3E2PA

Catalytic subunit of m. jannaschii aspartate transcarbamoylase in an orthorhombic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
306
structure length
306
Chain Sequence
b'MKHLISMKDIGKEEILEILDEARKMEELLNTKRPLKLLEGKILATVFYEPSTRTRLSFETAMKRLGGEVITMTDLKSSSVAKGESLIDTIRVISGYADIIVLRHPSEGAARLASEYSQVPIINAGDGSNQHPTQTLLDLYTIMREIGRIDGIKIAFVGDLKYGRTVHSLVYALSLFENVEMYFVSPKELRLPKDIIEDLKAKNIKFYEKESLDDLDDDIDVLYVTRIQKERFPDPNEYEKVKGSYKIKREYVEGKKFIIMHPLPRVDEIDYDVDDLPQAKYFKQSFYGIPVRMAILKKLIEDNEGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Structure of the catalytic trimer of Methanococcus jannaschii aspartate transcarbamoylase in an orthorhombic crystal form.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 109
structure length 306
sequence length 306
chains with identical sequence B, C, D, E, F, I, J, K, L, M, N
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3e2pA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 3e2pA01
1AT1A 1ACMA 4E2FA 4KWTA 2W37A 3R7DA 1JS1X 1EZZA 4WTOA 4A8TA 4FYVA 4F04A 1PVVA 1SKUA 1TTHA 1PG5A 2YFKA 2OTCA 2P2GA 1VLVA 3M5CA 3M4NA 4EP1A 1I5OA 4IV5A 3L06A 2BE7A 4JQOA 4A8HA 3L05A 3M5DA 1ORTA 2EF0A 2FZGA 4KGVA 4BJHB 1RADA 2QGFA 3TXXA 2I6UA 1R0BA 3AT1A 3Q98A 1XJWA 2A0FA 3R7FA 3MPUA 4F2GA 3KZMA 1EKXA 2BE9A 3L02A 4AMUA 1DUVG 1RAHA 4AT1A 2AT1A 4FYYA 5G1NA 9ATCA 1F1BA 5G1OA 4KH0A 3KZCA 4KH1A 1TU0A 4NF2A 2H3EA 3UPDA 3D6NB 8AT1A 1D09A 4AM8A 5G1PA 1RAEA 4EKNB 1FVOA 3R7LA 1RAFA 4KGZA 4JFRA 1RABA 4H31A 3L04A 3E2PA 4KGXA 4A8PA 3KZNA 1DXHA 3KZOA 2QG9A 3KZKA 1C9YA 4ANFA 4OH7A 1ZA2A 2AIRA 3TPFA 1RACA 2FZKA 2FG7C 3GD5A 1NBEA 1Q95A 3LXMA 4FYXA 2FZCA 3SDSA 7AT1A 1OTHA 5ILQA 4JHXA 6AT1A 2HSEA 2RGWA 5AT1A 3NPMA 3GRFA 2IPOA 8ATCA 3M4JA 1TUGA 1RAAA 1FB5A 1A1SA 1RAGA 1ZA1A 1AKMA 4FYWA 2G7MC 1ML4A 2ATCA 3CSUA 1RAIA 1R0CA 2FG6C 1EP9A 3D7SA
chains in the Genus database with same CATH superfamily
2R1TA 3RYCB 1UPXA 1NASA 1HRKA 4OBEA 4R8VA 4NZOA 1RZRD 1IU9A 3BH6A 1EG2A 1Z4NA 5DNYB 1HLGA 4JC8A 1JFFA 1HOXA 2MU1A 5HS6A 3EY4A 1OU0A 3SLKA 3QXXA 1DS6A 4HKTA 3T99A 3AM4A 4O3MA 1DNPA 4BCDA 2VS1A 1QYVA 3FR8A 3T4UA 3H8SA 4YRLA 4H18A 1JHXA 2WU1A 4RXMA 3Q5EA 2WTBA 4YFYA 2X1MA 2BUBA 2V3CC 5KTOA 1KZ1A 3W7VA 4EHBA 2FPPB 5AK3A 4CM5A 1CQPA 3M4NA 2EOAA 2ZUCA 4Y0VA 3O3NB 4LXIA 3SQMA 3VZPA 2FFJA 3BXPA 1FBNA 5TQJA 3ENVA 2J48A 1J99A 2A1UB 3DVAA 1L5RA 3OU2A 1FY2A 5FWYA 3ZBPA 3ZNNA 3WAGA 1FC0A 3PEUA 3IP9A 3TOCA 3W7BA 3SN6A 5CR9A 5HKKA 2Q9UA 3EZ9A 1GNQA 4QPJC 1ZD2P 5AW6A 1CZNA 3LBFA 5DSZA 3WQHA 4HEQA 5C7YA 4XWAA 4CEJA 2CMKA 3DHWC 3L18A 5JYBA 4OIFA 3NU1A 1KI8A 1TM3E 2KHZA 2JAHA 3AKYA 3I73A 3MLBA 4QUJA 3QLUA 5H9WA 2JF0A 4AT1A 3J81A 2NUTB 2HZBA 3IMEA 2CB0A 1FYXA 2BT4A 2R7NA 3CH5A 3ZIAD 3A28A 3EXEB 5C4MA 1PTKA 1GQOA 1VJCA 3P4YA 1B42A 2QX4A 1KF0A 1T8SA 4DPKA 4J4BA 2R25B 5AK4A 3O2QB 3OMLA 3P26A 1DI0A 1PRYA 4WVLA 1EK1A 1W36D 5E6RB 4HZUB 4XE5A 3VRHA 4AJ2A 2QMUA 3H2BA 3AUTA 2E4AA 2AFRA 2OXCA 3TAXA 1J2YA 2P9GA 4WOBA 3L7JA 4BMSA 4QUIA 3GNSA 3G1TA 3CE6A 3EQ2A 4Q3AA 5GTDA 1PR0A 5FBRB 2O2SA 5E6UA 5D6NA 4UC0A 3A4IA 2KWIA 3BK2A 5KJ6A 2XQFA 3GFPA 1WULS 1K1EA 2J3QA 1SU7A 3JARA 1LJLA 3PHLA 2V9CA 4XCQA 4AUKA 4EA6A 2GX6A 3CUTA 4AZSA 3LBYA 2R96A 3KQWA 5AJWA 2G88A 3WFZA 2GF2A 1ISRA 5CDFA 3CMCO 2ZQZA 1QP7A 3SNHA 1OAAA 1V1RB 3GNQA 5KOJB 2JZOA 1PT8A 3P1JA 4IQFA 1XGKA 4TL9A 1XJ0A 3W2IA 4BYMA 4DMFA 2H1OA 3JD4A 4HD8A 4HYTA 2MHCA 2B4TO 1A97A 1WE2A 2OHOA 3BHIA 3EASA 4KZPA 4R1TA 1EFDN 5DT9A 5G4LA 1Z4PX 2RFLA 2QRMA 1N1EA 4DLAA 2NYRA 2QD2A 3AF4A 1UPFA 1U8ZA 3S27A 2VH5R 2BH2A 2IUUA 3KAQA 5IFLA 1YRLA 2Y8EA 3Q10A 4RDHA 1WLYA 4XM1A 2H1CA 2IYTA 3B6KA 5SZIA 4PF1A 8ABPA 1J20A 3ZX5A 3N0XA 4K28A 3NWEA 1BC5A 3DHYA 3IX7A 4X92A 1GPH1 4DJTA 3RADC 1ATZA 2VBIA 3L7BA 2ZBGA 1ULSA 2NMVA 1E3WA 4TQAA 4PZZA 2OQVA 1EGMB 1MO2A 4DIBA 1I7QB 1KQNA 4WFQA 3D3QA 3K53A 5G41A 1AT1A 3ZH9B 4JLBA 2OHXA 3B3JA 5EP4A 3HE3A 3L07A 1BEZA 2YX1A 4DNQA 2ASVA 2PRZA 4JGGA 4FGJA 5K03A 5I9LA 3ASYA 2DOKA 5CDYA 3JYOA 1SR8A 3H8JA 3WK5A 3X1WA 5LQNA 3KU1A 4PTZA 3GYBA 3H1FA 3P9QA 1OXSC 1PG5A 1UQRA 2WAMA 2BFDA 1G2IA 1V7QA 2ZSAA 2NUPB 4TWAA 3C43A 4YMHA 2D1QA 4ZVOA 2FPWA 2WAXA 3REOA 1NXTA 3HB5X 3U0BA 5CYGA 2KJQA 3F3YA 2BYTA 1Z2NX 1K2WA 1PEKE 4LA4A 5E9QA 1HV8A 2VC2B 2JCBA 2X23A 2ABWA 4WNIA 2VWHA 4PRZA 3MXTA 3RT1A 2ZUBA 3DTYA 4ROTA 4ZJPA 2C96A 3GFFA 3BQ9A 1RYFA 2IHUA 2DBZA 3BEDA 4LZLA 2I2FA 1VJTA 3P4XA 3T3HA 4Y18A 1SPBS 5C53B 2HWUA 1DMRA 2QW0X 1Y1TA 4QYTA 3RABA 1EEHA 1DRJA 1U3CA 4PSCA 4B3XA 4DLBA 2B2XA 1H3EA 2HCJB 4YJFA 2Q3EA 1O4VA 4GKVA 4OHRA 4KCGA 5FRDA 1X38A 3FPJA 4FUQA 2VRCD 4I1OA 3RV3A 3SYTA 4WOKA 1CUFA 3BD7A 3ZHVA 3L5OA 3K70B 4HUJA 5LLDA 3VHLB 3WRXA 1Y0BA 3FPKA 3A1NA 5AIBA 1Z5PA 3EUWA 1HOTA 4HMOA 3TRKA 4HR7A 1TYAE 1QQ7A 4IDFA 4BVGA 3SMVA 2CDBA 2GCEA 3FKQA 4Z3OA 2RCYA 2QRVA 2AEEA 2PR7A 1ES9A 2C2XA 2JAQA 3AKEA 4TTTS 4A1FA 3AFHA 1II0A 2CXOA 5JARA 5EKTA 7YASA 2AN3A 4TMZA 1JIJA 1SURA 5AVYA 4WZZA 4PPNA 2A9VA 3KOXA 1XZKA 4XSGA 5JNSA 1DAHA 1VPDA 5MN6A 2CDNA 1RABA 1DKUA 3LGSA 3UJ9A 5JBNA 3VA7A 1GR1A 4PLFA 1U7TA 2ODTX 1JWBB 1YC5A 1Z56C 1RWBA 4LNHA 2IT1A 4P93A 4D7AA 4MCAA 1G5FA 1KAEA 4EGCB 