3CZ5A

Crystal structure of two-component response regulator, luxr family, from aurantimonas sp. si85-9a1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
141
structure length
141
Chain Sequence
STARIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYRETTPDIVVMDLTLPGPGGIEATRHIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAGRRAMSPDIAQEIAEERVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component response regulator, LuxR family
publication title Crystal structure of two-component response regulator, LuxR family, from Aurantimonas sp. SI85-9A1.
rcsb
source organism Aurantimonas sp.
molecule tags Transcription regulator
total genus 51
structure length 141
sequence length 141
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3cz5A00
5JS2A 3OMWA 2N9UA 1JL3A 4JASB 5EWLA 3O74A 1QKKA 4MR8B 5KC9A 2IPMA 2R47A 3HSYA 3IP5A 5KWSA 2FTKE 2FXIA 3BREA 4OLAA 3IP7A 5TQ2A 2FEPA 5IEBA 3TB6A 1TJYA 1Z17A 5HQJA 1RXIA 2FSPA 2CHFA 2FN8A 1PNTA 3ILHA 3KJXA 3F6CA 3HM9A 3N6VA 2QSJA 2ID9A 3CU5A 4EYOA 1P6QA 1L5ZA 1WETA 3HCWA 1ZN2A 2Q5CA 3OO0A 1H9CA 3JVIA 1RPJA 3CKMA 3FMVA 3O1IC 3D02A 2QU7A 4G0QA 2NUBA 1GCGA 3E3MA 3GBPA 3R0JA 3Q7RA 2PUAA 3DLBA 2WJAA 3BRQA 5IUNC 4KMRA 3OQMA 4JB2A 3QK7A 3Q7TA 3HZHA 5DLEA 3EGCA 1JDNA 5KC8A 1D5WA 3L6UA 4JAVC 1SXIA 4RK5A 1SXHA 4RXUA 1U2QA 7ABPA 1SRRA 2V0NA 1HEYA 3GL9A 3QLVA 1MB0A 2HPHA 3H1GA 3KHTA 3RVKA 4RK4A 1BAPA 2PAFA 2JVJA 1E6MA 3CZ5A 2LP4Y 3QLUA 4YRZA 3B2NA 1D4ZA 2IPNA 1BDJA 1LK0A 5GOTA 3LUJA 1JF8A 4S05A 1W9HA 4LX8A 5EWJB 5B3JC 1U8TA 4EYGA 1EWTA 2VYCA 4PEVA 2QZJA 1FQWA 3HDGA 3KCNA 3CLKA 1JFVA 5TQ0B 1M5UA 3T6KA 1NTRA 4G0XA 3IPAA 4E7OA 4RK0A 3URMA 2GWRA 2MYNA 4PICA 1YK1A 3RVLA 5KQPA 1QQBA 4DN6A 4ZMSA 1YVUA 2VUHB 