3E2PA

Catalytic subunit of m. jannaschii aspartate transcarbamoylase in an orthorhombic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
306
structure length
306
Chain Sequence
MKHLISMKDIGKEEILEILDEARKMEELLNTKRPLKLLEGKILATVFYEPSTRTRLSFETAMKRLGGEVITMTDLKSSSVAKGESLIDTIRVISGYADIIVLRHPSEGAARLASEYSQVPIINAGDGSNQHPTQTLLDLYTIMREIGRIDGIKIAFVGDLKYGRTVHSLVYALSLFENVEMYFVSPKELRLPKDIIEDLKAKNIKFYEKESLDDLDDDIDVLYVTRIQKERFPDPNEYEKVKGSYKIKREYVEGKKFIIMHPLPRVDEIDYDVDDLPQAKYFKQSFYGIPVRMAILKKLIEDNEGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic trimer of Methanococcus jannaschii aspartate transcarbamoylase in an orthorhombic crystal form.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Aspartate carbamoyltransferase
total genus 109
structure length 306
sequence length 306
chains with identical sequence B, C, D, E, F, I, J, K, L, M, N
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3e2pA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3e2pA01
4A8PA 3M5CA 1EP9A 1R0BA 2H3EA 1RAIA 6AT1A 1RABA 3L05A 1OTHA 1R0CA 2EF0A 4OH7A 3CSUA 4NF2A 1AT1A 3KZNA 3LXMA 2BE7A 2P2GA 4KH0A 3KZKA 4FYXA 2FG7C 7AT1A 2ATCA 4F04A 3M5DA 4EKNB 1SKUA 3R7LA 2FZGA 3TXXA 1DUVG 4KGZA 2AT1A 9ATCA 3SDSA 4A8HA 1C9YA 1TTHA 1AKMA 5G1PA 3M4JA 3D6NB 4AMUA 4FYWA 1ORTA 1RAEA 3NPMA 3E2PA 1FB5A 5ILQA 1VLVA 4JHXA 2QG9A 5AT1A 2RGWA 1PG5A 1XJWA 1Q95A 2FZKA 4KH1A 3GRFA 1RAGA 3MPUA 2YFKA 1PVVA 1ZA1A 4BJHB 3UPDA 3TPFA 3L06A 1RADA 2AIRA 3D7SA 4FYVA 4E2FA 2W37A 2FZCA 3KZCA 2G7MC 1TU0A 1RACA 3L02A 2BE9A 1JS1X 1DXHA 4KWTA 8AT1A 4AT1A 1TUGA 2QGFA 4WTOA 8ATCA 4FYYA 3Q98A 1EZZA 4JQOA 4KGXA 2IPOA 4F2GA 2I6UA 1FVOA 1RAHA 3AT1A 1EKXA 4IV5A 3KZOA 3KZMA 3M4NA 2FG6C 4EP1A 4A8TA 1ML4A 4H31A 1NBEA 4AM8A 2A0FA 3R7FA 5G1OA 5G1NA 1D09A 3R7DA 1RAAA 1A1SA 1RAFA 1ACMA 3GD5A 1I5OA 1ZA2A 2OTCA 4KGVA 4JFRA 1F1BA 3L04A 4ANFA 2HSEA
chains in the Genus database with same CATH superfamily
5C80A 2X41A 2GBFA 1L7NA 3D4BA 2H3EA 5C3MA 1YBAA 3H5LA 3TR6A 3VVBA 3ZWYA 1NT4A 3HZRA 5F2OA 1WP9A 2HBYA 2JFYA 3QP9A 3PFHA 1TQ2A 2AFIA 3AIOA 1FTSA 3N75A 5C31A 3W78A 2R85A 4ZYVA 2M9MA 5AVUA 3LKVA 4L8GA 4RY8A 4P1ZA 1FYWA 1GHTA 1OI2A 4S24A 1J07A 3HUEA 4AJPA 2QTBA 4LRXA 1BKSB 3LXUX 2O23A 3P9NA 3T0GA 3LT2A 1KQ3A 1UMBA 1XVLA 3KQHA 4DUYB 4KLRA 4MA0A 4DWJA 2ZAMA 1VXOA 3OCXA 2E4YA 2CDAA 1ECBA 2I54A 2RCNA 4YUXA 5CVTA 1UBOS 3D0QA 2AWNA 4R9UC 4YPFA 3F8SA 5AQEA 2HSZA 1EXDA 3OPYB 3BIWA 3QW4B 3V9PA 4F91B 3USCS 1CCWA 2F3PA 4F9TA 4A03A 5K0TA 3FKJA 4RPJA 4IDBA 1N5OX 3MLEA 4YCBA 3C3WA 2R6DA 4M53A 1WD5A 3FKSA 4CG3A 3QKIA 2WIBA 5AI5A 5CDTA 1PX0A 1KEZA 3TLCA 2DF8A 3ABQB 3OOJA 3H5WA 1HDOA 1FQJA 3DDCA 4I55A 3TQHA 1KE2A 4H7FA 4O5OA 3TUJC 3L7AA 3OM1A 2VPWA 1UMCA 4FB5A 4H1WA 1C7RA 2ZI9A 5JFGA 1XRLA 1Y5RA 3K6JA 3HGTA 3AF1A 4ZEOA 3MEQA 4W5QA 4B76A 3PPIA 2WWIA 3B1JA 3IO3A 3PLAE 4LDPA 1O57A 2QP3A 4RVNA 2G83A 1YV9A 3OT1B 5SYNA 4OYHA 2IPLA 2V7UA 4YR7A 1B4DA 1XQYA 2X40A 3R5XA 4UTNA 1SXIA 3FWYA 3BWBA 3PICA 4J1QA 2DETA 2WWGA 3BC1A 4K88A 2GJAA 2FRVA 2OHHA 1E3WA 3G8AA 1E5TA 3VJLA 4N0MA 1AKRA 5DXJA 3EIQA 3SZLA 1GJRA 2PS3A 4BJ6A 3NOVA 1E9CA 1G8PA 1P72A 1GDTA 4HEA6 3R6WA 5CA0A 1Y9JA 1OLSA 5HRCA 1VOTA 1U0RA 1Q11A 1K7FB 5A71A 1SQ5A 3GJQA 3ZE2B 3LTEA 3JD1A 1AK2A 1FW8A 5GV7A 1N0HA 1R0LA 2PUBA 5TMBA 2IHTA 2XEDA 3EXG1 3N76A 3GGCA 3ZHXA 2B4YA 2C2GA 4X1YA 5T3YA 4PC1A 4EFMA 1GQYA 1LBHA 3CW2A 1F7UA 4UE6A 1BGWA 1B8UA 2RKWA 2NSHA 3CVJA 4I0WB 1T9GS 4K1LA 4TVKA 4MV7A 3V34A 4OLJA 4FMCB 1JYSA 1L1FA 1VSVA 2FUCA 5HCIA 3TDNA 3IIMA 3OOWA 3WP1B 3JSAA 4MR9B 1KVSA 4G1CA 3WLEA 4PZ0A 4JLMA 5KKAA 4IH9A 4H3KB 4HR7A 4FFLA 2IA5A 1YU9A 1I10A 4YECA 1NQAO 4X7PA 2RHBA 1E8NA 2Z83A 3NLLA 4XUDA 1EP3B 1CS4C 2PAAA 3HKCA 3NBMA 1AOXA 1Z16A 4X20A 1QPZA 2XZOA 3WWDA 1II8B 3EXAA 3VKFA 4EWLA 1RLJA 3H6GA 4XB1A 3ZQKA 4DG9A 3CVWA 1JN0A 1CB7A 3LWZA 3N8GA 5KOJA 4Q9NA 4N40A 3DEFA 3B89A 4JWKA 4P7BA 1Z18A 3TTVA 4Y6LA 4CMBA 1VCNA 1CFZA 3P2KA 3QPAA 5BSWA 4H4DA 2LW7A 1R9MA 3B38A 2YV3A 4ZZ1A 1OKKD 3V8PA 2QN8A 4YMHA 5FWXB 1J97A 4K9QA 1CY2A 4XGNA 2FPGA 3WHLA 2PY6A 2WAYA 2IEGA 3NHLA 4FXPA 3OI7A 2QVCA 2Z58A 1GRCA 1FJ2A 3U9TA 1YTUA 1JR3D 3ENKA 3ENZA 1XKTA 5FNVF 5LPNA 5CA0F 1HT3A 3EGDB 5ABPA 2B8EA 1FPQA 1SIBE 1TXGA 2YN4A 3RSFA 3VKUA 1KY3A 4QEKA 4LHSA 1SZCA 1E9DA 1A9SA 2ZSDA 2VYNA 3HL4A 1XMSA 2ID7A 2Q2NA 1E4YA 2QTWB 2BFBA 3EA4A 1CZNA 3LUFA 3QEJA 4KQ1A 4ME6A 3RASA 4BO4A 1SG9A 3ORSA 4MW4A 4FIZA 3DO6A 3LFUA 2B1RA 2DGDA 1VMAA 2B7BA 1RYEA 3SHQA 4TV8A 2JIBA 1NOKA 4U6SA 1ZJWA 5LKAA 1U94A 4R9NA 4DXAA 1GZ6A 5A9SB 4C2UA 1ECGA 2OFWA 3CS3A 3DE4X 4UNNA 5T4FA 3W1VA 4LSMA 3O03A 4OAPA 3WFJA 5KTPA 4KR2A 5BN4B 1RHUA 2Y92A 2CYAA 1DX4A 4IYRA 2H9IA 4MWSA 4AW9A 5KZMB 1JR3A 3ONDA 1EFLA 4KDFA 4PHGA 5C8XA 3MMXA 4OCZA 3EMKA 1GZSA 1FUYB 4G9BA 5EMNA 4B31A 4CM4B 2JEZA 5CFLA 1MNAA 4JT8A 1E2GA 3BH7A 9GPBA 1GCGA 4PLTA 2FZLA 2JLSA 3SMQA 2IE8A 2EW2A 1NVGA 3I2HA 3VH3A 5IF3A 3R5FA 2DTDA 3K0FA 2C31A 4JI4B 1EXNA 2NV2B 1AVTA 3W1EA 4BXOA 2GRUA 3WJAA 3WV4A 3OEHA 1X3LA 3I2YX 3OQHA 1A7UA 3LTNC 5IC5A 2JFFA 4C01A 3KUDA 3QJYA 2QUIA 2F9FA 2XWPA 4OJYA 3WK4A 2G9QA 1TCVA 2G40A 2OT3B 2YWFA 5EG5A 3D3KA 1U9IC 3AF5A 1X7HA 