3UK7A

Crystal structure of arabidopsis thaliana dj-1d
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
386
structure length
384
Chain Sequence
NSRTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCGHQTYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKPIASIHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATYEGHPEFIQLFVKALGGKITGANKRILFLCGDYMEDYEVKVPFQSLQALGCQVDAVCPEKKAGDRCPTAIHDFEGDQTYSEKPGHTFALTTNFDDLVSSSYDALVIPGGRAPEYLALNEHVLNIVKEFMNSEKPVASIHGQQILAAAGVLKGRKCTAYPAVKLNVVLGGGTWLEPDPIDRCFTDGNLVTGAAWPGHPEFVSQLMALLGIQVSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Class I glutamine amidotransferase-like domain-containing pr
publication title Crystal Structure of Arabidopsis DJ-1D
rcsb
source organism Arabidopsis thaliana
total genus 129
structure length 384
sequence length 386
chains with identical sequence B, C
ec nomenclature ec 4.4.1.5: Lactoylglutathione lyase.
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uk7A02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uk7A01
4ENUA 4S0ZA 1SOAA 4WINA 1P81A 5E9AA 5SY4A 3TTSA 3PQ4A 4QYTA 1IZZA 2AB0A 2NV0A 3PQ3A 4E5VA 3NORA 4HCJA 1C30B 3R75A 1VCOA 3NOOA 5IP5A 4RKYA 4BTEA 5SY6A 4Y1EA 1T3TA 4ENPA 2YWBA 4AUNA 3L7NA 1C3OB 3D54D 1GGJA 2XF2A 3NOVA 4L7QA 4ENRA 4JQSA 3TTWA 4RKWA 5JZMA 4L8WB 2NV2B 1VHQA 1S1MA 4I46A 2V4UA 1GGFA 4R7GA 1GG9A 4Y1RA 4P34A 5K4AA 1JDBC 4PXYA 1P7ZA 2R1VB 1P80A 1Q2UA 1GGEA 4ENQA 3P9RA 3N7TA 4ZDKA 4P35A 3SF8A 4ZDJA 4N12A 4OGGA 3ZJ4A 1U9CA 3OT1B 1OY1A 4UNIA 2ZUTA 4WXYB 2VXOA 3CZ9A 3PQ2A 4L8YA 4QYXA 2YWJA 4N0MA 2RK4A 1G2IA 3TTXA 3RHTA 4B31A 2R1TB 4ADSG 4ENVA 2ISSD 4MNTA 5LIRA 4GE0A 4GUDA 1GPMA 3OT1A 3TTTA 4B5KA 3P9SA 1OX6A 3CNEA 2ZUUA 1M6VB 3CZAA 1IPHA 2D7JA 2ZUVA 1I7SB 4P2GA 2WJZB 1BXRB 4L8FA 3PQ8A 4I4NA 4P5PA 1N57A 1P5FA 3SOZA 3BWEA 1PDWA 3TQIA 3P9QA 4ENSA 3F71A 1KWGA 2VKTA 1I1QB 2RK6A 3EJ6A 4L95C 4XLLA 5JZOA 1KWKA 3PQ7A 3FSEA 3NONA 4BIMA 4I2NA 3ER6A 1O1YA 4P36A 3PQ5A 4AUMA 1GGKA 2R1VA 3ZJ5A 1CE8B 2GK3A 2GHRA 4AJ9A 4UCFA 2RK3A 4BFLA 1UCFA 4Y1FA 2FEXA 1CF9A 2A9VA 3B36A 3MIIA 1Q7RA 3P9PA 1FY2A 1ONSA 4ENWA 3UJNA 4L78A 3UOWA 5SY9A 4OFWA 3CY6A 3WFZA 2W7TA 1PV2A 2YWCA 1PDVA 1T0BA 2ZUSA 3KKLA 1IZYA 1WL8A 1QDLB 2R1TA 4MTCA 4UOQA 4ENTA 1R9GA 3EWNA 3ZR4B 1GGHA 3B38A 3MGKA 4ZDIA 3L3BA 2VDJA 3PQ6A 3CYFA 2H2WA 3UGJA 1KXJA 3M3PA 2VRNA 3L4EA 4GE3A 4OQ4A 2AD5A 3EFEA 1QVVA 1QF7A 1JVNA 3B3AA 3F5DA 3R76A 4MGHA 1T36B 1QVZA 4UOZA 1VCMA 4K2HA 2OR3A 4B40A 3TTVA 4B7AA 1GPWB 2LXNA 4OGFA 4LGYA 2IUFA 2ABWA 3FIJA 1I7QB 4Y1RB 1QWSA 1KA9H 3TTUA 1L9XA 3L18A 4ZGGA 1J42A 3NOQA 1OX5A 5DFAA 5BV2P 3SF8B 1OX4B 1A9XB 3BHNA 3GRAA 4OIFA 3R74A 3VU3A 3UK7A 3UMMA 4AULA 2R1UA 2VPIA 2ZUWA 4UZSA 4OJYA 1OI4A 1KEEB 4D1YA 3EN0A 1OX4A 1CS0B 1VCNA 3EZGA 4Y1GA 1SY7A 2YWDA 5SYAA 1P7YA 1K9VF 1QVWA 3TTYA 4B2YA 4AUEA 4LRUA 4E08A 1FYEA 3NVAA 1PE0A 4Y0NA
chains in the Genus database with same CATH superfamily
2AC7A 1N2JA 2DHDA 2ORWA 1P62B 1KSFX 5FUMA 2O8FB 5I5EA 1W36C 4EF5A 1I2BA 4HQRA 4RD6A 1CR2A 1QTRA 4RKYA 3CLKA 4Y9SA 521PA 4QOHA 2IW1A 1AC5A 2BFWA 3HA7A 4BDSA 1ZEJA 5B6PA 2ORVA 3DOOA 3I6QA 3RTAA 1NPDA 4IDHA 2BY4A 4ZA2A 3I30X 1UKZA 3RSOA 1QX4A 4LX8A 1Z62A 1KOFA 2CHQA 2XUDA 3IHTA 5DYTA 1P2FA 2BHNA 2SECE 2JHGA 2NSYA 3BTUA 4BKMA 1Z12A 4CHTA 5DNYB 2YZKA 4DC1A 5H8WA 5EIBC 2DQZA 4DG9A 4LJYA 2X0DA 2P9GA 4AFNA 3PE4A 4OG2A 1BHO1 2W6MA 3JYLA 5D7NA 1KMQA 3O7WA 5DW3A 3MD9A 1RLIA 1XRJA 4TLLB 3RRYA 2P5TB 2Z5LA 4DDHA 1O89A 5K3FB 4HVLA 1ORTA 2HA4A 4HO1X 5YASA 5KI6A 1C8VB 1M2OA 1EZ4A 1MT3A 1CSEE 2OKCA 2BKLA 4MQBA 4WCVA 4UPEA 1J2EA 1OTHA 4KUGA 4CMIB 4LDQA 3LHIA 1V45E 2PGOA 3LKVA 3BDIA 3H04A 1Z08A 2JEZA 1KGDA 3M89A 3PP8A 4BNNA 2FPRA 3NVMB 3ZG6A 3GK3A 4XTRA 2WTMA 3MGCA 4G0NA 5GOZA 4WJLA 1S7CA 4XCXA 5JSYA 3LKDA 5BYBA 5CH8A 3LHDA 3PQ5A 3KB8A 3ZQJA 1MJFA 3Q3HA 3KZ1E 1MG0A 5I6DA 2JI8A 1M6HA 4HPJB 4KE7A 2JJ2A 1E18A 4PW0A 3SC2A 4HK4A 4WUVA 4AY6A 2W93A 2OBBA 4LJ6A 5FXMA 2GM5A 4N40A 2BGNA 2HYIC 1YVRA 1OI3A 1KRWA 3N6RA 4HFJA 2PXCA 1MORA 1GZ4A 2DTXA 2XCIA 2FLWA 2XE8A 2PN1A 2YMPA 2H2GA 4U6NA 2Q2OA 3RYFA 3VTAA 1TADA 4ZOLA 2AG5A 4WKPA 5JS8A 1T9GS 2PJZA 3OQPA 3QXXA 2X86A 4QTTB 1OFVA 1SBTA 5TQVA 3AUXA 4CL3A 5JPDA 2O5EA 1BWQA 3D6MA 3DFFA 3AIKA 1L4FA 3DEFA 4HDCA 4Q03A 5JCJD 1QVVA 5JO0A 4C0BA 4PY2A 4WLUA 2QDKA 3ETNA 5DM60 3MFYA 4FJ2A 1YJCA 2OXFA 4UDYX 4D2IA 4FJ1A 2W2VA 3ZWBA 3EEFA 3OICA 1CWUA 3OIGA 3K0CA 4QU8A 3ROMA 1NE2A 3H8WA 1QZTA 1PL8A 4XFJA 1SBYA 4IVRA 1HV8A 4M7WA 3LQKA 4CGZA 2Y93A 4MARA 5E8RA 3QF7A 4RH1A 4WD3A 2JFXA 3SEQA 3VKHA 3DDOA 2R2GA 3HC7A 1E2KA 4H7FA 4A4DA 4OJYA 3PNQA 5E9JA 3EVGA 1FDIA 2GCIA 3D6TB 5ILGA 5I8WA 1W46A 4HTFB 2G6TA 1FB5A 1GTL1 5FTNA 5L51A 4TV9B 3GHYA 3VC2A 5LC1A 3QTLA 3I64A 2C3PA 4WOBA 4KXVA 6YASA 3BQNB 4JLUA 2BF4A 5IANA 3MJCA 3W78A 3KQLA 3CUSA 4KB5A 1HNWB 1V39A 5CVEA 4O3MA 1XL0A 1QF9A 4DSAA 4TRRA 1IZ9A 3B9RA 3A11A 1L3IA 3RREA 1TC1A 1RXUA 3U44B 3E5RA 2V54A 4L3VA 2MYUA 1SUBA 2P6RA 3TO5A 3DAFA 4JAVC 1VL1A 2FZLA 3UAVA 1P6XA 4X6YA 2XT6A 2BBTA 4PZ9A 5BSFA 1HH4A 2HJWA 3PEUA 3ZI7A 3THYA 1ESEA 2PGAA 3RYCA 3IBYA 1RRGA 1Y4ZA 2NTJA 2YZ2A 2Z2IA 3R44A 4ED9A 1B43A 1ST2A 2WAMA 