5B7NA 1LEHA 5CFMA 5E4FA 4DWWA 1T0JB 5FBVB 1O3YA 1KA9H 3COWA 4LCBA 4BVFA 2ATXA 1RD4A 1T9DA 2ZLBA 1A9PA 2IZ5A 5A7HA 3DOHA 1S4MA 1YDFA 4OAPA 4B3BA 3W1EA 3WS7A 1I1OA 3UATA 1U02A 4HZGA 4TQ9A 4AZ0A 3O31A 4V1CB 2VJYA 5KX5B 4NCBA 1ZC4A 1XZNA 3K05A 2YRXA 3HSSA 4HQ0A 3VSBA 1ILWA 1ZGJA 1SC1A 3IQDB 3MS4A 4NRDA 3DLHA 2X1LA 5LOVB 2WWXA 4K9MA 4Z7OB 121PA 1K6IA 3EQ7A 3LW7A 2GFIA 3K5PA 4G4SO 2JW5A 3TZBA 3O7MA 5CNMA 5JQGF 1ZG3A 3LYLA 4IINA 1T36B 4QWWA 2ATCA 1S3SA 5ARCA 5IAKA 4D8UA 4E13A 3DGFC 3L6EA 4IIHA 3DV0B 5BSEA 4JUAA 3C3YA 721PA 1R9GA 2RGDA 4CEIB 2WAOA 1D2HA 2QYOA 4BFVA 4J91A 5DI3B 1UP7A 3GRPA 4TXNA 2HT1A 2WJ6A 2O8DB 3N2NA 2OO5C 4UUMA 1L4KA 1A5SB 2AFIA 4DHWA 4IJQA 4AUMA 2X5NA 2QAGC 4C04A 2WKWA 4D3ZA 3I5YA 1MH1A 4GKJB 3T38A 1V3VA 3NGXA 4B6FA 2EC5A 2WNHA 3C6YA 2Y1OA 1Q74A 5ABPA 3ZNQA 1T9KA 2YXPX 1XCGB 3LFUA 4Q66C 5IK2D 1EFTA 4EYSA 4ICIA 2ZRCA 3JASA 3CLUD 4MKGA 4P80A 5CLGA 5LUAA 2YWRA 5I7FA 2WZDA 2Y1KA 3I62A 4RY0A 4DADA 1IZ0A 1UBSB 1PQYA 1ZX1A 2NO6A 3AR9A 3PGA1 3PZBA 2G5CA 4V0RA 1JVSA 3GR6A 1F8XA 4L4SA 3WRWA 1MGPA 1NLZA 2BFWA 3JWHA 3VR5A 3UGJA 1Q15A 2REQA 2C5HA 4V0SA 1I80A 2ZS8A 1EM8B 2IU4A 1U6IA 4U6NA 1Z26A 3U6KA 1MTZA 1Y9DA 4KIFA 1O4WA 3CLSC 3TNFA 3T1TA 2B69A 5FOWA 1PVOA 2UXCB 4PGMA 2XCQA 2OLKA 2A9FA 5A7FA 1T1GA 2F1HA 5CG1A 3S2GA 2H8KA 3OCVA 4L73A 1GZ4A 2XA2A 1UADA 3KO8A 2D2EA 4RVGA 2AMLA 5B53A 1SAYA 3AM3A 1JMVA 3QX9A 5I9IA 2B35A 1RRPA 4MS4B 1VCNA 1MIHA 2FSVA 4OLBA 1H0SA 3DCJA 3DBHA 1CUAA 3ONDA 5KYWA 4D9MA 2HNBA 1CWUA 1X19A 1NNUA 1CE8B 4I1PA 5DOZA 2D59A 3HL4A 1UDWA 5REQB 1D0VA 1Q44A 4RS4A 2R87A 3K0EA 4HI0E 4I5DA 2CV1A 2QUBA 3HN6A 1O77A 3N0RA 3ANXA 3WLRA 4BNZA 3U3XA 1PS9A 4KW7A 4CKCB 3MAJA 5EZSA 3NWJA 5DN9A 4IG9A 3UHFA 4NBRA 2DUJA 1HQDA 4UEKA 4LYJA 4B3FX 1AF7A 2IEDA 5KKAA 3S99A 4ARUA 4BVHA 3WWDA 3DYIA 4MIEA 4R1PA 4JI5B 3R0QA 1CQWA 1NN5A 1XYVA 2XADA 5GJCA 2Y9PB 4O2AF 4B3DA 4CKWB 4RPJA 3UV3A 4DRXB 3HRHA 1W85B 3OKPA 3CR3C 4WCDA 4YRAA 3F6BX 4PTYA 2WV9A 1Y1LA 4LF4B 2HKIA 3NHZA 2D00A 1ADBA 4JBHA 4O4HA 2QUZA 5FYQA 3SGLA 3WIOA 2OCPA 3WL7A 1H22A 2EDCA 3PRKE 4S1TA 3EAQA 1NOIA 3E9QA 3TW0A 4LG1A 2BKEA 3A4NA 3BPSA 3FIJA 1H1TA 3QBVA 3IB3A 2AF4C 2G5PA 2GVNA 2II6A 4M0UA 4TKUA 3S2SA 4JJEA 5FBZA 1GL3A 1FXUA 1E79A 1OKKD 2BZGA 4JBXA 3R5HA 4C08A 3ZHXA 1ZCAA 3JVDA 2EQ5A 2NQ8A 4IVNA 3S44A 3FI9A 3I04M 5HIMA 1OLSB 1OCEA 4ID3A 2EJUA 3DONA 1G2PA 2DYKA 1I3NA 2FG6C 3HUEA 3OFKA 4Q9HA 3LK6A 4DCMA 4UHDA 5ALLA 3GEEA 3AEUA 1JEQB 2QKYA 1NVDA 1Q0TA 1U4NA 1QFYA 3OHPA 3EIEA 3JQ7A 2XB6A 3O7WA 3SNKA 3N8HA 4D9GA 2XCRB 2MMCA 1CR4A 2YBEA 3DTVD 3KG2A 1RRMA 2PDAA 3UWDA 4N01A 2OXIA 5C3MA 3ZD7A 5FLKA 3LT1A 5THKA 2C07A 2P9HA 2FF7A 3HSYA 4FCVA 2E85A 2N1MA 2BJWA 4AP5A 1OZ0A 2X9QA 2OGWA 3ABSB 3K6SB 5KKNB 2I91A 2R8OA 3HB0A 3HCBA 1W35A 4BO6A 5H5JA 4BQRA 5FUQA 1TVKB 3TOVA 5LMCA 3HMKA 5MHTA 3DLBA 4PSAA 3VYVA 1JIKA 1WHSA 3IDSA 3IKLA 1XZ8A 4G1EB 3WLSA 3OKCA 4PU0A 1CZLA 2JLCA 3PC8C 4M6WB 3PPYA 4R01A 2GN8A 4EJSA 3G6WA 4C76A 1PGPA 4JXZA 3F2IA 5ILOA 1GTZA 1UFRA 4AY3A 5I48A 5LA6B 1QLHA 3B8EA 1NMSA 1Y48E 1BU5A 2EWWA 3HCWA 3CTPA 2J85A 3COPA 4H15A 4R3UC 4ALNA 1WSWA 2WVAA 4HJRA 4L2IB 3EGVA 5I8WA 3MNFA 4EMUA 3FFXA 1PCXA 2XGMA 1WKVA 1M8KA 3HP7A 4LFCB 3SZOA 2HMUA 1Y81A 3GZ4A 4OQQA 3RSGA 4JI7B 5JDCC 5B7QA 1OTXA 3QUTA 4Y9SA 4FYYA 4D25A 3CNNA 3DMTA 4DA7A 4NSNA 4DYDA 3C74A 3LM8A 3PUIA 1P5ZB 5BMOA 4DV6B 4O02B 1BKYA 1RLIA 3LKZA 3GLFA 1XMSA 1I4WA 4CFZA 1VP3A 1B0PA 5LBIA 3ZHZA 2JAWA 1TYDE 3EIQA 3MWEA 4B3MB 4AWBA 1QCCA 5EXSA 3WGZA 3R6TA 4J2OA 1CJTC 1M5TA 5A3JA 4BB6A 2AR0A 2VZ8A 4IZOA 1ZGZA 4B8WA 2BMAA 3BIWA 2YOHA 1HETA 4LVOA 2GN2A 3COSA 3EGEA 2C3YA 2YVQA 1G8MA 2H18A 3DDOA 4ZRNA 5LZ7A 4EG8A 2PQMA 2DCMA 2VZ0A 3FLMA 1BFDA 4TT8A 5FUXA 3WP0A 5IWAB 2PUWA 1TF2A 2WWRA 3O93A 1JHVA 4WKBA 4XKJA 4YRZA 4KGXA 1E8NA 3I2JA 1O9GA 1RYNA 3KFXA 4UXHA 1XDDA 4XH9B 2Q7OE 1Z4OA 2GS9A 1HZZC 2B7CA 2O2JA 5CVCA 5FD8A 1V4NA 2XZOA 2V7VA 1SUCA 5EP2A 1REQB 3O8OB 2RHLA 4PZLA 2OBLA 1XHFA 5ALMA 3SVTA 2MDTA 4K0RA 3E7WA 2PH7A 1D4OA 1WHTA 2JKYA 5FTMA 3U56A 4LJAA 1D7AA 2WYOA 5HQTA 3BHJA 3L1KA 4IH9A 1ZKDA 4V2UA 3BD6A 3I3OA 1D5CA 3M89A 4KIWA 3QLTA 4KREA 1BHO1 3GJ7A 3KUKA 5CDSA 1JFVA 5CK5A 5FPHA 4L8WB 1WUIS 4URYR 1U2RA 4HC4A 2HZ7A 1EX1A 1L5OA 2EQAA 2OAQ1 3H1AA 1WEHA 4G0NA 3FB4A 4KUHA 3IPRA 3TZ6A 4DAOA 4NDNE 4URVR 5I47A 3JQ9C 2X2EA 4ZDKA 3MHTA 1IEQA 4H7PA 2O06A 4OQLA 4IIUA 1AS0A 4KXNA 2Y1CA 1BCRA 1OAOC 1Y4UA 1NE2A 4K1XA 1H93A 3ESXA 1XQXA 3LY9A 1B4DA 3B3GA 2G7MC 2PFKA 4XX1A 1U99A 4C5CA 1A4IA 4I6JA 1MIOA 1XKLA 4YREA 5KDLA 1A7AA 2HMTA 1NF2A 2AX4A 2CB9A 2FPXA 1NVFA 2R86A 3A3PA 3BN3A 3K5IA 4G0MA 4KLZA 3VV3A 5T3UA 4AN1A 1DELA 4D02A 3WLKX 4NEQA 3ES9A 4RTJA 1KI4A 1X3SA 4FNAA 1GGHA 4GYJA 2W8ZA 2VJDA 2YWFA 3NKVA 2NSHA 2ZQ5A 1XTPA 4ZYTA 3BIFA 2IPXA 1F14A 2I4OA 3DUFB 4I14A 1PE0A 1YA8A 3SM3A 5B57C 4BFXA 5JZBA 5FUVA 4MYUA 1JDJA 1YZVA 4QJ5A 2HU5A 4ZK2A 4F4CA 1YUNA 1CZHA 4D8WA 2WJHA 2BI4A 4GX0A 1FTYA 2H2WA 4KXQA 1D4ZA 3FNFA 3QHPA 4X44A 5JD4A 3V80A 2VFAA 1G4AE 1KQPA 1UBLS 1JLKA 4TUYB 1LPAB 4MR7A 3ZYZA 1H4QA 3X1DA 2E2WA 4MHOA 4JQOA 2HRDA 1QAMA 1ZMRA 5DBOA 3RTGA 4MW0A 2EJTA 2VDWA 3QZUA 3W06A 2PKYX 3HLTA 2O52A 3WSWA 2VUSA 