2WOOA 3PL1A 2GR9A 2O8DA 4A6PA 3OEEA 4ZTUB 3I30X 1Z0AA 1JAYA 2RHGB 1M74A 3G2LA 5JE8A 4P5EA 1NFQA 5CA1B 3ODPA 2GA9A 5JJBA 1CQIA 3ETLA 4F4IA 1JDZA 1TUGA 1V3TA 1GQQA 2MJLA 4G63A 3GRUA 4HYEA 3AG5A 4Y1EA 5FA6A 1Z0KA 1NQXA 2HA5A 1FQOA 1V37A 1CFJA 3I23A 3S2GA 1WMEA 4NULA 4P3YA 4W9NA 4CKBB 2YS6A 3GH3A 1PYGA 3WVNA 2PUAA 5IFKA 3LUHA 2AGVA 1O58A 2VH1A 1FP6A 3FROA 4RVSA 3NO4A 4B7UA 1UWLA 3PXGA 2A0XA 1WKCA 2M98A 4PNEA 2J59A 4ZVVA 4H31A 1Q0RA 3WGYA 2WHPA 3GROA 2VDKB 1U3GA 2ZRAA 4MUAA 5DBHX 1KNQA 3INTA 2XMZA 3AEKB 5F64A 1LCIA 3D4PA 4Z4CA 1RXVA 2EJBA 1FBNA 3VX4A 1G59A 3WE7A 2HIMA 3O94A 2ZRMA 4XARA 2PO7A 5CT5A 2IUUA 3ZX5A 5J2TA 4CKXA 4MS4A 3AWIA 2YX1A 4LRQA 1L7RA 4A0RA 5BSVA 5I3ZA 5IKMA 3F5MA 3Q9LA 4QBGB 4GT1A 3MGGA 1VL0A 2NZ2A 4EJ6A 2IYEA 4EHDA 4G25A 3I61A 2FFRA 2ZSFA 5FOTA 4O5AA 4CM8B 1AUXA 5JI2E 1G7RA 2A59A 3R7NA 4BX3A 1QS0B 4ZI2A 2OL4A 3RUHA 3IVGA 1B3RA 2Q6IA 1HQDA 2DQZA 3QVWA 1JX6A 4LPKA 2X3UA 2NO6A 4QM7A 1ZC4A 1VYHA 4ZVLA 6ABPA 1XXHA 3R6GA 3TRJA 1TAUA 1G2PA 1CE8A 1SXJC 4K0RA 3VUEA 4HT3B 1JQDA 2F43B 4J7XA 3I2FA 3VPHA 2LWIA 3QTTA 1S2OA 4QPNA 4FYMA 5E6SA 4CEIA 1RXCA 3TXXA 4BTVA 4EELA 1JLRA 4MKHA 1RZRA 3QVMA 4D9FA 1L7PA 3GZJA 2ANCA 4PVDA 5KOJB 4L9WA 3ZWCA 5EVCA 1GAWA 3RHZA 6REQB 1EDEA 1X0XA 3B1KA 1P5RA 2AHRA 2RHCA 3EIFA 3KUKA 2X76A 4ENUA 3P9KA 1WCIB 2D1SA 5LN1A 1H2XA 3T7KA 3GCDA 2AG8A 2IQIA 2A78A 2HKIA 3JQFC 3QFSA 1F14A 3GZNA 1ITZA 3CGGA 4I1UA 4JP2A 4RK0A 5KAPA 5IHPA 1HKHA 1R8YA 1C80A 3HK2A 3COSA 2PYZA 4OQLA 4J8PA 5DMHA 1V8ZA 1GEEA 5JWRA 5JH7B 4FS3A 2HWXA 4GBED 4OFXA 3UBMA 1MRNA 3EAQA 1GT91 3CNLA 3ZWBA 5AH0A 1MB2A 3VV3A 5KYYB 3GBSA 2IOFK 3S5UA 1TYCA 3C74A 5I45A 3MPUA 3CKKA 1PZFA 3TTXA 2FWMX 4HS9A 2D0PB 4H0FA 2WY2D 4NNPA 4RGQA 3G5TA 4MV4A 1EFUA 2PL5A 5E8RA 1ZN8A 4GYWA 3PQ8A 1D6NA 4DTIA 5GWXA 2A33A 1UBKS 1ZSNA 3RYFA 1VGRA 2YUTA 3D8TA 3SM3A 4EYKA 4E09A 4WL0A 2EBFX 2YWHA 3BE5A 4BTEA 5AQ1A 3LDAA 1DAFA 1JMVA 3WJ7A 5FLKA 3ABZA 1SC4A 5AXDA 4FMPA 2RI0A 2VAWA 4PTLA 1IY9A 1ZYUA 4K9LA 3U5ZB 2J5QA 1B42A 3RTGA 4BKPA 2EC5A 2NACA 3IT2A 1UJNA 2I7XA 4AF6A 2YV2A 1GG9A 3BT7A 3EDCA 4UM9B 2HCFA 2VHTA 4NOKA 4OHMA 4BNZA 4NONA 4WZAA 2IPOA 1GZ7A 4JUAA 3MTAA 4P4SB 1NUPA 4M1YA 8MHTA 3NBAA 1JU4A 4MWBA 5AVOA 3NTLA 2FGKA 1UJ6A 3W2GA 1ZK0A 1CP3A 2PSFA 3A14A 1EX1A 1ML4A 2NQ8A 2V7GA 4KL8S 4MUBA 4RQTA 2IUTA 4NBUA 1SCBA 3LCRA 3EIXA 5TQ0B 2A0UA 5AXAA 4GX2A 4OJTA 1FP4A 2R7MA 3OE5A 1IN6A 4M55A 5K0GA 3V4OA 4YHBA 1NNUA 1DO0A 4CXMA 3FPEA 4M1EA 3JWHA 1H8EA 2IZ5A 3CISA 3EVNA 1N9ZA 1AQIA 3GGSA 1CLUA 1N7JA 1R8XA 4N01A 5GY7A 1FJXA 4FNAA 1SD2A 3G82C 4XQEA 1VMIA 4DR5B 1WDLA 3CCFA 4N5LA 5CPBA 5L3QB 2IHUA 3HUFA 4LQLA 1JG6A 2Q3JA 4EG3A 3JYOA 1QVZA 1M66A 4XAQA 3TKAA 2ZIFA 1Q12A 4GUDA 1Q0ZA 3SXPA 1F9AA 1JJFA 4WH0A 2ZG6A 2GEBA 4RD2A 5LYJA 2P9QA 3QNMA 4XSVA 4YJ2F 2DBVO 1WETA 4KQ6A 4RJKA 1XRPA 1MU0A 1NM5A 2PMCA 3Q3JB 1YJ8A 4IOKA 4JUBA 4ETIA 5HFAA 5K3EA 2FLWA 3MMNA 3OQMA 3AFHA 1BCRB 1SXQA 2FWJA 1I6WA 3WZLA 3ZYCA 2G25A 5CK5A 2YWXA 3CH4B 5CT8A 4B17A 2OB2A 2QIOA 2EKBA 4YYEA 2VAVA 4E08A 5COQA 5ITZB 1YHYA 4MQEA 5DIZA 3IURA 1WQ3A 3F8WA 2QVBA 1FLNA 2AYXA 4X3PA 5J59A 1H9CA 1SXJA 3ENWA 4ISBA 1R9NA 1TTHA 2Z2YA 2FZVA 2LV8A 2R7NA 4HNGA 2VP0A 1D0IA 2FRXA 4KQGA 5JD6A 3AUSA 3NOXA 1SMKA 5JARA 1R10A 2WP0A 2FI1A 1JKJA 3O1IC 5D00A 2NZJA 3ADKA 3K4PA 3IGFA 3GZTB 2APJA 3GJ7A 3ZJ4A 4ALLA 2ACEA 2G3YA 1WCIA 3URKA 3EGVA 4B82A 4QXMA 3RGGA 4H4EA 1Z0SA 3E53A 2YQZA 1L5OA 1Z83A 3VKWA 2QRQA 3RSQA 2GDZA 1SAYA 3KALA 2BUBA 1NI5A 1H93A 1RLIA 3L3BA 4RJTA 3NEAA 4U63A 4PO1A 2LTAA 5JISA 4QTYA 2J3MA 1FDWA 3ETNA 3GPIA 4RULA 2EKQA 1VYVA 5AK0A 4F4HA 3ORQA 3E4CA 4IJMA 4YY3B 3EW9A 3T94A 4DQLA 2LPMA 1H2BA 4HRXA 1YIOA 2FR8C 3LUPA 4II2A 1FUEA 4JU8A 1ZD1A 4E21A 5C2JB 1M67A 2QUJA 1WVGA 1VHWA 3BL8A 4M9ZA 4MO9A 1Z7YA 4B7XA 4F4FA 2N0SA 5KQRA 3QXCA 3OM8A 2DHEA 2VXOA 4RM2A 3UWMA 3FCYA 4J6FA 3SJZA 3H17A 3TE6A 4UHFA 2KMLA 1PJBA 3ROZA 2PGLA 3OFNA 2QJOA 5DGDA 3R0JA 1PT5A 5ALVA 2F1RA 3MGAA 4YREA 2OG2A 1NW6A 3T34A 3DZFA 3RCBA 3TECE 1ESDA 3I9V1 3C70A 1JEYA 3JR3A 2Q7XA 1QQBA 5H4HA 2JLRA 1R9JA 2QAGC 2ZJFA 3R7WA 3VSEA 4ED9A 3P5BA 5BQOA 3ZKAA 1F9EA 2ATIA 1B2LA 1TTTA 1JKJB 3NDBB 2X0FA 1T43A 2YJ5A 1VPTA 4Z9AA 2IV7A 4KRYA 2J4CA 1EHCA 5DGIA 3U4DA 1KJ9A 1TM1E 4JMPA 5D5PA 2ZTVA 1PT6A 3UHPA 4DARA 2NG1A 2HLDA 4MQ4A 1T25A 2B6HA 2J48A 4PCLA 1TEHA 4HZIA 3TOVA 821PA 5JC1A 1AE1A 1KDRA 5DLEA 3B7WA 1L5KA 4YRKA 1ES9A 1L7DA 2C07A 2FMKA 3P19A 3N5KA 3RU2A 3CV3A 3UJ8A 2Q1YA 5L45A 1JDNA 5EP1A 4D2IA 1PD1A 4DBZA 2FPXA 2V5VA 2WUWE 5K9ZA 2ZTMA 5LZ5A 3FVQA 3O4JA 1CDDA 1T0PA 4PLZA 2C97A 4TUYF 4U5QA 3JQQA 3L77A 3FBWA 4G0XA 4JP3A 3LDUA 3R77A 2LIVA 2C9MA 1NBMA 1E6UA 2YS7A 3D31A 1FY2A 2ZR0A 1CQZA 3H4VA 2C77A 2FOIA 2JASA 3OIVA 1GDHA 1DRJA 2VK1A 2QE7A 5KSZA 4MVJA 3L01A 3F3MA 4A2WA 3RHTA 4DM3A 1WD7A 2IZ7A 3BJEA 5DVZA 5L6LB 1IN4A 4GI5A 1TM7E 1ISSA 1KEUA 4JS0A 2QHXA 1KXZA 3AR4A 3QJ5A 4RSGA 2X1LA 3AMVA 3RVLA 4BASA 1OWPA 3E9EA 1J8DA 1TIKA 4JVSB 3P4YA 2EX4A 2LP4Y 1DOAA 2AK2A 4LJ6A 1LXCA 5ALGA 1DRWA 2JD2A 3ACCA 1C9YA 3LUJA 3QYAA 3WLHA 2FP4A 3ZBPA 5ALLA 1QKIA 4EZEA 1ZUD1 5EPEA 3JQ8B 3IAEA 2Y2VA 1RWBA 3EFEA 4BEBA 1A8UA 1AKYA 1AUPA 1PSDA 2O1EA 2FW1A 1JECA 