRMA 1JEEA 1NY5A 2XEDA 3AKYA 2RHCA 3M1YA 3VR5H 4TZTA 1OWLA 4V02A 1ODSA 1P73A 2QD2A 2Q6KA 3PRYA 3PXAA 3AJEA 4HDAA 4JKIA 3KQOA 2ON6A 2QVCA 2R47A 3BN3A 4W5TA 4MZDA 2DUJA 3WDKA 1V6SA 2IE0A 4OMUA 3B3GA 3KXPA 4Y9SA 2OV2A 1E2GA 2BGIA 1VCMA 2HDHA 2C77A 5IMSA 3HJHA 3KZXA 2HBQA 2XAAA 1XD8A 2YQ5A 3AYXB 1EFRD 3CHYA 3EWSA 1HKUA 4WWHA 2RGEA 5T6MA 4CE6A 5C46F 4Q4DA 1JQLB 1HYHA 3GT3A 4KAXA 3P0EA 1FFDA 1XDDA 4R7GA 1X7WA 2Z83A 4Y2HA 3HBJA 4AROA 5ABPA 3RTEA 1RXIA 4BFLA 1M2JA 5TXGA 1FRQA 3RVKA 4E2YA 5JWRA 1C8KA 3UT0A 2AC4A 1ZHFA 2LZ0A 3VHXA 3L8EA 3M4XA 1HLDA 1ZW1A 2AN4A 4FFWA 2ZSBA 3OZXA 2HHLA 4I1RA 5P21A 1F8YA 1NVAA 2VFAA 3P2KA 5KTMA 2J87A 4G0NA 3V1MA 1LPMA 2AIRA 3I23A 2CF5A 3LHDA 3THWA 4EB3A 1KEUA 4RH1A 3HVUA 1T6YA 4WADA 3QVWA 2C8KA 3RGGA 2K87A 3LKZA 3WADA 1TUGA 1USGA 4FYJA 3FR7A 4PLGA 4QGBA 5F77A 1KEEB 2FCAA 4FXPA 2QJRA 5K0TA 1LNSA 4J43A 3F6BX 1PDOA 4P4SA 1P0PA 4YYEA 1Q0RA 3CSUA 2RIRA 2LBPA 2NV2B 4JUDX 3AF1A 3FZEA 2CBZA 4LKRA 4TLAA 3UANA 3QXSA 4XYGA 2GM3A 3UHFA 1ZP6A 2C4WA 3MT8A 3KQSA 4JLWA 4U02A 2VTBB 3WR5A 3JCZA 4AIIA 3H2ZA 2V6GA 3GUHA 5LA6F 2YYAA 4CNBA 1A9RA 3OZEA 3PUKA 4NEGA 1NQAO 1H6AA 2O8DB 3C3YA 4EGFA 4JVSB 3I1FA 2IYLD 2OSVA 4I4IA 3P1JA 4KR0A 3VPCA 1XAJA 3GRAA 4HRYA 1SXGA 3VKGA 1RWKA 3QUAA 4O0LA 4QATA 4JBNA 5GV7A 4B73A 5FQNA 1Z5OA 2HIAA 6YASA 2FJUA 3GJ5A 1YIDA 4FSHA 2AMFA 3R3WA 1FUIA 2IF2A 3AP2A 2NN3C 3IAS6 4MPTA 3VZBA 2EQBA 2OILA 4ZOLA 1QH1B 1DIRA 3TRFA 1LJUA 1C2TA 4FX2A 3PX3A 1WSDA 1MXHA 3N2KB 1MO2A 1YU9A 4JP8A 2IYRA 3LC2O 3CINA 4M6WA 3QBDA 1UMCA 2C2HA 1UR5A 4XGIA 2NSYA 4NXMB 2G5GX 1JPUA 1TEVA 4LFBB 2N75A 1N2ZA 4K05A 2H18A 13PKA 1G66A 2D6FA 3C45A 2Q1TA 2X5OA 5JW6A 2R7NA 1T36B 4XYEA 4F6RB 1ZZGA 1RYNA 2G8NA 2QUHA 2BTQA 2J3LA 4DCJA 5IF9A 1ZA1A 2OZLB 3RAEC 5SY9A 3EPHA 4UXIA 4KL8S 4RQTA 2BKXA 4Q47A 3V4RA 4F6RA 3I9V6 5ICEA 4M83A 2RJNA 2WD7B 3IB6A 4L75A 4LRTB 1NI5A 4IQ4A 3EDOA 3A3YA 3DFIA 3FAZA 1MGOA 3OQ6A 4HX9A 4M8KA 4DUYB 4CIYA 2B21A 4B4WA 1TZMA 3MPOA 3O94A 2UYOA 5SY6A 4L76A 1BCRB 1E1DA 2J7PA 3FLBA 1B6SA 3GCZA 4R8RA 5H02A 2QXUA 1V8BA 3S1SA 1C9YA 2B34A 1ESEA 4MR8A 3NHSA 3W5VA 1MX9A 1UC9A 4UU0A 3FNHA 3EPPA 4V3CA 3U7IA 4A0QA 1IBLB 1X74A 1IY8A 1IY2A 2BF4A 2E7ZA 3QX8A 4MRSA 4DARA 1CY1A 3GUUA 4LXYA 1XR3A 1DOAA 1X9GA 2FW6A 2G04A 2VQ6A 4PLCA 3HTXA 4A27A 3IUQA 1P9NA 1Y4SA 2XB8A 3HYTA 4O5OA 1UZNA 4ZDKA 5LLTA 4JQCA 3U5TA 3DO6A 2UUAB 3CBGA 4P8RA 1PZEA 3QVGA 2O3UA 4UVIA 4M9UA 4JD5A 5AW6A 1LW7A 4PHTA 3JPYA 4RZUA 1M6VB 5FTLA 3QMVA 3BXZA 4BHTA 4J8PA 4AECA 1FUEA 1OHHD 2AS0A 4I50F 4N6GA 1MW8X 3BDAA 1LK5A 1L7PA 1YZ3A 5FV7A 4DHEA 1QVRA 2F00A 2V6BA 3IEXA 3JQQA 3OHPA 4KEAA 5ERYA 2XBUA 4DDVA 3ER9A 4HX2A 2I4RA 3A6EA 1F3LA 5AIBA 5KC9A 3HHPA 4TLBA 3RS9A 3I6IA 4ARSA 2H1OA 4PC6A 1NQOA 2LUOA 2NUBA 2GZAA 3DZKA 3E05A 4LXIA 4RTLA 5FWXB 2DMRA 3GVXA 5EXSA 1E5TA 1A9PA 3EHDA 3WFZA 2XEXA 1PV2A 4QHYA 1KYXA 4RKWA 1G5TA 3WXMA 4JDPA 4DZRA 3PICA 5EPUA 2CHVA 4DAOA 2YWGA 3FYUB 5KTPA 3GWGA 1FDVA 1Y9AA 4LJ7A 3F5SA 1TIPA 2OLEA 4MXDA 4H3HB 3O0DA 4ZHQA 4ZK6A 2XE8A 2BGJA 3IQDB 5J1SB 2BBOA 2WJJA 1K0UA 3E1KA 4YRAA 4DANA 3GGGA 3LA8A 4C1NA 1HDYA 2YIVX 2XB4A 3FE2A 3M83A 2MOKA 3DOIA 4QYSA 5GIOE 4LDPA 4EJ6A 5C1OA 2OHVA 4RD2A 1S96A 5EFOA 3R2JA 3FZGA 3TR0A 2XMCA 4G23A 1RJEA 4HSGA 3IBCA 2Z9BA 4HRXA 3FMOB 1BVYF 2HO4A 2Q49A 3TDNA 1KJJA 