3E2PA

Catalytic subunit of m. jannaschii aspartate transcarbamoylase in an orthorhombic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
306
structure length
306
Chain Sequence
MKHLISMKDIGKEEILEILDEARKMEELLNTKRPLKLLEGKILATVFYEPSTRTRLSFETAMKRLGGEVITMTDLKSSSVAKGESLIDTIRVISGYADIIVLRHPSEGAARLASEYSQVPIINAGDGSNQHPTQTLLDLYTIMREIGRIDGIKIAFVGDLKYGRTVHSLVYALSLFENVEMYFVSPKELRLPKDIIEDLKAKNIKFYEKESLDDLDDDIDVLYVTRIQKERFPDPNEYEKVKGSYKIKREYVEGKKFIIMHPLPRVDEIDYDVDDLPQAKYFKQSFYGIPVRMAILKKLIEDNEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Structure of the catalytic trimer of Methanococcus jannaschii aspartate transcarbamoylase in an orthorhombic crystal form.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 109
structure length 306
sequence length 306
chains with identical sequence B, C, D, E, F, I, J, K, L, M, N
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3e2pA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3e2pA01
4H31A 5ILQA 4E2FA 7AT1A 1FB5A 2AIRA 1SKUA 2BE9A 1D09A 2FG7C 4AMUA 3KZMA 4EP1A 2RGWA 3L06A 1ZA2A 2YFKA 1DXHA 2AT1A 3M4NA 1OTHA 8AT1A 4FYYA 4NF2A 2P2GA 4AM8A 4WTOA 3E2PA 2ATCA 1Q95A 3M5CA 4OH7A 2FZGA 2FG6C 2OTCA 4KH1A 4KWTA 1VLVA 1FVOA 3KZKA 1F1BA 4A8PA 1RAGA 4FYVA 1I5OA 3SDSA 2FZCA 1ORTA 1AKMA 1TU0A 3KZCA 3UPDA 4F04A 3R7FA 5G1PA 1EP9A 3R7DA 1TTHA 1ACMA 1R0CA 9ATCA 3NPMA 3D7SA 2A0FA 2G7MC 3AT1A 1ZA1A 2HSEA 3GRFA 2BE7A 4KGVA 4BJHB 1A1SA 1XJWA 4A8HA 2IPOA 2QG9A 3L04A 4FYWA 3D6NB 1RABA 3L02A 3R7LA 4AT1A 6AT1A 1RAEA 3CSUA 1JS1X 4IV5A 2I6UA 4JHXA 1NBEA 2QGFA 1PVVA 1RAHA 4FYXA 3TXXA 1RAFA 3KZNA 4JFRA 3Q98A 1TUGA 4KH0A 4EKNB 1RAIA 4F2GA 3M4JA 3GD5A 5G1NA 4ANFA 2H3EA 1EZZA 4JQOA 1R0BA 8ATCA 3MPUA 3LXMA 1DUVG 1PG5A 4A8TA 4KGZA 3KZOA 3L05A 3TPFA 2EF0A 4KGXA 3M5DA 1RAAA 5G1OA 2FZKA 1EKXA 1ML4A 1RACA 2W37A 5AT1A 1C9YA 1RADA 1AT1A
chains in the Genus database with same CATH superfamily
2YINC 4RHFA 4DDHA 2D1TA 4Z86A 1OD6A 1E9SA 3W9YA 2FUEA 4R51A 3ENWA 1DL5A 2FAXA 5KVAA 2GFHA 2Q29A 3PTLA 5I7AA 1QDUA 3SZOA 3FHCB 2BE9A 3G2KA 1K68A 2Q5CA 3QOFA 4LXXA 5E0KB 2VPTA 3MJ4A 2QYTA 2NN3C 4YT4A 4G1FA 4LJRA 2JGDA 4ZOEA 1A2BA 3VC2A 4ZU1X 5J9FA 3TUZC 1FK8A 2A86A 3DR3A 4E2ZA 3ICEA 4D25A 3ZHCA 3G8BA 4MVJE 4B71A 1H69A 3TSZA 4BFXA 1NBAA 5EHIA 2IOFA 4BNYA 2F48A 3V2GA 4MB6A 2H8KA 3H0EA 4G5QA 3WIUA 4G5GA 4AM8A 1YXMA 4R1UA 3NTUA 2BEWA 2AFIB 3STHA 1Q95A 3AXTA 4OH7A 1NJ6A 3EGEA 2XCLA 3BL5A 4GI5A 1RMTA 4UOZA 2PUWA 3SY8A 4N49A 4XVHA 2IHJA 4I50B 5DM2A 1NLFA 4TMYA 3UT5A 5H68A 3TF5A 1Q0RA 3G88A 4O2BA 1BVRA 1JHVA 4KXWA 3C97A 4HXFB 3H7IA 1B93A 1G3QA 4KOEC 3IEMA 5DNYB 1FJGB 4ZEOA 3HM9A 5H4HA 1XWFA 1FLVA 4LRYA 3SDZA 4Z1OA 4F7DA 2AC2A 2AEEA 2GNOA 4JXJA 4HGQA 4EG8A 5KTTA 1FOEB 1OSNA 2P69A 3KOMA 4GSLA 4M9XA 4JJ8A 4BO6A 5C4MA 3UAGA 1M2FA 1NI5A 1RPNA 2DZDA 2HQOA 3BQMB 4NJEB 5D3KA 3NXKA 5FOVA 1K6IA 1OLSB 1NVWQ 1FFXB 8GPBA 3PC3A 2H5IA 4I9FA 2IXDA 3OPYB 1V9SA 3MVEA 2D74A 2OA0A 2QM8A 1WEKA 3L9XA 1AS0A 1KARA 2FW8A 5B58T 2Y1OA 1NMYA 1JBEA 4M98A 1UT8A 1L5YA 1OFUX 1NNSA 2YN0A 1V7QA 4J1TA 2O2ZA 5SV2A 3LHIA 1JYEA 3BHMA 3MXOA 2GN9A 4TRJA 1MUUA 1NPYA 1FZQA 3ZC3A 3KYIB 2GD1O 3CSUA 3HWX1 4KRXA 1QJCA 2P3LA 2XZTA 3LU1A 2OV8A 2Q1SA 1WE2A 5K9ZA 1G4UR 3QPBA 3NWBA 3RS5A 4DDWA 3AVOA 3LXXA 4QYIA 5BUSA 1RZRA 5FPTA 2QPTA 2VXBA 2ZIGA 5JBIA 3OIWA 2QNRA 3SM3A 4FX2A 4XA8A 2BTEA 1FP1D 5D87A 3DL4A 3WA6A 3QSYA 4ZMSA 2BFDA 1UMKA 3KPUA 1KK2A 1ZH0A 2XUIA 2GEUA 4IDFA 5KU1A 3OO1A 3AL2A 4LKRA 5E4JA 1YS9A 2HKIA 3TRKA 4U8GA 3DV0B 1Z18A 1E20A 4F11A 1Z3IX 2I66A 1U3WA 2XZDA 3EEQA 2ESRA 2B5WA 4FILA 1XZPA 3SGLA 1RBZA 3IPCA 4Q4AA 1IUKA 2E9SA 4G09A 1MHPA 5CB4B 4YAUA 5CIQA 1RI5A 3DKVA 4XJXA 2YRXA 5DHAA 1I6WA 3LW7A 4HVLA 3ZDCA 3RRFA 3IPLA 1AGPA 1E2HA 1JT9A 2XUFA 3E3AA 3INRA 4Q12A 5FL7D 5CG1A 2R6DA 3SIXA 4HLQB 4HDSB 1MB4A 1EXMA 1V1MA 2DSNA 4X54A 5FIUA 3K94A 3R5SA 4OHRA 4U2DA 1R8SA 3BWBA 5DGTA 1ZO8A 3OHSX 1CXZA 1AKYA 3O0TA 2YL2A 1EBBA 1PS9A 2I7XA 2ORWA 1W47A 3IELA 1QOZA 2XMCA 4E5NA 4OJKA 2EXXA 3RE1A 3H9QA 3ILVA 3TAXA 1X42A 3JQQA 2CSUA 4CGZA 4NS4A 5TGTA 2OECA 3UWMA 3G2HA 4NF2A 2Q9UA 4KQKA 1S9DA 1FJXA 3AOGA 2JFHA 2TS1A 5TS2A 1SBCA 1SMKA 4JDUA 2IITA 4LMBA 3NZEA 3DJFA 4BN0A 1I7PA 1XEXB 3K2EA 1ICEA 4ZK2A 1K98A 1FTSA 1X8JA 2YFYA 3LHFA 5FRDA 3W6OA 3CLTC 3D8BA 1B3RA 4A91A 3C8UA 3I9OA 2WSLA 2A58A 3DVQX 1ML3A 1OREA 1YQQA 4RD3A 2YNMC 3AEZA 3I53A 4ZQBA 3E1SA 4QPDA 5IT5A 4DM7A 3PX7A 1MEOA 2XOKA 1H6BA 3IS3A 4B6FA 2IBTA 4B84A 4NXNB 3KQQA 4YUAA 4P84A 2FMFA 4M0KA 2NYAA 4DR6B 3ON5A 1PNTA 2HK7A 2AZDA 3AERA 1EP9A 4YV1A 1M2GA 2DAPA 3AHGA 4Y2HA 5CT4A 4YJDA 5A4MS 5E6SB 3MQ4A 4J9UE 5AVVA 3ASZA 3QWFA 1V11A 3K9CA 2MSKA 3P9IA 1CJSA 4K0RA 3ZE6A 3N3BC 5FPKA 5CURA 3R5TA 2R3SA 4NNJA 3B52X 4OK5A 3TEMA 3MBKA 1SCUA 5MGNA 1R4AA 4W9NA 1E3QA 4F2DA 1QHEA 1T5IA 3DDWA 3R7BA 5B2EA 5KI6A 2REOA 2XBLA 4K1LA 5IC6A 3SMVA 2CVPA 2EW2A 2NSYA 2G36A 1RU3A 1ZINA 3HLYA 3RS9A 4BS9A 4R7GA 4YROA 1J0CA 2AG5A 3LPMA 4KQIA 4LZPA 1QP0A 1EP1B 2ATVA 3LFHA 5FLEX 4A9AA 4EW6A 3EIEA 3FLAA 3BIXA 1K3TA 2I6QA 3NIDB 2I22A 4TM7A 4BHTA 4B3FX 4C07A 3IBYA 1PL7A 1RKBA 2BFBB 4KQXA 3TGPA 3M4ZA 2X40A 4KQ6A 3KQPA 2WJIA 3D0OA 1XO1A 