3IP8A 3K73O 2Q8QA 3VYSB 4WK2B 5FWAA 1I3NA 4N7MA 1NDUA 5B4TA 5JZ9A 3CZ5A 1ZR2A 1OB5A 3QG5A 4B48A 1NQUA 2UXDB 3QHQA 4P98A 3CW2A 5F35A 4LJLA 5J1SB 1Z5UA 4BNVA 1WMAA 4PEVA 1WMEA 3BL8A 3N9IA 2JI6A 4JNKA 1M1YA 4R83A 2GZRA 4EYKA 3BGIA 1OYVA 5FORA 2HQ1A 2C61A 4ALLA 3CWQA 3EG9A 1E2GA 2C2OA 3AK4A 4PYNA 1LSOA 3PNLA 4M1KA 3RJ5A 4CN8A 1GCUA 1UANA 2YW9A 1BXRB 3A6EA 1DX9A 3G8YA 4L8FA 1CJBA 4EFLA 2XADA 3HFGA 3D0OA 3QGMA 4O5AA 4KQ6A 3A27A 2E4YA 4L9RA 5E3JA 1JIKA 3D5EA 1UL1X 3PRHA 3GDHA 2FCRA 1U7UA 1P19A 2PKYX 5TEVA 2O5CA 2YMMA 2EL9A 3HBNA 1IAVA 3HR4A 5B58C 3C3MA 3JZFA 4P36A 5AVZA 1BVRA 5E1OA 2GHIA 3IIKA 4C5CA 1CKEA 1HDGO 4GBMA 3E1KA 3FMFA 1R0LA 3ZXUB 3A0UA 5AM3A 5BMVA 1ZGJA 1PEYA 4MGEA 2AWNA 2PRZA 1LX6A 2B7CA 2RGAA 4K3UA 2FN8A 2XOXA 3DBLB 1KU0A 2WYUA 3H2BA 4MCAA 3AVVA 2PS9A 2BMAA 2LCQA 4O4HB 4LJRA 1RIIA 1TJ3A 5J4YA 4UHKA 3PUHA 3K8YA 4MTLA 2KHZA 5B1HA 3ZWYA 3PUWA 2Q7DA 3WMRA 1EGAA 1AQIA 1TVEA 2ZIVB 5E6UB 1E0DA 4MVJE 1XCGB 4D97A 4LQLA 1TA4A 2FUG6 4LJ5A 5E7IA 2QTFA 1S3IA 1KEVA 1QAMA 3GUHA 3LBIA 5G0SA 1KORA 1VRCA 2H7YA 1T5DX 3QKSB 2DETA 2HHAA 2XB6A 4KXMA 4DRXB 4IFEA 1U2ZA 4G36A 3L18A 2OA0A 1JN0A 1V7PC 3MT0A 4DR4B 2RARA 1AS2A 1YMQA 4V0SA 2IVZA 2GJKA 1QCDA 4G85A 3NIWA 2UVDA 4D8TA 2W11A 3M33A 4D56A 2X8JA 2VT7A 3FTEA 1JA0A 1OH5A 2ZSUA 4YQFA 4AJIA 1Q0SA 3OQBA 1SA0A 3DV9A 1JMKC 5J40A 3FSGA 3L6CA 4RLFA 5B58T 3P52A 3ZLUA 1P7YA 2YQ5A 1Z0IA 5EPOA 4BO7A 4E4TA 2FQXA 4TSRA 2QLBA 2JAOA 3RBXA 4GOOD 1GTJ1 5FUBA 1CS4C 5MN4A 4EATA 4U2KA 1X8LA 3VTKA 4JB2A 2FJ0A 1C14A 4ZN6A 2EWMA 3OJXA 3IUSA 1ZH4A 1ZVQA 3IQIX 4MKXA 5LUBA 4F1WA 1CBUA 1R7RA 5JWHA 1FCJA 4MLZA 1FS6A 2Q9UA 4QJBA 2ZB3A 1MG5A 3FNQA 3IESA 4Y6SA 5E1MA 4A6EA 1R5OA 1GKYA 4DY4A 2EDAA 3ZHYA 4DCPA 4CG1A 3I62A 4RVNA 4WNCA 2QLFA 3ACBA 5LN1A 1V41E 2CYCA 4DDTA 3DLHA 5AVYA 1QZ3A 4H08A 4TXHA 1CG6A 3WXBA 1V8FA 1RWWA 2B4TO 2REQB 1EI9A 5JSFA 1D6MA 3K32A 1ISPA 3EWIA 4R8KA 2R9VA 4X60A 2H07A 2Q62A 3LXRA 4CV2A 3ITDA 2ZUBA 3B51X 3SYTA 1ORIA 4TLDA 4PHFA 1NR5A 1HSZA 1QLJA 1ACMA 1ODIA 3EXHB 3CCCA 4QBHA 3I58A 1GQOA 1GPMA 1WMFA 3DBHA 1R4AA 4GXRA 3QTTA 5HEKA 2GKOA 3TIIA 3AF3A 3BF7A 2N46A 2GN0A 3OF2A 2IP1A 2ZSIA 1WD7A 5BR8B 3HDHA 2Z04A 5I7OA 1W1IA 3MJEA 4GM1A 1PJRA 2GX6A 4BZQA 1DINA 4AWBA 4II7A 3E5MA 2ZB4A 2NUPB 4Z2YA 3P9QA 2UYGA 1F9EA 4ZJUA 1J1UA 2VNSA 4I2VA 1XNJA 4GO1A 2DEUA 2UZ3A 3CGWA 1PUJA 1KEWA 5DWDA 3B3FA 1SUFA 2I2WA 2OZEA 1GFSA 1QG2A 5KNBH 2HX1A 1WD5A 2A0YA 4CE6A 4IH9A 2HRCA 2NTNA 3TRHA 3T12A 3BCRA 2ONYA 3NWJA 3P2OA 4UM9D 2QPTA 3RLIA 3A1UA 3V8RA 4QXPA 4EO4A 5HCIA 2PG3A 2YV5A 5DM1A 1PJLA 2VS1A 4H7IA 4RVCA 1G20B 3PBKA 2PFSA 4OKNA 3B6IA 3WMFA 2HPVA 3OWHA 1TM7E 4KVZA 2H85A 5G1NA 4QTUB 2DUWA 1SC6A 1NG1A 1UUFA 2R97A 3ROQA 5DHFA 3HBMA 1W4RA 4F5EA 5KTOA 2WJVA 3LCCA 5F9HA 4JC5A 2RAFA 3DMHA 3TR0A 3BSSA 1SQGA 2BFNA 4KMMA 4X0EA 1SIWA 4BNUA 3EX7C 1V2HE 1D0IA 1MXHA 1LFAA 2Z6VA 3PF9A 1O96A 4HAOA 2ABWA 1VLZA 1URPA 1UKVY 1UZUA 1QX3A 2X23A 3OLVA 3GZTB 1PJ2A 3H9EO 1ZCZA 2Z8ZA 2VYND 5KSPA 3SQOA 1A9XB 1JTFA 3T5CA 3ABOB 3HU3A 3PWZA 3RIEA 3VO1A 2PRSA 2GUWA 3BJMA 3SJBA 3UHAA 2RGGA 3HA3A 5BVHA 5CG2A 2MSEB 3HHEA 3L1KA 5EA2A 3ZDRA 2OV8A 1L8LA 1DX6A 4I6JA 1AGNA 4YV2A 4IYRA 4KLAA 3RSZA 1YZTA 2QROA 1SJ9A 2GLXA 2QSZA 3ICPA 4QBIA 4YV1A 4MW2A 5C1PA 5E9AA 4ERXA 4G07A 2ZI5A 3H83A 3PDIB 3UUGA 1QYCA 3RJTA 4PANA 1XZKA 2M1XA 5C5EA 2WQZA 2ZVDA 1ISIA 5IK2D 1RRMA 1J8MF 2A92A 2DQYA 2H0QA 3DL4A 1YVEI 2VPYA 3S2EA 4DM7A 3ZCTA 4CFSA 5A5DA 5CM2Z 2XWQA 2XBLA 1DLJA 2QYOA 5BWBA 3BCUA 1O0SA 3VJKA 3UATA 3IL2A 3SYNA 4F04A 4I14A 3F9IA 1CZUA 5JJLA 3ST7A 1ZCBA 3IAM1 4CIAA 1PG0A 3WYFA 5DTMA 1CUZA 4E21A 2PU7A 2BTEA 2Q1SA 4O29A 4FQ8A 4R1TA 5IDQA 3M83A 3SSOA 4D5GA 4P7FA 4FB5A 5HQ3B 4JI0B 3O31A 1VFNA 5ADUS 3KQKA 2WWRA 2BBSA 3LAWA 4INAA 2P69A 4OGGA 4L0QA 3QMVA 1K7XB 2VPXA 3QJYA 1Z2CA 5KPJA 4FD3A 4ESHA 1KEKA 2IZ7A 4WLNA 4GHWA 3FPFA 4RF4A 4ENVA 2NZXA 2IPAB 1T6BY 4URHA 4PAQA 1YFKA 2CB0A 3CF0A 3E0XA 3C14C 3C97A 1W36B 3M5DA 4FGUA 2YFHA 4DE5A 4F2GA 1ODJA 1PJ3A 1SOVA 3RC2A 5IF9A 1XZPA 3ZE9A 1XNQB 4P5PA 1ONNA 1JKXA 1Z5ZA 2G0TA 3JV7A 3JQQA 3VR6H 5FPKA 1JAYA 1VJ1A 3T1HB 5HA5A 1TT7A 1IN6A 5GONF 2Y05A 3HVJA 3QEOA 3OQIA 2GBCA 4Z0TA 1E4EB 3TW0A 2IITA 4TXLA 2BRUC 1GCIA 3A1NA 4UTOA 4Y2UA 2CSXA 2QX8A 4IILA 1H22A 1S8AA 1ESZA 1RXEA 4EO7A 2DECA 3OMLA 5FNVA 4DADA 1EVLA 2CT8A 3PEFA 4IIXA 2GZMA 3K6SB 2VHUA 3F90A 1IQRA 3FCUB 4HH0A 1REQB 3SEAA 3SI7A 3BMXA 2IHTA 4TLCA 5HKLA 3CVOA 4PLZA 4I1VA 4G0PA 3GUCA 3LZDA 4UM5A 4D0SA 3PRJA 4LY3A 3JZAA 3BTOA 3AF5A 2O07A 1P5RA 1UBLS 4JJ4A 4PO3X 2W2LA 1ZUD1 5C1DA 3V34A 1OBFO 5L45A 1AUVA 3FUXA 2C4VA 3ZD8A 5T6BA 4R8VA 3R3VA 1P31A 1SNYA 2MR5A 1P0IA 5L95A 2ORIA 2EWVA 2PUJA 3I2KA 3O83A 1NF3A 4QULA 5E9WA 5E9QA 3UG7A 1CB7A 4B74A 3AW8A 4DTIA 3AVWA 3N2ZB 1N4DA 3FCSB 4M1QA 3CEAA 4B7AA 3KYJB 1HO3A 1Q1AA 4YCDA 5E2BA 5A4KA 1CUSA 2WU1A 3Q2KA 1Y7IA 3ROPA 1GLNA 3E23A 2FLVA 2QT9A 1SXJC 1XYYA 1GTVA 3MWJA 4WKGA 3T0IA 1QG0A 3O0DA 3QXCA 3TGWA 3B1ZA 3F4BA 5FTJA 4HGRA 4B8ZA 3O3OB 3RYTC 4G81A 2RGEA 4NONA 2NP6A 2A84A 5FV4A 5IDWA 2C2XA 1DOAA 3A10A 1H2XA 2YZGA 4HN9A 4YRQA 5A9RA 3WQHA 1A27A 3PDUA 3R7FA 1AKVA 4WGGA 9ATCA 2FSHA 1SRQA 1ZEMA 5JHHB 1P7VA 2C9BA 2JGDA 3W90A 