1GCGA 3EF0A 4MICA 4CKWB 1L7RA 3GFGA 3LBIA 1U81A 1CUYA 4PO9A 4D9HA 3E9NA 2C5BA 2JJ1D 3P2JA 2ZTLA 4JJKA 4JC0A 3SFZA 3Q41A 2B35A 1V1RB 3A2LA 3JSXA 5D1NA 2XUGA 1HE8B 1L7QA 1UAYA 3NTUA 1XPRA 1PT9A 4M36A 4QDJA 1T3GA 4YMUA 1KTVA 1SA0A 2NPFA 3BCUA 1EFPB 4U00A 1IHOA 1Q15A 4UTVA 1CPYA 1CJKC 2I99A 1N0WA 5AOAA 3R9XA 3ZD6A 1CB0A 2GF0A 4BX0A 4G9EA 3ILYA 2PGIA 2AE2A 4GXQA 4FU0A 3DFKA 2EP8A 3GLKA 2M6RA 3OJ0A 1R74A 4FIDA 1UBUS 4MI3A 3RF7A 5BQFA 4Q9IA 4ITRC 1EFTA 3R1IA 2LIVA 4TVOA 4BIIA 1YDFA 2XE7A 2OHJA 2RGGA 3TL3A 1RKUA 4OKIA 4P4NA 2HR1A 1M1YA 2JK0A 5JH7A 2VNHA 5DBGA 3WTCA 1SXQA 2B20A 2ZIXA 4G5RA 3RVOA 3ZOKA 2ZAYA 5DNAA 3ZGXA 2DECA 2W2KA 4KTVE 4D9IA 3U4MA 4F1KA 4HDNA 1AF7A 3SCZA 3TNDA 1YI0A 3R20A 3F47A 1T34A 4JBYA 4LUCA 3FTCA 1RRCA 1P6UA 2XOKA 3PHCA 4H1TA 2K7FA 5C32A 3FGOA 3QUSA 4YP6A 1Y8RB 2XF2A 2GASA 3A1TA 5JJIA 3P9RA 3QGMA 4JB0A 1WE2A 2IZZA 1UK6A 4OGGA 5BUZA 2WIJA 1QHSA 3LOPA 2J5XA 3N8NA 4E21A 5JNVA 1H2AS 3LUJA 4R1PA 1PHRA 2VPPA 4ZQCB 3QPWA 4RMGA 4ZTBA 5GVRA 2QPOA 2W0MA 4ZQHA 3UJPA 4J16C 5F76A 2PN1A 3PPWA 4CJXA 1XQYA 2VYVD 1RPZA 2MSDB 5FNVF 4N0PA 3RUFA 3KHUA 1ZO8A 4L7QA 1LDMA 3ZC3A 2GBIA 2YNMD 2Q5CA 4MWDA 3ZDQA 3D8BA 1W4AA 2GM9A 3BOSA 3E8XA 1UBGA 3PTLA 2AJDA 4FOLA 4BS9A 3CH5A 1YZQA 4QU0A 2NTEA 2VP5A 2VNSA 1M2HA 2Z2ZA 1GZHB 2CYBA 5JMPA 2BEWB 4ZOEA 4ETIA 3ROQA 2C57A 5L4SA 4PPQA 2PRJA 3K0FB 4FJ2A 1OAKA 2WYUA 5EXXA 4UEOA 2YYZA 4KWHA 2R44A 4NHOA 4C03A 3GELA 4IIBA 4MITA 3TQTA 4D7AA 1NHGA 1YBAA 2INGX 1Z6QA 5ER9A 4AY3A 2VDWA 4RVUA 1EGQA 4KFRA 2EL7A 4EUKA 3KZVA 4YB8A 3SYRA 1UDCA 2BM1A 1N2CB 5B2ZA 1U1CA 3UZUA 1FCJA 2Y0EA 4WW0A 5CW2A 1AKQA 4EUHA 3N2NA 1RAIA 3NUQA 4YNBA 3VDQA 2DR2A 1E2JA 3ZCSA 3BH0A 5C4MA 2PL5A 3AKEA 1QJ4A 2JJMA 3PNPA 4S2UA 3NDBB 2IUYA 521PA 3WNQA 2UZ1B 7ADHA 2IZ6A 3U7RA 3V6LA 2C95A 1RXWA 3DLIA 1RPNA 2COUA 1P5FA 2QLLA 3IMCA 1UKBA 1KSFX 3MLAA 5G4LA 3RHTA 1WMEA 1RXYA 2GR9A 5D01A 2FZGA 3T1TA 1JIQA 1C7EA 5IX8A 4C29A 1KPGA 3LQ2A 4EPTA 3DPIA 4WFJA 3OZVA 1V35A 4AUMA 3R7DA 1BDIA 4C2TA 4L4UA 5CVEA 1NKVA 4YRFA 1VP3A 3AM5A 3DCNA 3ZD7A 2H1SA 2EKQA 3E48A 1ZH4A 3MT9A 3IQXA 5EUQB 4D43A 2VTBA 4YYZA 4LC9A 2P40A 4QRDA 3RFCA 1MUUA 1N5OX 2Q9AA 3RTDA 1MTOA 2H7VA 2XX3A 5ALNA 2QT1A 1TTHA 1UBOS 1TA0A 4RIIA 3FHLA 3P71T 4TROA 1CJSA 3SYMA 2GJKA 3M1LA 4ZZIA 1GGEA 4Q39A 1SBNE 4YAEA 2C0CA 2O3JA 5FRDA 5HX7A 4O8CA 3LSYA 1FLAA 4RZQA 2IU0A 4F2WA 3UJDA 2C4HA 2G6BA 2GAAA 3HCWA 2H11A 3FLAA 5AUNB 4CTNA 1ZC4A 3RUPA 5DHFA 2NXJA 5AYVA 5EMJA 1KVTA 3QPVA 2FF5A 1HMPA 2IPMA 1MO3A 2HC9A 1DIHA 2CJXA 1EA7A 2R1VA 1NN5A 3QNUA 4YCSA 3QKRA 2B6NA 2XW6A 2JA2A 3MGKA 4KE7A 1ZM3A 1GFIA 2Y0PA 3PIRA 4IV8A 3RAGA 4AXBA 1EFAA 1O8CA 5CT9A 2QX7A 4L5YA 1P29A 5IT5A 2JLWA 3W6ZA 3L04A 4UMDA 4XFDA 3RSLA 5E6RB 1K9SA 4ZCPA 1RCUA 2PL3A 4J03A 2YWRA 3SPXA 3EE6A 4CUZA 3R3SA 2WIDA 1K6JA 1REQA 1VRWA 3LXXA 3JD3A 3OT5A 3PZBA 4HB4A 1Y48E 5DU2A 3WBJA 3CEJA 2CLKB 2PGXA 4YMWA 1E9DA 3RABA 1NG9A 4GDMA 2IU3A 2EATA 3PWZA 1JDJA 1V45E 1PZXA 1OOEA 5SZIA 1PSWA 2VJMB 1N32B 4EFNA 1G60A 4XM0A 1GFZA 3KXDA 4ZT7A 2OBNA 1KNQA 4KDCA 3DONA 2IEAA 3R7WA 3ZX4A 2PZEA 4OYHA 4DF3A 4F7WA 2D4AA 2CD9A 3HL4A 4HFJA 4EARA 4AZTA 4GI5A 1GOTA 4Z6KA 2FPUA 2I9KA 1GZ5A 2VZLA 1RABA 3V1NA 4EHDA 3EW7A 5AJYA 3KQNA 3JPWA 4K5QA 4KR2A 2WAMA 1VL8A 1PUXA 5JFTA 1OXMA 4KXUA 1D04A 3SHQA 4L0DA 2OO5C 