3CZ5A

Crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
141
Chain Sequence
STARIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIEATRHIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSPDIAQEIAEERVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Two-component response regulator, LuxR family
publication title Crystal structure of two-component response regulator, LuxR family, from Aurantimonas sp. SI85-9A1.
rcsb
source organism Aurantimonas sp.
total genus 51
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cz5A00
5KC9A 4O1IA 2MSLA 1DP4A 4RDCA 1FFSA 3C6QA 3CS3A 1TMYA 3URMA 1MB3A 2PJUA 5FWXA 2NZVG 2P9HA 1EHCA 2QVGA 4N41A 3IDOA 3OMWA 2QXYA 1Z13A 4G0MA 4KPYA 4KZKA 4OATA 3P9YA 3CFYA 1GUBA 3RVOA 3I45A 4YP9A 1D1PA 1MAVA 1HEYA 3H1EA 3C97A 2E4XA 4G97A 3A0RB 3RVQA 2PUAA 1QKKA 5JNRA 1CYEA 1QMPA 3BBLA 3RVMA 8ABPA 3QK7A 3M6MD 5C5EA 4ZYLA 1S8NA 3EQ2A 4LZLA 1JFVA 4KVFA 1KGSA 3O21A 1FSPA 1KRWA 2Q5CA 4YCSA 1ABEA 3G1WA 2E4YA 3O74A 3Q7RA 3GYBA 4MYRA 2JRLA 3NNDA 3KHTA 4GNRA 5DCLA 5TQ2A 5BQ3A 1MIHA 3QEKA 3LFTA 2JB9A 3EDCA 4HNQA 4KK4A 2IPMA 2FN9A 1NXSA 1Z2DA 3KYJB 4DN6A 3BILA 5KQMA 1BDIA 1W25A 2OQRA 2F8SA 4O5AA 1L5ZA 2L2QA 1ZY2A 2VUHB 4KK3A 1JWLA 4EYGA 4RXTA 1JLKA 3TX6A 4KFCA 1ZGZA 4RS3A 1D1QA 2GI4A 3RVRA 2FQXA 1SXIA 4CBVA 1JFSA 1FFWA 1K68A 2HQOA 2N9UA 3N0WA 3QLUA 4EGSA 1EWVA 5CNJA 3UK0A 3TMYA 4IMJB 1MVOA 2FLKA 4RK6A 2JVIA 3DGEC 2L18A 1QP4A 3RH0A 1KMIY 4MQEA 4Z9BA 5IUNC 2PAFA 1F51E 4Z4FA 1P8AA 3EULA 2A9RA 1ZDMA 2ID7A 2JCGA 3MMNA 3Q15C 4JB2A 4XLTA 1QQBA 3LUDA 3K9CA 2JVKA 3RVJA 5TPWB 4IF4A 1YMUA 3C3KA 4Q6BA 2FW0A 2HQRA 4KMRA 1NXOA 2FSPA 4D74A 3FDFA 3LUJA 3OLYA 3NHZA 1AB6A 4FE4A 3IP9A 1A04A 3I42A 5HSGA 1AB5A 3MYYA 3I5AA 3OM1A 4MLCA 5I4CA 3H5OA 2DRIA 4TLLB 2RJOA 1ABFA 1M5TA 3CZCA 2MYPA 3CU5A 5ABPA 3MA0A 4MQFA 2IKSA 3FFWA 3HCWA 4MR9B 4S05A 3A10A 4MR8B 5JNTA 4PYRA 3RVKA 2PUFA 4G0ZA 3KLOA 5GOTA 3CKMA 1DBQA 2GKGA 3H6HA 1ZHHA 1QPZA 4IILA 4RK1A 2PUDA 4KNYA 1Z12A 1RNLA 3JVIA 3NNNA 2JBAB 3TO5A 4WXEA 2ZWMA 1SXHA 3LUCA 5CNIA 1ZN2A 3Q7SA 2R4QA 3T95A 3LUKA 1RZRD 4UHJA 3O1IC 4Q6WA 3QELB 4WWHA 1LJLA 4IMIB 4NV3A 3L49A 4F06A 2RJNA 4MS1A 4RY8A 4MRMB 4Z4IA 2R48A 3BRSA 2WWVD 2FN8A 4E7OA 1PNTA 2JK1A 1JYFA 7ABPA 4W5NA 1K66A 4RWEA 3CNBA 1T34A 1Z2EA 4MS3B 3OQNA 2XDYA 3H5WA 2VYCA 1A2OA 3KS9A 1LBIA 5JS1A 3LKVA 5JNVA 4O1HA 3CG4A 1ZAYA 4XFKA 5F64A 9ABPA 2FMHA 2LPMA 3M9XA 5KWSA 1DCKA 1M2EA 2WJWA 1MB0A 4F11A 1NATA 1Z16A 4MLDA 4EVQA 4G0XA 2E4UA 4WZZA 1Z17A 2FTKE 2RDMA 4MS4A 3UUGA 1RZRA 4EUKA 1Z18A 3A3KA 3F7NA 3NBMA 4JOQA 5FWXB 1JBEA 6ABPA 3SY8A 1NXXA 3RVLA 5D2CA 3SM9A 3HK2A 2L19A 3D02A 4OG2A 3F6PA 2VUIB 4XASA 1U2QA 1U04A 1PUXA 3JPWA 3RVNA 4YWHA 4EVRA 3DBIA 3H6GA 2GBPA 3H5IA 4QYWA 2PUEA 2NT3A 3NNSA 1DZ3A 1TJYA 2TMYA 2QU7A 3LUHA 4ZPJA 5FBKA 2B4AA 4F3TA 1M2FA 1DRKA 1NXTA 1SXGA 4RK4A 3SAJA 1P2FA 4RK5A 1XHEA 3T8YA 1YK0A 2FXIA 5EWJA 2MYTA 4LE1A 4KRFA 1PEYA 5TQ2B 4RZSA 3KCNA 1LK0A 4D6YA 4Z4HA 1BDHA 3IP5A 2WRZA 3SG0A 4WUTA 3K4HA 3CHYA 3LTEA 1ZH4A 3RVPA 4FB4A 4Z4CA 3LUFA 2WJAA 3LOPA 4P1ZA 3DGFC 1LBHA 2QR3A 3MIZA 5FWYA 3OO0A 1QO0D 1DC8A 1Z25A 5HM6A 2FEKA 6CHYA 3OLZA 1E2BA 5EWLA 3DZDA 3FGZA 4M88A 2B1JA 1YVUA 4RSMA 1C4WA 3N6VA 3JS5A 3R0JA 5BR1A 4F12A 2CHEA 3HEBA 1EFAA 1C0EA 1DCFA 3LUAA 5TQ0A 2E4VA 3MM4A 1Y1LA 3E3MA 4IGAA 3CG0A 4RU1A 2LIVA 5E3JA 1YTUA 2L17A 4MQEB 5CHYA 4W5TA 3UKJA 3H1FA 2V0NA 1E6KA 4ML3A 3HM9A 3LMKA 4EY3A 5JNUA 2FMKA 4LDAA 2P4UA 4ETNA 1EWKA 1Z15A 1USKA 2MYNA 3OLWA 5IUKC 1QO0A 3LUGA 2QSJA 1DBPA 5DGCA 5FBHA 2MSKA 3N0RA 4NICA 2FMFA 3FMVA 3N53A 1DC7A 2O20A 3OO1A 1E6MA 1NY5A 1DJMA 2E4ZA 1Z26A 3QLVC 4RK7A 1I3CA 4G0QA 1D5WA 4MR7A 4EYOA 1H9CA 3BRQA 3JPYA 4TLMB 3B2NA 3GWGA 2YHBA 3KKEA 5IUJC 3NHMA 3ILYA 5IBQA 4TN5A 4NCAA 2PUGA 2PL1A 2PUCA 2E4WA 2WB4A 2H3HA 5JNSA 2W42A 2VK2A 1FQWA 4MQFB 4YS6A 4Z0NA 5B3JC 4N03A 1JYEA 3IPAA 2FMIA 3F6CA 3MF4A 2GX6A 3H75A 4G0PA 2PUBA 4RXUA 4KQCA 3DLBA 4F8JA 1DRJA 4YO7A 2QW1A 3ILHA 3W9SA 1FFGA 1P6QA 3Q41A 2A9QA 1TM2A 2HSGA 3ROTA 2NZUG 3HXMA 1JF8A 4LRQA 2CWDA 3Q9SA 1QQAA 4FE7A 1U8TA 1KRXA 5IEJA 4JB0A 1BA2A 2IPLA 1L5YA 4PEVA 1BAPA 3OQMA 4HNSA 3T38A 2R47A 1TVMA 4DADA 3L6UA 1P6UA 4RKQA 5TE9A 5IULC 2J48A 2WY2D 1WETA 4MS1B 3TD9A 3N0XA 4YV7A 5PNTA 3QEMA 4YLEA 4G86A 2ZAYA 2PLNA 3FFXA 4OLAA 4RV5A 4EVSA 3N8IA 4N76A 2PL9A 1UDRA 1VLZA 2IDMA 4RXMA 4Q7EA 4QPJC 1CEYA 1JHZA 3C3WA 5EWMA 1YIOA 2HJ9A 3HSYA 1EWTA 1SRRA 4EYKA 1IIBA 3CZ5A 4MPTA 3JTEA 2PMCA 5KQGA 3CLKA 4XAQA 4KV7A 1OXKB 4MS4B 4P98A 1M5UA 2A9PA 1ZESA 2X7XA 3GA5A 5BRJA 2IOYA 2PE5A 3CTPA 3VNBA 4ETIA 1LJUA 3KLNA 4YR7A 2CHFA 5DLEA 2QZJA 4WT7A 1W9HA 4RKRA 5CNMA 2R25B 3EODA 3QX8A 3GBVA 1JX6A 3SQNA 1NXPA 3HUTA 1GLGA 1VPWA 4QICA 1ZVVA 4KREA 4KQ9A 1PNRA 1U0SY 4IRXA 3GV0A 4H3KB 1QNLA 3O1HB 5T3YA 2IPAB 3O1JC 2RGYA 3O2SB 1GCGA 3HV2A 4YGXB 3HJFA 4Z99A 3RVSA 2ID9A 4D6XA 2AYXA 4NQRA 2LP4Y 3N75A 1RXIA 4Z9AA 1NXVA 3F73A 5HQJA 3OMXA 4ZMRA 2LUOA 3KG2A 3KYIB 3Q7TA 4PICA 2IYNA 2F8TA 1XWWA 1JDNA 5BRAA 4H60A 3GBPA 5TPZD 2JVJA 5EWJB 5GQSA 4L4UA 3EGCA 4RY9A 1VRVA 5KQPA 3GL9A 1YS6A 2FQWA 3SNKA 4ZJPA 5HKOA 5IX8A 1CHNA 3T6KA 