5FBHA 3N53A 1DG9A 1QP0A 2NT3A 3MYYA 2JRLA 1ISSA 3MIZA 3IDOA 1KGSA 1D2AA 2MSKA 5TPZA 2FMHA 2MYUA 4MR9A 2PUCA 3KYIB 1XHEA 3LKVA 2FQWA 3OLWA 1ABEA 3NHZA 1DRKA 3DBIA 5IBQA 3DLHA 1EFAA 4HNSA 4KV7A 4ZJPA 2P4UA 1DJMA 2IPAB 2QVCA 3E61A 1NATA 1Z16A 2IYNA 4W5NA 4Q6BA 2LUOA 3VNAA 5CNMA 3LUKA 4B09A 4WT7A 3HEBA 3T95A 5FWXB 1U2PA 4QYMA 1BA2A 1D1PA 1QO0D 2NZUG 2PKXA 3UKJA 3GA5A 1B00A 4GNRA 4MS3A 3H5IA 4TMYA 6ABPA 4F06A 3EODA 4MS3B 5DCLA 5KQMA 1NXSA 3I45A 4KZKA 4QICA 4MS1A 4MAAA 1SXGA 3IPCA 3ILYA 3OLYA 5GQSA 2YHBA 4FE4A 4LE2A 5DGCA 4MS1B 8ABPA 3JS5A 1LJUA 1BDIA 4E7PA 1XWWA 1UDRA 3CG0A 5IC5A 4MS4B 4YR7A 4N47A 3RQIA 2CD7A 4G86A 1M5TA 2PUBA 3JTEA 2MSWA 3C3KA 3H6HA 4PE5B 3KYJB 4H3HB 1PEAA 3TO5A 3T38A 3C3MA 4EY3A 5HSGA 3QLVC 4TN5A 4EVRA 2O20A 4MR8A 3HXMA 4RK7A 1ZGGA 1Z13A 1OXKB 4GPAA 4OBBA 4G0OA 4P98A 4Z0NA 2XDYA 3O21A 2WY2D 3QLUC 1P2FA 1YS7A 1NXXA 3N0XA 4KPYA 4HNQA 1F51E 4IRXA 3LOPA 1Y1LA 4OTZA 3BBLA 4W5QA 3LKBA 3HK2A 3FFXA 1QMPA 2JCGA 5JS1A 3G1WA 4RSMA 4OLBA 4RS3A 1FFGA 1ABFA 2FKAA 3RVQA 1QQAA 4UHKA 4JB0A 1OXBB 5BQ3A 4ZMRA 1RZRD 4EUKA 4EYKA 3EJWA 1A2OA 3H5LA 4G0ZA 1DBWA 2FVYA 2FMFA 3H6GA 3OO1A 4JP1A 2HQRA 4F11A 5HKOA 3MM4A 2ZAYA 1MAVA 1C4WA 5JNSA 3DGFC 3A0UA 1ZVVA 2A9PA 5IUKC 1YTUA 4F12A 2PL1A 2JBAA 2GX6A 4OATA 4RK6A 1AB6A 2YHAA 4MPTA 2JBAB 1KRXA 3TMYA 1USKA 1DBPA 1GCAA 2NZVG 4LRQA 4LZLA 5CHYA 1DRJA 1QP7A 3I42A 4FE7A 1USGA 3SY8A 3UK0A 4KVFA 4Z4EA 3IP9A 3N8IA 4LE0A 2E4VA 3O2SB 3CZCA 4MLCA 3CG4A 1M2FA 5EWJA 2FEWB 2L17A 9ABPA 4LDZA 4Z4CA 3HUUA 5TQ0A 5IEJA 2AYXA 4NQRA 2JVKA 2R4QA 3F7NA 3HO1A 4MRMA 4D6YA 3H5OA 1DC8A 3K4HA 3F6PA 3O1JC 4MRMB 5FBKA 5IX8A 3CTPA 2BGGA 5CNKA 3TX6A 3H5TA 4YGXB 1IIBA 1P6UA 5I4CA 3GT7A 4L85A 5EWMB 3CS3A 4YWHA 1ZAYA 3MF4A 4RXMA 