3CZ5A

Crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
141
Chain Sequence
b'STARIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIEATRHIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSPDIAQEIAEERVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component response regulator, LuxR family
publication title Crystal structure of two-component response regulator, LuxR family, from Aurantimonas sp. SI85-9A1.
rcsb
source organism Aurantimonas sp.
molecule tags Transcription regulator
total genus 51
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cz5A00
1ABFA 2LPMA 3GBVA 3JPWA 5DCLA 5T3YA 3TO5A 3LUCA 3HV2A 4Z4CA 2WB4A 3IP7A 2QXYA 1J56A 4YV7A 4NCAA 2L19A 5EWJA 3H5VA 1JDNA 1JYEA 5EWLB 2PAFA 1KMIY 3H5WA 1YMVA 3MQ4A 1D1QA 5FWYA 1SXGA 1DBPA 4JB0A 3DGEC 4O1IA 4XARA 4G97A 3RQIA 1RNLA 2L17A 2MYNA 3K9CA 1VLZA 3BREA 1BVHA 1RXEA 2H3HA 5FWXB 5IEBA 1W9HA 4RXTA 1JH9A 4QYWA 3I42A 1ZY2A 1Z26A 2E4ZA 4LE2A 1E2BA 1LBIA 3O2QB 4EVSA 1DBWA 2FKAA 4UHKA 4ZYLA 1RPJA 4UHJA 2JK1A 4FB4A 5BQ3A 1DCFA 3FFTA 4F3TA 4RDCA 1QQAA 4EYGA 3FFWA 4FE4A 3GT7A 3QLVC 4CBVA 3GL9A 1TM2A 4YR7A 1BA2A 2FQWA 1KRWA 4KREA 4RZSA 1E6KA 3VNAA 1NXVA 3DGFC 3IP5A 4N76A 2QW1A 3KHTA 1M5TA 2P4UA 2IKSA 1FFWA 1JL3A 1OXBB 1QMPA 1SD5A 1U8TA 2FEPA 2A9QA 4LX8A 3EQZA 4YGXB 3OQOA 2PUGA 1DCMA 2WJAA 4KNYA 3BBLA 3SNKA 1Z15A 3QEMB 3CFYA 3QX8A 4ZPJA 1L5ZA 2FLWA 3T95A 2GI4A 3C6QA 3TB6A 2NT3A 2GWRA 1T34A 3LUKA 5CHYA 5EWMB 3LUGA 2AYZA 3M9XA 5TQ2A 3W9SA 5JNRA 4RK5A 4ZMSA 1VRVA 3C3WA 4JAVC 3L6UA 1QQBA 3CLKA 5HM6A 1NXSA 1KRXA 3FGZA 3LFTA 4EUKA 2HPHA 9ABPA 3TD9A 5IULC 4PYRA 5IX8A 3H5TA 3M6MD 1MB3A 1RXIA 3HK2A 3CU5A 2XDYA 5TPZD 4Z4IA 4TLMB 3DZDA 1F51E 3O74A 4Q6WA 2JBAB 4MRMB 3LKBA 2GBPA 4KQ9A 3QELB 4LDAA 2B1JA 1ISRA 1ZDMA 4Q6BA 3O21A 3HVRA 4JOQA 2LP4Y 1Z2DA 3FMVA 4YO7A 5E3JA 4LZLA 4LRQA 5KWSA 1LBHA 3H1FA 1YIOA 2E4YA 2P9HA 5DKFA 3UKJA 1FQWA 1CEYA 2R48A 1XHEA 1DJMA 1ZH4A 4KPYA 4N03A 1YVUA 3MA0A 5IUNC 1DBQA 4WXEA 3CHYA 4XXHA 4WZZA 1JHZA 1P2FA 1BDIA 1YS7A 2X7XA 4MS1B 4L85A 4D74A 4MQFB 4Z4FA 4Z4HA 4LDZA 4RV5A 5PNTA 3HS3A 1EWVA 4HYEA 4MPTA 1R8JA 4IF4A 3JY6A 1MB0A 1DG9A 3F6CA 1ZHHA 4NCBA 3OQMA 2IPMA 4Z9BA 1A2OA 3MYYA 1MIHA 3KSMA 3EGCA 1ZVVA 2H0AA 4QYMA 1SXIA 5JNSA 2IOYA 4XFKA 3OO1A 1NTRA 4NQRA 2VYCA 4IMJB 4QICA 3SY8A 2QZJA 3HDVA 4OATA 2N9UA 2Q5CA 1ISSA 3F6PA 3JVDA 2WY2D 3O1HB 1LK0A 3KS9A 4TLLB 1I3CA 1RZRA 3H5LA 4S04A 3OMXA 1DC7A 3EULA 3QEMA 4W5RA 4DN6A 3H5IA 2IPAB 4PICA 3SAJA 1WETA 5TQJA 3OLVA 5JNWA 3L49A 5DGCA 5C5EA 5TE9A 2ID7A 3Q7SA 5D2CA 3F73A 4FE7A 1QO0A 4MS4B 4KVFA 2OENG 4D6YA 5EWMA 1UDRA 2VUHB 3CKMA 3DLHA 2PE5A 5KQPA 4KQCA 4ETIA 3IDOA 8ABPA 1PEYA 2FTKE 5KQMA 4D6XA 3N0RA 5KQGA 2PLNA 4MR7B 2FEKA 1U2PA 2WWVD 4YP9A 4MGEA 4MYRA 4IILA 3RVJA 1JDPA 3CRNA 4DADA 4TN5A 2LBPA 2RJNA 2VK2A 3KCNA 2DRIA 4RKQA 1JYFA 2RGYA 4LE0A 3OM1A 4E7OA 2A9RA 4N0PA 3H6HA 1GUBA 3G1WA 1LJLA 3VNBA 4OLAA 3OLXA 4MR8A 2QR3A 3QELA 1AB5A 3O2SB 4PZ0A 4ZJPA 2IPLA 3RH0A 4Z99A 4EYKA 3LUAA 3FDFA 1EWTA 3G85A 2V0NA 1Y1LA 2QU7A 2R25B 5FBKA 2PUFA 3O1JC 4KK4A 1YK1A 5KC9A 1QP0A 4WXMA 4W5QA 4JASB 5CNIA 1DP4A 3URMA 3N53A 3N0WA 4WT7A 5CNMA 4F11A 5B3JA 3MIZA 2YHAA 5IUJC 2MYUA 3RVMA 2JB9A 4MQEB 3FFXA 3JVIA 4F8JA 4MS1A 1NY5A 1JLKA 2VUIB 1NATA 4H60A 4RWEA 3D8UA 3IPCA 1GUDA 4ML3A 5CNJA 4Z9AA 5I4CA 2MSWA 1JF8A 3JPYA 4EYQA 4LE1A 3A0RB 3NHMA 5JNTA 1D2AA 4WWHA 4KMRA 2RJOA 4KK3A 4PEVA 1PEAA 3GYBA 1NXWA 3ILYA 3HJFA 3O2JA 1DCKA 1GCAA 1U04A 2PMCA 4H3HB 1K68A 3N75A 1C4WA 5BRAA 2FN8A 4MLCA 1JWLA 2CD7A 2L2QA 2BGGA 2FLKA 1ABEA 2JVIA 2LUOA 3T38A 3QLTA 5TPWB 3H5OA 1A0OA 3JTEA 1Z17A 3EDCA 5C5CA 4MLDA 3KYJB 1QP7A 1DRKA 1D5WA 4MS4A 2NZVG 3A3KA 1C0EA 1EHCA 2FN9A 3LUJA 4RK4A 5EWLA 1BDHA 1USGA 3EODA 3A10A 4G0YA 2I6FA 1ZGZA 3H1EA 4HNRA 1SXHA 3Q9SA 3UK0A 5B3JC 4N41A 1CYEA 3OM0A 4RU1A 1U2QA 5FWXA 4Z4GA 1USIA 2RDMA 3HCWA 1SRRA 3Q7TA 3QEKA 4RKRA 4EY3A 1HEYA 4MAAA 3ILHA 2OQRA 4G86A 3P9YA 3ROTA 3MM4A 2PJUA 1JBEA 2M1ZA 3NNDA 3I45A 3I5AA 4RSMA 2R47A 3LOPA 4RXUA 1BAPA 5IUKC 1BDJA 1Z2EA 3CZCA 1XWWA 2YHBA 4OBBA 4B09A 2MYPA 2LIVA 3EJWA 1W25A 2NT4A 3LKVA 3KJXA 2F8TA 4OTZA 2QVGA 2QVCA 4XAQA 3JS5A 4PE5B 4EVRA 2O20A 4EVQA 3MMNA 3BRSA 3GBPA 4OG2A 5IEJA 3QX9A 4H3KB 5GQSA 4NICA 3N6VA 3RVOA 2WRZA 1KGSA 2W42A 3OQNA 2J48A 3RVLA 5GOTA 3OMWA 2TMYA 3TX6A 4G0ZA 1YTUA 4G0QA 5BR1A 3EAFA 2HJ9A 2IDMA 3NNNA 1IIBA 3LUFA 5JNVA 3M9WA 2PL1A 3BRQA 2FMIA 1JFSA 3HXMA 3KLNA 4JA2A 3NBMA 3H6GA 3KYIB 2FW0A 4P98A 1GLGA 2CWDA 4YWHA 1RZRD 4F12A 1OXKB 4XLTA 3D02A 5TQ2B 4YRZA 3CG4A 3R0JA 4GNRA 3BILA 1YMUA 4RY9A 1M2FA 3SQNA 4YLEA 4RK0A 1YK0A 4RK1A 5HKOA 4W5OA 1FFGA 3KG2A 3RVSA 4ZMRA 2QSJA 2WJWA 3HO1A 1TJYA 1EWKA 1PUXA 5TPWA 4KRFA 5HQJA 1JX6A 2CHFA 3C3KA 6CHYA 3NNSA 2PUAA 4DQDA 2JBAA 4MRMA 2FQXA 2JVKA 2E4XA 3C3MA 3GRCA 3OO0A 1APBA 1MVOA 4N0QA 6ABPA 1P6QA 2E4VA 2MSKA 3OLZA 2B4AA 5ABPA 3LUDA 1TMYA 5BRJA 3IP9A 4GPAA 2MSLA 2PUEA 3O75A 4G0XA 2HQBA 4HNQA 5JS2A 1EAYA 2FXIA 1B00A 4L4UA 3Q15C 1Z25A 1Z12A 2IPNA 3OLWA 5TQ0B 5JS1A 2M98A 4EGSA 2PUCA 3MF4A 3HZHA 5DTEA 4OLBA 2CHEA 5FBHA 2FSPA 3HUTA 3KTOA 4MQFA 1XHFA 1VPWA 2JVJA 2GX6A 4Z4EA 