4LHEA 3U19A 4MS3B 1P81A 3R20A 4HVAA 5CAEA 3BXXA 2WAYA 1M7GA 1QFMA 3BB4A 3TZBA 3ODGA 1BGVA 3G8AA 3TL3A 1T0PA 3IKLA 3IPXA 3WADA 3LPCA 2IV2X 1RM3A 2Q1YA 2Z09A 1C7IA 3D54D 1WUKS 5BUSA 2GPBA 2XNJA 4KUEA 1GZ6A 1VPWA 2C5SA 4HH3C 2ZWOA 1NJ8A 2OXEA 1VIMA 5KWSA 1XTRA 4LPKA 2P1ZA 4OL0A 3KVOA 3VPAA 5JMWA 1JI3A 5CK4A 2XDAA 4IF4A 4G4GA 3SAJA 1CTQA 3VYTB 1Q2UA 1ZLYA 5EPUA 4LQ4A 1R6VA 4PRZA 3SF8A 5IU6A 1SO8A 2ZULA 5ILQA 5M3BA 3WK8A 4PIPA 3QSGA 1B3BA 1IY1A 1NI4A 2BI7A 3DZFA 3RS3A 5TRTA 4ALNA 3LZCA 5ALRA 1E7QA 4ON9A 3K1YA 2V8OA 5JC1A 3AEKA 1CHDA 1KNQA 2NSJA 2PWAA 3JQAD 3CV3A 1B15A 3LPNA 2OHVA 3E5HA 4OJNA 1JDVA 3TYXA 3FHLA 3OLXA 3PC8A 4G2NA 3P1JA 4AKSA 2O2IA 2JJ2D 3OP4A 4XWKA 4QT4A 4XWWA 1N3YA 2PX6A 4ZO9A 2WAOA 3ZHXA 2YV2A 3FZNA 5FIUA 4RL4A 2JVKA 5HWSA 1ZDMA 1CRPA 2ZWMA 4YQEA 3OZUA 4FWBA 3ZXSA 4FX5A 1ULUA 1JAZA 3ZUGA 3VR4A 4WA7A 1LB1B 3MJDA 3WLIA 2YJNA 4ZCIA 1A95A 5CA0F 5LQKA 3R5JA 3PNVA 5C37A 3UMFA 2GYVA 1ZBDA 5K4GA 4FEEA 2V5UA 1XRPA 4BX3A 1C7QA 1N2CE 1XCJA 4M1OA 4OHOA 3WWOA 4LWZA 2VHZA 1UQRA 4F4DA 1RRCA 1ZNYA 3NHJA 2AKYA 4PO9A 2CHFA 3QQ5A 3TQHA 4KYTA 1F3OA 4GF5A 3WWPA 1E6WA 1LDMA 3SG0A 2MMGA 3O1JC 1DWUA 3ZCRA 4NCHA 5JCXA 3SLRA 2JEOA 3OZ7A 1R18A 1ONSA 4YDSA 3FM9A 4YJ3F 2B9VA 1QTIA 4HWRA 4OQFA 4Y2VA 3EVBA 1IJKA 4I50A 3PD1A 4JYPA 2CDAA 2KLBA 4G37A 2WQ6A 1SKMA 1N6PA 2RE8A 1QS0B 1V8ZA 3U31A 1EP2B 1ZUNA 5J5CA 3J7AC 4JUCA 4MMYB 4JJAA 3F7TA 3I83A 4OA5A 2DXIA 4P3XA 4OQ4A 4DMFA 1S2DA 3OOSA 2V5VA 1U2GA 1FYDA 3QBTA 1W4CA 5KQRA 3RBZA 3DS8A 2HY7A 3HYSA 4CLOB 3V33A 5JDIC 4C2AA 3G3EA 2IUUA 3CEJA 3OLCX 3AR3A 2P65A 1NMZA 2CLLB 2RAPA 3UJPA 1UK9A 3HJFA 4IO0A 4ZVLA 2GVZC 3KT6A 1DKPA 2P2GA 3PNBA 5AKZA 1V47A 5IUNC 1GG5A 2P6PA 1PG2A 2P4QA 3PWKA 4LHVA 3ZGLA 3W8EA 4G1VA 2H16A 3VU3A 4JEMA 5H83A 2NTEA 4LVUA 4HG2A 5I5GA 3JAWA 5IC5A 5HUHA 2E5LB 2QRJA 4YNBA 5F9FA 2NPFA 4BJ1A 1KEEB 3DZIA 3I8OA 1CZRA 2ZGVA 3CN7A 1EG2A 4PSCA 5ERXA 5ESXA 2PVPA 5EHZA 4YI3A 3VH1A 2ZJ7A 3UA3A 2EHJA 4FU0A 4GP9A 4ZVQA 5DYNA 2PMEA 1CXZA 3EH2A 4UUPA 1L4MA 2OFPA 1JS1X 1CF4A 2R6JA 4DAOA 4IH1A 3LC0A 5KQMA 5L3VA 4TV9A 4GGOA 5DSXA 3SZ3A 4Q1VA 3NUGA 4FYXA 3L1HA 1JIUA 4M88A 1WUIS 1SIOA 1T3TA 3CSSA 3PLRA 1WO8A 4XWAA 4GPTA 3MEQA 2YINC 3PHHA 4LNHA 1ZIOA 3LOPA 2ERCA 4U8HA 1W96A 2F62A 1VHQA 4FJ0A 4MDHA 2Q5HA 2R5FA 2CLHB 1L7NA 4QOEA 3KOMA 4CZ2A 2KSQA 1T4DA 3JRXA 1ENZA 3U44A 3IVMA 3DB2A 2VN8A 4JVMA 3HWWA 2NNWB 8AT1A 5K9ZA 3K0AA 2YY6A 2WPDD 1ZK1A 3PJDA 4WBXC 2Y77A 1QK5A 4MO2A 4LV5B 1OY1A 5EQJB 3RC7A 3KXDA 2QD4A 4MCHA 2ZE6A 3F6RA 3K35A 4DSTA 3AYZB 3CLUD 4MHSA 4DLVA 3QFCA 4JU8A 2PE5A 4WFJA 5KTRA 2YASA 4FE7A 4HGYA 1CT9A 2OZLB 2L18A 1L1QA 4I3FA 4R1PA 3FH0A 4DEXA 4PZEA 1RJWA 2RKOA 2VQDA 3BSWA 4NHEA 3HMKA 2I6QA 1SXIA 4XB6B 1NMXA 2HV8A 3O2NA 3JU3A 3P4XA 1K3FA 3GX1A 5JY1A 1TD9A 1WZUA 3R5SA 1DCTA 1P7CA 1LGYA 3WYCA 1DZIA 4GKAA 4C14A 1FNBA 1SBQA 4JN6B 1RWPA 2XAAA 4US1R 4V39A 3LBHA 4BVAA 4HEQA 5ELMA 4HDNB 3TSZA 4OF4A 1G64A 4QEKA 2I4LA 5D87A 2A0WA 5TX7A 4A5OA 2RK3A 5HJEA 4LDJA 1FDOA 3ICWA 3KCNA 1Z17A 3GCZA 4BTLA 4GMKA 1YULA 4Q39A 4MVJA 5KOHB 1ADCA 5CYPA 2OZPA 3ZHVA 4Q3EA 3W6PA 4CFZA 2OBNA 3Q9SA 4RF5A 2EHDA 3AFGA 1P8JA 3A4NA 4DHEA 4UOQA 1WIWA 5AM2A 4QQNA 3HWX1 4YAFA 1SUSA 3JATA 4AO8A 4MUAA 3AVXA 1DAOA 3HJNA 3OZRA 3C8HA 3H5NA 4NXNB 2ATXA 2J4DA 1PQPA 3E9QA 3UF0A 4EB8A 3IO3A 3L8HA 5AVKA 5HK8A 2VTBA 3V8PA 1AF4A 4DIUA 2JH9A 1XK7A 2OHJA 3BH7A 3EASA 3FWZA 1B8VA 1NVXQ 4XIFA 5E6UA 3SR4A 3UWOA 4BJHB 4EUKA 2HHLA 1V5WA 3GEHA 1T8WA 2FEKA 3NOQA 4W5JA 2DWUA 3G85A 3PYXA 3T61A 5EIXA 3QX3A 3KRTA 1YS9A 4ZPXA 4BLQA 1A8QA 1TCAA 4EF4A 5IPFA 3QKSA 4E5PA 2G06A 4LYGA 4L51A 1UJ2A 5DXAA 2CV1A 1MMFB 3FLMA 4GQAA 1CIPA 4AS1A 4PF1A 1WTAA 2ZI4A 5F98A 3ZNOA 1ONBA 3QXJA 1ETHA 1BMQA 4P7JA 1QHGA 4CM1A 3PEWA 1GFZA 3AEUA 5ECDA 3SSMA 1T2EA 2IEDA 4HGZA 4BCDA 5JAOA 1H85A 5I3ZA 4MUKA 4WEQA 5AJZA 3QUCA 3VKGA 3HDGA 3HY3A 1P7PA 5AUQA 4HCJA 4X6LA 4BAZA 4ZRNA 2ZROA 1Z8FA 3FVWA 5T4FA 1HR0B 4G0UA 5TMEA 4X41A 3K1AB 4N76A 4KWCA 3PFWO 1R3UA 2WT9A 2FPPB 3N5KA 1DC7A 2ACWA 2DVMA 3RVDA 4C2TA 1V48A 2XF2A 5EMLA 3LMKA 4R54A 3AKEA 3COYA 4EECA 4KVGA 4DJJA 4OOFA 1ZNXA 5K4HA 2QM7A 4NBVA 5CB4F 3SZUA 3WBKA 2QLTA 5J58A 1XL1A 1PR4A 1ZONA 2A2ZA 4FDTA 3T3NA 3FYSA 4I4CA 4YJ2F 2BKAA 2IEAA 3GT4A 4EWLA 4Y0AA 4DABA 2HQBA 4MUXA 2YWFA 4GG1A 1KYZA 4FOTA 3ZX4A 3KVNA 1JJBA 2YKGA 4JITA 5EXXA 4DBZA 1ZA2A 1X3LA 1XPUA 3A1DA 4PSUA 1K8ZB 3EXEB 3GRRA 4ND7A 4S1NA 4B6QA 2Q50A 5JSZB 4URXR 5K0CA 2OGSA 2EW1A 4ZT3A 1TGVA 2OGZA 1VP9A 2REQA 3HO8A 3UYLA 4AL4A 3FGNA 2IS1A 2PSSA 3C43A 3DFZA 2O9JA 3C6MA 1OXSC 3ROKA 2J59A 4G0OA 5I7FA 1GUAA 2ZJ1A 3G13A 3PD0A 4CM8A 2DLNA 2VG8A 3MNFA 3ZXIA 5ALWA 1ZUHA 3VR4H 1QG6A 3HUDA 4HYYA 4PGHA 2Y9MB 1QE0A 3N2KB 5TQ0B 5HM8A 1ODSA 3D8HA 1XLUA 3BMCA 3ED1A 4G01B 1JNXX 4AZ3B 4JI5B 3E2MA 5K5EA 4GYKA 1X39A 1U6IA 2RHJA 3H8SA 1WLSA 3PFKA 3R09A 4MEJA 3CVXA 5HJ5A 1RC0A 3O8OB 1ZD8A 3K6RA 1USUA 5FOSA 4YWJA 3A6GA 3F6EX 3L84A 3ZNQA 2JDIA 4RZSA 3LKZA 1ZKDA 3TKLA 1AHPA 1PFUA 2AV6A 1QHEA 1PP4A 1IJBA 4W6ZA 3KQMA 4EGQA 4YCCA 2XZOA 4N7RA 1PWHA 4EJ6A 3TKYA 4D6YA 1IN7A 5I7WA 3ZS8A 4LAFA 4ZVOA 5DRYA 4E88A 3F7OA 1ULBA 5K0TA 5CVJA 2KJQA 4TVSA 2OHFA 3WAJA 1MEEA 4W1RA 4QLOA 