2DHRA 3WLLA 5JLJA 2I22A 5JZMA 4QRHA 1FMLA 3INRA 2F48A 1W30A 2XGGA 4KMMA 4CCSA 1NQ5A 3S1AB 2QBYA 4X8MA 4MQ4A 4U7DA 2CLOB 4EG5A 1KO1A 1JQLB 2AT1A 2NU7B 4PRLA 4R40A 3R8XA 5WRFA 4L5BA 4IKPA 1V95A 3FHTA 3IERA 2FSGA 4XJXA 4W5OA 1Z17A 2GASA 4LXGA 3MSCA 2CJWB 2FW0A 4PVDA 3GPLA 2DPXA 4UHEA 3DB1A 1F8YA 4GGPA 4IGEA 3PGLA 4PYKA 3B13B 2EZTA 2I4NA 2TMYA 2WP0A 1EYZA 4FJ0A 1QHHB 2YWEA 1C4XA 5AK6A 3VR5H 1EA7A 4B2IA 1BXGB 4KACA 4WZAA 5SY4A 4EUHA 3CG0A 3LQRA 4GXQA 3SVZA 3MB8A 4PG5A 3WADA 1Y7IA 4R5MA 5HIAA 4MA5A 1ZW6A 3OJLA 4ZGGA 4YPVA 2W00A 2ZAIA 4QPZA 4MV5A 1SKYE 2ZJAA 3IQZA 4HWRA 4ENUA 4IY1A 2CV0A 3NTRA 5DGXA 4DNXA 2Q1UA 3H6HA 3DBOB 2ZB2A 1D07A 1CP3A 3BXXA 2P5SA 3ETJA 3IDFA 5AMXA 5JSUA 1AS3A 2FEOA 4P3OA 4RTRA 5EXDA 2QLTA 1CR2A 3K0FB 1C30A 2D2FA 3SS8A 3F6CA 3NHSA 5DM1A 4Z9XA 4EHHA 3F6RA 1T3ZA 2QT0A 3IEVA 3LUGA 1LI4A 5ERYA 1QE0A 2FN4A 3J7TA 1P9WA 2YINC 3KXDA 4OQMA 3KV1A 4TL8A 2HLPA 3PQ7A 4ZQFA 5FLYA 5L7YA 2QL6A 3M82A 5ELXA 5KU7A 2B8JA 3B3FA 1SOVA 2HFJA 5KU1A 1C4OA 1UR5A 3WKDA 1E7WA 2H5LA 4WZBE 2W6NA 5DCUA 2W71A 2D8AA 1EAMA 5AM1A 4DQXA 2ZJ5A 4MGHA 5DFAA 5CIYA 1TIKA 4QECA 1R0CA 3D2LA 1AUOA 3SVLA 1KO8A 2Q4TA 3OZXA 4TQGA 1VE9A 1P31A 1CUJA 1T0HB 3Q8MA 5JMWA 4PX2A 3DAGA 2CW5A 3C3JA 4FBLA 4LZWA 5CFRA 5IASA 3L8EA 5LQCA 1H6AA 4XRRA 3D6MA 3HO8A 4AVYA 2WUEA 3OZRA 2FMTA 3BJIC 1W4CA 2XW6A 1GQ2A 3PPXA 1QU2A 2NZWA 3DCYA 3N58A 2PCJA 5K3BA 1YVPA 4EL5A 4C21A 4LJRA 1Y3BE 3C5CA 3LQYA 4BC0A 1QUFA 3B89A 3K4PA 4KI7A 2P3QA 2PX6A 2VT6A 2WJJA 4QUDA 2EZ9A 3IUPA 4EHLA 1ZR2A 5CXXA 1Y7HA 2VYCA 4B8ZA 2XQIA 2ZBEA 4BL5A 3MJ4A 1FQWA 5CVJA 4DUGA 5EJ4A 3FOEC 5D7NA 1ZBDA 2E6KA 5EWLB 3U4HA 2AG6A 5HPYB 2D0DA 2UUOA 4ISCA 2C88A 4XW2A 1QK4A 2XD9A 1OWNA 2DQ4A 1Z4MA 4E2ZA 1JU9A 4G4IA 4GLFA 1TCVA 1RADA 3C8HA 3HEAA 3NEAA 3T34A 1AUVA 2QW1A 1UKAA 2DR0A 2TS1A 3A2LA 4JVOA 2W6OA 3RS2A 3ZHCA 4DJJA 1PSZA 4AQYB 1HKUA 1I1NA 2WFMA 2W5UA 5CM9C 2G8NA 2GPAA 3NALA 3UV7A 4U9UA 3L0YA 4GPEA 3ZX4A 2WYVA 3AVPA 3CRMA 1J8QA 2OMKA 2PUJA 1YIAA 2HF7A 1JDBB 5G0VA 2BGLA 4TSRA 1D6JA 5LPNA 2XYGA 2C9CA 1ZVKA 2ZSIA 4K05A 4AJKA 3TNDA 3OJOA 1RW4A 1JA0A 1S2DA 1RC1A 2Z2KA 3O9ZA 1VJ1A 3KPVA 4CMIA 1E79D 1ZD9A 4I3GA 3RFTA 2AOXA 3LZDA 2ZRIA 2GPYA 2DUMA 1KQ3A 1S3IA 3PUHA 3B5EA 4DV4B 4KL8S 3VX4A 2CL6X 2WTAA 4IHJB 4LOJA 4E46A 4ERXA 2DUWA 3BE6A 3OJ0A 4W63A 2M1XA 2Q5OA 4H17A 1BMFA 2Q1TA 4WHMA 1WXGA 5D8DA 2AD1A 4E70A 5DOVA 4EO9A 5HRAA 1M34E 4H77A 3Q41A 3BKXA 3GGPA 3ZGNA 3UMSA 1OFTA 4A8JA 4Z4CA 5ELLA 1TD1A 2IIQA 3RV4A 4KEAA 2IYVA 3U0VA 1S7CA 2IY8A 2HA6A 2FW9A 3B9BA 4LPKA 5LYJA 4C05A 5HQ3B 1YZTA 2FHSA 3KDAA 1CY4A 1H2AS 3OF3A 1JWAB 4ZMSA 1Q95A 2X4LA 1FFCA 1P9NA 2E4ZA 2HMYB 1GL6A 2FZCA 1DINA 1PQ4A 1ZBQA 2ZYTX 3F7MA 2WM2A 4IX9A 3AY6A 2Z4RA 4EAQA 1QKJA 3RRBA 3PEEA 4MIYA 1D6MA 4RDCA 1R0LA 5FWXA 3AI3A 4MHTA 2J0UB 3TRDA 1T1IA 4C3UA 4GVLA 4DMKA 2NSDA 4WLFA 4ENQA 3H11A 4US1R 1IIBA 3SF8B 3GP5A 1IHDA 1ECBA 2GB4A 2IPOA 2IUEA 4GYKA 1CDOA 4N54A 2EKPA 2QDXA 3W8NA 3G2HA 5H3CA 2BV3A 4KNYA 5DHUA 2BFEB 2FA9A 5K51A 4MRNA 3FYCA 1SQGA 3M6MD 4Z1MA 1GQFA 2ZIVB 4J0IA 4OP3A 3I6IA 1UKYA 1KPGA 2H4FA 3CSUA 3I1FA 4LGCA 3ACBA 3NGMA 4UREA 1W46A 3G7UA 3IVGA 5CB8A 5DWQA 2OFFA 2W2QA 1S02A 4PYQA 1U8FO 3E1GA 4RZSA 2Z8XA 4NXMB 1K97A 1JLLA 1CUHA 2WC1A 3NT2A 5FUYA 5EN4A 5FT9A 2C1EA 3T95A 4BWYA 5FUMA 4XPIA 1TZKA 2VXBA 3GO4A 1YE8A 2V7BA 1T1SA 1C80A 1U9JA 2CLEB 3UA4A 4BTLA 2G6TA 1KMCA 2ZSHA 4OQNA 1N7GA 1P74A 3FNEA 2QRKA 1KY4A 4E5KA 1PW5A 1NR1A 3CWCA 1VP9A 3ZW7A 1KYQA 1CZRA 2QY6A 4MQLA 4Z2AA 4LF9B 2QN7A 1D2NA 2F1IA 4HGQA 4N5DA 5KMGB 3EGDB 3SEZA 5BVGA 3ADPA 3VDRA 1E61A 2K6GA 3ECSA 1CUUA 1JILA 2HY7A 2BE7A 2QMOA 2QRZA 5JEEA 3T0GA 2D2VA 2X6TA 3K8OE 4AJIA 1RBYA 3R7WA 4EA8A 8ADHA 5KTKA 4H7HA 2RK6A 1TJYA 2R48A 4H1TA 4HAXA 1KRWA 2E18A 1CIJA 2AZ4A 3ND5A 5EIXA 3O2NA 4IIVA 1GP2A 3QU7A 4OXNA 2AJDA 3GJQA 2PS1A 2H1WA 4LQ4A 2VHZA 4E2XA 3KVRA 3HO1A 1C7FA 2IW3A 1BX3A 1QHNA 1WDKA 1V7ZA 2PFGA 2QVBA 3AJRA 3AJEA 3QWAA 1GG5A 4LC9A 3DNMA 4J90A 3G79A 4DFDA 5AKXA 1KNQA 4J0JA 1Z25A 4LMAA 5AI0A 2ATEA 2HSWA 4YP7A 3IQIX 4F84A 1RHUA 1I13A 2H2DA 2X4GA 2Y6VA 1GG2A 4UM5A 2A9JA 1FFAA 1QVZA 4KQIA 2DHDA 5DH9A 2Q3DA 3K6KA 3RSCA 1SG9A 2QRJA 5E9JA 1UOOA 1LTHR 2MWMA 4IDBA 4IIEA 4LOKA 2ZRJA 4KN8A 2PAFA 4YJKA 5JY1A 4LF7B 1UT8A 3VPFA 5IXYA 1VFNA 3R7SA 3IBTA 5B3JA 4OGGA 5AKIA 1VKRA 4LQLA 2OQIA 1BE1A 2CYAA 3HDHA 1RC8A 2PS3A 4D26A 3LPDA 4O4LF 3F97A 3KQVA 2WTUA 4M7RA 2AKAB 4QAJA 1QIMA 1UOEA 1TLFA 1GM5A 5DCWA 2V6GA 3OQIA 4ZOBA 5BNFA 4UAVA 1KZ4A 4ND4A 5E4TA 3AGPA 1B41A 1I33A 1PL8A 4EF4A 2XJ4A 3OUZA 4KXLA 4DEXA 2QSYA 4JLPA 1ICIA 5DYYA 4B4UA 3P9NA 3SD7A 1I5EA 2X41A 3O8RA 4NG5A 4KLAA 4F6RB 1LZKA 2GLXA 2JFXA 2XWPA 1GCIA 3SM9A 1NM5A 2A5FA 1YTLA 3AJ8A 3IUSA 3N5CA 5T5QA 3ZU2A 2H29A 4E3WA 3HR8A 3NYRA 5F3WB 3OFJA 1R1DA 2Q6TA 5IEBA 4BQNA 1OGYA 3AUJB 2QVZX 2PXAA 3KQPA 2VSXA 2I33A 3K1YA 2VO1A 4HB2A 4J0GA 2ZRDA 3E5RA 2QN1A 3FI0A 4PNPA 3BKWA 5BQPA 4IF6A 4K2AA 5K3OA 1VHTA 2HPHA 1RLOA 1NYRA 3GGOA 3M2TA 3PNPA 1J21A 5A1TA 1LS6A 5JMPA 2YFQA 2GNAA 1PQWA 4TWZA 5ALUA 4HAYA 4ND6A 4PG7A 2I9KA 2IQIA 4PRKA 3ROTA 1QR2A 3KOOA 1GKYA 4FFPA 5D85A 3LPMA 2QZ9A 5IT0A 1VL2A 1OT5A 1X77A 4F1KA 3CJRA 3QIAA 