1RYFA 5SV2A 4IJKA 4XRRA 4KMSA 1BYUA 3ILSA 3N6RA 2GUGA 2XGMA 2ZT8A 3NOOA 4A7PA 3T0IA 2JRLA 5IP5A 1V2HE 3GOQA 1ML4A 2TSYB 2PBZA 4LQDA 4YDHB 2GCEA 1OGYA 3AIOA 4JUBA 4LHEA 2B0JA 2XMRA 3UJCA 1AKUA 1BE1A 1DFIA 3RVRA 2J9RA 1CIJA 4E5VA 3RADC 1L7NA 3UBTA 3K4QA 3CR8A 4XSGA 2Q5EA 2O6HA 2W6MA 2Y4OA 4NS4A 1Q0UA 4OQPA 3GP8A 2QUKA 2YZ2A 3FOCA 2CV2A 4X61A 2Q41A 4EW6A 2JS7A 4MX8A 5J4VA 4B84A 1WW2A 3DBIA 1I7PA 1SB9A 1X14A 3PX2A 4HUQA 1ZW6A 4QWWA 5DWDA 5J2UB 4XQ0A 4EKNB 3E8MA 5AK6A 4OSOA 1BH6A 4BFCA 3MHPA 4UHBA 1LRLA 1IY1A 3HNPA 2IOFA 3L7LA 1E1RD 1JJFA 1NAIA 4PX3A 5ES3A 5LBUA 1YZYA 1MV5A 1P4GA 2MINA 2AOWA 3IBTA 2OBYA 4JJ4A 3JRXA 3GPBA 2GEBA 1Q2UA 1Y34E 1W2GA 4TSFD 1LVUA 3IOYA 3M3PA 3U4IA 4IMRA 1V5FA 2G5TA 1J1UA 5BN4B 3U56A 3UB2A 4BNWA 1O0BA 5A5DA 1XG5A 3OWXA 1MHTA 4YV7A 4JLAA 1RWWA 4X64B 5LYYA 2ZROA 3K9BA 2Z1DA 3MCUA 4GYWA 2DFTA 4OH7A 2R3SA 2VBCA 5ECGC 3TRIA 1FXWF 4YUXA 3T5GA 3F73A 3ZJTA 1DPGA 4BQPA 1Q0ZA 4TM8A 1L7DA 4QAQA 4J0KA 4YRMA 1HFEL 1VLVA 2J5BA 1C0PA 1FF9A 2L82A 3N28A 3PLRA 1Y63A 4Q7JB 3TSOA 4L9SA 4D4GA 2ZB4A 3VAAA 2KMLA 4YCMA 4F2HA 1RI1A 1U9YA 4RFSA 4XIFA 2QOEA 4C4YA 1C1DB 3U9TA 2B1IA 1EYZA 4IY1A 3ANMA 4UUQA 1JG4A 3HSKA 5AJZA 4KJXA 3KTFA 3E61A 2ACEA 4UAUA 1SKYB 2QYOA 1YD7A 1HURA 2V7VA 4FEAA 1ILWA 3IA2A 4YR7A 1U7OA 3P8ZA 3HV2A 3KOMA 5K0BA 5GMOA 5EJEA 4A5OA 1J8YF 4Q1BA 4DR2B 4Z4FA 2HJ9A 2HRCA 5JZ9A 3LUBA 4LGVA 4ZAZA 4I1SA 1P7WA 2D1SA 4B45A 4D57A 1YJAA 2W8ZA 4MULA 2WTBA 3MELA 2XYRA 2BMWA 2AN9A 4BE4A 4P7FA 5A1TA 1FRVA 3EODA 4FYXA 2CLFB 3WMWA 3Q2OA 4A8PA 4AUEA 1E3DA 1NM5C 4DWOA 3HPQA 2QJOA 3P5BA 4KMMA 2G1JA 3DAGA 1R0ZA 2G1KA 4FEYA 4YS6A 3A28A 5FWYA 2X5JO 5K0GA 2C1ZA 2JAOA 3KL4A 3ZHSA 5ADHA 2MSKA 1OT3A 2P1RA 1E2IA 4W7SA 4DIMA 4EVIA 4KITB 1JFSA 2ZRIA 4UUMA 3SBDA 4LJ6A 3T3EA 4ALMA 5CBPB 1SM4A 3O31A 4RTOA 1RXSA 4OG2A 4O2RA 4EEZA 4O3MA 2YMLA 2ZSDA 3KFXA 1UDXA 1UMBA 5ADVA 4B46A 2PT6A 2Y76A 3BRQA 4I8XA 1KDYA 2GYUA 4LJKA 1OFVA 5B6PA 2E18A 2F1RA 3KQYA 4AYXA 4FGZA 3KQHA 3VSAA 3FSJX 2CSUA 2QY9A 2WDZA 3AUJB 5E0OA 2N0SA 2YX1A 3KQQA 4LQ4A 3AU9A 1URPA 3RSQA 1AQYA 1T5SA 2X5XA 1BVHA 3C87A 3EAFA 4FZRA 5JQGA 5JSHA 5EIEA 1XTTA 1GZUA 4R40A 4AB1A 5KU1A 2C8LA 2PU5A 3PUVA 4JLPA 5F5NA 5B4VA 4IXDA 2Y8EA 4PQRA 2R5FA 1WLSA 1D4ZA 1DMRA 1VLQA 4XJVA 2NTJA 3BMCA 4HDMA 2SBTA 5LQRA 1A76A 1SVNA 1M3SA 2QU8A 5EP1A 1X19A 2A86A 3WGYA 1E4YA 3WLIA 1XZFA 2Q4EA 1DVRA 2E4WA 1ATZA 1NXOA 3MXTA 2WUFA 1SPXA 3H8VA 4LRUA 1YSCA 4YT5A 3W2HA 5BN3B 2C42A 2FMFA 5ALUA 4KPUB 4FHGA 1BCSB 4L9WA 4MIEA 3IAAA 2E4VA 4KN8A 4KWIA 4BUJA 4IDQA 1R7RA 1ZMOA 3G2OA 5ICCA 4BV9A 2OM2A 1CY0A 3QBEA 1XZMA 4A0HA 2JH3A 4QT0A 4O0MA 4RPGA 1DC7A 5KAMA 4TYQA 4INZA 5IJ9B 2P6UA 3T7KA 5EXDA 5A0VA 4M9ZA 1CJVC 1OX6A 1QV6A 1EVZA 1GY8A 3KYDA 4UARA 1G16A 1C1DA 1S4MA 1XZPA 3DMTA 2N47A 1L0BA 3PEEA 3UXEA 4FR2A 2X1MA 1A27A 1OYWA 3CW8X 2XCQA 4M49A 3O3NB 1OX4B 4AZ0B 4DSOA 4DWVA 1OI2A 2OV3A 1YULA 4FFLA 2QTLA 1XJQA 5DRYA 4RGVA 3N87A 3SFTA 2X2OA 4IL5A 1IIBA 2TRSB 5AVUA 3EXIB 3TOXA 1D6MA 3MMPA 4LOKA 4PCVA 3HBMA 1Z4KA 5IBRA 1TPZA 1S0UA 1PNVA 1U2ZA 1ZL0A 3IAHA 4RVFA 3NBUA 4KFUA 4UEJA 4QUIA 1THMA 4EY3A 1SC4A 5AHXA 5J2TA 1VQ1A 4GVXA 1WV1A 4WHMA 4BLTA 4LF5B 5A4MS 4WUTA 4UBMA 4D46A 4L27A 3D1VA 3FCUB 1FB5A 1Y5NA 4L50A 1H2ZA 3FPAA 4C0XA 4DS3A 1SVKA 2Q5QA 2CMDA 4QUJA 1QH8A 3MT7A 1CJCA 