2YJ5A 5AIAA 1QKKA 1YBAA 3H17A 3I6QA 2OGTA 2YJZA 1TAQA 2JH3A 3PG5A 4HEA6 3UAZA 3S5UA 2UYGA 5AKIA 1J2JA 1I10A 3C1OA 1GGEA 3SNKA 3AY0A 3AUJB 5CDGA 1SVKA 1T9GR 3D59A 4XWTA 5BQ5A 1W85A 4DRXB 3GZJA 2CLLB 1HL7A 3EDOA 3NR2A 3ORFA 3R3UA 5B7GA 2COKA 2WKWA 3S8YA 5D1HA 1UDAA 2EQAA 4FINA 4CIWA 4AURA 4R68A 2PX5A 3IO5A 3RAFC 2FZKA 1NSYA 4OP3A 2Q6IA 5L6LB 1FDTA 1V3TA 3LNCA 2DHQA 2C7PA 3Q7PA 3BMOA 1C14A 1JF8A 2IZ7A 4BNJA 2C5GA 1UFRA 1XCPA 1GPBA 1S8FA 1KAOA 1SQSA 1PKEA 5DRYA 1XZJA 5TPZA 3RU3A 4DV7B 2WG2A 2W6CX 4RF2A 1R66A 3D0QA 2PS3A 3F6PA 4RQUA 4XFJA 3T5TA 3F74A 4M4SA 4D9EA 1XAIA 2GOYA 2EJBA 2R6JA 3RVPA 2IYZA 1LBIA 2LDXA 2EBHX 2O0MA 4P35A 4PW0A 2NG1A 2ZIZA 4HUJA 3TTYA 3UAVA 1MVOA 2PLFA 1FFEA 2ZI7A 4HDRB 1OGIA 2Q8NA 2P9CA 4ARSA 1B2LA 4OHKA 1AJEA 3QA3E 4J91A 2OUIA 1J0EA 1SUPA 1C1YA 2EV9A 2W2VA 2WHRA 2GAFA 3NVDA 2C2ZA 1VMDA 4M22A 3PVZA 4BCBA 3AF3A 3RUCA 3VHLB 4LQ4A 3WO0A 2W4MA 4EFMA 4NCAA 2IIVA 2DU8A 3TEJA 4MW5A 3O4HA 1D8AA 2VUSA 4H1WA 3EQ7A 4B3TB 1AKRA 3GPIA 3U5TA 3ZKWA 4BLOA 3GEIA 5DMHA 1DMRA 3DD5A 5IBPA 3QFHA 4CU5A 1SCKA 1T3GA 2RHHA 3A4TA 4UUMA 3O2SB 3ROMA 1JH9A 3USES 3BRSA 5L7WA 1GEGA 2IYPA 3WRXA 3DLPX 2CHEA 3JCZA 4RNDB 1DKRA 2JGDB 1YRBA 5AW6A 1Q20A 4LJ5A 1HLGA 2JJ1D 1INLA 1B76A 1P5ZB 4GWKA 4I5EA 2GPYA 2PQ2A 2H7YA 3QNUA 4GSYA 4PC7A 4F04A 2AOXA 2J3MA 1QZXA 2OBBA 3DC7A 5DOVA 4CM9A 1TVCA 3CH6A 2Q45A 3EZLA 4R05A 4ZGBA 1GGHA 1I0ZA 5DJ5A 2QRKA 1U7TA 4MI9A 1ECPA 2HHCA 1J6UA 4MICA 1E79D 1F8XA 2BEWB 3CMCO 1JE1A 2QIOA 5FBVB 4U3JA 5IXJA 5GZ1A 3W7AA 4L5YA 2WYOA 4P2GA 5CDFE 3Q0EA 1JSRA 3QLTA 5AESA 1WSDA 1ZLYA 2QW0X 2WR8A 5A1TA 3R9IA 1ARZA 2A1TS 3ESCA 5KCMA 4CQLA 5K0JA 1B7GO 3UT5B 1RRFA 3MEQA 3WBKA 1KNXA 1KYYA 1YQGA 1LC0A 1TU4A 2HDHA 5JSQA 2BTQA 4PZ0A 1R88A 1N0HA 1N0UA 1ZXLA 2WWYA 3CSDA 1P2TA 1P2DA 4M53A 1N2CA 2BKEA 4CV3A 4BEJA 1GPUA 2EERA 3CSSA 5AM2A 5GOZA 1VECA 1YJXA 3I2KA 3K8YA 1NASA 4BCCA 1WV1A 3A6PC 4W99A 2HRBA 4YWJA 5CK4A 1UR5A 5EGSA 1XHEA 2N1BA 1NMZA 1X1SA 4W5NA 2OXFA 4RHYA 3IAHA 4ZCIA 4ETIA 4RAOA 2WTMA 3P19A 4IZHA 3HK2A 3Q88A 5DCYA 1YZ3A 3UNXA 1VCMA 3N2IA 1JJIA 3M4YA 4ND1A 4NZYA 3U4GA 4GKJB 1G42A 2CVHA 2OVFA 4WEOA 4DBLC 3WGTA 2CLIB 3N75A 2UZAA 2YQ5A 1KEUA 4MV0A 2BMFA 3RVBA 3W5JA 1WOYA 2IDMA 2F9LA 2Q3DA 1FTWA 1VSTA 2XDQA 2YHIA 4BOYA 4IIJF 3OF3A 1Q3TA 1XA4A 3S40A 5KNLA 1Y89A 4Y2UA 5J40A 1PCXA 4PN7A 3ZNQA 2AJCA 5I4IA 2ADFA 2ZQZA 4NCXA 3TFOA 3B6JA 2P11A 2W37A 5EAIA 3GA5A 2QP3A 3FTEA 1NSFA 4D6YA 2YWHA 2VQ6A 2QRLA 2XNJA 1P8JA 3RJZA 5A71A 3SM9A 3THSA 1D2EA 3SVLA 4LVCA 1KI1A 4OKSA 4HV4A 2DWPA 2PL3A 4M86A 2Z8ZA 3T4XA 5J2TB 2J7PD 3HRIA 3L0OA 3VR4H 1L2TA 4DKJA 4AG5A 1OA0A 1T9CA 2D00A 2A84A 2FLKA 2C82A 3BTSA 3MLEA 1TQ8A 1CLEA 4UVEA 2BFDB 1GNRA 3LWZA 4QLBA 4MAAA 1YS1X 4YAIA 4J6EA 4BAGA 2OHIA 4MGHA 4HGOA 2FR1A 2B8NA 4CGYA 3RYIA 1DE0A 1TKBA 1XLTA 5M2QA 1WDKA 3E2IA 1YDEA 3VR3A 3V4SA 1VKHA 1P0CA 1SCNE 4UHKA 1IG3A 4HEJA 3AW8A 5EJ8A 2QRNA 1M83A 2Y92A 1NPTO 1V0JA 3GT0A 4ZOCA 4QICA 3FVWA 3MPOA 3KTOA 3AKZA 4I50F 4M8KA 4MPDA 5LBUA 4D4HA 1QIMA 1XPJA 1QF7A 2PA0A 4YRPA 5BN1A 3HP1A 3W4IA 1Y9AA 1WZNA 2F59A 2P67A 5B6IA 2I8AA 2FKAA 1ECCA 3QLEA 4UBLA 4EEKA 1T1GA 5DEIA 1P3DA 3D64A 1OV4A 4BJ6A 3OIGA 5FWYA 3TECE 3VR6A 4DQDA 1OAOA 2Z8YM 3FTPA 4IXNA 1ONPA 4W7SA 1YU9A 5DYIA 2Q2OA 4XQGA 2ATXA 1COZA 1TX4B 1FDIA 2ASVA 3PC4A 4HZIA 1M1YA 2XV1A 4MV5A 4DY6A 2LIPA 3KZXA 2H3HA 2QS9A 2QQGA 2XVYA 2OM6A 2ZYUX 3LUJA 4KDCA 4WINA 1TEHA 1Q2UA 3EIUA 3QFCA 4FHZA 4UNSA 2WAOA 1NJSA 1Z9BA 4ZPJA 2IPLA 2HQSA 1J8QA 1G291 2B4RO 2QZJA 2ZITA 3CNOA 2OBFA 3I12A 3NEYA 4IV0A 4Q03A 3VZSA 1ORRA 1OFIA 2WUDA 1W30A 2WW8A 3B6EA 1DMSA 1ZM3A 1F4LA 1TFUA 3ITNA 3NTLA 1CVRA 1YQ9A 2WF6A 4LG1A 1Y4AE 4YJKA 1E4EA 4CIVA 1U2EA 2VQFB 3DE2X 2BFEB 1O8BA 4C7BA 2WD9A 2QR2A 4DQKA 1ZJYA 1E5DA 5KAPA 4H4DA 3FF4A 1AURA 4X60A 2V6GA 1WMDA 1XMIA 2R66A 3ELBA 2X13A 4W5QA 3TLBA 3EPRA 1SUDA 5ITVA 3F2VA 3L8MA 4OXNA 4ECEA 4C5BA 2CNOA 1TKCA 4G4SO 3UMYA 2GPTA 3AERB 3QWAA 5DHTA 4OHXA 4PZDA 2G77B 3UO8B 2XY4A 3LVRE 2QROA 2I54A 3ADKA 2AXEA 2VHZA 3R6DA 3H13A 1EUDB 2G76A 3OQVA 2VAPA 1V11B 1X1TA 3NCTA 3EG9B 4FDAA 4L7VA 5FORA 1OWLA 2D1RA 3PUXA 1NW8A 1PJTA 1ISFA 2XMRA 2GAIA 4Q3EA 2QGNA 4RF4A 1SCUB 1RR6A 3FUUA 4A8TA 2A5GA 4TQ9A 4D45A 2W2NA 1O58A 1AKUA 1D6NA 2VT7A 3FRHA 3COJA 1ZD3A 4QXRA 3RREA 5CEJA 5A62A 2JI4A 3RC1A 3ITDA 5CB4F 1GY8A 3I34X 3AFGA 3ZD9A 1QF6A 3IR7A 4QFCA 1BN6A 4KE8A 2BJWA 3EGVA 3ZK8A 2Z43A 1UXIA 4RADA 3ZY4A 4EGAA 5ICGA 2YZMA 3MZ0A 3U3JA 4RGBA 3WZ2A 5TLSA 4LOLA 1U2DA 4MTCA 3VHRA 1YZYA 2YFHA 3K2IA 5JNVA 3F5FA 3BFKA 5KWJA 1KVUA 4CCSA 2DBYA 1R15A 3N0VA 3OVMA 3RTAA 4JC5A 4DFDA 1RYDA 2GCGA 1NG1A 5EHNA 1KZ1A 2FUG1 4V0NA 4A0QA 1V5GA 1T15A 2DPGA 2YHAA 3WWOA 3L07A 5GV8A 1IBSA 2QX6A 4L8WB 3EW7A 4JNKA 2XUAA 3JS5A 1JEJA 1OTHA 2AGVA 2YX1A 1W25A 4N03A 3TQRA 3ZLBA 1W85B 3CF0A 4NMWA 2OXCA 4Z8YA 5HF8A 3C70A 1WA5A 4BX9A 1BMTA 3I1IA 4QQRA 4B6PA 1TJ3A 4OQMA 4WKCA 3A1SA 2ZI4A 4FEGA 3Q3JB 2WIJA 2OXEA 3IJPA 4Y3UA 3UMCA 2W58A 2NUBA 3VR5H 2B78A 4RJ2A 2LPMA 1UBFA 3GU3A 3T35A 3SZMA 5LVAA 3ASVA 4I1YA 4XM2A 5KNCH 3U0VA 3NBKA 1F1BA 3MJRA 1GNSA 3G2LA 3F46A 1EU1A 3KLOA 4UVHA 1MX3A 4GOXA 4D9MA 5AJWA 1SHLA 5L3SA 2J48A 2YBEA 