3LFHA 2DWUA 1Z36A 5AW4A 2XT6A 5LQMA 1XZJA 4P4SA 4YRBA 1NVUQ 1UDXA 2QTRA 1OBFO 3FA2A 4L57A 5CK4A 5JXJA 1JFTA 4EJ0A 2FW1A 2VAMA 2DE0X 3CT6A 2GQ0A 4X8LA 3FH0A 4XLTA 2QRPA 5AWFC 4OGKA 4TZ6A 2R5WA 1XPJA 1RLTA 4ZOAA 1TW2A 1UXJA 4MW7A 3IRUA 3N2ZB 3G2KA 3T7JA 4I7EA 5A2QA 2FQXA 1NNI1 1E2JA 2HJSA 2RE8A 1HE3A 3NRJA 1NP3A 2BTOA 3RARA 1FMTA 2FMKA 2FMHA 3EZ6A 4DT1A 1AOXA 5AVJA 1PWZA 2FZWA 3L7YA 5JNVA 5JDIC 2P11A 3LPLA 3IEPA 1YI1A 2BHNA 3GY0A 2FSHA 2B7BA 2R4QA 4Q9DA 2H2IA 2XNSA 4FN4A 3TO5A 2FX3A 2JCVA 2I8CA 4FLFA 4YJHA 2XB4A 4Q7LA 4DZRA 4J75A 4B3CA 1KAQA 3PKJA 5FB3A 3LLMA 1NUAA 3HR7A 4DY4A 4W5WA 4W99A 4EUEA 1Z33A 1ULAA 2HPVA 4HDMA 2ODPA 1B3BA 1VI5A 2WPNA 3DULA 4UEQA 3A1SA 1Q3KA 4H35A 4DCNA 4MP3A 1K7CA 1S8OA 1TEVA 1DIGA 2CFOA 3JSXA 4Q4LA 3SIXA 1QGZA 4MCHA 3WHLA 4MAAA 1YOVA 2JC3A 2GCNA 3QMVA 5EMKA 3UCXA 4UHFA 5BURA 3K9FC 3D8SA 5LP6A 2G77B 3ECCA 5ENVA 1Y8QA 4JL8A 2XH8A 1ZY2A 3CV3A 3BIXA 3NCHA 4FBGA 3GJZA 2R7KA 4LF5B 1X13A 1CQIA 4NXNB 2QLLA 1T6YA 1V7CA 4LZNA 4ZV7A 2P2YA 1E1KA 1M6HA 2CE7A 2OHFA 3CF6R 5J5AA 4EDHA 2G07A 2P79A 3EW7A 5IDXA 4WBNF 2QIOA 4ETIA 1J56A 2XB9A 4WRRA 5BN4B 3LUHA 5A5FA 4EG0A 1V16B 2RH9B 2C98A 1NF3A 2VYVD 3O84A 4ZXPA 5TY0A 5JHHB 1KVRA 1H9AA 2ZI6A 3SU8A 5DB4A 3GD5A 1RS0A 5KS2A 2GEJA 1NXPA 3SCZA 5DNCA 1XD9A 3W79A 3ZD9A 2C2ZA 1GG9A 3KAKA 2ZSUA 3ITNA 4LGYA 1G0NA 1Z2DA 3FCUB 2GBLC 2G5GX 4CI0B 1G7RA 2M6LA 3GV0A 1WS6A 4BGUA 4J29A 3VR2A 1PNVA 1BGWA 4FFSA 4MMYB 1E1RD 2HK9A 4MR8A 3IPXA 1ZMBA 5BYAA 3HKEA 1L4HA 3FVQA 2VL7A 3TGLA 4E1AA 3EPHA 4H6WA 1MVOA 2PBZA 5FAKA 5K7SA 3UW1A 2LV8A 3SQOA 4PHCA 4Q4JA 1T5IA 3L84A 5JPCA 1NW7A 1UJ2A 1KVTA 4I36A 4QT4A 1EWVA 2A94A 1XMPA 3AUSA 3B38A 3ZY6A 4B35A 1HSOA 4UHKA 4CODB 2IBTA 3V4RA 3WYGA 3GDWA 4J0HA 1YU9A 1CUEA 1EA5A 6PFKA 4F3NA 1GFIA 3FRJA 2FYTA 1Z0UA 1GFWA 2G4CA 2C4VA 2JIRA 3FWNA 3NAGA 4LY6A 4BVAA 4K46A 3CX3A 5HUHA 1KVSA 1KWGA 5E3JA 3ZIDA 3DP9A 4ESEA 3UJ8A 5E0OA 1K5PA 2QN6A 4BNWA 4TV9F 3GXBA 3L4EA 1T4CB 4Y2VA 5DK4A 1OBVA 1ZD8A 1NZJA 4ABTA 2VDQB 3WJ2A 1E2MA 2XUDA 3TMAA 1V9SA 2I3DA 2Q49A 1XF1A 4FINA 4Y7CA 3TL3A 4D96A 2GZ3A 1KJQA 2I2DA 4DLPA 5HOQA 2ERXA 2PWBA 2ICAA 4TLBA 1KO7A 3BWEA 2LZ0A 2VJMA 3INGA 5AOAA 4AMGA 4BBPA 4IJWA 4J7AA 4YMTA 1NGSA 3X1KA 4ZVNA 2VXOA 2G9ZA 2CL0X 5EKSA 4D42A 3ZG6A 2D5BA 1ADYA 2SCUB 3FMFA 4U7TB 6ADHA 3TLGA 2YN0A 2DLCX 2ARKA 4Y6OA 1IH8A 3CKYA 3EULA 3ZWXA 4AN4A 4BU1A 1G8GA 1Q0RA 2BE9A 4AQDA 5TV2A 1RWQA 1A4XA 4EX6A 3W5BA 4JOQA 3P2IA 3ZZTA 3VSEA 4A27A 1CNEA 4C6RA 3DLPX 3WWCA 2VCHA 2OBFA 4FKMA 1W52X 3VHQA 1ECPA 5TQ0B 3ASUA 1AKQA 3GLKA 3H5WA 4REOA 3RT7A 3P7MA 1JAIA 1NXWA 3TD6A 4P38A 4ZVKA 2ZJ8A 3K71B 1YSCA 2NU6B 2E4UA 2IZ6A 1GRNA 5C8YF 1YULA 4JX8A 5AQEA 2J5BA 1LDYA 5GIOE 1L7RA 4AY6A 3E9MA 5DNDA 2GBCA 1TCCA 1PWHA 1ULZA 2NX2A 1EWYA 5CYOA 2R5FA 1KZHA 3FF1A 3W5VA 5DNWA 3M6IA 2HCTA 4N3GA 4R2JA 3QNUA 4V3CA 3V8VA 3K35A 3OQJA 3GLIB 5IAJA 4IEFB 5ALFA 2ECKA 4Q6BA 5ALZA 2X1VA 1HT0A 2GF0A 4LWPA 5ALSA 3ILHA 4EHFA 4JVSB 2WTEA 2ZUDA 3AGQA 1X8XA 5IABA 4EZIA 5CXSA 3AEYA 4M9UA 1J42A 2PGAA 4ZMRA 1W0KD 2C2YA 3PB3A 4PLGA 1MX3A 1CSEE 1E18A 2BH9A 2YZMA 2EX0A 1DQSA 1W88B 2FVYA 5FV4A 6AT1A 2FFAA 3VTAA 2J31A 2ZRMA 4K6KA 3C7TA 3PICA 4E5VA 4XGKA 3LVQE 2X7JA 5T6MA 1C50A 4NQRA 3OQMA 1WV0A 2GSDA 1DT5A 1DC5A 5LQDA 5EJMA 2W42A 1TXGA 3CSSA 1A72A 1NOKA 3GDOA 3TLBA 1DC8A 1T8PA 2GD1O 2OZPA 2VJKA 1Z7WA 5B58T 5IYZB 4TZ0A 1S8NA 1XB2A 2XEDA 1UM9B 5AI5A 5FNZA 2J6CA 3KR2A 4EGAA 5F51A 5HGJA 3DQQA 3IE1A 1NQVA 4N7BA 2QJOA 2PWAA 4LQCA 2GF9A 3QENA 3JRWA 3V1MA 4JC4A 4LJYA 2C9MA 2FQQA 2WZQA 4PZEA 3FDIA 3H5AA 3HO6A 1XZMA 2B83A 2FPPA 4UQPA 4ESVA 3RD5A 1O54A 2ASEA 4Q7QA 3AVOA 5CURA 5K3AA 1DDGA 5LXTA 2EG5A 3DLAA 1TF5A 3OCWA 5CEFA 1YGPA 1WTAA 2F3TA 1L5KA 1T3TA 3RBXA 5A5VA 3DL2A 1UJ5A 1YR2A 2FWPA 1W4LA 4QM7A 1G19A 2OOSA 4C1NA 1G2OA 4E5SA 3PHGA 1E7YA 1IN5A 3HXTA 3DLCA 2LGJA 5TC4A 4EW1A 4BXOB 3G3EA 4AO7A 5CH5A 4F7DA 3UQZA 2FRXA 5ICGA 4Y1GA 2GRUA 3JQAA 2Y66A 3ER6A 3LOUA 5C3UA 4JEIA 4UUPA 3BE4A 3TH5A 1CPYA 1RCUA 1UBNA 3PNBA 1Z08A 2WF5A 3C41J 3MBIA 3RIYA 4XPZA 2A1IA 4ZVVA 4Q12A 3BRQA 4RQTA 4LHSA 1UKBA 2GHQA 1ONPA 1ELOA 3W3AD 2VAWA 4MRMB 4NDZA 1JJBA 4HWSA 3U2QA 3PLAE 2F43A 4NATA 3V1NA 4DBVO 1P6UA 2B2CA 4WN9B 3OT4A 4LS3A 1QORA 4PXYA 5IT4A 2DSNA 1PFKA 5DF1A 5E2AA 3PQFA 1JG6A 1M7BA 2FZ4A 2YWHA 3HBNA 3DWIA 2VZ9A 3NTLA 4KH0A 1UJCA 4JBGA 2H8GA 3NXSA 1H4TA 3HFGA 3I9V6 1WZUA 2VUUA 3VNQA 2IYUA 2PNFA 1NVVR 4PC3A 3UAXA 4UPDA 3FTDA 3IAXA 1WZNA 6Q21A 1DG3A 1Y9AA 3D2AA 3I04A 3L0DA 2LXNA 2VDKB 3FYUA 1V1RA 4L78A 1JT9A 2O5RA 4LSMA 4O63O 3RDPA 5KOJA 1NQXA 2Z4TA 4F4IA 3NBKA 1HORA 1NLFA 5B64A 1VYTA 3K73O 5KTMA 2YVLA 3C7CB 4JNKA 3KQKA 3OA2A 4L5CA 2ZS9A 4IHKA 3D3JA 3T5TA 4ZU6X 5L51A 1UDBA 1JJIA 4IIJF 1OA1A 3W7AA 4NK5A 4NMWA 4YA6A 1RACA 3RKRA 4UKDA 1QBKC 3ZE7A 4Z7JA 5TPWB 5B3KA 4B9EA 5C8DA 1WD5A 1H3NA 1ZW1A 2G9VA 1EX6A 5AKKA 3PFGA 2WD9A 4UUBA 3KT6A 1M2KA 3RROA 3I8XA 3ZHTA 2WTXA 1I9GA 1ZH6A 4I8DA 3I53A 3PEVA 1ORWA 5EXTA 4RF4A 5EMLA 3BL5A 2WQ6A 5LWQA 1U3FA 1M1NA 3O2SB 3PX7A 4JLWA 1ADFA 1B7GO 1M1YA 3W5CA 1SC6A 2B6NA 3QYJA 5IH3A 4BN4A 3BOSA 4RZ3A 3MZ0A 2BR4A 3PGVA 3HFRA 3TG8A 5J4LA 1JJ7A 1FEZA 4XDHA 3ILXA 4DLTA 1SZJG 