3UK7A

Crystal structure of arabidopsis thaliana dj-1d
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
386
structure length
384
Chain Sequence
NSRTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCGHQTYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKPIASIHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATYEGHPEFIQLFVKALGGKITGANKRILFLCGDYMEDYEVKVPFQSLQALGCQVDAVCPEKKAGDRCPTAIHDFEGDQTYSEKPGHTFALTTNFDDLVSSSYDALVIPGGRAPEYLALNEHVLNIVKEFMNSEKPVASIHGQQILAAAGVLKGRKCTAYPAVKLNVVLGGGTWLEPDPIDRCFTDGNLVTGAAWPGHPEFVSQLMALLGIQVSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Arabidopsis DJ-1D
rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Class I glutamine amidotransferase-like domain-containing pr
total genus 129
structure length 384
sequence length 386
chains with identical sequence B, C
ec nomenclature ec 4.4.1.5: Lactoylglutathione lyase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uk7A02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uk7A01
4Y1FA 1ONSA 3EJ6A 4ENRA 2YWCA 4N12A 2IUFA 3N7TA 4P2GA 1T3TA 4Y0NA 4Y1RA 4E08A 1QVVA 3SOZA 4LGYA 4ZGGA 5BV2P 3PQ7A 4WINA 2VRNA 3R75A 2A9VA 3CZAA 2RK3A 3FSEA 3B38A 4BTEA 1QDLB 4UNIA 4BIMA 1S1MA 4ENWA 1VHQA 2AD5A 1PDWA 2R1TA 2RK4A 4GE3A 3UOWA 4Y1GA 2AB0A 4P34A 3NONA 1CS0B 1IZYA 1P5FA 3TTXA 3PQ5A 1OI4A 3L3BA 5SY9A 2R1VA 2FEXA 2R1TB 4MGHA 1FYEA 1K9VF 1I7QB 4L95C 1UCFA 3FIJA 2NV0A 1JDBC 4L8YA 4WXYB 2D7JA 1T36B 2OR3A 3ZR4B 4L78A 5SY6A 4OQ4A 1KEEB 1VCOA 3L7NA 1I1QB 3P9RA 3PQ3A 4P36A 4AUNA 4Y1RB 4ADSG 2XF2A 2VXOA 4XLLA 1PDVA 4OIFA 3NOVA 1KXJA 5JZOA 3EN0A 1GPMA 1JVNA 3B3AA 4ENQA 1GG9A 3ER6A 4I2NA 3P9PA 4GUDA 4P5PA 3B36A 3EZGA 4AUMA 2VDJA 5E9AA 1SY7A 2WJZB 4ZDIA 1GGFA 1P7ZA 4QYXA 4AJ9A 1BXRB 4R7GA 4MNTA 4ENUA 3WFZA 4E5VA 1OX4B 4ENSA 2VPIA 1GGKA 1CF9A 1O1YA 1FY2A 3TTSA 1P80A 4OGFA 1GGJA 1C3OB 2LXNA 2H2WA 4N0MA 4UZSA 1KWGA 1R9GA 1OX5A 4OGGA 3UGJA 4D1YA 1QWSA 3SF8A 1QVWA 2ZUVA 2R1UA 4UOQA 5K4AA 2VKTA 2YWJA 1U9CA 4RKWA 4MTCA 3CZ9A 3EWNA 3L4EA 3P9QA 1IPHA 1P7YA 1C30B 4L7QA 3R76A 3NOOA 4S0ZA 3OT1A 4ENPA 2ISSD 4AUEA 1QF7A 3UK7A 3CNEA 1QVZA 1J42A 3F5DA 1KA9H 3PQ4A 5IP5A 1OX4A 1Q2UA 3D54D 2W7TA 1CE8B 2ZUWA 4JQSA 2GHRA 4ZDJA 4B40A 3VU3A 4I46A 3R74A 3P9SA 3PQ8A 3PQ2A 5LIRA 2ZUUA 3EFEA 3PQ6A 1GPWB 1VCNA 4L8FA 3NOQA 1GGEA 2ZUTA 4ZDKA 1PE0A 4B31A 4UCFA 1M6VB 2GK3A 3MGKA 4LRUA 3TTUA 4B2YA 5JZMA 3UMMA 2ZUSA 4PXYA 3OT1B 1VCMA 4L8WB 5SYAA 3UJNA 2ABWA 1G2IA 1L9XA 3TTVA 4GE0A 4I4NA 2RK6A 4B5KA 1T0BA 3NORA 3RHTA 3BHNA 3TTWA 4P35A 2V4UA 3SF8B 3TQIA 3GRAA 4ENTA 1OY1A 3ZJ4A 3ZJ5A 2R1VB 4QYTA 1Q7RA 3L18A 4Y1EA 4ENVA 1WL8A 4UOZA 4HCJA 4K2HA 2NV2B 1A9XB 1KWKA 1P81A 3CY6A 3F71A 4OJYA 1OX6A 3MIIA 3TTTA 2YWDA 1SOAA 1I7SB 3BWEA 3M3PA 3KKLA 4OFWA 4RKYA 3NVAA 5DFAA 5SY4A 4B7AA 1N57A 3TTYA 4BFLA 1IZZA 1PV2A 3CYFA 1GGHA 4AULA 2YWBA
chains in the Genus database with same CATH superfamily
1TECE 4MW7A 1SO8A 3ANSA 3K8OE 2C8JA 5D8DA 3T1VA 5LP1A 3QK7A 1N9GB 1E32A 4E21A 1CRWG 3GLIA 3PBKA 4KQIA 4ES6A 3ICQB 5EOVA 2C42A 3G1WA 3PJRA 4ESOA 3IEXA 5DYTA 5BNTA 2C2KA 3DOOA 2VUTA 5FNZA 4O2RA 1UJ5A 3FWHA 1E99A 1YRLA 3NM6B 5K45A 1CVLA 1WRBA 2DQZA 5TGZA 2VSXA 2C61A 2E4ZA 5LOVF 3ZE9A 1GTMA 1YZVA 3L5KA 4P84A 4E7OA 5HM8A 5IVHA 4CWAA 3CF4G 2FN7A 1M2VB 3H0KA 2J9GA 2FRVA 1DAKA 1N6NA 2QTWB 1A1SA 1KK1A 2AZXA 3ZIAD 1TQHA 3LK7A 4X00A 1DSSG 1VE9A 4NMXB 1I2DA 1U0BB 5HIIA 3JAWB 4EX7A 1G8SA 4RHCA 1E2PA 2QRQA 1VKHA 2X4LA 4FGUA 1XPOA 1T8TA 5BW4A 2D6FA 5HQJA 2DR3A 1Y1LA 4DQUA 3FOWA 1ZICA 3V4VB 2HNAA 5J43A 3Q12A 3L92A 3OQ6A 5KDOA 1TGVA 4R51A 2HXSA 3QOFA 1G42A 2P11A 3DV0B 5HMMA 3DZCA 3LE8A 3VUFA 2BHLA 3RVMA 3LBHA 3I39X 4TKMA 1A5TA 5EQJB 1GGKA 2AK3A 4DPMA 2WF9A 4FDVA 1PS9A 1P2BA 4MYUA 1V39A 5KWIA 3AERB 1I4EB 4IF4A 4WZZA 3L4KA 2O8DB 1XXHE 3TL2A 3F4KA 3QENA 3KFXA 2O4CA 2BM1A 3C7CB 3IBSA 1WVMA 2HHAA 3L7MA 3N75A 4BLVA 3QX9A 3GEPA 1REQA 4QG3A 5ENZA 3TBKA 5EP3A 3UFXB 1ZN8A 3NOOA 3QU4A 3TSWA 2C4VA 3OP4A 2B0JA 4DSAA 4TXLA 5K6TA 2O8EA 3MIZA 3CE6A 4R1UA 5IP5A 4DTIA 5TPZD 4RFVA 2ZCUA 4I1RA 4PLGA 4YRRA 4DREA 2D4AA 3TMAA 1O4WA 4RIEA 2ZUUA 5CCEA 1UBNA 2VWHA 1VI2A 4IW3B 1AQJA 1A9RA 1KZYC 4I55B 4NLLA 5EYPA 1BAPA 1G60A 2GZ2A 2FQXA 4DG9A 3WL4A 1YCGA 3LY8A 2BAGA 2VEDA 3RAJA 4GZ6A 3GRUA 2G88A 1O6GA 1GAEO 4DJ5X 2GZ3A 2QW1A 1C0IA 1WXDA 2VH1A 3SFTA 3MTQA 2WV7A 3BQMB 3B9RA 1IZ9A 2MYNA 3C15C 3ESDA 3LO8A 4JZYA 3UJCA 1ZIPA 2C2OA 4KSBA 3FNRA 3UJ6A 1BGWA 2B82A 1NXPA 2Q2WA 1E4EB 2QK4A 1Z0AA 2B4QA 4DDWA 1CERA 3L18A 1O94C 1Q11A 5E1DA 5KWSA 2OFXA 4M8IA 3TSAA 2XMQA 3DXXA 1Y5IA 3KAKA 3HQ4O 5DWQA 1TLFA 1OFTA 2MTBA 2Q5QA 3OCVA 1JLMA 1IH8A 1QF6A 4PLHA 2AXQA 1NXTA 1LTKA 3FVQA 1UIRA 1XTTA 4R81A 3LQQA 5FEMA 3RYFB 2YVUA 3N2KB 3Q7TA 3UMYA 2PMBA 3P0JA 3RS0A 4BFCA 4EBFA 3TUZC 3V9PA 2XZTA 5CAEA 3W7AA 4CM8B 3OQVA 4EARA 2X15A 4AF6A 1DKLA 1X1DA 3L1UA 1ZAYA 3OZDA 5EUCA 1A88A 2AI2A 4J0GA 1FTQA 1C9DB 1LPBB 2GESA 2HI0A 2VRNA 2Z3ZA 3KAPA 3LLSA 1GKLA 1A8PA 4TMTA 2V55B 2I78A 2JZOA 3PTLA 4LK3A 3HEAA 3I1FA 3L8DA 1CJVC 4OEHA 4EGCB 3ZVMA 2VHWA 5CIQA 3CRMA 1UZUA 1ECFA 3HJHA 2FTKE 1KQNA 4YMTA 3AILA 3BXEA 3WB1A 3TF5A 2GZHA 4UUOA 1CQXA 1NFRA 4LBWA 3IMKA 5FL7A 