1PJZA 1T34A 3ICCA 1YI8A 1PYOA 2PJUA 2PZMA 4HLQB 4QICA 3ROGA 1HE5A 4WKCA 4DJDC 3BK1A 3R5XA 4U3JB 3VKFA 3W8RA 1EK0A 2VBGA 3H9BA 4B3IA 1MTOA 1XDWA 2D7CA 1BKDR 4DLZA 1JBQA 1E2LA 5JMOA 1GRCA 2J5QA 5AHWA 1WM1A 3L6OO 3M6XA 4UMVA 4YRSA 4QM7A 3QA9A 1L0BA 1EDOA 3GJ8A 2I1QA 2QX9A 3HFSA 5CLGA 1A8UA 2KWIA 1QO0A 2GXUA 5DFAA 3COWA 1IB0A 2DT5A 4D9GA 1VG9B 4LJ8A 1XEFA 5TS2A 2VZ9A 2ZKIA 3DZDA 2XI4A 1JP7A 4FCTA 1UBMS 2OG2A 2O8DB 2GZ2A 2JBHA 2PJDA 5TMDA 1ZZEA 2AG1A 3N70A 3RANA 1LF0A 3QUBA 4MINA 3GG9A 1Y4UA 4FGKA 3EG5A 4UUBA 3GP5A 2N3ZA 3AXSA 3I9V1 3LA8A 5D51S 3G82C 4KNVA 3LDHA 4Y3UA 5ECYA 3RQIA 4DQ0A 5FFNA 1DTEA 4CMEA 1DJNA 1I4EB 1WCIA 3ABSB 3BE5A 4A7PA 4DQXA 2ONJA 2Y1FA 3R75A 1MO4A 5DSZA 5IP5A 1HLGA 2QT0A 2ZTVA 3UFXA 1E0JA 1QO9A 3GLGB 2NWQA 4RGQA 3W4KA 3GPCA 4AAYA 3PDIA 3D3JA 1GRRA 1L3CA 2DPGA 1CIJA 4J9UE 1DADA 3S7ZA 3UXHA 3V1UA 4X1KB 3K2BA 2ZVQX 3BHJA 4FM9A 1SXJB 2YHIB 1BHQ1 3I76A 1SXPA 1RXSA 4Y30A 4DPLA 1C4OA 3AGQA 4GEKA 4PYIA 3N7TA 1YB6A 3JWHA 2FV8A 4HWSA 4QASA 1I80A 1ZG3A 1ML4A 3PPIA 3CVYA 1PWYE 4PTLA 2BTQB 2B4KA 1H6BA 1QE5A 3LCRA 4IZHA 2B92A 2Q2NA 2EW2A 2C4UA 4AW9A 3AZPA 3M6LA 3EQZA 4G24A 4H6XA 5J2TF 1SVWA 5F1OA 1JUDA 2RK4A 3K7EA 3Q6IA 5T3UA 2R1TB 3KO8A 4Q4AA 5KYGA 3EGOA 3UQYS 1H2WA 1YFLA 1ZRHA 4FFMA 4INPA 1X92A 3OPXA 3P2MA 1KO8A 2GJ9A 4BNMA 4BQPA 4BEBA 4KWTA 4EDFA 4EENA 1QUEA 4XPZA 1FFGA 2HXYA 3BERA 3RTGA 3AB3A 3ISVA 1V6CA 3FD8A 3H2GA 3OPYI 2OCBA 1E7YA 1AXGA 3HGTA 4UNSA 4D4HA 4C4OA 1PFWA 1L1RA 4UHFA 1NW3A 1QOQB 1U8ZA 2ZJYA 4XFKA 1YZKA 2VSYA 1UIMA 1TRKA 2PTHA 4XB1A 1U0HC 2QORA 3O75A 4MUEA 2OUIA 1KIMA 4MYTA 3V8NA 1UAYA 2NSHA 9LDTA 2BJWA 3H99A 1ISGA 1D1SA 1E4EA 3AHCA 3D6VA 3T3EA 4EQ6B 1X1TA 4OA8A 2AXEA 3AY7A 5TNXA 4GLJA 5KNDA 4OQEA 1LRLA 1IVYA 2VK2A 4RA6A 1MO3A 2N42A 2IC5A 5J9FA 2VIIA 4J7XA 4OI1A 2A6PA 4MVJH 4EA9A 1YRAA 4D79A 1TTTA 4X64B 1Y3FE 1Z7GA 2B30A 4A6XA 3LV8A 1VLHA 1BD4A 4WKBA 4IDEA 4KDFA 4EY6A 3DAPA 5DV9A 5CLFA 1VC2A 1VKJA 4GL2A 5CVDA 1SUWA 4MKRA 1DDOA 2ZYIA 4DW8A 2EYUA 4PFKA 2VBIA 2I65A 4F9GA 5FWNA 1ZW1A 2E5FA 1YQXA 3IJRA 2UXBB 1JVBA 4OHVA 4YYEA 1WG8A 2VYQA 3O47A 3COVA 1WHTA 3BAZA 5EJIA 3WLTA 1H0RA 1C8BA 3HPRA 4Z4IA 4Y7CA 1E8NA 4TRNA 3L6DA 4AU1A 1M2VB 3VOAA 2FE4A 5JLAA 3DDWA 3QKRB 4J0FA 2JLZA 4RC9A 4CQJA 4WRRA 1PZXA 2X1LA 4KGDA 4AKHA 4G67A 4GLOA 1XZIA 5AP9A 1KFJB 1S6YA 3OP1A 4PZAA 2VUHB 2XQGA 3D1JA 4GEGA 3OETA 4OAPA 4U9UA 4GGPA 4Y2RA 1UC8A 1JR6A 2O3TA 1FF9A 3V3TA 3IELA 1ESNA 1R8XA 4Z7OB 1KI6B 3ZWAA 1H0SA 1KP3A 4ZKDA 2YBEA 4GNKA 4ZQBA 2WJYA 1ZJ4A 3A9UA 3BTVA 3F7NA 5A62A 1G3IA 1QHIA 3AVYA 3MQ4A 1M8GA 1N75A 2YJ3A 3AC0A 3C5EA 3EC1A 1YR8A 5SV2A 3HP7A 3FFBA 2D2IA 4QYSA 3QEMB 1U28C 1JALA 2I7XA 2IZ0A 3H7IA 2XMZA 4L4YA 1BWPA 1E1CB 1R37A 4OLHA 1VJCA 4MA4A 3RJ9A 2YIDA 4GYYA 4MS3A 4Q9HA 3QH4A 4F60A 3SP1A 2EKLA 4QE3A 3RTEA 1NW4A 1C3OB 3QRWA 4LHWA 3MMNA 3WGLA 1KZ4A 3E4CA 4W8GA 4EHDA 1WB9A 1NTOA 3N53A 4EYSA 4MB2A 2O1SA 1S1MA 2IDJA 3RT7A 3UJDA 1YE8A 2JGKA 4WNYA 3RS5A 1E9EA 4FDAA 3CVUA 4MPJA 3WBBA 2OBFA 4G0VA 2RC5A 1G9TA 2AJCA 3G8DA 3HO1A 2OFFA 4CLRA 4HI0E 1S8FA 3Q8LA 2IE0A 2JZCA 3PUZA 1FU4A 1H9AA 3PR1A 3LLMA 3DOIA 4M1MA 2J4FA 1P5HA 4JEIA 2FFAA 5TY0A 3UEOA 3TNFA 4B46A 2QL7A 2YCLA 1O0BA 1NATA 1N2CA 3U3XA 2ZM6B 3L49A 4Q16A 1VZ3A 5F5XA 4E5NA 1C29B 1QKKA 4D0RA 3PE3A 3WGTA 2AK3A 1L1EA 1WXEA 2A1IA 3R8CA 3UCEA 1KP9A 1QMPA 3L7MA 3PIDA 3LRXA 4KK3A 2OQIA 2Z4RA 4I55F 4I4LA 5TARA 4BEVA 2CLEB 4ENSA 1B23P 2RK6A 4PWYA 3GNTA 1SU4A 4FCWA 1M5RA 5KDLA 2R7MA 5IYZA 5ESWA 4QDUA 3F67A 3KUKA 2Y1DA 2QD3A 5DIZA 2WAAA 1X94A 2AG8A 3HKEA 5JXWA 2P2YA 5HGXA 2YJ5A 4KV9A 4W5RA 1DBRA 5H80A 4OSOA 5G53C 1NBME 2QRGA 2ISCA 5CPBA 4C1BA 4D3ZA 2YIMA 3QX9A 1SZJG 4L08A 1RLOA 2H1SA 2C88A 4Q0MA 2ISQA 3O9MA 3QEBZ 1TVMA 1TZKA 4C0XA 5TS3A 3ZHOA 3WVNA 1WVGA 1R9GA 1XXLA 4PZUA 2CMGA 2J0UA 3R4VA 3TLEA 1D0SA 5I9NA 1VLQA 3ETCA 4GD3Q 4OIMA 1C1HA 2R6R1 3F7MA 3TSOA 2OAEA 3DHNA 4RTJA 5J47A 1CUFA 1N6OA 1Q12A 2ZI6A 3FTDA 1H8HA 1YZVA 2HWUA 4CG0A 1ODKA 5BWCA 1OLOA 4FYVA 4YBRA 3QE2A 5EGNA 2HCTA 4E7PA 5LU9A 3A14A 1EDZA 5DHUA 2HTFA 3I5XA 4AP9A 4LPSA 2NXWA 1U3UA 1YGPA 1OT3A 2HLDD 3RWOA 4DV5B 4V0RA 3PA6A 1X15A 2XQKA 4J76A 2OD9A 3W6ZA 3DDUA 2VJKA 5FBLB 1NKSA 1U7OA 1UXGA 3IKVA 3D81A 2X8LA 2QR2A 1DO2A 2YQZA 3BMQA 1L4UA 4ZP1A 4RETA 3DE7X 4YROA 1R8SA 1B26A 4COKA 2PUCA 2QM3A 3K8OE 2Q99A 1E64A 1CQWA 1AA9A 1HMYA 3EQ2A 3EBPA 3M7IA 4XYMA 3PKJA 1HE8B 3M6UA 3EE6A 2FEAA 4R1NA 3TQQA 3HSKA 2NUTB 2VQ3A 5CH5A 2XR1A 4OGKA 5CGZA 3HYRA 3LO8A 1EQ2A 3PV0A 1AT1A 1TCVA 3C1OA 1M67A 3DV0A 1EFCA 3KJZA 3TFWA 5M04A 4ZC1A 3CLHA 3FWYA 5CMLA 2EEPA 1YCGA 2FA9A 2VHVA 4RXUA 4WZBE 4CEIA 3VUFA 1QGZA 1RJDA 1P72A 3MRTA 2X6TA 2D5IA 2BJVA 3PTAA 3FTFA 3BJZA 2BSXA 4RX1A 5EHIA 5KTPA 2VH5R 4L8LA 1DQZA 4K6HA 5JVDB 1YMVA 3H2KA 4KXQA 1NUQA 2GF0A 4E2YA 4EAQA 5ABPA 2Z1DA 4N48A 4N6NA 1YO6A 4EJMA 1TVKA 4AS3A 1P60A 1AQUA 3HE3A 4LGVA 4P80A 5AKHA 2ZJZA 2YX1A 3AP3A 4RE5A 3OPMA 3Q6NA 4Y6GB 3UK2A 3ZYZA 3HUUA 4GNRA 4IDQA 4NNJA 4YRIA 3JTEA 4JUIA 3CNNA 1MRNA 1SD5A 4B31A 3WA7A 4S1PA 1VP3A 2C5EA 3CTMA 4FGZA 1G4UR 5BV8A 3C3BA 4NJMA 4IUCS 5I7EA 1EM8B 1I4OA 3M4NA 4X1OA 4YPOA 3IP3A 1E2HA 2XYPA 4IJ6A 3PNOA 2HDOA 5LPNA 3QPCA 5K1ZA 2HOQA 5IBPA 