3L6UA 4MV1A 2DHEA 4WD3A 3ZYCA 4V0QA 4DNXA 1HV8A 3F3YA 5K6AC 2ON6A 1I36A 1OA1A 3USZA 3QW2A 3HVHA 3B60A 4LYEA 3OC6A 2VAXA 3JYNA 2WSMA 5I9IA 4DJDC 1QH8A 5BWNA 1E9BA 5KTNA 2VYQA 4E12A 1ENPA 5E0OA 3F78A 2YMQA 3GGOA 3IRUA 2A0WA 4PHFA 2DQYA 5JBNA 2ZIFA 2P35A 2ZE6A 1A27A 4JJ7A 1BAPA 3UJ8A 1M34A 1GN8A 1ZITA 1XCBA 4ARIA 5JJIA 3CRNA 4BNNA 1QHSA 3IKMB 4C2AA 4PBRA 2G1AA 5EOVA 5K8TA 2BDTA 5KSWB 4S12A 2Q9BA 2PL5A 2ZZNA 2IOYA 2PR7A 4C5CA 4BX2A 3WK7A 1U8YA 3FMPB 4OHYA 4J90A 4ZVUA 2OHOA 4ZVNA 4E5SA 1Q16A 3ZKWB 2BGWA 4L9AA 5DW0A 1KEWA 6AT1A 3IHKA 1RM4A 4IDAA 3GFFA 5AYVA 2J0VA 1A9OA 2QI9C 1P1IA 1P39A 3FD8A 4X6YA 3U2QA 3QKUA 5LWHA 2P90A 3UTCA 4F3KA 1HNWB 1PX2A 4G41A 4OATA 4QYTA 1W76A 1NT4A 4GMDA 4QLAA 3SZRA 4URUR 1N8TA 3ESYA 1D2GA 1AUPA 2G5TA 2WABA 2HQBA 2WJVA 3DBHA 4HZUA 4ND7A 5IEJA 1HX7A 2R6HA 3C4JA 1L5ZA 1PSZA 3RIYA 4UTPA 1P1RA 2FLWA 4WNCA 3QUCA 4PLFA 1YR2A 1CW2B 1YZVA 3AC0A 3IMCA 4MKHA 4RE5A 4MS4A 4U3JB 3RIMA 1H8HD 2FWAA 2J45A 2P62A 3HWRA 1RLTA 2QGZA 4LVOA 3U61B 1EJ0A 1L3BA 3VAAA 2RB5A 4CQLB 1B73A 2V7GA 3LOUA 2G4LA 4CEJB 1PT6A 1Z2DA 2B1RA 2BTQB 3CPHA 2HPAA 4U1RA 5IM5A 1N5LA 1PJLA 1TIPA 2PY6A 1Q0PA 2GO7A 2VRNA 1N2CB 2WHEA 3CLHA 2QAIA 1M8GA 3I4CA 1TMOA 3LQ4A 4QXMA 4XDGA 5AKHA 3QYPA 3NXSA 4B35A 1G5RA 1P6UA 3IE0A 5DH9A 1UJCA 4D8XA 1T2FA 4X24A 1ZC4A 3MSXA 5CW2A 1GL3A 1TQ4A 2ORED 3DAOA 3A4NA 3WC4A 4U7JA 4N41A 1EBFA 4PAOA 1AF7A 1KETA 1YQWA 4JQYA 4BNLA 1GZ6A 1SD5A 4K9QA 7AT1A 1E0SA 4GNKA 2XGJA 5IK2A 3I9NA 2XVAA 3GHHA 3VC3A 1TZBA 1NHGA 2L17A 1K6EA 3GELA 3LTNC 2PMBA 2HUPA 1PJBA 1WIWA 1KEPA 5CH5A 5AR1A 1H2WA 1PEKE 1SKMA 2NVOA 5BPHA 4HQOA 4QQFA 1V45E 4HEHA 3K1AA 4BVAA 4GICA 2CK3D 5AXAA 3PF9A 1L1RA 1XVUA 3TB6A 4Y7CA 2YHIB 1F8GA 3WDKA 1UPCA 2WFZA 4Y98A 5ILGA 4B8YA 3EVGA 4DDTA 2QB5A 2NPOA 2G4CA 2NNLD 2H1VA 3HM2A 2KLBA 5TR9A 3ZXYA 2WKPA 3KQTA 1RZVA 3B5IA 2EX4A 2BZSA 1E2NA 4BNFA 3BIJA 4WUTA 1AN9A 2I0FA 3TTTA 2OHVA 1T6YA 3A14A 2PV0A 4QECA 2QTZA 3I4LA 1YUMA 4FIZA 4NV1A 4N8DA 3PX2A 1WZ2A 3EGDA 2NZ8A 4UBMA 3DXXA 5AFSA 2JFYA 3WMWA 3B1FA 4BFVA 1L8XA 2Q2WA 5HTKA 1MU0A 4A7PA 2Z98A 2O7NA 1XPUA 4ZQIA 1OIVA 4DG5A 2B7CA 2ZSAA 2WIGA 5K4HA 1WY5A 1CJUC 2ATIA 2YVQA 3EZ7A 4P82A 3RYIB 3QF7A 5TJHA 2IYVA 4EG4A 4J43A 4Q7QA 2J9XB 2O3RA 1G5IA 3QOYA 1KBZA 2ZUDA 2G7MC 3SU8A 3NHMA 3GEMA 3G0OA 4XUCA 1Q0UA 5JZOA 1IB0A 3NEJA 5I8PA 4A23A 1Y5NA 3KOYA 3LUHA 4H7EA 3T3GA 1WVMA 3GPDG 4IDOA 2YHBA 4D98A 4S2EA 1RMYA 2YYZA 1GUDA 2IHBA 4YVFA 3D8RA 2HMSA 2HA5A 2BFOA 4XUGB 3BN3A 1KR2A 5KVVA 1MDFA 2DFKB 2OD2A 3DZJA 3N9IA 4TVKA 1ZXBA 4LNAA 1L5KA 4XSGA 3AR2A 1X39A 1B74A 1BGWA 1ZIOA 2WI8A 2Y0EA 3AR8A 4ZYZA 5HHTA 4QPPA 1NF8A 1N6OA 5AI5A 2I80A 4X6UA 1RAHA 1A7AA 4HKTA 2ZYSA 4ZHQF 3TMAA 2QMEA 5FWYB 1RD4A 1IY2A 3QG5A 4OB7A 5FQNA 13PKA 4E3WA 4P98A 2C07A 1BN7A 3H2BA 3KLNA 1GWNA 3NC1C 4X3OA 3NDBB 3PKIA 4XEUA 1KMQA 1M1YB 3FH0A 1Z88A 1R16A 3U1BA 4TRNA 3W3AA 4LNUA 4MYUA 3K70C 2R2GA 1E4OA 2PA3A 1E5TA 1NBOA 3HCWA 4D0LB 3FFBA 2GQ0A 4PLYA 5ALVA 3C5VA 1X7YA 3JRXA 3PTZA 1EWQA 1SUEA 5CXUA 5ITZA 3M49A 2G5PA 1OUMA 4EA7A 3CUTA 1UJ2A 5ITSA 1YCFA 2L18A 5DYWA 3IMKA 1SBYA 5LLSA 3TSAA 1W9HA 3R0IA 4C6HA 4PFKA 3U7EB 1PZXA 1RRGA 2HMAA 3EAFA 3DF7A 1CR2A 5K0EA 1M7BA 3CLVA 1V16A 2FW6A 5FAXA 3HVKA 4UW9A 1WHTA 4H17A 5A3QA 5G02A 1EDZA 1PJ2A 1Y5IA 5J2TF 3YASA 3K53A 1R00A 2PIAA 2YWJA 4EHKA 3TGLA 4C4OA 1IE3A 2XB6A 1RKVA 2H8GA 3IDFA 4Q21A 4JB3A 1ZUIA 1WDTA 3OESA 4OK6A 4ZAZA 3SS9X 2JLAA 5FOWA 3B38A 2O19A 1UKAA 4K8RB 3PXDA 2FZ5A 2FRDA 3I04A 4IQFA 4M99A 4PONA 4ZXPA 2REBA 5KKAA 4DZRA 3MBOA 4WSOA 4BATA 1X7HA 2P2GA 1LNSA 2QVLA 4D57A 2XAAA 3GIDA 3R6TA 3OLWA 1YRHA 3HXOA 1DWUA 4ZC8A 2AFIE 2DR3A 2ENWA 1NYQA 1GNTA 3JVDA 2RGNC 3T4EA 2FZLA 3M70A 4Z7JA 5B1YA 3ZDDA 1I1NA 4H7PA 3RF6A 5G40A 4DAEA 1XZLA 1HMPA 2AJLI 4BB5A 5JU6A 3L0CA 3QUTA 1EFUA 2K87A 4FLEA 3NIWA 4DEYA 3DFMA 3R7WB 1R0KA 4M9QA 4NARA 1FMJA 2HIMA 2YJTD 2ZQYA 3ZNPA 1ISSA 2GZSA 5B4UA 4LXYA 5KYNA 3OTIA 2RB4A 4B79A 4DBLE 5JSZA 2DPHA 5BWMA 3BWCA 1F1JA 2GK3A 5A5DA 3NNSA 1HTTA 3GDGA 1P1FA 3W6NA 5K3OA 2VF2A 2YXBA 3CS3A 4LI0A 4Y8VA 4ZYWA 2BCEA 2X3YA 4N5DA 1OZGA 4R01A 3BHJA 3W4KA 2WT8A 5A3JA 1OH8A 3RSCA 2I87A 2JIBA 2UXBB 3RPEA 2IE8A 4IGKA 4U0JA 1MW8X 4R1MA 4NK5A 2BW0A 5JTUA 1E89A 2H11A 3EW9A 1PQUA 5JSUA 2FN9A 4OUKX 1E6CA 1HQYE 4W9RA 3AUFA 2FV8A 1ULZA 2XF8A 4P3NA 1P6QA 4TXHA 3TW8A 3ZWMA 4TLBA 3TZKA 3ZW9A 5AK0A 1G60A 5L3SB 1I1OA 1U8UA 3BBPA 3OC0A 1G16A 2XSZD 1G38A 1S2GA 2FQQA 1KI2A 2MJLA 3DBIA 3F8WA 1VTKA 2H4JA 4EX7A 5B6PA 1K4YA 3N07A 1TZMA 5JADA 1CZKA 1NVAA 1EVKA 1G17A 1QH8B 5F78A 4C05A 1K6XA 2BZ1A 3FSGD 1GU1A 2IWRA 2XWJI 4Z7NB 1JQAA 1WF6A 4FJ0A 1DAHA 2CDCA 1M34B 5ITWA 2LVBA 3ZDAA 3H0KA 4RO0A 1AZWA 1UODA 4XVRA 3TPZA 5CA1F 1KFEB 5AXDA 2CNKA 1DCFA 1KH3A 4WNAA 1ODCA 3WIDA 5BY2A 1ULBA 2QUZA 2X8LA 4KYTA 1KXZA 4QAJA 5EIBD 5KSPA 2ZE7A 4HMQA 4IL5A 3V9AA 4CYMA 2HBQA 2E5FA 4X00A 5KCZA 3T5GA 2B82A 2OESA 4R0VA 3VSEA 4AF7A 1AKQA 1NUAA 5CYGA 3CW8X 1DAFA 2B5VA 4R1NA 4B31A 3BJEA 4LJYA 3U0BA 4JV5B 3KXPA 1FX0A 1YQDA 4HDMA 2QVZX 2YHSA 4A2PA 4DF3A 1Z6ZA 4M1TA 1JDZA 3JQGA 4G1VA 5EXPA 2I99A 3MS7A 1DAOA 4D43A 1T8TA 4H31A 3RANA 1XDWA 1BTOA 2LKDA 4P80A 4A2WA 2ERCA 3F6CA 2WTUA 