3LTEA 4Z0NA 2F8SA 3HM9A 2FEWB 3GA5A 4G0MA 3K4HA 4YS6A 1TVMA 4HNSA 2PKXA 3RVPA 4W5TA 4XASA 5KC8A 4ETMA 4G0PA 2JCGA 3I09A 2E4WA 4MS3B 1FFSA 4MR9B 2KYRA 2AYXA 1Z13A 3DLBA 2HQRA 1DC8A 4O5AA 1FSPA 2FQYA 5IC5A 1PHRA 3IP6A 3HDGA 4NV3A 4RK7A 1QP4A 2FMHA 1A04A 2HSGA 3HUUA 3N8IA 3RVRA 3CNBA 2IYNA 1D4ZA 3Q7RA 3E61A 5KI6A 3T6KA 3UUGA 1F4VA 3NHZA 7ABPA 3OLYA 1M5UA 1H9CA 3IPAA 3RVNA 4IRXA 1E6LA 1Z16A 3EQ2A 1DZ3A 2FMKA 3HEBA 3O1IC 3QLUA 4RK6A 5EWJB 4EYOA 4WUTA 4W5NA 1ZITA 3F7NA 1TLFA 3DBIA 1E6MA 5FWYB 2FMFA 3B2NA 4O1HA 2JRLA 4IMIB 3ROFA 1P8AA 4N47A 3Q41A 4M88A 4IGAA 4RXMA 1USKA 5TPZA 4MR7A 1NXOA 1GCGA 1JFVA 1ZGGA 3CZ5A 3CS3A 1DRJA 4G0OA 3LUHA 1LJUA 2GKGA 1M2EA 1P6UA 4ETNA 3SM9A 4KV7A 3S99A 1AB6A 1YS6A 2A9OA 4E7PA 4MR8B 5F64A 4RS3A 5IBQA 2L18A 1ZH2A 2ZAYA 1VKRA 5DLEA 1ZESA 3QK7A 4JB2A 1U0SY 5T7BA 2ZWMA 4Q7EA 5KQLA 1NXPA 1D1PA 1Z18A 4KFCA 3H1GA 2R4QA 2QV0A 3A0UA 1L5YA 4S05A 5HSGA 1PNRA 1QNLA 2PUBA 3HSYA 1NXTA 5TQ0A 1K66A 4YCSA 1QPZA 3SG0A 3RVQA 3CG0A 3TMYA 4MQEA 4QPJC 3QLUC 4F06A 2PUDA 3GWGA 2FVYA 4RY8A 1PNTA 1CHNA 4JP1A 1EFAA 1QKKA 5JNUA 3T8YA 4TMYA 1ZN2A 5CNKA 3N0XA 1ZAYA 5ED4A 2MYTA 2WMYA 3KLOA 4MR9A 4MS3A 3GV0A 4RY0A 4KZKA 3LMKA 2PL9A 2ID9A 1JFTA 3E3MA 3H75A 1NXXA 3RVKA 3QLVA 3CTPA 2HQOA 1QO0D 2E4UA 1URPA 4Y9TA 3KKEA 4P1ZA 2NUBA 3C97A 1MAVA 2A9PA 1S8NA 2NZUG
chains in the Genus database with same CATH superfamily
1RJDA 2AJCA 2EHJA 4MW0A 4OSPA 1QVAA 4V0SA 4BAUA 5BV8A 2ON6A 4TLDA 4EKEA 3H2YA 2NTVA 4LOHA 5FR2A 2Q9UA 5C1DA 1YL5A 4X7RA 5DYIA 3S5UA 3NHJA 3DEKA 2EHDA 3NYWA 1WMEA 4W82A 2WOJA 3PZRA 1HF3A 2A9JA 2WF8A 4HRXA 4RTSA 3EW9A 1D1QA 2G9ZA 1VIYA 1IHYA 3OPXA 2KI5A 2WD7B 1UF9A 3ELBA 4N3AA 4NYMR 3IXMA 1Y8CA 4MI1A 5KJ6A 4LDQA 3V4OA 3PRKE 4HRAA 5FWXB 4HQNA 3JQ6A 4HNAB 3ZVLA 1DBRA 3OQVA 1E69A 4RQBA 4FINA 1HZZA 1Q21A 1VP3A 3CR8A 1RWWA 3GCDA 1BRTA 2YBEA 5SZKB 3UPDA 3I42A 3SMQA 4XJSA 3AIKA 2HF7A 821PA 2VN8A 4I1YA 3RJZA 1O97D 3UJBA 1M2WA 2Q2QA 3N2ZB 4KDFA 5AVWA 1YJAA 2NUPA 2PS1A 4ARZB 2QORA 1WQ1R 1ZGAA 2R1VB 3GUUA 1T1SA 2P2DA 4OJYA 3WO0A 2O2JA 3IMGA 3TW8A 2MT9A 3EXFA 5F9FA 5B1HA 1A9RA 3RBAA 1NF3A 1TZCA 4ZOEA 3JQAB 2Q5LA 1EX6A 4NPCA 5BMOA 2ZSJA 1IN7A 2P0AA 4F9GA 1RLTA 3OH8A 4HB0A 3LHSA 4C6RA 4ZT2A 4L4XA 5KWVA 1NXVA 1ZKDA 3UT5A 2CNDA 2OMKA 2E49A 3VUFA 5FA6A 2B1IA 3LYAA 1XOIA 4YRJA 4YAIA 4GM0A 2AA3A 3E15A 1JEQB 2QL5A 4AT1A 3KQHA 4BBPA 4QECA 4KNYA 2WP0A 4JI2B 3BXGA 1TYZA 4UDOA 2GASA 4U2DA 2XUZA 3JQCA 3GAFA 3RC8A 1TK2A 5L51A 3B6JA 3SHOA 3M1YA 1RQPA 3GGJA 1FDIA 3REOA 1V1MB 1ZICA 3VPXA 4TQAA 4Y9SA 1QIIA 4BO0A 2I54A 2BISA 3IUQA 2IH4A 4XIYA 1G16A 1W59A 2COKA 1R6XA 1N32B 3TG2A 3PRHA 3UV6A 5JNRA 3TM4A 1E1DA 3N7TA 3GA7A 1RHQA 1G1AA 1SUAA 1ZA1A 2W7TA 3QUSA 1WA5A 3WKAA 1G8YA 4BB5A 5KYGA 3AFIA 4DYVA 2DPMA 3CWQA 3DYIA 3EFOB 4CEIB 4E12A 1HE2A 1WUKS 4WEQA 3KEFA 3TD9A 4G6ZA 3T7SA 1A8HA 4HVLA 3H5TA 3FPHA 4OHBA 2FQ1A 5CYFA 1RLOA 4OMUA 2PGNA 1OXUA 4KX5A 1J0BA 2CFCA 4E32A 2XECA 2C5HA 5LR6A 3K53A 1D09A 1QG6A 2H2WA 2JLRA 2CLCX 4QSMA 1GG9A 3WSWA 3DTNA 2XMPA 2DUUA 3QQPA 3D7RA 1Z2DA 5E7MA 2ZPAA 3FMVA 3IUBA 4G9BA 2QWXA 3OVMA 5FWDA 2V58A 4DRZA 1Z5OA 2A0KA 1G2IA 4EKDA 1I1OA 1WHTA 1YJBA 5LA6A 2IS1A 1C7JA 2GN0A 3GJXC 2ZJFA 1G0NA 1YC5A 3KJGA 1HQCA 4FFRA 4A6PA 2DWCA 5AHRA 2C1ZA 2A6PA 4PPFA 4CV2A 4TUYB 5IJWA 1M6EX 4FP9A 4F86A 3DHYA 3N05A 4W6ZA 4RO0A 1VJRA 4JP2A 3O4HA 3LHKA 3UXYA 3PNMA 2VSQA 3F6RA 4LDZA 3WDMA 4DNPA 4Z4FA 4FZVA 2R2GA 4R31A 2ATXA 3TIFA 1QK5A 2BFEB 3J80A 2ZBUA 1YRLA 5F9MA 2PL5A 2UUOA 3FXAA 1ESZA 1MIHA 3OE7D 4TXLA 5K8VA 3JD4A 1AN9A 1PQYA 4ONEA 3B5JA 3DBVO 3EPRA 2H0AA 4LJ9A 1NBIA 4R4JA 4EECA 5BQFA 3KZMA 2ZSDA 3E2IA 1U2EA 2WV7A 4PO1A 3U7QB 4M37A 1XLTC 1ECLA 4UOEA 4OATA 2JLXA 3RIYA 4MYDA 2Q5CA 1ISSA 3EJ6A 1MV8A 3OPYI 3O1HB 5KUTA 2GVDC 1OX6A 4ALIA 5J2TA 3VISA 2XTMA 3AEKA 2Q8NA 4ZRDA 5KWEA 1Q1AA 5FNVB 1VSTA 2JGIA 4BKQA 4PC7A 3SSMA 1WNTA 1R6BX 2NOAA 2R0QC 5DGCA 2W6IA 4Q4CA 2EFJA 2PBRA 3L7OA 4DC0A 4DJFC 1LRJA 1UZMA 4D5GA 3ISTA 1L7EA 3MCAA 3ENNA 1PRYA 4L9RA 3T9EA 4II2A 1VMKA 3FHJA 5K8IA 1C2YA 3T9CA 2FPKA 1ZJ4A 4B4VA 2VP6A 3R3JA 3O1LA 2FTKE 2ZYIA 3AR8A 4JLWA 3EIEA 4AYTA 2WFMA 2QL9A 1PR9A 4YHHB 2EBWA 3OSZA 1IC6A 4P2BA 4RESA 2VA8A 1JECA 1VIDA 2IUEA 3Q6NA 3QVGA 5KJ1A 4E7OA 1I2CA 3DJYA 2F48A 1U3UA 3CE9A 3STXA 3NT4A 3L1UA 3EXEA 1RAHA 4U2BA 3ICCA 4DR6B 1XVAA 3PFCA 1V71A 1I51A 4FC6A 4PLYA 4OYHA 4QARA 3LZCA 5F52A 2QR3A 4ZT5A 3VBEA 1K08A 1A9XA 2Q6VA 3AY6A 3H11B 5H16A 1JDBC 2DQZA 2XGOA 1KI4A 5LXTF 2OB2A 4LMAA 1COWA 1Y1LA 5CM9C 1X8XA 2PUFA 3KJQA 2AG6A 4M2LA 4JJ6A 1RP7A 3PC4A 1DRUA 2ZTMA 4G25A 1RM0A 5KX5B 4PQGA 5CNIA 1LTQA 3DL0A 3SJ7A 9MHTA 3IP8A 5GJBA 2VUTA 2OXEA 2FX5A 5B3JA 1RPAA 1TD9A 2YC4C 4I1PA 3VGJA 5G4KB 1SB9A 2A9FA 1IM5A 1P2UA 1ZYUA 3LP6A 2PX5A 1O8BA 2I03A 2X13A 3IB3A 4QDXA 5TGTA 3TOVA 3IOCA 3BM5A 2NO7A 5L3SA 3A2LA 4R3WA 1ISJA 4Q9DA 4DY4A 1NW6A 2W6CX 2Q5QA 1IEWA 3E8XA 1VOTA 5BO5A 4EJ2A 2WHPA 4KPEC 3W5AA 1LSJA 1OU0A 3A0RB 3CLSD 5A1JA 2NXCA 5JS8A 1PT8A 3OZBA 3ZDDA 1EIWA 3IALA 2QIOA 1K88A 1SUCA 2GNAA 2J5RA 2YV1A 4Q3CA 4MO2A 4DMHA 4ISCA 1F48A 1MO3A 2FWJA 1R8XA 3HJFA 1MRSA 2YIVX 4K6CA 3UMRA 1WPQA 