1XHFA 1NXOA 2E4WA 4EGSA 4MYRA 3Q15C 2RJOA 1E2BA 1KRWA 2CWDA 2JB9A 4NCBA 1RNLA 3NNDA 3UUGA 1L5YA 1ZDMA 2NT4A 4WXEA 2PE5A 2DRIA 3RVNA 1M2EA 4WXMA 3M6MD 2FEKA 4CBVA 4DADA 1Z25A 1VKRA 4OG2A 4IILA 1APBA 1JYEA 4ML3A 4PYRA 4P1ZA 2PUEA 3HVRA 4RY0A 5BRJA 2PL9A 3N0WA 4KRFA 2L18A 1KMIY 2M1ZA 5FWXA 3OM0A 4ETNA 3Q41A 3KLOA 5CNJA 4XXHA 1DBQA 5JNUA 1DZ3A 4NV3A 6CHYA 2GKGA 4DQDA 1LBHA 4Z4GA 3KS9A 3SNKA 3KSMA 4YS6A 5C5CA 4YCSA 4XLTA 1DC7A 1NY5A 2I6FA 3LUCA 3OMXA 2QVGA 3RVJA 1K68A 2PJUA 2PUGA 1CEYA 2RJNA 3M9WA 5TQJA 1FFWA 2HJ9A 1CYEA 2IDMA 4MS4A 1JBEA 1Z2EA 3RVOA 1Z2DA 1YMVA 3CHYA 4RU1A 3T8YA 2QV0A 4G0PA 3EQ2A 4Z4IA 1ZH4A 1E6LA 3QEMA 5T7BA 5JNTA 3QEMB 4RKQA 1S8NA 1YS6A 2E4YA 3CFYA 4TLLB 1JH9A 1Z26A 3KLNA 3LUAA 4LDAA 1ZESA 2HSGA 4ZYLA 2PUDA 2PMCA 4H60A 3O2QB 2IKSA 4KFCA 3NNNA 1AB5A 1QO0A 4WZZA 4YLEA 2MYTA 2TMYA 3EULA 1QNLA 1TLFA 4RKRA 4JA2A 3RVPA 1ZITA 4YV7A 1YIOA 1SD5A 2H3HA 3C3WA 3K9CA 3H1EA 4JOQA 4Q7EA 3I09A 1EWKA 5TPWA 4NICA 1MB3A 2RDMA 3O2JA 5IUJC 5TPWB 1JFSA 2FMKA 3FDFA 4RK1A 4IMJB 3A10A 3W9SA 3RVRA 3LMKA 4MQEA 4O5AA 1VRVA 4MQEB 1JLKA 5FWYB 5C5EA 4MR7A 2FW0A 4KNYA 2HQOA 3CNBA 3BILA 1YMUA 3LFTA 4MR7B 1T34A 3HJFA 3O75A 5EWLB 1A0OA 3Q9SA 2AYZA 3SAJA 3QX9A 2IOYA 3D8UA 3LUHA 1GLGA 5TQ2B 3GYBA 4O1HA 4FB4A 4IGAA 4PZ0A 2B1JA 1EHCA 4W5RA 2A9RA 3C6QA 3LTEA 3MMNA 3OLZA 4HYEA 4RY9A 2R25B 2W42A 1I3CA 2VUIB 4N0PA 1GUDA 3GBVA 3H5VA 4G97A 3FGZA 3JVDA 1CHNA 4ETMA 5ED4A 1PHRA 1USIA 1F4VA 2OENG 1JDPA 1Z12A 3I5AA 4HNRA 1ISRA 1YK0A 4IMIB 1RZRA 4LE1A 2WJWA 1JX6A 3NHMA 4F3TA 3OLXA 4KK4A 3ROFA 4N41A 2A9OA 2IPLA 4Z99A 1NXWA 3QEKA 3OLVA 2LBPA 1DCKA 2GBPA 3JY6A 4O1IA 3L49A 4IF4A 3QLTA 3KG2A 2ID7A 4D6XA 1DCFA 1TM2A 3MA0A 4UHJA 1MVOA 3RVMA 5JNWA 3HS3A 5EWMA 5HM6A 4RY8A 3RH0A 