2CD7A 1ZGGA 3CRNA 2LBPA 4XARA 1NTRA 3MQ4A 2A9OA 4ZMSA 3H1GA 4PZ0A 5C5CA 1APBA 3H5TA 5FWYB 4OBBA 1D2AA 4PE5B 2M98A 3IP7A 1BDJA 5EWLB 3IPCA 4NCBA 5TPZA 5JNWA 3ROFA 1U2PA 1GUDA 1RXEA 3KTOA 2FEWB 3QLUC 2QV0A 2HQBA 4G0OA 4H3HB 4JP1A 5JS2A 4GPAA 4G0YA 5TQ0B 2NUBA 4LE2A 5DKFA 2AYZA 4LDZA 3FFTA 4QYMA 3E61A 2HPHA 4L85A 3QX9A 2QVCA 3KSMA 3OM0A 1USIA 5KC8A 5TPWA 2PKXA 3JY6A 2YHAA 3TB6A 1B00A 3HUUA 5T7BA 4UHKA 3A0UA 1A0OA 1NXWA 2IPNA 3OLXA 1ISRA 1F4VA 4LE0A 1QP7A 3QLVA 2FLWA 3EQZA 3VNAA 4YRZA 2OENG 1PEAA 2NT4A 3RQIA 1E6LA 3S99A 4B09A 4Y9TA 5IC5A 3H5LA 4MR7B 4JA2A 1YMVA 2FKAA 3HS3A 4JASB 1JL3A 5ED4A 4W5RA 3GT7A 5B3JA 1SD5A 2FVYA 4Z4EA 4RY0A 2BGGA 3O2QB 4WXMA 4MGEA 4RK0A 3D8UA 1EAYA 4MR9A 4DQDA 4EYQA 4JAVC 4MR8A 4S04A 3EJWA 3HO1A 2H0AA 3C3MA 3G85A 4N0QA 3OLVA 1J56A 1OXBB 1DBWA 2I6FA 1R8JA 1ISSA 1ZH2A 3QLTA 2FEPA 5KQLA 2MYUA 1XHFA 2WMYA 3JVDA 1YK1A 4N0PA 2M1ZA 3KJXA 4OTZA 1USGA 1VKRA 3I09A 3DLHA 2KYRA 4OLBA 4XXHA 3HDGA 2JBAA 4LX8A 2MSWA 5DTEA 3M9WA 5KI6A 1RPJA 2FQYA 3H5VA 4Z4GA 3QELA 1URPA 5TQJA 1TLFA 3LKBA 4MRMA 5CNKA 4ETMA 3BREA 1DCMA 3O75A 1JH9A 1BVHA 5IEBA 4HYEA 3GRCA 4HNRA 4MS3A 4N47A 4MAAA 3QEMB 3HVRA 1JFTA 1ZITA 3EAFA 4E7PA 3OQOA 1YS7A 1D4ZA 1DG9A 4W5OA 4TMYA 1GCAA 3O2JA 3HDVA 5EWMB 1JDPA 2GWRA 3IP6A 4W5QA 1PHRA 1QP0A 3HZHA
chains in the Genus database with same CATH superfamily
4MW5A 1ZHOA 2BDEA 2MSLA 3BA6A 3MFYA 4IXWA 3MN1A 4V0LA 1FLDA 4EI2A 1YBAA 3ORHA 2EL9A 4FGLA 3PKZA 3TR5A 3USES 1W36D 5IMBA 4G5YA 1BRTA 3NTLA 5I5EA 4YJGB 3PGMA 3IOEA 3DMHA 4MAMA 1UIRA 4WADA 4PVDA 3RIYA 4J2TA 1ZOPA 4GBJA 1SBIA 3L9WA 5AOVA 3P9YA 2IIBA 4Z0PA 1V8BA 4FZRA 5IDQA 3FETA 5HQTA 2IX3A 5DHPA 2EP8A 1DEKA 1H0HA 1L5HA 3O8QB 4AB1A 4ZCPA 4CEHA 4WCVA 1T2AA 1EXWA 2PUAA 3PJFA 4QU8A 4HQ6A 3SYRA 1P44A 1QBKC 2DU8A 3I6QA 5LQCA 4L8FA 1UPCA 4ZYLA 3D5EA 1R7RA 4B4VA 3T99A 1N3BA 4FGKA 2A59A 3O21A 4ISCA 3V9PA 4EFMA 4FFNA 3AR4A 3G1WA 5J4KA 1TJPB 4IIGA 4CHGA 3PPYA 1M2VA 1UBTS 1J0CA 3T1QA 1J5XA 4K9OA 2HHCA 4Q9HA 3G2PA 3IBCA 4DDKA 4IJ5A 1ZJZA 1VA5A 2IVZA 4HNQA 1E6UA 1VHJA 2EERA 5KOIA 3HADA 1Z2DA 1V9CA 2VTDA 2W98A 4CDRA 2FU5C 5TGZA 1FZTA 3IUYA 5AI5A 1N7IA 4OH7A 2W6CX 2QAIA 1T2EA 4FHZA 4E13A 1CBUA 1M1YA 2CBXA 2YRXA 4PGAA 5MN6A 3ITNA 4KXWA 3V97A 1OC2A 1NVTA 4IYJA 1X1DA 2C3OA 4HTAA 1BROA 1E0KA 5AKKA 3ZK9A 3THYB 2XVZA 1MX9A 4LA4A 3MLEA 4XB2A 3SZOA 5F1PA 2ZPTX 2MOKA 4E5YA 2X77A 3W3ZB 3HA7A 5REQB 3GRYA 5LOVB 1KARA 1KRHA 3ZWQA 4KVAA 1U3TA 3MMNA 3F9RA 2X9NA 3RUDA 3BWXA 3LUDA 4NONA 2XYGA 1PAUA 1S4QA 4IF4A 1U7XA 1ZGBA 5KB3A 4KLAA 4F3CA 3NV9A 2BFOA 2E48A 2WKPA 2Q2VA 3F5SA 5KHAA 3U4QB 5AKEA 2IUSA 5L6MB 2FSPA 4Z4CA 2X19A 3R3UA 2BHTA 3EZGA 4IZOA 4CCAA 1DAEA 1J23A 4ZU3A 5BW8A 1W85B 3P2OA 5C80A 1P31A 3KJQA 7ADHA 1YBMA 4QYXA 4FEEA 3QKSB 4CMIB 3R5XA 4HF7A 4HDRB 2XD4A 4P35A 3VZQA 4P7JA 4LGVA 2IY8A 3VZBA 4DLVA 3ZOZA 1U2DA 3K30A 3WI7A 2DFDA 3H5OA 1V37A 3PTZA 3QA9A 4I50F 1NW3A 1RRMA 1MBZA 1YNSA 4TL7A 3RWOA 1ADCA 4GI3A 3TCKA 5A03A 1G20A 1T24A 1ZR2A 4FR0A 5ARDA 3UFBA 1UKEA 4S05A 1UT5A 1EDBA 3FKSD 4O4HA 2X4LA 3U39A 1Y6GA 3IQFA 2PRIA 4GAEA 5JXWA 1EFHA 1GRCA 1XTQA 2AXQA 3P0HA 2OBMA 2RKOA 2AH5A 4NV1A 2VDWA 4HNVA 1EP2B 2AF4C 4CM4B 3AM3A 1BHSA 4GQAA 1QPZA 2CZGA 4O3MA 1VB5A 3E1SA 3IBSA 4P54A 4X00A 3RARA 5AQEA 2C0QA 4UNRA 2O0HA 2VJNA 4HR7A 1J42A 3B2QA 4H18A 2GCGA 1H4TA 4WXEA 4JXXA 2X23A 2EKPA 3BF7A 4P4NA 3L4SO 4FGWA 3I5XA 1RZRD 2WSSA 1H4VB 4RMGA 3VPFA 2YWCA 1HT0A 3KAKA 2JHGA 1R9NA 3K05A 2PT5A 4L75A 5A1TA 2PL3A 2IF0A 1JECA 1XP5A 3N87A 5EIEA 3L7MA 1K66A 4RWEA 4EGQA 1A95A 1T34A 2QHXA 3SJUA 1F12A 2HU8A 2NAFA 1ZD3A 1G2PA 2V03A 1W44A 2VJLA 3MNFA 4QOEA 3VH3A 5K0SA 1OFGA 1RAFA 3L1KA 1V47A 3B82A 3RRFA 1R6XA 2HA6A 2QRPA 2REQA 4K9KA 4NPHA 5E8JA 4HPXB 5JHGB 3ERCA 4I9GA 3PQ7A 1SBNE 2C94A 2WILA 4OKIA 3DEHA 2GRUA 2R9VA 1CKEA 3JVEA 4FC7A 1NMZA 1MQ9A 2AE2A 4FYXA 4LBWA 3A2KA 3Q9LA 1EK2A 4IJUA 4DC9A 1HPLA 3H04A 4TKLA 2TSYB 1SK9A 2QVYX 4XDGA 5LLTA 3A9CA 1E7SA 4MPPA 3DL2A 3FY4A 5ESXA 2PWZA 1ORRA 2G28A 2A9VA 5F3DA 2AA3A 3GUYA 4I1YA 4B3MB 4GR9A 4N6OA 4UNNA 4WX2B 4W63A 4W8GA 3RUFA 3V7FA 5K01A 3ADBA 1SO8A 4TQAA 3WXBA 3IRVA 3F0TA 1PUJA 3LBYA 5FHRA 2OUIA 4E6EA 2V1UA 3TG2A 4A8TA 1E7QA 3EXFA 1SVSA 1NVAA 1MV5A 5B6JA 4YJ2A 2PH1A 1KQ3A 4J03A 1D2MA 3W6PA 2VLBA 5DHRA 4CI9A 2ZJZA 2W93A 2Q4DA 2QPLA 2YYSA 4QNMA 5IAJA 1HV8A 4RV9A 2NU9B 4A26A 4J7AA 2NV0A 4CN9A 4S24A 5IN4A 5E9JA 3N3AC 1L7OA 2R8BA 2VC2B 4BDTA 1SXGA 2RK3A 3T8YA 1NTOA 1XHEA 5TX7A 1SQ6A 3QEBZ 1E2MA 4RD2A 2WC1A 1WV0A 5EZSA 4B35A 1SK8A 4WESA 4A16A 3VOBA 2R6DA 3KCNA 4Z4HA 4IDAA 5DMHA 1QX4A 4I8XA 4P0TA 1BSVA 1Z83A 4YP5A 3NZEA 1RRPA 1YIAA 4YV2A 3OCZA 1DS6A 2YZNA 1OHHD 3BH0A 3OAAD 1NBAA 1GRQA 2Q0XA 4K6KA 5EMKA 5FUYA 4D3YA 5JROA 1RYEA 3UPUA 4PFSA 1CPYA 5JG7A 1X7XB 3RYIB 1ISJA 1AGXA 2IU4A 2ZVJA 1J8MF 3K0BA 5JD3A 4A9AA 1QO0D 3CEPB 3PXUA 3HC7A 3PWKA 1DC8A 2FEKA 5I7HA 1EINA 3D6UA 3HN2A 4JL8A 4NPAA 5MGNA 1E2BA 1MZVA 4BNZA 4UQLA 2FX5A 1YVUA 1MP0A 1D9ZA 1VZ2A 1JILA 1YE8A 1CUEA 1J49A 1OASA 5KYYA 3W8NA 1ODJA 2NUPB 5FWDA 3ZWNA 3MQ2A 5KKCA 1W6UA 4EUFA 2O2CA 1H5UA 3ZBPA 5K5EA 2I2BA 4MIOA 2SNIE 2QV7A 2VL7A 1KYWA 