3DCNA 3UUFA 4FZRA 1ILWA 1P1IA 2A4MA 2DPLA 3KJIA 5BNWA 4JA2A 4KV7A 2IYNA 1T36B 1PFYA 3NCHA 5JVDB 2H52A 4JROA 1TZ2A 2YXPX 2OLEA 1VP9A 3H84A 1KQGA 3H1TA 3I8XA 4WK6A 4D9JA 4FB4A 1I7DA 4PS0A 4EPRA 1GQRA 2OZLB 3R0ZA 1P5JA 1YS9A 3WJ2A 5TLSA 1DAGA 1NP3A 1QH8A 2YFKA 2DJ5A 3IEMA 4D56A 3S2ZA 5KO2A 5JBIA 4O2BF 4EENA 4TLAA 1FXWF 3L7DA 2IEDA 3O47A 4OO3A 4URVR 3A6EA 1HM5A 3GU3A 2G72A 2A84A 2EFEB 2VWHA 3MHTA 3U7QB 1RE0A 2UYCA 4L2IA 1SUDA 2L19A 4PRYA 1N0WA 1PZNA 2B9EA 1OX4B 2HJRA 2JGFA 2WTBA 3DTVD 3DVLA 1XTTA 1ZVQA 4KXXA 5H83A 4F71A 1BDIA 1US8A 5DFAA 1OZ0A 3UJ7A 1A2OA 2AEFA 2WNSA 3CX6A 3H83A 3ZEIA 4AJIA 1QIHA 1E3QA 2CFIA 4I1IA 5DBGA 4LGMA 1BCRA 1NX9A 1TAHA 4GVXA 4M8SA 4P4TA 1U0BB 1UXIA 5AKLA 4OHYA 4E7OA 1WOMA 4JLNA 5BNFA 2YHAA 3QY9A 3PQEA 4W8HA 2W2KA 1ZD2P 1WXGA 4DBVO 1A9QA 4BFCA 2CC2A 3DBRA 5G0TA 4EQZA 2QM7A 4NMMA 2VK2A 1RHRA 1TAGA 2J9RA 4L2IB 4MVJI 3OOHA 2N3ZA 2C7BA 5EMLA 3K0HA 2F8TA 1FEZA 2ZVPX 1SCAA 2PR2A 2ZXEA 1T26A 4LCEA 3QMMA 3AHFA 4FFWA 2WMNB 1B15A 1XFAA 1CRWG 3QLVA 1T24A 4JBHA 3TLZA 2I78A 4DSTA 1IDN1 2A58A 5TVGA 1U8UA 2MINA 3RSCA 2R8OA 3EYWA 1CY7A 4UNPA 2JHGA 3OJCA 3DF7A 1HSZA 4LZPA 5TQ0A 1E1QA 1VSQA 1QFMA 3N86A 3UV7A 4RYDA 3F96A 1DRKA 1YZNA 1ACLA 3ZQ6A 1IVNA 4R5HA 5CM9C 4J4BA 1WRBA 2X2OA 2Z1DA 4IJ6A 2ZZKA 4FWTA 3TH5A 5I9MA 4GKJB 1E3WB 2PMWB 2QE7D 4TYYA 2QNIA 5KOYA 3IP8A 1Z28A 1M1UA 3K0CC 4EHLA 1FDUA 2OGWA 3C3MA 2LNDA 1GTJ1 2HHJA 4RPKA 3U7IA 3CNOA 3TQCA 1K7CA 3EY9A 2RGYA 4KUEA 4YH1A 1YASA 2BH9A 4X1KA 3ZQJA 1D2NA 1UBMS 3FYUB 4L9AA 4RE6A 4EABA 2PH7A 4I81A 1R66A 1XQXA 4W7HA 4F7DA 1PLLA 3MGBA 3RFCA 2H57A 2IUFA 5CNMA 1YVEI 3QIAA 4B09A 3DPIA 4R2JA 4CMEA 2VI5A 1E1KA 2CFRA 3RUCA 4DLNA 4F11A 1Q92A 3PFBA 4EHAA 3LI2A 4HB2A 1ZHFA 1E1YA 4JP1A 2HRDA 4M1WA 3WGOA 3B3GA 1CZOA 1GN9A 1Q20A 1WV0A 2G5GX 2XYRA 4WQMA 2WR8A 4ZI5A 3UH0A 1J70A 1YMQA 3GOHA 3IDZA 2C8LA 1YS1X 4N47A 1TL7C 4C7MA 4JLWA 2V55B 5DGHA 5D86A 5C7IO 1EVZA 4YAEA 5I7OA 3C1TA 1QIMA 5K8IA 1XVIA 2MT9A 3L8HA 3ND8A 4HY3A 5TQVA 3UAXA 1BOFA 2X0KA 2Z5LA 3PXBA 4AK9A 5DLQC 5C81A 1SB9A 4BYGA 4BJ1A 1WWKA 4R9RA 1PQYA 4C21A 1PS8A 1B23P 4B6RA 2HK7A 4YRGA 4H6WA 4XW2A 2ZBFA 1I7SB 4J7AA 4BKMA 1I0LA 4U0JA 5BN3A 2OE2A 4R2KA 5E9QA 3DHVA 4X92A 1H6BA 1W93A 2ZBPA 1BMQA 2PQ2A 4GI1A 5TARA 5L53A 1HBJA 3I9JA 1T5OA 4LI3X 4NAUA 3A1FA 3ZGVA 4V0OA 2MSDB 2WWFA 1B1CA 1RWPA 1VJDA 1GNQA 3CIOA 2V4MA 4NBSA 1RQ7A 1QP7A 5EMJA 3U44B 4P80A 1GG5A 1GFSA 3AKDA 1WQ4A 1SKYB 1C8VB 4MVJF 1J09A 1JG7A 2HXYA 3ED1A 4FMBB 2XF8A 4LMAA 3RIEA 4C07A 3SQXA 1KAHA 1Z62A 4L0MA 4WKGA 5KSYA 3PHBE 1T5IA 3DBLB 5DYWA 1ORRA 3T4XA 4Y2GA 2JCGA 5C5IA 1Z34A 3OIUA 4S0ZA 5KX5B 3IQEA 3W5IA 1ADYA 2FQWA 2RHJA 4A0HA 1IUPA 3AERA 1XUOA 4CIBA 4INAA 3D4LA 5J4LA 1JHPA 4ZT5A 5LQUA 1GZ3A 4KK4A 2VT7A 4C5AA 5CEEA 5TPZA 4AM8A 5LL6P 1EEHA 2ID4A 4HDSB 4E0BA 1I2AA 2IDJA 3KFXA 4YS6A 3Q7PA 4E3ZA 2PAFA 3GPLA 2NUPA 3SYTA 1W9MA 3WLNA 1Y81A 3QE3A 2HZBA 3QMPA 4MGZR 3WO0A 1NBHA 4ZK6A 2Z4TA 4KDEA 5EIBD 3OKPA 1APBA 1W4LA 5FOVA 3KU1A 3VR1A 3ZV4A 2SKDA 4ATNA 3U19A 1E9EA 1DAMA 2ZVJA 3H9EO 3IUMA 1TKBA 3Q2IA 1TM4E 4HMQA 2MHCA 4R7ZA 4KR7A 1GU7A 2XUPA 1TDJA 5KPJA 3B6EA 1KZYC 2VRBA 1ZN7A 2Y0DA 4K9OA 5ELMA 3SNKA 1XEXB 1UH5A 1P2UA 1D9XA 1PW7A 5C4MA 4AKGA 2A9QA 3HN2A 4EJSA 4X3CA 4IY1A 2H85A 4ALNA 5KX5A 2B2CA 5GP1A 1RWKA 4D25A 4EEKA 4A26A 2G5TA 1XLWA 3QX3A 3TQRA 1II9A 1AS2A 5FWYB 2N9UA 2HN9A 2ZM6B 3K4QA 5PNTA 3W9UA 1GXSB 1N2CA 1URPA 3A4IA 4CIWA 1DC4A 5KINB 2WPNA 5TMEA 3CB2A 4G1UC 4IQ8A 4WDRA 1SEPA 1GGKA 4BX9A 5HXAA 2NTJA 1SVSA 3ROXA 4AQYB 2B1GA 3ESXA 4DLLA 1B00A 4FOSA 1KPIA 4B6JA 5DYGA 3L4BA 4AJJA 1BYUA 3P9SA 3WLOA 1KSHA 3QVXA 3GGPA 4BFTA 3H5IA 2BFDA 1Y9AA 4ZAGA 1NW7A 3AU9A 4N3GA 4BNYA 1BVHA 2D06A 1XJ5A 1U1GA 4ZCMA 5P8WA 1Y1PA 2HIHA 4YUYA 3BCRA 1XQ6A 4C2BA 5KNBD 5TNXA 1JA1A 5TMPA 4XM2A 5KB3A 2GYUA 4TZKA 1JKIA 1NR1A 4GS5A 3DWEX 3KHTA 4KQCA 4CLRB 2VSOA 4FMDB 1JEJA 2PX4A 2NGRA 2Y4NA 4S12A 2C5HA 4YGYA 5LBTA 2IWRA 3WNDA 1X7ZA 1L1EA 2FZCA 3F49S 4L4YA 4X90A 3SHTA 4D8TA 1FP2A 4UCWA 1SIUA 1JDSA 1QZ3A 4FHGA 2CLOB 2VC2B 1TVMA 3FNIA 4ZOQI 2JS7A 5F51A 5EHZA 1NVDA 4WZAB 4ZO7A 4DMLA 4A15A 2R1TB 4RZSA 2IWHA 3WRXC 4BNFA 1Y63A 10MHA 2YWRA 2WSYB 3KVOA 3PI6A 5K3AA 1EFHA 2YASA 4AT1A 3SYKA 4Z4QA 1E6MA 4K03A 3UZUA 5C7LO 1QR2A 1CXZA 3AVWA 5FT9A 4WXPA 5CFZA 3VTAA 4AJNA 2W6ZA 1U2EA 4TWBA 4ISCA 5JY6A 4JOBA 4S1NA 3IIIA 3PDJA 2FEKA 3PNBA 1Y4DE 4MS3B 5THXA 4XDYA 1GL3A 3WA6A 5FX2A 1K4MA 4GYKA 2W8ZA 3EZ6A 3H5VA 1OOEA 3NBYC 2ZYUX 5A9RA 2I3ZA 4FR5A 3ZNOA 3F4LA 4EITA 4D44A 4E22A 1ABEA 3W8FA 5EKXA 4GKKB 1FDSA 4CT5A 4ON9A 2BMFA 3DMDA 1SC1A 4YMGA 5LB2A 4CF7A 4JBWA 1AQUA 3KQUA 4Q1VA 1D2RA 2O2GA 4P8RA 4KQXA 4KU4A 1KVUA 2C4TA 3H9BA 1RJGA 1KH1A 3QM1A 2OYCA 2FJ0A 2XH8A 3OWOA 5KNCH 3FA2A 5EN4A 1XKLA 2SKCA 1MXFA 1RTKA 2O8BB 1BW9B 4PO8A 2B61A 1T9AA 2HF9A 5HGXA 3H8WA 3B1FA 1WXFA 2YXBA 1HDCA 1IBRA 1PNOA 3JAKB 3KHUA 1BVUA 3E0XA 3CZAA 4MHTA 3Q8LA 2EWMA 4N1AA 3AFOA 2J5XA 3AEQB 1O94A 3R74A 3R3HA 1I3LA 3KZNA 3QVGB 2WKPA 2WYHA 1CD5A 4X1OA 5IYZF 1GTRA 3THWB 3AI2A 1LLQA 1Q57A 3QITA 3EOBI 1EFCA 2ATCA 2XF2A 2ZIAA 4QX6A 4DQ0A 2WJYA 2MSKA 1PNRA 5AFSA 4BNDA 2Q9AA 4O2LA 1EYZA 2X9NA 4RQBA 3GUUA 4KPUB 2EFCB 