1DEXA 1TPZA 2VUIB 1NUHA 2FE1A 3H5WA 4GYKA 3K1ZA 5K51A 3H6GA 5JIBA 4DV3B 3VSDA 1HM5A 3DEZA 4PX5A 4UVGA 3NHPA 1XCMA 1U7DA 1Y8QA 2PCLA 2XD4A 4PFSA 2KPOA 4RCYA 4TKLA 1Z38A 3OZCA 2XBMA 2I4OA 3KC2A 2EJWA 1WABA 3M6VA 3JPYA 2FDRA 1T3LA 1PHRA 1C1DB 1JIUA 4JEUA 3Q3EA 4AWBA 1N5MA 8AT1A 3OOWA 3PCTA 3U44B 1DCTA 1HC7A 1Z0KA 3P2KA 4GECA 4PYMA 5AH0A 3WI7A 3WNZA 4D4LA 4Y6LA 4YALA 5GAJA 3OHPA 1ZM4A 1J22A 3UJDA 5KWVA 4RXMA 4GUDA 3IA2A 2JIOA 4EGJA 1P3JA 1XVIA 1CBUA 2PEZA 1LU9A 4NBKA 1UAAA 4RDXA 5FUXA 3G89A 5EUCA 2ZWPA 4QNMA 3P1JA 1RAGA 5BNFA 1KTVA 2D0DA 2H1CA 3DV9A 3PC7A 3RS7A 1M2VA 5I7OA 4QE3A 2ZWVA 2NUAA 1Y7HA 4MNTA 5IH7A 4NOKA 4U6SA 4FBMA 1O97C 4MVJM 3ND6A 2Q6VA 3GT7A 4N0PA 4KXUA 5HP4A 4V0KA 5JEEA 2V58A 3CXUA 5K4AA 1OB5A 2XWBF 3K1AB 4B6QA 4CM5A 1DGQA 4TXLA 5ALQA 4Q1EA 4KFRA 1O1YA 1PDVA 3W7BA 4LFBB 3LY8A 2HDNB 2X1LA 4QARA 3S2ZA 1BOOA 5ALHA 1QQAA 1FL9A 3Q9UA 2IGBA 3FTFA 4MUAA 1JHXA 3T5BA 1JFVA 2EBUA 1YA8A 2LIVA 1EHIA 4LRXA 4R3UC 1R6DA 3FUVA 4PZPA 3PXUA 3HYRA 2GRAA 1IWBB 2WKQA 1ZNXA 1UL1X 3OQ6A 5CEEA 4JLKA 1X8KA 3IEIA 4IOLA 1GDHA 3RRNA 1JDUA 3GYGA 4UVIA 1VJ1A 4FFMA 5MGBA 2Z04A 4DDVA 3EGDB 1IZ7A 5LLTA 4PEVA 3NHZA 3VQTA 4MRSA 1Z4JA 1R4MB 2W2QA 4L08A 1GR1A 2Q62A 2O7QA 4HNHA 3A36A 2VF5X 4JFRA 2GEVA 1UDCA 5IPFA 4N5IX 2B35A 3RHZA 3TAUA 3GWGA 1JYFA 4OIFA 3RUPA 2VHWA 4M0PA 1VB3A 3K6JA 1HETA 5DWVA 1ZMOA 2GBLA 3FCEA 2HMWA 2ZTUA 4RK6A 1DBSA 2RH9B 3PNMA 1MRSA 3PZRA 4FHFA 1BWSA 1XNGA 2B94A 4XRRA 5DTQA 2PZKA 2P4HX 3TOZA 4CKYA 3NW9A 1DKMA 4NENA 3STVA 4FP9A 1XLTC 1LBQA 3H3JA 4IX1A 4QGFA 2WY2D 1FLNA 1V25A 1P74A 3I76A 4A5SA 4B7ZA 4D92A 5C8ZA 3DAGA 4MWGA 4A36A 2GB4A 4BNDA 4X66B 2V7EA 2VNSA 3SFTA 3O38A 2P8SA 3ELUA 3F6EX 2IZ0A 3PYLA 2YW2A 4N1AA 3TIXB 4EW1A 1XVLA 1T2EA 3QJYA 1OW3B 3WJAA 4J16A 4D96A 2VYND 4K3UA 4MIEA 4HQRA 1U31A 1DC8A 5DOZA 1X1QA 4TS9A 3T61A 5JRJA 4I3HA 5ALMA 2OCXA 2X0FA 2B4TO 3PEYA 4AJOA 4AWXA 4G25A 1M6HA 5EFOA 3QFFA 3EB9A 4LC9A 1PFYA 2QTHA 4Q24A 3KELA 4HWSA 1V5IA 4LNUB 3V1YA 1OOEA 5I51A 3FNIA 1JVNA 3KD3A 2OP1A 1L3CA 3NAQA 1DRWA 2PO5A 3OETA 3P9QA 5CBKA 1DXHA 1KAHA 3C3XA 3UFBA 5ITZB 2QTNA 1PUJA 1U4OA 3ZD7A 1UIRA 2ZW9A 3CVJA 4IIYA 2WHQA 3WL4A 4CTOA 2ATCA 3GH3A 3SZLA 3GLGA 221PA 3I83A 4MP8A 4DSUA 2NQ2C 1DIAA 2Q99A 2ZUFA 2C9ZA 4DNFA 5CLHA 1Z4PX 1O7JA 3IUMA 3SKXA 4EG1A 2AI3A 3DCJA 1OWPA 4HSGA 4Z9YA 2VH2A 2Q9CA 3RFVA 4C4AA 4DXDA 1KORA 2AG8A 1UCFA 5FTMA 1P2VA 1V16B 2WQZA 4H9GA 3CGGA 5FWXA 4WCFA 1NA5A 2XNCA 1WHTB 3WLHA 1HT1E 4AFNA 5B12A 2OQIA 3CNBA 3W4JA 3FHTA 3HJTA 2R11A 3K96A 2C5EA 1SZDA 4XGNA 4A26A 1XDSA 3SAJA 5BSGA 3BIOA 5JS8A 4J6FA 3RSSA 4DV1B 2QL9A 4NG4A 2FX3A 1DVRA 3INGA 2YVAA 3NORA 4EMTA 4GVXA 4H3KB 1VLZA 4MMZB 2X3UA 4NICA 1JSZA 3RU7A 1JEEA 1WCXA 2QK4A 1V35A 3HJBA 5J63A 4B3DA 4DCVA 3IQZA 2I91A 4IKOA 3A32A 4EMUA 1SC1A 4BLRA 3MMNA 4LFAB 3CLSC 2XQVA 4PM4A 5FFMA 4JYAB 2J4FA 3OX3A 3Q87B 1RZUA 2D5AA 4IOKA 4KXQA 5H59A 3SS8A 3AWIA 4AIIA 1TA9A 1HKUA 4C4RA 4RH3A 3X1MA 5B3AA 2QTBA 2HHAA 2BISA 2RIPA 3L7CA 4IM7A 1F2TA 1H0SA 3RU2A 4E3ZA 4WK2B 5FOTA 4EI2A 2DQSA 5IT4A 2UYCA 4NXMB 1MP0A 2WJYA 1QRRA 1E5QA 1FRNA 2VDPB 2YIVX 5D1NA 1HQCA 5L3VA 4C1NA 3GMSA 2H1FA 2X0RA 1K7SN 1XRSB 1QP8A 3IBSA 4MV9A 1YB2A 1U6IA 1JBQA 2QTRA 3I09A 1NXXA 3WFIA 1Z5NA 2GCPA 1C3EA 2HLDA 4LC0A 4XASA 5G2OA 2O8BA 4ZYVA 2C2WA 3VKFA 1PNVA 3KEGA 2DFTA 1FP4A 1I3CA 5JS2A 3M6FA 5BNTA 2P9HA 1U2DC 2XYGA 1UC9A 2H3EA 2GFQA 5F1KA 1BWRA 1WVIA 3DBVO 4QDUA 3H04A 5DVZA 1T29A 4LNHA 1GPYA 1ZNWA 2YHUA 1TKRA 3EXEB 1TYBE 4CLDA 1XI2A 4MKRA 4GZLA 1ZRNA 4IYJA 1E9RA 2WPDD 4IW3B 1D9ZA 2E85A 2RONA 3DBOB 2V96A 3K16A 4IICA 3IP8A 3F7TA 4QDKA 3QVTA 2FFJA 4LDJA 1XQXA 1YQEA 3J7TA 3TW8B 1BE6A 4BX8A 5CGQB 2QXUA 5C46F 5FOXA 1T0BA 1ZGHA 1X9IA 3EF3A 4QTZA 4BNHA 5CD9A 5B1IA 4OXRA 4HTFA 4TYQA 4I08A 1NVKA 2FRXA 1DWPA 1JQJC 2FQWA 4M83A 1E6UA 5KIAA 1RYNA 4X8LA 4K9PA 1TTTA 1GAXA 1OZFA 1YV9A 2B20A 4IPTA 4OLAA 1Y4ZA 3IFSA 3KJHA 5IG2A 3BWVA 3ZGXA 3I62A 1D09A 2Q5IA 3NI2A 1EX7A 2Q5QA 4PU0A 4EQ6A 2DUWA 4F4HA 4JSTA 3E1GA 4MK4A 2PV7A 2VDKB 5LSAA 5FYQA 3UWDA 3DEJA 1EGMB 1P3Y1 4KQ9A 3F6BX 1K7YA 3U9SA 3DLHA 3O82A 2V9CA 4AO6A 4RTQA 2HY7A 1U7UA 2XITA 3DZKA 4FNAA 4IH1A 3P97A 1USUA 1E3TA 4RFLA 5EERA 5FNZA 3TVDA 4OOEA 2ECPA 1XUOA 4H4CA 1YOBA 3NC4A 1AB6A 4XIIA 4DSZA 4I9NA 4MV4A 1U2ZA 3I2HA 1R5BA 4FQ7A 1QAMA 4J7AA 4PLPA 3IIJA 4TWRA 3VU0A 1KGSA 3WADA 4C14A 4AMYA 2DTDA 1FX0B 2C9BA 3FJ1A 5T3UA 3OCVA 1CSEE 1N9KA 5KNDA 3HA2A 1L0BA 3JQGB 4BZWA 3R4CA 3QVOA 3PLAE 2ZVQX 1NR7A 3GVPA 1E2MA 1U2RA 1WPRA 2FK7A 1CUIA 3OCUA 2AKEA 3KUDA 1J2YA 4DLBA 2CVZA 5D86A 1J00A 4IS2A 2QVXX 1Q0TA 2P9GA 3CX8A 3D4IA 4WLVA 1D9XA 1Y8QB 3QELA 4GOJA 2IYYA 1TVKA 5CYPA 1MRNA 4JOCA 4P7FA 1HTBA 4JEMA 1KO1A 1LLUA 1GUAA 2IEBA 2BM0A 2POCA 4BMCA 621PA 1L4LA 3FHLA 5EXTA 1KE1A 3REOA 4CQMA 4EBBA 3AYZB 3CE6A 4L73A 4I0WB 1IFXA 1FF9A 4AL4A 2HA2A 2P3OA 1Q21A 3IJRA 3B9RA 4B85A 3RHSA 1UT5A 5KOIA 2H18A 2C7OA 2FVXA 2Y3IA 4EX6A 3IHTA 5M7EA 4J7CA 2QN3A 3R8CA 5EINA 1J21A 3H1EA 3L04A 4NEGA 3PFHA 4NPCA 1WXWA 1ZUHA 2J5QA 5ECWA 2DJ5A 2EKZA 6ADHA 3GNQA 1NBEA 5LZ7A 1M2VB 5CFMA 3CBGA 3LI2A 4PF1A 1FQWA 5CRIA 2NUAB 3VX4A 3FDFA 4E1VA 4DWWA 4M1ZA 3BCHA 1U65A 2E5WA 3M3PA 