1QFXA 4E2FA 2Q7OE 1YJ5A 3IR6A 3H6KA 1Y3FE 4AX4A 3TWOA 1YD7A 4EHDA 1ATIA 3LMKA 2XCUA 3QVTA 3WRWA 2YN2A 3PZBA 4B40A 1EWKA 1XMVA 2C9OA 2J5QA 3ZGOA 2MYNA 4NSNA 1KIAA 1D04A 3JQQA 4NEHB 2I2FA 4F1WA 1SCJA 2A33A 2V3WA 3HVUA 3N53A 3TK1A 4OXRA 1O94D 1VHTA 4HEJA 1E58A 5ICGA 1E9FA 1YR7A 1S1CA 3ICPA 3GGDA 1RSZA 2GEKA 3SLGA 1Z8DA 2QE7D 3AR6A 4NX2A 2LZ0A 3AI3A 4S1PA 4K9LA 4BVEA 1JRLA 3JPYA 5FA6A 3P0FA 3BSFA 2ZJ1A 2O2XA 3M1IA 4RPHA 5D86A 4OAPA 4QT0A 4BQSA 2AXPA 1V8FA 2RGWA 3AI2A 4XIFA 4DNQA 1T36B 2E1RA 1C4OA 4U7JA 4KRXA 3E48A 4MQFB 4R31A 5CJJA 1PWYE 2HCFA 3CO5A 4BECA 4DV1B 4M89A 5BWBA 2PZFA 2DE0X 2XE6A 2VNJA 1P9WA 3U3XA 3BDVA 4IWXA 2DQSA 1NQXA 6ADHA 1NVKA 2OCPA 1EYZA 4KQKA 3HSSA 1XROA 5EUCA 1TM2A 2VLIA 3NBYC 5FBRB 3LFHA 3ROGA 2VWGA 5JH7F 1YL5A 4TXLA 4PLYA 1OZGA 1NU6A 1PLJA 2GBIA 1DV1A 3A1VA 2QN6A 2IPLA 3F46A 3HABA 4OM8A 1I94B 4A36A 2E4AA 2XE8A 4MVJM 3WTBA 1JEQA 2FW8A 4LDNA 5AXCA 2DFNA 1N0IA 3UWOA 2C54A 1ZK2A 4BRUA 5TE9A 5B64A 2J48A 3BHNA 3K32A 3MWEB 3NKVA 1TLLA 3N0XA 2XCIA 1QF6A 1I6WA 4TV9A 3FIJA 4DJDC 4KOEC 3URKA 1RBMA 3GN2A 1Z2PX 4J6FA 4KW7A 1RWXA 3OIDA 4IFEA 2XQJA 2AMVA 4EVSA 1SBYA 2WD9A 3MPOA 4EUSA 4N76A 1UDRA 3UAGA 4R9SA 1YAHA 2IP4A 4Q7EA 2ECPA 1SQSA 1QCYA 3RHSA 4X65B 3I23A 1WXIA 2R1ZA 4PLVA 1F14A 1L7DA 3OQPA 1ZD2P 2GXSA 1XTSA 3T12A 3QWFA 3BQMB 3TZBA 5JSHA 1JQ5A 3A05A 4GS5A 4N3CA 1PYGA 3G1UA 2P5UA 2OMKA 2Z4TA 4G1MB 3IXQA 3VMMA 1VE9A 2CLOB 1S3GA 3O8NA 2RC6A 1AIPA 3S27A 1S2IA 3DZ8A 5IM5A 3PL1A 4A3SA 4QU0A 4YRJA 1U2ZA 2JI8A 5BR8B 3CUYA 4IRXA 5AKJA 3NAMA 1PG2A 2ZWAA 3D0QA 2IDZA 3DKIA 3KJHA 3PKJA 5FO1A 3PWTA 3O2SB 3KB2A 1C9JA 4MHSA 4CNQA 5BP7A 2CDBA 2MJLA 1YASA 4FSDA 2FZ5A 1FX0A 3D4LA 2FFRA 1UJ4A 4ER6A 5CLJA 2RH9B 4C7BA 5C8YF 5AYVA 2XUAA 1OF1A 3BL8A 2ICAA 3N28A 2WHPB 4ZMRA 1JXAA 1PW5A 4PICA 1E2NA 4ZAZA 1OAOA 1CY7A 2A0KA 2IYNA 4BE4A 4CMAA 3DA8A 3DNMA 2VZ9A 5BRAA 4Q7KA 1OLUA 1H8ED 1N0VC 3EIUA 4G2TA 4CMEC 3DEAA 2D2XA 2H1WA 4EUNA 1DJLA 1PJCA 4RH0A 4U6NA 3UCFA 4URXR 1IATA 4DTIA 5DK6A 5FL7A 3DKKA 3Q6MA 1KHHA 2Y1DA 4MVJD 2WSYB 4QXAA 4F8EA 5HQ3B 2VRNA 4XWGA 2B4RO 4K46A 3ZHRA 1MDFA 2I6QA 1CHNA 2I67A 3T6KA 5HKOA 1U6JA 2DR2A 3CUKA 1SU7A 3AVPA 3UHJA 5J2UA 3AG6A 1N6IA 4CCWA 4ZN6A 3BH6A 1O77A 5L8VA 5C5CA 2J9YB 2LDBA 4KO3S 3P9QA 3KR9A 1QHHB 2I4IA 4FFBB 4BZPA 1U0TA 1OWLA 1E20A 1P5ZB 2C2WA 2YH2A 4D99A 3QU5A 2P35A 4DLZA 4PAMA 3VBCA 4FFDA 5B3LA 4YB8A 3IP7A 3IVMA 1A72A 4KAJA 2ZLBA 1JR6A 1JIJA 3EZ2A 2VG8A 3DLPX 2IJGX 2YOGA 4H3HB 2RAFA 2FZCA 3JQ6A 2C2KA 4LY9A 4XTRA 3FHCB 5TQ0B 2NSYA 3EEQA 5MN4A 1YRHA 3WKEA 4BNMA 1DMSA 2PMEA 4HX2A 3FTEA 5CBKA 1JHMA 2GZ3A 4G9EA 4AYTA 1QYCA 2QVCA 3EEOA 3D9QX 5JFOA 1YQUA 4AF6A 1PZNA 3MCUA 4I46A 2BFFB 3AVTA 2ZJ5A 4NBLA 4R83A 4I66A 4X60A 3SDBA 2FLWA 1IHUA 2XV1A 3VNUA 4FW9A 4MW2A 3C45A 4GX5A 1UJBA 3NS7A 4N1AA 3EVZA 1S0UA 4Y9TA 1C3JA 4KXMA 1JR3A 2TYSB 3BMQA 5HOQA 3G49A 3N2NA 1ECCA 4EB0A 5I4IA 3KPJA 3AEKA 4CLRA 3O9ZA 5DIFA 1WUTA 5EQFA 5KVSA 2I55A 4PYKA 4RK0A 4BAZA 4ED9A 5HRCA 1WRBA 1JN0A 3PEVA 4IPTA 4OM7A 1GNRA 4Q9LA 4V0QA 3N2KA 3UH1A 1HMPA 2H0AA 3DC7A 2IBMA 2QX9A 3V1KA 2CD9A 1VI6A 1AKVA 5A4FS 5AI9A 4XTCS 3W5UA 4CDNA 1U0JA 1NLYA 1EFCA 3ILVA 4A0QA 2M1ZA 3M89A 4CIAA 1NA5A 4EKDA 4XXHA 1Y4AE 5CA1B 3K53A 1R4ZA 4F92B 3JARA 2WKQA 3M9WA 4YLGA 1PQWA 1TVKA 4S1WA 1UKBA 1PKEA 2DQZA 1VSTA 5HKKD 3QELA 2EP5A 4P33A 4DV6B 1ECLA 5F7ZA 1YHNA 4FCTA 5CNKA 1SUDA 1DCMA 1A4IA 1Q0UA 4OPMA 1OLSB 1K6IA 3FNFA 3ACDA 4D3FA 1F06A 2GZRA 2Q3DA 4MS3A 4OUDA 4MQLA 4QX6A 1E2GA 5JVDB 4GKJB 1XF1A 4ENRA 4EJSA 1RAHA 3AV3A 4LVOA 1DNPA 4CM8A 4J49A 2BMJA 3DVQX 3R6GA 2J4DA 3AHJA 4AZVA 3AEZA 3E9MA 4RAOA 1BKSB 2V7XA 1EX7A 4B1FA 1K5GA 4GLFA 5EJ6A 3ZR4B 4ALIA 2NYUA 1CUFA 4Y9UA 3TOVA 4PZ9A 3ZTTA 4N5DA 2FFBA 3QQ5A 3MB8A 4NBWA 3DXXA 5HDBB 1NZFA 3MUOA 1XRNA 1HR0B 4KE9A 1WDLA 3WRVA 1DRWA 2QJRA 3TLGB 5EKXA 2REXB 4DCCA 4C0HA 3KKNA 2XUFA 3PHCA 2CV0A 1ISFA 1OZ0A 1V5EA 4ZJZA 3GRVA 2HT1A 2WJ6A 4EG1A 2HNAA 3VPCA 4EI8A 1P7CA 2EG9A 2JJ1A 1ZIYA 5DVZA 1NF3A 1II8A 2BF7A 4WOBA 1EBFA 3WNVA 2YDYA 4C88A 4CM1A 1OIWA 1FYDA 2UYGA 3OWHA 4ARCA 1KY3A 4E03A 1PFYA 4PYJA 3K0EA 1P33A 4BASA 4X5OA 1XTVA 3BBLA 5HCIA 4E5VA 1J5PA 4GECA 5C5EA 1PDWA 5B1SA 2ISCA 4ZHSA 4XEUA 3ZWBA 2OHJA 3G23A 1UJ6A 1KGSA 3HZZA 4UUBA 1PEDA 3RR2A 1K92A 4GH5A 4KBGA 4DC1A 1DL5A 3FYCA 2XGGA 2GEUA 1E8NA 3P9IA 3O91A 721PA 1FFEA 3CKKA 3WDMA 1DWOA 1TTHA 1UAYA 3IT1A 1Z08A 3JQ8A 3LT2A 2R2AA 2VEOA 3HKEA 4FE3A 4M8LA 4YYZA 5E6RA 5ITZA 4ZOEA 4WK2B 5LKRA 3RYCB 2DR3A 1WOMA 5AVWA 3AY0A 3AQ4A 4MW4A 4EO9A 2BLLA 3DE3X 3BILA 2W4IA 2X9GA 4XSVA 4ZA2A 4PN7A 2DLCX 3K9NA 4I8DA 2KB0A 4WFKA 3I72A 3NYQA 2HRZA 1FDUA 3Q0EA 3Q85A 2VF8A 3R9KA 3PLNA 1SA0B 1SOVA 3VHXB 1HH4A 4UHCA 5DM1A 3OMLA 4EJ6A 1BJRE 4G8JA 3OE7D 3PQ8A 4JI4B 1RRVA 2GCIA 3RYTC 4ZQGA 3LL4A 2NO9A 4AUKA 3I9MA 1T8SA 1YFZA 3HGTA 4FBMA 1XEAA 3TM5A 5KWEA 1JKIA 3PHHA 4JP2A 2ZWVA 5GTDA 4ND8A 3D2LA 1MJNA 1FXWF 4CJXA 4RTNA 2RHJA 1RVDA 4ROTA 4XDZA 2NIPA 4FZ5A 3LCVB 4AKIA 4E2WA 1T9CA 2O48X 3O8RA 4Z2AA 1WSBA 1J97A 4U9HS 1E3QA 1HLGA 1F51E 1Q1GA 2DCMA 3ECCA 1IPHA 5CG1A 5TMBA 2QRQA 1HMYA 1B8PA 1LDNA 2A86A 2JFGA 3ZWVA 4PXYA 2REOA 