2Q2NA 1JDSA 2GN8A 3Q0TA 3OZVA 1YCFA 4YAFA 2IV3A 1MFPA 1C14A 1CUZA 5JPIA 1JPJA 4EI2A 4ECEA 3TECE 3KYJB 2W6NA 3EXHB 4QUEA 1HQKA 3I28A 4XX0B 4B33A 5JAOA 4RHTA 1H69A 1G9XA 3CJTA 2IZ6A 3ZE9A 5EWLA 2QN7A 3M0EA 4A82A 4FDLA 3CWCA 2AZTA 2ZUWA 4B3JA 2LZ0A 3VSEA 1P7ZA 1XCPA 1IBRA 2NV2B 4DT1B 4LJYA 3P0IA 4YACA 4YIKA 4HDRA 1BMDA 1H0RA 4RABA 1X0XA 3HR8A 3HXTA 3KPYA 2MOKA 3QEKA 5H9WA 1U81A 1N25A 5CJPA 3RW9A 1Q0UA 2A0UA 1EP3B 2BFFA 1JNYA 3MM4A 3ODPA 4LSWA 3TL6A 5JXHA 4OHUA 5ALUA 2G1PA 1JKJA 4ZV4A 1Z2AA 3U80A 1RXUA 2J87A 3HY3A 3K4QA 5D5QA 2X15A 1G7RA 1SOMA 3EZLA 5CDFE 2C4TA 3DEIA 3ETGA 4QRHA 1W4BA 3V1UA 1QZTA 4UDYX 4B09A 4MEBA 4OOFA 3DAYA 2QAGB 2VTKA 4E5VA 3IMFA 1KI8A 3DR3A 2HBZA 3D6UA 3T3HA 1XL0A 5CX1B 1L7QA 3D1VA 3QVJA 1F6WA 4GP6A 4F2DA 5KMGB 3O6VA 3PSAA 2C9CA 1RXVA 1KAHA 1UADA 4CTMA 1JA0A 2JJYA 2SKEA 2WRZA 2VT7A 4IRUB 4PYIA 3LDUA 3I9JA 4RF2A 1GNLA 1RAFA 4XYMA 2FP3A 2ZZKA 1XEFA 4GKKB 3MWGA 4BO3A 2XTZA 1ZC4A 2QP3A 1K63A 1M74A 3HWWA 4QKQA 2H2FA 3WK9A 4D0GA 3H86A 5JDIC 3V8BA 1QO7A 2JI9A 2UDPA 5AK5A 2CFSA 3PYXA 4CQMD 3M7IA 2XTJA 3A6PC 1DWUA 1II8B 2C57A 3C5EA 4CN8A 5JEEA 4YCLA 4MB2A 4I99A 4WASA 2GFIA 1VSBA 5LZ7A 2EARA 3RGGA 4B45A 4Y2JA 2PIDA 5JWRA 1E7QA 5IM4A 2WYOA 2D1YA 4MUIA 3A1SA 4KO3S 4C0LA 4Q9AA 4NQZA 3RI3A 2NSJA 2PO5A 1MJFA 2WV9A 3I4FA 3OEWA 3W3AA 4MIKA 4BLRA 4UPEA 2QSJA 3G8DA 2WJWA 4IZHA 4FXPA 1X0VA 1QC5B 1TUIA 2ABWA 4X41A 2XDAA 2YXEA 4WKCA 4M7PA 3TJZA 5JVDF 1S5PA 2V3WA 4MWCA 4IOJA 5AXAA 5HQJA 4M1YA 3ZY6A 2EVWX 4CM5A 1P7WA 3K92A 4HAOA 4JN6B 4PSCA 1B42A 4ANFA 2ZIXB 2WQ7A 3HCPA 2WYIA 4IX1A 3V7FA 2NADA 4O08A 1QHSA 1XZ8A 1Z88A 3O31A 2F9LA 5FPTA 1GM5A 4KXFB 4Q4HA 2W6JD 2GZ1A 2MSKA 1ZGCA 2PVSA 3ZD9A 4OI4A 5ABPA 2Y76A 2G0AA 1FY2A 1CQPA 3F49S 1VCHA 2MSLA 1JKXA 1ENZA 3R5TA 4C3OB 7REQA 1GSIA 2IPNA 3ROEA 4CM6A 1I6LA 3COZA 5DTJA 4ZEOA 3Q3GE 1OH7A 3V1MA 1BQ3A 4CQMA 3EISA 4UEKA 3KOUA 1ZSYA 3IKMB 4N3BA 5SY6A 5EJ6A 1N8NA 3GJSA 3KM0A 3KTOA 2OCYC 4DLRA 2BTQB 3CRVA 3DM9B 1B0UA 5TDHA 3MC1A 5JXIA 2XE4A 2QPTA 3E2MA 3NIDB 1N9GB 5HK9A 3HL0A 3UENA 2C92A 3K0FA 1O95A 2XBLA 4HH4A 4LNUB 5SV2A 2G9UA 3GOQA 2PKXA 2P1DA 3ZCSA 2YIDA 4MQUA 4C29A 3COPA 1RDFA 1U6JA 1IULA 2XNDA 4KIUA 5AOAA 4FK8A 3GI1A 3GO4A 1RYEA 2HTFA 2QROA 1GZDA 3IAEA 3V3KA 1CQWA 4PGFA 1YQDA 2ZWIA 1DEHA 4IIVA 1R8YA 2G76A 3A2MA 2NZYA 4FNOA 3AEQB 3K3PA 4C7VA 3DLBA 1Z7GA 2JHPA 5EEGA 5CLJA 3AF2A 4DV3B 4AQ7A 2XZPA 4G81A 4J3FA 5GJCA 3GEMA 1Y7TA 2JH3A 3D1JA 4IRMA 3O7WA 2WD9A 2HSGA 1SIUA 1X39A 5BOVA 4FLMA 4V0KA 1PFVA 5G2OA 4UPDA 3KKNA 5EERA 3SQXA 5G4LA 2WMDA 3EF0A 3VVCA 3WGTA 1OGIA 4TL6A 3X3HA 8MHTA 3BA6A 4V0QA 2EU8A 3NVAA 2WUGA 2ZETA 1EFRA 4XUGB 2K7FA 2UYCA 1UKYA 2XXAA 4KLNA 3X1MA 2WJYA 4IGAA 1CFJA 3AM1A 1ISMA 3UG6A 3I5YA 3WLSA 3INRA 1MT0A 5IABA 1I6WA 5JJLA 1TLLA 2AW5A 3DAHA 2VYFA 1Q3HA 1DPGA 1TGVA 4ETNA 2CJPA 3R5JA 3QIAA 2C9YA 5CXXA 5J5AA 1THTA 2Q1WA 3DVAA 4MR8B 3KCQA 1W44A 4PZPA 1XPUA 3G0GA 3IHWA 2GM3A 2P8SA 1ZH2A 3SGLA 1L4BA 5DSZA 2DWUA 1H0KA 1KYIA 3ZCTA 1C30B 1HMPA 3T7JA 2P9FA 4LW8A 4GWLA 4JFRA 1BCSB 1T0IA 1ST3A 1NYQA 2NU8A 4HDMB 3WK8A 3QVKA 2W37A 2SECE 2VDKB 4QQRA 3SJZA 4EY4A 4FHDA 4QVGA 4W5WA 1LQTA 4LXTA 5CR9A 1FCJA 4KXLA 1U63A 2PKYX 4LJLA 3AL3A 3JQAD 3UUEA 3KWLA 1Y98A 1HFJA 4BYGA 1I7DA 1M0WA 4RFVA 2FPIA 2E4AA 1L9XA 3LK6A 3V1KA 1U2DC 4YT8A 2DLNA 2HV8A 1JJIA 4WBSA 2FPOA 3JZDA 4F60A 4Z9XA 2V1XA 3B7PA 4QREA 4ZANA 1UOQA 2B1QA 3T8YA 4MV1A 1EFVA 3FCOA 3NHSA 4B83A 1L4EA 2P65A 1KYQA 3GMIA 1CFZA 2EIHA 4XM2A 4ZOBA 1DS6A 2IIVA 2PFSA 3AM5A 1JEAA 3W6UA 2D1TA 4MS3A 2WVJA 1NSTA 5ADWA 4KDEA 1YF3A 3DAGA 2ID9A 4JOBA 4RE6A 1BEZA 1N4DA 4S12A 3FLMA 5FBWB 1W30A 4EA6A 3QQ5A 5L4NA 2PNFA 4ACAA 3ANLA 1N5JA 1WNFA 3COYA 4B0OA 3WRXA 5ITVA 3GJ4A 5BYKA 1XXHB 3PGMA 4GI3A 4Z4CA 3GHYA 3HV2A 3KV3O 2RH9B 4LJ5A 2ZE7A 4LZPA 1P73A 4JKOA 1E1CA 3ND6A 2KLHA 2ZSFA 3WX0A 5EWJA 4JMLA 2YOHA 1M1YE 5EE0A 3WMXA 1YMVA 5AVOA 2CLDX 1JFFB 2HPVA 1WB4A 3IGFA 4YO8A 2DWQA 1NUUA 1JU3A 5B7GA 3LL7A 1GUFA 1RKBA 3DXZA 3MT8A 1G6KA 1JIQA 1XALA 1YOVB 3CX8A 5BN3A 1JH9A 2Z56A 1L5WA 5D7NA 5KSPA 3DZJA 5FO0A 1S4QA 2FB9A 4G89A 4C88A 3OPNA 3EDOA 1A76A 3WLHA 1XTZA 4FLFA 4NBRA 1QHHA 5CA1A 3EW7A 4BUCA 4EBFA 9GPBA 2CXXA 5K3SA 4EX6A 1CVRA 3ZK9A 3A6FA 3OZXA 3DZBA 5EE9A 3RS8A 2R9VA 3FFTA 5B4VA 2GILA 4LV5B 4TXNA 5LD2B 2CCKA 2QE7D 5D87A 3RVDA 3UJPA 3GZNB 1D4AA 1DAIA 3PHHA 4PC2A 2PUJA 3ZGVA 2XA2A 3HO8A 5LDHA 5TIIA 3GT7A 1JPUA 4KSCA 1E2GA 1VG1A 4LCEA 2N1MA 1G64A 1CQJA 1BHQ1 1Z3CA 2ZBQA 1N1MA 5DWQA 4ABTA 4OQEA 3IE0A 4N76A 3E70C 4LFBB 2WWXA 1Y7HA 3UM9A 3HXKA 4N9WA 2IKSA 4LOJA 4M1SA 3IPYA 3OM9A 1MDFA 1WBJB 2WJAA 4NNJA 2PUGA 3RUAA 3SNKA 5EE3A 4PZ9A 3HYLA 1KJIA 5J9FA 5EQTA 4CCYB 2REQA 2XDQB 1CJSA 4ZT6A 3U3DA 5ADHA 1FUUA 3WO1A 3MTBA 3QX3A 3C6QA 3STWA 1INLA 1BFUA 3KHSA 5HKKD 2O06A 3MOGA 4B6EA 4KYUA 2ZYVX 4F8YA 3LWBA 3PNYA 4IJ5A 5CVEA 5TQ2A 1IH8A 4O63O 3NATA 5FV4A 3DCNA 2QD2A 3L6UA 1AXGA 4ZRNA 1UBJS 1VCNA 3KKOA 2PGXA 2WMOB 1RKQA 3SC3A 1SQSA 3LFTA 4BV2A 1GPWB 3EWSA 4QU8A 3AEUA 2R6JA 4L5BA 3GJ3A 3FB1A 1J0AA 3JQ9C 3QPUA 5JCPA 3FKSA 3BXXA 4B7AA 4CE6A 3O38A 4TL7A 4XCQA 4FHCA 3VDQA 1KU6A 3R6LA 3WZ2A 3CY6A 3DZDA 