3IPAA 3QEKA 4ZT2A 2B9VA 4MX8A 3G13A 1XEAA 1RAIA 4HVTA 4QD3A 5FWDA 3FGNA 3SFZA 4DYDA 4EB0A 5JHGB 2R1ZA 1E96A 2QWXA 2FMTA 3OLZA 5K0TA 1C0LA 2B37A 3H8SA 3KG2A 2VAVA 3DO5A 1CJMA 5LB2A 3WLNA 1HYQA 3A9TA 8ABPA 4DXAA 4J94A 1KOGA 4NNOA 1E3IA 4G89A 4LF5B 2TSYB 2VNAA 3EASA 5EMLA 1OI4A 3USCS 4ENUA 1FBTA 3ISVA 5G1OA 2JLCA 1U94A 3UK6A 4A1OA 5DNCA 2ZPAA 4P7BA 4NYMR 5E95A 1EXVA 1YB1A 4QTUB 2VTBA 1G66A 2W6JA 4IJVA 1EWYA 4OQ4A 1A72A 1P4AA 2WYVA 5KNCA 1Z0IA 3LUDA 4INJA 1RADA 1E1DA 2J0SA 3DAHA 4IDNA 3S2IA 2RKWA 3ZIAA 3CX4A 4PR0A 4UUAA 1XC7A 2JZCA 3REGA 3UXHA 1AV7A 1I4OA 3B5EA 2LP4Y 2R8YA 2CJYA 3R2JA 4DNPA 5E4FA 5KYKA 3E8XA 5EPEA 1UZMA 3NBQA 1NW9B 2H1OA 1P5FA 3GCGA 3NH9A 4LDNA 4MVJG 5JCXA 3IAEA 1MG0A 1OGJA 5FJIA 2QE7A 3FY4A 4YDQA 4P4NA 1UK7A 4QU8A 1R5JA 3DCIA 4DZZA 1KS9A 1VE9A 2QA5A 5P21A 3GRCA 5EJ9A 1ZHFA 5LQSA 3FMIA 3EC7A 1Y8RA 3A1UA 3PL5A 1UXJA 1S96A 4NENB 4OJMX 1P91A 1S4MA 3JARA 1XNJA 3UK7A 1Z4OA 1C0EA 4LWPA 2SNIE 3TSOA 5FDFA 4BNDB 2I6TA 2GHIA 3EYWA 3O9MA 2R5FA 1IY8A 4Y6SA 2QG6A 5KTYA 3ZDQA 1JHQA 1W75A 2REXB 3OA0A 1EJBA 1ONSA 2BGLA 5KWSA 5D3QA 2IZ5A 2XQGA 2ZQ5A 5KTKA 2I6FA 3KEMA 1QFYA 4PS0A 1CTQA 3EGCA 1K06A 4BJ5A 4CM1A 4TUYB 1QIJA 1KE2A 2HA7A 1KJNA 3NKVA 4LA4A 1E3EA 1FY2A 5FV7A 5JQWA 5C51B 2BFAA 2CUKA 2XUOA 4G01B 3TNLA 1XDDA 3MYRA 3WGOA 1E2BA 3ZQJA 3K1YA 3N2EA 2Z0MA 2Q5OA 3C3WA 3QFTA 1FVHA 1XE3A 4GQBA 1HYEA 1MLDA 4IF4A 3KFLA 3GLGB 2GSWA 1BJTA 1RWPA 1R8JA 3FSJX 1NW7A 4ZAGA 3MF4A 4IHAA 3F4LA 4TWJA 4DJFC 4FYPA 4F9GA 1QYXA 1NXVA 4RZXA 2GZRA 4F72A 2ZYIA 3H65A 1PP4A 1UPFA 3FYTA 2YKGA 2K4MA 4JLAA 4MULA 4HUTA 1SCIA 2D3WA 1UK9A 3KYDA 3HE3A 5FWXB 1ODSA 2ZJ6A 1J06A 3IB3A 2C5SA 4WCFB 4MI1A 4NI5A 2ZKIA 3V1TC 5AVUA 5AVZA 5J58A 1CZOA 4P93A 1FYXA 4GLLA 2FZEA 3KQYA 1KH1A 2BBTA 3A6ZA 2AZTA 3LBIA 3HU1A 1ISHA 2FX5A 3ONFA 1MIHA 3P0EA 4IIDA 1ZW6A 4CF7A 2Z4SA 1A9ZA 1Q6YA 1CUGA 1KJIA 1JECA 1TM7E 3R8FA 5J43A 2PGIA 4O63O 3X2EA 4BCDA 1A76A 4XTRA 4KL8S 3NO4A 4TZ0A 2FSPA 1UFQA 1SQ0A 1RLUA 4N54A 1GAJA 2CHUA 4V2UA 4G0WA 1SR8A 5DN6A 1L6RA 4ZYXA 3E5MA 3I0MA 3IIIA 2I3DA 3HDHA 3KR2A 3MOSA 3U3ZA 1KHTA 1QH1A 2JD0A 2NUTB 4J4HA 5IUKC 3BSWA 2QQ5A 1C30B 1MIOA 1VIMA 2ODAA 5SY9A 3Q8WA 3Q3GE 3NWPA 1Y80A 4RSGA 2VSYA 3M6UA 2PAFA 4Q9KA 5B3LA 3PUZA 1NI4B 1V6SA 1J5PA 1JLMA 1Y3BE 5AW5A 4Q1FA 1Q7BA 3ZCTA 2VZ0A 2VUHB 1N2CE 3CT6A 1CWUA 5JATA 3DEYX 9MHTA 2DG2A 4OXIA 5I8WA 2RHMA 4C06A 4C7XA 1K2WA 1UMCB 1ZSYA 2EC5A 3PFKA 5DWDA 3E9NA 2O8BB 2IUUA 3H2YA 4ALLA 3WMFA 1I2MA 5ER6A 1EB8A 4TLCA 1FP4B 1FNBA 4MUBA 2G0AA 2QTVA 3S81A 1FW6A 3ET4A 1U0EA 2DWCA 2EBWA 1CY4A 4GS5A 3K0BA 2G88A 2I6GA 3E9YA 1ZZGA 3F98A 3KKZA 3UXEA 2ZRDA 3KP1A 4BFSA 1XD9A 2DEUA 4X92A 4GX2A 3HB0A 4HWKA 4JBNA 2LCFA 2I29A 3D6TB 3GUUA 1W96A 1LRKA 2PWPA 3QY0A 1E77A 4JEHA 2Q5EA 3FGZA 3M5CA 4FOSA 4OGFA 4CIDA 3EPKA 2OD7A 3KFVA 1QYWA 1YL6A 2P0YA 2BJHA 2VDQB 3D6JA 3UUFA 2NZXA 2GD0A 2AF4C 4BDSA 4BWVA 1NXQA 1Q14A 1N2XA 1I80A 4HTFB 2PSDA 3CR3C 3IRVA 4KB5A 5IAEA 1W36D 3FOZA 4ZWNA 2ODEA 4DNOA 3MD0A 1I8TA 3O9ZA 3EA4A 4FEEA 1QFXA 3GA7A 4RJIA 2RK3A 1QTIA 2O05A 1IQRA 2HFJA 2IBMA 2NXCA 3BE4A 1NXOA 1VOTA 4N82A 4YT5A 5IAOA 5AICA 4EQ6B 3I5UA 1Z26A 4EFLA 2MCFA 1GFWA 3CVOA 2VBGA 2O3JA 5C32A 1A8UA 4WAUA 4QKQA 1I4DD 1M67A 1ZY2A 2C5FA 1L7BA 4JR1A 4B8ZA 4K26A 1DIRA 1XMPA 5SZJA 1ESZA 1T5BA 4L4ZA 3E7WA 3UEOA 1G9TA 2G72A 3M2PA 1WMEA 1T5HX 4AJIA 3MGAA 1NOKA 3L8GA 4DIFA 1IVNA 4P31A 3EXHB 3K3PA 1KQ3A 4KN6A 3CUSA 4LZWA 1BJKA 5D5PA 2CKDA 4EO7A 3QE9Y 3IVMA 1LS1A 4JB8A 4RJKA 9LDTA 3LRTA 4IFEA 1EK5A 3GRZA 2Y0CA 2PMDA 3RQSA 4KQEA 3L7NA 3H5RA 4Q3KA 1BXZA 1QGDA 1VLQA 2EZ4A 4CL8A 2GXQA 3RI3A 4B4OA 1XVTA 4RD4A 1GIAA 3ZOZA 4CFZA 5BQFA 4QG7A 4RS4A 4P0PB 3W2FA 2GTHA 3ZG6A 4X9XA 5IDQA 3QLUA 1C80A 5D5QA 4EMSA 3N2YA 1Z7WA 1Q19A 3M6LA 3QELB 1TVKB 4Z49A 4GNRA 1DG3A 4EJSA 3NWEA 5IWCA 3ONDA 3IEUA 1OWOA 4L6CA 3VPGA 3AEXA 4PNZA 2Y9PB 4HNAA 3U37A 3SX4A 1TUGA 3UG7A 3WLEA 1G63A 1IEXA 2IJGX 4UATA 4L9WA 3WVNA 4CQMB 3GH1A 4GOLD 1K6MA 2EFEB 5FTWA 2BYTA 1M1YE 4ZRMA 2L0XA 5JH7A 3AEQA 1ZDMA 4XXHA 3SD7A 2IPAB 3LCMA 3OIFA 5DM0A 5GIPE 3NNNA 4KI7A 2GF9A 2V4MA 1Y34E 3V8QA 1O96A 1QSGA 2OENG 1QKIA 5B3JA 2X0KA 1B0UA 4S35A 5F9MA 4LRTB 5A4FS 1RQPA 4MITA 2OL4A 4OP1A 1KDZA 3VNSA 4ZCTA 5C0OE 3CF2A 3E4DA 4OKNA 3KKQA 4QODA 3VTKA 1V47A 2PRYA 1GV1A 1MN6A 2CE2X 4N7JA 3SSAA 4ZRDA 3FLBA 4WN9A 1A77A 3PHIA 5EXDA 5CIYA 3KYBA 3NDRA 4IGIA 4YCLA 4DR2B 4OGLA 2ZJOA 1ULTA 4B4WA 1ZP6A 5CCDA 1EEHA 4J3FA 2Q07A 2PLNA 1FYFA 2QT0A 4KRYA 4XI9A 5UKDA 2PX2A 2DMRA 2B0CA 3LPLA 3OHMA 1MPXA 3RUIA 3TOCA 4JI5B 4X7BA 2GM9A 4EP1A 3E3LA 4LCJA 1V4BA 1JEOA 3PJFA 1QX3A 1LXCA 2AOWA 1TIBA 2XCIA 4F3TA 2OB2A 2FLVA 4G5FA 5LXTA 2Q3FA 3JQ9A 4DMLA 4CEIB 1B8OA 2ZM6B 4BUJA 4PO3X 3HWSA 2R7LA 2C4MA 3KUKA 2VRWA 4RZHA 4X8OA 3PUVA 3VVLA 2I3ZA 1C7QA 4YP1A 3Q6MA 1W4RA 2KSQA 4HWPA 4OL0A 1H05A 4JI0B 4DYVA 3LVFO 3A28A 3NS7A 3BWMA 2NAPA 3QEMA 3AHDA 3M0EA 3GRAA 5DXJA 2VTBB 3FTNA 3V32A 5CXSA 1KOLA 2Z2YA 4NOJA 1ESMA 3LGSA 4YCNA 3O4JA 4NFSA 3FJOA 3LV8A 3ROFA 3QVMA 2UUAB 5KOYA 4LK3A 1A5ZA 1HOTA 2OCGA 3NETA 3S1SA 4E22A 2QX8A 4M60A 2PZFA 5M04A 5EXXA 4HB0A 2Y76A 4UC0A 521PA 4QJ3A 5K01A 2RJOA 3IB6A 2WJAA 4QBKA 3BD6A 1IZYA 