4EB0A 3P96A 3EIOA 1Z2OX 2PX3A 4EYGA 4GLOA 2B4RO 1DZ3A 2AT1A 3PDWA 4EFDA 4ZYWA 2IS4A 4PM4A 4C05A 5JAIA 1V8DA 3QFCA 2ZSJA 2DCUA 3OU6A 1CW2B 1Z6TA 2QYHA 5ALTA 4RV9A 3V2UA 4DMKA 1YB4A 4RZXA 2WIDA 3HB1A 4EW2A 1DFGA 1PNVA 2AF4C 3OCVA 3IIEA 4M46A 4M7PA 5EE0A 2WIJA 3AINA 3W8DA 4Q00A 3WK9A 5JC8A 1QHHA 3MTIA 5DXFA 1KKMA 1QGOA 1J2RA 4JJZA 1G42A 4TMVA 3RREA 5BYJA 4PSAA 3BILA 3LECA 3OBIA 3IR7A 1TTQB 4AO6A 3TUZC 1NBAA 3BFKA 2C3YA 3F6CA 2ZRIA 4KUHA 4OSPA 3KAPA 4OBEA 3ZGYA 4HNSA 5ITWA 3HYRA 3EXEB 4YP1A 4WOPA 4D92A 4F12A 4RTQA 4BMOB 4HH0A 4TL9A 5KYGA 5DEOA 2XEXA 1RQNA 2JGDB 3ZY6A 2AHOA 1DJQA 2VNSA 4DLWA 5GIOE 1H0RA 1NYLA 2WB2A 1YJBA 2CNBA 3BMNA 3L84A 4W7SA 1J39A 4TRRA 5K0EA 5K0JA 3V4LA 4HNVA 4ESVA 4CF6A 2AJCA 4ZYXA 4RAQA 2FUEA 3Q8WA 1FFWA 3MA0A 3PEFA 2L0XA 5FR2A 1L5WA 4IR7A 2A7XA 4B3TB 3CJRA 3CURA 2QM0A 3A1WA 1GT6A 2G07A 5DBEX 3WFIA 4XXHA 4QU0A 3SJ7A 3NZEA 3TQFA 3EASA 3ZOKA 3GLGB 5B7NA 3IP3A 2O1SA 2C2OA 1QKJA 3DT6A 3K0KA 1PK7A 4EAQA 3U44A 1RKVA 2NM0A 3CEHA 2ZB3A 2C00A 2QG4A 4RE5A 3E3NA 3ZBTA 1UFRA 2QRUA 3QEAZ 2IU4A 2OEPA 4MR8A 2CHGA 4QFMA 5EZ5A 2DY1A 2OO5C 1D09A 3CY6A 3F7NA 4J6EA 4QXOA 4R2HA 1HNZB 1DRUA 3CR8A 5J2TF 2V6BA 1ZINA 5EQFA 3PK0A 1TUIA 5JS1A 1SZPA 5I8PA 5AJTA 2E2WA 5HZGA 1OXXK 2I03A 2PJZA 2VT6A 4KLNA 4TS9A 2PFGA 2OFFA 1F2UB 4LMRA 2Q41A 4XVRA 1QORA 2GZRA 1SUAA 4Q15A 1D8AA 4NBLA 2PX6A 4LJ4A 4BNXA 1HYHA 1X1SA 2VPZA 4H9GA 4JX8A 4M9QA 5C8YB 1JFSA 1P2FA 1V2HE 4RACA 2B30A 3EF0A 4PIPA 1A0OA 4TPKA 2FTKE 4UDOA 3UTDA 6REQA 2EF0A 2H4WA 5T41A 2VBIA 1XR3A 4ESHA 1QKKA 3AETB 3K4HA 3U4GA 4LX0A 3ETHA 1K6IA 3QNUA 1ID1A 1YACA 1C7FA 3FPGA 4F84A 4ZD6A 2PZLA 4MIYA 5DTJA 1OGYA 4TV9F 2F17A 5KJFA 1A97A 2RCYA 1LDBA 5A3RA 5LLTA 3C6QA 2CVHA 4UQOA 5FPQA 3GFSA 2IV3A 4BN4A 1C1DB 3EZLA 3QV1A 2D00A 3UM9A 1J9EA 4C14A 4DT1A 4FE7A 5K3FA 4FC6A 1JQEA 4MGYR 4YJKA 1G20A 4A23A 5I5EA 2DB3A 1JTEA 2H5EA 4CLOB 2P62A 2VDPB 3SIRA 4D81A 2HA2A 4WADA 2KHZA 4X85A 2LXNA 1SXPA 3H16A 5FLEX 3MC1A 5FV7A 3MM4A 3M83A 1YR2A 4RXMA 2PSSA 2W6QA 3GQBB 1H85A 1QTNA 3LMKA 1QHSA 1BEUB 4HH1A 3GT0A 3ICVA 2Q5CA 3RNLA 4PRKA 1AN0A 1KXJA 3CRQA 1CDZA 1LF5A 3K6RA 1GGNA 4DREA 2AK3A 3AY6A 3IUYA 3DMYA 4X93A 3GGDA 2Y77A 4JJ7A 1JKXA 2UKDA 4MA5A 5FPHA 2Y0EA 5C1BA 2YJTD 4JH0A 2LVBA 2CWDA 1J20A 5BN3B 1I4DD 3F90A 2HSDA 2VHVA 4YRRA 4TL7A 3HP1A 4AYTA 4RTJA 4WKBA 5MHTA 3THSA 4UTRA 1FTYA 3RS0A 4AG5A 4MWCA 1SKYE 1LVUA 3W7VA 4PGMA 4AL4A 2C7RA 5CJJA 2VJCA 2DPHA 2QNRA 5JECA 1KZ6A 1SUEA 2ZAOA 5AHRA 5E3HA 4QUIA 3D1LA 4L3WA 3ZWWA 2IP1A 3GLHA 4MJ3A 4U7DA 3F73A 3CRW1 1HTBA 3SQMA 4QG7A 4J9UE 4LE2A 1G16A 2WF9A 4EPXA 3RC3A 1K66A 1MRSA 1RAHA 2DPXA 1BRMA 4JFAA 3L93A 5FA5A 2ISCA 2HA4A 1L5MA 3EFBA 1D0VA 3GJ3A 4RK6A 2ORIA 3DKRA 3LY8A 1JIVA 4AZWA 2BGMA 2GGSA 3AL2A 3QWHA 3VC3A 3VPGA 1JPVA 4CHTA 2X22A 1QG4A 4Q1EA 3WOHA 1Z4JA 6NULA 4ICIA 4KPYA 1I1NA 3MXOA 4X91A 1BVRA 3SSOA 5CD1A 5TPWB 4N76A 1T2FA 4YRFA 4RMIA 1B8NA 3ME5A 1KC3A 1DEHA 4CM4A 4C04A 3L8GA 3COZA 1QH8B 5ALDA 4G97A 2ZRBA 3KR2A 5FCDA 3VJKA 3Q7SA 1G8SA 2QX6A 2HLHA 5J5AA 4C0WA 3A4LA 3CX8A 3LQRA 3PD7A 4MAAA 1RRCA 2GUGA 2RK4A 2XAUA 4X95A 6ADHA 1BXZA 2GB4A 2WSLA 4PZLA 3JASB 3H5NA 4YAFA 4R1SA 5FORA 5HIKA 5ECGC 5BNTA 3BIOA 2ZIXA 1JLSA 1C41A 1UFKA 2OBMA 4MJLA 1ESEA 3D3QA 3PC3A 3KZKA 4UREA 3TXAA 4DG5A 1PK9A 4TMWA 4F6LA 4UKDA 1I7NA 1OX6A 1UCFA 4U8HA 4D9IA 5B1DA 5KNCD 5JSZA 2AYYA 3Q3HA 4B45A 5CT4A 2Z3WA 3HRHA 3M1IA 2C9DA 2GSWA 5A1JA 5KDOA 3ZNNA 4YJGB 4JVNA 4ZOLF 1R64A 4Y9SA 4MCJA 1PSZA 3NONA 1KI4A 2PT5A 5BPHA 5J43A 4KREA 2XGOA 5K01A 1HE8B 1W4RA 2D6FA 2V9PA 5B3LA 1LX6A 4LK3A 1LS1A 3WLIA 3TCNA 4HNAB 1A2BA 4A0GA 1IN8A 2AXNA 4GX0A 5HOQA 2RJNA 3U16A 2DQ4A 3IDOA 1Q14A 4M88A 1VMDA 4C7OA 1TU4A 2OECA 3FZGA 4GW3A 2REBA 5LXTF 2RFLA 1AB5A 1G4HA 1R88A 2GJKA 4YAIA 3CUWA 4P5PA 5J1TB 2PCJA 4C0JA 3AQ4A 4ZHQB 4B9AA 4ODIA 4KACA 2OQVA 3LC1O 2VF5X 4V3CA 3T61A 4K0KB 2PPVA 1FUUA 2WBLC 1JH8A 3I28A 4RHXA 3N7AA 4UDXX 1GPYA 3VC7A 4ZICA 3K53A 4NARA 4UM8B 5B1HA 5IPFA 2V54A 3OF3A 2LDBA 3EXFA 1S9DA 1OZAA 3KQVA 2X9VA 1ZUNB 2PH1A 4FYHA 1ST2A 2UYQA 4H1HA 2OFPA 4FFOA 3JU3A 5FQNA 5JH7A 3MJEA 1QTQA 2P69A 2A35A 5AOBA 4G26A 5REQA 3U37A 2O52A 1VKNA 2HMTA 2FF7A 1UPAA 3KFLA 3HJBA 2A94A 2PQMA 4BE9A 1JG2A 2WUGA 3K96A 4JGGA 4CODB 4EHHA 2AI2A 4NQRA 3REOA 1G0NA 1D4OA 1X39A 4XQ0A 4R2XA 4B1FA 4BHTA 5BV7A 1ESNA 1GNPA 1NV8A 1JTFA 2B4TO 2G9NA 5AW0A 1XRMA 3OE7D 1M6VA 3NVDA 3UT0A 2MDTA 3I6BA 3W5CA 4RLSA 3S1AA 2OWEA 3M0EA 3PQFA 5L51A 3U4QA 4R6WA 1ZNZA 3MJDA 3FRJA 3LX8A 5J2UA 1EM6A 2I5PO 2G4VA 1S8AA 1C9DB 2Q1UA 5ESWA 3JWPA 2Q1XA 2IUYA 4IIFA 2YZ2A 1PJLA 3ANMA 3V1YA 3MMZA 1NZDA 3KNZA 3EVBA 4V3BA 3WRVA 5B1YA 1NU6A 3ZJTA 1UPBA 1I9GA 4UTZA 1J1UA 1G1MA 2GCOB 1Q3KA 3QX7A 3USES 1Q2UA 1L7XA 1C8KA 5CDFE 3SZOA 4QJ3A 5JJCA 5KYKA 4M8LA 1E3IA 2PRYA 4FGJA 3TLAA 1W36D 2CDBA 1J2EA 1UT6A 1ECFA 1O97D 1NXTA 2HX1A 2XE6A 4DNXA 3OTQA 1ND6A 3V1UA 1I51A 2GNOA 3JS5A 1TIPA 3AX6A 3I92A 4JQYA 1XQ1A 4KWEA 4MS4B 2GA8A 3UMVA 5KTMA 2C7PA 2H8GA 1PJTA 3VPFA 5DASA 2I7TA 3OQBA 4FFBA 4B6PA 3MINB 1GPH1 4LHWA 3OOEA 4E31A 4QBIA 3AEKA 6YASA 1G41A 4R1PA 5FP0A 3V8QA 5A03A 3FMGA 5DX0A 3ZIUA 4BBPA 2G06A 4L6IA 1ODJA 5JZOA 1E8DA 3AKYA 1QGYA 4C76A 