3OCCA 2EHJA 2OLJA 4LCEA 3M4YA 3R75A 2CHEA 2LIPA 2OCXA 1KEEB 3FAKA 3SWWA 2AR9A 3UKDA 3RSOA 2O05A 2GEFA 2I7XA 1QH8B 2V7UA 1MC1A 3O26A 2ZB4A 5BRNA 4GC9A 2VF8A 4S04A 3BMXA 4GLJA 1QLWA 3GLVA 4YJ3A 1WB9A 2O8BA 3C4VA 5IHXA 3T3EA 1GSOA 3SK0A 2DFLA 4BZPA 3PNOA 2IOFA 2VCEA 5AFSA 2H4HA 1LJUA 4ZCRA 2IGBA 3FGZA 2AKYA 2JLSA 3H9EO 4PYRA 2V4UA 4LJ5A 4ZT6A 4KQHA 3VGPA 3C3DA 1M6NA 4HB4A 2FZLA 4I19A 2IY7A 2VNAA 3ME5A 4IAOA 2P9CA 1YT5A 1PTJC 2QQEA 4MVJF 3C3EA 1DB3A 3PDIB 4TV8F 1P4GA 1U7OA 2NXEA 4ZOLA 2C83A 2RGNA 3U60B 3E9RA 1W2WB 1U5BA 3HY6A 1FTWA 1T0BA 3WWPA 5HZMA 4KAFA 3ISTA 1K4YA 3LQFA 4RD2A 4P81A 4MQBA 2WHRA 2ZB7A 2XZTA 4EPYA 1PYOA 2BEWA 2IIPA 7MDHA 1NVKA 1R6AA 2W8BA 4BX9A 2NN3C 3BFJA 2G08A 2HCRA 3LY5A 1G63A 3IPYA 2PBRA 5BNZA 3ZXUB 2ENWA 1U1CA 1Q6ZA 2HHLA 3FNGA 4XGRA 3FPLA 3RAFC 1NF9A 3ZVMA 2NVWA 2CBZA 2AYXA 1W1WA 1ONSA 2M6SA 2PMKA 1RJ9B 2W6QA 3IOMA 4PLZA 4PLTA 2ROQA 2I6UA 1BVHA 5JH7A 1DQZA 5FCDA 4LNUA 2Z1NA 1WPXA 4RIGA 3VUEA 2B21A 4B7ZA 5CD9A 4FEGA 3OSUA 4CDNA 2H52A 1N9GB 4JLVA 1CY2A 1R6TA 2YR0A 5EE1A 2YUTA 1A1VA 4Y0AA 2Z2IA 3EW9A 4Y9DA 3TJZA 2CF5A 5CLLA 1WW2A 2AFHB 3CRVA 4MO9A 1P39A 5FL7D 3R7NA 2GZRA 4B34A 2H1FA 2NXCA 4F3TA 4BQEA 4ZZ3A 1XWWA 3UKJA 1M76A 1ZFNA 3DBLB 3VR1A 2GEKA 5HKBA 1HT2E 2GAAA 3BB4A 1K4KA 2HDOA 1YBAA 1GRVA 3NKFA 5I9SA 1B8UA 4LYYA 4XEHA 5ED4A 1GZHB 2WFAA 4RVNA 3A10A 1SBYA 4ABYA 5ES4B 1WTCA 1NQWA 1PL6A 4XRGA 3WGKA 2EP7A 2JVJA 1MCZA 1RAFA 2ZCJA 1NQOA 4C29A 4DR7B 1ZM9A 3MFQA 1DX6A 2B4YA 3U37A 4UTZA 5EIAA 1UMCB 2FU5C 1ADCA 3CB2A 3FVVA 4P7GA 2PA3A 5IT9A 3DE5X 4H7IA 1O96A 2E5WA 2VQ3A 3BC1A 5D3QA 4FNOA 1N2GA 5FYDA 1CUXA 4R31A 5A5EA 5GV8A 4BFWA 4BLPA 1GU0A 2DWQA 2JFNA 1GSHA 3I9KA 1V7PC 5LOVA 1BWQA 4NYMR 5FADA 1Q7TA 3S2UA 1HDRA 2W70A 3GLGB 2FB9A 2H7VA 4JQSA 3V00A 4DSTA 1JZQA 4FDLA 3EOAI 1M2OA 1N5OX 3VM6A 3WV5A 2Z4SA 4D80A 4ZRMA 2BW0A 3B20A 1UP6A 5J3JA 3DV0A 3ZZ0A 4OHXA 4Q9AA 3T9BA 1JZTA 2I2AA 2RGWA 3MILA 4OP2A 4U2CA 1RIFA 2Z2JA 2VQEB 4BMCA 1FZTA 2D8MA 1ZGAA 2I65A 4AC9A 2V8OA 3EZXA 4AU1A 5IDWA 3HXOA 4EY8A 2W58A 1ZVQA 1N3IA 1HDXA 4HQ6A 4B6RA 4BWFB 3WIBA 4QODA 1LB1B 3G1WA 4ZEWA 3V32A 2X4DA 1NV9A 1Z06A 1G1MA 3A1WA 2V7QA 4RK1A 5J2UB 2DM6A 4L0CA 2XT0A 4O3FA 5DM2A 5HJ5A 3NDIA 5FHQA 5TNXA 1F0NA 4CLEA 4CTKA 3S8YA 2XMCA 3WSVA 1IBRA 1Q1ZA 1MAHA 1I8TA 3AESB 3EG9B 1AM4D 2JLQA 5ER6A 1MLDA 2QVCA 4PO1A 1N8TA 3ILSA 1Z8DA 4UFOA 4U9HS 1BS2A 1W6UA 1I3OA 2XMSA 4DQUA 1AB5A 1CX9B 1NJ1A 1TTQB 2BGJA 1CFZA 2P2SA 1E2EA 3HZOA 1U2DC 4CLRA 1ZH4A 2ZE6A 3DOOA 4F1JA 5FOXA 1E59A 3ZXXA 1VDZA 4G5XA 1TA9A 1EM8A 3A4MA 3LX5A 4XDZA 4GKKB 1LVHA 5NLLA 3DMPA 1NVGA 1J22A 1PJZA 2I03A 4OD0A 5FQNA 1KBQA 4CUJA 3D2CA 2GGSA 2BLNA 1ECCA 2XHZA 1GPUA 1QZZA 1WXDA 3Q5DA 5EKDA 4BTEA 1PU2A 1Z0DA 3CVJA 2O50A 2XNKA 2WWVD 1WPQA 1E9EA 4KVGA 2H3HA 3H1TA 3RWBA 3ZWOA 2X42A 1JE0A 3PD1A 1EGVB 3OMWA 5E4JA 4ZALA 3Q98A 4NCKA 5TS2A 3AHJA 4BMNA 4BKPA 4F72A 1N75A 3EA4A 2X40A 4GI7A 2XLBA 5BN5A 4GX5A 2R79A 4UEWA 2KLBA 3C3MA 2PN1A 3TJRA 5J4YA 5REQA 1L7AA 3ZDEA 3ZTTA 1G20E 2H59A 3C4JA 3EXHA 2HPAA 1KOFA 4WFKA 3H2YA 2WD7A 4ND8B 4CL2A 2EFEB 4S1VA 4MVJE 3RC3A 1QHFA 5JZ9A 3LUKA 3AV3A 3DHVA 2HK6A 4M0CA 4BP8A 4OHKA 3HL0A 1L1QA 3NPAA 4G26A 3LPNA 4Z0TA 3ZDCA 1D7OA 1ZI6A 1PR3A 3NH6A 1HX7A 1BIFA 5CA1A 4AX8A 1TPZA 1B2LA 3D8NA 4YN3A 4DMHA 2DX7A 3MT9A 1KJ9A 2WJWA 1GEGA 3VX3A 1ML3A 1TKBA 2HV8A 2Q28A 2JA1A 1SXHA 3KPYA 5IJ9A 3STVA 2VJQA 5CA0B 5D5HA 3H7IA 1MJFA 3TWOA 1XQ1A 3DT6A 4YCAA 4ZHQF 4TV9B 3X3HA 1GSAA 1ZRMA 3ENNA 3G6KA 3OO0A 3GWZA 1VJ5A 3K0BA 1SC3A 5CLHA 5DBIA 3SJZA 1JHUA 4DL9A 4XIGS 5KVQA 1R9NA 1XCBA 3ABRB 4MWOA 4JV5B 1BFUA 3MK31 2VATA 1TZMA 3PVZA 3QM1A 1TCUA 5EE9A 2HDWA 1E3IA 3QPDA 3EGOA 1X0VA 2ZAGA 1ZJZA 3EWIA 5B4TA 3JQAD 5C81A 5KPJA 4R9NA 2QWXA 3WISA 3V4FA 5AW0A 2WIGA 3MQ4A 1M3SA 4QTXA 4QVIA 3OZEA 4QDOA 3GT3A 5LLTA 2HHAA 1JEQA 3B3QA 3KDSE 1L4LA 3MWDB 3PE4A 8ATCA 4DV1B 4CQMB 4FEYA 1T2NA 5TVGA 4UVHA 1ISGA 3NTUA 4YAKA 1I94B 3PFIA 3QG5A 2J3LA 2Q5FA 4X93A 1H0KA 2RKBA 1CUWA 1VSBA 1R74A 1ZOLA 4QJIA 9MHTA 4KR6A 3UC9A 2MIIA 5HP4A 2RIRA 1EVZA 4N6NA 1MT3A 2YZNA 4AUNA 4YXFA 4JXXA 3K6SA 1LBTA 1VJRA 4WXYB 2MYPA 3PHBE 4CR8A 3L4BA 4D92A 3OOHA 3WNVA 5HILA 5BV0A 4JYAB 4J4HA 1CUCA 3I9V1 4DG9A 5B4UA 4B5LA 2Q5CA 1X7GA 2H6EA 1QH9A 1SKBA 2VR1A 2OBBA 1DRUA 2QMEA 5BMVF 1VHWA 1BA3A 2IOFK 1J1ZA 2DPMA 3A1DA 4MUGA 3IQFA 4NI5A 4FI3F 3BFPA 5P8WA 5BNWA 4MPPA 2WIDA 3R3ZA 4ZAFA 1Z75A 1UQTA 2WJ3A 3MRTA 1PGQA 5JO9A 4Q1DA 5LA6A 5C46F 4JI3B 1GYPA 3I0ZA 1TT5B 1VCMA 4OVKA 4YK7A 2IOQA 4AY4A 2AXEA 1N1GA 2V7XA 3LMKA 4HNUA 2PX0A 1NJGA 1SXJC 3I76A 4B6GA 4ZAXA 1U98A 2GCOB 4MNTA 4EB6A 1XRRA 3ORSA 1VGRA 4BJHB 4NFSA 1D0SA 4JEMA 4EMTA 3AO0B 3VSDA 2AZTA 3LDUA 1KMHB 1L4MA 2NZXA 2UYGA 4KX5A 4LV6A 4ITUA 4OHOA 4U0KA 5CH3A 4ZDWA 4EUSA 3R3XA 1WV1A 1AC5A 2RBGA 3TZHA 2PH5A 2OYRA 3ZY2A 5EPUA 1GN9A 2X9GA 2BFBA 3DE2X 3K8YA 3P96A 3PE6A 4OY3A 5L3QB 2JD1A 1OX6A 5JXWA 3KZMA 4G0YA 3KLMX 3WBJA 3CXRA 4LBWA 2O3UA 4EYKA 4CNBA 1GYQA 5BWCA 4TLAA 1USKA 1FTGA 1D2EA 2C3UA 5KHOC 3QYAA 2WABA 1Q21A 2OZKA 3AQIA 3MERA 2FK7A 1M9NA 4HAOA 4AZWA 2JKZA 1OWLA 4OMFG 2CYCA 4IFTA 1OB5A 3FSGD 3EIFA 1REQA 3WK6A 1IDN1 4LJLA 5GOZA 4RMJA 1LSSA 2XGOA 5IC5A 