4ASUD 5JYBA 1VDZA 1YZYA 3PDIB 3WSWA 2V7GA 4F06A 5B3KA 3HEBA 3CB4A 3IC5A 2H1SA 4PQEA 1XEFA 1UADA 2BH2A 1U2SA 2Q3CA 3GFRA 2FY8A 1MVLA 2JRCA 2XVAA 1G5HA 3GJ0A 1GSAA 1YIAA 2H2IA 1GUFA 1MOPA 1TIBA 3E7XA 3V97A 1KXJA 1T9CA 4YRFA 3ZCQA 1S7GA 4OKIA 3T3DA 3U09A 3C3DA 2V3CC 4DJTA 1OBHA 2FZKA 2EG9A 3NHPA 4L9SA 1HFEL 1DC7A 3PXAA 4MUEA 4HLCA 4TV8B 3LDFA 2H8GA 4G89A 4GMHA 4MQLA 3MNFA 4ZJUA 5HUHA 2V96A 1Q6YA 5K6AA 1RVDA 2QXYA 2X8JB 3DAOA 3VSDA 1KHHA 1M1XB 1VE3A 4JWTA 4QUHA 2H3EA 1NG1A 3I9JA 3EIFA 4PSAA 4RZ3A 1T3GA 3L41A 2RARA 5TEWA 1F8GA 4NV0A 1MEEA 5AK4A 3R44A 4KBYA 1UBJS 5MN6A 4MQ5A 1GARA 1SU4A 3OIDA 5ULLA 3TSCA 3HY4A 3VR3D 4YRAA 2JF0A 3C6BA 3ZDCA 3TPZA 2HRQA 5TE9A 2IU6A 4XDZA 1Q0HA 3OT1A 2I3ZA 5FWYB 1Y4DE 5P8WA 4IF6A 3ZD9A 4GPZA 2YJ5A 5DLEA 5H16A 4G0QA 1TI7A 4DABA 4BLQA 4FEYA 3LPMA 4KFTA 5JPCA 1M75A 1N3IA 1LA2A 3FZEA 4CKCA 1RE0A 4EGAA 4LZJA 2G4LA 3QLTA 1RAAA 2DTXA 2HIGA 4B3HA 1FE8A 5BSMA 4TMVA 1CK4A 3HMKA 2B2NA 2Y1WA 3UJPA 1KDOA 3ZE6A 1GDTA 1WZ2A 4PX2A 2BL4A 2FNAA 2G08A 2QPLA 2QNBA 2HJVA 5DHSA 1PR0A 3NORA 4NBWA 1R1DA 4L28A 4YRQA 1Z62A 4OUKX 4W9RA 3W1EA 2W9XA 4QASA 3SGLA 1U7PA 3K16A 4INJA 3CVJA 4Y9RA 3GDHA 4YMSA 4EUHA 3UGKA 4PGGA 5D01A 2OENG 2AX3A 3JV7A 2AN4A 3E8XA 4QYIA 1ADJA 4V3BA 1Y1TA 1KJIA 5IAJA 2XADA 3VC1A 4J1SA 4P22A 3UHAA 2J6CA 3AP2A 4RFLA 3ITKA 821PA 2LW7A 1D0VA 5EI5A 1Q0QA 1BQEA 5BN4B 5JAIA 3WKDA 1O0SA 2KX7A 3ZU3A 4H4EA 3GZJA 5DM1A 1EP9A 4D9CA 4LF8B 4WZAE 2D5IA 4P4UA 2BR4A 1Y6RA 4HNVA 5EIOA 4MA0A 3QE2A 4QDKA 2AR0A 4FDAA 4R69A 4Y98A 1R8SA 3I73A 2HWUA 3NQ41 4AROA 3I61A 4NCBA 1PJCA 3P2EA 3CH6A 4H0NA 4I50B 5K3CA 2Y9MB 2EC5A 3UGQA 1YBFA 1EHYA 2IYVA 4RM2A 1LZKA 1M6VA 2Q5FA 1K2VN 3OF3A 4TT8A 3BL8A 5AR1A 4EEZA 1RLUA 1I30A 4X3CA 4AY3A 4EYSA 5KREA 1E0JA 2DCMA 1O8CA 3BJMA 3QW2A 4A9AA 3KTAA 3F74A 4IWXA 3HWRA 4MR8B 1PQWA 1X87A 2Z3WA 2YJNA 1EVLA 2GBFA 3GRRA 3VU9A 2QUKA 2HD4A 1S2DA 1DLIA 2FK8A 4J4BA 3TCKA 2O20A 3ISJA 4KRYA 3ZWMA 1UKBA 2W70A 5K8UA 1Z4QA 3C5EA 3JQBA 1VMAA 1AA6A 2FZCA 2QUIA 4OTZA 2PZBA 1NN5A 3EAGA 1U5CA 4UVDA 5DNWA 4P5DA 3SEQA 3FHTA 1M1UA 1Z4KA 2H2GA 2HRCA 2ZYDA 3QG1A 2EKDA 1ZXBA 3E7DA 4GZ3A 1MXHA 1XQVA 5BOSB 1Z2CA 1GPAA 2W4MA 3N86A 4XB6B 3T61A 1OGYA 3PRYA 4KREA 2F17A 3WIUA 4Y6QA 1Q22A 2H48A 2FPKA 3NUZA 3JZDA 4AF7A 1KAQA 3J80A 4A16A 2PT9A 1O8BA 3EXG1 3OQMA 3GLIB 4JHLA 2FJUA 3C6MA 3QWIA 4EHBA 2V1XA 1I2AA 4QRIA 2QZ9A 1U0OC 2A1UB 3DP9A 3QHPA 5ALPA 4LPSA 1GTG1 4A8TA 1WZCA 2M1XA 4FVTA 3ANTA 5LLSA 4WDRA 5BQ3A 3VHLB 4D6XA 4KU4A 5BYJA 3PXXA 5HIAA 5EZYB 4BNMA 3CX3A 5L7TA 3M70A 1H94A 2XITA 2YXDA 1LKZA 3CR8A 3TD6A 5JAPA 5I5GA 5B58T 3V8EA 4YJ2A 4QNRA 2PX3A 2GMWA 4EO4A 1CE8B 2PZKA 2A14A 1Z8NA 4TMZA 2C4TA 1YGYA 4EJFA 2PPLA 3HZZA 2QVYX 3WAKA 5EXPA 3TBHA 4X54A 3TLBA 1PFGA 4X7MA 2A0WA 1WJGA 2IY9A 3ZE2B 1ZI9A 1CS4C 3B6ZA 1RI2A 2J0VA 5LXTF 3KK0A 4MKIA 2CVPA 4XKJA 1Y42X 1CZHA 4HYEA 3O4JA 4KWTA 5EZYA 3ZCPA 1SKBA 3AEQB 2LDXA 4CIBA 1YCHA 1IY2A 2P3LA 3CF2A 1UP6A 4UD2A 3EGXB 5FD8A 3QIVA 4MWSA 5TPWB 2NT4A 3SYNA 1YL7A 4TTPA 4MUBA 2O59A 3P9CA 2M1ZA 4NCAA 3FE2A 4O5OA 1AO0A 2N42A 1Z7WA 3FTFA 4FMDF 5AW4A 3QSYA 3CUSA 1IB0A 3TMYA 1L7BA 4O59O 1WW2A 4MA5A 5TMPA 5M34A 1OYOA 3OY2A 2OCXA 3SHWA 1Z17A 4K2HA 4D4MA 1Y5MA 2P0AA 2IXAA 3UCEA 4B6GA 2C92A 4HNAB 5JNTA 1JKJA 4EP1A 1YS6A 2PXAA 1A9ZA 4AT1A 3GYGA 3PGVA 4H7IA 1SG9A 4ZRNA 3VX3A 4LYHA 1JU9A 1XZLA 3DEJA 2ZIEA 4G8BA 2JH3A 3DHYA 4JN6B 2JD2A 3KQYA 1AGNA 4DMMA 2PL3A 2C54A 3N7TA 3COJA 2PJRA 2YR0A 5E0OA 4RGVA 5GVRA 3PA6A 1ZI8A 1DDIA 3VSBA 4GPTA 4JB2A 3WLJA 1TJNA 3WYNA 3F7OA 1VPDA 4QJ4A 3CUVA 5CB8A 5J5CA 2HUPA 1H8HA 3LV8A 3BHIA 4H2DA 3O8LA 2FE4A 1YJBA 3WK4A 4FS3A 4J0HA 4KWEA 1OI7A 2C2HA 4Q12A 5CX1A 3RVBA 1HG0A 2OBYA 4MVJM 4LC9A 2J48A 1QZUA 1MQSA 3GXBA 3PGMA 3Q9SA 4MDYA 1PS0A 2V7VA 1L7OA 3A0RB 4JOBA 4RNDB 1KBQA 3D8BA 2NZ2A 2B7LA 1NA5A 5EIBD 1T36B 2WLSA 2H4FA 3F78A 4PYOA 4JV5B 4I1UA 4S0XA 1TJ3A 5TNXA 5BT8A 4EX6A 4C30A 2O6HA 1CUFA 4Y1RB 3PG5A 1G21A 4DJAA 5BYKA 5HQ3B 2ZI7A 3WKAA 4FI3C 5JC1A 5E7IA 4L5JA 2V5UA 1DV2A 1S4MA 2VLBA 4NJEA 4XA8A 4OMFG 3PV0A 3OJFA 2P1ZA 3RRBA 8ATCA 2GXUA 1YB1A 1GNTA 3B3AA 5FOVA 5BR7A 2WUDA 4EB8A 1FZQA 3R3UA 2Z1NA 1FMFA 3VR6D 1XHEA 5IT4A 3VKHA 5REQA 3WLMA 4QYIB 2GD0A 2QMOA 3AVQA 4CQJA 4EUKA 3HKCB 2FEKA 3NX4A 4OYRA 4NS4A 4LWOA 4D4JA 5ALHA 1RWPA 3RKRA 4DUYB 3PT5A 4BFTA 2C9BA 3DL2A 4UVEA 1W44A 2YFKA 4K9MA 1NSTA 2PO5A 1D09A 1FLVA 3CX4A 1ONOA 2BKUA 4RD1A 4AN4A 1PU2A 3O2JA 2XQFA 3ED1A 5KAPA 3C3PA 3SIPA 4EG3A 2JZNA 2QT9A 2OM6A 3LHKA 3TX2A 4AQDA 5ED4A 1P7YA 4XDGA 4R1SA 2XQGA 2BF7A 1ID8A 4X6UA 1KE2A 4YJ2F 5E9JA 2C2BA 1MZPA 3L0BA 3LOUA 5LBTA 1DCKA 1DIOB 2Q9CA 1GUZA 2AC2A 3B5IA 3D54D 3K3PA 5FTKA 4MX8A 2B4AA 4MI1A 3ZWQA 3CG0A 1JMVA 3UKJA 3B6MA 3ZYCA 5LQDA 1TMGE 3A06A 3I3OA 3VVLA 5F52A 1SOVA 2ZR0A 1ONBA 2FR8A 3A4MA 1DTWA 3K1TA 4B7XA 4YMUA 2UZ4A 2P7HA 1R16A 3H2YA 5A62A 4HH1A 1TVMA 3A7DA 3FUTA 3ZH9B 1P45A 1J5XA 1E3WA 2ZULA 2N0SA 3JQEA 2WNIA 1TC2A 2B30A 2G09A 3C24A 4EPRA 1W4RA 5EP1A 4RJTA 3OMWA 3LRXA 4GE0A 4HAWA 3R9XA 2WTEA 2VP2A 5DM2A 1BROA 5JOQA 1R0BA 2HLPA 3HWSA 2W58A 2WJGA 2P9CA 3DUFB 5L3VA 3RUIA 3DG9A 2P67A 1JSXA 1PVOA 2HCJB 2HQ1A 3W5VA 4AIRA 1Q7RA 4OY3A 3QKSA 1B6GA 4ENVA 