3R6TA 4FN4A 1AKWA 2WYWA 5ADUS 3KPJA 1A4XA 3KQTA 3KTDA 4O33A 2GF9A 2IHVA 5JAMA 1FRQA 3FTNA 1GTG1 1ZCZA 2QX8A 3P2OA 2J7KA 4J3JA 5ILOA 5DK6A 3NNSA 1U5BB 1UM8A 2IPMA 2ODEA 3ER8A 2P9YA 4RV5A 5H0IA 1C2TA 4UBIA 1TKCA 3QHPA 2AE2A 3SXUB 4ZZ3A 3R7WB 1R8JA 3DOUA 4FZJA 2WWXA 1XDUA 3P0FA 4U0KA 2W70A 3S68A 2O2YA 1QK3A 4HNQA 1H2EA 2WAMA 4DMMA 5FLXA 4J2HA 4RF3A 1H94A 4K2AA 4BVFA 4B3JA 4EY5A 3I58A 2OZPA 1GAQA 1IPHA 2Y6UA 2XDAA 1YJQA 1YB5A 3IKVA 4L02A 3SQWA 1FXUA 5MGBA 2GESA 2VG8A 4C7BA 2Q4TA 4LK2A 4N8SA 1RI4A 3NTQA 2Q27A 2ZYTX 3K5WA 3IELA 1S2NA 3V4RA 1SIOA 1K06A 4MVCA 4ZAVA 1FXSA 3OT1A 2PV0A 2CXHA 2JK1A 1H2AS 3AUJB 2DQKA 2HRCA 5C8DA 5EJ5A 3VPAA 4CRWB 4IJVA 3X1JA 3B5IA 1HT1E 4CG0A 2RHDA 4Q1BA 1SWWA 3K9CA 4MJXA 3BWYA 1XC7A 3GLRA 4KVAA 3D6VA 2AMVA 5H16A 4TYWA 3E22A 5LA6B 2RJ3A 1H4QA 4BNMA 1L4GA 4XASA 2N46A 5SV2A 1N32B 5EWMB 3GLHB 5DE3A 3VO9A 4ENSA 2CCGA 3UMJA 1VBKA 3U1BA 3BCHA 3H75A 5IF9A 5E4YA 3V8NA 5SYMA 4KGDA 1AM4D 3LIPA 4MRVA 3CEMA 3G0BA 4OB6A 4RJJA 1XP5A 1PE0A 2DPMA 4HDSA 2QUZA 4N6OA 1CS0A 2HHLA 3NYIA 4NU5A 1VHJA 2VA9A 4CQLA 5EAIA 1CRPA 1OA1A 4ZT7A 1PDWA 2AXQA 3MYYA 1EAMA 4GF5A 5A4FS 5HM8A 2XGJA 4R01A 4TKLA 3UKOA 1W75A 2CXOA 3KS9A 4Q03A 1I4LD 1F8GA 1H1LA 1CT9A 4CKYA 1A77A 4JCCA 4Q34A 4IMJB 4R16A 4UNSA 3T7SA 1DMSA 3VR5D 5ENDA 2WZBA 4X6UA 3H3FA 1N3BA 5F2KA 3TDMA 5IAEA 2C1ZA 5JYEA 4EG0A 2AUTA 4HB3A 3KX2A 3L0PA 3UH1A 1V45E 1Z5WA 2BLNA 4U7PB 4V0LA 2QL6A 1T5DX 1PTKA 4G0PA 4BNHA 4K6OA 1E5LA 1FMFA 2H4XA 3VOAA 4IEFB 4P4GA 2F3UA 4N8EA 4P84A 2QK4A 1Q7EA 4UTOA 3IEIA 1J8YF 1IUOA 2ARKA 3GLQA 4Z2YA 3RYIA 4Z1MD 3WQBA 4H0CA 3FOBA 3IUNA 3ZN2A 3QELB 4RFSB 4E5NA 5HWSA 4BQEA 2ICAA 1J24A 2BN4A 2HSJA 2ZWAA 5TC4A 2OV6A 4UU7A 3IFSA 5HFNA 2XD4A 5ICGA 5E6RB 3X1MA 1WM1A 2XXBA 4I1SA 2AOTA 2E5FA 5IU6A 2WDPA 1XU9A 1Z7WA 2WP8J 1Y7PA 3DMPA 5KNBA 2FN9A 2G88A 2PUTA 4NPAA 2FPRA 1LU9A 1J6UA 1Z4IA 2B7LA 4XD2A 5JFOA 4DQUA 4KMRA 4UHDA 2GN0A 2B6NA 3MUFA 2R8PA 1NBMD 4ALJA 2FHPA 2VRCD 3FF4A 4GE0A 4IRXA 1QC5A 1K7XB 1EM8B 1T8WA 5EGNA 1T5TA 4MLPA 3G7NA 4O4IA 3WIDA 2R84A 3LPDA 1P8JA 4QL3A 2VQSA 3AK4A 4ENQA 4V1CA 3RLFA 2PKQO 5B7QA 1CZKA 3QVLA 3FB4A 4OXQA 5CPFA 2R6AA 3VYUB 4E15A 2P4EA 2PMEA 1E7RA 4LFAB 1IVYA 3IOCA 4Z7NB 1HUQA 4NPHA 4C06A 4ZZ0A 3Q8KA 4YDHB 2A6PA 3T3NA 1QX4A 1X86B 3E18A 1I7QB 2AF3C 9ABPA 2VHJA 1S3IA 1RU3A 2DHCA 5KYWB 3PS9A 2RGAA 3Q6MA 4J91A 5JCOC 4NJMA 1D9ZA 2W43A 3ANNA 1CY8A 4KZPA 4ZREA 3VHLB 3VNUA 1NPTO 2GZMA 5EINA 2FZKA 2I62A 3I4FA 4QECA 1K9VF 1XNRB 3DUFA 1C0LA 1MMFB 2GNPA 1O0BA 4ZVMA 1F1JA 5D5HA 4OJNA 3KDSE 3WXMA 3CG0A 1L8AA 3FCXA 4ZCTA 3PHLA 2HA7A 2COKA 2V65A 2XUQA 4NC9A 5T67A 3PLRA 2IT1A 4FCWA 1ZC3A 3MTJA 3AM1A 5CNIA 1QGED 2QI9F 4P22A 5IT0A 1PJSA 3C5HA 3HU3A 4KMSA 1U4SA 1K0FA 1LVHA 1RJDA 2KYRA 3G6WA 4Q18A 5D7BA 5D2CA 3T3MB 3VAYA 4LF7B 3D6AA 2PUGA 1FBTA 3TD6A 4YRZA 2RSLA 4E3WA 1WCV1 3VUFA 1TF7A 4EDFA 1IOLA 2GS9A 2G5CA 2Z2ZA 3S7TA 3V55A 4DNOA 4WMLA 4C6RA 3E82A 2W2MA 2WYUA 1B6GA 1QU2A 1Z2PX 1YRBA 3CUKA 3LT1A 1E3JA 3WHIA 2HWWA 4JSRA 1E20A 4C20A 3DNFA 3EK2A 3A28A 1L4HA 1NIPA 4IOLA 2XB8A 4EP1A 5TDHA 4DRXB 4TYMA 1CY4A 1I36A 3PLNA 3NV9A 3Q2OA 1LX7A 2AX3A 2BT4A 1QF7A 4OU4A 4U2GA 5DYTA 3TW8A 5AKHA 2RIPA 5TPWA 5J58A 4DMHA 1XMVA 4GLLA 2F43A 1IWBB 4YK7A 4LFCB 4Z7QB 3GYBA 2NZUG 4PBSA 2ZTHA 3H2HA 1MOZA 4FX2A 3LDFA 1ZXLA 2X1MA 1NKTA 4BQIA 2XOXA 1X1RA 2Q9BA 1OFVA 3FPJA 1CRZA 1GKYA 1NU8A 3KVVA 4QODA 3RBXA 4X63A 3TLGA 2HH9A 1KO4A 2YH2A 4PR0A 4UVGA 4ZAYA 1ZAYA 5JLJA 1I01A 1UPXA 2P4QA 4GM4A 1IXZA 2O7QA 3WI7A 3KLMX 1PFQA 1SRQA 4IGKA 3NFRA 3VZQA 2VHYA 1GUFA 4F46A 3CVYA 1JPNA 4GR4A 4KW7A 3PNOA 1SY7A 1T0IA 3SR0A 2W6PA 3NTUA 3GUHA 1N2SA 2NO1A 2W0SA 4QOGA 3KOZA 4XYGA 4PQYA 3D2CA 3GXBA 1P4RA 3PF8A 4QGHA 1AZTA 3C85A 5IJZA 3C5EA 3ICEA 2DH6A 4QWMA 5JAHA 4HDRA 3LQYA 4MQ5A 1HH4A 4HG2A 2R66A 4LA4A 1GRQA 4R40A 4AZSA 2PWAA 2CXNA 3R3YA 4I4TF 4DA0A 5IM4A 4BO9A 2O2SA 5BPFA 2JIQA 2C82A 1B93A 1XZFA 2IZ0A 3GJRA 2HRBA 1IATA 5ESDA 5AK6A 1O9GA 4KKVA 5FAXA 3UOAB 1K97A 2REOA 4DC1A 5A5VA 5KYXA 4YAOA 3SVLA 4EMSA 1BDHA 1B1AA 3SHWA 2BISA 3HVKA 3RQSA 2IYWA 1D6MA 2ZAGA 2G0TA 2PVPA 2RAUA 3O0DA 4EHJA 1KMHB 1NL3A 3KRTA 1NLZA 1PNTA 5JQGA 4FGLA 4M1QA 2PTGA 1GY8A 2NW6A 5EIOA 3HR7A 1V5EA 2K7ZA 3EBPA 1DTSA 2C20A 3GGGA 5FIUA 4Z3KA 3DZJA 1XMJA 5K20A 3EVTA 2CXUA 1IZ8A 1TOAA 3A6ZA 1UBCA 1MB9A 2XYHA 3AB7A 1HE4A 3LGAA 4IJQA 3GJZA 1KRXA 3F6SA 3IAFA 4IXWA 4HK4A 1HA3A 1Y6RA 4JLDA 1QUFA 4U2BA 2B2NA 2Y1KA 4PX3A 2B0JA 2PK3A 4GH5A 1RADA 3RJ5A 3G2OA 1W8DA 3GRPA 4QOFA 5K0FA 3OUTA 2VYVD 1C1XB 2JIZD 5DCLA 3KC2A 4QYIB 5E4JA 2V5AA 2BI4A 4R2MA 3SFZA 5D6NA 3SYNA 3WL6A 2ONKA 2PT6A 4Q7MB 2QTFA 5IABA 3CUYA 2JCXA 1C4XA 2ZS7A 5L40A 3K05A 3FMVA 1PTJA 4YXWA 4ER7A 1OBFO 1VG8A 3E7PA 3DKVA 1KYXA 3PGJA 4LXTA 4ZOLA 5GGYA 2COUA 3G59A 3GUVA 3UY4A 2RE8A 2W48A 3AETA 3E9RA 4OL0A 3GT7A 2PZMA 3LT4A 3RRMA 2J8ZA 2Q5HA 1O7JA 5JZMA 1V1RB 1JZTA 4LHZA 4L4RA 2I9PA 5DOVA 4WY5A 3SSNA 2VF2A 1Y1TA 3E9DA 2K6GA 5ALJA 1GD1O 4AC9A 1NXOA 1QCZA 5HE9A 3D3EA 1MUUA 1ZS9A 4UXIA 4B35A 2WTUA 1TI7A 1EUZA 2J67A 3I9NA 3WB0A 5KQMA 3PJEA 1KJQA 4HEA1 1MJNA 4U9HS 2A3RA 2ZAYA 3OTOB 1EG2A 4BRSA 4GP7A 1FK8A 3DNMA 1DQZA 3FPKA 2FOXA 1QQ5A 1XTPA 