1Q7RA 3RR2A 1R15A 2CLKB 1SZDA 5ESDA 1O95C 2PKQO 3PYXA 5JMTA 3U7FB 3A9CA 3KVOA 3WGIA 3ZLBA 1WNFA 4OXIA 2E6UX 5AHOA 3IEMA 5MN5A 4CNQA 3U3MA 5BN3A 5E6SA 1DXHA 1VXRA 3EPRA 2YW2A 3SHTA 2IZ0A 4TMWA 4CIXA 4PANA 5A4AA 2Q0SA 1TUEA 3IBFA 3CZQA 4KYUA 2CWWA 2D1SA 2COEA 2QTTA 2O6HA 4GR5A 5M04A 2PGLA 4FTWA 4IFIA 1TQHA 1UKZA 4XJVA 4F0JA 2JLBA 5F2OA 2JFOA 2JH9A 3HM9A 1IUKA 2Y1DA 4DE5A 3O4GA 3LQ4A 4HDSB 2IW1A 1Z68A 2J4DA 4NBNA 1OA0A 4AJNA 4XYLA 2IS4A 3PBKA 3FPEA 3HWX1 4MCIA 4MINA 5FOSA 4KHZA 5TE9A 1ZN7A 2C8KA 5EE0A 5DNUA 3MIIA 3A3YA 4N5LA 2BP7B 1X7XB 4AAYA 1NN3A 1U80A 2B8NA 5AVKA 4FGSA 3QEOA 4D0SA 1ICEA 3PNSA 4LE0A 4US0R 2G40A 4ZQHA 1HMYA 1NVMB 2HRQA 4MI6A 5D84A 3WWZA 1Y5MA 4OIMA 3NBFA 2AZXA 3LTNC 2P2CA 4HDQB 1B6GA 4B73A 2PX4A 4E6PA 5I45A 2H2GA 3K0CC 1M0TA 1D1SA 2RCNA 3DEIA 3TLEA 4V0ME 1NXVA 2QS9A 3AHIA 1KYZA 3P19A 1SULA 3K9HA 2X0EA 5TGTA 3LC2O 3E3NA 4Y2HA 3ZWQA 4Z4GA 1R4NA 4RW0A 1TVMA 3FUCA 2QUKA 4BEWA 3TTVA 2PYDA 1II8A 4JVMA 3CLRC 3SYLA 1ZXXA 1V9CA 2P4QA 4ZD6A 5ALKA 4O08A 3OC0A 1F4LA 3OWXA 3BREA 2HJVA 2ZBQA 3H1PA 1BDHA 5AI9A 4LSGA 2IDZA 5IARA 2DFVA 3BAFA 2O19A 1KMNA 2C9OA 3BDIA 4IIJB 5I7VA 2QT1A 2BJHA 3A6KA 4KN5A 4DIKA 1QPGA 3I4LA 4NBKA 4H6XA 5T4HA 3SX2A 3W6OA 3K0SA 2XTAA 1E2FA 3F49S 1PQUA 2DR3A 4NZPA 1YV9A 2BFFA 4Z4IA 1AH2A 4FQ5A 4CTOA 1FP1D 1UPCA 4QVGA 1HQKA 3CZCA 1XJWA 3LX4A 4EPVA 2V54A 4YV2A 3U3DA 2O2XA 3CRRA 3IVCA 4ESHA 1IEWA 3H5VA 1C7ZA 1VSVA 4F60A 2C2WA 3W9BA 1U65A 1VBKA 2BI8A 3AU8A 3DB2A 4YLYA 2CBGA 2UUAB 2V5VA 2AGVA 4L1KA 2DKNA 1RLUA 2WJPA 4A91A 5LVAA 3TSOA 2CY0A 1DTWA 3GLRA 3JZMA 4UOEA 5ICSA 3FHJA 4W1PA 1F20A 1JJVA 4W4TA 2VP9A 2VHQA 3LUAA 3R0VA 2VHEA 4JVNA 1J0XO 4RL4A 2QUHA 3T5AA 2HIGA 4HTAA 2VA9A 4X20A 4ZVTA 2ZRLA 4H27A 3WLPA 2HXSA 3M34A 1RAEA 1DKQA 3OE4A 3MXOA 2RJNA 2HA2A 4G37A 3LBAA 5COQA 3WOVA 1CJCA 3X2EA 4DM4A 1ZK2A 3LC1O 2IIVA 3PCXA 1EFPB 1QZ3A 1KY2A 1T25A 3IESA 1R0RE 4I4TB 2QF7A 2JJMA 4C03A 3CZ4A 4O4JB 4F86A 1XIVA 4PLPA 3GGCA 3M33A 3VO8A 4ENTA 4HJXA 1Z8NA 3V8QA 2GYWA 1X39A 3VH2A 2A67A 4TV8B 3GG2A 1YH3A 4KNWA 1F38A 4NNPA 1ZA2A 4EY7A 4WXEA 4RF2A 5JQWA 2JI9A 5TMDA 1HTTA 1WVIA 1KAGA 2WZBA 3MPOA 4MWZA 3OZDA 2YYZA 4GWKA 4JJ8A 3O21A 2QE7D 4GGMX 2HU7A 4BNXA 3JPYA 3HVIA 5JU6A 1VCOA 1A7KA 1I3CA 2DU8A 2BEUA 2Q2NA 2BAGA 1N5IA 2M1ZA 3GUYA 3BZUA 1C4KA 5EMNA 3AHEA 5KAPA 2HA5A 2P77A 1FB5A 4N5NA 5EINA 3S2ZA 4J7UA 2PVCA 3L0PA 4YUZA 1IVYA 3WL8A 2CLCX 4WCFA 3L8MA 3LXXA 1T2EA 3ZQUA 3DMFA 3I2KA 3KSBC 2WEKA 3DXZA 4ILKA 2QAJA 4WASA 3F96A 3QVLA 4UM8B 3FYDA 5LLSA 3VHXB 1YAJA 2UAGA 1EQAA 5EC8A 1XCOA 5DT2A 3U9SA 4L5YA 3BHNA 2I1LA 4OFXA 3ZS9A 1BOFA 2AEMA 3PUXA 1JYFA 3WXBA 3X44A 2BGMA 1RFGE 4WTOA 5CTJA 1CF2O 5AVQA 1GQYA 3F46A 5EWLA 3IODA 3LJKA 1CVIA 4YCMA 1KP3A 2ZB8A 4G0OA 4NENA 3PD0A 2ZAMA 3COZA 3MOIA 1YCGA 2ZBPA 1ZWLA 3OHSX 5BV1A 1RR6A 1I7DA 3CM0A 3OPYI 1DIRA 5IJAA 4C0QC 1F60A 1I0LA 2UUPA 1LNSA 4EGSA 5C5IA 1N92A 4JQCA 3A1EA 3FR7A 4GWLA 5B58C 1UPAA 1Z2CA 5JVDF 4BECA 1U0BB 1MC4A 2FSIA 3AI1A 3IVMA 4X6XA 3R3JA 3ABQB 5K8CA 4RJLA 4J1TA 1YBVA 3DZJA 2PZGA 4IO0A 2PMWB 5AHWA 1IPEA 2X8WA 2QRHA 4R6WA 5IKPA 1UAGA 3RUDA 4EFNA 4M7PA 3PEWA 1KJIA 4I08A 4O5AA 1QZUA 4W8GA 1VKNA 1UIMA 3CF2A 1QDUA 5HHTA 1V45E 2J9YB 2ZTSA 3H7AA 1P7YA 4BLRA 1N0HA 5DHAA 3Q9SA 4CL0A 1P81A 5JQGA 2WUGA 3UPUA 2Z6QA 2VNSA 3MVEA 4WBXC 2G9NA 1LI5A 1S2IA 4P86A 3S5JA 4NV3A 1D6NA 4IHJA 4R1OA 1RAHA 2IDJA 3B9RA 1PJ2A 1XMQB 1P73A 2XEXA 2NNLD 5B3LA 5C1OA 1PLJA 4FNGA 4TL6A 5JFGA 2J45A 4MULA 2V03A 3KZCA 1L7VC 5AKLA 1Q57A 1DV2A 2RI0A 1QIJA 4P84A 1E5TA 2DAPA 2BFOA 2FLKA 2XQJA 5SYAA 4EVIA 4JBWA 3TR5A 4I9FA 4LHZA 4HL6A 1B76A 4GZ3A 4BN0A 4U02A 3WYEA 4TVKA 3TW8A 1RWWA 4BX2A 2H85A 4CVNA 4JR2A 4JZYA 1YHYA 1USGA 4BLTA 4NG4A 1OGJA 2DXIA 1JG1A 1V0JA 1VMKA 3F4BA 4QXPA 5LXTB 1ESNA 1QLJA 1UOPA 2J6BA 1HPLA 3GOHA 4QC2A 1SBIA 3KE8A 3QU4A 4F46A 2DKFA 4G1VA 4GVPA 4RACA 1BHSA 1D2CA 3AEKA 3PQ3A 5F5XA 4CUKA 3IKVA 1RZUA 1WSBA 4FX2A 1E6WA 1TO6A 3SF8A 4ARIA 2NP6A 3I0NA 1NVXQ 4TN1A 5TF4A 1EWKA 1BDBA 4P33A 4YC7A 5TJ9A 2AUMA 2CK3D 4YLGA 1NSFA 5AQ1A 4DIDA 3U1VA 2YY7A 4ZI2A 3I30X 1W4BA 4EQ6B 1SCAA 4FE3A 2D1YA 5H68A 5CIWA 4H1VA 3C3AA 3ZDRA 4EECA 2WU4A 5F78A 1NY6A 3QVXA 3T4PA 3VOSA 1LF0A 1R3UA 3EZLA 4P3YA 1YRYE 3T3IA 5KNDA 2OCKA 7ADHA 1X8KA 2Q8NA 3U6BA 2H1SA 1SNYA 1AO0A 4W5TA 4F11A 1MEJA 1TRKA 3G02A 1KEWA 3OZWA 4FMCF 5L40A 1P2DA 1KEKA 1FIUA 3OICA 1E0SA 2XITA 1A4RA 2MOKA 1Q6YA 3HACA 4E7OA 3E03A 1XXHE 3DFMA 5THXA 4B1FA 1T8YA 2XMRA 4WESA 4KODA 3JQ6A 3ZV3A 3S81A 1NN1A 3NG1A 2AXQA 3F1KA 1XA0A 1GXSA 3LE8A 4MAFA 4Y2XA 3RAEC 1E2NA 1LLFA 3ETGA 5TQ2B 1KI6B 1S5PA 1I7NA 1LNQA 3HYSA 4GLOA 4A7PA 2PG3A 2PGNA 2WSLA 3E9CA 3EPJA 3R9XA 1JQ3A 3EGDA 3JPWA 2BMWA 3QFFA 2AWNA 3FOZA 4O2RA 3QFSA 4AMBA 2P67A 4Q4DA 4AUEA 1ISJA 1W44A 3NHBA 4Y9TA 3EIOA 3ZNPA 1Z35A 1PJTA 3EEFA 3EMDA 2VDJA 4L4UA 4MCJA 2B0CA 2ZI9A 2ZKIA 1H1DA 1OX4A 1VM6A 4BRSA 4O2AA 4LRQA 1C9KA 1N1DA 3LF2A 1L8AA 1GLVA 2AOTA 3ORYA 2PKRA 1AUPA 1QHGA 3ITKA 3KXIA 1FUUA 4KB5A 3VAYA 4JUDX 1GFSA 2IHVA 3RK0A 3F74A 4DR1B 1GPJA 3WNCA 4PICA 4A8HA 2VSFA 4OMDA 5CIQA 3HCCA 3CH6A 1ISFA 1FJXA 4N5MA 1H05A 1SO8A 2OWDA 4UZFA 3STYA 3HDQA 3VHRA 2VEDA 4N6OA 4FHEA 3LWDA 