3CWCA 1ULAA 4CI0B 3OTGA 4M3NA 4CG2A 4IIJF 2FJ0A 4G0ZA 2FRXA 3TLGA 4MA4A 2FG5A 2GWRA 4ZEVA 4HS9A 3KVNA 1X7ZB 3IHTA 1EM8A 1FNBA 2VKTA 4Q9LA 5K03A 3TTWA 1GPDG 4LMAA 2JGDB 1F38A 1C7ZA 2WIKA 2WR8A 3ENZA 3JW8A 4TSFA 4UCXA 4N82A 4D6PA 4KQWA 2P5TB 1EG7A 2QPLA 3EZYA 3AB7A 4J3NA 3CKKA 1KWKA 3KSUA 3TE6A 3PC7A 4JYMA 4RK1A 4DCUA 4YAGA 4V1CA 1QRAA 1HE1C 4L8WB 3GJ4A 4B80A 4JYAB 2YNMA 2ONKA 5DXJA 4N5MA 1JEYB 3K6KA 1HEYA 5CB6A 4HMOA 2DOKA 4AFNA 1U7ZA 1ZIOA 3KU4A 5KNDH 3R3XA 1XKQA 1VJRA 4ZZ2A 1ICEA 3N2EA 3PXDA 4C2UA 1IN1A 4Y2YA 2C1XA 4UNIA 1QBKC 1ZBQA 1TKRA 3ZU2A 3FSGA 1UDRA 2QM0A 2ZSIA 4OFZA 4UE3S 3UJBA 3RC3A 5I7HA 2XBMA 2G63A 121PA 3GW8A 3FWYA 4X41A 8ATCA 2YC2C 3T3PB 2G17A 4BMZA 3VAZA 3ULKA 4MPPA 3OIWA 2Q21A 2D7DA 1H2RS 3NXKA 1RP7A 5BR7A 4X85A 1U7UA 3QF4A 3MWYW 2H2GA 3CWQA 4IDFA 3FF1A 5J5VA 3UO8B 3ZDXB 3LECA 4RCZA 1IOZA 5H9VA 3ELDA 4OP3A 3R40A 2ZE5A 1AVTA 2BKEA 2E1RA 2J6CA 4QDUA 4RACA 2IT1A 2EW8A 3BWMA 2UXDB 2BHTA 1NULA 2PLAA 1HEUA 2XHEA 5K6AC 4MLDA 4KNWA 2Q99A 3F3SA 3EUAA 4ZAWA 1VBMA 2O8EB 2ECQA 1BNCA 3R7NA 3SLKA 3UH0A 1ONPA 4POAA 2C2ZA 1E79A 1L4YA 1T35A 1NASA 4D0NA 1U7PA 3UJAA 3PVCA 1SCNE 2AG8A 1NNSA 3GUCA 3QEMB 1Z4QA 2XD9A 2JIMA 4H15A 1FS4A 4J0JA 3EEOA 2ZUSA 3FCCA 4GYJA 1JFRA 4J6FA 3V34A 1Z6ZA 3KK0A 1XLTA 2VSYA 3REGA 4ZJZA 3QVKA 2W6ZA 1TCVA 4YAWA 1EB8A 3CX3A 4JLUA 4E7PA 1O9BA 4OXRA 3DHWC 3M70A 4H6WA 1D6JA 5TLSA 1OASA 2DT8A 2PL9A 3IQGX 4YUVA 4B3IA 5I7OA 1NBME 5JATA 4NENB 1INLA 2YUIA 4JELA 4UM5A 1VMEA 3OJLA 3VNQA 1WDTA 4GI1A 2HAEA 3W77A 1M72A 3WDLA 1H2XA 2IZ1A 4BZWA 3VR5D 1X38A 4JYPA 2G08A 3DKKA 3WP1B 4BB0A 4YN3A 3KUDA 2WIGA 2WV7A 4GGPA 3SHOA 1R6DA 1B23P 1W0CA 2G28A 5K3FB 4RORA 4KNYA 1DNPA 3O95A 5CW1A 4XD2A 2RHGB 1PVVA 2VJQA 4NCKA 4ND1A 2OAGA 4DM4A 4C4TA 3GV0A 3JVIA 1E0KA 4Z0NA 3O1IC 2JGFA 3Q0IA 5M34A 1HY3A 4A2PA 2ORYA 3ZIUA 5I4BA 3BHJA 2IW3A 1YNSA 3H7IA 4GLFA 1H2HA 3L7CA 4WFIA 3RSSA 3TQIA 4K9QA 5EUCA 2JCSA 4R1NA 2VK4A 3E7FA 1SUCA 5D6OA 3ZZMA 1GPLA 3GZJA 1M0WA 1TT5A 1WF6A 1XEWY 1ZJ4A 2VNAA 3NWJA 1WP9A 3OMXA 4KV7A 4OK5A 1C50A 4A26A 4RVOA 4IJWA 2WY2D 1K8XB 4GLLA 4HWTA 5E6UB 4AKEA 1YS9A 1GCIA 4NU6A 1KYWA 4NAVA 3VPHA 1NSFA 3JR3A 4CMIB 2OHFA 1MD9A 1N2OA 3LGXA 1JE0A 3EDRA 3CLVA 6AT1A 3PNSA 4URFA 3IOEA 3HADA 5G0SA 2AFIE 1P3Y1 3KBOA 4WDRA 1NXQA 1WKBA 3UW1A 4Z49A 1JJIA 1MBZA 2B1JA 2P75A 4WVFA 2VP2A 1DSSG 1QFYA 4HQ0A 4IDDA 1A9YA 4ZRNA 4DCTA 1Y5MA 1YS2X 1TLTA 1SXJB 2P65A 2PR2A 3IUPA 3LLUA 5DV9A 1UBRS 1N7HA 4H3VA 3RASA 1JFFB 1GG5A 1R50A 4TKZA 3BHIA 5C1IA 3TUIC 3UMMA 2XJ4A 1KQNA 3O1HB 4RMNA 4RPHA 5DYTA 1FC0A 1WG8A 4Z7OB 1LDGA 2PV7A 3R74A 2CDBA 4KYIB 2WEKA 3LV8A 1KH1A 1FK8A 4XLZA 4V3BA 1J20A 1JT9A 3DAFA 5K4AA 1ZL2A 4UHEA 4ZICA 2SKDA 4EB8A 3VH3A 2CJWA 4DPLA 4ERXA 4P32A 2GRUA 2VT3A 1JFLA 5BYKA 4DIUA 5TJ9A 4P83A 1YJ5A 1K3TA 1C1XA 3C0KA 1DTEA 1I2AA 3FB4A 3GU3A 4LG1A 4F4DA 3NMUF 2P3OA 3FUWA 2D5CA 3F67A 2NXWA 3PPIA 2M6LA 4HNTA 2Y77A 4DCNA 3TSYA 1CUFA 4EY4A 1NF3A 1FFYA 2GHIA 2VYNA 4FXOA 5EI5A 4BDTA 2WWXA 4Y6SA 2CFTA 1JYFA 2NU7A 4WNAB 2QAIA 3K6SB 1JR3E 4QYXA 1F06A 3AR7A 5BQPA 5IVHA 2RCYA 4WERA 4NMWA 1JBEA 4OHZA 2QTHA 5F9FA 3NHYA 3ZLTA 2FPGB 2AD1A 4PGHA 3P9NA 2GX6A 1TTQB 2YXPX 3W7AA 4CV3A 5C7OO 3ZU6A 1B1CA 1UBHS 4KIFA 4DUGA 1M6EX 1T4CB 3QMWA 4TVBA 1L5LA 4FE7A 2J6HA 4LJRA 1VLLA 1EK6A 1BS1A 5H9WA 1I5RA 