2DWOA 3PNMA 1YRLA 4HLUA 1HZJA 4JN6B 4XUCA 5JSUA 4XKJA 1XAHA 1SCIA 1LUAA 4F21A 4E51A 1UODA 2D0IA 2G36A 3SKVA 2CMFA 4OL9A 2QMOA 1X1CA 3O7MA 5C5EA 4BMDA 5LNK6 1SQSA 2WT8A 2ZS8A 3UC5A 1WU7A 3L7BA 1WEKA 3U0VA 1ZVJA 4OBBA 4WCFC 4GM0A 2O2ZA 3SBOA 1V4VA 4BLRA 4Z0NA 3LQKA 4L74A 3PVZA 5IP5A 1RZRD 4XQGA 2YWBA 1VMEA 3QYJA 3IMKA 1RPTA 2ZI7A 4ZQGA 4ERNA 4RIHA 5JD4A 2AJ8A 5AWFC 3ZZ0A 4CPDA 4MZDA 3F6EX 4EUHA 3TGPA 2FSGA 1M2HA 5BWCA 2HV9A 1T6BY 4HWGA 4G5HA 5IBPA 1XB2A 3UAVA 3G49A 1IQPA 3LY5A 1GFIA 4R5MA 4TS4A 3PPYA 1G291 2WJ6A 4LXIA 4N4AA 3A05A 2UUBB 5BWNA 2ADOA 5CVCA 1LDEA 1F5SA 3NHSA 3IQHX 4BO8A 2Q5IA 2CHFA 5DOZA 5DM70 1MFZA 3H4MA 1UC5B 4QJ4A 1BYIA 4B6SA 1E7WA 1QZUA 1TNDA 4WEQA 4ZOAA 1YB2A 4HDRB 2PXXA 1E89A 2ZRNA 5E6UA 2CV0A 3LZDA 2HR1A 3VSCA 3GLKA 3RTBA 1OYOA 4MWZA 5HS6A 4KDRA 4AWAA 4Q4HB 3LP8A 1VIDA 5CVEA 4JU9A 1CUXA 1SCDA 4QDJA 2IIPA 4HRVA 1YI1A 3STXA 4F5EA 3NUQA 1I80A 2HJ9A 3EA5A 3D8BA 3M6WA 3EBOA 4O4LB 4BB6A 4C1BA 1F6WA 2RBEA 1SC6A 1X87A 4JASB 5CXXA 5KYUA 4KCGA 3GEDA 4I36A 2H29A 1NJ5A 4I2VA 3ZCTA 1V3VA 4LZWA 4WVLA 2MSCB 3AWDA 5DSTA 3U3KA 1TZKA 3OTGA 3W3ZB 3JCZA 4US1R 4JKYA 5L3QA 4LJYA 4XLZA 1FL9A 2FMUA 4K9PA 3AL0C 3ZVLA 4JXZA 2BTOA 4I3GA 3SZMA 2BJVA 5JAOA 4TWAA 2IRWA 4ZGWA 1KP2A 3R3UA 5FWDA 2WMDA 3CH7A 2PUFA 2G8NA 4BPRA 3GLFA 4IOJA 421PA 3C3CA 2VHXA 5TR9A 2QRVA 1ZDMA 2OQ2A 5AJZA 3W6PA 5IG2A 1NNSA 3FD8A 4IIJB 3I4CA 1R74A 4TTPA 1XMPA 3G1TA 2DLCX 2CXRA 1L5ZA 2ST1A 3OPYI 3W9SA 3KZ1E 1JJAA 4Z53A 2PO5A 5CB6A 8AT1A 4WN9B 5EIWA 2XTJA 3OPQA 1FRFS 5F9FA 1FX0A 4D43A 3NDIA 3OCJA 3DE0X 4ABYA 4U7FA 3P0EA 1SVIA 2NTNA 3DE6X 4KG7A 4LHVA 4E11A 3LJKA 2QBYA 1RYMA 2O3TA 1DQYA 3PDUA 4TYPA 3VOTA 1WB9A 3GGJA 1HRDA 3LE8A 3IPAA 4HHEA 4BUJA 4G5YA 3V8EA 3P9ZA 4ZIRA 1TKRA 3PE3A 3CA8A 4A2QA 2OHIA 4Q4JB 1XROA 1E5DA 4FGZA 4JEHA 5FPYA 5AM0A 3HRKA 1U6IA 3KV1A 3U1TA 3BHJA 3R8XA 2OKCA 5C8ZA 2ZSHA 4WXEA 1SGWA 5CFMA 1VI2A 2HGZA 3VR4A 4BNWA 5KWSA 1Z5UA 5M29A 4A36A 5CB8A 1DG1G 1GA4A 4IDAA 4MQMA 2Z04A 5CMLA 3SX2A 1O3YA 1TO6A 3BMCA 1XPJA 3KB2A 3NYWA 4QBHA 2B8NA 2G63A 4CIXA 3DAFA 4K8OA 4GBMA 4PWZA 3QYFA 4E7PA 4NBTA 3TX6A 1K5HA 2JKYA 1XU4A 5TEWA 3V1KA 1FFBA 2J08A 1N77A 2G4LA 4MYTA 4D9MA 5FPTA 1P4HA 4Z0PA 2FPPB 3GJYA 3TOXA 1XZAA 3P2YA 2P2GA 4L95C 1FFGA 4GZ6A 3RD5A 1JPUA 2XQVA 5JSQA 2GBGA 2IOFA 2ZSAA 3HGMA 2PZKA 4BJ5A 4V1CB 4CN9A 2BDEA 2P5TB 4Q1CA 4EPYA 1EB9A 2OBFA 1KMMA 1QF9A 2BUAA 1L6RA 3KQLA 3DDSA 4M0UA 2ORYA 4I1RA 4DMRA 2QPTA 4HJRA 4NI5A 3L6BA 3HI6A 2BFPA 3PT9A 1U3CA 2AKEA 4O4IB 1TVCA 3KYJB 2OCXA 2K5UA 4N3NA 4YRAA 4FQ5A 1L5HA 1ZIOA 3BQMB 1UDCA 1EFVA 3OX2A 1ZCAA 2XHZA 3UBTA 5A7GA 2ZUVA 1LLUA 2IPNA 2XOKD 4GXTA 4J16C 2YN2A 2V5UA 4UBLA 4BGIA 1IZ9A 1LPAB 1TZJA 4GX5A 4XDGA 2P3QA 5CAEB 1ST3A 4ER5A 1XTJA 1EUCA 2SNIE 1ZW1A 3SBDA 4EF5A 3EGXA 3O2NA 1MW9X 3G5LA 2B4KA 1NC1A 3GC6A 1YZGA 1FJGB 4QYMA 3RC7A 2YHSA 2Z2JA 4ARZA 5CUQA 1O03A 1GCAA 1K8QA 4MYUA 3F5SA 4EGSA 1JWLA 2VQ6A 1TX4B 3P32A 1MKYA 5ALRA 3LF2A 4ECAA 3L5KA 5FYDA 1T8PA 3V7FA 4RZ3A 2LGJA 3ZE7A 1E92A 5EMHA 4LMBA 4TMFA 1CDOA 2QYSA 5BW4A 3LSTA 3FCEA 5TVKA 2YYZA 3T5TA 3IPLA 4WK2B 5TF4A 3K72B 3SS8A 4CEJA 1EXVA 4II7A 4NYJQ 5IEBA 3OHSX 4MWEA 5DO9A 2HFKA 3ZWPA 3PX7A 2OXCA 2B8TA 3DDWA 1U0LA 2YXEA 1B0UA 1M7GA 2B99A 4OXNA 2RK3A 1TPZA 4WW0A 4C6SA 1R0WA 4L8LA 2FK7A 4RIIA 1KEEA 3LPLA 5JBNA 5BW6B 2G1PA 1U80A 1XQWA 1N2JA 2ALJA 1FU7A 4K6KA 4DLPA 2QZPA 2YFYA 3HV2A 4KQEA 1VPWA 4MDFA 1XNHA 1QR6A 2O3QA 1X2EA 2HDNB 3M49A 2BGGA 3HS3A 1PG0A 4OFBA 1ONPA 4NU8X 5L3ZA 5A02A 3BVPA 4GMFA 4GZMA 2I4OA 4O4LF 3VKVA 1TPYA 3HZZA 5JHGB 1KVQA 2YXLA 3IBFA 3HA2A 4JVOA 1TC2A 4KAAA 3HXKA 1UZNA 3RODA 4ZANA 4XCVA 3KQMA 1E63A 3ZJUA 2TMGA 1P6QA 3ZU4A 3KOYA 2QAIA 1Y8AA 4C2TA 4GPD1 4LWQA 3IIJA 4ZK2A 1SUPA 4ANFA 4KO2S 2C3PA 4QOJA 3PL5A 3SS7X 3DF9A 2FQ1A 1T2UA 1G8MA 1ADFA 1MEJA 3H18A 3M1YA 4NOLA 4AFNA 4RORA 4L5CA 1M6YA 1UEJA 1VHTA 1GZUA 5GGXA 3IEUA 3NNDA 3L6RA 2CZCA 2FEAA 5DGXA 5ETJA 5JANA 4IGEA 3KQYA 4FBMA 1BS2A 3ZS8A 3W3AA 4ARBA 8ADHA 1PG2A 4N39A 3ZE8A 5GZ3A 2VJPA 4W9NC 4AKIA 1RTTA 1FP4B 4CFSA 4O02B 2Q3LA 1N36B 2GTIA 1RQGA 3AIIA 3W2IA 2H1OA 4TV9B 4D97A 4OK6A 4QM6A 1M2OB 4YAKA 1M34E 4MMZB 1T0JB 1EG7A 3L2OB 1B0ZA 3A9VA 5FBKA 1ORVA 1ZOIA 5HA5A 4I3FA 4C4YA 3W79A 2ORWA 1Z07A 2VDJA 4CUKA 3PDHA 4GQAA 4GM1A 4W6ZA 1G18A 4J0CA 5IC6A 5FBHA 3BIJA 2HMVA 5JASA 3JYHA 4GMGA 2YHIB 4I8DA 3WV5A 5LZ9A 3HBJA 5H3LA 4FDMA 2DFLA 2CF5A 1MN6A 2FPPA 2KQUA 2QU8A 4L9SA 4DMCA 4OLAA 4JJGA 1S01A 5EEHA 5JSHA 2WU4A 2HTFA 4BNIA 3H2JA 1TVEA 5TMDA 3IE2A 3TQIA 1SUWA 3HYLA 5E38A 2F9LA 2N1BA 4ZOEA 4JI3B 4QVKA 2YV5A 4DQDA 5B1EA 3TBHA 1A5TA 2FE1A 5TPZD 2ONJA 2YVAA 5G0UA 2Q21A 4BOYA 1MAVA 3S1LA 2Q4BA 1Q95A 2H11A 2PUDA 3BMQA 4EW3A 4O1HA 4HGYA 1JQ3A 2PYIA 3G88A 3O92A 3WWYA 3G02A 1XD2B 4A92A 3CLVA 3EOAI 3BK1A 1A76A 1MZPA 2NV0A 1W8IA 2M2IA 4PAOA 3N0VA 2DUNA 2QVLA 2Y2UA 1HDYA 4LTDA 3RE1A 4EBFA 5LQCA 3T3OA 1R0ZA 3H7AA 4HZUB 1CJBA 1O94C 4LTMA 4NRDA 1THGA 3UA4A 2B37A 3G9UA 3AF6A 4E70A 5I7HA 4GWGA 3RH0A 3EN0A 2UZIR 3QKRB 4Q37A 5DBOA 5DW0A 5ELXA 2GCOA 1P31A 3KZCA 2QU7A 1IJEA 3RUDA 1ABFA 1O1YA 3ASYA 3CUVA 3NYRA 1YQUA 2PGJA 3MG9A 4KX3A 4QUBA 3SKYA 3WSWA 4EI2A 4Y2PA 3JVEA 1KK1A 1F2TA 