1LS1A 1OAKA 2J67A 1I2ZA 5DYYA 1GTZA 3H11A 1RZRD 4G5OA 3J81k 4P3NA 3KUUA 4NFSA 4GLBA 2QVYX 1PX2A 3RUCA 1FP7A 2RGXA 2I2FA 2BFDA 1F2TB 3TD2A 3R7LA 3RGWS 1U98A 4AO6A 2XGJA 1PKEA 3T94A 2CZQA 3TQOA 3ER6A 1DI0A 2BGIA 4PAOA 4PR3A 4TLBA 4NCIA 2PRJA 2XTJA 4FNOA 4MRPA 4PSAA 4RKFA 5IDYA 3G23A 4EW1A 4XOUA 4BFLA 3O8CA 1XMOB 3WICA 3GRVA 3UT5A 1M1UA 1ZU5A 4FMBB 2PZBA 4I1SA 1V9CA 4EO9A 2FK7A 3D6NB 4E5SA 3W7AA 3GRFA 2ZM5A 3DLBA 1UBFA 3CY6A 3SPXA 3R3YA 3DEAA 4V0LA 4NPHA 2FWJA 3IV6A 4ZVPA 4JCCA 4CMBA 1YOVA 4OBEA 1SQSA 4J1SA 5DHPA 2BI8A 4JL5A 3V6MA 1YKSA 4GMDA 2OSBA 121PA 4QUKA 5KOHA 4FE4A 3U3OA 4RHCA 4D9MA 4QFCA 2SCUA 2C3YA 4AD8A 1G19A 2AD5A 1KSGA 3ZY2A 1AKTA 1E2PA 3H3XA 4JENA 1I2MA 5JECA 1FBNA 1EIWA 1YI1A 1YRBA 1J8FA 1QGUB 1KZ7B 1GL6A 3DWGA 4D7AA 5EQDA 3MUFA 1C81A 4AXBA 5HKAA 3RADC 1XTQA 4P81A 5DTJA 4UEJA 1J42A 1KZGB 3KE8A 4FSHA 4S3MA 4ZAYA 2OCPA 3UM9A 2QVCA 3LW7A 4DN6A 4DPMA 4I1UA 4XVQA 5LYJF 3V4ZA 5ALIA 3VNAA 2P91A 1XLTC 3BHNA 4M9SA 4EG5A 4F72A 1CF2O 3PFHA 1DAKA 1HXHA 2Q27A 4RFSB 3ODPA 3RSHA 3U4AA 5A03A 4CL2A 1CK4A 5LMZA 5IJ9A 3DB1A 5LQJA 4XD2A 5LVAA 3SR0A 2XSZD 3D6JA 2HJRA 3ZKWB 1PJ8A 4CKCA 3NYQA 1OZGA 4MQMA 4CMKA 4MDYA 1MQSA 1UT5A 2IEIA 2WFAA 1Y5MA 3KL4A 3M4ZA 3R6DA 4R84A 4OM8A 3FBWA 5ESRA 1NQOA 1S96A 5BT9A 3U62A 5L4NA 4B5LA 1FTGA 2QUBA 4UU0A 2H7XA 4FFVA 5JE8A 3T4UA 4B47A 1BHJA 4MYHA 2HIAA 4WCFB 5CM8B 1FQOA 3F6BX 3FCCA 3OE1A 4HGNA 4ARBA 3HJUA 1VHWA 3GHHA 1FLAA 2Y92A 5BRNA 3WIEA 4R9NA 3VUEA 4GVLA 4N5HX 5C81A 3L8ZA 3TZKA 3CUVA 3H9JA 3TRKA 821PA 1I4LD 1U3FA 1U8EA 2GNOA 3CUYA 1O94C 2Z8YA 3MTGA 5CJJA 5FA6A 4N0EA 1XRSB 5C31A 1ZFNA 1ZAYA 3DCYA 1WLYA 3HWRA 4HWKA 3ZQ4A 2EJCA 3EMKA 3H75A 3G8CA 1XJ0A 3WOHA 4ZI7F 3KTFA 3OT1B 1M0SA 2C7VA 2G80A 3EC2A 5A7GA 2D1RA 1V1RB 4HNGA 1NWHA 4B83A 3Q7SA 2JDID 2JHAA 1MEJA 3PHBE 1SKUA 4DIFA 2R62A 4PLTA 1DDIA 3DMTA 4GBJA 4GWKA 4Y2GA 3DD1A 1PIWA 4MO9A 2EF1A 4NRDA 3ZHQA 4RNCA 3I34X 3L07A 3HL0A 4A0RA 3FAKA 2PMCA 1QHHB 4NBNA 5AW0A 3ECAA 3TXAA 3KCQA 1WXGA 1E3WA 4A1OA 4RMGA 4BU0A 3K4HA 3GGPA 2G72A 3GROA 4BBJA 3ZWMA 1J06A 5LYYA 4C7XA 4K28A 3HM9A 3CW9A 4K9KA 1KMCA 5D1HA 1O2DA 3X2SA 2CXTA 2PBLA 2OFXA 4BE9A 5LUAA 1F4LA 2G09A 4BKPA 3WL4A 2PUEA 1EP1B 1QGOA 4TM7A 5DW0A 4EG0A 3GOHA 2A30A 2QNBA 3GLTA 1YNOA 5A4MS 4GPZA 2OGUA 4G56A 1JDSA 1QFSA 1RJEA 4YWHA 1JECA 1WX1A 4CM6A 3PGLA 2BKEA 5PGMA 4M7PA 2H4WA 3NCTA 4O4LF 5CP8A 1F8GA 3HA5A 3R3WA 2B1JA 4V24A 1DQYA 3TQRA 3BD7A 3C48A 3UB3A 2EJUA 4RHFA 4YT5A 3KPWA 2R68A 5DH9A 5HXAA 1ZD5A 1ZN8A 2VP2A 2AJLI 4JQOA 3H05A 1SHKA 5KDOA 4CM9A 3ID6C 4DKXA 5K20A 4FYKA 2Q9BA 3T7RA 4M6WB 3L6EA 1ES9A 1EK6A 1HA3A 1WXHA 4EPTA 1YA8A 1G2QA 2JCYA 3GDGA 4C7OB 1XD9A 4ZWNA 3FETA 4P32A 4ZVUA 1NLZA 2E37A 1GLVA 2YFQA 2BFPA 1JSZA 4RMJA 5DT2A 3W5VA 4MYRA 4RULA 3COJA 2GDZA 5JAQA 2VZ0A 3BH0A 4BC0A 5KU7A 2L19A 4HV4A 3EYWA 4EDHA 1CY2A 4IZIA 1A96A 1T4MA 3CINA 1N4AA 3V4FA 4ARAA 5LA6F 3V4VB 1HT2E 1U3DA 3ND9A 4MUJA 2A58A 3GA5A 5BSGA 4GMFA 1MAAA 2YZ7A 4P4SB 5A7HA 1Y6GA 4HGQA 3QVWA 5AI9A 1CRLA 2XUOA 5LQDA 4DEYA 3E03A 2E0IA 1N33B 2BP7B 2JD1A 4Y2JA 3WGIA 4GOJA 5B3JA 5KSWB 1BA3A 5SY4A 5B64A 3TDNA 2K5UA 1Z4NA 2PQMA 4JLMA 3ZY6A 4WUTA 2OO7A 1PUXA 2QNIA 3N0RA 1NF2A 4JKYA 4J6EA 1BXZA 1ORRA 5DHAA 2NM0A 3H4VA 1DBSA 4HDAA 1YD7A 1EFUA 4YLYA 1UKEA 1E77A 1BGXT 1U1FA 2W6PA 5T4BA 1E4VA 4IM7A 2FMFA 1X38A 2IELA 4FKBA 2R5NA 4RD3A 4UNNA 3QV1A 3S3TA 4ZYWA 3G0GA 2P4HX 1OXUA 3K5HA 1W36D 4KW7A 4X00A 4URYR 1YDEA 3P9RA 4RIIA 1H94A 3R9IA 5DBFA 4CF4A 3TDMA 1SXJA 1TK9A 2G1JA 1XP8A 1W25A 1RVDA 2PV0A 4NDZA 3U7GA 2R7KA 1XTPA 3DVLA 2X5NA 4N12A 4RZIA 4ZDWA 4B7ZA 5JTUA 2IS2A 1COZA 3QE0A 4PQFA 4PG5A 421PA 3VHQA 2FSPA 1JDNA 5AM4A 1T1EA 4KHPB 3W9YA 1QF6A 1UMDB 3ZCQA 2BTQA 3PU6A 4YCMA 1QE3A 3PT5A 4JHXA 5KNDD 1KH3A 1VBKA 5TSDA 4BECA 2IKQA 4PVDA 4HUQB 1XVLA 3H1PA 1L4NA 5B2FA 1XXHE 4ODIA 3M82A 5FTLA 1IN8A 2E87A 2XOKA 1K1EA 2V9CA 1ZVVA 4K6OA 2B25A 2Z5FA 3AETA 3QV2A 3T35A 5AFSA 4IHJF 5LP6F 5JJKA 4P22A 5K3EA 1FSFA 1VKZA 5HF6A 5REQA 3HCPA 5K6RA 2DE0X 3DBOB 3PUIA 3L7JA 5CYGA 2RCNA 3HDVA 4XCVA 4QWWA 2FR8C 3TNJA 3BMOB 1WKCA 1NL3A 3G9QA 4ZQFA 2Y0DA 2VTEA 3VNBA 1M34E 1ZD4A 5FFMA 4Y18A 4DZRA 3DE0X 1GUYA 2A0XA 3Q85A 4U2GA 5IJXA 2D0DA 3KEOA 4YRDA 1WEKA 3CX7A 1MKYA 2XKKA 3STUA 1K5HA 3HXKA 1JHYA 2V7BA 1T0BA 4G8CA 3NRCA 3ZU2A 3HYTA 5MGBA 2EBWA 5ADHA 3ZK8A 1GUBA 2WM8A 1GTMA 1YQEA 4X3CA 2CLCX 2ZRLA 3KSRA 1QKJA 2VDJA 5BSWA 1IVSA 5AYVA 1Z5WA 1FZQA 1CUYA 2C00A 3EBLA 3JZIA 2RH5A 2XHZA 3MWLA 4TS4A 3QP9A 2IHBA 3CEHA 4U7TB 3A05A 1HFJA 1RKVA 5KS2A 4LWOA 4WNAA 5I9LA 1JWAB 1XDZA 1YMUA 2OBMA 4X94A 2NZUG 1A4UA 1LSUA 4V0MA 3RFUA 3SZLA 2IU6A 2IUFA 2WD8A 3C6BA 4Y1RB 5C7LO 4X65B 3PKZA 3O91A 3VR3A 4E2FA 1PR6A 3V8BA 3ZE0B 2G76A 1ECFA 1Z2AA 3ZBUA 3EZ2A 1F4PA 2V7VA 3NWEA 3NV7A 1NP7A 2VSQA 4KZPA 2B6HA 1ND5A 1EFVB 1M2VA 1QXSA 1O6FA 3ISJA 1M8JA 3PNSA 5KAMA 4CETA 2CFOA 1QP4A 4CCAA 5JH7F 2D1TA 1TCUA 1GLGA 4M0KA 2GARA 4IOJA 4LNUB 2GZHA 4HB2A 1OAAA 3T7TA 1GSIA 4KFRA 3UMSA 3UW1A 4R9VA 2WA2A 2FGJA 1JWLA 1GGNA 1KDVA 2AI2A 5DBIA 5JQGF 2AQHA 3SYMA 5BNIA 2YXBA 4D4JA 4XDZA 4ATNA 5KNLA 3W2HA 1LK5A 3AFOA 4AKTA 2CUNA 3I04A 4JQSA 3QEMA 4B79A 5IASA 3S1AB 4IEIA 2HQOA 1B2RA 2FSVC 1DEOA 