3GX1A 3I1JA 1UEJA 5EIBD 1FTNA 3BQNB 3PS9A 4UFPA 5C51B 4BVEA 4DDTA 1D2RA 4BKMA 5HZKA 1QCDA 4UMFA 4UTNA 4W9NC 5TDHA 1VKJA 2A5JA 1QIDA 1C3LA 4Y6GB 2Q4DA 3USCS 2CFSA 3KLBA 5K3CA 4WH0A 2FK8A 1PGJA 1K89A 1DRWA 1B0AA 3MQ2A 4HEJA 4OB6A 3AR8A 4XXHA 1NL3A 5EL0A 3C5VA 1Y4ZA 1SU4A 2I55A 2XR1A 2C2BA 4YEDA 2PXHA 5K0ZA 3PTAA 4B4OA 4DV0B 3HB1A 4MVWA 4WNAB 3TLAA 3ONFA 2DF8A 3PCRB 4L7VA 4KQ1A 2FJPA 4WFIA 3OETA 3A6DA 4L6IA 2Q6OA 1WUJS 2YIMA 3FDZA 3R5XA 1T9ZA 4ZVMA 1Z6QA 3I05A 3NEYA 1SGWA 4KFRA 5JSKA 1QFZA 1YAHA 2NTYC 3EH1A 4K26A 4LTNA 4P35A 1JDVA 1OU4A 2PZKA 2BBTA 3GN2A 3TM5A 1C9YA 3N70A 4R2KA 1W73A 1JPJA 1P0PA 2PUFA 1LRJA 3QVWA 1NUHA 4YBRA 5AJXA 3VJRA 2PLFA 4Y1FA 4A92A 4LZAA 4DV2B 4Y6QA 5KIAA 3O9MA 4ZN6A 3O95A 2EX1A 1R8QA 1VRWA 1B8NA 5FUWA 2HT6A 2VNKA 2WWTA 5L3VA 1KQGA 2JDIA 4ZO4A 4ZYLA 2R8RA 2ZZMA 3UF0A 3PXEA 3NUQA 4RGQA 3T3DA 2MR6A 1ISIA 2SICE 1Q20A 5HJ2A 3WBKA 3ML1A 2WE7A 3MT0A 3DQZA 2NPFA 4PV7A 5DBFA 3V8NA 3W8RA 5IDQA 1MJHA 1QVRA 1D2MA 9LDTA 4JI1B 3LL4A 3TSZA 4N3CA 2JGKA 4MVJM 3UIEA 3BSYA 4UBIA 5EKXA 4URHA 1D04A 1F0YA 3WLMA 3RUCA 1IAVA 4Y6RA 3CA8A 5K6AC 2QN8A 1OXKB 1RBQA 4DC1A 2Q3CA 1THZA 4ZU3A 1QYCA 1W0JA 4H08A 3CLTC 3TINA 1PZXA 4PZYA 3FBTA 3M6VA 2PZ8A 2QM8A 3DYBA 5L4LA 1ZIXA 4BNHA 1L8QA 4GUDA 3HJUA 2P7HA 1BRTA 5EUBA 2RH8A 2FPIB 5D5QA 4QSMA 3V6LA 3HQ4O 4W6ZA 4B6SA 4D43A 2WIJA 2J0VA 5CD1A 3AY7A 4S2EA 4B47A 1FNMA 1YZYA 1QV7A 1ODKA 1WRBA 4TN5A 5FBKA 3RYTC 2C61A 4S1PA 3PQ6A 2SECE 1ZKMA 1CP2A 3FZGA 1C1XB 3ZY3A 3UK7A 3QFHA 3UOGA 3FNHA 4I99A 3RO7A 3VH4A 4LOLA 2ZK7A 1OYVA 5EP1A 3HBMA 5LWHA 1L7XA 2R6FA 1QGUB 4FFBB 5DK6A 5ECGC 3CUVA 4KFSA 5TT1A 1YHNA 2YMMA 5BUQA 3FF4A 3L9XA 5ECWA 2QXTA 1Q3TA 4BN5A 2CXUA 2DFPA 3D81A 3KWLA 4LE1A 1NPYA 3N6VA 1QQ5A 1X6VA 5TMPA 1QTQA 1RHMA 3FFBA 4YAOA 4A73A 3VI4B 4HUQB 1FTSA 2PRIA 2WJYA 4YS6A 3UJDA 1OVMA 3A05A 4HNGA 1IBCA 2WMYA 3DC7A 3TUIC 1Z0ZA 1EFRA 1VA4A 3AVUA 3OZIA 1T8UA 3B12A 1UBKS 1Z2AA 1WKBA 4OA5A 2WUVA 5GY7A 2AXPA 2IU3A 1O9HA 5DWVA 5JO0A 5K9ZA 5AXCA 4LHWA 1UOQA 1JDTA 1YI8A 5LDHA 3W2FA 1IWOA 1EZ4A 3ZVKA 3PNKA 4OHVA 3ZWCA 1KJNA 1N3BA 3FVRA 4EHDA 2NIPA 5JT1A 3OC6A 2B7LA 3QWIA 3QX7A 5LU8A 1SXJE 4HO1X 1OOEA 2GN4A 2J3KA 3G0IA 3QI7A 2LKCA 3M1LA 3FWZA 4BUCA 5JJKA 4C0WA 1GU1A 2AN9A 2R8XA 2VUIB 4FMDB 2ZPTX 4K03A 4L0MA 5LBTA 4TZTA 3TCNA 3UM9A 3JWGA 3TLMA 1T8WA 2QLBA 1S3GA 2BKAA 3A3NA 3R6GA 3ZUGA 1G6HA 1JSRA 4TVSA 2ZIFA 5FA6A 2O14A 2WWFA 2C7GA 2Z3WA 5A2GA 4FM9A 1BW9A 1I3KA 4Y2UA 1Y3DE 5K0FA 3UUGA 3L1UA 2OXFA 1WZEA 3FYSA 3USES 1GPNA 4KN6A 3KUDA 4QNNA 4TTVA 3WV4A 2NV2B 4ISBA 1P0MA 1MB4A 2GD2A 2OB2A 4Q05A 4ZP1A 1BN6A 1WXWA 3CXUA 5CB4F 5JYDA 2X15A 3OEEA 5HFNA 5ETJA 3B1KA 3S70A 3ABOB 1TPYA 4BC1A 4DQVA 2YVUA 3O4HA 4FW9A 3B70A 3N2KB 5AUOB 1VYUA 4EF6A 3AR4A 4Q3NA 3VYTB 5I6DA 4M22A 4YWHA 3EBLA 2XIQA 3BWDD 3QE2A 3O8QB 3CY6A 4LXUA 3NHJA 4D44A 2QTWB 1WMEA 4MLDA 1NJ6A 1JIVA 1NSYA 2HB6A 3L7NA 3P52A 4LOAA 5E1OA 4DSNA 5BVHB 1MV8A 1CZUA 1AHIA 1JSZA 4FYWA 1BA2A 3OIFA 2Z2XA 3MGAA 5A4DA 5BQFA 2GM5A 2J7PA 2TRSB 5FF9A 3WYNA 1N7IA 3K4HA 1T4CA 3DCIA 1DRVA 4FYMA 1PR9A 1R4MB 3W6UA 4P7FA 4C5BA 4IQ8A 4MVJI 4ZQGA 3OD5A 4J6FA 1N6IA 1O6ZA 3GLUA 2PUAA 1HQYE 3PKIA 4R1QA 5B1EA 1VL8A 1GL7A 1XMIA 2ZWIA 4IKEA 3SDZA 3ZU6A 1EBUA 2GPSA 2PX2A 3AETA 3MCVA 5KNDH 1ESDA 4EPXA 5LKAA 3BIOA 4BVKA 3D6TB 1SEPA 1UIRA 4WERA 4IFEA 3WE7A 2DTEA 4AO8A 1KC3A 1A2QA 2P9YA 3KR9A 4LVCA 2AK3A 2SCUA 3AR3A 2N1BA 3GBSA 3HA2A 3NEJA 1Q3HA 5A4JA 3L06A 2DY0A 4NU5A 3X2FA 1YB4A 1HG1A 3N6RA 4FONA 1P7VA 2PK3A 3QXCA 3W2EA 3VDXA 2XZDA 3IHKA 1LZLA 4HGZA 1AZWA 2P0AA 1H1LB 4XQ0A 4MRRA 1E1YA 1QS0B 3OJEA 5TQ0A 2FN8A 1FW8A 1UMKA 4YPOA 5INTA 4D1YA 5K05A 1FMCA 1KFJB 1LGYA 2VK1A 3GYGA 3HVJA 3ZCUA 4MUNA 3VNSA 5TSDA 4P98A 3MELA 3TX6A 1GNSA 3QKRB 3RTEA 1QIGA 2QTHA 3JWPA 1P7PA 5CDHA 1LK0A 2H9IA 1XEXA 2BD0A 2XCSB 2OO5A 2WSSD 1IB0A 4JLUA 3TX2A 1Y5IA 2ZDHA 1NZDA 4JLAA 2HIMA 1JIXA 2QAGA 3OFNA 4QPDA 4WKNA 4WXPA 4X61A 3RVDA 4DG8A 5A4FS 1ZCBA 3QW2A 2XOXA 5A5DA 2RMKA 3TL6A 4YRRA 3ROKA 5JTTA 2NZJA 2XTJA 2AX3A 3X2SA 1P29A 1P6XA 1A7UA 1DKRA 1WUKS 2ZI5A 4QUKA 1C7RA 1B2RA 5ADVA 4HG2A 2A78A 2IYNA 1T43A 1PBTA 1W93A 2VAVA 3Q8XB 4KQCA 2KLHA 3ICPA 5F33A 4DMUB 1NBHA 4GGOA 4B7XA 2HNKA 1V3UA 1T5LA 3DVRX 1HT3A 3BWMA 2HJGA 4WDRA 1W88A 3C87A 5E3IA 3ADCA 2KSQA 4Y98A 1Q14A 3KFVA 2AWOA 2XVAA 2O2DA 2WYHA 1I3MA 1W4AA 2G6BA 1TFRA 3DSRA 3L7KA 4DLUA 1R8YA 3C48A 3CE9A 4S0XA 5I7SA 5JVDB 2R6AA 3SE7A 3EQ6A 1WP9A 5D5PA 1TVCA 3LPAA 1RXYA 4PFSA 1IG0A 2IS2A 4WX2B 4O1MA 3A9UA 5F64A 2PGDA 3USZA 1UWCA 2ERCA 2VPYA 4HYYA 1UM9A 1OTHA 4MDHA 3UWOA 1FMFA 2FWBA 2ZULA 3RYFB 5T7BA 1EI9A 5AM2A 3BRWD 5K5EA 4CT0A 4LFAB 1JKFA 3WO0A 5F98A 3AY3A 2RJ3A 3K9WA 4FWIB 3I8OA 3RIGA 1E60A 2L42A 3OTGA 2GZ2A 4PN3A 1SKMA 2QTAA 1F5SA 5ADHA 5TT0A 2E3JA 3ZGZA 1LPMA 5GONF 3K32A 1DU4A 4FHGA 2Y76A 1ADGA 2MSLA 4M8SA 1AXEA 1E5QA 3EYAA 3IUNA 3SR0A 3KKOA 1MAAA 2EVWX 1RAIA 1P2GA 4FD3A 1JQ5A 4JLJA 3THRA 3BL6A 4FFVA 2O8EB 2PEYA 2CC2A 4R83A 1W6RA 1YBMA 1XCMA 3GAAA 4YUVA 1VLZA 1Z5GA 1VIMA 2GZAA 3A11A 3MJFA 4G65A 5GOTA 1WB4A 2GXSA 3UCEA 3VC2A 1UAAA 2L0XA 1FL9A 7MHTA 2JJ8A 5A9SB 3LDHA 3U4GA 4JU9A 1T9BA 2H2HA 4HEHA 2NYVA 3CVOA 1KE2A 5LNK6 