3LQ4A 4CMHA 1RXEA 4OQYA 1DXHA 1BS1A 2CW5A 2O8FB 1EK1A 3HADA 5CIQA 7YASA 4ZHQF 3RU3A 2P9EA 2GTHA 2BFEA 3C7AA 5EJAA 3UT6A 3W4IA 3ZWDA 4XTCS 1C1YA 3R6LA 2ANBA 5CXUA 1GKIA 1IY2A 3E9MA 4FCVA 3DCYA 1IIRA 4HQKA 2FA9A 2C2WA 5H80A 2LRHA 2D13A 4BN0A 4OA8A 1EFVB 4HWOA 5T5QA 5BORA 2DKFA 1UP7A 4H4CA 4UNQA 1SELA 1KWGA 1ZKMA 1H23A 1E9AA 1MQ9A 1X14A 2QV7A 2K2QB 3H2BA 4QGFA 2B98A 2JGIA 2WM9B 4RKFA 4KOEC 3SSMA 3J81A 2Q4RA 3LLSA 2E0IA 1HE1C 2JJQA 2A9JA 4IGFA 2ID8A 5IJWA 5REQB 2OC4A 3TO5A 4ZVUA 3WS7A 1I5OA 5JQWA 1P7ZA 1ZESA 5IKPA 2HDOA 2YNMC 3SN6A 2QSZA 3FRIA 1K7EB 3R0XA 1KYTA 1T4DA 1YUNA 1M1NA 2QS9A 1XDBA 3CZQA 3Q10A 2AN3A 2XXAA 2IY8A 2W6NA 4RS3A 2COEA 2WABA 3ROKA 1DXYA 4XSGA 2QP9X 4LWPA 4YJ3A 3UJCA 4CYMA 1U02A 3AUFA 1ENPA 3V48A 5B4VA 4DA4A 1BE1A 3H2IA 3SWWA 4DV6B 5J2TB 4TZ6A 2QN3A 4PZYA 2QRPA 3VGPA 3ZNPA 4FYXA 2W6OA 1ABBA 4KVFA 3ZC3A 3BJMA 4FDVA 5B53A 2C9OA 1KSGA 4RFVA 1N2BA 4LJKA 1FTWA 2YMMA 1XAJA 4DJ5X 4KFRA 3A26A 2ZUEA 3RVKA 3UMGA 2KS6A 2QSUA 3HRIA 4WV3A 2PD6A 1II0A 4OJQA 3M2PA 4MPRA 1GDDA 2XTAA 1Z8DA 5L3SA 5EKUA 1VLQA 4L5YA 3I9KA 4MVXA 3BF7A 3L6OO 4ND6A 4REQB 3CKYA 1HXHA 1XVTA 2A9OA 3T06B 4EAAA 2XVXA 1QFJA 1IMOA 4AB1A 1I1OA 4EGAA 3C14C 2NAPA 3VZRA 1D07A 2ZRQA 4F5ZA 2ZJ3A 1M2JA 3EZXA 2NVBA 2NV6A 4D02A 2PYDA 4LVUA 3G0IA 4R83A 4DG8A 2WFAA 3RSHA 1G21B 1KZ7B 1DSSG 2DECA 2ETXA 1E1QD 2FN3A 2WTXA 3GRCA 3KD3A 4RZIA 4WZZA 2J0UB 4QUKA 3UWPA 3G0DA 3Q2KA 4DCNA 3FMFA 2VTBA 4B3MB 4QUEA 2O6HA 3HDHA 1ILEA 9MHTA 5EUMA 3THXA 4IIJA 2QPLA 2OPHA 3D2LA 3GEGA 1QHEA 3V3KA 4YCSA 1ANKA 4ILEA 3QBTA 4FS8A 1BS9A 3CF2A 1EK6A 1UC8A 2Q3BA 5HG0A 4BATA 5CDYA 1FTNA 1NXWA 3CFYA 3EQZA 1K88A 1JVNA 3PXXA 4OQZA 1OI7A 4ZI7B 5DNUA 2ZWIA 4LXYA 3WG9A 5JJKA 1EWTA 4W9RA 4XFDA 5JVDF 3NV7A 3QE9Y 1A82A 3OHMA 3QFFA 4RD1A 2Z09A 3FR8A 3JQBA 2BONA 2UUOA 2J3LA 3H5RA 4JXJA 4ZO4A 5EIFA 3VR5A 1DXOA 1KERA 1A8IA 3OZTA 3E1KA 3SC4A 1YQWA 3WKBA 4CKEA 2NO5A 3AG6A 1PJ4A 2C0CA 2WZQA 4LJAA 4DC0A 4GPBA 4QT4A 1QP0A 4O2AA 2E5LB 4P2BA 4OYLA 1D1SA 2REQA 4XUGB 3VU9A 5BV2P 3CLTC 2DJIA 1GR0A 3KL2A 1EUDA 3MWDA 3LRPA 1IN7A 3BYZA 5K6AC 4QNRA 4NV1A 4P36A 2OBXA 3IERA 1NW9B 4L4ZA 4NCNA 4BMXA 3V8RA 4XJTA 1Z5VA 3PQ3A 4CM7A 5KTRA 2HK9A 4HAYA 4DW8A 4EJMA 1EWRA 2WJVA 4ZYZA 2CYBA 3MTQA 1ZI6A 1KY5A 1KJJA 3KO8A 4ADSG 1JSLA 4JB2A 2IGBA 4MRRA 5JCOA 2WQZA 1IQRA 1ZI8A 3JALB 2O8BA 3KWJA 1AZWA 2VJQA 2QVXX 3NHRA 4GYYA 4J4TA 1RAFA 1H0SA 1W0KD 2BZ0A 2O1XA 4UUAA 4D9HA 3ZWOA 2F2TA 1O77A 1RDFA 3HJNA 4XCQA 5KOHB 1EVIA 2YW9A 1FDOA 1XTKA 3HWWA 3IAS6 1WHSB 1NX6A 4DCJA 1GXSA 1N2CB 2JI7A 2QKYA 4EY6A 4P7JA 3DEJA 3HCOA 4Z4HA 5B4UA 1HLDA 2W5UA 3GP3A 4OQXA 1RI2A 4RH0A 3SJUA 2AOUA 1B3BA 2JI8A 4H6VA 5KQPA 5LOVF 1NDHA 2PS1A 2RGEA 4TTQA 3TR5A 3NRBA 5L95A 2FNAA 1R27A 1Z82A 5AJVB 4XWOA 4NIMA 3PWTA 1ZRNA 4FP9A 2ZRJA 1DCKA 2BFAA 3D5QA 4JKIA 2B9VA 2NIPA 2V8BA 5AVQA 4NFYA 3C4VA 3LVFO 4LOKA 3BXHA 3QFRA 3BK7A 2ZEJA 2J9FB 3TAHA 1JEEA 1GKLA 1N6NA 2AEMA 1GU0A 3X1KA 1XZPA 3AP3A 3LWBA 1N78A 4DDVA 2AR0A 1G20B 3U56A 1ZU4A 4HXGA 3AEUA 1IHOA 4G5QA 5IEJA 1M10A 3TOSA 3BULA 1ZEJA 4UUNA 1IXYA 4CGZA 3UCFA 5HUQA 1OFHA 1JA9A 5C8VA 3ZUGA 3EQ7A 4F06A 1UAGA 1VZ3A 3E8XA 3ZTWA 4OX9B 3IT3A 3HXPA 1FU4A 2BEWB 4JELA 3P0IA 5HFJA 3RU7A 3PNYA 3RVJA 3SX4A 1LLFA 5T3UA 5CB4A 3GHHA 1Z26A 3RYTC 1OV4A 1X7ZB 1UBFA 2VUIB 5E9WA 5CVVA 3ZGNA 2DRIA 3ZXXA 4A8JC 3I42A 4TKVB 2P5SA 3K8OE 1F5NA 4JYPA 4O0LA 3ZHBA 2PL3A 1GEGA 3B36A 4RZUA 2EFDB 2CZGA 2IE0A 3E8SA 3EFHA 4LHXA 3R3SA 3N2IA 2VRWA 3D3NA 1Y33E 1KMCA 5HIIA 4N5NA 2RGGA 5B7PA 1E2QA 1PJAA 3IVXA 3NBXX 4XUEA 3CO5A 2J6HA 1H1TA 4TM7A 4ZQFA 2YC2C 3QU7A 4OHVA 3NWPA 1LW6E 2F1IA 4C4TA 4RH1A 1KMQA 1YIAA 4JI2B 2C9YA 4RBNA 2G9RA 4BRZA 3OFND 1YONA 3GF4A 4PYOA 4FFVA 3PUJA 2BFNA 4UE3S 5AHOA 5HF5A 3TDKA 1E0AA 3GUYA 4ZEWA 4N7JA 4QQ8A 3IP5A 3PE4A 3RFUA 1M34B 1NZJA 3HSSA 3PITA 5BO5A 4AG6A 1U3UA 4DXHA 2W6CX 1C0KA 1COZA 2WZCA 3QU2A 4ROSA 3FOFC 1P73A 3WJ1A 1UOOA 4OG2A 5EMMA 5IM4F 1RI3A 1E2IA 5ALQA 3F6YA 1A4RA 4B73A 3TX2A 3CSDA 3O91A 4LZAA 1WCYA 1VJ1A 2CJYA 5AJHA 2XUHA 3A3YA 2HREA 2XTZA 2JEYA 3BPSA 1NIJA 3AM3A 4EB8A 1QMPA 3JQ9C 4QBFA 3GLTA 1LTKA 2C95A 4RELA 1V16A 4RPHA 2QW1A 3BGOS 3ZK7A 4BFSA 1CX9B 4ZEXA 1KR2A 1JDBB 3F9RA 1Y8RA 5EZSA 4E1BA 3BMXA 1G7TA 3OCUA 1MZVA 2Q5OA 2XUKA 2GD0A 2I3DA 3WAKA 1AKVA 1XIVA 4ZDWA 4RVOA 1TADA 4K9DA 3TOCA 3ZD7A 2ZU6A 2CHUA 1TQDA 1O94D 3L1HA 3LHFA 2P9ZA 3O74A 4XVQA 3PKJA 1W5FA 1RRMA 5CFQA 4YP9A 3OBBA 4XDZA 1IULA 2XRFA 3HVRA 1EE2A 1WXQA 4KE8A 3GY0A 2NNLD 2VVTA 3HFSA 2HTEA 3MJSA 1FE8A 1VRVA 3KXLA 4OHWA 4Q93A 5DW3A 3IQZA 2XLBA 3WQSB 4I46A 1ATZA 3PGA1 3VI4B 3MZ0A 1TGVA 3O31A 3RYHB 3K15A 3G2PA 2VDWA 3CXRA 4K9SA 2HW8A 2A86A 1KFJB 1DTWB 1VE3A 3HXMA 1F3OA 4U2KA 2QR5A 1OMOA 3QU5A 3RRFA 1WDMA 3NEYA 2AOWA 3NM4A 1TJPB 4TMKA 2QXUA 2O8EA 3AC0A 3GVXA 4UOQA 3LYHA 3T9FA 1RM5A 1V3UA 1OR8A 2YZMA 2MYNA 1IRIA 1OZGA 2WU3A 2CK3A 2N47A 4JBNA 3PX2A 3RFXA 3U7FB 2BH2A 1D6JA 5E7JA 1X2BA 2VDQB 2V97A 1H66A 2OENG 4TV8F 2Q8QA 1QZXA 3GMDA 4P4LA 1PI3A 3MWFA 4YJ3F 1TA0A 2V59A 4MB6A 4JI6B 2VJAA 1A50B 4M0DA 4TXMA 4ITVA 4OP1A 4BDSA 3X3HA 3RKRA 3E7XA 4NR0A 4Q4HA 4WGGA 3SE7A 2X8JB 4V2IA 4YC7A 4A6DA 4CL0A 2QD4A 1B43A 4UCXA 4WZBB 