2X15A 3D3KA 4RLHA 2QVZX 4EDHA 3EVTA 3U4IA 2G0NA 1A97A 1FLVA 2FW0A 2ZIEA 5L7WA 5LQKA 3ZD6A 5EXDA 1T6YA 2V45A 3CVVA 2ETXA 4GOKA 1ISGA 4CU2A 1DQNA 2I7XA 1VKHA 5F73A 1OQAA 2ZB4A 3OZAA 4MRSA 2HWUA 4C06A 1JIIA 3CF4G 4K9MA 4B3TB 1WVIA 1Y1TA 3A4NA 4P82A 3VU8A 3DD5A 1Q6ZA 2W2PA 3HU5A 4BMCA 5ABPA 1RKXA 3KKMA 3SFTA 1Z56C 4MUYA 3NXKA 5FEMA 1J22A 3FW1A 1G2IA 1NPYA 3R3WA 2ZQYA 3AFHA 1NF8A 4NEQA 4ZALA 1PWXA 3ZY5A 1RPTA 1PZFA 1YDEA 4U1RA 4CFYA 1AQIA 2B6HA 3EGOA 4JLMA 4OHFA 3SYNA 1B6SA 4QBFA 3SIPA 1UFKA 1XZQA 4JKIA 3R44A 4CT0A 4HDQB 1NBIA 2P3LA 1SG0A 4HI0E 4LFCB 3JVIA 2CCJA 4QRIA 1H66A 4XVQA 5TJHA 4IZ6A 2OBXA 4BJHB 4EUHA 2JA2A 3NEPX 3FRHA 4JI6B 4AC9A 1RABA 1MJFA 2NU7A 2E7ZA 3H4VA 2X9QA 3VDQA 2QY6A 4MQ6A 4PQEA 1FPMA 3OTGA 3VO8A 3BMNA 1QDEA 1UFQA 5CB4A 3FPGA 2IYWA 4LPKA 3SC2B 3AP2A 4ESHA 1YWGO 3OJXA 3FHJA 3QSYA 3WV5A 1J0EA 4XFKA 3UPTA 3T3EA 2FMHA 4ZJYA 4F6RA 4RMHA 2OOSA 3KL2A 2FB9A 3BJIC 2F1KA 3IAEA 4RZ2A 4TN1A 3OPYB 1BMTA 3L7DA 2Q6TA 1LKZA 5IC6A 2WVHA 1S6YA 1Z62A 2YIMA 4KR0A 3VO2A 4CE6A 2BYTA 2YZ2A 3SZUA 5JJIA 3SHOA 3GH1A 2QNRA 1N77A 1M34B 1FDOA 1T91A 2HOQA 1XPRA 1X42A 2H85A 5HILA 3LYLA 2A5YB 4MV7A 3C3JA 3P52A 4DMFA 1CD5A 3I92A 5KEIA 5FBQB 1L8QA 1JZTA 4HOYA 4RZ3A 4Y9RA 3K8QA 1Z33A 1TYEB 4IV5A 3T5MA 5I9LA 1CS4C 4PONA 4FYMA 3GJSA 3WAJA 1IVSA 3D8HA 3KJIA 1ETUA 1RC8A 4XQGA 2QM3A 3JPWA 2JBHA 5AW1A 2DY1A 3NVKI 4F96A 3ADKA 3KFXA 4FD3A 1NBHA 4QG7A 4QYWA 3E9EA 2PUEA 1PFKA 2WTUA 2RGRA 3DO5A 1WS6A 4UE3S 4BNNA 2E55A 4AN1A 3ZX5A 1IDOA 1YJBA 4ZT2A 4IJKA 1DKMA 5G1PA 1S8FA 2RSLA 2CE2X 3GLGB 2FETA 3VYSB 3M4XA 2CC2A 2JFBA 4F60A 2BM1A 1Y34E 4RH1A 4WOPA 5CTAA 1UPFA 5IWAB 1E3DA 1TTTA 3EWNA 1IM8A 4J0IA 2ZSAA 3PQ2A 2DY0A 4K3UA 5JCOC 3ANLA 2OAEA 1JVNA 1LBQA 3ANTA 3CHYA 3ZCUA 3AVOA 2VDRB 5DN6D 4FB4A 1N5KA 1T29A 2Q41A 1UJ5A 4CMGA 3OFJA 4MV3A 4OEHA 1NUUA 2YBDA 4ECEA 2I1VB 4ND5A 3KQMA 5DYIA 3CQ9A 2ZSKA 3T7TA 4OJQA 2VJQA 1F38A 4Q1FA 1GQFA 2IZ0A 2OZLB 3Q4GA 5K3BA 3KDAA 3C98A 1D4FA 5FP0A 4YFVA 3UCXA 3V55A 4EKEA 4ZI7A 1L4UA 1YR3A 4S2EA 2XB2A 3F97A 1YUBA 4B33A 4J9VA 1DCFA 3D8TA 4IGIA 4M76B 3SDSA 1I7DA 3I32A 2WTNA 4YASA 5C35A 2C1EA 1YTUA 4PYNA 2HMWA 1V6AA 1H85A 1PR2A 4BDSA 2HA0A 3GPCA 2HRCA 2FR0A 4OJKA 2CSUA 5EJAA 3AM1A 2XOKA 3NIGB 1TZCA 1Y7TA 1JR4A 4YT4A 1IQPA 4JGBA 4TV8A 4RULA 3D6NB 4QJ5A 1UPXA 3LZ6A 1DOHA 3AKDA 1SQ0A 1Z8NA 2Y8EA 5CA1F 5FBHA 4D3SA 5H16A 1NIJA 4UARA 3ESRA 4DSNA 5A0VA 2JLRA 4KGZA 3FHTA 4BUZA 1MO3A 3U3JA 1PZMA 3ZHCA 3DUWA 2C5FA 2ZS7A 4Q19A 3ZV4A 1XAHA 221PA 4ZTUB 2B3TA 1ZGCA 4F9TA 1AMNA 5IUJC 2NAPA 3GWGA 2MSCB 1F8XA 2CYCA 5IBQA 2AX3A 2GS9A 4NRDA 4OUKX 2RHOA 1MT3A 1Z4KA 2JC3A 4DCJA 4E3ZA 4MV9A 2XECA 2JCBA 4B4OA 4HFMA 1SPBS 4UU1A 1KI6B 2F9MA 2DSTA 3BMOA 5ICMA 3HH8A 1QSGA 1S8AA 1Z4MA 4NNJA 2OD9A 3WSVA 1XCMA 5HR5A 3JWEA 1RP7A 5ALPA 4D9CA 2DVMA 3K1TA 2O3JA 2OKCA 2D4AA 3CNQS 1OTYA 3Q9SA 3SQMA 4FGJA 2XWPA 1TQ8A 4X54A 2WT4A 4C89A 3KSAC 1SVWA 1AKWA 2MTBA 3C3PA 3HMQA 3LL7A 2J46A 3OICA 4OBWA 1Y9ZA 4TL6A 5J4HA 2GK7A 3AR5A 2VDUE 1NR5A 1XA3A 1NBME 2D2FA 3MELA 4TMTA 5EQTA 1FYWA 4DQKA 4S3MA 3PSHA 3IP1A 4EX6A 2IW3A 3IBFA 4H7KA 2ATXA 2JFQA 5M5BA 1ZNQO 5EHGA 4RCZA 2ZRJA 4UU7A 1HFWA 3W5DA 1BKDR 4RV5A 2OEPA 1MPXA 1FW6A 2QTFA 1BTOA 5EOVA 2OTCA 1VLZA 2H06A 2HBYA 1S89A 3L46A 5C31A 4UXHA 4BEVA 2UUPA 3RU3A 1YKGA 2P0AA 3QFSA 5AW0A 3IOCA 4RVGA 1IG3A 1EP3B 3ULKA 2G4VA 1CS0B 4NYIQ 4XWOA 3PNVA 2YYZA 4B9EA 2C7QA 3QYPA 3FCXA 2YOFA 3PK0A 5FUWA 1RWMA 3WGYA 1A82A 4EHBA 2A9PA 1ZESA 2OGZA 4HDMB 3RREA 1IIRA 5A3JA 5CDHA 4DR1B 2IOYA 1YZHA 5L4SA 1IN5A 1UANA 4E14A 1PVDA 3B38A 4PZZA 3L8EA 2H48A 1K9SA 3B6ZA 3ITEA 1O0SA 2XGOA 3GMTA 3OJ0A 4ZYXA 1PNRA 2UXCB 5EMJA 4M86A 1CUWA 1V7CA 1PG0A 3O1JC 4MVXA 4AMBA 2J9FB 3F4KA 4QE3A 1NN0A 3R74A 4INAA 3DAGA 2XUHA 3JYQA 5A4DA 3KTDA 5L6LB 3LPAA 2WM2A 3K9WA 5HQJA 1DO2A 2RGAA 4KR9A 1WKBA 2WWRA 4H08A 4BBJA 5FPYA 3TIXB 1FNNA 3P27A 4II2A 5TPZD 2ODNA 3TOZA 1ZQ1A 2OM6A 3RRBA 4ZOCA 1NNEA 3HKDA 1FTQA 1G5TA 1L5SA 2ACKA 4PPQA 1WUHS 1HNZB 2FE4A 1DTWA 1DXYA 2OVFA 3IUMA 4HB4A 5ALHA 2P78A 5IMSA 2BI7A 5TF0A 2G40A 2ZIUB 3OU2A 3V34A 2IITA 4G4JA 5G1NA 3DBVO 4W7IA 3H7IA 2VKTA 3AI1A 4YPVA 1DPFA 2D2VA 3JALB 4K6HA 4PFJA 5TXGA 3E9NA 4L0QA 5KSPA 4ZZ3A 4DCGA 2P91A 4LF9B 1RWKA 3S2FA 5DULA 1GTZA 1SWVA 2H2IA 2I4MA 4OBBA 1ZM7A 4YMLA 3FPFA 1O57A 2KMLA 2KW5A 3V8QA 2CJYA 3TIFA 4C76A 2OFXA 2WJIA 3BAZA 3D0OA 2A9KA 3G02A 4C1BA 3JQFA 4C4YA 5DGTA 1IBLB 3ZI4A 3K6KA 3C74A 2C1XA 3KHSA 1DQYA 2NO6A 3I4CA 3EDRA 2FEWB 4GKBA 1WUKS 4JMPA 3I1JA 3OE4A 2Z2ZA 4TTVA 1OD6A 5G3YA 3W1EA 4EG5A 1JAXA 1M66A 3B3GA 5AW7A 2QTMA 4ADSG 1M1UA 3RUPA 3BD6A 4GLJA 4JN6B 3DAFA 1UBRS 4L5CA 4GOND 4E07A 2EZUA 2PXAA 2SCUB 4PTZA 3G0CA 3K9QO 5IK2D 1PR4A 3S7TA 2HSJA 5ILOA 3S5JA 1CNMA 3EG9A 5EIBC 1ZJYA 5TV2A 4M38A 1UC9A 2OO3A 3A1UA 4HDCA 4E12A 3HUUA 2MR6A 4JLVA 1OFUX 1PQ4A 3K4PA 4MO2A 4D43A 1IDN1 3WB0A 1QP7A 4U8HA 5DV9A 4UM7A 4MJXA 1TEHA 3L7KA 4ZHQA 4L7VA 5F5LA 4JYZA 4YP7A 4LOJA 3U7IA 3ETEA 3DEYX 1QWSA 3EY9A 4MROA 3VR2A 5ALVA 2QNIA 1WR8A 3M9LA 1HOTA 3UUFA 1XJ0A 5EE1A 1P9OA 3IKMB 3AETB 2FVYA 2WJGA 4Y2JA 2BMWA 4A4DA 2IZOA 3FWYA 4LXIA 1VJTA 4QBHA 4KUEA 4DJAA 