1UIMA 4B5KA 3KB6A 4YRCA 1XEWX 4WINA 2HXGA 1V37A 2FEXA 2PMKA 3IP1A 4LCJA 4LDRA 4Q1BA 4H6PA 4OIMA 3UCXA 4KSYA 1KBOA 4WOBA 2HU2A 3NIBA 2OZVA 5FULA 3HKCB 3CLVA 3I72A 5DM0A 1DB3A 1BX0A 1R0YA 2OOKA 3MTQA 1T5HX 3ORFA 4GPIB 4LRQA 5KWSA 1LBHA 1M2OA 1ODJA 4O25A 3VHLB 5A62A 1F7VA 5DKFA 2IU0A 3RSFA 2X8WA 1WQ3A 3BMQA 3KQOA 4QUAA 1JLMA 5TY0A 3HR7A 2XR1A 1L4UA 2HIHA 3E7FA 4MHSA 4DPKA 5KNCD 5L3ZA 1XVLA 1H1LA 1V4VA 2Y99A 2ECQA 2X76A 3GAMA 1XQWA 3O3MB 1P2FA 2JLUA 3I1JA 3TLXA 1OU4A 4D74A 2AEMA 2V6FA 2Q4DA 2RCNA 2PV0A 1PZEA 3HS3A 4HYEA 1DXOA 3G5LA 4ZV9A 3FSEA 3KPVA 3R3UA 4W8GA 3VKUA 4LN1A 5TNXA 1YCGA 1RVDA 5A3QA 4I55F 1BD4A 1IWPB 1SC4A 1SIOA 3WIVA 2X22A 4IGIA 3SYMA 1NU8A 1BS1A 3CZ9A 3E7DA 5AKYA 1ZVVA 2NGRA 1IY0A 1SXIA 1QCZA 4JBXA 4P93A 3V8MA 4ZHQF 3W5CA 2Y4OA 5JZOA 3AF6A 5IF9A 5DNVA 4OI1A 1COZA 1T0PA 2VYCA 3KPWA 2O8CA 4R40A 1M0SA 3TEJA 1U0BB 1WLYA 4UBNA 1NQWA 1WCXA 2OSBA 4K9QA 3G2JA 2GYWA 2ZVDA 2VPPA 4XW2A 3IPXA 1DKQA 1GNQA 2YXLA 1KO7A 2JARA 4HTAA 3KDAA 1H05A 5C5EA 5K5EA 1XWFA 1HOXA 1WCIB 3OJXA 5F5XA 1HFWA 1BMFA 1B6GA 4KVFA 1FTNA 1IZ9A 2JATA 4WKPA 1QYIA 3W6PA 1LDGA 1VC2A 1UDRA 1N34B 4WJLA 3CVJA 2BEVB 2OD2A 3V7NA 1ONBA 1K89A 4CV1A 3I1IA 4A1FA 1E1KA 5THQA 1X1BA 3VGPA 4DRXA 3ED1A 1C3LA 3GRAA 1O6FA 5F7JA 1GXSB 1JHMA 4YJFB 5JSFA 5K0ZA 4R71A 4FMCF 4CEHB 4GGMX 2YDYA 2FETA 1XZHA 2YWBA 5EJMA 3RRFA 3DV9A 5A5DA 2R7LA 3DC7A 2OC9A 3DNMA 3F9CA 4KI7A 3KQTA 1AHPA 5LMUB 2XT6A 4KFRA 1SZJG 2OL4A 3HZRA 4QO7A 4O2BB 1D2RA 1XZFA 3M4ZA 5EJ2A 1OX5A 1TM3E 2E37A 3GRFA 2DJ5A 4QC2A 5I7RA 1TO1E 1KP9A 5K7SA 2JKZA 1GRCA 1NW5A 3KT8A 1SK9A 4ILEA 2B5OA 5HWSA 2AQ8A 2GM9A 2B8EA 2ZI9A 2YMLA 2PTGA 1M2JA 5A7HA 3TAXA 2G5TA 4MB0A 3S2IA 3UWMA 1FNNA 2WP8J 5LOVB 2YHIB 3VBCA 4AO8A 3QXXA 3MD9A 1FX0B 3GRUA 1MXHA 1PQWA 4OB8A 3AHIA 3L07A 1BH2A 3URMA 4ASUD 3SFVA 5K3OA 1DG3A 2VDLB 3P4UA 4FI3F 1ECFA 4EHKA 4P4SA 2IGTA 5LUAA 2C20A 3LT5A 5JTUA 4H16A 4L73A 1Q22A 1WW8A 3MUEA 3FSGD 1LBQA 1LK7A 3ANSA 3QBTA 1JHPA 3G8BA 5KDDA 5GVRA 5CCXA 3TRDA 5EUQB 1YT5A 4U7TB 5JUWA 1GR0A 1ZUWA 4OMFG 3BHJA 1ZIXA 3VR5D 3KU1A 3PQCA 1U0OC 2NO6A 1JGTA 2HMYB 5EP2A 3ZCUA 2KJQA 2XUOA 1DAHA 3C4QA 1VHDA 1NXWA 3DAFA 2BE9A 4QU0A 4ZEMA 1ZM7A 2Z6AA 4G56A 2UZ1B 2WDZA 1DCKA 2G88A 3KFLA 4Q18A 5ALNA 3SHWA 4PLTA 4IOKA 4RUKA 2CXRA 1P9OA 2JLSA 3AKEA 3EF1A 4MDYA 5LJIA 2YW2A 3SQDA 3TZLA 1A7JA 1Q95A 3NKLA 2LUOA 3IBTA 1N0IA 5AM0A 4DCTA 1NMZA 4MUAA 3MRTA 5LQSA 2VP0A 4LX0A 3ZE0B 1I3LA 4Y2YA 4ZQCB 5F21A 1R0CA 3WIBA 1T0BA 1EE1A 2NZVG 1EVLA 1D6MA 1GN9A 2X6TA 3FA2A 1NTOA 3LUJA 4G36A 2WF7A 4OMDA 2CJFA 2OXTA 1UBCA 3HKEA 3LW7A 2PZKA 3I9MA 3PXDA 3QXCA 2H11A 4WDQA 5KKCA 2J6CA 4X1YA 5KOHA 2YFKA 5DGTA 5FTNA 1U99A 1NVUQ 4KR9A 3UVEA 3BJRA 3SIPA 4B6OA 1VE5A 5GZ3A 4NOKA 5A9SA 4RKRA 3MWEA 3NONA 3BDAA 4P4UA 4W1QA 3BKWA 2BFBB 5H3CA 3B9RA 2OQRA 4P8RA 1E3JA 4YRKA 5MGBA 4TMTA 4HWPA 1GA6A 1VJTA 3U4QA 4QXPA 1CDOA 5I51A 4B8WA 2IP2A 1QRTA 1NMYA 5DHUA 5DFAA 2XT0A 3F6SA 4H0FA 3LP5A 3HGMA 2O19A 3I32A 4TMKA 4LHYA 4K2HA 4LTDA 2QVCA 1JKMA 1X7WA 1PYDA 3DBOB 2P8JA 4JYPA 4D0LB 4EVRA 2R65A 1T3HA 5AVTA 4BC1A 5JAHA 1HDYA 1CXZA 3L6EA 5CLGA 5B3KA 1Z6ZA 2AJ8A 1KKLA 5GGXA 3WQQA 1UAAA 1Y9ZA 1Z5UA 3IUEA 1S2OA 3N6VA 3AQ4A 4S2UA 5AP9A 4D99A 3A11A 3LLCA 4DV2B 2VHYA 3OTOB 4J07A 3ZZ0A 3C6XA 3TMAA 2EZUA 4HWTA 3AF4A 3DYVA 5ER6A 3A1TA 3Q3JB 2HJ9A 5FLYA 2ZZNA 1YRBA 2DVMA 3FW1A 1XRPA 3ELWA 3UH0A 1QGAA 1ID1A 1P9NA 3UO8B 4QOJA 4BY9E 2J33A 1JAHA 3BEOA 1NQUA 3V2IA 3JQGA 1WMFA 2ZROA 4YNBA 1SEPA 2SNIE 5CEEA 5D01A 2CWDA 4O3FA 3DA8A 3P2EA 1BA3A 4XCXA 1MFZA 4MWZA 1ZN8A 1UKAA 1XZDA 1MGPA 1R0KA 1UZAA 4KE6A 4UE3S 3EXG1 4HDNB 3O8OA 2VXBA 2QP9X 5CMLA 1NJ5A 1DAGA 2JANA 3NT5A 1B8OA 1LK5A 1RBYA 4NE2A 1BS9A 5K6AA 1XVTA 1EKXA 1EWKA 4NK4A 4WESA 2ASEA 5LQAA 4J2TA 4EM6A 2AOVA 2BM9A 4HVAA 2O2GA 3ZE6A 3EVAA 2QB5A 2Q5EA 4QOSA 1CUEA 1O08A 2Y05A 2PQ0A 3BJIC 3Q2IA 4QXAA 1UFQA 3NEPX 2IOFA 3OA2A 2JVKA 3WMGA 4BWYA 5IVKA 3AG6A 2VH5R 3NM5A 3OO0A 1VG0B 3G1UA 3NDJA 1NDUA 4Y2XA 5HM8A 3KWJA 3LCRA 2Z6UA 3ACBA 3C6YA 3NHKA 3PE6A 1MQ9A 4U7DA 3AVVA 5EOVA 1X1SA 1V7QA 5B1SA 3WV4A 4I3FA 1IRXA 4COKA 1EVQA 4U00A 1FIUA 2REBA 3O75A 3VFDA 4J7CA 1C9EA 5KINB 5JY1A 3LL4A 3VU8A 1W4CA 5AW9A 3OIDA 2Q1UA 2R96A 1IM2A 1ZOLA 2M98A 3PU6A 4D9FA 5ITSA 4QAQA 1U2RA 1X7DA 3P26A 4F92B 3KO8A 4L22A 2SCUA 2Z9DA 1THMA 3HFRA 3EZFA 3GF4A 1YV9A 3FKJA 3R6DA 3X44A 4J7UA 4EB6B 4EKNB 3HJHA 4YRGA 3WS7A 1KIAA 3EDQA 3K0HA 3BYZA 1E2HA 4INPA 4ZI3A 1VCMA 3ZWNA 3L18A 1KH2A 2HUPA 1J2UA 4BO7A 4E88A 2R1ZA 4WZBA 2QSUA 3I1FA 2CEKA 3QWHA 4MR9B 1EEHA 1C8BA 2Q7XA 4QJ3A 1KSFX 4P4TA 3R3YA 2NU6B 3B89A 3P9RA 2O8DB 2YXNA 1TJ4A 2C9OA 1V1RA 1UDBA 1CR2A 1CB7A 1C3OA 3X1ZA 1KA9H 4TWRA 2GF2A 1Y5MA 2OBBA 2ZJ0A 3QVXA 2I0FA 4DLKA 2HLDD 3MTJA 3MHTA 4RK7A 2V6IA 3PUHA 3KUXA 4RFLA 4YDSA 4RD0A 2VHTA 4TKZA 1A04A 4GD3Q 3N8IA 5HS6A 4CUZA 4HK4A 3G0OA 4KYTA 2FEOA 1R3UA 2PD4A 2FMKA 1U8FO 3PK0A 1UPXA 5HUJA 5HCUA 3RV3A 4XWYA 1SBTA 1U5AA 2J30A 3ROFA 3F6EX 1G98A 3VHRA 3GT3A 5KNCH 2I6TA 4NG4A 1WTAA 2G04A 1QHGA 2P9GA 1JSCA 4EHLA 5FBZA 4ZYTA 1NFRA 3KKQA 5DGXA 3NIGB 3WLRA 5EJIA 1T5IA 5A5FA 4GI5A 3K73O 4F6CA 2WZDA 3KK0A 2GZAA 1T5TA 