4G24A 4ZZ3A 2QVZX 4CKEA 4B43A 4KFSA 2WWVD 1XL1A 3RHFA 3HUTA 3JWPA 5DTMA 3ZVNA 5E4JA 2ILVA 2IS4A 3A1UA 4KCGA 1HE4A 5TLSA 1TA0A 2ZYVX 4TZ6A 2OXEA 4ZYXA 3RS8A 1HDZA 4IEEA 2I3GA 2ODTX 4V0QA 2CHUA 1WV1A 5AM3A 3KR1A 1CY4A 1KJNA 1US8B 3A10A 1GNRA 4BLOA 3ZCUA 5CXQA 1UBUS 3HSKA 2CMDA 3L0SA 5H9VA 3RG2A 2WWGA 3DT6A 3IAEA 3W5AA 2CXTA 2HZBA 1ZBDA 2ZJ4A 4PWZA 1Z25A 1HYBA 3KWFA 5DNEA 3W9YA 3OUZA 5IYZB 1YCDA 4MAMA 3I37X 2HYIC 2YVQA 4QGAA 2YX1A 5IF3A 2F8MA 4K9OA 2WNHA 1NI4B 1Z6ZA 3FOCA 1PT7A 2GEUA 2QJOA 4GHWA 4Y2PA 2A4MA 3O92A 1HK7A 1NBIA 1NW7A 3KVVA 1TW2A 2GJAA 2H9AA 2QM8A 2BFOA 1HE2A 3BCSA 5CX4A 4AUNA 5F12A 4Q47A 3ZCSA 4R40A 5K0FA 4JGIA 2F2TA 1B93A 2KYRA 2PH3A 1P75A 1U11A 2XF2A 3L04A 5DN9A 4FZVA 1TK2A 1DS6A 3NTXA 5FPYA 4G41A 3DMDA 3VHRA 4TWZA 5EERA 1R0WA 3Q3CA 5FV7A 4FU0A 4URZR 5KTMA 3AI2A 3GAZA 4LNUB 4S2EA 1P31A 1E2UA 4D9FA 5MDHA 4OHBA 5FNVF 1XTBA 2CLDX 4P4SB 5J4HA 2B5WA 2XNJA 4FFBA 3PDHA 3NBXX 3MB8A 2JZCA 2QLMA 4WNAB 5G4LA 3RC7A 5F1YA 2AYXA 2G5CA 2H2AA 4J3FA 4NMLA 1HNNA 1Z22A 2D06A 4B8WA 2ID8A 2H2WA 4TMKA 1M0EA 1ZD9A 1ORTA 4ZVOA 3VSEA 3G68A 2Q7XA 4N7JA 5K3OA 2AFIB 3I76A 1FK8A 1H6BA 5SYNA 4QOFA 1CDEA 1NUUA 4CE6A 4K9SA 4GKJB 1VJ1A 1CVRA 1S8AA 2QLTA 3BHJA 4FYMA 4BQIA 1G8YA 2HADA 2P6UA 3DGEC 3EA4A 3F3KA 3FHJA 2WYVA 2YXLA 3O47A 4WPGA 3T3MB 1CUZA 1K4MA 2FN4A 4NPHA 4OCZA 1KZHA 4WHMA 1ENPA 4D42A 1JEAA 3ZZTA 4HMQA 2W7TA 3TZBA 4JQSA 2H11A 1Y5NA 3BXGA 1R3DA 3FRIA 3CC8A 2M2IA 3DOUA 2QQ0A 3QXGA 4UTXA 5JD4A 4MMZB 4XM0A 4JOSA 5DLQC 4ALLA 5CB0A 3A1FA 3K5PA 2VJOA 1V1MA 5IZ4A 2ZSIA 4XWKA 1IPEA 1PAUA 4M38A 1PG2A 4UU7A 2GM9A 2FHPA 1J4AA 2HMSA 3ISTA 3OJWA 5F4ZA 1JIKA 2HHLA 4RWZA 2HM7A 3S8EA 4RK5A 3TTWA 3TQHA 3UG7A 1T4MA 1NY5A 3MLAA 4PZPA 5E2IA 3AEXA 3CLTD 3HLKA 4M1TA 1SCQA 4PBTA 4V0MA 2FMHA 4BGVA 2JEYA 4M46A 3K0AA 4TM7A 4OM8A 3FSJX 3GB9A 1WO8A 5CDUA 5CEEA 2H0QA 2FCAA 3GJ5A 4Q9KA 1TFRA 4AECA 1OH8A 1U1EA 3HK2A 1XRPA 3GHHA 4OMDA 1BVHA 2JGMA 2AFVA 3NEPX 2YL2A 1DAFA 1ZA2A 2Q62A 1QH1A 4QATA 2V5VA 4XOUA 1E62A 1BDMA 1X42A 3A31A 4DM7A 1EVYA 3ZDXB 3ZV4A 3ETNA 5B4VA 3WG9A 1AN0A 3KOYA 1MVOA 2C96A 2HMYB 4HFMA 1KI6A 3KR2A 3SJZA 2I54A 3ONVA 2CUNA 2R00A 1ZVJA 1P60A 3O26A 2WIAA 3ST7A 4E09A 3BT7A 2NN3C 2Y2UA 2PT6A 1B0AA 4YAEA 5JO0A 3WIVA 1FMJA 2IOHA 3CHYA 1OWLA 2DHCA 2QUJA 2Y0PA 3MXOA 4OM7A 5KCMA 1I5OA 5SV2A 4AXBA 1V9CA 1JEEA 1OPRA 2VOEA 3Q7PA 4Q4DA 1Z08A 4JI6B 4CG1A 1QRSA 4S1PA 2M9MA 4UJ5A 5AM0A 1QG2A 2VTEA 2OD9A 5CM2Z 1FFGA 1YS4A 1RFGE 2A35A 3C3AA 3RV4A 1PQYA 1GUYA 3BFVA 4G2NA 3TB6A 2NO6A 3NDIA 1ATZA 1J2EA 1N8KA 2JK0A 2EZUA 1QO9A 2GDZA 3EIWA 1WW8A 3ADPA 6REQB 4N1AA 4V0RA 4FFDA 3ZIDA 1Z0ZA 2BR5A 4KQCA 5ISMA 2RGWA 4KO3S 1UJ2A 3B70A 2Q6TA 4NZOA 4FBLA 4RQTA 1Y7PA 5AHXA 2J9ZB 2G5PA 3TB4A 3V4SA 5KYTA 2PYIA 4W9MC 3Q3VA 4JLNA 3HCFA 2F55A 5ALMA 1CQJA 3D64A 3G17A 4GEKA 4I4IA 3UT0A 2IHTA 5IU6A 1O6CA 2FH5B 3U4HA 1QSGA 4L08A 3R5HA 4C4RA 1G3MA 3IIJA 3EFHA 4Q02A 3DV0A 2LIVA 1ZSVA 2FVXA 3RVRA 4OYYA 3LZ6A 1ZH2A 1C30A 1SOUA 2XOKA 1Z5NA 1JPUA 4PPFA 4M0CA 4AURA 3A6KA 4HDSA 4Z7QB 3G7UA 4LNUA 4PZ0A 1BIFA 2YMMA 4PQGA 1UMCB 4DV3B 3E1SA 1UFRA 1IXYA 1DHRA 2FJPA 4QBKA 3WLRA 4AZ3B 4RMHA 4WGFA 2B98A 1FFEA 1MCZA 1N8TA 2JI7A 3ONFA 2ERYA 4CQMB 1DEKA 1TLLA 2Q2VA 2XTZA 1NUSA 2I80A 5IM5A 1ZEMA 5AI6A 3TN7A 4AM8A 3I9FA 2UU9B 1CU1A 4IMRA 2EWWA 2WUFA 1DJLA 5K8IA 3Q6IA 3RRFA 4IDBA 1F2UA 3B82A 1UMDA 3P45A 2DWPA 3PHJA 1TYAE 3N28A 5AW1A 1VBMA 3D5TA 1DI0A 4AJ1A 1GWNA 2NSDA 3GAAA 1S9DA 1RTTA 2VP0A 3K15A 1SUCA 4B84A 4DM4A 1DIGA 4AX4A 4BO6A 5LYYA 1OY1A 1TAQA 4OK6A 1Z7BA 3FTCA 1KRWA 4TYMA 3FMFA 1U2ZA 3W9UA 2YWFA 2CDCA 1L8AA 1I3LA 1VLJA 2JCXA 1G3QA 1UDAA 2ZATA 1K4YA 3K9GA 3OWXA 3Q3GE 4JL5A 1YOVA 1MTOA 1YU9A 3O0DA 4P7BA 3RIEA 3VKGA 4E13A 4H3SA 5K0LA 4HEJA 4Q9JA 3PDJA 4CQNA 4ZQGA 3WYGA 1NOIA 1T26A 4LXYA 4EM6A 1I7SB 3QWAA 5JLAA 4JU9A 5ECGC 1XOIA 4Z1MA 5C5IA 4D4KA 2GNOA 3CYFA 3HJTA 3E22A 1V16B 2Y3IA 3BHMA 4JUIA 4UHCA 2J9FB 2VHJA 2SCUA 3X44A 5J4KA 3DUFA 1QVAA 4KKXB 2V3VA 3KEQA 1G5QA 2QG6A 5CH3A 2RI0A 3ACBA 1NSYA 1RKQA 1J2TA 3RRJA 1FFCA 1J0DA 3G9TA 4OJKA 3OD5A 3RFTA 3S3TA 1ZA1A 3U62A 4YT8A 2JI9A 3RB8A 5L3SA 2ZXUA 4IH9A 2JLQA 4JYPA 3TEFA 3ZDBA 5DGDA 3AF2A 1NI3A 1Q17A 1Q91A 5G0UA 2VPWA 2IYOA 2VYFA 5A1TA 5FAXA 3PQ5A 2WABA 3ESBA 4E12A 3E05A 2CVOA 2X7JA 4X1OA 4ZAZA 2AMFA 2HJGA 2Q1YA 3BS4A 3MGGA 4KKVA 5DBFA 4ZTBA 3H17A 2FE1A 2J3MA 2NTNA 4GBMA 3D7LA 1EX6A 4XEHA 4QYMA 1JDNA 3ZTWA 1VG0B 1HV8A 1RKVA 3B85A 1A95A 2G71A 1U3DA 1E6UA 4MQ6A 4RORA 3CEPB 5C8YA 2HW8A 1NDQA 4E5SA 5KSYA 2QN9A 2DLNA 3ZZ1A 4M8KA 4X8MA 1PDVA 2BZ0A 5H68A 2XDAA 2ZJAA 1MX5A 1WXGA 3W7VA 4XTCS 4A03A 2Q3FA 5BR4A 1JHDA 3S2ZA 3NEAA 5JNUA 3EN0A 5DX1A 4U7FA 4UM7A 4ZQCB 1D2NA 1V1RB 1G19A 3MMNA 1VLQA 4HDKA 1IN8A 3GJQA 4DJJA 1OLSB 4OBEA 4UU1A 3RBVA 4CI0B 2DR0A 1IMOA 1EJ6A 1P17A 1XWFA 2FKNA 1T8PA 3FTNA 3ESQA 4Q3NA 4D9IA 3C43A 4LBYA 2UUPA 4GZMA 4LDQA 1J8MF 3O9VA 5NULA 4F72A 3GJZA 1S89A 3RO7A 1MG0A 4CKZA 5IM4F 4GLFA 1E8MA 1JZQA 4BO9A 2G9UA 4W1SA 2C2MA 4IFTA 2R5NA 5H8WA 4V03A 2ZUVA 3L8MA 2WSIA 4RHXA 1Q19A 3L8YA 2WV9A 4BMXA 5AWFC 1V11A 3LX4A 3SU8A 2RG1A 2Z5LA 5JQGB 4DA6A 3HBLA 4TQAA 2KJQA 4KE7A 4F6LA 4I9FA 1Q1GA 2PD3A 3CNEA 3OLCX 4G2TA 