1IB6A 2DC1A 4CWAA 1HNXB 1ZGGA 1SUAA 4DXDA 1U1DA 4CG2A 5BQXA 4L74A 5I7RA 4NAHA 1EVQA 1C4WA 2WYUA 2GJAA 4KQWA 4LDQA 4NFLA 5LN1A 3RUPA 3NHYA 1X2BA 4NC9A 3KEMA 1K4MA 1I5OA 1HTBA 1U0OC 2A0YA 1TD9A 5I7UA 1L5ZA 1T10A 3WB2A 3IVXA 1L7DA 1BGXT 5K09A 4MW1A 3E70C 3H2KA 2FPSA 3WDKA 2VDPB 1B14A 1KR2A 1NURA 2E4XA 1DBPA 2NADA 2ZETA 1VE5A 3SP1A 3I5MA 5I7WA 4M86A 1M34B 4Y7DA 4IH4A 3T7DA 3WG9A 1US8B 3QNWA 1Y5NA 4M36A 4KBFA 4PLVA 4R0MA 1WXEA 5SV2A 2YN4A 5HBRA 3PJRA 2YZGA 5K2MA 3MAGA 1GTRA 2J3EA 4YNBA 3JW8A 4X24A 3QVGB 3ZS8A 1J6UA 4LDPA 3QA9A 3EDYA 4LXTA 5ALHA 16PKA 3B1JA 1I6MA 4Z8YA 1P61B 1ZM2A 4P5PA 5G0TA 2I2XB 3W4IA 2AZDA 3UAYA 2Y05A 2B1QA 4WOCA 5IKMA 1KC1A 3GUHA 4QJ4A 4A1OA 1IY2A 3T9CA 4E09A 1AQLA 3IHTA 2YWGA 8AT1A 1LDMA 4PWZA 4MV6A 1USVA 4X65B 5KO2A 1OH8A 2WG0A 2I0FA 2ZDQA 5FI3A 2CXRA 4BEBA 2C7PA 5F35A 4DBLE 3KVVA 5TPWA 4ZDIA 1R5JA 3KSUA 3JYQA 4MQUA 5ANRB 3T7TA 4LYFA 5DCYA 3LCVB 4HH1A 4JFRA 4PR3A 2BDUA 3PD7A 4Y67A 2QJRA 5AYVA 5AW8A 3PC8A 3DFFA 1X7HA 2OBYA 1LDEA 2YV2A 3HHPA 3RUHA 1E3SA 4I55B 3RQSA 2PH3A 3GA7A 4LYEA 3V48A 4H1WA 2GAIA 4N8EA 2OO7A 3JQGB 1H2HA 3TPFA 4RFSB 3FNBA 2FG7C 1Y1QA 1ZO8A 1L7PA 3HEMA 4G8JA 3SBOA 1NBEA 3UFXB 3W6PA 5AW5A 4EI2A 5BNIA 2SHKA 2HF2A 1P3Y1 2ZVJA 4BQOA 4BNDA 5JDCA 4MV4A 3PLNA 4W7SA 1EUCB 1E7MA 2GEUA 2WJ4A 1SVMA 2ZRFA 3A1FA 3F4KA 3IVRA 4MKFA 4G63A 4Q4CA 1RZ3A 4ZARA 1FRZA 3VKGA 3CBGA 4P2GA 1GILA 3KQQA 2RKWA 4MB6A 4Q47A 5EMHA 3RS7A 3SSAA 3WICA 1QYRA 1J25A 3L8DA 5EVCA 4LI3X 4MVJP 3OX3A 3FMPB 3DOCA 1EFKA 3INYA 3QA3E 4V0OA 3FGOA 5DISB 3E3LA 3MBOA 1F3OA 4QUGA 4MMZB 2Q0QA 2J3DA 1G3IA 3CNEA 3R41A 4BFUA 3PDIA 2Q0HA 3CBQA 2VLBA 5GADl 2ZIXA 5E8RA 4F9TA 2P41A 5EWMB 4QXMA 1V8OA 1OGIA 4G1UC 4O4LA 5P21A 3D5QA 4Z8XA 1LDBA 2HDHA 4JB8A 1EFHA 4RELA 3FMOB 5J59A 3IP5A 1RRGA 5K0CA 4P31A 3IJRA 2P3OA 4TKLA 1S9DA 2NVOA 3SLGA 5KTPA 4FHZA 2PE5A 1XZQA 4RJJA 3E9ZA 4K86A 4TLCA 3QELA 4CCYB 5LMNB 1D3AA 4JN6B 5SZJA 4UZEA 3ESDA 3LUCA 4PGFA 4RMHA 3DUWA 2EDAA 4E5NA 3BSFA 1LV7A 3H19A 1MA3A 3IUBA 3AU9A 5D2CA 1DGQA 5EUQB 4B0OA 2ACVA 4AI6A 2XVXA 2P65A 2HO4A 1O5IA 3BWYA 3JQ9A 3BORA 2QGNA 1J7JA 1XC7A 3RJTA 3GNTA 1PJRA 1TQ6A 3QUQA 5IMSA 1T2DA 4RPHA 3LA8A 4DRYA 4DCPA 3RAJA 1OAOA 1MPXA 1MUUA 3WZLA 2SKDA 2JBAB 3NV7A 3R3SA 4IUCS 3KC2A 2FOLA 5KWIA 1BVRA 1TW3A 3KKMA 3CR8A 3TD2A 4UM7A 3WGVA 3LCRA 3OZ7A 1TU4A 1G1AA 4R7TA 1ZHOA 1OF1A 2AN5A 1KI9A 1V39A 3KYJB 3NDBB 5DBEX 2PMCA 2YUIA 1QRTA 2J4CA 1ZK1A 1CY6A 2CJXA 1JB1A 1M10A 3I64A 1OWOA 2ZCUA 2P30A 2G1UA 3B60A 3I3SR 4JA0A 3OE7A 5AJTA 2B20A 4O8CA 1X80B 3NVAA 4Q7EA 4YP5A 2O0LA 4Z4QA 1E3EA 2BRUC 3F5DA 4FMBB 1IM5A 1JMKC 4D4KA 3A7EA 1KQFA 1IONA 2DP4E 1VE7A 1E2QA 5AXBA 2R00C 3MAAC 4G67A 3V33A 1JR4A 1E3DA 3NHPA 5E3HA 2PV0A 3H86A 3TXYA 1TLTA 1J5XA 2P9EA 1S8FA 4M8IA 2J1LA 4XQ9A 5CW2A 4B85A 5C35A 1G0OA 1AUQA 3OPYA 4ARVA 5IU6A 3ZK9A 1WXXA 3AZOA 3DP7A 1IRIA 1BRMA 4P0PB 1HRDA 4OQPA 2RK4A 4IRXA 2ZYHA 5G0UA 3GFRA 1ZRSA 2H1LA 3TBKA 2ECFA 3PUWA 3H5NA 2VP5A 1PX0A 4JROA 6YASA 4LWQA 4BO5A 5JD5A 3VKFA 4ZJUA 4KRYA 4J49A 1P19A 1WL8A 1CD5A 1E4OA 1MR3F 4IW3B 5FX2A 2GXUA 4B2LA 4JKOA 3RS5A 2P4UA 2WF8A 2R8ZA 1K27A 5J23A 1N2JA 2Y0CA 1W36C 1WA5A 2VVTA 3O3MB 1O2DA 1Y98A 3O4FA 4Z99A 4BB9A 4JHXA 1C41A 3MWJA 1DTEA 4FLMA 1HNNA 4QFBA 3HJBA 5KSPA 3D5TA 2PD6A 1LBIA 5EGNA 4E3ZA 3NCTA 5BR4A 1QIFA 3QHQA 1N34B 3DCNA 3S55A 1N1MA 3EG9A 3D54D 2R7AA 3KZXA 3SHFA 1N57A 1OHHA 4LC1A 3H3XA 1LQTA 4B6QA 1NU8A 3GAFA 4DWJA 3UJPA 4B83A 2X8LA 2J5RA 2BSXA 3OKAA 1U7DA 2ZVDA 3GJSA 4BATA 1GNLA 3GJ8A 1VCIA 4IL5A 3C8UA 3L1IA 4MLCA 3U9TA 5I4BA 1A8QA 1PR2A 4MI1A 3IDAA 4OXKA 4QQKA 3WO1A 1UAYA 3NP9A 4G4JA 3GVXA 3AHDA 4OQEA 1EE9A 3DVSX 3UWSA 4IGFA 3OFND 4IDPA 4M1KA 4MYTA 5F3RA 3ZCQA 4MKHA 4WBNA 1NHGA 2XMGA 1KZ6A 3IULA 4MPDA 2KBFA 5JAMA 1N2CB 4MB2A 2VWQA 1NFQA 1NW4A 1IUOA 3D4NA 4YGXB 1U8AA 2WWWA 1C7JA 4QG3A 4KFCA 3FUVA 1MKYA 4JS0A 1E9AA 2PGOA 3GRUA 2GRAA 3Q4GA 1Y6JA 3W8FA 1ECGA 4FYIA 4GP9A 4Q4HB 4LV5B 4X8HA 5E0KB 5ER9A 3WP1B 1TX4B 3D43A 1GGVA 3AMVA 5EXXA 5ECDA 4INOA 3SC3A 4JR1A 1ARZA 1E7RA 4FR0A 4IR7A 1ZAKA 3FBWA 3HSKA 4U7GA 3WYAA 4CMCA 3W5AA 1WX1A 2W2NA 3DDHA 5H1YA 1Z3IX 3ZWWA 5KYYA 3QWFA 1HA3A 3PJDA 4Q1FA 2P27A 1F1JA 2BEVB 5SZKB 3UV6A 2YRWA 4F5EA 4WZAE 5H7XA 4KGDA 3H3JA 5BSRA 1U9YA 4OUKX 3IO5A 3ZEIA 2WVGA 3GT0A 3N05A 4EHNA 1S7GA 2D1FA 3SE0A 3T5BA 1G8KA 1YZHA 4PAOA 3P4UA 3SPXA 4DC9A 2VJAA 3MTEA 1VMDA 4BPBA 5DULA 1SHKA 5L7TA 4EABA 2F8SA 1LWOA 3JD2A 3NTOA 2FQWA 4GRIA 4P5DA 4WACA 4BV8A 2XBMA 1DAKA 5CLJA 2OGSA 4OSOA 5KSZA 2UXBB 1EB9A 3RBVA 4X60A 1ATIA 3X1XA 2LKDA 3IMCA 2PH1A 2H16A 4F3KA 3MS7A 1W76A 3EVNA 3MGGA 4RWZA 1JIQA 2W4MA 5AVXA 4OK5A 3ICEA 4GI2A 1P7ZA 4H3SA 4EVQA 1YE3A 2PV7A 4R9RA 2E48A 4X90A 3LHIA 4EJMA 3GRCA 4RVHA 4TV9A 2H4YA 1OLXB 5TXGA 1Q1QA 2PBFA 4D9FA 4JI2B 2XWSA 4MIOA 1E94E 1H2YA 2ZBUA 2PZLA 5BWOA 3V34A 3A6PC 2FJUA 1TI7A 1WCXA 1ZD5A 5MGBA 1N33B 1ZYUA 3P5BA 1QONA 2B5WA 5LNK1 2WW8A 1IE3A 4CMAA 1V9LA 2CXTA 4KQGA 2QEQA 2Y99A 1DX4A 1E9SA 1U1IA 2WWIA 4NBVA 3KZKA 1S2MA 2QZPA 4C7XA 4F93B 1XEFA 4OATA 3AM1A 4HTFB 5JUWA 1VLHA 2O2EA 2PWYA 3MWDA 2X9LA 4CKBA 2YZ2A 2KBEA 2WB2A 2ZDGA 2FG5A 2RBEA 5GINE 2GNPA 1ZWKA 4RA9B 3TZEA 3O9VA 1XLVA