1NGSA 1MB2A 2YJTD 5KYKA 3NP9A 3FH0A 1YUNA 1I8TA 2NZWA 4C4ZA 2NUPB 3CC8A 4D81A 4GDFA 1CRQA 3TGWA 3QA3E 2F3TA 4A3SA 4OHPA 5A1TA 3DKPA 2DBQA 5A4MS 4AN1A 4IXNA 3TW8B 3WGHA 1FTWA 1DRWA 1XAHA 4HAZA 1B8NA 1UQTA 1WF3A 3GPDG 3QMPA 4ENSA 2YIJA 1P1BA 1NFQA 4QT0A 1KI3A 3AV0B 3P2JA 4CDNA 3A0UA 3SHVA 4BTVA 5BOSA 2R6DA 4YUYA 4EG8A 4C2TA 2CMKA 4S05A 3AF3A 4EHDA 1SHKA 1SKYB 2IA5A 1W75A 2QTNA 3HSYA 4JCOA 4EUSA 1YE8A 2FGJA 2V4MA 4X6LA 5AI4A 4EGAA 4YCSA 4LDJA 1QPZA 3F90A 5A4JA 3P5BA 2BKLA 2JGNA 3L1IA 4P7GA 5LP6F 1K5GA 5KZMB 4FWIB 3MAAC 1WUIS 4E07A 4XYLA 1UWLA 2BJHA 2E5LB 4KR7A 2O23A 3N6RA 3H04A 1NN3A 4A8JA 3EIOA 3UV7A 1KO1A 3COJA 3RS0A 3IHKA 5BVGA 2UZ3A 3WLAA 1UINA 1EUDA 3VVLA 5E0KB 4A26A 5BSKA 3ABRB 5HDQA 2G82A 4DLLA 2OORC 1I32A 4MV4A 2QHXA 1UZUA 1SQFA 1PS8A 1PW7A 3L1JA 4L08A 1AXEA 2CLKB 2QTCA 2BYTA 3DYBA 3C97A 2EFDB 4K9KA 1H4SA 2YJ5A 3FHCB 1M2VA 5MN6A 2RGRA 5DCLA 4EW1A 2OMEA 3TQCA 4CI9A 2QJRA 2ZRFA 3AUJB 2BKUA 3CE6A 4PSUA 3UJCA 3SIXA 1UH5A 4OA5A 3SZ3A 1XZLA 2RGAA 1MAAA 3H5VA 4NK5A 4UD6A 4BMNA 1IPHA 1L4GA 2O05A 3GDFA 4CW7A 2YY6A 1F2DA 4O4IB 2VYND 4N9QA 5DXAA 4NBLA 3I2YX 1QRAA 1J97A 1YQTA 4K28A 2ZI7A 4YMUA 2ORED 3MXTA 5B55A 1MPTA 1BRMA 1O4VA 2VUUA 5FTKA 5I8ZA 2H92A 5BP7A 5IBCA 3BQMB 4JBGA 4M9UA 4UEWA 1E0KA 2DY1A 3BEDA 5LA6B 4LI3X 3EK2A 1E5QA 1IBCA 2P2LA 3EOZA 3RS3A 5AHWA 4PANA 4YRNA 1CF2O 1WKVA 2FKAA 2H57A 3G9QA 3N9IA 4UHKA 3SDZA 3ORSA 1HDOA 2DAPA 2PWBA 4WVLA 421PA 4DLWA 2E89A 3U60B 3HB9A 3N58A 2IPOA 3R7NA 2VYVA 3HGQA 4EPVA 5B6PA 2VPTA 2OBLA 1T0JB 4GP9A 4S1WA 5EJ5A 1N2SA 3NUQA 2OCLA 1TYEB 2VPIA 2HB6A 2HRDA 5AW7A 3DE4X 1CY8A 1EFKA 1TM2A 2JAHA 5GPBA 3F7MA 4J43A 3FGOA 4A2QA 1TAUA 2EZ9A 2XRYA 1L7AA 1V8ZA 4UTXA 1NBWB 2YWJA 5ALYA 5BWNA 5FXMA 5LYJB 4B3SB 3VOTA 1YVPA 5LBUA 3VXKA 1PR5A 3PFWO 3ZXXA 1AKMA 1DZIA 1MV5A 4I2VA 3HI4A 4REQA 1I0IA 2D2IA 3ICVA 1JEYA 1DL5A 1MEEA 4AJHA 5J2TB 2R66A 3AEKB 3WNBA 1NZFA 3JAMA 3KR0A 1L5ZA 3DXXA 1HT0A 3P32A 4D3YA 5TGDA 1I0LA 1E79D 4ZU1X 1E20A 1JHXA 1GZ7A 1K98A 5I4BA 5FRDA 4AUKA 4G41A 2AMJA 4NXMB 5FUBA 4CR7A 2WHYA 3PUYA 1W93A 1B1AA 3OY2A 1NBAA 5JS6A 1QQBA 1ENYA 4R2IA 4DG5A 4MO9A 5LBIA 3FGZA 1LPNA 1Q57A 4LF7B 3WR5A 3MPUA 1VI5A 4R1QA 3LLVA 4TMVA 1NLZA 3QVGB 3SXUA 3UN1A 4BUJA 4AJKA 4TSFD 1ZRHA 4WZBE 4AJNA 2R7NA 4Q3NA 1MB3A 3L6OO 5A3SA 2F9FA 4IZ6A 1ZCZA 4HDCA 4TLMB 4IGEA 4ITVA 1F51E 6Q21A 5CURA 4ZYZA 2YWFA 3R5HA 1M2HA 4EB8A 5JDCA 3WGZA 5DN6D 1QFZA 2FZLA 3NASA 4RH0A 1ZDMA 3O21A 2I9PA 2BJWA 5JFGA 1IY2A 1YKSA 4J03A 4XA8A 3BRWD 3BWYA 2ZYWX 5JYBA 4JLBA 1K2VN 1PV4A 1Y1PA 2Y0EA 3R75A 1WB6A 2DG2A 5C7OO 1PK7A 1QGUA 2O0KA 2PQ2A 4IVNA 3RRBA 3L8DA 5J4YA 1ORHA 2AG0A 1K6JA 3ZWWA 1Y3FE 6REQA 3IBCA 3ZXYA 2D5CA 5EP3A 4JJIA 1L2TA 1O77A 2DCUA 3RSQA 4D4MA 1U2SA 1U7TA 1ORTA 2B4KA 1DWQA 5L3SB 2N42A 4H18A 2P90A 1ZHHA 4ES6A 4JYZA 1I3KA 5EMJA 4ZOLA 3SVZA 2WHPB 3OWXA 1ISIA 4R3NA 4KWHA 3L6BA 2C4NA 2P9ZA 2XCQA 3AILA 1BN6A 2H3EA 3GBSA 2ZVQX 4XFKA 3AVUA 1RPZA 1PIWA 1VE7A 3AUXA 1I9CA 1RCUA 1GU7A 1H9AA 1W88A 3RWOA 3LWZA 3IODA 3KZXA 4R9NA 5EXDA 4QQNA 4XDHA 1E3MA 4PF1A 1RZRA 4LXHA 1TUEA 2RGCA 2XYGA 4L5IA 4AECA 4QD3A 1ARZA 2BHRA 4DIFA 1IBLB 2A1UA 1VM6A 5F1YA 2VTEA 3U44A 3U26A 1N2JA 3MJRA 3AIOA 3PUZA 3CF0A 4R9UC 3RYHA 4ENUA 3LZ6A 5KHAA 1WO8A 5BSHA 3VSCA 4ZQFA 2CMGA 3ZIAA 1PGOA 3HNPA 4E70A 1XI2A 1ILEA 4P3XA 4IVPA 5EIWA 3T4XA 3AY3A 5EAIA 3QIVA 4YMGA 1IZ8A 3GMSA 4NTZA 2CNWD 4M4SA 1KOFA 3WK4A 5CHEA 4QBKA 2B2NA 3TMKA 2YY5A 3W77A 2F67A 4DOMA 4KLCA 1E18A 5ECGC 4PGAA 4L95C 1TB4A 2VK2A 1QE5A 1QP8A 2B6HA 2BFFB 5AFSA 1H66A 2ILVA 2ZANA 2A9RA 3UFXB 2XCRB 3GCWA 3CF6R 1T2FA 2ST1A 3WTCA 5K6TA 2C7GA 3IBYA 4LYHA 1EAMA 1LDEA 4RL6A 4CM9D 4BMCA 3M6AA 3VPAA 1CPYA 2ZPUA 2OSVA 2PQMA 3LCUA 5FWAA 1GQYA 2G1AA 3DWIA 2GCIA 2HA6A 1CZNA 4DZZA 3R9WA 1KI6A 2J9GA 3FOZA 4JUFA 3UJ9A 3SVTA 1F2VA 3HY4A 4JT2A 5CTJA 3TN7A 2IGBA 2GO1A 3B5IA 3DFFA 5KPDA 2C78A 1KO5A 1SUEA 5IKXA 4MVJA 2V7VA 1DEOA 5BMVA 2HXSA 3CF2A 2A1TS 1Y1QA 1D4FA 3A9SA 3P20A 5JJ5A 2UXCB 1ZIDA 3AU8A 4KFUA 3O9VA 4RA6B 2OC4A 4MS1A 3VTZA 2YNMD 3FTEA 4C0XA 4HFMA 4DC1A 1MX9A 4U2FA 1L5LA 3X1WA 3ZTWA 2F1OA 4BEVA 4RWEA 4R2XA 4BP9A 3HR4A 4JK3A 4PONA 1UQUA 4YJ3A 1GD1O 4C76A 1AGXA 4E2YA 1PWXA 1XXLA 3EG5A 2HPAA 4QVIA 1A5SB 1Y37A 1GY8A 1PJTA 5EN4A 5GAJA 1TK9A 5EPEA 2YUIA 1EGHA 4UBKA 3HFJA 1OBCA 2OHVA 1FFXA 4WWHA 3L1HA 2I3AA 2QMQA 1HEIA 3HU5A 1ZSNA 1UFVA 4BWVA 1Y1RA 1P44A 4B74A 4B7XA 1V41E 3DW3X 4RHXA 1H4QA 1ZH0A 3OF3A 1NJ6A 1IOVA 2X7HA 4KJZA 2VG8A 3LC1O 4MUXA 3O26A 1QBKC 1VKHA 3GR6A 4NG5A 3JTEA 1HURA 4UZFA 1E77A 1V9CA 3GLRA 4FGWA 4NBUA 4QE3A 3GZJA 4XM0A 4D82A 1AKQA 4L15A 1DRKA 1PL8A 4CETA 1ADJA 1FJ2A 4BO9A 3CCBA 1AG9A 3C8DA 3O83A 5U4XA 1C0EA 2GLUA 3ZGNA 3G8AA 1BDHA 1USGA 4HSGA 4TZTA 4G0YA 3HO6A 1VIMA 4TYWA 1A8PA 3VPHA 1QHXA 3MAGA 4M49A 3U7FB 3F7OA 3L0ZA 4JU8A 3SHTA 2JI6A 1U28A 1PAUA 4CMGA 2QQ5A 2FWAA 2VJQA 1SHZA 4D8YA 2DSTA 1IVNA 1FFCA 1T10A 1Y33E 5CYPA 4HLDA 4TRMA 2XOXA 1W46A 4Y1RA 2GHRA 5IBRA 1C8LA 4A10A 5TF4A 2R47A 1FFEA 4OUDA 4QWWA 2ZJ7A 3AVTA 3WLPA 3WXMA 4EG5A 1CY6A 1XWWA 3WAGA 4MCAA 2CUTA 4GOJA 4E5YA 1VJDA 1Y8RB 1E0AA 1U5BB 2F8TA 2HA3A 3K0FB 1ZLXA 3U3RA 2OHFA 