2PT9A 4LYHA 3UY4A 3M2PA 1BRTA 3ESRA 3OBBA 5JDIA 5LQSA 5AW2A 3GELA 2X4DA 4FFBA 3SBOA 5GJCA 2F3RA 5LNK6 5AO9A 5IBRA 4BASA 4TUYF 2CF5A 4KAFA 3VHRA 1CDEA 5J2TB 1V6SA 1XWFA 2ZUTA 5H3CA 2PMWB 1RHQA 2ZT7A 3THSA 5ALFA 3E6AA 2WF8A 1ZZGA 1Q1GA 2C20A 4B6EA 1K8RA 1QZUA 1UKCA 2G17A 3E8XA 5DP2A 3RVSA 1NU8A 3UW3A 5AK3A 2CYBA 5JASA 2D3WA 4P5EA 2WWYA 1IK6A 3T34A 5FAKA 1Z3IX 4X62B 5IS2A 1Q7TA 1MTZA 1PRYA 3KKEA 1EUDA 3NU1A 3RC1A 2Z57A 1NBMA 3KELA 3C0KA 3LK7A 5DM0A 5LL6P 2VKTA 2I1LA 1Z5VA 3BHIA 2NTVA 4YHBA 4C6TA 2QUIA 1LZKA 1IRXA 4RV5A 4PLVA 1X9GA 4NCNA 3KPYA 2HQSA 5L3QA 3E84A 5A2QA 4V0NA 2A5YB 3AHHA 3EIWA 2CNWA 1JQBA 4HFNA 4K46A 1O54A 3AIOA 1KZHA 3TZ6A 4QAQA 4NY1A 4B73A 1BQ3A 2P9ZA 2WF9A 3CB4A 1R4NB 1Z8HA 2A9VA 3DE2X 4MV3A 4X1IB 3WFIA 5L6LB 2R2AA 3G0OA 3VC3A 3JXEA 3I61A 4FGWA 1L7EA 1ZSVA 3EVEA 5MF6A 3JYPA 3OCCA 4UZEA 3G0BA 3LU1A 1AE1A 4CM4B 5FTWA 2GHTA 5K2OA 1IFXA 1EUCA 3QE4A 2GAJA 5DTIA 1PD0A 3AJ8A 2JFPA 3QYJA 4CWAA 1I4DD 1KRHA 2BM1A 3WNBA 4C87A 5ENZA 4PHHA 4B17A 4BFZA 3U3KA 2W6OA 1YXMA 3KTAB 1GN9A 3SDSA 1GG8A 3TNYA 2ZUFA 3WL6A 1QLHA 2XVXA 3TVYA 4F38A 1JSXA 2LUOA 2A5LA 3IVGA 5FFFA 4XWYA 1FPQA 2A5GA 3Q87B 4WESA 5AK6A 2PBZA 2FXVA 2BEWA 3A1SA 3EDQA 4PQRA 5AWFC 3S1LA 2RG7A 2R00C 4H1HA 4TZ6A 2G4LA 4NZPA 3CEMA 2IHYA 2QQEA 3CXUA 1XAHA 4OIFA 3DBRB 4LV6A 1NN0A 1MIHA 3KB6A 3NKFA 2NMVA 1Q77A 1UFOA 1OTYA 1YGYA 2G82A 1Z6QA 2W70A 2P67A 4A10A 4CRWB 4D4LA 3AF4A 1DQRA 4CTMA 5KKAA 4DV1B 3ED5A 5GIOE 1JA9A 3GU3A 3KKNA 3P20A 5TMBA 4MW1A 4NOLA 4OLJA 2XVZA 3T4XA 3L1JA 2G28A 2O1EA 2W83A 5TT1A 2D8AA 5JUWA 5FR2A 3WZMA 2ZU0C 2C04A 3M6AA 1WP4A 3C5HA 3NXKA 3QLEA 4AMZA 3LQFA 4M0EA 3BXGA 4UVEA 1VJ0A 3EZYA 5LP6C 4AG3A 3L4BC 4MEAA 3ZEIA 1OYYA 4IHAA 4MRMB 1IBMB 3IQWA 2VQSA 1DPFA 3DLAA 4ECAA 3MHTA 1XTZA 4M54A 4HP8A 1QH1A 2ZDGA 3DG9A 4ETMA 1ULSA 3VDQA 1KH1A 3LYLA 4C0AC 5JMTA 1VPDA 3IRVA 4YACA 3VVLA 4EBFA 2AFHE 1P80A 2YHBA 5H3HA 5IAKA 2CB9A 2GBGA 3OJLA 3W5BA 1M2GA 3E27A 3AG6A 3LZ6A 1LK7A 2I55A 2VPWA 4KQCA 3GN2A 4QU5A 3TAUA 4Q37A 4FHDA 4ZV4A 4JYBA 2PEYA 5LSAA 4ITUA 4LRYA 4BXOA 4WFIA 3WG9A 4BN4A 1SEPA 4BQNA 2CXHA 3MINB 4XJVA 4NICA 1V3VA 2P9TA 2H2FA 3TI7A 2HV9A 5BN3A 1CVIA 1NQ5A 1LTHR 1JILA 2J5KA 2H8KA 1J07A 2P3SA 1UJMA 3IEKA 4TL9A 5KX5F 1TLLA 2FW7A 3WIDA 5C5IA 2QYTA 5EG5A 4FK8A 5H9VA 2WRZA 3WNQA 1I7SB 4PV7A 1YRQA 4JUFA 3WTBA 2WTNA 4I55B 2H1RA 2P7HA 4O0MA 2D2XA 4MQUA 4AJHA 2BEVB 3CN9A 1VL8A 3A70A 3BH6A 3O82A 2RG1A 2JFQA 1RQGA 5CA0A 2VI5A 1TU0A 1YC5A 2VKQA 3OMWA 2Q6IA 4UVHA 2O2CA 1E2JA 1J2RA 2NAPA 1L3BA 1CFJA 2IEGA 5DEOA 1QQAA 1S2LA 2CZCA 3NKLA 3GN1A 4LI3X 3E3LA 3LC1O 2AJ8A 4IKEA 3X1XA 4NOMA 3C15C 3FVRA 1K7SN 3H8JA 3WLEA 2PD3A 1CF9A 1NF8A 1WNFA 3RHZA 1Z6YA 1GPKA 5CBPA 1JSRA 2Q3EA 1XCMA 1PFQA 3SC3A 4LNAA 1ZNZA 5KDDA 3V97A 4YJ3A 5CGQB 3KV1A 3MJFA 5AVRA 4P3KA 4R2KA 3MCTA 3U56A 5THQA 1J33A 4WJZA 4X24A 1HWYA 1YB1A 4L7VA 3C7DB 3WI7A 4R3WA 1JHUA 2ZXUA 3FI9A 2NZJA 1TKBA 3HNOA 3EGWA 4ZRMA 3I2FA 3SE7A 4J16C 1JVNA 3O8LA 1BMTA 3G5AA 4XKJA 3GWGA 2G9VA 2EBFX 1WY5A 3EPLA 2OR3A 3PHLA 3VPBA 1V11A 4AQDA 2H1IA 3LPMA 4BMCA 4W5TA 3GVXA 1EFTA 4DLKA 1AM4D 1BC5A 1U8UA 2FB9A 1IBSA 1ZM3A 3K05A 3NIGB 1V3QE 1QQ7A 1YKGA 2HZ7A 2R3SA 3DSRA 4N49A 2XMGA 1C7JA 1C9YA 5ALJA 3RYHA 1IY0A 1RBZA 2Y99A 4B7CA 2XUQA 7GPBA 1MVOA 4J07A 1DTWB 2C2BA 3ETLA 2OORC 1IWPB 4U2DA 1XIVA 3L0SA 3SC4A 4F6RA 3M0EA 4K6MA 1Q1EA 2CEAA 4XRGA 3IUPA 1HT3A 2Y71A 3AZQA 1B2LA 2Z3VA 4MS4B 3U37A 1EUQA 4D46A 4JLKA 4QPNA 2H5EA 1XZEA 1UMCA 4OQMA 1IZZA 2ZTLA 4X61A 1Z73A 3E9MA 3SCZA 1PU2A 4B8WA 4BIIA 5BW5A 3CO5A 1DKRA 2ALJA 3H1TA 3AT1A 3GQVA 2HBQA 1YS1X 5DBHX 5H59A 3TOZA 2VNKA 2FTKE 3OBIA 3K9HA 3PDHA 1KMHA 1GCGA 1EQAA 5TMPA 1PW7A 1H2HA 1JU3A 1F0NA 1YASA 4NESA 4EFDA 2ZBDA 3RS8A 2X76A 1PR2A 1MW8X 4ND5A 3FX2A 3E05A 4F5ZA 1L1FA 4XDYA 3W5JA 2QM0A 3GRCA 3ABZA 3D6HA 1Z34A 4MUGA 1D1PA 1MIOB 1XUOA 1N2ZA 4NAVA 4YUVA 3V2HA 3VNSA 5KYUB 2R65A 4B7XA 1MNQA 2X3FA 3M5PA 2GPWA 4JXXA 3TCXB 3BWXA 3DWEX 4I5IA 2O2ZA 3ZHSA 1ZN7A 2ACKA 3OT1A 3AR2A 3M2TA 2Y1LA 1RT9A 3PXBA 2W0MA 4P4TA 4A2WA 5BRAA 1VJDA 1Z8NA 4EM6A 4UUNA 1AN0A 4F3KA 2Q4RA 5CA1B 1QRAA 2QJTA 1E6MA 1I1OA 2I6TA 3QFRA 3WJ7A 6GPBA 2ZI3A 3O4HA 2Q6KA 2X5OA 1B16A 4PZYA 4WWHA 2FEWB 3K4QA 3QX7A 1KAGA 1PT6A 2DWQA 1KTIA 3FHTA 1A69A 2ZJFA 2HDWA 3QLUC 4B80A 4PBSA 3HB4X 2I8AA 2KW5A 3EUWA 2P79A 3C2QA 3QFTA 1QHHA 4TTAA 4CM9D 3EB9A 3U3MA 3QM1A 2XRFA 4BIMA 3SQNA 2XYGA 3TLYA 1UKBA 3LVRE 1ULHA 1FDUA 4D8UA 5THKA 3TBKA 2FWMX 2UVPA 2OWDA 3B8HA 2ACEA 4NBSA 3RH0A 3I23A 3L7YA 3WX0A 2DUMA 3A6JA 1K2VN 4WN9B 5SY9A 5IVIA 3KKQA 2CD9A 1O77A 1TQHA 2OILA 3RT1A 4ZIRA 5H81A 5I8PA 4TMYA 2WYIA 5IH7A 2ZXFA 2Q3LA 3FFXA 2PL1A 3NATA 4OEHA 4UPDA 4ZVNA 3WSVA 3DR3A 4D98A 2BDTA 1OQAA 5KPDA 1DMSA 1CZOA 3E4DA 4IG9A 4J7CA 3FIUA 5HVNA 4ID9A 2JFOA 4P3YA 4TTPA 4UMDA 3R7SA 3OLQA 3KZNA 1CFZA 4EJSA 5A5FA 3Q41A 4AJ4A 3OTOB 1RYNA 1K08A 1T36B 1K86A 4MW9A 2HK6A 4A15A 1MUUA 3HKCB 4OYHA 3T5GA 4D02A 3HKBB 3WGJA 4BLSA 4MR7B 1OLUA 4Y6RA 4N3AA 2L17A 3E7XA 4A36A 3NBAA 2R8OA 1W48A 2QTWB 4D41A 6AT1A 4D3XA 2QJWA 3M6IA 4GICA 1Q16A 1UPFA 2IZZA 4WA8A 3TH5A 4KAJA 3R74A 1S2NA 4Q1DA 3OE5A 3T9EA 3V9AA 2PCLA 1K98A 5IHPA 5HCUA 4GOND 1AMOA 4A5SA 2QF7A 1N8TA 