2JLYA 2JLZA 2ATEA 4R9NA 1J5XA 4H1VA 1MO2A 1QO7A 2EDCA 1FDUA 2ISQA 3Q0IA 4J0HA 5K1ZA 4OQZA 5EIAA 4IAOA 3SQNA 3NTQA 2FFBA 2Q8PA 4JQZA 3QYFA 1H4QA 1DUIA 2GHRA 4KP7A 4NDZA 4RXTA 4V03A 3WYNA 3M33A 2R7AA 4POOA 3DZGA 1BFDA 2QAJA 2WSIA 4N7MA 2ZEJA 3B7GA 1K0FA 2PWYA 3AT1A 1U8XX 3JXEA 1Y8RB 2Z2IA 1X86B 4NU5A 3ZH2A 1MB0A 2DJIA 3RGGA 4ZAYA 2PS9A 4PSAA 2SBTA 2I2BA 4JODA 4CT5A 4PIPA 3SMQA 3KQWA 1Z34A 4KXLA 2GBLC 1Q84A 5IT9A 3VNQA 2IEDA 2P6PA 2IPXA 3VV2A 1XAJA 3JAKA 4K9DA 4LXTA 4GC5A 4O02B 3OZ7A 3AV3A 3DJYA 4FB4A 3WLSA 4Y2JA 3U60B 1VHWA 3GZNA 1UBOS 1GPLA 1PYOA 1U0HC 2Q0QA 2VTEA 4RTLA 4LF4B 1GFIA 1LNZA 1ZEJA 2XA1A 1T0UA 2NU8B 3Q98A 1XFDA 1DFGA 2JIZD 4WY2A 3OOEA 3RROA 1OH6A 2NIPA 3PPIA 4IBOA 1NAHA 1J9GA 1SAYA 1EZZA 2OK7A 4MW0A 1M34E 2XTNA 2E49A 3B6IA 4X6LA 4Q9NA 1V26A 4B17A 1T0PA 2UVDA 2BHRA 3KAJA 4MVJH 3ER8A 1MJGA 3IP7A 1HEYA 1C9MA 2C03A 4DWOA 2Q1YA 1N5DA 3R40A 2ID4A 3S68A 1OXVA 3LTEA 3KB1A 1IMJA 4RCZA 1NNEA 1GZVA 4OSEA 5COBA 3QKTA 4FR5A 1FA9A 4M8IA 3RIGA 1ZYUA 1NRIA 3KKEA 3CPEA 3G0HA 4HDOB 4PYIA 3DFZA 4PAWA 4F2WA 3VR2D 3ZWOA 5K03A 2G1KA 1R74A 1QR2A 1PFUA 3MJHA 3E61A 3BJRA 2AW5A 4PCVA 8ADHA 3FPFA 1GU0A 2Y99A 1OWMA 3H1FA 3I37X 4JIMA 2IUFA 1LLCA 2OY0A 4I8DA 4Q93A 1KZ7B 3INNA 4R98A 1DARA 4UUBA 4FFBA 2I7TA 3RVQA 5DLQC 4M9ZA 3AB3A 3L1VA 2POQX 4OAOA 1QH1B 2COEA 4ZA2A 5F2KA 5CA0A 3VU1A 5L51A 1E3WB 4TKUA 4LJ7A 1VPTA 2CFOA 2ZP1A 3G1UA 4QA9A 4YMWA 4BV2A 3COVA 4CN9A 4BNTA 3GAMA 4OYHA 4DARA 5BUQA 3PQEA 4XOIA 4JX8A 5H70A 3TB4A 4HQNA 1JA9A 1FXWA 2ZULA 1TI7A 3JD1A 3T1VA 3GOHA 4OMCA 1Z5VA 4A92A 5A6SB 4MUKA 3OA2A 1OCEA 5HJ7A 3B70A 1XU4A 4QQ8A 4FONA 3S70A 1KI4A 2V4ZA 3HNOA 2RMKA 4YV7A 1ZRSA 1C7EA 4K03A 2VP0A 5JWOA 1JDBB 3EK2A 5EUBA 1FE8A 3N7AA 4CG3A 5T3YA 3K73O 3FI0A 1PR6A 2C7GA 2R68A 4QJ5A 4JC8A 4TUYF 1MAAA 4EY8A 1QGED 5L4NA 4U7PB 3H1GA 4BKMA 1JJBA 5TGZA 2YC4C 1JPJA 1E1LA 2ZUWA 3B36A 5COQA 2OO3A 1MB9A 3BOSA 5FI1B 3G17A 3WQSB 4EUNA 1U6KA 1WJGA 2P5TB 4LJ4A 1VE1A 1IK6A 3QITA 4AP5A 3K20A 1UQRA 1PQWA 2X77A 1P75A 3HJAA 3CLTD 2G25A 3M3DA 2V7TA 2ZRBA 4PSKA 5GTDA 3QM1A 3DW3X 4ZOLA 5FKJA 3HUDA 3COWA 1OV6A 1JG4A 2BZ0A 4X93A 2PH5A 2EFGA 1W581 3OCJA 5DEOA 2JIMA 5DNVA 1F6DA 1TW2A 2JK1A 1VYTA 3B82A 1LDNA 3OX2A 5FADA 2C04A 1OAKA 4FE3A 3WXBA 4Y2QA 2JAXA 3R3VA 5HR5A 1VE5A 2W98A 3LRXA 5CIWA 5EMHA 5GWXA 5CVTA 2V8BA 3T7EA 3T3HA 1RAFA 1JQ3A 1VBKA 2R6CA 1OLOA 1YFZA 2C92A 2R60A 3NEAA 3PE6A 4Q7KA 1QLWA 1JR3A 3RASA 1DIGA 1FUEA 3O4GA 4HD8A 1F4VA 5TSDA 3TLEA 3W1EA 2BV3A 2YY5A 4BB9A 4BLTA 1L7QA 3QHPA 1IG0A 1SKYB 1LWNA 5HCNA 3QUSA 5KJ6A 4YNBA 3D4PA 4AJHA 4I36A 3LUKA 3DE0X 1NC3A 2Q3EA 3EULA 3HFJA 1JH8A 1UFKA 4I1VA 2HZBA 3FIUA 3UAXA 4DIEA 4C20A 1EHYA 1GGMA 2H5EA 4BQPA 4N0EA 3EIHA 3KM0A 4H3HB 4N9WA 1UJMA 5DTMA 4K6OA 4FXOA 5AT1A 4IGAA 2F6RA 1DRKA 1SU6A 2PQMA 3QMMA 2X2FA 4MQUA 3D7NA 5JQGA 1XELA 3BE6A 1B4DA 1FLDA 1C2YA 4M1QA 2F67A 1L4KA 1UFOA 5DYGA 1RXIA 4EJSB 5K6RA 2P2LA 5JAMA 4TTVA 1ZGJA 2Y67A 4DSAA 3MQFA 1SBHA 3R74A 2HPVA 3QE0A 4Y9TA 4ZGWA 3MXTA 2XT0A 5IJZA 1NKVA 3IULA 3C3CA 2IHKA 3M83A 3AEQB 4K87A 1P4RA 2AQKA 3C4QA 4XIFA 1COWD 1P0FA 2R48A 4BQQA 4ER5A 4ZEMA 3G6WA 4PX2A 1NP3A 1YE5A 1O96B 1L5GB 4EY5A 4XVUA 1OC2A 2BFCA 3ITEA 4NK4A 4MUGA 5DHPA 3ZBQA 4MW6A 1N6KA 5LJLA 2BVNA 4RGVA 2GUWA 5ERGB 4KYUA 2QMYA 2CZCA 3G2PA 3O8QA 4FSXA 4KZPA 3S28A 4B2IA 1W46A 3DLCA 3G8CA 1OBOA 4YAWA 4GOKA 5SICE 1ANKA 4WN9B 5D6OA 1C4WA 1MMFB 1A5AB 2O14A 4GWGA 2A2ZA 4Q00A 2FUCA 4P3KA 2PUCA 3DDOA 1M66A 3ZS9A 3NJRA 1VDMA 4CDMA 3KTAA 2HREA 1B0AA 3ZWWA 1QGYA 3LC0A 2F8LA 4BO4A 3LW8A 1JGTA 1NWCA 1D2MA 2PH7A 2QAGC 1I6LA 2B36A 2XB8A 2C3OA 3G0CA 4J4BA 3GJTA 4XVCA 2YC2C 1W4ZA 1TQ6A 3VMMA 2R6ZA 2GZAA 3CTPA 3OQOA 1MX9A 2PBZA 1IHPA 1YKFA 2VQDA 2GEBA 4UCWA 1B14A 3CCBA 3BGOS 2FDCA 1RT9A 4NX2A 2GN4A 2QPAA 1U1EA 2Z5VA 3NBYC 4D0RA 1SOAA 1VE6A 1J1UA 4QDTA 3F3MA 2NO9A 3GMDA 3NKFA 5ALZA 2V59A 4DIBA 5KTMA 1ZH2A 1WV0A 4NL4H 4E4YA 3QEMB 1LBEA 3NJ8A 3P4YA 4PQEA 4TRMA 1Q0LA 2A9KA 1GZ4A 3OT1A 4ZU6X 5HGJA 3GDFA 1XZQA 1A5SB 4LDRA 2WZBA 2C8KA 2W4QA 1JEDA 5JXGA 4YK7A 4O2AA 4CFYA 1SURA 3AJRA 4BRZA 2IU3A 3K6RA 5E6RB 2IYSA 2QZPA 4INOA 2R8BA 2V65A 1EAMA 4RMNA 1QGOA 2I6UA 2VJOA 5L7YA 1R5OA 5FV4A 5ICEA 2ZZMA 1I3OA 3BE8A 1XZ8A 3OZSA 5LMCA 1TZJA 1KBOA 4FFNA 2MIIA 4R84A 1M0SA 5K0FA 1A95A 3MJCA 3OM0A 4CKCB 5HM8A 4B32A 2VOJA 3L7LA 2JAQA 5IVDA 3DL7A 1XTIA 1SNYA 1NIJA 5T8KC 1B0PA 3QRWA 5I7SA 4HMPA 5G1NA 3GT4A 1FBNA 1HYBA 3RSQA 3FWZA 1TIKA 2Z1MA 4MO2A 8ATCA 1GZ3A 5E1MA 4Q48A 4P1ZA 1JFSA 2GFIA 3UENA 1SZCA 2RI1A 3LLMA 4GI7A 5AM4A 4KGZA 5H02A 3O1JC 3PUWA 1BE0A 3O47A 2YS7A 2PT9A 3PHGA 3QVSA 1Z4NA 3SQDA 5JNRA 2F1HA 1QF9A 3WWPA 4JGBA 3IMEA 4P7KA 3IUQA 1A0OA 1BS2A 1NQXA 4X63A 1HKHA 2XTAA 2CJPA 4FCTA 3WL6A 1JVBA 1Q1QA 1OXSC 1XZIA 3JAKB 2GZ2A 4MYHA 1OX4A 1F2DA 2P65A 1NBIA 4QVIA 4EJ0A 1S1MA 4G65A 1VCNA 3NT4A 2OBXA 4JJGA 1YCDA 1OBCA 3GZNB 2CFSA 5FUWA 4I5GA 4C0BA 2P77A 3F9IA 3JWIA 4BP8A 1IDOA 3AVTA 1RXVA 2YIMA 4N8SA 1J8DA 4ZMBA 1HF3A 3OZBA 1QG0A 2QJFA 2QSUA 3FROA 5BV8A 2H65A 1OI2A 2IVFA 3LC2O 2VWPA 1A4UA 2CLCX 4XQ0A 3IHLA 3TLCA 3ZHYA 4ICIA 3HXMA 3QU7A 4B9AA 2TECE 3HXTA 1ORWA 2V0NA 2YFKA 5A4KA 1J2UA 4ALNA 5JD5A 4H3SA 3X1JA 