3QY0A 2LVBA 4BWGA 1HEIA 1IVNA 1OAAA 3E5RA 4KAXA 2BY4A 3M49A 3QV2A 4KH1A 4L2IA 4MQUA 1PGOA 1T4CA 4EHFA 3HO1A 2YN4A 4PX5A 1CUUA 3LDFA 4UNSA 4IIYA 4JUIA 3CNOA 3QEAZ 1JTEA 1RXCA 4URZR 3HLTA 4EAAA 5BOSB 3MOGA 4KIJA 2EIHA 4BV2A 1QB7A 5CVUA 5T6MA 2CDAA 3PDIB 3CVOA 2C2GA 2G0AA 2ZI3A 3Q3VA 3W5AA 2PQ0A 3BMCB 4OGWA 4QJ4A 1XRMA 5HBGA 4JENA 1FDVA 1VCHA 4QUBA 5FFMA 1N2GA 2FZWA 2PWPA 3ABQB 5LMZA 1XNQB 2F9LA 3DDSA 3ZPXA 4H1WA 3EWAA 2LKCA 3KVNA 1EBBA 4MW1A 2VT2A 2W2LA 1WDMA 4L3WA 8MHTA 3RRXA 1MV8A 2AG0A 4Z7OB 3PQ4A 1AKRA 1KBZA 3C5WP 3D6HA 3SSNA 1LPAB 2JEYA 3BCSA 2H1IA 4ZJUA 4MI6A 2Q6VA 1G64A 1LPNA 1X9IA 4GOOD 4MAAA 4EKYA 2FFAA 5I51A 1ADGA 3FOWA 1U5AA 1ZGHA 2CFRA 3RRMA 1KORA 4KYTA 3KTFA 1WE2A 1D4ZA 2I4TA 2XUOA 3AY3A 5AUQA 1ICEA 5IT9A 4Z7NB 1EVLA 4ZYWA 3QU4A 3IUEA 4M1KA 2YVUA 5EIFA 4CTKA 3A25A 1GKIA 3DDUA 1IUPA 1U28A 3W9BA 1NN3A 4UEWA 2BFBB 3MCZA 3SZ3A 4AY4A 4L9RA 4XPIA 4JUBA 3D3WA 3PUWA 3FUCA 2O8EB 2PMKA 2JIRA 4FYHA 4XJTA 3SBDA 2C3PA 4D9GA 3L0DA 2V6GA 3AC0A 1YCDA 5FL7D 3C8UA 2I65A 1KMHB 3P4XA 2C92A 2VA8A 5TGDA 1U65A 4B9AA 2VUUA 4D92A 4KPYA 4ZO9A 5DOZA 1RXYA 3C5VA 1E77A 1UEXC 2WYWA 3NONA 5DTIA 1CB0A 4O02B 3VHRA 2GPAA 3DE2X 1UMCB 2NVOA 1HEYA 2PFKA 2QE6A 2JHFA 2DP4E 1H42A 2V6BA 2YZKA 4M8IA 4RJKA 4WD3A 2BFEA 1ITZA 4ANFA 5JNRA 2Q3JA 3FCUB 8ABPA 1UBNA 1R5BA 3M6MD 3K6SA 4ZOBA 4K6GA 3WMGA 1H65A 1GG9A 3LSTA 3EQ2A 1PR5A 2HDNB 3OZSA 5ALKA 4KVFA 1JZSA 3DDWA 3PXEA 4B4WA 1QYXA 2NTVA 3BD9A 1AUPA 4V38A 4CKBB 2Z5FA 5B7PA 4FFVA 3TD6A 3WXMA 2OC9A 1SZCA 1Z45A 3II6X 1A3CA 1KK3A 4G4IA 1QG4A 2CKDA 3KHTA 4LZWA 5TQ2A 3RBZA 5BQ3A 3DC2A 4G6ZA 1DRUA 2XEXA 2BFWA 2XMCA 4XX0A 3GGPA 5FR2A 3JQGB 3VPSA 3ZE8A 2JLAA 5C8YA 1F3OA 1OBHA 1UMBA 2A92A 4V24A 2WZDA 2KS6A 3IIEA 1ZN9A 3N8NA 2VHZA 3EUFA 2QJTA 4DMKA 5LYJA 4QAJA 5CH3A 4J0QA 3ZC3A 1L5ZA 2BEVA 3OZUA 2C9BA 4WL0A 4YEDA 1QGED 2JHCA 2WOJA 4OJYA 4E5SA 5IG2A 2WU3A 3AP1A 4NL4H 4D41A 4AYWA 1J2RA 2AW5A 1ZGZA 3ACBA 3F49S 4FQ7A 1XVUA 4OXNA 2GI4A 4LTMA 3RS4A 2CJWA 3WNZA 2OHFA 4CBVA 2IIQA 3RK1A 2XSZD 1GT91 1M1NB 2OOKA 5AW4A 2PNFA 2A7XA 3L06A 3GPLA 4NF2A 1IVYA 5DTQA 5ERGB 1CWUA 1KVTA 3GH3A 5CLGA 4D26A 2VJMB 4O1MA 4OIMA 3QI7A 2D1SA 4QVGA 4TKZA 4FYPA 3PJGA 3JZMA 3VKFA 3A70A 5IUNC 1KJZA 2C78A 4AMVA 4BL5A 1Q0TA 4XLTA 4XVCA 3IAM1 4RS4A 1WWKA 4CFSA 1NJ5A 4GQIA 1FL9A 1XOIA 3CN9A 1CTQA 2GVDC 2QENA 4Q6BA 3AIOA 3JYNA 1Y0BA 1XZCA 3L40A 1BWSA 2HC9A 3HUDA 1R16A 3TECE 4B46A 1MH1A 4MYSA 1R12A 1N2SA 1ULSA 1NKSA 5L95A 1QGDA 4HWRA 1ZM3A 1EA5A 3FZQA 4NZMA 1UFVA 3MTEA 5JDCA 2P2SA 5ALZA 2PL5A 5JATA 1LDYA 6Q21A 4L4RA 4U0JA 2QIPA 3S55A 1M7HA 5T8KC 2KJQA 1TK3A 1ODKA 3C5CA 1WMAA 4L8GA 4IIJF 3WGTA 1QVZA 3EE6A 3ZJ4A 3BXFA 3PHLA 2F48A 4OFZA 3K0KA 4MR8B 2ZBDA 2VTVA 4UVDA 2WFMA 4OQEA 3RKRA 4DGSA 1IM5A 3CKMA 3PXCX 3X1JA 2CT8A 1ZJ5A 2BUBA 2CB0A 3H6HA 1YR2A 3B6JA 4TM8A 4TRJA 4X93A 2XKAA 1R6UA 3W3AH 4CM5A 1Z5GA 3C3CA 3LHKA 4BVFA 3V2HA 5LLSA 1CRLA 4HRVA 3RAPR 3ONFA 4UU0A 3Q7SA 3T95A 1QHGA 4PC7A 3QRWA 4Z86A 3MJEA 3QXXA 3FFAA 5KNDH 1Q92A 1Z37A 3GP5A 2RB4A 5L3SA 1VECA 2XT6A 3CVJA 4G1UC 4FOSA 1TRKA 4KO8A 4ABTA 4KFTA 4YI5A 4AMGA 2IOFK 1IZ0A 3FROA 2X0NA 3CXUA 3GWZA 1PJ2A 1D6SA 3E2PA 3LXUX 4MW7A 4TUYF 5BPHA 3UB2A 5LMNB 5TEWA 3KQSA 4CL0A 3LKVA 2I78A 2A8YA 3WB1A 4ZCMA 5FPSA 4HFNA 2W6OA 5JZVA 3PC2A 1QAMA 3S8EA 4Z2YA 2ZWPA 3GMDA 1VHDA 3GPIA 4WCFC 2EJUA 2WJWA 1DE0A 1ESNA 4D42A 4RE5A 4YAWA 4B4KA 4G8DA 2E4UA 4MYCA 3AF5A 1M7BA 1AA6A 4EUKA 1KAEA 3SE0A 4P3XA 2YWFA 1OGIA 4RQAA 1CNFA 2EJWA 3KOMA 3QBJA 1L4MA 1OWPA 1SY7A 4BJ3A 3FYTA 1T0IA 3M6FA 4E1AA 1PG5A 5A4MS 3ITKA 4GE0A 1ZLYA 4ZOLB 5KJ1A 3E05A 5D2CA 3EZLA 4U5XA 3QM1A 4LHZA 4H1HA 1WZCA 4TTTS 2PK3A 3QE9Y 3TW6A 1MJHA 3BSSA 2A9JA 3DBIA 3FCOA 2M32A 3KOZA 3CUTA 4YXWD 2CUZA 4BFUA 1BMFA 2YFYA 2VJCA 3G6WA 2IXTA 3IAS1 4IXMA 1B8VA 1YS4A 5AR1A 1G8KA 3AEQB 1XU9A 1VPVA 1Z39A 3PPVA 3EPHA 2YV3A 1K8RA 3LG2A 5JZBA 2B4AA 3O95A 3PB3A 2EJVA 4J16A 2D8MA 1TADA 3E9QA 2HF2A 4JVSB 2CZQA 1W36B 2REBA 3OD5A 2GSDA 4ZWNA 4NIMA 1IONA 1W0KA 3NDRA 5JADA 2HA5A 1EGQA 5LZ9A 4TKUB 2OORA 3ER6A 1ESZA 4F85A 2NWQA 4K9NA 3VDMA 5KVCA 2GCEA 5EQJB 1IJFA 5KREA 1HE8B 3OT5A 4ZAXA 1VQ1A 3HO8A 4UUNA 1W2HA 3IJPA 4HAYA 1I1HA 3W2EA 2QEQA 4KQ1A 1SUWA 1SAYA 2QL5A 2PUWA 5JBQA 1RJ9A 2XQKA 4PYQA 1IZ7A 3EOZA 1KEWA 1W1UA 1XDWA 2XODA 3VPBA 1IXYA 1H2XA 3JVUA 3MWDB 1RHRA 4AKEA 2AIRA 4DA0A 4YCAA 3TXAA 1E3WB 2CL0X 5BR4A 3TXXA 3DE0X 3CLRD 3GNLA 3W79A 2V58A 1G3UA 4N40A 5DT9A 4CT5A 1UUFA 3VU9A 1AUOA 1E1DA 4M88A 4MKXA 1D8AA 1WG8A 1N5LA 1FK8A 1M2KA 2WI8A 3WWOA 2Y27A 3N6VA 3RWBA 1X38A 4KODA 1L7AA 1M83A 3UJPA 3FMOB 1C1DA 2FP4B 4A8PA 3ORQA 4OK6A 4HQOA 4F12A 3ZY2A 1H4SA 3MM4A 3IVGA 5LVAA 2FN3A 4DDUA 3F47A 4IS3A 1BXRA 1DB3A 2Q29A 5TT0A 2GHQA 2OHHA 4HT3B 1KBQA 5EJ2A 1U3CA 1T1GA 2H1OA 2UUCB 1HDIA 2XE4A 5ES4B 2BR5A 4AS1A 1YDGA 5G40A 3HWX1 3G2KA 1T3SA 4JY7A 3V8EA 3LQ2A 1V45E 3WQHA 1H1DA 2QX6A 2V4MA 5DYGA 3CWCA 5DGCA 3HR4A 4DNOA 2MSKA 4YI3A 3SEQA 1X7WB 2JKVA 2WE8A 2GYYA 3K16A 2C5SA 4W9NC 3LNCA 4OQXA 4J7XA 2F1IA 3RAGA 2OQVA 5F78A 4JBHA 4DNPA 1U5BB 1D5WA 4IOMA 2BFPA 4X64B 2O19A 5JYDA 5I8PA 4PPYA 5ULLA 3BKXA 5IJ9B 4S12A 1ML4A 