1GM5A 4P4NA 2ADFA 4OYRA 4BB9A 1YE5A 5DCWA 2AMVA 5BY2A 1GEGA 1P77A 1U5AA 3M9LA 1SXJD 1PF7E 5ALPA 3H5TA 4PCVA 3KYIB 1E5QA 4P4SA 3HJTA 4MITA 1VJRA 1VMAA 1IY9A 3JWGA 5FWDA 4ZPJA 5TQ2A 5JFTA 4I9UA 1VCOA 2WT8A 4P08A 5CDFE 3W5SA 1HDIA 1ZGCA 4K2AA 2AX4A 4PLGA 1X0XA 3G68A 3T54A 1XLWA 1GPLA 1P0CA 3W8NA 1Y9DA 1AXEA 1HQCA 1Z5PA 2WYHA 3O9VA 2C5BA 1PT9A 3GD5A 2FEPA 3O4JA 1QP7A 1ZH8A 4YJHB 3PYLA 3CVWA 3KR2A 2BV3A 4Z8XA 1Z83A 2OGWA 4TMZA 4Z5XA 1L9KA 1EUYA 4B09A 2WIKA 3AOGA 2VJMB 5CB4A 1DWOA 2RHTA 4V03A 3IEXA 1A2OA 2QTCA 4LRSB 3JYNA 4YJ2A 2K7ZA 3OU6A 1K5PA 1ZR4A 4MQEA 3AZOA 1U9IA 1US8B 2OG1A 3TDKA 2D8MA 2UYHA 3YASA 1WQ3A 1YVDA 2IZOA 3ABQB 4MXDA 4I9HA 4KQKA 3UKOA 2P9HA 2XYVA 1YK0A 3P9SA 4RK1A 3SEFA 1NWCA 3VKWA 2K2WA 1O6GA 3SMVA 4N41A 1EVQA 1PGOA 1G5FA 5HQJA 3SR3A 1JEYB 3Q5DA 4MIYA 1R0SA 1YQQA 4UE6A 5C1IA 3C74A 2G4CA 1Z7BA 4BMSA 2B1IA 3R2JA 3DLIA 5TPZA 2KBFA 4HUQA 1G5PA 1NHGA 5EP4A 4CIDA 1G21E 2R751 1Q3TA 3HYNA 4IKPA 2I2DA 5BR4A 2IY8A 3IR5A 3PGJA 1WB4A 2O1XA 2OMKA 2O2HA 1NXPA 1NI3A 1TPZA 1TFUA 5LZ7A 4QOJA 4MI1A 1KETA 4XJSA 4QATA 3EIXA 3ENKA 1FS5A 2R1VA 1Q7CA 1USGA 2HAEA 4ZQHA 1JYSA 1USIA 2B0CA 3FWHA 3HFRA 4LY9A 1W0KA 2HF2A 3OTIA 3B7WA 3BMOA 1IN5A 2ZRKA 3QE3A 5I9SA 4EGSA 5BQFA 2QT1A 1U99A 4O4LB 1TK3A 2X8WA 4Z99A 4D3DA 4M49A 4ZZ1A 3RRBA 1LNSA 5NULA 2FUG1 3GFQA 2NUAB 1GILA 2YHSA 2VUUA 1SUCA 4H9GA 1ZCAA 3MWKA 2ZCUA 3EWNA 1RW4A 3RVLA 4X85A 3TR6A 4ER0A 1B6TA 1ZIXA 4LQCA 1Z8DA 3OZEA 4YMIA 3QWBA 2EXXA 3CYFA 3SBEA 3SIRA 3TE6A 4B3MB 3WSTA 3UMBA 4DSNA 4R9UC 3L7DA 1JEQB 3RYIB 1TEHA 1PO7A 1DO0A 3VISA 4PICA 2GBPA 1R0ZA 4G9BA 2IYLD 5C18A 4AZ0B 3D7RA 4G0ZA 5AR1A 4J2HA 1IEXA 1I6WA 1XAJA 3KT3A 3RCBA 2R25B 4MWTA 4PR0A 2XBMA 4A1FA 5LZ2A 2IVFA 3GLIE 3BA1A 4O2LA 1NSTA 4TLEA 1GQYA 3U26A 1BXGB 1PBTA 1NPTO 4LECA 1IN4A 4FBMA 3DNPA 5EGSA 3IUBA 5LA6B 2BEJA 4NE2A 3QU2A 4AMUA 1GQSA 3ESDA 3OMXA 1TEZA 2R1UA 3AOEC 3DHEA 3LD9A 4CTKA 1JW9B 1A7JA 4E33A 3KQPA 3TQSA 3DKPA 4AP6A 4BP8A 3SDZA 4MAFA 2C78A 3QPUA 2V58A 2GT1A 3AGPA 4DA0A 4UARA 4XQ0A 3UWSA 4F97A 1FDWA 2PL5A 4NE7A 4I8XA 3MWDB 1FX0A 3IAM6 3BXEA 2R11A 4M36A 2HC9A 2J3JA 1TDJA 4LZPA 4RXTA 1AZSC 1E1LA 3MRXA 1C30B 2JFUA 1W73A 2Q2WA 4BTEA 4MKHA 2QP4A 3M6VA 4QNMA 1E3JA 1LZLA 3OJEA 2Q1TA 1E3TA 5ALLA 4DWJA 3D7SA 3R5KA 5E6RA 3OIDA 4DUGA 4IQ4A 3G59A 4YV0A 1RD4A 2C07A 1JDPA 3VMFA 4CKXA 3Q3CA 3RS7A 1DS6A 4PGAA 2Q5IA 4JBLA 4U7HA 1PJQA 4GMGA 3SXUB 4UAGA 3TKAA 2OLKA 3BRQA 4W8HA 3S1AA 4ZRDA 5K51A 2XUIA 4TSFA 3SM9A 4Z49A 4V0KA 1IJFA 4B3CA 5JAMA 1GZ3A 2CK3A 1HC7A 2B61A 2Z4SA 3G0DA 4UQLA 4CEHB 2JJ1A 5G2OA 5MHTA 4ZAVA 3MCVA 3L82B 1HM5A 1NDQA 1E5DA 1GL7A 2RAVA 4M46A 3CURA 3WGHA 4BNFA 5B3KA 4I1YA 3KIPA 2MYNA 5LZ5A 1ZSYA 4NEHB 3CG0A 5JJBA 5J43A 5J2TA 1MO2A 2QI9F 1GNQA 2OFOA 2ODTX 3CISA 4KPEC 4H6PA 3R24A 3U5TA 5D3ZA 4J49A 4DDUA 4H17A 1OR8A 1IBCA 4EMTA 1Y7PA 4WY2A 4PXAA 3WOVA 4BNHA 2EQBA 4DMMA 5TJHA 3EUFA 4LYFA 5DHRA 3DMNA 3DLPX 3KR1A 3ONEA 1GUDA 2CNLA 3DHWC 5C5CA 4L5IA 3UXMA 1XLVA 2Q6OA 1Q57A 1Z7WA 2OV6A 1CB0A 1U0SY 3QA3E 4ML3A 4BO8A 3GEBA 1H9BA 1XZNA 3PJFA 1BTOA 4JP8A 3DNMA 2AN4A 4Y2HA 3RVOA 1QC5A 3A2KA 1I1NA 2OGTA 1N7JA 2X4IA 2BCEA 4AUMA 5BUQA 1MB2A 2R6CA 1NONA 2OQ2A 3RUFA 4TKLA 4KC0A 4CVNA 3ZGVA 4C78A 4HQNA 1QYWA 5DWQA 1MVNA 1E6UA 4PYQA 3CWCA 1Z36A 2JGMA 3RIGA 3QVUA 4Q7QA 1M74A 4NDNE 4TKUB 1RQ7A 1YJ8A 4YJGB 3OPYA 3AERA 1JG7A 3KOOA 1L7OA 4WVFA 2H9AA 1Y1PA 1COWA 5HJ2A 1JXOA 3QF4A 5FL7A 3RKSA 3CUWA 4ZFNA 2I4TA 1UMBA 1L4LA 4TRJA 4BGEA 2WWFA 4Z3OA 3GJ6A 1M0EA 1UZNA 3KZMA 3PZBA 2PYIA 2JLSA 3STWA 2Z58A 5CCEA 1K7YA 3B1KA 1WBBA 3HVHA 1VIVA 1CV2A 3FMVA 2QD1A 2V7XA 4FTWA 3R6WA 4LZAA 2LXNA 1FFBA 1VDMA 2D5LA 2ZATA 3IALA 4Q7MB 1M6YA 3G17A 4HOYA 4BVKA 1D3AA 1QBKC 2P62A 4TTSA 3A4TA 3X0DA 5JCZA 5KYYA 4UXJA 3KTAA 4TYMA 4I19A 3RUEA 4CPDA 5JFOA 3JQ8B 3B5IA 3DT6A 3ZGOA 3BC1A 2VTKA 5DWVA 3VU9B 1GSAA 3CZRA 5H3LA 4MB6A 1T3GA 4RVHA 1XDSA 3C39A 1GZUA 5HFNA 5JH7B 2JS7A 1KEZA 3GJ4A 5FPPA 2XYHA 3LY8A 1QRUA 5EWJB 5FBHA 3MB5A 4FC7A 3B1YA 3M5WA 4WXRA 4YRPA 4D96A 3K70C 3DDSA 4HQ0A 2Q5QA 3WB0A 3KU1A 4G8JA 3GVPA 1RXIA 1NT2A 4NFYA 4KPUA 3DZBA 2C9ZA 2YZNA 4D8YA 3NORA 4OSPA 3KQNA 2J31A 3WLAA 2V1XA 1G4AE 1NV8A 4LSZA 2AFHA 1Z39A 1BWSA 2XQFA 3DF9A 4FMDF 5CRIA 1ZWKA 3E8SA 1LBIA 5CW2A 1WSWA 2FW8A 1JEDA 4RMIA 1EINA 2AC2A 1I0ZA 1GGJA 3V1MA 4HS4A 5DIFA 5BT8A 3I3OA 1F2UB 3IODA 2FPKA 2I7TA 4YRAA 4DQUA 5JYBA 1QANA 4IFBA 2J45A 4I81A 4MRMA 1QV7A 2PTGA 1U0TA 1DMRA 4A0FA 4OQNA 2VK1A 3GIDA 1Z68A 4CJXA 2EG5A 5LD2C 1AH2A 1G5IA 5ED4A 3X1MA 4O1MA 2X0FA 2AOUA 5ICEA 3CVVA 5EUCA 1KP2A 3LTEA 3M8KA 4LXXA 2ZPAA 3CZ9A 4TTTS 2R87A 3MAJA 3HB0A 2P40A 4Q12A 3WIVA 3WMXA 4RTPA 2COEA 2QAJA 4RQAA 3U4IA 3AM4A 3ZHZA 1BMFA 4YUWA 1V71A 2FVXA 2UV8A 4PPNA 5ALMA 3RKUA 1ONPA 4NZOA 2JIZD 1E9BA 1OX6A 2WIGA 1M6VB 4EI9A 3WKEA 5LXTB 1S5PA 2CVPA 2ID8A 3KPJA 2VTVA 4HLUC 2GXQA 3LT4A 2VT3A 2YXLA 1LV8A 3G2OA 2JG3A 3BWEA 4RFLA 3S29A 3T0FA 3JD0A 1PX0A 1GQ2A 4QLBA 5FCDA 3HVRA 4EHIA 3AR8A 4KQHA 3CB2A 1Y6QA 5AJUA 4BP3A 5LMNB 4I55A 2XD4A 2J5XA 4DHWA 1U2EA 1Q6YA 3IMKA 1ZOIA 5H5JA 3V7YA 4CXMA 4RTQA 3M3DA 4QX6A 1SOUA 2QP3A 3TIVA 4ZZ2A 2XCSB 3MBKA 4PHCA 4BE7B 5EUQB 1S2OA 2HREA 2OLEA 2XRYA 4JI7B 3P9PA 