4AN0A 5IN4A 1W0KA 4J07A 4IH9A 3EVNA 1Z2CA 5JPDA 3QHQA 1YS2X 1Z17A 5DGXA 1WLSA 1QPZA 5L8VA 4NQZA 3L0ZA 2MDTA 3DWFA 1R6BX 4NAHA 5BQOA 2GHTA 1CZUA 3FZQA 3DW1X 1LK5A 1BEEA 2HF2A 1AA9A 3OAAA 2ANCA 3A9RA 2JGEA 2XE8A 4JUBA 3NHJA 4RIHA 2WP8J 1B41A 3OT5A 2CMGA 4DLSA 3B51X 3CLRC 1G3IA 1E9CA 1E66A 2PGDA 4O8CA 3G7NA 2AR0A 2WDZA 3LQYA 1KO8A 3N8IA 4KNVA 4FDUA 3O8RA 1I5OA 4P0QB 3HFGA 1U81A 2E4UA 3RTCA 5BWBA 5DYNA 5LU9A 4RTKA 1CDDA 2OGWA 3RS0A 5FUQA 3CIOA 1V8OA 2H00A 2C3UA 3VTZA 2JJQA 2R5NA 1DRJA 3IUPA 2YS6A 2JZNA 4PC6A 5AKKA 5TB5A 5BURA 2BGTA 1SBQA 1M1UA 1K4KA 2GMWA 4NJMB 1B23P 3NOOA 5KX5A 1NQVA 1XAGA 1C0IA 2EJUA 4K88A 4ZQFA 2ZWIA 4FFBB 4UMEA 4AJ4A 4QUDA 1VDZA 5CA0B 1WBBA 4KAAA 4D82A 4TKUB 2QR5A 1W1IA 4G0MA 3SXPA 4EHDA 1JU9A 3HB4X 3IXLA 4P22A 3CUUA 1LJ8A 3ZVRA 4YUXA 4GF5A 4C0SA 1ZU4A 5CT6A 4KGVA 3CR8A 1W19A 3DPUA 1S4QA 4JYMA 2RBKA 1XYYA 3DZCA 2BOVA 4TXNA 1EHCA 4A4DA 1UMDA 1RBMA 1HBJA 1F51E 4W82A 1GXSA 1U4SA 5JDIC 4MEJA 1O95A 3PNSA 1VG0B 3QU2A 5E8RA 2ERYA 4CLEA 3DEKA 2K7ZA 1H65A 1RJEA 2BMVA 2JGFA 3EXIA 4W6ZA 5FX2A 2DBZA 2YRFA 1BKYA 2E37A 3LQRA 4EYEA 2FKNA 2JFPA 3VC1A 3EIXA 4DPLA 2GA9A 4CLHA 1O5IA 4RWEA 1E6WA 1EFRD 1MAUA 5KUTA 1JAHA 2ZBRA 3D02A 4OBEA 2FMKA 1AO0A 4RJLA 4O4JA 1YO6A 4O8ZA 3CWQA 4UBIA 5T6MA 2ROQA 4YR9A 1JDBC 4R0NA 2HK9A 4WXPA 1W1UA 1WF3A 3AFOA 2X5OA 2QN9A 4Y2VA 1Z6QA 3ZQKA 5BSFA 3UJAA 5KSYA 1W5AA 1KQPA 3LXMA 4LN1A 1N1GA 3T7IA 1DKNA 1QG2A 4FYIA 1NW6A 1H2HA 4A82A 3SK0A 2WQ7A 1BX3A 4UHDA 5JFTA 1BHQ1 3MTGA 4K9SA 2X76A 1RFGE 3CUWA 3HXPA 2XZLA 3WDMA 3NHUA 3NWJA 1Q44A 3ZJYA 3FOEC 1I7DA 1IIBA 1NE2A 2BP7A 4FWIB 5LZ5A 1KDRA 1WSBA 3KE8A 2BBSA 4W6QA 1DELA 2O52A 3DDCA 1P18A 1SGWA 3FDZB 1UDRA 4CM7A 3P9ZA 3LT0A 4HWRA 3PJRA 5EWLB 3ABSB 3L4EA 1KO5A 5KAMA 2GCNA 3DTVA 1H6CA 3P0JA 1NXWA 1RQXA 1WCV1 1SBTA 3EZGA 1XKLA 4G8DA 4PINA 1SU4A 4IEFB 5BW8A 1U4NA 4XEHA 3LBAA 4M38A 1EUCA 2XI4A 4QJ4A 2EFCB 1UOPA 1E1MA 3S2EA 3TZQA 1WB9A 1IM5A 4BO5A 4GAEA 2I3AA 821PA 4WXHA 4AJEA 1L5OA 3BGIA 3ELDA 2GK6A 4WBNA 1WDWB 3DLTA 3PNOA 4QWWA 4RK5A 4LI3X 3UMVA 1NJ2A 2C42A 1Y8CA 4C0QC 2LR0A 4L74A 3KSRA 3F7MA 1VI2A 3SXJA 2AL7A 3DONA 4REQA 4AECA 3ECCA 5JQGB 4PXSA 4C0JA 3DQQA 5EQTA 3DB1A 3ADPA 3KOXA 3QBDA 4FWBA 4E2YA 1J8VA 3GJXC 3E05A 5TT0A 2BEJA 1B1AA 4Q7LA 5IVIA 3CUKA 1O57A 3LP6A 2VEOA 2XYQA 4EPRA 4AXBA 1P2BA 2EKLA 2B8TA 4WJKB 5MN4A 3H7AA 2NACA 5KYVA 2Q4OA 3EMKA 4B09A 4C01A 4QPJC 3CGWA 3NP7A 4GZMA 1N0VC 3QLUC 3B6KA 6PFKA 4FFRA 1HSOA 3BD8A 4MUNA 4GUAA 4PPYA 1QB7A 2RGAA 2EKPA 3UYLA 3J81A 1BS1A 2A0YA 2V6MA 1I01A 2WWXA 3ZDFA 2OEPA 3BXOA 1HORA 2JBAA 2BFCB 1C1XA 2ZRCA 4IINA 5EVCA 5IJXA 3EIWA 4ARZA 2VATA 3WRVA 4Y6GB 4DCMA 1LW6E 4GE0A 3DEIA 2P2CA 4AX8A 2DXIA 3OQHA 1AKEA 1ZSNA 3AMVA 3O8QB 1JLSA 3DDHA 4P7GA 1WQ1R 4BMOB 1Z83A 1AGYA 3GLGE 4PLWA 1EH5A 2VA8A 3A1VA 1GSOA 1RWXA 5IAAA 3CVYA 2PKWA 1ZWKA 3GRKA 4J7XA 1RABA 1WUTA 3WS7A 2CL5A 2EZ9A 3FVRA 2VXYA 3WB2A 2GK7A 4ENVA 1U8AA 3KTAB 3V1MA 5B3JC 1KO7A 1SWWA 4NESA 4AU1A 3DH0A 4TTQA 3PJGA 5C4GB 1MVNA 3GAFA 4IDPA 5JROA 1R6TA 2XJ4A 1W34A 2DVMA 5FP0A 3LG2A 1W6UA 1GARA 5JV5A 2Y71A 1P9NA 4JI7B 2PRJA 4AQDA 2R8XA 3E5HA 2C4VA 1P5HA 2ID7A 5NULA 1NWHA 4YIKA 2WD7A 1KIFA 1Z29A 2ZK7A 4URWR 2OAP1 5EHZA 4U7FA 4WKGA 2G6BA 4I4NA 3RYHA 3WQBA 4I2VA 3OBBA 3KJQA 1T8UA 2Y66A 2OLJA 4KSYA 5DMXA 5D00A 1Q0ZA 3EHDA 1C3OA 4DYHA 5HGXA 4EGQA 4MRMA 3I9V6 4MINA 5AP9A 1EX9A 3OT1B 2GYWA 2VZEA 1GOTA 3HVRA 5K8LA 4PYLA 4HYEA 1SB8A 4O2AB 4LYFA 2QE6A 4MQ4A 3JQ9C 5FTKA 4LXQA 4XX1A 3OOSA 1XOIA 2FPGA 3LLVA 3PUKA 2COUA 3BXGA 4JBYA 4LBZA 3TLZA 3DGFC 3QXXA 5CCBA 1R12A 2Y0PA 1IATA 4RIEA 2GJ9A 3T7KA 4HGYA 3WYFA 2WTAA 2WWRA 3OJFA 4X90A 1UXOA 2Y1EA 3ND7A 4BU1A 1SKUA 4H35A 1PL8A 2PRIA 4C7JA 2F8SA 3LQKA 1VPDA 2CVQA 1NOJA 2DUMA 3NAZA 5DBIA 5HIJA 1WP4A 1N1EA 1XQYA 4NMXB 1U90A 2D2VA 2JKZA 1X3SA 3GEPA 3HCBA 1H8EA 2PPVA 3L06A 5T67A 3JASA 1LEHA 2W4IA 3LX8A 3Q12A 1JLKA 5CB6A 1FSFA 5JH7F 1U9ZA 2AT1A 5AUNB 2FR0A 2YZGA 2JLUA 4S0ZA 1L7RA 3CZRA 1EA5A 2QJRA 5DX1A 2FWBA 3BMXA 5AI8A 2CJFA 1C8KA 4KO3S 1KOJA 3UKJA 2H2HA 2HMTA 3MT0A 2P2NA 4PQFA 2IOHA 5DT2A 1HGXA 3D0RA 3DBRB 3O8DA 4NCKA 3B1YA 2N47A 3IBTA 1V4NA 1CY0A 5INTA 4PTLA 1UBLS 1IZZA 3F71A 2O0KA 1OX4B 2ETXA 3EMVA 1PL0A 4IDBA 1KP3A 4IG4A 4BFUA 3GRVA 5DDIP 2PYDA 4JU9A 1HURA 2MINA 1L1FA 3VZRA 1WCYA 4DLKA 4MVJP 3A6EA 4L3VA 1G5HA 5DU2A 2C1ZA 2V9ZA 4IDQA 4LJAA 4TV9F 1FNSA 2CFRA 3C6QA 3LT2A 1T9DA 1QHGA 3AM3A 3JVUA 5G3ZA 4JD5A 5JE8A 2VSOA 4ZDJA 1DBPA 1ACMA 1WXQA 5LNK1 4BO8A 4KR6A 2WE8A 3PWSA 4YLEA 1T5OA 4E31A 5E7JA 4MUYA 1JIKA 2BELA 4G1UC 1LRJA 2VYVA 1FUIA 1CR0A 1QM5A 1T8YA 2ZBEA 4JSRA 4LGCA 1RHKA 4S1VA 4LWOA 5E4YA 5F76A 4KV9A 3SG0A 3PGVA 4KDFA 1LV7A 1V96A 2FWRA 4M0FA 1D4AA 1X7WB 4NOLA 4BYGA 5BYAA 5KTRA 1N5RA 2KE5A 3ODGA 1A8QA 2H48A 2UUPA 4FYWA 3UK0A 4XTCS 2WZCA 2OXIA 2HBRA 1GHTA 4A03A 4V24A 5EG5A 1C7ZA 1J42A 1PVVA 1SPXA 3TEFA 3DAFA 1UKZA 1WW3A 4OHFA 1CRQA 4C4ZA 3BC1A 2IS6A 4FHDA 3Q15C 1J9ZA 5IASA 2LKCA 5KNBA 2H2AA 3QBVA 3ZHQA 3AJAA 4JCCA 4DILA 3BF7A 5CX1B 1MV5A 2Z3VA 4GU5A 3EZ2A 3N2GB 3TMKA 4F84A 4PHCA 2GN6A 2I76A 1Q15A 1SUIA 1LK0A 2J5RA 2VG8A 3EDQA 4IQ8A 5CYFA 3G5TA 2R00A 1TPYA 2V7QD 2WTNA 4KGDA 4YRNA 4TQGA 