2VZLA 3HDQA 2FUCA 2O5RA 4D4MA 2Q2WA 5JDIC 3F3MA 3Q6NA 1R0ZA 4QDOA 2AN5A 4HZIA 4MWOA 3IUPA 1QE5A 3H75A 1CUJA 2C5GA 1R4AA 1CULC 3O03A 3KEQA 4ITRC 4RF2A 3LHIA 1T2UA 1C41A 4NFSA 4KSYA 3HXMA 2X41A 1ZVJA 4DBLC 3HJGA 4XOUA 2WE7A 1SC3A 5YASA 2H7XA 1FBTA 1U11A 1OX6A 2Q9CA 3BH7A 5D8DA 3QE2A 1ST2A 2VK8A 4E21A 4BLQA 1E3MA 2H8KA 2GBCA 2JGLA 3N2IA 4BFZA 2BFMA 3V4VB 1GN9A 5HDQA 3TJZA 4B75A 3W78A 3WTCA 5FV7A 2VPXA 1V4VA 3PCRB 3PXBA 4MS1B 1NRWA 3MGAA 4M8SA 3NALA 3L5KA 4JLSA 1TT7A 1P72A 1H05A 4YLEA 1XNRB 1L4HA 2JI7A 2HU5A 3GX1A 1XRQA 2Y2UA 1VLJA 2ZXFA 3T52A 3WYNA 4E11A 5JJBA 1YB5A 4I1SA 4X7MA 5HKBA 1DBSA 1VOTA 1DUIA 2DPLA 1YV9A 3A2LA 1PJTA 2IP1A 4UUQA 4X1IB 1CIPA 1V71A 3MGBA 3HYRA 1NV9A 3NOQA 4I9FA 4X1YA 3TTSA 4BMVA 3OTHA 4IRUB 3E7XA 5AW9A 1A5AB 3QVVA 4XAQA 5C81A 3ZQJA 5PGMA 4XOIA 2ZRPA 4KV7A 3PHIA 2O2GA 2A78A 4XCVA 3AJDA 4EHKA 2R8XA 1RWBA 4QTXA 1NP6A 1LJUA 3AI7A 1QVRA 3SLRA 4YY3B 3CA8A 2JDIA 3N05A 1W9HA 2YJGA 1IK6A 4UFNA 3QX8A 3H2HA 1JX6A 1W34A 3OIYA 2GAIA 2VH5R 5DYTA 4JQCA 2QK4A 1U0SY 1P74A 4LGCA 1IC6A 3IGFA 1CXZA 3WLFA 4U7HA 3D8RA 1TJNA 4K2HA 5JAHA 1SUFA 1BRMA 2AYXA 4D6XA 2QTVA 2UYQA 4FCVA 4L4YA 1X1SA 1I32A 5C1OA 3UGJA 3NPAA 2IELA 2QP3A 2A0UA 4WBNB 5K8JB 5TMEA 2OZKA 4Q02A 4QT4A 1N75A 1DOZA 3RW9A 3KG2A 3CB2A 4U7PB 5TC4A 5IYZB 2Q4BA 3DUFA 3F5DA 3TZQA 3RS9A 1O96A 5KYTA 2WQ6A 1XI2A 1BE1A 2AMYA 1V96A 3UWKA 3VTAA 1U7ZA 2R7NA 2VQDA 5BQ5A 1J0AA 1L4GA 4PC6A 4EQ6A 1YS6A 2XOKD 5AVXA 2H52A 3QNWA 3O38A 1NU8A 1DADA 4JZYA 5B2FA 5A05A 2XY4A 3OCWA 1V43A 4XARA 3TX2A 4N65A 5EUQB 3RUEA 2HHHB 1NTRA 4OGFA 4GHWA 4CF6A 2AHRA 2PU5A 3DMNA 1Q11A 2FOLA 3H1GA 3IFSA 3KSDO 4JX9A 5G41A 3LIPA 4CKWB 2FOXA 1Z68A 3BHIA 4QIHA 1ZN7A 3OTWA 5TS3A 1P29A 2YTZA 3V7YA 4FDVA 2QORA 2R1VA 1PDVA 4NCBA 3LTNC 3IPCA 3NWJA 3H86A 3UOWA 3FPBA 4TXHA 4MEJA 3AZOA 4GDMA 2BE7A 1RAEA 2HV9A 4XB6B 5BOVA 2BFAA 2HH9A 4MQMA 1UQTA 1U1CA 2C2ZA 4EX7A 5LN1A 2IWHA 4G0YA 1S4MA 2VPYA 4R1TA 3V8PA 1I6KA 5DN9A 4LF4B 4TQUS 1SUIA 1D0IA 5IRCD 5I4BA 5G0TA 4EEXA 2E3JA 1KNQA 2H4WA 4I2VA 2YW9A 3PNOA 4L85A 4MQ5A 3OHMA 4OHZA 1M2OB 1F5SA 4C43A 2HA7A 2W7TA 4HXFB 3LD9A 4UM5A 1P2VA 1C2TA 1ULAA 3JCZA 2ZE6A 2ZUFA 4UAVA 1E2PA 4HY3A 4O4LA 5CRIA 2QVXX 3HXPA 1U8YA 1B0UA 5KS2A 4YMIA 3VNAA 2VDMB 2OENG 2FJ0A 3KYCB 5BSWA 2YHSA 2XCOA 2PUJA 2XAUA 1X14A 3PR3A 3CJTA 5H3LA 5IC5A 3RJTA 3AUKA 1NYLA 2G25A 3H5LA 4FYVA 3AKYA 2ZXEA 3IYLW 1CQZA 3DOIA 4H7DA 4JODA 5J9FA 1WOYA 2WP8J 2H5EA 4BAUA 1B8UA 3FSGA 4MR9A 3U1BA 4JX8A 2P67A 1RC1A 1GZ3A 1L2TA 5DI3A 5K8LA 2X9VA 4NVRA 3AW8A 5KOYA 1J7JA 2XRZA 2ZBVA 3NC0C 3CBQA 5E7JA 5JWOA 3W9YA 2IUYA 3WQRA 4BMOB 3KIPA 1V7ZA 3GRUA 3TIVA 2R6CA 3F6YA 4O2AA 3IQDB 3WGKA 5BSVA 4GGMX 2VJPA 4HDKA 2Q45A 4A5SA 4E32A 1SOUA 4K05A 2CDNA 4EVIA 1PJAA 4NBKA 4WRRA 5FF9A 1IXRC 2C4HA 3OUZA 1EFPA 1D4AA 1M33A 3LBIA 5EZYB 1RJEA 1THZA 4WNAB 5FLKA 3ZGZA 2A35A 4JVNA 2C82A 1U1DA 3VOSA 2O8FA 3G9XA 3KVVA 2AUMA 2NQ2C 4RLSA 5CVCA 2WJPA 4MW0A 3WMFA 4JBGA 2R3SA 2X0JA 2FPLA 3ZE1B 5BN4A 5KCMA 3EXHC 3HVRA 4XIIA 1SKYB 1ZITA 3EEBA 4YECA 3SLKA 4DA8A 1FU7A 2WYOA 3ECAA 3U44A 2GLUA 2GD1O 2FUKA 3Q5DA 4QATA 2IS1A 1CG6A 2V74B 3GJ6A 1CY2A 3AFIA 4G89A 5LU8A 2BT4A 1H1LA 1DP4A 3UBMA 4A10A 4BO3A 3GARA 2WLSA 3CE6A 4UUPA 2FPKA 1MB3A 4WFJA 2F3UA 5KQRA 1L8OA 1BEZA 2C7VA 4O0MA 2Q8QA 4NHEA 1NVVQ 1YE5A 1U6KA 1F4LA 3CFYA 4U7WA 2WZBA 3DFMA 3WK6A 5KAPA 4M83A 4C3OB 2ADOA 4KR7A 3AVWA 3I45A 4YP9A 3E8XA 4KPUB 4QNRA 3M5DA 4MDYA 4U2KA 4EZBA 3GLSA 1WB9A 2O2SA 2CEAA 2J3DA 4DUPA 3GJ5A 1GHTA 4HPJB 2Z2IA 4UULA 1YR1A 1S8NA 2O4UX 5K8IA 4Q7QA 3ONVA 4KXVA 4M1WA 2YZ7A 4EJ2A 5JQGF 1FSPA 4C2AA 3L0CA 2Q5CA 2YS7A 5FI0B 5LQAA 2HCJB 1NVEA 4YP6A 2Y1CA 2WFLA 2NSJA 4JLPA 3NHRA 4A23A 1A69A 1YAJA 2QDXA 3TI9A 1K8YB 5HTOA 3B70A 1SPXA 2CVOA 3DZJA 5A5GA 1QFMA 3L82B 3NRCA 4OL9A 5KVQA 3GLIB 2NO5A 1L6RA 3QKTA 2J9XB 4YBZA 3S70A 3WL8A 3A6EA 3W4IA 5KQMA 1E3JA 1BCSB 2D5BA 3VU0A 4XUCA 2GCOA 4KZPA 2QTRA 1RIFA 3I3SR 4CPDA 1NBMA 1ZK3A 3ESDA 1EWYA 2G17A 3M5WA 1AKTA 2DPHA 2XMGA 1NLUA 2QTNA 3MW8A 3LCUA 1ZM4A 3DQPA 3BVPA 3BTSA 3JASB 2FQXA 3CM0A 3QIVA 1KVSA 1KJQA 2PGJA 4O4IA 4IQGA 2BKVA 1FTSA 2ABWA 1ECFA 2P6MA 1TA9A 2BP7A 3C3XA 3M33A 3ID6C 3BB3A 2GVZC 4L51A 4H0FA 1CDDA 3O8OA 4TRMA 1LV7A 1QYRA 4E22A 1RYBA 3MGCA 1R2QA 2ZIZA 4EFNA 1G9SA 3MJSA 2CXOA 2AB0A 3C39A 2XDAA 1Q0HA 3R3ZA 1TC2A 2DEUA 2QTWB 2H4XA 3PUVA 4UZEA 3SHFA 2PYZA 4DCVA 1NVFA 5H8WA 1KYYA 1BJTA 1KOGA 1RBZA 3PITA 3VZSA 1BVUA 2ID7A 5ELLA 1KI9A 4YIHA 5BMVA 2PGDA 2PNJA 4JI1B 4OU5A 1E59A 4QGGA 4LFAB 3KZKA 1AQYA 3U7QB 2Q2QA 5GVSA 4KMRA 5J4YA 5FRDA 1JHYA 4G0WA 5BSMA 2HL6A 3QUQA 2GN1A 4GICA 2PZEA 4KSBA 3ZLVA 2C2OA 3LWDA 4HO1X 1W4LA 1FS6A 1QH9A 1QZZA 2RI0A 4LY3A 5DM60 3BXEA 1OWOA 5LD2C 5AJZA 2QM8A 1HZZC 3CKYA 5H80A 4OFBA 3QUTA 4LSZA 1V2GA 4OFXA 4RHCA 5CR9A 1XYVA 2W71A 3KLMX 2FCAA 5AM0A 3CVXA 4MKFA 1SR8A 1ZOSA 5F9HA 5C4GB 4RSHA 3RT7A 4RMIA 4C7XA 4ZEVA 4GVPA 3QPVA 3TW0A 1BXKA 3KB6A 3TQCA 4PYOA 4D5EA 4H35A 2GF0A 2PUFA 3AY6A 3DZFA 3QVUA 5BV2P 3QKRA 3N8GA 3I30X 4W9MC 2G04A 3M6XA 2PCLA 3DYVA 5JFGA 3PRHA 4H6WA 2P69A 2CHQA 2QP4A 4B82A 3K9LA 1SHUX 4WFIA 4I55F 5LR6A 1E5VA 2L69A 3U60B 