1Q74A 4LAFA 2MMCA 3BL8A 1JPVA 5T57A 5DHTA 1W87A 2DKFA 1UFKA 3TZCA 3JD2A 1IQ0A 5LLDA 3F96A 5K0NA 4AZTA 1E98A 1TEHA 4G0NA 4UM7A 4KKVA 3DE0X 1DMSA 4LOIA 4S1NA 3RVLA 1C9NA 1MORA 3OMWA 3LDFA 3SC2A 5KTTA 1NNEA 5LLTA 3H99A 2NVUA 4HS4A 4TVSA 1Y6ZA 4N49A 4RZ2A 3MJ4A 2QTMA 1JXAA 4URXR 2ZM6B 3WP1B 2A1IA 2A35A 2NO5A 1RJ9A 2Q6IA 2V7BA 3B85A 3KYIB 4LWPA 5EZYB 3PHIA 1GPUA 1YRHA 3TLZA 3O4GA 3QKSA 3VX4A 2X2PA 4KR6A 1K5PA 1MUUA 1FP4B 1CQZA 2YZMA 2W93A 1P18A 1DIRA 2P6PA 1H42A 3KKKA 3LF1A 3CVOA 5GGYA 3PQ4A 4U7JA 2H0QA 2DXIA 3A9CA 6YASA 2OK8A 4L5JA 3I2HA 1MJ5A 2CDCA 3B1FA 1SOVA 3DQQA 4RF4A 2VO1A 3AV3A 3K1AB 4L8LA 2V98A 2FDXA 3O9MA 4PQRA 2HJGA 3IELA 1UBSB 3R09A 2R79A 2O9JA 3ND7A 4MZDA 4DEXA 2WSMA 3DVAB 3NNSA 3T3NA 3KUCA 3M3PA 1BTOA 2GSDA 3DW1X 2G28A 2PJZA 5JALA 4UAUA 4UMFA 3H13A 2XGJA 5HPYB 3HN6A 4PGHA 1E3EA 5CB8A 1FMTA 1MPXA 4AO6A 4R98A 3FX2A 3RJMA 5CIWA 5K3DA 3M4XA 1HDIA 1SCQA 3H9GA 5KVVA 1TKRA 4D4HA 1C7FA 1ML3A 4Q34A 4V2UA 2YFQA 4XJVA 1M6HA 2VCHA 4X0EA 3WMWA 3SKVA 3WLTA 4Z3KA 5JCJD 2YMQA 4KWCA 1IJKA 2IP4A 2PSJA 5IJ9A 2ZRGA 1KK1A 2AN1A 3QU7A 3ZV5A 3M5DA 1U9IC 2FPIB 1USWA 5AKZA 5HJEA 1D6JA 2WAOA 4Z4EA 4YP1A 1G20A 4OLFA 3GAAA 1AQNA 1GPNA 5CK5A 4URZR 5KCZA 2C2WA 5CFOA 5JRZA 3LU1A 1H2YA 4EPTA 1QZUA 4W5TA 3A4LA 3S70A 2Q3FA 3FZEA 1AY0A 4MS3B 1IWBB 1RJEA 1ULHA 2CVPA 3G23A 3QE3A 3VO9A 2GHIA 4ND2A 1TT5A 5HZHA 1USVA 3KBOA 3LKZA 5EE1A 3O84A 2XNSA 3P71T 5KTKA 3OU7A 1UP4A 5H70A 1K2WA 1X74A 4J7AA 4MLPA 5F3RA 4A2CA 5T4HA 4F97A 2F3SA 3KQMA 4XTRA 3EB9A 5JQGB 1XMOB 3DE5X 2CDNA 4JT4A 3VJLA 2G4LA 4RKEA 4AY4A 4MROA 1H9CA 1C41A 4KZPA 3DD1A 1KH1A 2C3MA 3BMCA 1CNFA 4P3YA 3AC0A 4RK6A 5EWJB 4EYOA 4MV6A 1EJ6A 1RQGA 3F7NA 3NHLA 5BSRA 2JFYA 1KS9A 3AHEA 4GRAA 4RVCA 5EIAA 1QX3A 5AR1A 5K03A 2EAUA 4N47A 3EC7A 4LC1A 5IHXA 1OLUB 1USKA 3DQZA 1U5CA 3LBFA 3QM1A 2YFYA 4DJDC 2BEKA 2OPHA 4Q9IA 1RAIA 2HKIA 2GKGA 3S5JA 2ZIFA 4D3ZA 4UE2A 4P35A 3GG9A 3RFUA 1QHHB 5DX0A 4QBFA 5CA1B 4TWBA 3NEJA 1E7WA 3MCTA 3F3KA 5IJ0B 2NYUA 4FS8A 1GPLA 5EJFA 1G2QA 2JLZA 1PJQA 2QRMA 3D0OA 1MW9X 5IBQA 3TL2A 3BSYA 3IVRA 3FOEC 4KR3A 3HB1A 1TEVA 3KYCA 2FFBA 1ZL0A 2SBTA 3OWHA 2X0DA 5HE9A 3NB0A 3QKWA 1XA4A 1F5SA 3EIFA 4G67A 1CR1A 1CQJB 2QV0A 2I4RA 5G40A 3G68A 3ZDZB 1PSWA 1QGYA 5FF9A 3C8ZA 2OWDA 4JY7A 4AIIA 4DPMA 1XDSA 5GP1A 2H5IA 1UK6A 2JGJA 4WFKA 4BHTA 1NIJA 3KOOA 3SG0A 3K9NA 1O96A 1N36B 2RBKA 3HHPA 3M33A 4F06A 1ZX1A 2PRKA 3DMDA 2CC2A 4OHRA 1OC2A 2REQB 2W83A 1U02A 1B8VA 4UVHA 4D25A 4BJ5A 3CZ4A 1HT2E 2X9GA 2IXDA 3L6RA 4JZYA 4YUZA 1PFGA 3MB8A 1HKHA 3U3JA 4ZVSA 3UKOA 3AQIA 2ZPTX 4DNXA 3K70C 4NNPA 3R3HA 4OHVA 4PRZA 3TIGA 5AW6A 3VPSA 1UWKA 2ZRAA 1YZGA 3KLOA 3SS7X 4JT8A 3DONA 5LNK6 4QODA 4NCIA 3EGWA 1JUDA 1BWQA 5E4TA 1F6BA 3HU1A 1NYTA 5HGXA 3U3XA 3LOQA 3EIHA 1ISHA 1RSZA 1T29A 1HNXB 4NAHA 4I3GA 2NPFA 2NZ2A 1ATIA 3TO5A 1FRQA 2H16A 4PBSA 2IEGA 2WU4A 2AOTB 4BRWA 3DB2A 2Z4RA 4YV7A 1OVGA 2VK4A 1U8YA 3KVOA 1V35A 3TLYA 3H9UA 2ZJ2A 2V7EA 1JR3A 4V2IA 1DT3A 3TLJA 5IK2D 5E9WA 3RYCB 1EEXB 3WWPA 5BW5A 3WYBA 1US8A 4BNGA 1VLZA 3EPLA 1Z6XA 2WWIA 4GX2A 4H7PA 4OQZA 4L07A 4B8YA 1M2OB 2CE2X 3FHLA 2W2PA 3DNFA 4JOSA 3KKMA 3LHFA 1X42A 4E3ZA 5FUQA 3SZUA 3OTGA 1K0UA 4H27A 1XEWY 3QSGA 4OHOA 2Z30A 4ZAVA 4ARBA 5K4GA 3O2QB 1COWD 3FCAA 3AKCA 3PLNA 4EEXA 5LFAA 3M4NA 5C1IA 2FMTA 4R9VA 1DKUA 2OHHA 5HUHA 1P6XA 2XA1A 5C52B 3ADDA 2QTZA 3P19A 4ZU6X 1QKJA 2FJ0A 3QH4A 2DT5A 4NU6A 4UFNA 3VH2A 1YS1X 3M1IA 4DQVA 1SXQA 1KQGA 4FLEA 5KKNB 6NULA 3ZX5A 5JISA 1P1IA 4U7PB 5CD9A 1DC6A 5EPUA 1IOZA 1FVHA 1B7GO 2WPDA 2DUJA 1O5OA 2CVQA 3PIIA 4FD3A 3EWNA 3QPAA 5HKBA 5JSUA 2LXNA 2WTAA 4MV9A 3ROKA 4ZZ0A 2Q3JA 1XPJA 4AS2A 2CVFA 4J9VA 3UGJA 4CUJA 3FPBA 2O8CB 1QHYA 3PVCA 1M5TA 1SU8A 3CR7A 2MR6A 4GNKA 2FEPA 2EBUA 2P78A 3E35A 2AI2A 4FBLA 4WA8A 4UDNA 5FA8A 2XW6A 1OYWA 3K8YA 2CZCA 1YA6A 3L6CA 3EBPA 4BNMA 5F77A 2FLWA 2V6BA 5JARA 3I0ZA 1K4MA 1G2OA 5DWVA 3EDMA 3MGKA 3HABA 1W6RA 2BGIA 4MKFA 5FBLB 4BQQA 3K6SA 3IT2A 4XOIA 5F78A 1T9HA 1SKYE 1PFUA 2J0UB 2OT3B 3KD3A 4X20A 1G3IA 5JEDA 3N07A 1Q50A 4UJ5A 3T1YB 3WYCA 3OF2A 2ADOA 1Q19A 4RSRA 2HO5A 1U2TA 1YI0A 3EUEA 2AK3A 4ZO8A 2REOA 1ZSVA 2BN4A 1A72A 1DQRA 1WXHA 3P52A 3NBXX 1JDVA 2N3ZA 4RTQA 3VMFA 4DRXB 1G20E 2HGZA 2LE0A 3UIEA 3ZY2A 2AZ4A 4OXXA 3ORQA 2OV3A 2VHQA 2OCAA 4NR0A 2YHSA 2V96A 1MN6A 5KJEA 1NZDA 1CK4A 3N2IA 4BNLA 3FHTA 3TDNA 4DSAA 4CKWA 3DEHA 3T52A 3GD7A 2Q3LA 5ER9A 5F4BA 4QQ8A 1XRQA 3IVCA 3DL2A 2EP7A 3N8HA 5IARA 4MRPA 5ALZA 2XMQA 2PU5A 2A0FA 3X1DA 4DE5A 3O73A 4WKOA 1UBOS 4YQFA 4DLBA 1GTG1 4X1OA 5AM3A 4LV6A 2LWIA 4U0KA 5B1EA 3VR6D 1YXMA 4B3IA 2OECA 1AO0A 1QH0A 5MHTA 1LWOA 3R5XA 1AUVA 5CA0A 1ACJA 1S2DA 4BNFA 4F1WA 5KYYB 1ZN9A 3MBIA 5F2NA 1AKNA 3GC6A 1RRFA 1FW8A 1XTVA 3MA0A 4P4SB 1N2OA 2IEBA 4DBVO 4LV8B 4XXHA 1WSWA 1ZL2A 2A5DA 1HEUA 1KEVA 5DB4A 5BUSA 1RHKA 5AJXA 5DLQC 2CJYA 1SOAA 3N2YA 7MDHA 5G0VA 2CVHA 2D2EA 1OBHA 1R8JA 2FJPA 3D0KA 4K9LA 4QHYA 2W00A 4YJ2A 3ZDQA 5U4QA 3NDIA 1AA9A 4PCUA 4EARA 3MYYA 4O5OA 5BN4A 3D3NA 5IASA 4R5MA 1S9HA 3FJOA 4W5HA 5IYZB 1O58A 4BV3A 1QR6A 2DPXA 1GYRA 1M34E 4JI6B 3HKBA 5D6OA 3DOUA 2OFXA 3VAAA 2GHTA 4BEWA 2R1UA 1E60A 2H1IA 