4DV1B 2AGVA 1P8JA 1ZRHA 2AEJA 4NWIA 1N1GA 1EIWA 4Y2VA 1M5TA 3BSWA 2NAFA 1Z16A 1GRRA 2XE7A 3BMNB 3LHSA 1UXKA 4LHWA 1D2CA 2ZWIA 1Q5PA 4M3NA 4OUDB 2XNKA 4PQFA 2YS6A 3JQ6A 2Z57A 1E7SA 2XVYA 2W8BA 1ZIYA 3KUDA 1QOZA 1O9HA 3F46A 4GI1A 4EI7A 2XNDD 3GH3A 5CVDA 2VHVA 1YC2A 3I12A 2EKPA 3ZDAA 4HDNB 1ADCA 1A9QA 3FBGA 4H1UA 3BZUA 3OLZA 2ZJ3A 2ZJ7A 1BU5A 5EKTA 3LCCA 4K9PA 4B3TB 3QA9A 4JUDX 1PUXA 4HDRA 4KZPA 2ZRAA 4D82A 3E5HA 3FPLA 1N2CB 3MS4A 2FFJA 4WSOA 3UKOA 1QH8A 1VG1A 3GAFA 4F85A 3MN1A 5H3CA 1JP7A 2J33A 4L9AA 1NRJB 5HWSA 4TTTS 1F8XA 4P32A 1UT8A 2FXIA 3E3NA 1WSAA 3AO0B 2EFJA 3EF1A 3RK4A 3KVYA 1XTUA 1RC0A 4HPXB 1YZNA 4W8OA 3ROGA 4DWOA 4G5RA 1ODJA 1UZAA 3IPLA 4DY4A 1KPGA 5K4GA 3WLQA 1AZWA 2PCLA 3K9BA 1XL0A 2VQDA 3NYRA 2FN3A 3FFTA 4DMRA 1IJKA 3WGVA 3DXZA 2HSJA 5JDIC 3B9BA 1JHZA 1BCSB 1J25A 1SVNA 1RZVA 2R751 3RVDA 1DJOA 4PICA 3UJHA 3WGZA 4DCSA 1KEEA 2BFBB 4L9RA 5DJ5A 2VBCA 3GFPA 4L75A 2HIMA 1COWA 1L7QA 1ZGZA 3LP8A 5CGQB 3GY0A 4OK5A 2QAGA 3ITNA 2CFOA 3RTAA 2Q6IA 1YB2A 3JQAA 2G67A 2VK4A 3AFIA 4S24A 1TFUA 2JJQA 3F7MA 2NPIA 3WB0A 4R0NA 2HEGA 5K3AA 3OTGA 3DL0A 1RSZA 4C4YA 3T7CA 5IF9A 1WCYA 4ETIA 1TL7C 1WDLA 2Y66A 4BCDA 4YRZA 4H7KA 3WL7A 4R71A 5JMTA 3LY5A 1Y7LA 4LV8B 5BYBA 7REQA 4PONA 3ER9A 4NOJA 1SHZA 1B73A 4A5SA 4D2IA 5TRTA 2XCQA 1N5LA 1OMOA 1ZU5A 4FSDA 3LL4A 5TF0A 4W5NA 1TM4E 3DKPA 2AXEA 2FG6C 3FCOA 3I92A 4FE4A 5CBPA 2QAGB 4MYCA 4FM9A 4R2IA 3U5TA 4AO7A 4HEA6 4HKTA 2H5JA 2H7VA 2VPZA 2GLXA 1ULUA 4WBNB 2YFHA 1F8YA 4PCUA 3B48A 4RC9A 2P9GA 2F3QA 3B5JA 1UFKA 3VPAA 2WIKA 3JS5A 3QU2A 2X40A 4P7JA 2BMJA 5LPNA 1Y3FE 5IBCA 3JQGB 2CNOA 5HS4A 3RK0A 3HKDA 4EJSB 4CFZA 2H1IA 4U00A 1YHYA 1GGVA 4IFBA 1SQ5A 4GR9A 2CKMA 2GN6A 2PZMA 1E6CA 1FNNA 4N3AA 4P3PA 4A0FA 3FB1A 1RLOA 1M73E 4PZLA 4YCAA 1J6UA 1RXYA 5BR1A 1Y82A 3IVRA 1RZRD 3K0HA 4TGLA 1B41A 3AHDA 1JFFB 2V6FA 1OH5A 2DX7A 3SYKA 4EMSA 3NDPA 4D41A 3EGDB 3UMJA 4AMYA 2VDRB 3EZXA 3H16A 4Q82A 5A5VA 3VBEA 4M0UA 4PRKA 5IHXA 3VZBA 4EVRA 5KQMA 3EIOA 1E5XA 5IDXA 2CF6A 3AY7A 4N18A 2AQKA 1ZGBA 4IOLA 1NMXA 2C1ZA 1C8VB 3H5AA 3IP1A 5GADl 3UYLA 3W2HA 1N2OA 3AKDA 3LVRE 2PGJA 4RADA 4XJVA 2W00A 1P0PA 1QJ4A 3L0ZA 4IDGA 5DSZA 3PVSA 3RS5A 3PJGA 4I4TB 2BFEA 4L0DA 3H9QA 3DW3X 3UA3A 2R47A 3ZS9A 1DEXA 2LRHA 2NM0A 2VHUA 3EMVA 3L7JA 3NHBA 4ZREA 2W2NA 3OZSA 3W90A 4ON9A 3LQ4A 2YV4A 3GR6A 1E1YA 2GJSA 5JE8A 3QNWA 1V3VA 4GOOD 1LLQA 4XXHA 5A0FA 3RYHA 4ZZ1A 1J5EB 2FVYA 3WL8A 1SWVA 1T9HA 1YFZA 3OCYA 1JHPA 1C1HA 2AUNA 1NZDA 3R4VA 4IGKA 4JLWA 4ERXA 3T1YB 2YKGA 4OHYA 2KHZA 2PR7A 2GOYA 1BWPA 2M6LA 2ENWA 1XQ1A 2X23A 1X7DA 1TEXA 1HMPA 3DHNA 3NVKI 2PQMA 3UXHA 3PX2A 1K98A 3MW8A 4PAOA 2AFHE 3JQRA 1JXMA 1AKRA 1QRDA 1PP4A 1ZM9A 1EXNA 2OSVA 1A9SA 1PJTA 2OAGA 2CMHA 1UC5B 1Z15A 2EYUA 2Q0SA 3AY6A 3GMTA 2WHQA 4HXEB 2YN4A 4MCIA 9ABPA 3U56A 2AOUB 3ER8A 4XVHA 1JEOA 4PG8A 3AYXB 3E9MA 3JQFC 3PFKA 2GN2A 2Q5HA 5K99A 3O83A 1YA4A 2DY1A 3K2IA 2P65A 4HLUC 1TTQB 5E38A 1RXUA 4CIXA 2E55A 2JIMA 4UDNA 4UHDA 1JLSA 2JAWA 5C8YB 1S7CA 4YBZA 3GLGA 1N9KA 4CMHA 1Z5UA 1RWKA 5JRJA 3I72A 5JCOC 5JMOA 2H3HA 1F51E 2Q8NA 4V0KA 3T1HB 1G8JA 1T10A 2YV1A 1Y5RA 3LC2O 1DX6A 4QWMA 1KOLA 2G36A 1FMCA 2EF0A 3TLXA 1WPXA 3EXIA 4FCTA 2ZEJA 4CTKA 1I2CA 1GSOA 1T5HX 1XR3A 2R97A 1P7PA 2XV1A 2XCIA 3R1IA 3N5KA 4IHKA 3GK3A 1GJRA 4WJLA 4JUCA 4X3PA 2P4EA 4PEVA 1S2OA 4EHNA 1LNQA 4ARAA 1A5BB 1PEKE 5ECYA 4YDQA 2MDTA 2RH9B 4TLEA 4HDMB 2X8JA 2TMYA 2AI3A 3G8CA 2WT4A 3FUVA 3JRXA 1W6RA 4NULA 4RL4A 4DIUA 1EUCB 4NV3A 1KAGA 1SFRA 4PTLA 3OJOA 4R0MA 3BTUA 2IYNA 3OPMA 2BLNA 2PKYX 4C3VA 2E2WA 2O8BA 1JG2A 1I0ZA 2M6KA 4M89A 1XAGA 2BT4A 4MP3A 1XEWX 3GOHA 4PZDA 4AL4A 5JVDF 2CXUA 2VN8A 2WIFA 5REQB 4EW2A 3N7AA 1Y1SA 1A4RA 3GGDA 4P4SA 2IUEA 1XA0A 1ZP6A 1JQLB 2COUA 3F8WA 3IMEA 1VCIA 4Z54A 4ZTZB 2WE8A 1QPZA 4RSHA 2IXBA 3EHEA 4YASA 5BVGB 3L8GA 1NUQA 2IF0A 4L0CA 5LDHA 4RDIA 2VDVE 4PNPA 3SK0A 4HGNA 1ISGA 4HNHA 4DIBA 1CC1S 1HKUA 3DTTA 3H3XA 5GQSA 2B0CA 2RHRA 1Q7TA 2P5UA 5IMBA 1NAHA 3ROKA 2IITA 4QFCA 4RD6A 1FJXA 2RAFA 2CLOB 1E7YA 3QY0A 1MRNA 1FS4A 5D5PA 5C35A 3SQDA 4YQFA 2RGBA 3UJ9A 1DP4A 4LXXA 1L5OA 3V2UA 1QC5B 3AXSA 1XEXB 1W9HA 3RYFA 3ZCRA 1F1BA 2Z5VA 3EWAA 3TZ6A 5JRDS 4GEGA 5EPOA 1X0VA 2A9RA 3L6UA 4YNBA 1QLJA 3PGA1 4KXFB 4XCXA 5ESWA 3ABIA 5HFJA 3DZ8A 4N03A 3QEAZ 2Z1MA 3R6TA 4LTDA 4WD3A 3NXSA 5KVAA 5F23A 4M54A 1Y48E 1O6BA 2QP9X 4C2UA 2CW5A 2IUUA 4ER0A 2Q41A 4JKYA 3F4LA 1K6EA 1RJWA 5BN3B 1XPRA 2HK7A 1MAWA 4HQFA 4RETA 4OU5A 4ZRDA 4EPTA 1E1QD 2CFCA 3ANXA 4NFLA 4Y1RA 2H18A 1L5QA 3WIBA 5HQ3A 4W7IA 1E1CA 2X7HA 3UT5B 2PUAA 4HADA 5J9FA 2W6JD 2Z43A 4JB8A 3WKCA 4E5DA 1VHQA 1E1QA 4ZVLA 1YQDA 4W8GA 5CXUA 3BB1A 2FX3A 4LQ4A 1KO1A 3ICPA 5ITVA 4PX9A 1EFRA 4Q39A 1DG3A 1MTZA 5J40A 3SOPA 1JH9A 1EUYA 1AGYA 4YXFA 1FDRA 1E5QA 2C0PA 1ZK4A 2NV0A 2OAEA 3A4LA 3OURA 4O5AA 4CM1A 3SQXA 2AZDA 2GNPA 3R6LA 5KNBA 2WZBA 3PQ3A 1P5RA 3OCZA 5CTJA 1GHTA 3CZ5A 2W2KA 4GM0A 5H4HA 5C7IO 3KJXA 3GPBA 3WNDA 5KU1A 4KE9A 3DV9A 3SG0A 1WVGA 2PKRA 3U0BA 3NTVA 2X9NA 4UASA 5CPFA 3EASA 4BX8A 5ARDA 4D99A 4MGEA 3ITEA 1RYFA 4GNKA 4HPWA 3TI9A 5C7LO 4B32A 1SZCA 2H59A 1SHTX 2CUZA 4YAUA 5LCXA 2XB4A 4KVAA 3WV4A 3FR8A 1VYUA 3ND5A 4NPAA 1B8VA 3KO8A 4ARBA 4C4TA 