4QPJC 4D74A 3ROTA 3P9YA 3SM9A 5TPZD 1K66A 2X7XA 2WWVD 3M9XA 4L4UA 1EAYA 2P9HA 2RGYA 3IP6A 2MSLA 3N75A 5CNIA 5T3YA 3A0RB 5D2CA 4S04A 3TD9A 4F8JA 1BDHA 3FFWA 3OQOA 1PNRA 2PUFA 1BVHA 5E3JA 4YP9A 1EWVA 5JNVA 3KKEA 5JNRA 3QX8A 3DZDA 3GWGA 2MYPA 1NXVA 3RVSA 4RV5A 3O1HB 2R48A 4Z9AA 1P8AA 4G0MA 4EVSA 2L19A 3Q7SA 2HQBA 2M98A 4KQ9A 4QYWA 4TLMB 2WRZA 4ETIA 3NNSA 1Z18A 4W5TA 2E4ZA 3KTOA 4ZPJA 1QP4A 5BRAA 1TVMA 2QR3A 5PNTA 4XAQA 3F73A 4Z9BA 2QW1A 4Y9TA 4W5OA 3QELA 3HDVA 2A9QA 1PUXA 2FN9A 4NCAA 3DGEC 1TMYA 4MR9B 3QELB 1ZGZA 3CRNA 1QPZA 1D1QA 3N0RA 5ABPA 3NBMA 3MQ4A 1E6KA 4KQCA 2WMYA 2VK2A 4WWHA 3SQNA 1JWLA 2J48A 1JYFA 2CHEA 1A04A 5TE9A 4KREA 4EVQA 4MLDA 2E4UA 5KQLA 3LUDA 5DKFA 4EYQA 3SG0A 3H1FA 4KK3A 2E4XA 1JFTA 5KI6A 5B3JA 1FFSA 1J56A 1W25A 4N0QA 4G0YA 1MIHA 1FSPA 1PEYA 1URPA 2JVIA 2FLWA 2FMIA 3JPYA 4MQFA 3G85A 2KYRA 3HV2A 2WB4A 4Q6WA 1VPWA 4MQFB 4N76A 4RZSA 3GV0A 1U0SY 1RXEA 5DTEA 3H75A 1Z15A 4M88A 2JK1A 1ZHHA 2PLNA 3LUGA 3LUFA 4Z4FA 4XARA 3FFTA 3S99A 3EAFA 5IULC 4N03A 1C0EA 1LJLA 1JHZA 1R8JA 2LPMA 3EQZA 1VLZA 3OM1A 4RWEA 2FQXA 2GI4A 3VNBA 4WUTA 5BR1A 4XFKA 2ZWMA 4YO7A 3BRSA 2B4AA 3H5WA 2F8TA 1GUBA 2LIVA 1DP4A 1U04A 3C97A 1ZY2A 2L2QA 3JPWA 1NXTA 2FQYA 3OQNA 3GRCA 5F64A 4H3KB 4RDCA 4RXTA 2QXYA 5KQGA 2H0AA 2OQRA 4Z4HA 4MGEA 2F8SA 1ZH2A 4XASA 3A3KA 1LBIA 3HUTA 5FWYA 3EDCA 2FLKA 1DCMA 1NXPA
chains in the Genus database with same CATH superfamily
2DT5A 1AIPA 4MW5A 3CZPA 3V1LA 1L4KA 3G9ZA 2FXIA 5LIPA 2X15A 1GSAA 4OLAA 4ZI5A 1E8DA 2RG1A 4DA8A 3TSAA 4MHSA 3ADCA 1EUZA 5ER9A 5HZKA 5BXQC 2YYAA 4MSUA 1PS0A 4TV9A 2C59A 3QWFA 3LCJA 3PQ2A 2P9JA 4JCOA 3TJMA 5LQMA 2PD4A 4UAGA 2QTAA 3TD6A 3MT9A 2ZBGA 1UBTS 4BGIA 4PYNA 1K7XB 1WL8A 3AHEA 3P9KA 4RTOA 3RS3A 1E3JA 1ND5A 