2Z4TA 2IW1A 3WL7A 1AY0A 3ZDYB 4BXOB 4EUEA 3E1GA 3A9VA 5FR1A 1A96A 1S4QA 4NE2A 4MVJH 3RYIB 5TIIA 5HWSA 6ADHA 4US1R 4BN4A 1NQUA 2HNAA 1NGSA 2AFHA 5CM9C 4CTOA 2CSXA 1CZOA 1ZY2A 2W43A 1U28C 2ZE7A 1UPUA 3D5QA 2KWIA 3CISA 2FZWA 3X1ZA 4C1BA 3R6WA 3OU6A 2IYZA 5DCLA 3BJEA 4M9CA 4MQEA 4TS9A 3HXQA 4GW3A 4L15A 4LJ5A 3MNFA 4NBVA 2OGSA 2QW1A 4QPZA 4Q9KA 1IULA 1ZVVA 3BC1A 5KHOC 3H9QA 1TI7A 2X8BA 5FH9A 1U1DA 4ID3A 3P2OA 2AF4C 5F1PA 3JASA 3K72B 3LC1O 5GY7A 3R9KA 4ZZ3A 1FMTA 4X7PA 3CRVA 1BRTA 4L5JA 5DYIA 2WTAA 1RQXA 4OQEA 1KI7A 1UK7A 4ZCTA 2A59A 3ZWYA 2G83A 2VUTA 1HE2A 1PDVA 1LDYA 2GD1O 1WU7A 2RHBA 4JQYA 2AFVA 4D02A 2OMEA 3HUTA 4EY6A 4OEHA 2PJUA 7GPBA 5H1YA 5JFOA 3A9TA 4HN9A 3IMFA 4FT4A 4QQNA 5JFGA 2GJ8A 5EVCA 1PEKE 3WYAA 1DEOA 2NQTA 2ZT6A 4FWBA 4BMOB 5KTOA 2QTZA 1U0OC 2GKSA 2X22A 5SZJA 1U65A 2IPNA 4ZANA 1KPIA 1FFXA 2FPPA 5ER6A 1V4NA 1Q0PA 3A32A 1FX0B 2C04A 4G5HA 3H11A 3RH0A 3MRVA 3FHCB 3CLTD 1DAFA 3STUA 1UBFA 2GCIA 2RKOA 3QBVA 4Q3DA 2Q4TA 4YRKA 4MYCA 2VHXA 2FEMA 1P19A 2QD4A 1NJFA 1TW3A 3LYLA 3WX0A 3WKCA 5CEFA 3GLUA 2D0IA 1EAYA 2YVKA 3I2HA 2C3OA 4KO3S 3HY3A 1CUEA 4XVRA 1AS2A 2GLTA 1SXJD 4ZJPA 3SOPA 1MTZA 2ZCJA 1BJRE 2H9IA 3BDIA 5FBRB 1YA4A 3BCSA 2A1IA 3QLVC 1NIPA 4M38A 3RBZA 2Q7XA 1KOLA 2X3UA 2W00A 1BROA 3OM0A 4RZHA 3VTFA 1ZH8A 4I55F 4F11A 4EG3A 4BGDA 1BXGA 5K3SA 2CVHA 2FP4A 1EBFA 1V41E 5REQA 3REFA 3I6MA 4C08A 4BFSA 1KJZA 2ID7A 2PUVA 3BEOA 4C4ZA 4D4IA 4E15A 4QGHA 1AX9A 2VTDA 1IEXA 1TB4A 2GXAA 3MOIA 1II8B 1SQ5A 2VJAA 1ISGA 5LQAA 4F9TA 2H7CA 4FGUA 3GN1A 4B2YA 1TU0A 2VA9A 4L6CA 5IBQA 2YDXA 3TD2A 3ZCQA 4LTMA 4NFLA 5KSYA 2OP0A 1X6VA 3GA0A 4KIJA 5KSPA 1IBSA 1N9ZA 1GG9A 2RGXA 1CY2A 3A27A 1JDTA 5KMGA 2OGZA 4D25A 1BHO1 2WP8J 1OI4A 1XZBA 4RHUA 2Q45A 4WESA 1BKYA 2FX3A 4XD7A 5CT8A 5AI0A 3RK0A 1U0EA 1W85B 3CONA 4TMTA 4FM9A 3TPCA 2P9QA 3NKVA 4KTTE 3KKLA 1XU9A 4KVZA 1O96B 3E27A 1G3MA 3L7KA 3QG1A 5A9SB 2PUCA 2AD5A 2BPOA 1LQTA 1E6UA 3BBPA 2GF2A 5A4IS 3BJZA 3JALA 2VK8A 4N0EA 4Z0HO 4CXMA 1YR7A 5A4JA 1PT7A 3QEMA 3UPTA 1Z5WA 3TEJA 1MOQA 2BE7A 2YH2A 1GCOA 3ZWQA 2ZBRA 2J7KA 4EW3A 3MAJA 3DMGA 3AUUA 3AI3A 4HH1A 5FEMA 4ER0A 3C7CB 4FMCF 1ADJA 4MCAA 1ISHA 2ZI3A 4PG6A 2I71A 1AMNA 2J07A 4C78A 2X77A 2O2JA 3Q7TA 4JI6B 3LNCA 5L7YA 4CIAA 2NVOA 3QW4B 2I34A 4KACA 3DZ8A 2YZ7A 3L0BA 1J7KA 2FY8A 1GNLA 3R7AA 1AKTA 1FNMA 1OC4A 4H7PA 2GILA 1HE4A 1XSEA 3ANXA 4BZZA 4UD2A 2W0SA 2I8CA 3DBHB 1K98A 4MWZA 1GKUB 1I3NA 1OI7A 4DKXA 3P45A 1E69A 1BMDA 2QL6A 2P7HA 3EGDA 4M1OA 2QU7A 5K2OA 2IEYA 2NSJA 3T41A 3KKQA 4F2PA 2RFLA 5IJXA 3GOHA 3K5PA 5KEIA 4FKMA 3M4ZA 1UT8A 3VR4H 5B57C 2R1TA 2ZUUA 3F6EX 3WB9A 2ZB3A 3UXMA 4EMBA 4AN4A 1N1MA 3PYMA 1P77A 1GU7A 4EGCB 3RBVA 3ZYCA 1QP0A 2V5VA 3EEIA 3OQHA 3EPJA 2NO1A 4ZOBA 4PU0A 4HBZA 2MWMA 3B38A 5ED0A 4P3NA 2PG3A 1AQLA 1PJBA 3DQZA 4FUTA 4YACA 3T7RA 4Q3LA 1WXXA 2GBCA 3NX4A 3EBLA 1UMKA 3L77A 4DDWA 5BNWA 3H3JA 5CLHA 1SBQA 2QVBA 2JCGA 3NHMA 1AB6A 2YJTD 1XP5A 2AMYA 3I62A 4GD3Q 3DOEA 4R3WA 3STVA 4P2BA 4QU8A 3FCSB 4QDTA 4ZQEA 4A0RA 2UUPA 5HBGA 2VSXA 4KFTA 4J0IA 4LDJA 2ZRBA 3E3MA 3DV0B 3VO2A 1FMFA 5JT1A 4BQFA 2YJ5A 2YZNA 4US0R 5C80A 5CMLA 1Q12A 2DHQA 4QULA 4ZXFA 5AFSA 1SHUX 2IHYA 4V03A 3HEMA 2HU7A 4YJGB 4Q4HA 3FI0A 2HU5A 1CDZA 3L8CA 3RIMA 3T5BA 2YQ4A 1N3LA 3M89A 4BKPA 1TC1A 3T52A 3IC5A 5BP7A 1G4AE 3UUEA 