4LOHA 1KP9A 5F3WB 2C1EA 1LX6A 3WG9A 4J2HA 4OG2A 1SOWA 4OSPA 1QWOA 1UMDB 5BSHA 1N92A 1NURA 3ZEAA 3KOOA 3OWHA 1B42A 1GXSB 3QLJA 3NYWA 4JVSB 1O0BA 4BY9E 4LC1A 4ZALA 2HXYA 5HQ3A 3KBOA 4OL9A 4P33A 3AL0C 1ISIA 1N75A 2XVMA 4RSHA 2HMUA 3ZYZA 1U0FA 5L3RA 4LF9B 3EXIB 5IZCA 1NC1A 3OIVA 4M0UA 3AF4A 3ZR4B 5F12A 4JLPA 3DVLA 2E4VA 3UJBA 4Q3AA 1G55A 3KQMA 5KYXA 2QM0A 2H1RA 3NYIA 4BE7B 1Q5PA 1UADA 1USGA 3BRWA 4WKBA 2AEFA 2R6GA 1AG9A 1H2XA 3KDSE 4O4JB 4C7MA 1OHHA 4KITB 4E07A 2V55B 3GR6A 2ECQA 2ICAA 4FI3C 4LTDA 4DHEA 2QTFA 3TLAA 2PKRA 1BXRA 4KWCA 3VNRA 4F4UA 1I0IA 2XQIA 1Z6XA 1XTKA 1X1CA 5I8ZA 3P32A 3T1QA 3ZE7A 1WL8A 2Q46A 3PT9A 1H2AS 3ZUGA 1K5PA 4PFQA 1V5WA 1A9RA 3KU4A 1ODFA 4QM6A 2P9TA 4ASUD 3PB3A 1TJ5A 1VP9A 2FXIA 2IIPA 3OKCA 1E9AA 1W8DA 1JQLB 4CI0B 4RCVA 2YUTA 4BE9A 1AMOA 2DWQA 2OXRA 3AEUA 3EVEA 2Y05A 4QREA 4RVFA 4F92B 3IP5A 4DEXA 1QGUA 3DO8A 4GMHA 5EYPA 1ONNA 2ZWOA 1EGAA 3V4OA 1VLVA 4EUEA 2CF5A 5JS6A 4ISCA 2HH9A 2O48X 2Q0SA 1F17A 2GH1A 3KTDA 4HL6A 3TI7A 1J2EA 2CLEB 3EQ2A 4UTXA 4IJ5A 1QKJA 1OX5A 5T64A 5JI2E 2IOFK 4BFLA 5C9ZA 3C3JA 1K8RA 4KCGA 3N5KA 4FW8A 4M0EA 3DTVB 5GPBA 1P4SA 3HKBA 1WEHA 4LE2A 2AZMA 4ZEXA 2C5HA 2EYUA 3F49S 4EEXA 4Z9AA 4DABA 1ABFA 1GPDG 3GBVA 4IJMA 4NCJA 3F7NA 3BXFA 4TWZA 2QV7A 3D6VA 3OICA 3I23A 3KETA 1EUCB 1RYEA 3QJGA 5CA0F 2D54A 3E9DA 3CVXA 2XHEA 4CKCA 3I2YX 2VJMA 4WXRA 1Q1BA 4WBNB 5DK6A 1XTPA 2JL1A 4V1CB 1ECFA 2ZJFA 5HQTA 4LYYA 1J5EB 1HNXB 3NHWA 1XZMA 3WV4A 3DE6X 1JSLA 2HSDA 3RU9A 4W1RA 1Q92A 2JCYA 4REQB 3ZI4A 5JCJD 4FIDA 2AD1A 3KDPA 5TXGA 4XQEA 4Y2YA 4S04A 2BMAA 1LUAA 2JFVA 2XE6A 1BU5A 4GKKB 1M2KA 2EFJA 2PX6A 1I33A 4PRLA 3CUEF 3EZ9A 3O8BA 4O4HA 4E33A 5JO0A 4NZNA 2QN2A 4OXYA 1K7EB 4ZP1A 2D06A 5BP7A 5IWAB 3V1NA 2XCSB 3DHEA 3G7UA 3PXXA 1N5JA 3LCJA 1M8JA 5ALIA 1HYHA 1ITZA 4V0SA 3SQLA 1ECBA 1GTJ1 1H3NA 2H0RA 5KJ1A 1BVHA 2C61A 1AB5A 1MH1A 1O54A 5DULA 1GL6A 2Z5FA 3D3NA 2CXPA 3B85A 4N48A 3N0RA 2AWOA 1BEZA 2C99A 2JBAB 3RUFA 3PC2A 4XB2A 1ZIPA 3FWYA 2EDAA 2MU1A 2WAXA 3JAMA 1A98A 3O03A 2FPMA 4F4JA 1HFJA 2NXNA 2WUEA 4FGWA 4BMDA 5B1SA 2QJTA 1KOFA 4MDHA 5I5EA 1B16A 2O5RA 3LVBA 3FRJA 4OMUA 2C2HA 4KGXA 3WYEA 4H1UA 1W93A 1Z5PA 3NDIA 5FI5A 3OH8A 2D7JA 3M5DA 5C3UA 3V7UA 2VR1A 3O3NB 5I5GA 3H6KA 4EYSA 3HVIA 5ALRA 3DL0A 4AS3A 2B3DA 3EA0A 3HSYA 1M5RA 2CDRA 2YV5A 2JH8A 4L2IB 2M9MA 3OEWA 4K46A 1DCKA 3DR5A 1KMIY 2O8FB 1M75A 2ZTHA 3TM4A 1E8MA 2ZU6A 5EJAA 4E03A 3GVCA 4B76A 3MJEA 4FC6A 1P0MA 3KHKA 4C6TB 5JH7B 1K8ZB 1RPJA 4P86A 2HEIA 3V5NA 2WD7B 5G0TA 1T2VA 3BFJA 3DPIA 1G4AE 1VMIA 3RYHB 4DDKA 5GIOE 5FBHA 3WLFA 4PC1A 5EMKA 1QIDA 2HJRA 2PTHA 2V74B 8OHMA 5KOJA 1FXUA 1C3OB 3IGFA 3PGKA 5I7WA 3AF6A 3MQ2A 1HLFA 1VKZA 4MRMB 3W2TA 4OGGA 4L50A 4R5HA 3R9WA 2OILA 4MW9A 5LZ9A 1F14A 4L72A 5F9HA 4LIPD 5H3HA 3JATA 4KVGA 3SEAA 4D8YA 1D3AA 1Y42X 3EMDA 2JJ2D 2FPGB 1KQFA 2GGSA 1SCAA 1JFLA 2VTDA 2EQBA 2C7QA 3GXBA 1RWOA 5EJFA 1BDBA 1Z0ZA 3GEEA 4GI3A 5JQGF 1M33A 3R3SA 3W5IA 1OXXK 3H9JA 5FO1A 4AB1A 3MGGA 3I92A 4TZTA 1PT5A 3QK7A 3U3XA 1IB6A 1TYDE 3VOTA 2NVUA 3W5UA 4K9NA 5BMVA 1DRUA 2AUMA 1PDWA 1R8YA 4K7JA 3GLFA 2HSJA 3P2YA 1Z6TA 2PU5A 3QENA 4JH0A 4ZO8A 2IX3A 2YVKA 7MHTA 1NYRA 4ZI5A 2XECA 1IC6A 3HFSA 3NAGA 1TDJA 4TX1A 4UUQA 2VPYA 3TWOA 9ATCA 1P45A 3AIOA 1SIUA 3BFXA 2XNHA 2D1SA 2HHLA 3E81A 4HEQA 3GCZA 4MYTA 3CPSA 5CDTA 4RFSA 3HJUA 1GRCA 1NRWA 2QR3A 4DMFA 5A2QA 2Z9CA 1M10A 2CXQA 1HG0A 2R85A 1BMDA 2UUBB 4HYYA 2I7CA 1E9FA 1RYBA 2E1PA 1U3CA 2JEOA 2ZCVA 4B7UA 4W4TA 5FOQA 2C2XA 2QRJA 5JZMA 4PFJA 4ZYLA 2NQTA 1SXQA 2IVZA 2JLWA 3B1XA 4E46A 2CHVA 2MINB 3WA7A 4NE7A 2RGRA 1FSZA 4HXYA 1EG2A 1O4WA 4O59O 1TK9A 1W1WA 1NVBA 2CXTA 2NZYA 3OLCX 5ADWA 4BTVA 2QX9A 5IDXA 1XZHA 3ZU4A 3BK2A 5E7QA 4BASA 1F9AA 3EPLA 1I9GA 3DM5A 5DHQA 4LDZA 4WN3A 1E1CB 1AKWA 4DCUA 3FKSD 3OZIA 2IXEA 1TD9A 3AM5A 2GAAA 3OO0A 4RXUA 4F1WA 3GJRA 2AMFA 1QMGA 1LA2A 2XMPA 4YJ2B 5C80A 2ILTA 2J0UA 3ND5A 4G0OA 4BQIA 5JNLA 5L40A 1TT5A 3Q7TA 1V5EA 1PFQA 4D80A 1A96A 1QQ7A 2C9OA 4I1UA 1SKYE 2CN1A 4FFSA 1RHRA 3RIXA 2ZUCA 1BMFA 5ENZA 2VHQA 3PF8A 3PNBA 4ETWA 2P6OA 2EG9A 2Q1WA 3N6XA 2H08A 1JALA 4R2KA 5JSYA 4EK9A 1E3MA 2A57A 4I1IA 2ZR8A 4KIJA 3AI3A 2CB9A 4M8NE 1OWNA 3FNRA 3JV7A 2NT4A 3PHJA 3QE2A 3EIOA 1I6KA 2X42A 3UN1A 1XEWY 3AHJA 4KSCA 1UINA 3CMMA 3Q1KA 5AO9A 3U81A 2X19A 3F67A 4OU4A 1M2WA 3RK1A 1TCBA 5ARCA 2PUEA 4YUVA 2D2FA 1GDDA 1EK2A 2PUVA 2Y1WA 2ZIVB 4GOOD 1BROA 1OI3A 4OHOA 4YGXB 4EW2A 5TX7A 2OP0A 1YDFA 2FN4A 2ZJAA 5EUMA 2JCBA 3K2QA 4URZR 2WJ3A 3NEPX 1PD1A 2GT1A 1CRPA 2W22A 4WBSA 2I1LA 3SEZA 3EFHA 4BNKA 3RRJA 2Y1DA 1FDWA 5CLIA 1U9YA 5BVGA 1NG9A 3EDMA 3DMRA 4WFIA 4BUZA 5H8WA 1DC5A 2XA2A 3H84A 3EZ6A 3PKJA 2ZYHA 3L18A 5JJ5A 4MR9A 2FSIA 3H2IA 4P5DA 3BK7A 1KZYC 1TAGA 5HQ3B 4B3XA 3TDMA 1X14A 5EC8A 1DPFA 4UAJA 2PGOA 5JDCA 1LGYA 4J0DA 4AZWA 1WKCA 2NP7A 4PLTA 4CF5A 5HTOA 3FFTA 5KYXB 1RWVA 5J3JA 3NKLA 4DLTA 3JAWA 3LL4A 2IIBA 1U2GC 1DBQA 5GZ3A 2FF5A 3NT5A 4CETA 5GJBA 4F3RA 3RSZA 1IEVA 4LW8A 4DLYA 1HE3A 1HMYA 4R2WA 2PO7A 1Y1PA 4I14A 5K3FA 1BXRB 1XROA 4JWTA 3UHFA 2HO5A 2RBGA 3KXIA 3OZWA 1IQ0A 1G2QA 3AUAA 4YJFA 2C3MA 1AS2A 5ES3A 4NAUA 5LBIA 4YJ3A 1CUVA 5LQJA 1WDMA 3D3WA 3VO2A 3AK4A 1JKFA 3TR0A