2Q5LA 4EI7A 1C7ZA 1T1GA 2XRFA 2H2IA 4YDQA 1Z4KA 2CLMB 4A8HA 4TKVA 4UAJA 5ARBA 3CONA 5JSQA 5DLEA 1E0DA 1JDNA 1XK6A 3EGCA 1FDSA 4Q7LA 2D2IA 1CNMA 4MV5A 1GU7A 5E2IA 3LY7A 1ZR2A 4DHEA 4JUDX 4WW0A 3CM0A 1MRZA 4BX3A 3OY7A 3FUTA 1DPFA 1MUUA 2I03A 4MPRA 5AI4A 4TKUA 5KAPA 1VE5A 1S2MA 3PBKA 1T6BY 2BFPA 3Q72A 1L5QA 3O94A 4PSKA 3WJAA 4ZJZA 4A9AA 4NULA 5AQEA 4CIAA 3L6OO 2OZVA 1SQSA 1R7RA 5LJIA 4OHFA 4QWWA 4BRUA 1GFSA 2C3YA 3DHEA 3DHVA 3E3OA 4INZA 4QJ4A 3KE9A 4NX2A 3T5TA 4CRWB 3R5XA 1HXHA 1FA9A 3MAGA 1W9HA 3OTWA 5AKJA 4AKSA 1E4YA 4QSMA 1ZQ9A 3C4VA 1JSRA 4KVGA 2C2GA 3DO5A 2QZJA 4MVXA 3KCNA 4YMIA 5HK8A 5TQ0B 2QLBA 3HNPA 3TZ6A 4MX8A 4PZUA 4HF7A 1R0LA 4DR4B 2B69A 2IS4A 3CMMA 2BFFA 2P5UA 3LBYA 2ZTSA 2Z5LA 2C9DA 2H2AA 9ATCA 1IG0A 1S2GA 4AZ0A 2B8EA 2JDIA 3ZD8A 1RJDA 1T8WA 2FSIA 4WXPA 5IM4F 1DG9A 4KQXA 2R2AA 3UENA 4LKRA 3VZPA 4WN9B 1HDEA 1HDZA 4E31A 5JZVA 2YHIA 2CMHA 3NTUA 1NOJA 2ANBA 2O2SA 3SJCA 1TCVA 1ZKMA 4DIUA 3N07A 3OU7A 2RMKA 1JHRA 1TM4E 2ZXEA 3Q9LA 2R3SA 4IUYA 3VQTA 3H9UA 3GLRA 4HDNB 2R1UA 4N7BA 4WI1A 3E23A 5CDYA 5HOEA 1UJNA 1PV2A 2LNDA 1O6ZA 3DLHA 5ICEA 2X58A 3QU4A 1GVNB 3D7MA 1LQTA 3ZBTA 4ILKA 3M6WA 4LIPD 1CS4C 2ZM5A 1WCIB 2AMVA 1P0FA 1AXGA 1QXSA 3LCVB 2QAJA 2VNSA 2VKQA 3AJEA 3JQEA 4TTVA 5K4GA 1FXUA 4YQYA 5TMEA 2OAQ1 3ANTA 2B21A 1N7HA 1YI8A 3MILA 2UXCB 3A37A 1QVZA 2BONA 2HK7A 1SUFA 2BEUA 2Y66A 3K6JA 3QE0A 4XQ9A 5JD3A 3VSDA 1Q0PA 1XU9A 2OG2A 2WDZA 1S1MA 2JGNA 2NTNA 13PKA 5B57C 1XXLA 4HO1X 2VHWA 1NXSA 1IVSA 3L7IA 2G8NA 2OOKA 4EPWA 3EISA 5AKLA 1NIPA 1UQUA 1D3AA 2XMBA 4DUZB 2RD2A 5SY6A 1Y3HA 3TM5A 1W5EA 3DMHA 5ECWA 2ZJFA 2GZMA 3ZV3A 4WACA 5BSTA 3MAAC 2B37A 1NBHA 2WSSD 3FDZA 2FSVA 2WP8J 1M0WA 3HFGA 3NIDB 2ZYVX 1E3QA 4MA4A 3WB9A 4OH1A 4CF3A 1DQRA 