3NBMA 5KTOA 2X1MA 4U4AA 1G20B 1PHPA 1CUWA 4Y6PA 3ESRA 2OZEA 3URMA 4M8NE 1JDUA 1YL5A 1Q15A 4UVGA 3ETLA 4BRSA 4GLOA 1IN4A 2IA5A 2PVPA 2ZAYA 3T41A 4CCSA 4OMCA 2VBFA 2GK6A 4QEZA 1QB8A 1P4SA 2QRLA 2Z4RA 2PWYA 2C99A 5D3QA 4RMIA 3DBIA 2XWSA 3PNMA 4LY9A 3WR5A 1SUBA 1IATA 1NNI1 3EPLA 2UVPB 1X7WB 1UC9A 2B3TA 4E30A 3PKIA 5BOSA 3H8SA 4Q7KA 4GU5A 2BDUA 2TMGA 2ZRFA 1G5FA 1DX9A 1S3GA 2XUJA 1KOJA 2IHZA 3FZQA 1G6KA 1CIPA 3WAGA 4Z0HO 4HAXA 1QMPA 5EJ8A 1L9XA 4MEAA 4N4AA 5C5DA 5KTPA 5KOJA 4I1SA 1H4VB 3DW1X 2XB2A 4F93B 3BHNA 2XZPA 3H3FA 1FFHA 3N05A 4Z4GA 3NV9A 1E5LA 2QX8A 3E0XA 5JAZA 2P4QA 4MVJI 2BKEA 5HJEA 4XOIA 1XJCA 4BS9A 4UJ3A 1VLLA 4ZI2A 2PKWA 2VHCA 3ILYA 1I32A 4HGRA 1KS9A 5F3RA 1JVSA 1P6UA 4MRNA 2GEKA 2HCRA 4DDKA 1ESZA 1UKCA 2C1EA 4P2BA 1F4VA 4PAGA 2RGNC 5JCOA 3KB8A 4PZ9A 3PRHA 3X1KA 3SFZA 5T57A 4B85A 2PO7A 4JJIA 4DR2B 2O8VA 4OATA 1LWNA 5DFAA 5J47A 2O2XA 4L72A 2ZCJA 3HCNA 2ORVA 3GGGA 2QJRA 3ODGA 5A06A 2D8AA 3SC2B 1Q83A 2P2SA 1KYQA 3FOAA 4MS1A 2P90A 4A8JC 3ABZA 4MINA 1OBCA 3HO8A 2IYLD 3NT2A 3REOA 2MR6A 3RAPR 1TAUA 5H0IA 4DWVA 1HNXB 2J5RA 4PQRA 1QO7A 4F12A 1ZGHA 3NHUA 5DULA 5A7GA 1HH4A 4ZU3A 3BK2A 2ZT7A 3TSYA 4FDUA 2OCIA 1SBTA 2BI4A 1VFNA 2Q6LA 4PGAA 4DQKA 2QAJA 4F2WA 5IG2A 3U49A 1JQEA 3PEWA 1RHUA 3ZOKA 1WBBA 3O8BA 1XMSA 4W5JA 1GU1A 1DJNA 4RQUA 3OMLA 4IKPA 4DJEC 3OQHA 1F9EA 3NP9A 5B1IA 3IYLW 1R8YA 5K0TA 5FB3A 1E60A 4HAVA 1GNPA 3TKLA 2NPFA 4BN4A 4C2AA 5I9NA 2BTEA 1RYYA 2OORA 4OF4A 3DVAB 4AUMA 3LX6A 2ZIUB 2Y1GA 4FQ5A 1LV8A 2QT0A 1U2DA 5JXHA 4L6CA 4W5TA 1E2EA 3NCHA 4Z0PA 4QDJA 2NU7A 3P0FA 4AUKA 4PLYA 5FPQA 2LIPA 2O2GA 4KGZA 3S1AB 3F90A 1VYVA 1Q16A 1XZQA 2WSBA 2CWDA 3OOSA 4RVUA 4TKLA 4UHEA 1EINA 2HTEA 5J3JA 1KMQA 3I2JA 3KL4A 2W2LD 4P3KA 4PG5A 2VYNA 1JQBA 1OFHA 2CXNA 4YPFA 4V0LA 1N2GA 4C0LA 2YQZA 4KE6A 3D59A 4QLBA 2AG0A 2FMKA 3KIPA 3M82A 1PKXA 3P4UA 1LGYA 3ZGNA 1DT3A 1C2YA 1E1DA 4CMEC 1YJXA 4JGGA 2OB1A 3GARA 3D4BA 3TPCA 4Y0VA 5DM4A 1QIDA 3IJEB 1R00A 1J9EA 4JP8A 5LD2C 5FWAA 1EP2B 3I5XA 2CLKB 2NOAA 1DC3A 3FOZA 2QN2A 2VXCA 1X80B 1P2FA 3H9GA 1U7WA 1WY5A 3EEIA 3ELBA 4FUQA 4RQAA 2OWEA 4UCFA 1P2TA 2IS1A 4V0OA 3S99A 7MDHA 5EVJA 1D9ZA 2B8EA 1LFDB 2BTQB 3EGOA 3BTVA 2AQIA 4G07A 3LRPA 4TL7A 4KAAA 5CT9A 1JB1A 4ALNA 1U3UA 1QGOA 5B7PA 4JVLA 3V6LA 1U5BB 3I0MA 3TE6A 3PPWA 1V95A 2XGMA 4MH0R 4CI9A 3KFLA 1G8AA 2PSDA 3HNOA 1J0XO 1DOZA 2PS9A 4H9GA 2PV7A 3G8AA 3GJ8A 3RHSA 1Z56C 3QITA 3T7DA 1GNVA 1KRHA 5KOHB 4UUNA 4IDCA 1YQXA 4UD6A 1Z6XA 4RH1A 1A8IA 1KI9A 2G72A 1IPFA 1ZJYA 3K32A 4YALA 1H2ZA 3AUJB 3HDJA 3W8DA 3DZJA 1NX9A 3SF0A 1PV2A 2UYYA 1OASA 3LGXA 3IDZA 4ZICA 2LNDA 3T99A 1AX9A 1BH6A 4BRZA 3L6DA 4XYLA 3EXHA 2WT9A 1IN5A 4UKDA 3VR5H 4C0QC 4DNOA 3NBAA 5K3DA 4GC9A 3WGUA 2X1LA 4FB4A 3LG2A 1I6WA 4G65A 3H6GA 1N78A 1E2LA 4Y6GB 3HKCA 2F1JA 5DTEA 1D07A 4ZQIA 3W6OA 2PGDA 4C04A 4RF5A 1SUEA 1E3TA 1EFPB 3KTDA 4PAMA 1E4EA 3GEMA 4YPVA 5IUKC 2A3RA 1J1UA 2XLBA 4RYLA 1U2TA 2ZROA 3SEFA 1P2UA 2CXRA 2WSYB 4C0JA 1PJ2A 1UEIA 2D8MA 4GPD1 1WP4A 2JGAA 2XWPA 1A97A 3CO5A 4GM4A 4IVNA 4RA9A 4JKIA 3H0EA 5BSKA 1QUEA 1J9ZA 3KTOA 3OFJA 5DM60 3S81A 1JUDA 2J0SA 5L7WA 2NSHA 4NYMR 1NIJA 2DQKA 2Y0CA 3RASA 4PZAA 5LMZA 1R4MB 2GA9A 2ZU0C 4DCGA 3OIGA 1NQOA 3SZGA 2V65A 1CUDA 3COZA 3Q1LA 5LKRA 1BW9B 3KV3O 4BNGA 3W5BA 3BDIA 1FUYB 2DUNA 4Y2GA 2P5YA 4PIPA 1K5GA 5GOTA 4D3YA 1CUJA 3V55A 3CLRC 3NHJA 3D02A 2QG4A 1WNFA 2DPYA 3DFFA 4BNDB 4KUGA 2FF7A 4W82A 3TD9A 3PQFA 1UBOS 4EG0A 4OBWA 2A67A 1U0RA 5HHTA 3ETHA 1SKYB 1W5EA 1CY6A 2IPLA 4MITA 4U2KA 3VDXA 1JKMA 3WIOA 4F4DA 5CFQA 4WEQA 1BW9A 5IJXA 2JFYA 3CFYA 4GZ5A 4UBOA 4X1YA 4UMEA 1Z75A 3AWIA 3K0KA 2B92A 4X9XA 4A92A 1F0NA 3NC1C 5BQFA 3OLWA 3ADKA 4XRRA 1JQDA 1DWPA 1GR0A 5E6UA 2AMLA 2ZBVA 5EKSA 1L5VA 2AN5A 3GUCA 1CJMA 2XUKA 1H2FA 4CT0A 2ZB7A 1SXJE 2JFZA 1Q7EA 4I9UA 2R00C 4Q0MA 1R27A 2VUIB 3BX1A 3O82A 4DIOA 1QYRA 3FNEA 4X5OA 4O2BF 3HXOA 4NBLA 3C3JA 1G0NA 2BEWA 2QQEA 2VQEB 3QPVA 1OW3B 3R0JA 1GPKA 1F14A 2K2QB 1J8DA 3AEQA 3HKBA 5EMJA 2F3RA 3VDMA 2CNBA 3R6DA 1OHHD 3UFXA 1Q0PA 5TX7A 4CL2A 3P71T 4OXKA 3CMCO 1BA2A 4J49A 1A7UA 4YLYA 1Z8FA 2C2YA 2LZ0A 2WKSA 2ZBEA 3ABRB 3EW9A 2WVJA 3MWDA 5K6AC 1HEUA 4J0CA 1V6CA 2W0SA 3DEAA 2HGSA 3DS8A 4ME6A 4C4XA 4C6RA 1JVBA 4H4CA 3BILA 2XD9A 3U81A 1KNXA 1KY2A 3VKFA 3NU1A 1GZ5A 5F2EA 3C1UA 4RTJA 1C29B 3V1YA 1QPBA 4TZTA 3W6ZA 3G8BA 3TRJA 4KO4S 5H3HA 4E32A 1SCBA 3KT0A 3FPCA 3OOYA 4FKZA 1PR5A 4TT3D 5JSKA 3WMEA 2GEFA 1SXPA 4IP0A 4ZVVA 4DWWA 4OP2A 3R5SA 3Q1KA 1FP6A 1I2BA 4HZGA 4HXYA 1NQWA 3N8KA 1E58A 1PGPA 4O4IF 2VTVA 3N2YA 5F98A 2XYQA 3IIEA 4IXWA 2PKXA 3VZDA 4WK6A 1XCPA 5L3ZA 4PYMA 4FT2A 1T3TA 4E22A 2OC9A 2XMSA 4MWDA 3M6IA 3OKCA 3G85A 2NU8A 1A4UA 1KVRA 3KV1A 5D84A 4LGYA 4B7UA 4AG6A 2KSQA 2G1AA 5EWLA 3I4CA 1P3Y1 1IXZA 1JDTA 2PKQO 3MWEB 5F7XA 3G5AA 4NONA 4NBKA 4OPMA 5JBNA 1X80A 1W8IA 3O7MA 1IVNA 1UMBA 7ADHA 3ZNPA 2YYYA 3REGA 3DB2A 3FZNA 2GBIA 4KIUA 5DH9A 3ET4A 1T0JB 4WXHA 1I7QB 1D2RA 1JYEA 3N87A 5I4IA 4DCPA 2OR3A 2W37A 2Y0DA 1W59A 4GP9A 5KDDA 2HXYA 2PWBA 4O63O 5C31A 3M4YA 1OYWA 2EBUA 2WKPA 2ZTLA 1V9LA 3JW8A 3TZHA 1ZVVA 4P4NA 2JGRA 3FMPB 3GIWA 5J4YA 1JJAA 3RGWS 3KVRA 3FPFA 4JLSA 4MKHA 5CGZA 5C3MA 5LDDC 1OGJA 3NKVA 1EX1A 