4IMJB 5AMXA 3PEFA 4GX0A 1LLCA 3FCEA 4C04A 1XPRA 4X8OA 4LHWA 4RDIA 2R86A 5K20A 4UEOA 1W1IA 3GDHA 5H59A 1PUIA 1KDRA 2WTEA 3WJAA 3ZD7A 3N1UA 3OZSA 1XROA 2COUA 2P6NA 3R3WA 4JJ4A 5I48A 4DB4A 4C89A 1T2NA 3CNQS 4JBYA 5JNWA 2C97A 5SY9A 5IW8A 2H4XA 3UAOA 4Z5XA 2DHEA 4BX2A 3SX4A 3CNOA 4ZMBA 1UM9A 3LPCA 3MQ2A 4W5JA 3W3AD 5IC6A 4EFKA 5CBKA 4G1BA 2OAGA 4FR2A 4KQGA 3R8XA 1DFIA 1ES9A 2JC3A 1PT5A 4K05A 3K72B 3HKEB 4DRYA 1MVLA 1E7MA 3I2GA 1JEEA 4H3SA 3KOMA 2A94A 2J6BA 4FGSA 3EA5A 4FN4A 4D6XA 4WXHA 5H1YA 5KQGA 2RHTA 1XRSB 5DCYA 1NG9A 221PA 3GLVA 2YVUA 3OE1A 4NMXB 1Z6QA 3MWEB 4B73A 1YUBA 5A9SB 4ZI2A 4ZZ3A 4IX9A 2RJNA 1IHOA 1OB2A 3P94A 1AH2A 3OM1A 2EJBA 2V6GA 4KIJA 4US0R 5ILOA 3OJLA 1OE0A 4MI3A 4Z49A 1LW7A 4S1TA 3WGQA 3G1WA 4OOEA 4MKRA 4O1MA 3BXPA 3DXFA 3JWJA 2R5NA 5DULA 1QUEA 3O2SB 3S2ZA 3F9IA 1X7WB 3FDFA 3ENVA 4RH3A 2GJAA 3D2LA 4OP2A 5BQPA 1QYCA 4TV9B 3IXQA 1P1RA 1QBGA 3ZLUA 1NQTA 1LLDA 1JWBB 1YMQA 1CUWA 1K6IA 3RUEA 1T26A 4AZVA 1IN5A 1L5FA 2XIJA 1DP4A 4CEJA 2IW3A 2D13A 2PBLA 3HLKA 3LXUX 4K5QA 4G85A 4LJKA 5IUJC 2XY4A 4MQEB 3JVVA 3DKIA 3FFXA 2Z8ZA 3L05A 5BV0A 1OH6A 3WBJA 3GNTA 1C9MA 1MAHA 2X2FA 3LX5A 3V3TA 2II6A 1ULAA 3ZWVA 1KVQA 3CW9A 3A4TA 2N75A 2FR8A 1ISFA 4YB8A 1DDIA 3KEOA 4O4HF 5GJWC 2QUZA 2UYQA 3JQGB 4Y30A 5UKDA 4Y2TA 1WBBA 1OZ0A 4PXYA 2D1SA 1L5NA 2HDHA 4L57A 1AK1A 3NHMA 5ESDA 1PTJC 3ZY5A 3R0ZA 2ZWOA 4M0KA 3PRYA 4RLFA 1A97A 2N47A 4QG3A 4KMRA 5EMKA 5IAGA 1M76A 1Z0JA 3RG8A 1SULA 1PEAA 3KJHA 4B3GA 4IO0A 1A27A 3DBHA 3REGA 2C7QA 1BYIA 3O8OB 5DF1A 3PGXA 4KKXB 1PJ4A 4E2ZA 1P5FA 2DFNA 3CMCO 1UT5A 4AFNA 4ESHA 3S1SA 4CF3A 1T2CA 1NG1A 2PX4A 2WUWE 1KJ8A 4C2UA 2VDWA 3CBQA 4WESB 3W79A 2QPOA 4PSAA 3CQ9A 2J07A 1XDZA 2CHVA 3S8EA 5BN5A 1ZRSA 4MS4A 4OVKA 1L5QA 2PWZA 3ZHOA 4EF4A 1JAXA 3CSDA 1U2DA 2XMSA 3H8JA 2ACWA 3QTBA 1MG5A 5TB5A 1A9OA 5TS3A 1OFIA 2V3VA 4MAFA 1Z22A 4ENQA 1LD3A 4LXQA 4N41A 2K2QB 3K35A 4QOHA 3W7AA 1NI5A 1YJ5A 3K94A 1F2TA 5F1PA 3LXMA 2ZRKA 3SZOA 1CUBA 4NDAA 2QG4A 4XI9A 2QDKA 4QU5A 3STHA 1XWIA 3DC2A 2VUSA 2V97A 3P8ZA 4YVFA 5IZCA 1SOUA 2VNJA 3KEMA 3LOPA 3OEHA 1VXRA 4R9SA 2ARKA 2HSJA 3QXHA 3WKBA 3RU7A 5KWIA 1NW7A 2Y67A 1VMDA 1F0YA 3AESB 1J21A 4AKGA 2GO7A 2J3IA 3V6MA 4TSKA 4BO5A 1RWNA 4NWIA 2OKGA 1Y0BA 1E2QA 5CT5A 5KTSA 4HWKA 1JH8A 3EGDB 3FPSA 3QX9A 4QUGA 2B94A 1IFXA 3BKXA 1VHJA 4DA6A 1W9MA 1DBVO 2IHVA 3RVOA 2CLMB 1XDDA 3IIKA 2YINC 1V1RB 3V7UA 1P3JA 4DM4A 3EWAA 3IVMA 1C3OB 3LM8A 2H18A 2J4FA 3ZGZA 5JSYA 4TYYA 4B82A 4N1AA 4NH4A 4DDUA 2J3LA 3OM8A 2EJVA 4G4GA 3ZC3A 4RA9A 2IZ5A 1QLJA 4CMIA 3ICQB 1SVSA 4D9HA 4E15A 2O8VA 4TKUB 4WLOA 5CVDA 5TF0A 3U3OA 4B6SA 4C06A 2G17A 5JNVA 1F7UA 3CISA 2AHRA 1Q7BA 3HVHA 1EFPB 3AYXB 1EJBA 2JNWA 4IFEA 3ZWKA 4AURA 3H4TA 2RH4A 4EJSC 3CVWA 3U7RA 4XGIA 3S2SA 4YRZA 3LQ4A 1T3ZA 1P1JA 4XFDA 1KFEB 4BKOA 2ISSD 3DFMA 3PI6A 3CZQA 4IHKA 4J1NA 4RK1A 5IRCD 4JLDA 2KB0A 4F3NA 1IHPA 5D3KA 4B2YA 2A0XA 4FDAA 1TPYA 1THGA 2G0NA 5WRFA 1TJYA 1U7ZA 5F2OA 2H4HA 2JGRA 2XE8A 3IR7A 5AVKA 4NXNB 1ANKA 4G8CA 3RKUA 2GK6A 1CUVA 1L5SA 1PQPA 2QT9A 3AJDA 3M5CA 3CRZA 3M3HA 4EG1A 2PK3A 1UMCA 1PZFA 1U3GA 2CHFA 4OFXA 1U7HA 4N6GA 4C0JA 6CHYA 1JJFA 2ZEJA 4I46A 4GOOD 2E4XA 3OECA 3KJFA 2J9FB 3RFXA 4CHGA 4HZGA 2V7QD 1H23A 4W9NC 1ULUA 1QXSA 2E4VA 2Q29A 3ON5A 5LWHA 2WABA 1O8CA 4MCJA 5BY2A 2QUAA 5B6JA 4DLZA 1Z56C 3TTXA 1TQ2A 2BW0A 3NW9A 4FFPA 2ZUFA 2EG9A 3DF7A 3D5QA 1XDGA 4QWMA 4Q1VA 1YJ8A 5CIQA 3S6JA 4EA8A 1J99A 4NEHB 4FYPA 5CM8B 2F8MA 3NWPA 5CXUA 1ZZGA 2AZXA 5JS1A 5FADA 2YWGA 1N7GA 1UJCA 2VHJA 1SBCA 3FNBA 3JQ9A 3PGKA 1FFYA 3QKTA 5BMVF 4I4TB 3WDKA 2VF7A 1MGOA 1DJOA 2RAVA 3DZKA 2JLYA 4WLNA 2ZYUX 3KBBA 4A0SA 3P4YA 2DPYA 2Y27A 2ZSIA 4A8JB 4AULA 3TRHA 1B6SA 1J5EB 1SVIA 2C3UA 4AKSA 4DCJA 2FUNB 3T7DA 3WL3A 2E4WA 2O3UA 4EDFA 1DJLA 4JUAA 4C87A 2DWPA 3QGMA 4IG9A 1Z5GA 4JITA 1Q6ZA 3ZBQA 5B7PA 2FSSA 3TOXA 1SCUA 3UHOA 5IKMA 4BC0A 1SKUA 4HDOB 2FQYA 5TXGA 4E33A 3GFGA 3MEQA 3SE7A 4AMVA 1IBSA 2EW8A 1U3CA 2ZJ8A 4PHGA 1M2VB 2FE1A 2G40A 2M32A 3FWPA 2VTBB 4G5RA 5I6DA 1G38A 3P0HA 3JAKA 3MTAA 1MBZA 4JBNA 3RVNA 4B6PA 4U0JA 3GPIA 1DZ3A 1GWNA 1WZUA 2R4UA 3JRWA 5I9BA 3VR6H 5CEFA 3FKSD 3OBBA 4BLWA 1TLFA 5FUYA 3B2NA 1VG8A 2BIFA 3EH1A 16PKA 2KLBA 1R18A 4IVQA 1T9AA 4BB6A 1PJAA 1Z07A 5B3LA 1SUBA 3OZIA 3I3OA 4NVRA 2HN9A 2FCRA 2PNJA 3TCNA 4EKYA 3SLKA 4EY7A 5IKEA 1M7BA 1U9ZA 3V1TC 1X7XA 3IUYA 4EVIA 5JZBA 1P6UA 4PNZA 1Z4PX 3N0VA 1R6DA 3FZGA 1NUQA 1E1QD 2CSUA 3INGA 3SCZA 3TJMA 5HVNA 5TS2A 2J6HA 1AB6A 1YS6A 1AHIA 2OY0A 1FS5A 2G0TA 1A95A 1JQKA 3LQKA 2X0NA 4IDHA 1J0EA 1DXQA 1RBQA 1G21E 3PWTA 4I1OA 3UCFA 3VH3A 1AE1A 2VXOA 2Q0XA 4J91A 4Q7EA 3VR4A 4OQNA 1LWNA 1T5BA 2O3JA 4XVRA 4DNQA 1Q0QA 2WTNA 3EEIA 3NXSA 2GNPA 2BGNA 3ANTA 1IUNA 1NXTA 2FHSA 1OTXA 4REQB 2XOKA 4LXUA 5T6MA 4FS3A 4MGYR 4YQYA 1X80A 3B1WA 4BZWA 1JEYB 1YRYE 4B4KA 2D7DA 4PVDA 4GVXA 5E2IA 5EESA 5EIFA 1LBEA 2C2OA 1K4YA 3UTDA 5EHIA 2JL1A 4GGOA 5ECYA 1IEQA 2I6XA 3IAS6 4DSZA 4KWIA 2AC2A 1PLKA 4BCDA 4FCTA 2C2BA 5ICMA 1PGNA 3K9FC 3ML1A 2I2DA 2YBDA 3ZJVA 3T61A 4JEIA 4B76A 4BVLA 3FCUB 4TT3D 4PG4A 1P39A 4KQ6A 4L3WA 3JARB 2QD5A 5K51A 1KRHA 3WC4A 4D9MA 4EKGA 8LDHA 4RIFA 