1KNXA 2QX4A 1QTIA 2AL7A 1ZJZA 4FU0A 4A8HA 4CNQA 3AR6A 2HU7A 1QHYA 3JD3A 2WF5A 1NUQA 3C8DA 4RAOA 2B94A 2BP7A 4LNUA 5IDYA 2ZYAA 1BWPA 2W11A 4DJEC 4L4XA 4TKUB 1CVRA 2VPYA 1ZUNA 2EF1A 1Y5NA 1NF9A 1X7YB 2HWYA 2PSHA 3ZWKA 1IBMB 5C18A 3MELA 3BE8A 4MSUA 4MDHA 4YROA 1DIOB 4NZNA 1P0IA 5ULLA 1QFXA 3CX7A 4C3ZA 2RD2A 2RGRA 3AVTA 2AUNA 2V7EA 3S28A 1O5TA 2HBRA 1YS7A 1LPOA 3I52A 2VCHA 1JIUA 1NHGA 3PNVA 2NQTA 5ALYA 1X7XA 2YVUA 1Q19A 3CPEA 3CW8X 4G24A 5DHUA 1LLDA 4EMTA 3HN6A 3OWHA 1P6UA 1CJMA 1ZA1A 2IXGA 1WUJS 3B9PA 3D8UA 5FEMA 2EP7A 3PXAA 3RVOA 1G3IA 3JATB 1ZJ6A 1A98A 4HMPA 4LJLA 1AX9A 2AB0A 2FZEA 2FWAA 4G5RA 1DJMA 1BU5A 2CJPA 1J90A 1AV6A 1WDTA 4X54A 2P90A 4PFSA 5ADWA 3W8EA 3TTTA 2GYWA 1DEKA 1OX4A 1V48A 1UKEA 1SB8A 2A5DA 1CJVC 2O07A 2VP5A 5EQTA 3G3EA 4XLLA 1ECLA 1DDIA 1QIKA 4ZP1A 4HTFA 4GP9A 4Q3LA 3T9BA 1ZK2A 4W63A 1YR3A 4Z49A 4BX0A 1DIAA 2A1TR 4C6HA 5L3RA 5BMVA 5BSHA 4HXFB 5KWJA 3K5HA 2OHGA 3MRXA 4QPCA 3PQ2A 3PXDA 4H17A 2J09A 3G1UA 4LHYA 4WERA 4Z51A 3DWGA 4JODA 3RGWS 2RHLA 3WGQA 4BQOA 3EAGA 3T7JA 3IHWA 2IYUA 2WYIA 5D6OA 3D6TB 2K87A 2WJ3A 1VB5A 4MRMB 3T1HB 5CFPA 4LOIA 2QDXA 3M4NA 1KIAA 2AMLA 3GDOA 4TWIA 3R9KA 4KPFC 2F90A 5A05A 3GFQA 4N5IX 3KKOA 1D5CA 1KJNA 4NFSA 1RBZA 4XR4A 1RAAA 4NYMQ 4TSKA 1DUSA 4GZ3A 3GJSA 4YJ2B 4BLTA 4FK8A 2WTEA 3AHCA 1P1CA 2LR0A 3Q9NA 1P9OA 5HZMA 1MB3A 5G40A 5HJ5A 1IHDA 3QLUA 3DR5A 4AZ3A 2GN1A 2FQYA 1UWVA 1UWKA 2ZTLA 3P2EA 1JDVA 3FLBA 1ISFA 3GAMA 4OK5A 4P31A 4JI0B 1POXA 3NOOA 1K8RA 3TRIA 5AM2A 4BO2A 5JNUA 1HI9A 2EBHX 4B33A 2CLEB 4PGAA 5BNIA 3I9OA 4N5HX 1RVDA 2OCGA 1NLYA 2ZQ5A 3GNQA 3TAUA 3U3JA 3OZXA 4KFUA 1I24A 2HJSA 3OD1A 4J0DA 3LAWA 3H11B 3UV6A 4FT4A 4UOZA 1UMDA 2PWZA 1VG9B 5CDHA 3AZPA 1YD7A 2X0JA 3LUDA 3SIXA 2J3IA 2I4TA 3P2IA 1ZOPA 1K6MA 3VH1A 2JKVA 4BFVA 1HTWA 4JLKA 4RZ2A 2FV8A 4BP1A 2VZEA 4OIFA 2Z2KA 5DXAA 5JCXA 4KFCA 1E8MA 5A5GA 3U2QA 1OBVA 2DBYA 3OPMA 2HQOA 4QYSA 5HDBB 4EKIA 1JF8A 1Y7TA 2XA2A 4L8FA 1KPHA 4EA8A 4BVJA 1V5GA 2JCVA 4G5XA 3G9ZA 3HCFA 4BVHA 3FB1A 1L5FA 1WG8A 4L0QA 4ZCPA 3KV3O 1PAUA 3S44A 1GTMA 2G9ZA 2ZIWB 4OHOA 1P4JA 3BRWA 3GP5A 3RJTA 3VDRA 3DAOA 4OI4A 1WBDA 1DOZA 2JI6A 3ELBA 3AOEC 3UT5B 3WYBA 4YCMA 2CMGA 1RC8A 5F5XA 5JAQA 1QO9A 2QP4A 2VHWA 5L6MB 1H6DA 4R8LA 5DLPA 4M49A 1FMCA 1H2WA 1JXOA 1BVYF 3E0QA 3HVIA 5FNZA 4UDNA 2PUWA 1RHKA 1JQAA 4XH9B 1NRXA 1W5SA 3T7DA 2PCLA 4ZYUA 1ULSA 2RIRA 3TNJA 4HGQA 3DT9A 4YGXB 2GD1O 3NKVA 4RA6A 4YRNA 1DQPA 1OROA 2X6QA 3KDAA 5LBUA 1AK1A 1SXGA 1IC6A 2P9TA 3KLOA 3BD9A 3PYLA 2OXEA 3QA9A 3ZHTA 2EAUA 3OQIA 2ZYIA 1MXHA 5JS6A 2NZXA 3V7UA 3EPJA 1Z17A 2FOLA 1YZHA 2AMJA 3JD4A 1M2NA 3NAQA 4YRJA 1XBTA 2JIPA 3ZE6A 5F2NA 1UZUA 3M6VA 1P7YA 1JDUA 1IG3A 2HBQA 3D8NA 3WY9A 2FMTA 2Y9MB 2YMPA 3FUUA 1G2QA 4IIDA 3HXOA 4NQZA 1GNLA 1WVMA 2VXCA 3PXCX 2AFHB 4Q82A 2OAGA 2H08A 5D3ZA 1GAXA 3MJHA 1BA3A 2QMEA 4DLKA 3TFOA 3MWGA 1FX1A 2QVGA 3HI4A 5HIMA 4LE0A 3IAUA 4BVBA 3NP9A 2QRJA 5T6MA 3GZ4A 5K6AA 5ALEA 2BBWA 2Y68A 4I5GA 4UJ5A 5C4IA 3FTPA 5LU9A 3QH4A 1GYRA 4FYKA 4G41A 3H05A 4PG7A 2WU1A 1L2TA 1SCKA 1A5ZA 3T9EA 1SQGA 2B0CA 2H00A 5I7AA 1FYVA 4UEJA 3DVRX 3K7EA 4LV6A 4R51A 4DBLC 4H7JA 1IM5A 1FVFA 4LDQA 5EZQA 5K3BA 3TIGA 3ORYA 4JKOA 5HJEA 1V96A 1LSJA 1CYEA 5HUJA 3A1UA 5IJ0B 5DM1A 3DFFA 3KKPA 3KOWA 2QV0A 5DB4A 3TZLA 3WIVA 4ZC1A 1AV7A 3B5JA 4MJ7A 3RT7A 4CLHA 4M1SA 1L5LA 4E5MA 4NJEB 1QBKC 5H68A 3UOGA 3ZCRA 2OK7A 3KSZO 1UBEA 5AW1A 4OQEA 3QEMA 3FWNA 4WY2A 5IMBA 4KR9A 4CDNA 4RMJA 2CLFB 3E81A 3T6KA 1GITA 4NCAA 1BHO1 2R6JA 5HF9A 3OC0A 4DPLA 1H3FA 1TVKA 3UUGA 1Z6PA 3INYA 2CLKB 3LZCA 3OKFA 4PE5B 2OA0A 4RHEA 3JD0A 2J0VA 5JOQA 4RUKA 3AJDA 1PK8A 3DPSA 1C3LA 1GO2A 1K7YA 1SVWA 3C3BA 2Q7OE 3GLFE 1OAOA 3OIGA 4X1IA 2BDUA 1I13A 3AR2A 1W6RA 4BQNA 2BZ1A 2DWUA 2QJTA 2X9GA 3DDUA 3L4EA 2BFCB 1GTSA 1GGEA 1EX7A 1TW3A 1RYNA 3UENA 3TQQA 2OYSA 3TMKA 3BXFA 3F1LA 2BKUA 4O4JA 1QAMA 5FTWA 3FDFA 4G4SP 2WTMA 1Q21A 4HWPA 4IG4A 1JDTA 5DF1A 1A72A 2OMKA 3F47A 3G0OA 4Y0AA 5JDIA 4IP0A 5KC8A 5IARA 2I22A 3ESCA 1XTVA 4NK5A 5F5NA 3UUWA 2BFBB 1G5HA 1MG0A 3PGKA 4GC9A 4MARA 4UZEA 4WLOA 5CX1B 4EGFA 2ID9A 2ZDGA 2XOEA 1JXAA 2YWJA 5BUSA 4KPGA 4TXHA 2J6IA 3ZDFA 1SHKA 1NVAA 1ULHA 1RMQA 5DJ5A 4UM5A 4YT2A 2V6MA 2PKXA 2OILA 3ETEA 1KU0A 2JW5A 3NM5A 4EO4A 4B3SB 1E2JA 4HFNA 3PEWA 3DBLA 2X0RA 1I3MA 1Z6YA 3H65A 3ONVA 4RPCA 3LBFA 1SN7A 4Y30A 1XMOB 4ZCQA 4BV9A 2YBEA 3BH6A 3FIUA 3II6X 3WNQA 3IBGA 5ANRB 1KRWA 2EP5A 4RKEA 3JVDA 4C4RA 3DEKA 1DX9A 1T0UA 3EF1A 3KQOA 4EI8A 2V58A 1P2TA 1BHQ1 4LDZA 4RF2A 4BMPB 3ZLBA 1QIDA 2HNKA 1PRYA 3AOGA 4WDQA 3S8MA 1RXYA 4PYQA 4NPCA 1Z0JA 4UC0A 1M1NB 3RI3A 2VSYA 2RAFA 1B73A 1EDBA 1FQKA 1RW4A 4BO1A 4ETWA 4LJ8A 3VOSA 5K4HA 4AZVA 2HLNA 3K73O 4FEAA 4N0DA 5K8JB 1MX5A 1ZUHA 4NCBA 1Q0SA 3OX3A 3K8YA 4PG4A 1NBIA 2EYUA 4NH4A 3HCDA 4MGHA 3CT4A 5GJVC 3ST7A 4D6XA 3KYIB 1FP1D 1N0IA 4G4GA 5D3KA 4M1MA 4A8JB 3H4TA 4LW8A 4DCSA 3G89A 4QULA 5TS2A 1P9RA 5C5DA 4IEEA 1OBHA 3SYLA 2FPOA 3PRKE 1RMYA 3WBKA 2JH9A 5HQ3A 1T5SA 1JG3A 5A3JA 3WMEA 2RGNC 2ZSUA 1KK0A 4CL8A 4Y0NA 1E58A 1U7WA 3IAAA 4FKMA 3U80A 2X5KO 3S3TA 2EQ5A 1XTZA 4OUKX 5IAAA 2HJVA 4ZAXA 3R4VA 1TTPB 1DAHA 1U8YA 1U8EA 3IAHA 4LYEA 1X7WB 4Q1FA 1TRHA 3VAAA 4DLVA 5C1DA