1VB3A 1O95D 2CEKA 4CNQA 1SVMA 2FWJA 1F8FA 4B7CA 2V7UA 3UJ3X 3M9LA 4EQ6A 3F73A 5A4DA 1NJGA 3GBPA 4EZEA 5JSFA 3IE0A 2QSZA 3HNPA 3VH3A 3WOVA 5GINE 1SD2A 2KWIA 2ZJ5A 4MW9A 3VV2A 3Q8XB 3TM5A 5EP2A 1AK1A 2PMWB 1NFFA 4AD8A 4L4RA 1SELA 4ZCSA 2OHOA 2EKZA 2NO1A 2VLIA 4O4IB 4UQOA 3D8NA 3EAQA 3G8YA 3PTZA 4N5DA 4LZWA 3IUSA 4JBHA 3SHQA 3Q5GA 2W0MA 4IIDA 421PA 2IYYA 4RY2A 1W88B 2CB0A 1GQYA 4M0FA 2JKZA 5DSTA 3D4PA 4QXPA 3OPQA 2VUSA 3OE1A 4U6QA 1QZ3A 3T0GA 2W6ID 3F5DA 3INNA 4BKRA 5BR8B 1R6AA 4ZAFA 4EG5A 1KQOA 4OJMX 2XYRA 1MC1A 3H84A 1NWCA 5LB4A 2WFMA 1H0HA 4JJ8A 3UT6A 4B8YA 1ILWA 4Q4JB 2B3DA 4WCFC 2MINB 1QR6A 3V8QA 5T4HA 2A8YA 3SQWA 3FGOA 3Q0EA 1R6DA 2A0XA 3TVDA 1O89A 4KWCA 3H9BA 1EQUA 2G5TA 3A14A 3PDWA 4REQA 5E6UB 1IBCA 1BQ4A 1RXCA 2QB5A 3DCNA 4L8WB 3ZKWB 1OIVA 5BMVF 1KEWA 2NMVA 3BGWA 4MS1B 1L6IA 3RHTA 4EUFA 1XN4A 3IR7A 4FGJA 4PSCA 3WLEA 2CHEA 1PZMA 5AW7A 5L7YA 2O52A 1KP9A 1TYCA 2CFTA 5BSEA 2QYOA 3MGCA 1TKAA 3HE3A 1G21E 4Q7QA 2P9HA 3K8ZA 1AS0A 2A94A 4GNRA 4RGQA 2A92A 3V7FA 1HTWA 1KEVA 1MX1A 3BCUA 3QKTA 4LUCA 1XLVA 1COZA 3C3YA 2JCYA 1ZC4A 3KOXA 1CJBA 3ENWA 2WFZA 1JI3A 3NTRA 3Q7QA 4QQNA 4UDOA 1P6QA 4DDTA 4BVEA 4MHSA 4DANA 4RPIA 1APBA 1EFKA 1U2GC 1M8KA 2ZIWB 3OX1A 3QRWA 2VA9A 3R5JA 4BFUA 1PR6A 1QKIA 2YWCA 3DZDA 5AXBA 5LC1A 2FWNA 2OV2A 2EP5A 2ERXA 5A3JA 1VE6A 1FDWA 2F9MA 3D0KA 4KXVA 3I6QA 1W0CA 3H9JA 4X7PA 4MPRA 5KYYB 2BEUB 2QLJA 1V4BA 2QU8A 2PNJA 3V4LA 3EFOB 3R75A 3AF6A 3ETEA 2HJ9A 3FSEA 3EIHA 1P1IA 1XQYA 1ZINA 3IIIA 4RPHA 3SLGA 1XB2A 4B09A 4N48A 1KE1A 1YU6A 4KODA 1TK9A 1Q7CA 1ZONA 2IUTA 1BVRA 2JLBA 2ZB3A 3OEED 3P9ZA 4LJ8A 3RKSA 5IT5A 3EPJA 1O58A 3WKEA 3QPAA 1DXOA 2J45A 2QTNA 2AN9A 2YQ4A 4PY2A 3N9IA 1TGYA 1UM9B 3IIKA 5GZ6A 4CIAA 4MCAA 3M5DA 5HDQA 5AKXA 3OEEA 2D7JA 3TDMA 3SZOA 2B8JA 5FQNA 6REQA 1DZ3A 4KMSA 5K5EA 3B5EA 1X38A 1HM5A 2VZ8A 3U3RA 4CU2A 5KNCH 2HT1A 2DFPA 3MAGA 1BN6A 1U8FO 3CLRD 4UEOA 3LUBA 3EXAA 4JLKA 3KJFA 1GTL1 2GFQA 4MWBA 2UZIR 2CZGA 1II8A 3EMDA 2IPMA 3DM5A 4L2IB 3ZI4A 4BL5A 3L8ZA 1UR5A 1XRMA 4MVJG 4ZMRA 1G2QA 2RD2A 1KI1A 2UZ0A 5CLIA 2QTTA 2QGZA 3IX7A 4R68A 4M8SA 4DMHA 2NQTA 1F2TB 1U2EA 3H11A 1HG1A 3E9CA 4DG8A 4DGSA 1I14A 1SIWA 4D80A 4GOMD 3WLAA 3K6SB 2WJJA 1WXIA 1HL7A 2HL6A 1I4WA 4CDRA 1JXAA 1TVKB 1QIFA 3IAS1 1K68A 3FN4A 4TL9A 3U3MA 1FSPA 4GIBA 1EJ0A 2IH2A 2ZKLA 3I58A 4HOYA 3CUUA 4IINA 4ZO4A 5KPDA 3M1AA 5TSDA 1ISHA 2QTGA 4IQ4A 4EKNB 3QPUA 4HQKA 4Q15A 5KJEA 4TVKA 1GZ6A 5ALJA 1D2HA 1DGQA 2VSFA 5IM4A 5J2TF 5DZSA 1CUHA 1U31A 1YAJA 2QJTA 1R4NA 4TZKA 1ZD3A 1NVWQ 3TSZA 1S8OA 2H9YA 2HWWA 4BV3A 5LQMA 2Y1XA 1ECBA 4EECA 1QMGA 1HEIA 2Y6UA 3T3GA 2LGJA 1RXWA 4YDSA 1I3OA 1MOSA 1ZUD1 1E1LA 4EBBA 4F4CA 4AJ2A 3PX7A 4G0VA 1DOHA 1G2OA 1YL6A 1YONA 2IL1A 2VTKA 3EQZA 4O0LA 4HGYA 4M36A 2B8WA 3OTWA 4U2DA 3PTAA 2AZMA 2FWIA 4Q3LA 1POWA 1ADFA 7YASA 5ESDA 3M6MD 4R2LA 2M6SA 4ZCPA 4KLCA 5ARBA 3HRHA 3STUA 5LZ4A 3H2SA 2OZVA 1T43A 2PYDA 1JFSA 5MGBA 1HZZC 2QXTA 4Q3KA 1I3MA 5BSGA 4HNTA 1CY2A 3SYLA 5AO9A 3L5OA 3FOBA 1K9SA 1YWGO 3FZGA 3SM9A 3HDYA 3C8MA 4R83A 2VTBA 1DDOA 4CMIA 4JX8A 3CLVA 3A04A 4LZNA 1QRTA 4MUAA 4EW6A 2J9YB 3R7AA 1OXMA 1T5TA 3KRTA 3NVAA 5SY4A 4P58A 4QUAA 4Q34A 1KSJA 1PUIA 3TLMA 3ZWCA 3BWXA 1C4OA 1ZH8A 2C9CA 3KB2A 2CLFB 2H16A 3QLEA 5HJ7A 5IASA 4FGZA 5BWLA 2EU8A 4TXJA 5C1BA 3ELYA 2C9ZA 3B78A 4H15A 2CXOA 1PJRA 3LOQA 1U6KA 3VR1A 4IXNA 3E15A 5CDFA 1OJ7A 4TXMA 2PZEA 3DO5A 3RJMA 5ALKA 2QJWA 4W1QA 1LK0A 1NQVA 1IUNA 1CZRA 3C6QA 5BY2A 2FPGB 4R8KA 1EA5A 3M49A 5AI0A 2A57A 2FPMA 3PVZA 1NJFA 2ECFA 4Y1GA 5JSZB 1LQ2A 3K5WA 3LUCA 1S4QA 3OQ1A 5KOYA 1WDTA 2Y8EA 4PHHA 3TDNA 4BX2A 3A6EA 5G1NA 5KJ1A 5GP1A 2WJIA 3ET5A 1QIMA 1TM3E 5EP4A 3P5BA 3PPXA 3FYUA 1JAYA 3GL9A 3H5VA 1JFFA 5SY6A 1DQNA 1E6EA 2CHGA 4NG5A 5HZGA 1U5BA 1N3BA 5L3RA 1QQ5A 2C7RA 4EDHA 3BERA 2O3JA 4C43A 1A1VA 1DBVO 3F3YA 3QJYA 4NDNE 1P4JA 4ZQBA 3GQBB 3TNYA 2RH5A 1LBHA 1EGAA 4DUGD 4X20A 1DKNA 2JDIA 5DHUA 3K5IA 5T5QA 1RAIA 1ULHA 1A8HA 2Q4DA 3I64A 1M34A 2BJHA 1F60A 3HUEA 4JI0B 4BOYA 3STTA 3ER6A 3JWJA 5EE3A 4EI8A 5DHFA 5EJ2A 2VO1A 3JD3A 5BW5A 2ESRA 2QQFA 4DUGA 4KL8S 4XWOA 1UK9A 2JBWA 3THXB 2FQQA 1JMYA 2GF0A 2J5QA 4JSYA 1J8FA 2JCVA 3B8EA 4EABA 4FYJA 1OXKB 4KLNA 4GSYA 4TM8A 1I4TD 2PZJA 1XJ5A 4Q1AA 3ZE7A 2CLSA 4I99A 3HU2A 2PGOA 4AX8A 3VNAA 3FFXA 4CJXA 3JATB 3LX8A 3DDZX 4G0YA 2F67A 5LQJA 2QZ4A 3M33A 1SRQA 2VDPB 2R79A 2C3YA 5AKZA 1D4ZA 2FHSA 4NFSA 4ZYWA 5BNZA 5JLJA 1G4AE 4H0CA 2XCLA 1TYBE 4OHRA 1JN0A 4QA9A 2ATCA 3QZUA 2NU7B 4WLFA 1OX4A 2ONCA 1Q57A 5D86A 2JFGA 1VL0A 1XXLA 4YRBA 2AS0A 1WM1A 1U0LA 3INTA 3B1WA 4MYHA 2ZTVA 3OT5A 4K28A 1PNOA 2ATEA 2RH4A 2JHAA 2P69A 2ZRBA 3RS9A 3ZQKA 4YT2A 5DHRA 1CFZA 1WMEA 4F4JA 3M6VA 4W99A 5JZMA 1IBLB 4MYTA 1W49A 4UM8B 4X20B 4YFYA 3T52A 2ZQZA 4MGKR 3IDQA 2ZRIA 3O84A 1VLHA 4H7EA 2IPNA 4LJ9A 4DUPA 4QQRA 1Z2AA 2R6DA 3L7LA 5CH8A 5EG5A 3RK1A 2VJDA 1I6MA 4J03A 3L0OA 5TARA 4ARZB 1NMZA 3I2KA 4RWEA 3GWZA 4MWZA 3GRAA 2O3RA 3FTDA 3RYIB 4U3JA 3SBXA 3T7KA 1MKYA 4BIMA 5ALQA 3S6JA 4AN0A 4ER7A 1U04A 3Q0IA 5D3MA 4US2R 5I45A 3VAYA 2DXIA 1J8VA 3HVHA 3JWGA 2QIOA 4NJMB 3U7JA 5GONF 5JYEA 4P53A 1AK2A 3GN2A 1M2FA 4CF4A 2HDHA 2JBHA 1WLSA 2K7FA 1I3NA 1J90A 3PYXA 1FQJA 1OA1A 