1Z12A 3KM0A 3L7CA 4MKHA 5K0LA 3WWPA 1W4CA 3RSGA 2ODBA 1ENZA 1RMQA 1OTHA 2AJTA 2ZYUX 1XQ9A 3KFLA 1KH2A 3LY5A 4O2BA 3P20A 5GZ3A 2P90A 5F1YA 3ROKA 3V4SA 8GPBA 4RY8A 4QGBA 4RFSB 1GQSA 1QIKA 1U7HA 3HLYA 3T7RA 3ZZNA 3KRTA 2ZIXB 4GLOA 5T57A 3ZXIA 3FOEC 2B7BA 4DM7A 5EJ4A 5FWNA 3V46A 5DHSA 3ZLJA 4O1HA 4IS2A 4B45A 2O2ZA 1UKYA 3OUUA 2UZ4A 1BEUB 9ABPA 1XO1A 2BRUA 3JQ7B 1EQUA 1WZNA 1XCJA 2ECFA 4RZHA 4JOBA 2VYVD 4URYR 2FFHA 4HAIA 3MCVA 3MTJA 3MJRA 4BE7B 3ZI0A 5CFLA 3V7UA 1LPPA 2ASEA 4CDGA 5CXSA 3ET4A 5AKHA 1WF3A 2B36A 1WULS 3M4JA 1W47A 1MNAA 2JARA 3U7EB 3NBMA 5A0FA 4Q5IA 3O4JA 2I99A 3R4VA 3EZ7A 2KBFA 3PG5A 4V1CB 3O82A 3KUDA 4Y6SA 2BSXA 1QF9A 2ATIA 2C9CA 4M9CA 2H65A 4MMXB 2HSEA 4AI6A 4XIGS 3QMMA 1OBOA 3VPHA 2ZI9A 3X1DA 2ONKA 2F8MA 3WP0A 4RVFA 2NTJA 2ZRKA 4CETA 1U5CA 1AQUA 1ZQ9A 4RZQA 4XEHA 3FKJA 4XGNA 3RUIA 1MXFA 4TZ6A 3ONEA 4Q1BA 3UW3A 2Q3EA 2GBPA 3EZNA 2D7DA 3LUBA 3I6ZA 1LI4A 2FSFA 4UTNA 1LS1A 3HWSA 1FDTA 1P81A 4HUQA 2V3CC 2JLBA 4IZHA 2CLKB 5M2QA 1UT8A 3RT1A 5G0UA 1WJGA 2VZ0A 2FW6A 1XD2B 2HK7A 5FB3A 4RK4A 3TQOA 3BA1A 2V59A 4QAQA 2Y76A 3SBOA 3ESXA 3D81A 4X8HA 1PGQA 4KVGA 4Z3DA 1GZVA 2FP3A 2NYAA 3GEEA 4X66B 4DABA 3OPYI 1KQGA 1A5ZA 3FZYA 3PYMA 2EKLA 1ENPA 2PUHA 3DBOB 1KAHA 1NLMA 2ORIA 4IINA 3SM3A 3CGWA 5C8ZA 5IFKA 3RVPA 1L4BA 1NQVA 1UWCA 1JJFA 2IEYA 2R1TA 3GELA 3W2FA 4TS3A 1L3BA 1IE3A 2XMDA 4PS0A 4AWBA 2VHJA 4RVUA 5F5XA 1FQJA 2ILTA 2NZWA 1Q1BA 2C5BA 4B87A 1FFHA 2RFLA 4AZ0A 3DZDA 2F43A 2R8RA 4CV1A 3AUTA 3GGJA 3PFBA 5AOCA 5IH3A 3VTKA 3IA2A 2XTNA 3UATA 1A98A 2XZTA 4HATA 3ZWKA 2GJKA 2NZYA 2OCGA 3GG2A 2P4SA 3RM3A 3VVBA 4BNLA 2DPMA 3OFVA 4QU9A 3T1VA 1UDAA 4X92A 1TL7C 2RK6A 4DILA 1WMEA 2AC7A 3E3MA 3HUEA 3L8DA 2D5LA 3D6VA 1RI5A 1SU6A 1UK6A 1LFAA 4MQEB 3DH0A 4J3JA 2FPPA 4U39A 2AFHB 3KVOA 2HJSA 5GIPE 1D0SA 1QDLB 4PZYA 3E82A 2DHCA 3TW8B 5LPNA 3NOOA 1AT1A 3RKUA 3MXTA 3I4FA 3Q88A 2EZ9A 4XDHA 4V2IA 1EK5A 2FMFA 3A3PA 4MEBA 4O0LA 4HZGA 4DV7B 3RLIA 4PO8A 5EAIA 1E6MA 2DG2A 3EGXA 4XVUA 1SXJE 2E4ZA 5DK4A 3ASUA 5AVSA 1I3CA 5FBWB 3NVAA 3HKBA 5ESDA 1O95D 5EJMA 2PX2A 2X0IA 4TLMB 1N8KA 2YHBA 1DC3A 4R68A 4CG1A 2RE8A 2QTHA 5BQOA 3BL6A 1ATZA 3GRPA 5EN4A 5I3ZA 4EKGA 2FRXA 2VK2A 1L4KA 5FPHA 3E3AA 3B5IA 1RAAA 5BQXA 3F6CA 4G36A 1MABB 2X40A 3BRWD 1T0PA 3D7LA 1UK8A 1DWUA 1IRIA 1B6RA 1T3TA 3MWKA 2YY7A 3U0VA 4JMLA 3W9SA 2HSGA 1PGNA 1R4MB 4IJ6A 4MVJP 3SI7A 1ADFA 4K40A 1E63A 5JSKA 3TI7A 3OESA 4XWWA 2CK3A 3N39C 3LQ4A 1GG5A 4GXTA 4JB0A 1WMDA 3QKWA 1L5YA 4LZOA 1GM5A 5IVHA 3A9UA 4HWKA 2FWRA 2J0SA 2CUTA 1JIKA 1TU0A 4PPGA 4BC1A 5IF3A 2QUBA 2E2WA 2OCLA 4FOTA 4I99A 2ZYDA 1DUVG 3BAFA 2V8BA 1C30B 2AGVA 3AZQA 3I61A 4P83A 4FS8A 4AIRA 1ZIDA 4G4GA 4W7SA 5KNCA 1Z6PA 1GPMA 1GNTA 1M9NA 2OSBA 3NR2A 4ZARA 1TYCA 1BMFD 2PLNA 3UJCA 3F1LA 2CLDX 2W70A 4QEDA 2AR0A 2FG7C 3PSAA 4IAOA 4IWNA 4REQA 3AJ8A 2IDMA 4X1KA 5GZ1A 5M04A 4YRIA 3I3OA 1YSCA 2QQGA 1SRRA 3KDSE 3OWXA 2O8CB 2WPDD 3ZU3A 4B74A 1CZNA 2W2TA 4ZEXA 3BE5A 1UZMA 1GCIA 2GK3A 3EZ6A 2Z5LA 1YOVA 3R77A 4WCDA 3CURA 5LWHA 4QYIB 2EX0A 4GUDA 1AU9A 1L9KA 4HAZA 2XUKA 2G9ZA 1L7QA 2NO1A 3SFZA 3UJ6A 1NI3A 2BH2A 3A8TA 2CHVA 2GEFA 2XNKA 4AJKA 4R1UA 5J5AA 1HDRA 1LUAA 2SICE 4G67A 2G5GX 4G9BA 4MYTA 4FINA 1YQ9A 1I3NA 4XSHA 1LLUA 1QVWA 2OA0A 4DRYA 4F3NA 4KQ9A 3THSA 3QHPA 1DAHA 3SEZA 1DJOA 1P75A 2ZSUA 3A7DA 3N07A 3O1HB 2W2QA 1M3SA 2QLJA 2WJVA 1WU8A 2P3OA 5D6NA 4C6RA 4AQ7A 3PNQA 2H3EA 1VE3A 2V7QA 3B6EA 1YR9A 3AESA 3RSHA 5A62A 4DCPA 1E61A 4Z9AA 1YRWA 2QRMA 4OXXA 3BZWA 3H8VA 3F73A 2HI0A 4DY6A 1WCV1 3KZXA 4D9KA 4FVTA 4M54A 4WGGA 3TSZA 3P26A 1DKOA 3IB3A 2OGSA 1SKAA 2DBQA 1F1BA 1JDNA 1N92A 2GLTA 3VC2A 2F8TA 1HFKA 4TVOA 3BRCA 4GWGA 4ND2A 3BXZA 1YNOA 2UVPB 3D5QA 1YKSA 5GQSA 2QL7A 2W2OA 2Y93A 4FI3C 4TTQA 3V2IA 4A2CA 4XIJA 4D02A 1T5DX 1E5QA 3RFTA 1K0UA 4Y2PA 1QH1A 1IN1A 4LYAA 2HM7A 4TL8A 3KOWA 2OBLA 5EYPA 4CLEA 1LVHA 2CLHB 2EFGA 1GGEA 1GPBA 3L4BC 2C7PA 1YB4A 5ES3A 3H5TA 3REGA 9LDBA 2K6GA 5F76A 2M98A 3MD0A 4B7XA 1TGVA 1UBUS 2IZZA 13PKA 4PZUA 5AM2A 4G5SA 4GKKB 4Q34A 1DO8A 2I1LA 3QEJA 2BBWA 1E8MA 4AO7A 1JMKC 5I9BA 3DB2A 2PIDA 4GQBA 2QV0A 3H2JA 1SUCA 4X45A 4Q9IA 5IVPA 3NYIA 3AYZB 1XAJA 3L4EA 1ZD1A 4M6WA 2OYCA 821PA 5BSKA 4HS4A 1M6WA 5CVJA 3NU1A 3UMGA 2GYWA 2VNHA 1U99A 2O9JA 3AO0B 3OIFA 1SJ9A 2IEDA 1EVZA 3QJYA 5B58T 5TPWA 1M73E 2XDQB 1MU0A 2C5LA 1YJAA 2ANCA 1JE0A 5IKEA 2YXPX 5T6BA 4BJ1A 1Y5NA 4K86A 1ZCFA 4IHJB 4PXSA 1GSIA 4MB0A 4C6TB 1O5TA 5JAMA 4LMRA 1PSWA 5DSXA 4LRUA 1PEAA 2J08A 1DAGA 2ERYA 4RPKA 1YI8A 4EW6A 5KDOA 4LK2A 4LVNA 1HYHA 3SQDA 1CUXA 5IXSA 4NULA 5NULA 3QW4B 1GSAA 5G2OA 2EZ8A 2VPQA 2XUZA 4O4HB 1KYIA 5ALIA 2BGGA 5TY0A 1G8FA 3SOZA 2EQAA 4PC2A 4I6GA 4KDFA 2BFCA 4BNDB 4TT3D 4WI1A 2HJWA 3A1EA 1ISSA 5KQLA 1RWQA 4FCWA 4O4JA 2OV4A 1Z7EA 2D8AA 3H9UA 1O8BA 2JBAA 4JCOA 1KMMA 5DTEA 4KO4S 1L4FA 1G38A 1NAHA 1P5FA 4LC9A 4AJIA 4NOLA 3T4XA 1KNXA 1JI3A 1LD3A 2EVWX 3BDIA 3DW1X 4HAOA 2QLBA 3A4IA 3AB3A 5DP2A 1EFRA 5J5CA 3ZE7A 4EG3A 1I8TA 2PZLA 4JYBA 2G4LA 2V96A 5B57C 4LOHA 2VDNB 2CLEB 1PR0A 3AU8A 4YJHA 1RQXA 5HZKA 4RC9A 1VI2A 2AXEA 5CURA 2K7FA 2GF9A 2ZCJA 2FW7A 4HQLA 4M1ZA 4WLVA 3ZWMA 4BQFA 5AKXA 5CIYA 