2VJKA 4IJVA 5J4KA 5ICMA 3RVBA 1S7CA 3WB1A 1ZJ6A 3HP4A 1QIHA 5AKIA 3PVSA 2FLWA 3CF4G 3TI7A 4F5YA 2NO0A 1HNXB 4RSHA 3KUKA 3C41J 3NH9A 2XZPA 3QV2A 1SUAA 4EGSA 2OESA 5DGDA 1ESZA 5FUWA 4BMDA 2C94A 4BPBA 3N1UA 3DNMA 4CLXA 2EBUA 4R1SA 2WAXA 4FFPA 3GO4A 3BE8A 4G2NA 1O6CA 4GEGA 4WD3A 2EZ9A 3IQIX 3GMTA 1R9JA 4EO4A 1TCUA 3L92A 5C31A 5JNUA 2WAAA 3RT9A 2XUDA 3OKPA 3OE5A 1YCGA 2Y1LA 1I3OA 3ZR4B 2XNHA 3GZNB 1E5QA 3IOBA 5CLGA 2AR0A 4AMUA 4EJ0A 3SMQA 3CMMA 3LUCA 1PF7E 4PRLA 3BTVA 1I24A 1NI4A 3ADKA 4B6QA 8LDHA 1TNDA 2PWZA 2QMQA 2AUTA 1EUDB 1GNTA 3D8NA 3SFVA 2LCQA 5IWAB 3Q7PA 3TF5A 1E2HA 2R751 1RAGA 2FQ1A 3M82A 4JEUA 4LI0A 4RFLA 1MT3A 3EZGA 2I80A 2VBIA 1P2VA 5IXJA 1VJGA 3AVPA 4M22A 1EHYA 4B4OA 3IYLW 4IOKA 6PFKA 3ZCRA 4QJBA 3B9QA 1LTHR 2BF7A 1K5HA 5ALYA 5CB4B 1AOXA 4JC5A 1I7QB 4KBGA 3VYUB 4AP5A 1G59A 1GYQA 1H9AA 3KPYA 1ZGGA 4V38A 4NBSA 4HNSA 4BEBA 1EVJA 3NH6A 3ZIAA 1BJTA 2EKZA 4BUCA 3FPGA 4KPEC 1JG6A 4LVCA 2HREA 5H8WA 4Q6WA 1RJ9A 4OBEA 5DKFA 3IR6A 1W7AA 2L2QA 1JDBC 3SX4A 2LR0A 3QVSA 1E3EA 4JODA 3QI7A 3CF6R 3FOEC 3QELB 5JDIC 3GPIA 2OCYC 5SICE 4B9AA 4PIVA 5ARBA 3UAWA 2Z8ZA 4DZTA 2PSEA 3H5VA 4Q16A 2CHFA 2V74B 1UJNA 2H1HA 2W9XA 4JP2A 2FLKA 3W5BA 1V1RA 1IN4A 3ESDA 1PL0A 2N42A 3CN7A 3FPEA 1US8A 4TT3D 5EZ5A 1BS2A 3BK2A 3KWMA 2WTUA 3G23A 3IUNA 3SD7A 4E5SA 3T15A 1BOOA 2C7RA 2FE4A 2O3QA 3VC3A 4JLSA 4JASB 5JJBA 4BP8A 3G49A 4Q15A 4CEIA 2P4HX 3AFMA 2GQ0A 2AC2A 4JCCA 2YHIA 3LFHA 1V16A 1XZAA 5KAPA 2F1JA 1ZXLA 5E4FA 5JUWA 5DK4A 1JA0A 3WLRA 3V1YA 3JALB 5AR1A 2FMXA 1U7XA 2C00A 4X93A 4ARUA 1I0IA 5FPTA 5KKNB 3AQIA 1YAJA 3GAMA 2FRVA 5JARA 3DDNA 3EGIA 4UHHA 2GBGA 4TMKA 2IDKA 1TCBA 4DV1B 2XYQA 3P4UA 1EZ4A 1SRRA 4ALJA 3IEVA 3AKCA 4ZI2A 1IZ8A 3I0MA 2JIQA 4E12A 1WZCA 3OA2A 4G24A 1H1DA 1KSJA 4ODIA 4JBXA 2I6TA 2XUHA 2VYFA 3EFBA 2VWPA 3QUCA 5AUPB 2EYUA 1VFPA 1L8LA 4PZ0A 4TKLA 3ORQA 1MC8A 4BRWA 5C18A 2EHJA 3OWOA 3NGLA 4EY5A 1MJGM 5GJVC 4KQKA 3K9QO 4KP7A 2XE6A 3SOZA 1M2VB 1R37A 4RKQA 2B4QA 2FSPA 3QU9A 1RI3A 3JQFC 4D80A 3T3NA 2C7PA 2BEVB 3HA2A 4PC3A 2CHUA 3M9XA 2BOVA 4B34A 4PPFA 1Z74A 5A3QA 2J32A 2H1VA 3RT1A 2AR7A 3P4XA 1YFKA 4JLBA 4PGGA 3A7DA 4EI7A 5F4BA 4XZ3A 3DEAA 4OFXA 1MABB 3PUXA 4E5UA 3H5RA 1MXFA 5D5QA 1AH2A 1W4BA 4HQKA 4TN1A 2G1PA 2JFWA 2ANBA 1Y7PA 4Y9RA 2FSVC 3RE1A 1F2UB 3WLMA 1TM5E 1TM2A 1M8FA 3FMIA 2JKZA 3MBIA 4FGSA 4MUKA 2R62A 4MP3A 2A33A 2PXAA 1PKXA 2C9DA 3IP7A 3U3MA 2LCIA 1DT3A 4EHNA 2ZR7A 1K27A 3FVQA 5AVKA 3L7MA 4LA4A 1APBA 1RI4A 4R8LA 5KDDA 2YV4A 2D1RA 1YC5A 3ROEA 4MO2A 4AJHA 3JQ6A 5C53B 1NPTO 3PI7A 5AJVB 1QVWA 3FAKA 2Z6UA 4KXVA 4PLHA 4CDMA 1IQ0A 4IUDS 1IHUA 3ZPXA 2Q0XA 2QVGA 3C24A 2HY7A 4DIFA 2EZUA 4HDOB 1JNYA 3TECE 1Z4JA 2Q29A 4YRDA 4NCBA 4BUZA 4CLRA 4PYLA 5U4QA 4AJLA 4N39A 4M89A 3I8SA 5K0NA 4TV9F 2LGJA 3ZBTA 5HP4A 1B0UA 2XJ9A 1Y6ZA 1LD3A 1EFCA 4KO1S 2O9JA 3A0UA 1NC1A 1QGYA 3HZZA 2JB9A 3UHPA 3IVMA 4AF8A 3O47A 3H2KA 2WF5A 1MW9X 3D8HA 3UJNA 2HV9A 4NYMQ 1SQ6A 4UOEA 2VJBA 2Q50A 5CHYA 4X7RA 1QGAA 2J67A 3U0BA 3NHJA 1WCWA 1QXSA 3ON5A 2BMFA 2HMUA 4RF5A 1FFEA 1SK9A 2XNDA 4O1HA 1M6VA 2ZXFA 4AMBA 3EOZA 5FP0A 3GRCA 4MV8A 2ONJA 1GQ2A 1WB5A 2IIBA 3L07A 3TRJA 3WOVA 4RDIA 5E3HA 2OLKA 2B1GA 1CC1S 2C31A 4Z86A 4BO5A 1Q0TA 1PO7A 3LXRA 2NZVG 4Q01A 1GIAA 5DBHX 5E6SA 5HQ3A 1WXDA 1IFXA 3COSA 4C20A 1KDTA 3RU2A 4Z9FA 4ZMBA 