2PRJA 1FMJA 3FBGA 3JYHA 4AW9A 1U0LA 2F55A 4ISBA 3CZRA 1NXXA 3IEPA 3K9HA 1BMFD 3RVKA 1ECBA 2NQ2C 2EKZA 5E2AA 3V42A 3SXUB 1G6HA 1MH1A 3G9UA 1TEXA 2BRUC 4CMEC 1FSFA 3WLKX 2F3QA 4F9TA 3ORHA 4XQCA 5L3QA 2WKRA 3LUCA 3OU2A 1L4KA 2FPGA 1A77A 1ESMA 4MKGA 1Q7CA 4J4BA 2B8WA 4M0FA 3ZV7A 2H08A 3U2QA 1JEOA 3PEUA 2Q1XA 3TI7A 1L5OA 4IQ0A 4YV0A 1YHYA 3PITA 4JI7B 1QM5A 2AG8A 5L45A 5EJ8A 4E5UA 4AYWA 3ZV4A 5FJIA 3JWPA 3CUVA 3E81A 2MYNA 1XU4A 4DF3A 5HIKA 3JSXA 3TXXA 3DTVA 4ARCA 1EE9A 2GZDA 3AETA 3HY6A 1Z0IA 4LVCA 4YREA 4CM8A 1P2VA 3I9FA 4BJHB 1UJMA 2O59A 5ES3A 4QYWA 1QGUB 3DDNA 4UCQA 4YMVA 3AMVA 2BGWA 1XMPA 3EHDA 4NENA 4GX5A 2R7MA 1XTRA 4AM8A 6REQB 1LRKA 3FAZA 1T43A 1DBWA 3F4KA 2GXUA 3OZFA 1RKUA 2WWYA 2BEUB 2DQKA 3BFJA 4UHJA 2FW9A 4HB4A 1E4YA 5BQ3A 1YRQA 1V3QE 4TLEA 2FWRA 4KHZA 4GO1A 4QUDA 3AUYA 1MO2A 2UU9B 2AUNA 5J63A 2CSXA 4ZOLB 1U65A 3GN2A 4P7BA 3AUKA 3UMVA 1SXJB 3VNUA 4G5HA 3UC9A 2HREA 1U0EA 1GZHB 1Y34E 2Q4OA 5LCXA 4KTVE 3PV0A 4NMMA 1W88B 3FUUA 5KSWB 5G53C 3QHAA 4KHPB 4LX8A 3M5PA 4YGXB 2OUKA 4JQSA 2X4LA 4ZHSA 3AIMA 4YCNA 3GZTB 3FKQA 3ERCA 1ZHOA 4ZJZA 1YWGO 3GAZA 2FSVA 3B6IA 3MJDA 4LBWA 4PLGA 5KDLA 4AZ3A 3U44B 5AM5A 3HDHA 2JHCA 4GOLD 2OWEA 1EDZA 1FXUA 4WVFA 1FP6A 5E6UA 3UGQA 5CGZA 4DW8A 1YO6A 3RYFA 3OIYA 3ZIUA 5ICSA 2QAIA 5LM3A 5BRNA 2ET6A 2B35A 5CHYA 3RFTA 3RO7A 5J43A 3GPLA 2IYYA 4PO9A 1HZJA 3RPEA 4CL2A 3VAZA 4PLCA 1CBUA 4HB2A 5AICA 3I5MA 5LU8A 4C4PA 4KRGA 2YICA 4ZDJA 1G2PA 1S89A 2QX8A 1TJNA 2PSFA 2Z9BA 1IQRA 4RYDA 3TBHA 1RBZA 2HPHA 3WIEA 1Z82A 5FLEX 5GM2A 1OKKA 1U90A 1XTQA 4I5EA 3UK6A 4TRJA 3AY0A 2FLVA 3TVYA 4BVEA 3HU2A 4PYRA 1NKSA 5AT1A 3M6MD 2WWGA 4KFSA 1PCXA 5I9SA 4S2EA 1TAHA 2NPIA 2ERCA 2FP4A 4O2AB 5BR8B 4FI3C 2AJDA 2JBAB 2QD4A 3KYDA 1UZNA 3CR3C 5HRAA 3ZCRA 4MRNA 3UT0A 5HP4A 1M5RA 5H0IA 5HR5A 2BPOA 3V9AA 4AF6A 1IPEA 4J16C 1BG6A 3KXIA 4HWRA 4NE7A 2AN5A 4JKIA 2DB3A 1JA1A 4A73A 1TZBA 1E6UA 4MW7A 2BF7A 2EYUA 4HFRA 3T99A 1QVVA 4P54A 1Z68A 4EY3A 2R8BA 3TTYA 5T5QA 1NE7A 5D6NA 5ALVA 3R1IA 1PKXA 4KUHA 5HMLA 4YP7A 4AS3A 5FPQA 3U4AA 4KPYA 2QX7A 3S40A 1K6MA 2OZLA 2O8BB 3ZWYA 4JLAA 1Q11A 2V7PA 2WT4A 4PAQA 1JHZA 5JFOA 4MS1B 1AZLA 4L85A 3BWDD 3KSUA 4FMDF 1DX9A 3CX3A 1EUCA 4MX8A 5BNWA 1W36B 1RWMA 1ZCAA 4BLSA 3JY6A 3DPIA 3F6CA 4YMIA 3SI7A 4ZZ1A 4L4YA 3AOEA 3C3XA 2W8BB 3FI9A 2NACA 3GQVA 3G2IA 3G0BA 4LOKA 4Y7DA 3WIOA 5FUMA 1WBDA 4DMCA 5DHAA 2QRLA 1MHPA 2RH5A 3RCBA 1OVMA 1P4GA 5JV5A 2PX0A 3KZCA 1RLUA 2V74B 2LDBA 3F71A 3HDVA 1E3TA 3WGIA 2I22A 4HYQA 2ZYSA 3R7SA 4WBNF 1C0KA 4QOGA 5M2QA 1DC7A 5AI9A 1KS2A 2QV7A 1O5IA 2Y0DA 3IUMA 4M98A 4ZVMA 2G67A 4O4JA 1L8OA 1I4TD 3LWNA 1QQ7A 2EXXA 3QWIA 4OI2A 3K5WA 2YUTA 3UWOA 1SHTX 3ENWA 4HLUA 4HQFA 2SICE 3R7LA 5KYXB 4PYOA 1LNZA 1HMYA 2H17A 3BE8A 1KFBB 1KQ3A 4G9EA 4N5HX 2PE5A 3DG9A 3E0XA 4TGLA 5GONA 3G5MA 2REXB 2RK6A 3KXDA 1XQ6A 2CFOA 3ZVNA 3K1JA 1XP8A 2GJKA 2I7VA 3ZCQA 5JSZB 2XBMA 4UM8B 3FETA 4I81A 1UODA 3RVJA 4PXAA 1AF4A 4OGGA 1KDYA 2LKCA 4KUEA 1XSEA 1U3TA 3E18A 4JBWA 2QX9A 4O2LA 2GBIA 3OQJA 3I2FA 4PPQA 3BSFA 1ZOOA 1RQRA 2BM8A 3DKKA 9LDTA 1OWOA 2KBEA 1NP6A 3D4BA 4N0PA 1GZSA 2ZATA 4OUDB 3WGUA 3QF4A 1LX6A 1CYEA 2WJ6A 4N0EA 1QOPB 4IUBS 3ZCXA 2O1WA 2CDAA 2XCLA 3VV2A 5LL6P 1MO6A 2JASA 5JCZA 5JW6A 3DV2A 1C1DA 3H83A 3NIFB 3ZYZA 1XMQB 1EWTA 1SVMA 3DQPA 3M5WA 1UPAA 2V0NA 1CG6A 3L7MA 4YCDA 2IEZA 3IL2A 4KK4A 3C39A 1V5FA 4JLPA 4MINA 1YDEA 3DKRA 4D4IA 1K97A 2VNHA 2X1VA 3IBGA 4G8DA 1QP0A 4JASB 4A0HA 1GPDG 2JPDA 2ZRNA 3WK6A 1R00A 4MYHA 3PXCX 3KOXA 3D3KA 4WNAA 1JG4A 4TT8A 4EIWA 3NPMA 2VK8A 4Q24A 4X95A 1X8LA 3K32A 4HUQB 3SC2B 3KETA 2NVUB 1J2TA 2WUEA 2PD6A 3OEYA 4ZPXA 2WTBA 3E4CA 5EE5B 1AA6A 1XEXB 5BSVA 1HRKA 2CZQA 3D8UA 4X1IA 4V0MA 4KRXA 4Z9AA 4L5CA 2X1HA 3TVDA 5I7SA 1SZPA 4LYYA 2V4ZA 1JR2A 4LE1A 4R8SA 1F2UA 3QE4A 2C7PA 4KMSA 2H1WA 5C5IA 3EZNA 1Z38A 2IZ0A 3H97A 5FV7A 2I6UA 4KQWA 4KQMA 1HSZA 2CBGA 4MKXA 2Z3ZA 4FEEA 4ZODA 3RSZA 1QFYA 1M1XB 3N75A 3RE1A 5BRAA 1T3GA 2UZAA 4B7CA 4Q47A 4YUVA 4YONB 5KAMA 2IY9A 1MW8X 2ICAA 3AEXA 4BV9A 3QW4B 2HNBA 1C1YA 3C7CB 4A8TA 4CR6A 4ND5A 3MCVA 4CMBA 4MULA 1VBMA 1MXFA 1LY1A 1VE9A 1ACMA 3Q98A 4GGPA 4JP8A 3MBKA 3Q9UA 5EIBC 5EMMA 2WHEA 4Y0NA 3QI7A 2P5SA 3NVDA 3TLEA 4D46A 2IZ7A 3K2QA 3KD2A 3HRKA 1Y48E 1L7DA 1QYWA 3LCJA 2MDTA 4JVMA 3UK0A 1YHZA 1U11A 4Z53A 4R81A 1E2KA 3VR4H 3MUFA 2IBSA 1QIGA 4Z4GA 4QPZA 1T2AA 1C9YA 4GYKA 1H4TA 5B1YA 5J59A 1A8IA 4NCJA 3UJNA 3L7JA 4WZ6A 4Z1MA 5YASA 3R6WA 3Q3HA 5IJ9B 2GBGA 2OLEA 2DOKA 2B98A 5ALMA 1R9GA 1SC9A 3PWZA 4CTNA 3UH1A 5CB6A 2WG0A 2D54A 2VF2A 3PPWA 3G5TA 5LBTA 1J0DA 4RTRA 3VYWA 1SBZA 4IS2A 4OTZA 5I9TA 2BSQA 5EXXA 1BXRA 1BROA 4CM3A 3TRFA 3H3FA 4QLBA 3HBMA 4D45A 1MAUA 4YRIA 3GLFB 4TVBA 4N48A 1CQIA 1L1RA 1WSDA 1HLDA 1RZUA 1TT5B 2WNHA 4LY6A 5FFFA 3N87A 4O4LA 4OCZA 3V4SA 5I47A 3P2IA 4Z3OA 1DEKA 3J7TA 3AGPA 5HIMA 4AG6A 4ER3A 2RGUA 3H4VA 3LPNA 3LECA 1UDWA 1WW3A 2C5LA 2XVYA 2I4NA 2GK4A 3HYSA 3MJHA 3ZBUA 3EH2A 2D6FA 2FUG6 1ZC3A 3MJVA 3RUFA 4FTWA 3KB2A 1H2ZA 3KLNA 1LI4A 2C2YA 1NFFA 1E8NA 3NBMA 4JL8A 4R1MA 4U8GA 3V34A 2VQ6A 4K26A 3QU9A 3WYAA 3A6LA 1RMQA 3OE4A 1GGEA 1N8KA 1RVV1 4CDMA 2IX3A 5JT1A 3EVNA