3IV6A 3QFTA 4GX2A 1Z6XA 4TMYA 2CNDA 1WPXA 1PZHA 2MMGA 2XITA 2Y1OA 4PIPA 4LQLA 3E9YA 1D2RA 2C4TA 3RVDA 4OYLA 3LW8A 4V0ME 4O1IA 1PCXA 1RHKA 1MDBA 2NP6A 3ZIAA 5DB4A 3THWA 1WP4A 1N2JA 3FWZA 3QV1A 3GJQA 5CT4A 3ZZUA 1I4EB 3WAGA 2AOUB 1U63A 3LVRE 4IDHA 1YI0A 1JEYA 2ZOSA 3DCNA 3VPGA 1ZOOA 2OPHA 4CM7A 1R8SA 5CEEA 3OQJA 4Q16A 4U3JA 2EFJA 1SXPA 1FLNA 1FYXA 1W5BA 1ZEMA 3VI3B 2Y0EA 2VO1A 1Z29A 2C58A 3GP8A 3IOMA 1J2UA 3UANA 1PT6A 3NM4A 5D1NA 2PWAA 3C97A 3IC5A 1LSSA 4G97A 3WO1A 2CXSA 1FC0A 1Q74A 4OV6B 1EI9A 1OI3A 1IZ9A 2G76A 1O6FA 1Y33E 4Y1RB 1VPTA 3I5UA 1GTRA 4M9UA 1RWNA 1G0OA 1VCIA 2AFVA 5FNVA 4BX2A 2IFTA 4ZGBA 2GAAA 2VAXA 1R74A 1N33B 3ABIA 1U7DA 5LP6C 1ABEA 1G59A 5EEGA 2DMRA 1WSDA 5LA6B 1HKUA 3C3YA 2Q6KA 1X19A 1SBZA 3S5UA 4QXOA 4WV3A 1E3TA 4DLXA 2AJCA 4DUZB 4JJAA 2YMQA 1G5HA 4RTQA 2EQ5A 1HZJA 4H1TA 2YW2A 3ZDYB 1Y6RA 1OA0A 1U2GA 2F9FA 2IEAA 4JEIA 4RHXA 1M2HA 5K1ZA 2XGJA 1D2CA 4M7RA 4DN6A 1YC5A 1XLWA 3IULA 2XUQA 4ZC1A 5JCPA 3ER9A 3QOXA 5IDYA 3P4UA 2FW9A 2FWJA 1AQNA 1NJ1A 4Y98A 1OU4A 5KWJA 3GAZA 4IEEA 1CQIB 1OMOA 5HFNA 3SICE 4MJ7A 3B9PA 5ICFA 2Z08A 4R8SA 4CNBA 3CPEA 3PIIA 3U4MA 4KHPB 1FFWA 2HQOA 2C77A 2PYDA 4B3GA 3ZGLA 3R7BA 4ER7A 3B89A 4WJZA 3OOWA 5H1YA 3E5HA 3NJ8A 1Z6GA 1E1QD 4DLYA 2OK7A 3WICA 5TEVA 3M5CA 4Q3LA 1BHJA 2HXSA 1JTVA 3K2QA 1FPQA 1PD1A 4CLOA 1FFXA 2YUIA 3FTFA 1PJBA 2PVCA 2AFIB 4KQFA 4R2MA 4JI5B 3WLIA 4B7AA 2VTBA 3FKQA 4OIFA 1QOZA 4LRXA 5AD1A 4UTVA 3EULA 2WNIA 3GEBA 1N9GA 1TX4B 4JB2A 4PG8A 4FP9A 3E1KA 1JDZA 4ECAA 2ZCUA 5GM2A 2XF8A 2XKBA 1T1JA 3FPLA 3VYUB 4RPIA 2NGRA 1V9SA 4H4EA 4PYMA 3TAXA 1BIFA 2Q0QA 1H6CA 1PTJC 3LRXA 1N4AA 1TF2A 4G65A 2A58A 4CMBA 2DULA 3V7WA 1TAQA 1ZWKA 3VV2A 5MF6A 3WS7A 1ZAKA 1Y3DE 1E1RD 4YRAA 1WW3A 4H7FA 1AB5A 5HSGA 4BKQA 1P4SA 1NY6A 3M70A 1P3DA 1QS0B 1SOWA 2RC5A 3GRAA 2VQ6A 3I37X 2C7GA 2H1SA 5AXAA 1ABFA 3JAWA 1FMJA 1ECPA 4UW9A 3CZCA 4WPGA 2VP6A 3HRKA 2V98A 4HLCA 2IKQA 3U0BA 4DBZA 3MA0A 4EW3A 3A9TA 5B6IA 4F21A 4IOLA 2ZRIA 1COWA 4MGZR 5KPJA 4Z8YA 2ZSIA 3GFGA 1SG6A 3HP4A 2BFDA 3EYAA 2DLNA 1NASA 1E3SA 2BGNA 3WK9A 1FX1A 4AX8A 3WAKA 1ZHHA 3WDLA 3TCNA 2FWMX 3S4YA 1MRSA 1V3VA 3P9RA 3RODA 4NE7A 2A67A 2M6RA 1NBEA 1CR4A 2VWQA 2ZVPX 3EFHA 4XVRA 5GPBA 1WHSB 1ZOLA 1U98A 3K8ZA 4QUEA 3UIEA 1DO0A 4PFKA 4EG0A 2GRAA 4GYKA 4OY3A 4KR3A 5IAOA 2PH3A 3FLAA 3QVSA 2WZCA 1NR7A 1GPUA 1X80B 1U81A 1GOTA 3E22A 2YIJA 3TXYA 1DAKA 1JYFA 2FPWA 2JEOA 3O8DA 2ZYAA 3PXAA 5CT9A 7ABPA 2BZ0A 4E88A 4CQLA 4HBZA 3R7AA 2IX9A 2FR8C 2I22A 2H00A 1ODFA 1TUEA 2JANA 3FVRA 2NUTB 2KPOA 3INNA 5JSFA 1H2WA 1EK1A 1F1JA 3WJ2A 2X1VA 4DMLA 5E4JA 3NORA 2NU6B 3BE4A 3K0FB 5FXMA 2W6QA 2PY6A 3H2KA 3MRVA 2ERCA 3GROA 3I12A 1X13A 2NO7A 2CMDA 3HVJA 3CX8A 4ME6A 4MZXA 4R2XA 5LZ8A 4MS4A 3D7KA 1BXGA 1HEUA 5EP4A 4B6GA 1SC1A 3A3KA 3DCYA 4GI1A 5KTKA 3STVA 5HS4A 3MJFA 1XZAA 4DIMA 2ZJYA 3LVQE 4B3RB 2CXQA 2X2OA 4R69A 1EEXB 1JGTA 1X7YA 1QONA 4ZIRB 3VH1A 3ZDFA 2GZMA 3D02A 1YZUA 3DHEA 2PRKA 3NHPA 3NX4A 4WLOA 3FNBA 1WY5A 3KXDA 3VJLA 4YWHA 5K3FB 4J9UE 1LK7A 3H6GA 2A1UA 2A4KA 3OFKA 4L3OA 1QXSA 2GD6A 2PD6A 3GFTA 2NT3A 2IUFA 5L40A 1KU6A 4FYIA 1J6UA 1IQUA 4HDNB 1OFHA 3OP1A 1HQYE 1KJ8A 5CM9C 5LUBA 3KQNA 1XZLA 1FSSA 2XNHA 1WW8A 4PX9A 5C5IA 2VP2A 2YR0A 1JAYA 2JH8A 4MJ3A 4JJKA 3VR4A 3D6FA 2G1UA 5ED0A 4L9SA 3IVAA 3AB8A 1UOQA 4KRFA 2JIZD 1BDHA 4RZSA 2FMTA 2I3ZA 3IP5A 4RHFA 2WRZA 1HX7A 2D5AA 1TO1E 2PN1A 4OXQA 1NJ2A 3UN1A 1KEZA 3DM9B 4BV9A 1K0FA 4IV0A 4EP1A 3H1PA 4AZWA 4XM0A 1ZH4A 4H6PA 2OHIA 3GXBA 4WXHA 1OH7A 2VRCD 2YIDA 3D6MA 2ZQ5A 4LVCA 1NUQA 4UTRA 1AE1A 1XT6A 2JLSA 1TYDE 2FWPA 1ODIA 3B48A 1C9MA 3QWIA 3KTAB 4NCHA 1Y8QB 5K0NA 1ZRMA 5IBCA 2EW2A 3BCUA 4PGGA 5IT5A 1YQEA 5B58C 1BFKA 4IG4A 4UM9D 4AXXA 2QZZA 4Y2QA 2X2PA 1LPOA 4EGAA 2IH5A 1QTIA 2JJ2A 2PS9A 3DL4A 3H99A 3LOQA 4GG1A 2X5KO 3HVHA 4K03A 4QC2A 4W1QA 5A6VA 2QYHA 1D2GA 2J9GA 3I8OA 1I14A 1WEKA 2CHEA 3H5RA 4RDHA 4LTDA 4ENPA 1CLEA 4A8JB 4AULA 2E4VA 1UK9A 3ZE6A 1FNMA 1QGAA 3KWFA 3E15A 4Y0AA 4CUJA 3EGDB 3KWLA 1T4MA 5DT2A 2QU8A 2QSUA 5HRUA 2B4KA 1IB6A 2XLCA 3H1FA 4KC0A 4E5MA 3CVUA 2YFHA 1MQAA 1SVOA 4LDAA 4ETNA 5IDWA 5LSAA 1HG0A 2VNAA 1USKA 1X8JA 5IUKC 4BMNA 3W3AD 4HVLA 5ARBA 5JPDA 3KX2A 4PX3A 1MAHA 2BJVA 2JIQA 1FP7A 4J3FA 2N46A 5B1EA 4XWAA 1TM4E 1PWZA 3BXHA 1KAGA 1J2YA 3MJCA 1BXZA 2UV8A 5HM8A 3FHLA 5KYUB 2YICA 2J6IA 4JEMA 4YP0A 5DNEA 4C9BA 5EKDA 1SCNE 4G0QA 2JH3A 5KNDD 2G72A 3DFKA 3UW1A 3D0KA 1KFJB 2B8NA 3NB0A 2NU8B 2CE7A 3KAQA 4P7BA 1C3VA 4IJVA 1TIPA 3ZCRA 2HCBA 4O5OA 5A6SB 4IEFB 1MORA 3ZWYA 1Q0SA 3QBEA 4N03A 1DIGA 2DCUA 2Z2XA 1YZ3A 4MB2A 2E18A 2DQKA 3AEUA 3O2NA 3MF4A 3OZWA 4G0PA 3PUJA 1QFYA 1U2DC 1DFIA 2XTAA 3OT1A 3G89A 4LKOA 3ZTWA 3E58A 2QW1A 5M7EA 4GZLA 1FFGA 3OM9A 4IXTA 4B7UA 4X0EA 3FDJA 4FLFA 2QQ5A 1A7KA 2DM6A 2NZUG 3FTNA 3JV7A 4YRPA 4BN4A 4LRQA 2AW3A 4FFOA 3DD1A 1B6GA 1C7FA 1EB8A 2WFAA 2JIMA 3ZHTA 2NG1A 4CQMD 5IP5A 1MIOB 5FDFA 2WM9B 4QFDA 1XDGA 1E2QA 2NV2B 4V02A 5TRTA 1I2DA 3WISA 4ERNA 3ODPA 3OQMA 3LT0A 1PRYA 2CYBA 1ZZGA 1B4DA 2G06A 1ZMRA 3BIOA 4Z9YA 5EZ5A 1W49A 1HT2E 2A5GA 3IAM6 4UDOA 5LYYA 4WNCA 3HB9A 3QF4A 3VX3A 2YIVX 4UHBA 1GTJ1 3KPWA 1L7EA 4FT2A<