3AF5A 4ZVUA 3THOA 4NOLA 1AK9A 4YV0A 2V6JA 2O48X 2BSXA 1ONPA 1ZX1A 2O14A 2Z4SA 3ENZA 1E7RA 3V4ZA 1W0JA 2WM2A 1HRKA 1UZNA 1X7XA 1XBTA 1MO5A 4PGHA 1BCRB 1E9EA 4V3CA 3ZWAA 4R5HA 3DQQA 5TR9A 2VNAA 3SC6A 1N0HA 2G3YA 1UKYA 2A9PA 3NNNA 5C3UA 2L17A 5TT1A 2JGJA 4UTVA 2GN8A 2WU0A 2PUTA 5FYDA 3IHLA 1H2RS 1UM9A 2J59A 4AZWA 4BLTA 2FSSA 1VOTA 4MO2A 1KR2A 1YRQA 4R6WA 2CCJA 4GG1A 3RS4A 2HGZA 2I2AA 5DP2A 2XIQA 3CWQA 4HDOB 4JUFA 2NVWA 3P4XA 4O25A 4TYQA 3T95A 4WFJA 2QL7A 4HS9A 3FBWA 4IO1A 3GPCA 5IN5A 1IJFA 1RC8A 5M04A 5J2TB 4OQ4A 2XKJE 1O97D 4BVHA 1J22A 5IBPA 4YUZA 1DXYA 1GQSA 2VHYA 4JCCA 1KOGA 1JALA 3GG9A 1WUKS 2GILA 2JS7A 2K4MA 4EI2A 1DAGA 3OM8A 4AZTA 2E4AA 2DTEA 2HLHA 1J39A 4Q3OA 5CBKA 1OFUX 1WMSA 2Q29A 5CFRA 5I7AA 1PT5A 1YS2X 3AW8A 4CU5A 1DBRA 2RGUA 3GLHA 4D98A 5CB4A 3FKQA 5C7OO 2ZBFA 1NNSA 3ZGYA 2EQBA 4XWWA 1N92A 2EJWA 4EJSA 3ETGA 3FDIA 3IOEA 3PXBA 5C8ZA 4MIYA 5BUQA 4HDAA 4COOA 4D9BA 2JASA 5KBYA 2CVHA 1IUPA 2N1BA 3SM3A 2HSZA 2PBZA 3WGOA 3ZGVA 5LYJF 1PQPA 3OHMA 3BK7A 1WMDA 1XJWA 1A7KA 1OLSA 2Y0BA 3FA2A 3LVQE 4P81A 3K2QA 3SXUB 4A73A 4K8OA 1B76A 3LGAA 3MT7A 1L3CA 4AQ7A 4UOQA 3ZX5A 4ED9A 1IZ8A 2GLUA 1X77A 4YAKA 1Z3CA 3PUJA 1MH9A 1XVIA 3PQDA 4J0FA 2WM9B 4QEKA 1X1BA 3OETA 3QBEA 4DIFA 2P27A 1G20A 2IYAA 4PLFA 4CM6A 1I1NA 1GEEA 3LGSA 5FTJA 1RYMA 4OXRA 1MIOA 4PC2A 3ZD6A 3DR5A 1F2TA 3ROZA 1K3UB 1NFQA 1H1TA 2BUAA 2QENA 1WXFA 1QKJA 4XIIA 4BECA 1Z29A 3I8OA 4CLEA 3TOZA 4JXJA 3CF0A 2WWHA 4IJKA 5TJ9A 3DL4A 3ENKA 4XSGA 5DDIP 1C4KA 1HY3A 4FYWA 2CVZA 5K2MA 1TCVA 1ZMRA 3TG8A 3KQKA 5IK2A 4KP7A 5EEHA 3MMXA 2IS2A 1UXGA 3AKZA 2IU4A 4LRSB 4EJ2A 3HKEA 3L4JA 1J1ZA 3QVVA 4ZYUA 2XOXA 3CW2A 5EHIA 2FWBA 4FOPA 3ES9A 2FRDC 3IOBA 4RD0A 1JMKC 3KJGA 2ONJA 1EUCA 4CG0A 5A6SA 1MMFB 2AC4A 3P32A 2Y1CA 1SU6A 5JVDB 3CWZA 3W5UA 5IFKA 2FFBA 2OILA 1Q0SA 2WUEA 3RUPA 3HUFA 2FLWA 5EL0A 3WP0A 1VPLA 1Q0ZA 1EQAA 1I1HA 2OZKA 2P2GA 4H4DA 4KQEA 2GYVA 3E3OA 4A0RA 3PHGA 4JUBA 2CXXA 3FTPA 4FWTA 5GAJA 2JLWA 3LYAA 3VDRA 5C4IA 2C29D 1NXWA 2XRYA 3PFWO 4AY6A 4L27A 1XROA 4PBSA 3O6VA 4QHSA 3TD2A 3C3BA 3NETA 2XCSB 3SIXA 2B4TO 4QVGA 4B3CA 4PN7A 5AUPB 4FBMA 2W6MA 5FTMA 1X7GA 4JODA 3L6RA 3GLIE 3DBHA 4WFQA 4ZXPA 3DV2A 1ZY2A 4Z9XA 1BN7A 5F7OA 1W94A 3FFWA 1NVVQ 4M1MA 3KZXA 4GXRA 2FEXA 2XW6A 1P9LA 3K0CC 5FO1A 5CT6A 2VUHB 3WTCA 3FPEA 3IP6A 3MWGA 1YBAA 4NATA 1XWIA 2P6OA 1NJSA 3EVZA 1ZG3A 3MBIA 5U4XA 3DNMA 3F9IA 1Z6QA 3MTJA 4D4HA 4C7XA 1Y4AE 2DQ4A 1QYXA 2XDQA 2BDTA 4Q4AA 4QPZA 3NG1A 4EYQA 3K70D 5SZKB 2D5AA 2N3ZA 3G2IA 2Y77A 1T9BA 3NOXA 1OBFO 2QMHA 5FOTA 4QTXA 1MBZA 3GGCA 1GG9A 1TK3A 2R6GA 4BYGA 4FR5A 4X63A 3B13B 3KHTA 2ACEA 4F3KA 1V48A 5ER9A 2N9UA 5JSYA 3ICEA 3CW9A 1H1LA 4ENUA 2CKDA 1QOPB 3PPIA 3A70A 4FP9A 4NZ9A 2X2FA 4M53A 1Q1EA 3T5GA 2C4HA 1NY6A 3W7BA 1K06A 4RVCA 5HJ5A 4F3TA 4KIWA 2DAPA 4LFCB 4F6RB 1G63A 2DULA 4R31A 3RU2A 1WF6A 3UTCA 2JAOA 4JI1B 4F8JA 1XD2A 4KR7A 2DT5A 2IEBA 3KOOA 4MVJP 3RFUA 2XXJA 2JGEA 4JR0A 1SCKA 5DO9A 1GPLA 3AV0B 3RIHA 3BKWA 1BSVA 1LX6A 3G0HA 1TPZA 3CR7A 3LUHA 3ORFA 1WTAA 3ZE8A 1GYRA 2VH5R 4Q01A 4NBTA 4IVPA 2KLBA 1FNDA 3U4CA 1MO6A 1QVZA 3G9UA 4OH7A 5G4KA 2BFMA 4X6LA 3KDSE 3FW1A 4A3SA 1M2HA 2GERA 1RRGA 2YZMA 4I9GA 1R9NA 2G76A 2XEDA 4LX8A 4M0DA 1HL3A 4HTFA 5TV2A 3OE7D 4I66A 3RRNA 1RD4A 3BKXA 1FFDA 4I4TF 2WJAA 2BP7B 4JI3B 5TS3A 4PRLA 5IH3A 1KJ8A 1KKLA 4C01A 5J58A 1QYCA 4FGLA 1BKSB 1W7AA 2F8TA 4EDFA 4G4SP 2P2LA 3F97A 1JDJA 1CEQA 1KYVA 4IIYA 4R05A 5IKPA 3P52A 4Y8VA 1Q0RA 1VL1A 4C0XA 3OFVA 3L79A 4ZO9A 4PANA 1GZ3A 4KLZA 1GFIA 2SKCA 2OM2A 4DLKA 1X1EA 1B74A 1OIXA 2DZDA 2JFVA 3BTSA 2WOOA 4MJLA 4X1YB 1QHEA 2NW6A 3GLGB 3UMBA 1JAIA 4HI0E 1VSQA 4TV9A 3UGTA 4D0GA 2X7XA 4DLNA 3GP3A 4WOPA 3DKIA 2PVSA 5DK4A 1YXMA 3D6HA 2X9QA 4KV9A 4B45A 3MTGA 4HGPA 4JJEA 1X1AA 3DQPA 4X45A 1CR0A 4FOTA 2FEOA 1PLJA 3QJGA 4ILEA 5IH7A 2I2XB 3JX9A 3CY6A 1N7IA 1GU0A 3NBKA 4OBXA 4IUDS 2GKSA 3K94A 2HU7A 2GK4A 3QOYA 4R7TA 4JBNA 1YD7A 5JS6A 3OESA 4R9SA 3BICA 2IGTA 4N49A 5LOVA 1LSOA 1T5DX 5HR5A 2CXPA 1F12A 4WESA 4V1CA 3IUQA 3HN6A 3LHIA 4C87A 3BN3A 2Q8PA 1FYVA 2P9FA 3QELA 4HEQA 3NM5A 1AHHA 3FF1A 3QF4A 4QPNA 1QV6A 4MS3B 2YRXA 5AM4A 1VLMA 4UQPA 1X39A 2A9VA 3CZAA 4L5YA 4UFOA 3THXA 4ER5A 3L7YA 3FVTA 3UAWA 2RK4A 5AVTA 1W1UA 2CLHB 5YASA 2QVBA 1E0KA 3GLKA 3KR9A 1V1MB 2IRWA 2VF4X 4GQBA 4NXMB 3OHPA 3OZXA 4CTNA 3O7WA 3TL3A 4I1VA 3ICCA 3ZHQA 2LUOA 4YH1A 3NNDA 2XZOA 1N4DA 2C83A 2W2QA 2VJMB 1AE1A 1K08A 4EKIA 2OZLB 4XR9A 2GXSA 1QQBA 5AOAA 3FG9A 1WUTA 1PR9A 2ZR8A 3K30A 4I3GA 4PS1A 5K8TA 1OLOA 4Z86A 2GRAA 1AJEA 3A9SA 4OBBA 1BOFA 1PQUA 5CEFA 2QKYA 4EWLA 2UYHA 3WK9A 1I9CA 3T3OA 3EVGA 4KAJA 5FBWB 1WEKA 3H1GA 4YI3A 4I8DA 2DG2A 2X1VA 5TF4A 4DDHA 1TLTA 1YMUA 1J21A 4HFRA 1P7ZA 2IHNA 3QMVA 4RTKA 1YJ5A 1TVCA 3AU9A 1P77A 3IAFA 4ENSA 5B4UA 1M0SA 1SKMA 4EHIA 5JDIA 1GPNA 1M54A 2BFDA 3G59A 3PZRA 1GZUA 2I67A 3HS3A 4DXAA 5JBIA 1MT3A 5CW1A 1DLJA 2VSYA 3W2IA 4G0UA 4IXMA 2RBEA 3O8RA 3FCEA 2OBLA 2W8ZA 4BFVA 5BO5A 3MTDA 4JA2A 4PG6A 2XOKD 1JSLA 1U0NA 1UIMA 2AWNA 1CZNA 3LBFA 3O3NB 3IALA 4G1EB 1GPJA 1SZJG 2ZBPA 3KZCA 1EP3B 3C6YA 3OBBA 5EJEA 2UXDB 3AHFA 1EGHA 1U9ZA 4XD7D 5DWDA 1NC3A 1NYQA 2GKOA 1WMFA 2GSWA 2XHEA 4E88A 5F2OA 5KTNA 1HFKA 