4JMLA 3U4GA 2JFWA 1LK0A 3JQ7B 2JA2A 4FNAA 2YXDA 3G2KA 4IUDS 4K88A 2ZQYA 3MWEB 3RE1A 1Y1TA 3FB4A 2I2AA 3HCRA 1JU4A 2WINI 2ZYUX 3FE2A 3WNZA 4HWOA 3EK2A 1KKLA 4L9WA 1DJPA 1MABA 2POCA 2JGEA 4L5AA 4S04A 4D9JA 1OWOA 3L5OA 4QPZA 1KDYA 4CR6A 2CW5A 3SY8A 5HRCA 1KAQA 5DHTA 3HEAA 4G23A 4Q3BA 1WULS 4KQMA 3EMVA 1NI5A 1DARA 2J3LA 2VRCD 3FW1A 4NJEB 5HCNA 1VHTA 2A5JA 4YR9A 2AFIE 2P30A 2HA3A 1AK9A 1MJGM 2KMLA 2ZYRA 3PGMA 1UBRS 5DYGA 5AKEA 2QEQA 2RHOA 5IN4A 2H1OA 1E5TA 4JD5A 2J5BA 4PS0A 5DCUA 2XCTB 4N65A 3W5HA 4FZJA 3ZOKA 1X1EA 4AKEA 3PCTA 2F43B 5CVCA 3ZV4A 2ZSDA 2Y1GA 3EYAA 3FZYA 4DLRA 3VOTA 1C3XA 2AQ8A 3H1FA 4RD2A 5HF8A 1EGQA 2OOKA 1O9GA 3K0SA 2BM8A 5EXTA 2HF7A 3EW9A 4LJ9A 4GX1A 3I09A 3WGOA 2OD7A 2C2HA 4B3JA 2R8YA 3LWBA 3DWFA 1LRKA 1WTCA 3LOQA 4DRZA 4BVGA 2PNFA 3GZNB 1RCTE 2QI9C 3DTVB 1DTWA 1NP6A 5JS7A 1Z0JA 3PQ3A 1QORA 2GPJA 3VNVA 1K89A 3JAKA 3JPYA 4EKEA 1R4MB 1WCWA 4HFMA 4LZNA 4EJFA 3ADDA 2AOTA 4UEQA 1L5HB 2JCVA 3WLSA 4R68A 1ZNQO 2YYSA 3H9QA 2WDPA 4G86A 3TZCA 2EBHX 3A26A 2DU8A 2GD1O 4ZVVA 3CKYA 3K20A 2AG6A 4IOMA 3ELBA 2P8JA 4O0LA 4W1PA 3EVFA 4IHKA 1LI7A 3KQOA 1LKZA 3R7NA 1O9HA 1FTQA 2JFNA 3EVNA 1W8IA 2X5KO 1UWCA 2PZKA 1EH5A 1W5FA 1IC6A 1NUHA 2W22A 4HDRB 4D44A 4N18A 3BGVA 2I8LA 3GZJA 3DZ8A 3HTXA 2V6MA 4TTJA 2HLPA 4FX2A 1DIGA 2RJNA 2W6ID 1DC5A 1BSVA 4NZNA 4AS2A 1GVHA 1KXZA 3JTMA 3SVZA 4O6VA 1JKIA 2HMUA 3NDBB 3DBIA 4C7KA 1MOQA 2G6BA 3NBYC 5KYWA 3TAHA 1MJNA 5KYUA 1EX6A 4W5HA 3ZIUA 5KX5B 4JGIA 1O95C 4NBRA 1HE4A 1Y7LA 2HU7A 3CUTA 4N8DA 4TPKA 1GZSA 2AN3A 3X44A 2M32A 5DNVA 2C58A 5FBWB 3NCHA 2HU5A 3ZQUA 2ZAGA 4PHTA 2PXAA 4CT0A 4CIYA 5AVVA 2WAXA 3QOWA 3OCJA 2DFKB 1NBOA 2I7CA 2O2YA 1TM5E 1JKJB 1NQWA 1T2CA 1Y7HA 1YBFA 3RSQA 3EJ6A 1I3KA 5JZOA 4K1XA 4YN3A 3PFCA 3D3KA 7REQA 3GJTA 1KE1A 1RFLA 3ZBTA 3GLFE 4P2BA 3TIGA 5L8VA 5EKUA 2DOKA 3DTYA 3L0PA 5F2KA 1Z13A 3WIUA 3WYNA 4ARUA 1P33A 5F7ZA 1UJBA 4OB6A 4PBRA 2XEDA 3DMPA 4DT1A 4FSDA 1GA6A 3GFPA 1XA4A 4B9AA 4YMGA 3D2AA 5L3ZA 4GBGA 4WLEA 3V7FA 2YH2A 2ZVJA 4LF7B 1CZKA 3L93A 1IZYA 2E4UA 2NGRA 3UBMA 1JPVA 1DHTA 1A50B 1B6SA 3Q5EA 3D7MA 4WN9A 2D06A 1THTA 4IMRA 4YMSA 5DNCA 5CLQA 1P29A 2BN4A 4H0FA 2ON6A 4NEGA 3NBMA 4Q9JA 4DDMA 3KKPA 5HIJA 1DIBA 1RAAA 3D8TA 3O4VA 2VF2A 4ZQCB 3WLJA 1FUYB 1QAOA 3FLEA 3LSTA 1S7GA 3ZHBA 3QI7A 5HZMA 1K92A 1GTG1 1N32B 3KP1A 1KYXA 1GRNA 4DC0A 1P9LA 1P0MA 2AYZA 2GSDA 3DPSA 5BQOA 4R5HA 4E3ZA 2I34A 2GCGA 4RS3A 3BWMA 4HDSA 4Y2PA 3F49S 4LS3A 2C7QA 2PY6A 2FR8A 2QAGC 3ROZA 4H59A 2FWNA 4MQ4A 4N47A 2QX4A 2HSZA 5LYJA 2WU8A 1L2TA 4MW4A 1K0FA 4FDUA 2BFMA 1CNFA 1HEUA 1JEEA 3VHXB 4I5FA 1BEEA 1QYXA 3ESZA 3SYRA 4PSVA 4U2FA 3VRHA 4YCLA 3JVEA 3L02A 4UCXA 3WY9A 4WIAA 4CKBA 5C4IA 5UKDA 1FU8A 2I54A 1H05A 1WMSA 4L3OA 1ZD9A 1MCZA 3ZU3A 4E0BA 4BP1A 2V7UA 4E2ZA 3SNHA 4XZ3A 1B1CA 1PTJA 1GTRA 1EXWA 2BEUB 3TG8A 1DELA 3PENA 1DC8A 4FNGA 1Q44A 4Q93A 2DFNA 2AKAB 2GVNA 1PGQA 5FEMA 3OFND 1GGMA 3UC5A 2WJIA 2DKOA 1TIKA 2DUJA 4QWMA 2AT1A 2BMDA 2HMVA 3MSXA 3OLZA 4OXXA 3V32A 3R7WA 2WDZA 5DLPA 3GCGA 2PU5A 1QIEA 1S02A 5AQ1A 1JRLA 4ND3A 4LQDA 4OSEA 1AUQA 4RKEA 1KJQA 4BX9A 1DAEA 2OCXA 4ZDKA 2A9KA 4YJHA 1I8TA 5LBTA 2VTDA 3BWDD 2CJXA 5BNFA 3M4XA 5CEFA 3OI7A 3C3KA 3NAMA 1SG9A 3R3XA 1UK6A 5JYEA 3H97A 2BTOA 2ONKA 2XAUA 3A3NA 3S1SA 2QN3A 3DEHA 4KMSA 5LBUA 2UZ4A 5K8LA 1JDTA 1I33A 2H52A 3C1AA 3GPDG 1NNI1 3O1LA 4ZI7A 1W0KD 5H7XA 5ALDA 1QHSA 3ZXXA 2GRJA 4JBIA 1G21A 5J59A 1EFPA 4B33A 4F4HA 3W06A 3D0KA 4YRJA 3K09C 3A3OA 2ZUUA 1J4AA 1US8A 2C03A 4QXAA 5CHYA 1KK2A 4JI3B 3GPIA 4TMTA 3SLKA 2Q21A 3KB2A 3DMFA 4NU8X 3RK0A 4GR4A 3BKWA 1GP2A 3E53A 2XA1A 3QVGB 4RD0A 3EXFA 4LF9B 5FWXB 4KQGA 4DPKA 4HT3B 4Q3OA 3KD2A 2IF2A 4MX8A 4HATA 2PD6A 1AG9A 4WMLA 1V96A 2ZRGA 3B2NA 3AXTA 3DF7A 1M6NA 1Z6XA 2FMKA 4D82A 3OM1A 4DBLC 4XVCA 5I7SA 2LRHA 3EGCA 1ISJA 2OD2A 2J7PD 2FSVA 5FPYA 2X1VA 1FYWA 3JVIA 2QAIA 2CFIA 3B2EA 2IXFA 1A7AA 2I03A 2IPMA 1SQ5A 1GEEA 2PS1A 3PQCA 1U9YA 4HWTA 2Y68A 3HH8A 1NBWB 1B0PA 4Y9DA 2BMFA 5BVGB 2RH8A 1XD2B 1VE9A 1KZ9A 1J0EA 4GQBA 2NO6A 3GJYA 4M1ZA 4O4LA 1C0IA 3NH9A 5EQTA 3TEMA 2FJPA 2O1WA 2OM6A 3L0BA 4FXOA 2NUBA 3WRXA 4O2AB 3U16A 5A4JA 3S5UA 4M0LA 3GO4A 1UDBA 5KEIA 4BNJA 1TYAE 4JR1A 4AZWA 2Y2VA 3OEWA 4Z4QA 3GRUA 2G5PA 4QELA 3H5VA 3HVKA 2VJBA 1XZLA 2YRXA 4EFKA 2VP3A 1FW8A 3A2NA 3I9V6 1V5IA 3TOVA 1I7QB 2FN9A 1NNLA 4CCWA 4RUKA 1OU4A 3DTNA 2C82A 5FB3A 4EYGA 5JROA 3AEZA 2DM6A 5CFNA 1BQEA 5I7RA 2BH9A 5A05A 4BZWA 2VPTA 4FMCB 4TQAA 4L9SA 2VPZA 1MT0A 3AJRA 5EZSA 4BQOA 1JG2A 1JHVA 2VOEA 2GRAA 3B85A 5E4YA 2OYCA 3RD5A 2HMTA 3RC9A 4GXTA 4LRWA 5LA6A 2VLBA 3U1VA 3BE6A 3SZOA 4TSFD 3RTCA 4BLOA 4AJLA 1AQYA 2CDRA 1W87A 2Q2QA 5DTRA 2SICE 3ESXA 4G26A 5C8DA 1FNSA 2UZ1A 1W94A 1GWNA 2ZRJA 2HRRA 4OXKA 1ZYUA 3D7NA 5K3OA 2RGNC 3HJAA 3D8SA 2IH2A 4PFSA 4JSTA 2GB4A 2AUTA 1ZJWA 2NOAA 2FUNB 1O6BA 1YCHA 2IX3A 2PUBA 1I2CA 3JQFA 5DNAA 1QU3A 3K0CC 1RJ9A 3AJAA 3NJ4A 4FOLA 1R0YA 4I46A 4OL9A 1ABEA 1SXQA 4C2UA 2YXPX 1TZCA 5COAA 8ATCA 1KK3A 4A8PA 3ZD6A 3SFVA 2NPOA 2XNHA 4QYIA 1D2CA 1UBGA 2XNKA 3LQ4A 2B2NA 4OP3A 4MI9A 5K0FA 5LQUA 2H1WA 2R00A 3EGXB 3FTNA 4C30A 3V7NA 4B45A 3VPHA 4CR7A 2AOWA 2PPLA 3Q15C 4XDHA 5EINA 1P45A 2PS0A 1R2QA 1DXQA 3K70B 1HDXA 1YV9