2UYCA 2BFOA 2VF8A 4FFVA 4MWSA 5G3YA 3VYWA 2EFGA 4CF4A 5IARA 5IM4F 2Y1FA 5T7BA 3HBLA 3ZVRA 5J4HA 2W6CX 1K66A 1YVDA 1YV9A 4YUAA 1JBQA 1YRQA 3FN4A 1YQTA 4MYTA 5BYJA 3TB4A 3CCFA 1FSZA 3NEJA 2DP4E 1QTRA 3PGVA 3M5DA 3WIDA 4ZYVA 3AUYA 1IB6A 5K0ZA 5A0TA 3QF4B 4UVDA 4M86A 1FDRA 1E2UA 2QM7A 1KIAA 1UZMA 3R5XA 4QOGA 2OCXA 1I1NA 4L8VA 1II8A 3ZTYA 1RJDA 3TFQA 2A5YB 3JQGB 1IHPA 1IY9A 1ULHA 16PKA 1I7LA 2R1UA 4EEXA 3ZDAA 2ZI9A 4ZEMA 4IQ8A 1FYVA 3DDHA 3K8ZA 1D0IA 4RH0A 3C5EA 4P2GA 4PTYA 3PNMA 3T4XA 1F0PA 1JR4A 3GMIA 3JSAA 4B48A 5JSZB 2IYNA 1X86B 1EG2A 2BELA 2VYND 4FDTA 3G8CA 3GX1A 3I83A 1JHXA 1IJBA 2B98A 2UUOA 3CT4A 2X0DA 1E94E 3SDSA 4QLBA 3VSDA 2FH5B 4DVJA 1ULBA 4FHFA 5F2KA 4ARCA 3P9QA 3RF6A 3PQ7A 3VU9B 1EXMA 5KNBA 4R69A 2F3UA 3JD2A 4J16A 4KKXB 1S9DA 1W76A 4CLOA 3IUMA 4O59O 4EB6B 1T0HB 4PPNA 4FEGA 1N3BA 4M37A 2DLDA 2AQKA 2GFIA 2RG1A 3B1JA 3E9DA 3OF5A 4QPDA 2C5FA 1PUJA 5DISB 4J7UA 5DTJA 1ICIA 1B0PA 4H17A 4HPJB 3TUJC 2NTVA 4Y2PA 2ZJ7A 3LWDA 2WA2A 4EO9A 2CLDX 4L3OA 1ZM9A 2C5AA 5F78A 4DA4A 3QF7A 3HRHA 4EHJA 5I5EA 2OFOA 4MKRA 4PPGA 3BPSA 3GDOA 5CFLA 2GLUA 1N0UA 2ZSHA 4MP8A 3QWBA 4YC7A 5KYWB 3COWA 1PG0A 2CGEA 1PFYA 2EV9A 3EZ6A 3OCJA 4O8ZA 3UT6A 5JECA 1JQ5A 2PQ0A 5LMCA 3OP1A 3MRTA 2UU9B 1ZSNA 2IYSA 2WZBA 4R8SA 3LY5A 1IN7A 2HPZA 1Z0KA 2QMOA 4HEJA 1DBQA 2LIPA 2H4ZA 2R4QA 2QN2A 1C3LA 1L5MA 3K1AA 3KLOA 2FSHA 2WT9A 2G7MC 2XT9A 2E4AA 4N3CA 3MOGA 1XJWA 2ZSEA 1HT0A 2PY6A 5ESDA 2MSLA 1YB1A 5JBNA 1NXVA 2BSQA 4NCAA 1FDUA 3RD5A 1U3VA 1Y89A 3NWEA 2J0UA 1V3TA 2VSQA 2Y2VA 3H3FA 5AIAA 4LJLA 1OAAA 4BGEA 1W8IA 5AW3A 4C6SA 3N8KA 2FSUA 2WU1A 2WVGA 4LYFA 3D3NA 4P4GA 1KARA 3EWIA 1RFLA 4RGBA 1RLJA 3WL5A 2CLCX 4CCSA 4EDFA 2PLFA 5AHWA 3I4LA 3CWZA 3WDSA 2NVBA 3H99A 1PZMA 2DYKA 3K16A 1KK3A 3MQ2A 4MR9A 4UVGA 2J6IA 3FKSD 2ZIZA 4OHMA 2X58A 1UFKA 1QO0A 1G19A 5JH7F 2Y71A 4KXLA 4KWEA 4FINA 3INTA 4L22A 3OT1A 3HP7A 1WPGA 3B52X 3ADOA 5DMXA 5C8ZA 3N8DA 3P9ZA 3R6TA 3T5MA 4FFRA 3NTXA 3UAGA 2KYRA 1V3VA 1M1YE 3DZCA 3LP6A 3WQSB 4DR3B 2J5RA 4R6XA 1FNNA 4YAFA 1L5RA 4KIWA 1J0BA 1RMYA 4QIHA 4F1WA 3OCXA 2OQIA 2NQ8A 2QN7A 3IT0A 4OJNA 1XTZA 2XB2A 3TS1A 4KO2S 2BZGA 2WU4A 3T7JA 4E6PA 4FW8A 3H19A 4GSYA 1XEXA 1L4BA 4Q6BA 4X90A 1XZDA 2Z43A 1NJSA 4JP1A 4O4JB 1CUDA 4UTXA 1ND6A 1T43A 3P9YA 5DN6A 4V39A 4YRSA 1QG0A 1M66A 3B6EA 3GPLA 1V71A 1N6KA 4O2BA 3UQYS 2GTIA 1CT9A 2OHIA 3K96A 5JC8A 1ZU5A 2O2GA 5EXTA 1L5HA 4ESVA 1PVOA 3TMYA 3RLIA 2JZOA 1BMFD 5BXQC 4X1IA 1IJFA 1QUFA 4XQ9A 5EIHA 3QU4A 2RJOA 3GEHA 4Z2YA 1EUDA 3C7KA 3TZBA 2X40A 4DYDA 5A2GA 3R7BA 2W8BA 3BM5A 1B0ZA 2CFIA 3PT9A 4R2XA 4F8JA 2UVQA 4KGXA 3IXLA 3T54A 5EA2A 1BHSA 2IZOA 2QZ9A 3DC7A 5BSVA 2Y68A 3U4QB 3THXA 2PSDA 2AYYA 2OUIA 4WPGA 3M6WA 2ODTX 5FPHA 4AURA 1MA3A 1J07A 1ZUHA 2GZ1A 3GIDA 5D00A 3ZZTA 1KYTA 3MCZA 1IQRA 3KQKA 3EGCA 3EOAI 4QWMA 3ESYA 3L5KA 4N3BA 3WOHA 5ENZA 4BO0A 1OIXA 3KPJA 2NXCA 4PRYA 2C3PA 1GN8A 3ROFA 3R24A 1ATIA 2GTPA 4CPDA 4HADA 3AF4A 2B4RO 3OEWA 3ESRA 4CI9A 5ILQA 2GO7A 2X0EA 2NG1A 3CUTA 2QBYA 1F8UA 4PCLA 4PRZA 1TMKA 2GZSA 2VP0A 2VAWA 2CBXA 2VQSA 2ZWVA 3F74A 2WSLA 3I2JA 2VDPB 1IG0A 4JI4B 3TLJA 3D3WA 3WGNA 3AEZA 8GPBA 5HKKD 4TPKA 1YJ8A 2ZRQA 3PD7A 5D3MA 4B2PA 2V9CA 4R54A 1R00A 4LW8A 4NJEA 2BFEA 4C7JA 3THOA 3FYUC 4G97A 1X1EA 4MAMA 3KQPA 1VPWA 2WG0A 3EVGA 1V5GA 4CM9D 5AVOA 2D1QA 