3HU3A 4RXTA 4F46A 2HBZA 4DNXA 3I2YX 3M3DA 1JHAA 1NZFA 1K0FA 1FX0B 1U8AA 4JWKA 2ZAOA 4I3FA 5KS2A 3UK2A 1K8QA 3G2KA 4LFBB 3RM3A 2ZWAA 2QYTA 1WBJB 5BQ5A 1R5JA 2VPXA 2P91A 1ABFA 1RT9A 1KFCB 2BR3A 3A4VA 4CMGA 3QBVA 1ORWA 1ODTC 1Q2XA 4J7UA 4P35A 1ELOA 4OIMA 1P8AA 1RWXA 4TV9F 4CM4A 4TRRA 1NVEA 1L3BA 4HHEA 3OCJA 4AMVA 2F4NA 1WULS 3JQ7A 4N5MA 4OQEA 4IDHA 2V7PA 2O2DA 3M6LA 1Z63A 2VQSA 4TSRA 1TRHA 3HR4A 3PNSA 3ND8A 4B6RA 4OYHA 3FPHA 2WK1A 1L5NA 1JLLB 1EVIA 3RSGA 1E6MA 2HA6A 3COVA 2OQRA 1J07A 2HBYA 1REQB 4XQCA 5LIPA 1M2EA 3MJFA 1CZOA 4O8ZA 2VTDA 4D0SA 1UFQA 2G4VA 5H9WA 1IY0A 3HXTA 2Q3HA 4Y1FA 2EF1A 1ADGA 4UNSA 3FSRA 3IOYA 1Z0DA 5GGXA 6AT1A 3LPDA 3WQHA 4EKEA 4Z1MD 3F67A 4BQNA 5LJLA 1U2RA 3OZWA 3LL7A 5K51A 3H2GA 4AZ0A 3O4IA 4R1PA 5HZMA 2V54A 2HC9A 3A1NA 4P33A 4KXYA 2QV7A 5GIPE 2PH7A 3TNJA 1AC5A 2ZM5A 4YJHB 3GAMA 1MQ9A 2P3QA 1KO7A 2FK7A 1MRZA 4MMXB 3MK31 3UK0A 2PWAA 2HBQA 2NV6A 3K9HA 4PXSA 2JI8A 2YXBA 4LTMA 3DZGA 1T8UA 1HYEA 3E2PA 1Z8HA 2XMCA 4MO9A 5DN6A 1OD6A 4LC0A 3VI4B 5K9ZA 5IWAB 5FA5A 2WYOA 4FT4A 1OLUA 2P79A 3PHIA 1SKUA 4L7VA 2H1OA 4ZI3A 4OHCA 2FFRA 1M2OB 3IUJA 2JFNA 1SB9A 1DRJA 2J9FA 3CEJA 3HR7A 3MLEA 4MAAA 3RIMA 5IDQA 4A0GA 4Q9IA 4JR2A 1BNCA 4EJSC 5JZBA 3GT4A 3MOGA 5EMLA 4BCBA 4N0QA 1SXIA 5B7QA 4S05A 1W29A 3Q2IA 1IULA 4FFNA 2NADA 4R2HA 3KCNA 5JHHB 3F8TA 3LLMA 4LWQA 4NYIR 5JS2A 2R5FA 4OX9B 3DCYA 4Y9DA 2UYGA 3LYLA 1UBMS 4UREA 5J1TB 1UWVA 2B25A 3DBVO 1SK8A 1JU4A 1XIVA 3A9TA 4DCJA 5JAHA 2YIJA 1TTHA 1I7PA 1S2GA 4PG7A 3WDMA 1L3IA 4HQLA 5LU8A 1M2KA 3DLCA 5AIAA 1ZC3A 3A3NA 4I6JA 3UAXA 3LWNA 3I52A 2QM0A 1ZK3A 1EBFA 3KP1A 3JQFA 2GT1A 3L6BA 3N1UA 3S27A 1LF0A 3R76A 3DEZA 1Y7HA 4Y2SA 1P1CA 4HWSA 3I1JA 4ZFNA 1T5IA 2E82A 3UXMA 1PGJA 3PJDA 3OPYI 4LXHA 5L4LA 3S8YA 4IIBA 1EWYA 1XP5A 3NATA 1J9GA 2FV8A 2QDKA 3NR2A 2O19A 5I47A 3VI3B 1Z28A 2BFCA 1UAAA 4EY7A 2FSIA 1E3LA 1Z7GA 2C2WA 4FQ8A 1V1RA 4QPJC 2OLJA 3PZBA 1KMNA 1SU7A 5M3BA 5KQLA 2XBMA 4Y6SA 2EJUA 4U8HA 3T9AA 5ECWA 1HBJA 3LK6A 3PC8A 5BSUA 4C03A 1GLNA 1LY1A 1KVTA 1EWQA 2NO4A 3DPSA 2B7BA 3Q3JB 1Y8RB 2CVFA 2G9QA 5KNCA 1WY7A 5E8RA 5LMUB 3EUFA 4PYIA 5F9FA 3F2VA 2PANA 3I62A 1US8A 3A6PC 2PEYA 1FYWA 4J0JA 1CUUA 3G3EA 2WIBA 3KU4A 5DIFA 1TT5A 5AVXA 1WU7A 2ECOA 3LBNA 4H3VA 3GZNB 1SCDA 3QFFA 4XUEA 2JLYA 4F2GA 3FMGA 4A82A 1R8QA 1R5OA 1LC0A 5SYMA 4DDMA 5KC9A 1JKJB 4MW6A 4GO1A 4Q4HA 4CG2A 1T34A 7ABPA 1XKLA 1E0AA 3F1KA 3NJRA 2JAQA 4Y18A 3KKKA 1QHIA 4KSYA 2H1WA 4WLNA 2A9JA 4XYEA 5FLEX 1PFWA 1BHJA 3QKSB 4UXIA 1EDEA 1SOMA 1TEVA 3KZNA 2H2HA 2DBYA 2NNWB 2NUTB 1FQKA 1XGKA 1HDRA 2P77A 3OWOA 4ZOAA 3W34A 2X19A 4ZCMA 2AHOA 4F9GA 4ENRA 2QORA 2QNRA 4K6GA 5IC6A 1CJUC 1DKQA 2AJDA 3TFOA 4RV4A 1J56A 1XNRB 3QOXA 3MQ2A 3K05A 1C0LA 3TTTA 3UWDA 3UB2A 2NU6B 1N6HA 2P9JA 3LSTA 4NCKA 2BMAA 5FADA 3U16A 2F3PA 1VRCA 2GCPA 3ASYA 2ECKA 1N2IA 4QEDA 4Y2HA 5IANA 5F33A 2UAGA 4ZKDA 2VF8A 1GKIA 3IV7A 4UZEA 1GL3A 5ALVA 2J46A 4QUEA 3RSSA 1D0SA 1KQPA 2DBVO 2VRCD 4YP7A 3AR5A 1CUAA 1W4AA 5CDYA 5LLDA 1N3LA 3K09A 3UT5A 1LK7A 2D0PB 3JQAD 2XUOA 2OCKA 2QRGA 1TU4A 4P9NA 2IBSA 5JS7A 1FTNA 2C98A 1E92A 2X0JA 2XUZA 1SUPA 4K9QA 1LLUA 3RUDA 3PXDA 4OYLA 5HUQA 3GMIA 3BULA 3H6HA 3UV3A 2E37A 2C3PA 3EQ9A 1FVHA 3GUZA 5G1PA 1C3EA 2E4WA 2Y99A 3L0DA 3R9WA 4PM4A 4JQCA 2ZYTX 4I1IA 3HV0A 1QLHA 1Z5GA 4OMUA 3RBZA 2YHUA 3VVBA 1SVLA 2XQIA 1EXDA 4OI0A 2FMXA 5L3QB 3JYOA 4K9DA 3F3SA 3ZDDA 2CY0A 4BLUA 4AJ4A 2YXPX 2B94A 1R4ZA 1JIJA 1D0IA 1Q44A 4HVLA 1G55A 4EATA 5AKKA 2NLOA 3LT2A 4J29A 4A23A 2SECE 4JI4B 2YW2A 3MJCA 4H59A 3SQLA 4R7ZA 2PX5A 4B33A 3EZNA 2LCQA 4POAA 2I3AA 3GEEA 3WDKA 4DZRA 4C7OB 4ALKA 4BGDA 2CCKA 1HT0A 4CEIA 3TCNA 3Q9UA 4JLJA 3W5JA 1THMA 2B37A 2WI8A 2IYTA 4RULA 3VO2A 1OI3A 3UV7A 2JAUA 2WKWA 4PZCA 3KTAB 5J2TA 4G09A 2EZ8A 5JROA 1V6SA 2RJOA 4L8FA 4OHOA 1GXSA 4ZDKA 2HMTA 4YO8A 4ACAA 1DG1G 2DUUA 2G17A 1QFSA 2ASVA 3MJ4A 4KI0A 3AYZB 4A4DA 2ZSUA 1M6EX 1UQRA 2WU3A 1X1SA 4YGXB 1G3IA 3T94A 1IRIA 1B15A 3WGMA 1PCXA 4GOXA 4IYJA 1HTTA 4LDRA 2OFWA 2ZJ0A 2DUMA 4E33A 5JV5A 1LDGA 3OJXA 3PXGA 1CZKA 4XGKA 1A2BA 3I6BA 4YLEA 3NC0C 4EVSA 3G2MA 2EARA 4OSPA 5HK9A 3Q0TA 1QCZA 4FJ0A 1N7JA 3D3JA 3OP1A 3ON5A 3OJCA 4C7MA 3JD2A 2A0YA 5K6RA 4I14A 2QZPA 2WIGA 4GS5A 4Y1EA 2JGLA 1JTEA 1G7SA 1P61B 5F5NA 2WHEA 3QI7A 4FC6A 4KR6A 1NQXA 1U99A 1VPVA 4G67A 2AFHA 4YHBA 1SOAA 1L5YA 3FJYA 3NBFA 3DONA 3RC3A 1E89A 1RVV1 4P92A 5DCWA 1PTJC 3EJ6A 1X9GA 2CJWB 2RJ3A 1KJWA 3P2YA 3D3WB 3L2OB 1OAKA 2HJHA 2PV0A 2XTNA 2HA4A 4GMXA 4MOWA 1U0JA 4XWGA 1HYGA 4F1WA 2G80A 1N6KA 4WCVA 1AUQA 1RADA 1Y8RA 3AOGA 4JQOA 4DYVA 1IEQA 2XCUA 2D2EA 3UPTA 1QYVA 2YBDA 1NPYA 2GDJA 3BE5A 2QT1A 3DSRA 4I7EA 1QF9A 4ZODA 4C05A 2FW8A 1L4HA 2A7XA 3UFBA 3P19A 4QUJA 3ONEA 3AEZA 3EYWA 2OB2A 2R4UA 3DNFA 3WHKA 4B4UA 4BEWA 4ESEA 4F92B 5FJJA 3QG5A 4L1KA 1ZGGA 4L95C 5EPUA 3W5HA 5JWHA 4ND3A 3V2GA 3KVNA 3VNUA 1W2HA 5IDWA 4HYYA 1F4LA 4E5MA 3N2NA 4YROA 3EXG2 1D2MA 1ZFNA 1ODIA 4YJ3F 1IJBA 1E4YA 3SE7A 1IK6A 3ROPA 1KYYA 3JVEA 2ZWOA 3VO8A 2H4HA 5D7BA 3GPIA 1XSEA 4M88A 4NBUA 4PIVA 5FTNA 1W36B 4IIXA 3EWIA 5KDLA 1P0IA 1YAHA 4QE3A 4I2NA 2VDWA 4ZI5A 1HRDA 4OHWA 1NDUA 5BW8A 2CL0X 4XVUA 2XA1A 4LZPA 4NE2A 3DA8A 5IYZF 3RYHB 2G77B 4BB0A 3D8SA