5SZKB 5CK5A 2RGAA 3F7TA 4G0WA 1O1YA 1O2DA 3AUTA 4D6XA 7MHTA 4CKWA 4FDVA 2C5GA 5EGNA 1R8XA 4G1MB 4YPOA 4H18A 1L6RA 3QVXA 4YROA 1W47A 3F9IA 2EFHB 3OOHA 3U3DA 1B26A 1Z4PX 1DP4A 3W5IA 1JMKC 2XCUA 1LWNA 4PM4A 5E2AA 4MV9A 3UGJA 2YNMC 2YCLA 1UP7A 2V9PA 1UH5A 3WK9A 2C9BA 1KIMA 3V3TA 1P4HA 3C6XA 1Q0HA 4JT8A 3TOVA 1D0VA 3NYQA 4M87A 4AZ3B 4F12A 4YRLA 3G0GA 2VRNA 1PL6A 2GJ9A 3BTOA 5F4ZA 3NS7A 5FTNA 3D02A 4GWLA 2XPCA 1BC5A 5JVDF 1EGMB 2JHPA 1QQAA 1J8MF 1R0XA 2E1PA 1Q92A 3AZOA 4KVFA 1F7UA 1Z37A 4WY2A 3ZTWA 1W0JA 1JX6A 2ZRPA 4GP7A 3D7MA 3RVDA 4EAQA 5IYZA 1JH8A 1ZESA 2R4TA 1A50B 2X8LA 2WAOA 4AKSA 4HYEA 3AESB 1YKSA 1GSIA 1VL2A 1H4SA 3QRWA 1UL1X 3E81A 2JCBA 4R2MA 3CKMA 2QDXA 1AK2A 1XZKA 3B1WA 3WO0A 3GDFA 3DMFA 1MJGA 1Q0QA 2JH8A 4FOTA 2A9FA 3PTZA 3X0DA 4CFZA 2QUJA 1KC1A 1SC6A 2PM8A 2A0WA 2WKQA 3JQ9C 2V7XA 3CNEA 3OZDA 4G8CA 4UULA 1MH1A 3LD9A 4GXRA 5EQFA 1GU0A 1QGUA 3CXRA 5KVCA 4IF4A 4HAWA 3L84A 3PL5A 3IAS1 3FPBA 2I2BA 5IAKA 4X8OA 4UAGA 1AUVA 1DRVA 3OTHA 3ETJA 3NM4A 5EJ7A 5JPDA 1G0NA 3LUAA 3U26A 2NSHA 4OBXA 2JJ2D 3DYIA 4KW7A 4Y7CA 3PKIA 5CEEA 2WJGA 2XVXA 2QM8A 2DKFA 1OXBB 3OJCA 4IQ0A 3HGTA 3H05A 4M1ZA 4MYSA 4RNDB 2OORC 1XKTA 2H8GA 2EARA 4FMDB 3WGZA 4BKUA 2A5GA 4IG9A 5C52B 4FQ8A 3WG9A 3CZ9A 4M7PA 1ZVQA 1L4GA 1RXUA 4HWGA 2IXDA 3ID6C 4H7DA 3DKPA 2WD8A 4P7KA 1O03A 1T6BY 3REOA 4QECA 5FI5A 1U6IA 3EXHB 4G4JA 1WB6A 1VJ1A 1YS6A 2GD0A 4QYIA 4RHCA 2D7CA 3OESA 1SU6A 1A5SB 2H17A 1NWCA 1BKDR 1CG6A 2Z9DA 3B6JA 3EXHA 5EJ9A 1IXYA 3PNBA 1OV6A 3PV0A 1CHDA 4NH0A 4RIGA 3H5NA 5FUQA 5I51A 5CHEA 2W42A 1HTWA 2P0AA 3FYCA 1PJ8A 3JRWA 4H3KB 1A9QA 1KOFA 1EUCA 5G4KB 1RJGA 2JI4A 4FKBA 3CVWA 3TZLA 4TTQA 2XDQA 1PAUA 3A26A 4NK4A 4FYWA 1BXKA 3ZV4A 4AKGA 2AH5A 1XRLA 5GTDA 2WNHA 4GZ6A 4DY4A 3B53X 3A1CA 2R5WA 2Z6QA 4DNQA 1GUZA 4BFWA 2GDZA 4QX6A 1C2YA 2B7CA 1WB4A 1XXHB 2R6DA 3BE4A 3FTQA 4ROTA 4H1VA 3D5TA 3CY6A 1GAXA 1VPVA 1T9BA 1YRHA 2Q8NA 3VA7A 3PFFA 4FUQA 3MUFA 5IJZA 2ZJ0A 3USCS 4TRMA 2P2YA 1MH9A 3UT5A 4I6GA 1RFGE 3GMSA 3MUEA 5TRTA 1P33A 3EGWA 2WIAA 3PB3A 1Q0LA 4NH4A 4G4GA 4YJ3B 3SQLA 1EIZA 4K6KA 4JBIA 4AG6A 3HDHA 4D42A 1L4HA 3HEAA 4YVFA 4DC1A 3GR6A 1M6NA 2FHPA 4JVNA 1FQWA 3GJ7A 1IHXA 2WT8A 3MTGA 1GNVA 3QPUA 3C3PA 2WTMA 2ZRGA 1C8VB 2PZJA 1WMAA 2HN9A 5B55A 5LP6F 1FDIA 1HEIA 5I9BA 4QKQA 3U44A 1V7CA 1QBGA 3F2IA 1N2BA 1UXOA 4JOSA 4KQHA 3T7DA 1L1EA 4JB2A 4B7AA 1ZLXA 1ZNZA 3T12A 1AA6A 4A03A 4XDHA 1GU1A 1DINA 2I0FA 3WK8A 1ZS9A 4B9EA 5JWOA 3SLGA 1KYVA 4TMYA 2WYHA 4J0CA 2ZBEA 2FWAA 3UV7A 3GEBA 4Q7EA 5F5XA 4TVSA 5L51A 4TV9A 3WZ2A 2FMIA 4KPUA 4LF9B 4N4AA 3GLRA 1P61B 1PYOA 2VJDA 3FNEA 3WP0A 3AB8A 5HA5A 1MX3A 1I0LA 3D7LA 3B60A 3Q10A 2P35A 4WBNF 5E1BA 1HZZC 3BA1A 3VTKA 4R7ZA 1C0IA 3W5SA 3L1VA 2DFKB 4EJSB 2O2DA 4AN0A 2X9LA 2OK8A 1JN0A 4DT1B 3D64A 2ZYRA 2H00A 3L6BA 5F21A 4CV2A 2YXNA 4TQAA 5K0EA 2CUTA 3UK2A 5DX0A 4DT1A 4XUCA 3IFSA 3K5IA 1N6OA 1WNFA 3OE4A 3P0HA 4XQGA 5TC4A 2PMEA 3PGXA 1POWA 3K6JA 3L3BA 4MYDA 3SDZA 5D3MB 1CF2O 2V96A 4ATNA 4HNAA 3F5FA 2YHIB 1AKNA 7YASA 3RWOA 1FFCA 4C0AC 1OV4A 4QQRA 4X00A 4ZCLA 4CLOB 5I8ZA 3FFXA 1Z6TA 4LNHA 3FOWA 1DE0A 2IE8A 2PS1A 3KM0A 2P8SA 1UKCA 1I4TD 3BFKA 2FN8A 3JAMA 1SKMA 5TMEA 1P39A 3QE9Y 4OY3A 4BCBA 3TNJA 4EVRA 1HYQA 1P3JA 4OU4A 4UMFA 5IFLA 4FGLA 1BDJA 4ZO6A 1XRQA 3VX4A 4RJLA 3CPEA 1XCGB 2Q3DA 3ZZUA