3NH6A 2O8EA 2B83A 1OWMA 3EG9B 4N7MA 2GFIA 3QWAA 1N5MA 4PHHA 2YOHA 3QVSA 4EY3A 1GYQA 5HSGA 5HUJA 1B4DA 3GFRA 4ZAGA 2Q7OE 1OZ0A 4EVRA 2FG7C 5BQPA 1XRRA 2B98A 3PHCA 2PSSA 3BIOA 1LLQA 4G0OA 1JEAA 1Z2CA 3O21A 2IS1A 5EKSA 3N0XA 1XEWY 3AUAA 3BYZA 2JLZA 1LDYA 5MHTA 3EW7A 3HJHA 3LKBA 3BMXA 4GVPA 4IRUB 4JLBA 1OLXB 3ZI4A 1VI6A 5HF5A 3OTHA 3JQ8B 4WD3A 1Z47A 3GZ4A 5HE8A 1Q0LA 2JJQA 2I3ZA 3H5NA 2W43A 1QGDA 4U7DA 1F8XA 3HADA 4D0GA 3EJWA 4GLOA 3AP2A 4DRXB 3PWZA 3EDRA 4BDTA 3HQ4O 1KVSA 1S3GA 3T61A 4IFTA 2VXOA 2DHRA 3SPXA 3GMIA 3ZHYA 1IOVA 3DO6A 4HDSA 1V1JA 4YCMA 3UMYA 3MEQA 2CL0X 3QFRA 4XWAA 4XPIB 5EZQA 1AK2A 5FHRA 4BB6A 3EOZA 4IJKA 4KGXA 4MROA 1FYEA 2OQIA 2NUAA 4JIGA 1XTZA 3LVQE 4XVRA 2H5JA 4OA5A 2AW3A 1G8GA 3OCYA 1R6DA 5ALDA 4NMWA 1PD0A 1W75A 4I55B 5AUQA 3TOXA 1XVIA 4HFMA 1VHQA 2GTIA 3VNSA 2PRSA 3I42A 1DQSA 3ZHBA 4X62B 2XZLA 1HQCA 4KN5A 4CIYA 4Z4EA 3N8IA 1GR0A 4EFMA 5IFKA 1L8QA 4BPBA 4Y6GB 2PU7A 3CBGA 3JXEA 3DL2A 3OEYA 5TF4A 5TMBA 2RB4A 1G98A 4AJ2A 1X1CA 2GAAA 3FBGA 1AHHA 1T9BA 4EX6A 5LJLA 3HUUA 3R5KA 3SXUB 1ODLA 2GZHA 3QFFA 4GFDA 4ZIRB 2R2GA 2EZTA 1P0CA 1P60A 4BN5A 3HO1A 2ATCA 3PHBE 3KSBC 2Q99A 2DQYA 1KI9A 2OSBA 1TQ8A 4E4YA 2JLBA 2RK6A 1XZLA 3PICA 1FYXA 1ZH8A 3IHLA 4P7BA 5CNKA 3ER9A 4M0FA 4DARA 5I4CA 3TAXA 2PIAA 5EWMB 3PA6A 4E4RA 3CS3A 2W8BB 2WMDA 1T0HB 3JAKA 1MABB 3OA0A 3TL3A 4RXMA 3TR5A 2C7RA 1DBRA 1VKNA 5DBGA 1ZNYA 3JVUA 3NP9A 3LXRA 3STUA 2A94A 2A5LA 2JB9A 4HEA1 1CQXA 3DO8A 1X3SA 2B1IA 3QW2A 2WFLA 4KZPA 3RTCA 3UQZA 3RSOA 1GQSA 3GN2A 1C3OA 4Q4HA 4BKOA 2FSVC 2QMQA 4KOEC 3PC4A 1T5LA 2XNHA 3ONEA 1OLSB 3EWSA 3X2SA 2PWPA 4EFLA 5KSYA 1YFJA 2IHJA 3QUQA 1YRAA 5G40A 4BO8A 1Q0TA 4FUTA 2PT5A 3SX0A 2QY9A 3KQUA 1A7KA 3U7JA 5ALYA 2ZUDA 5KWEA 5B6IA 2YR0A 5LA6F 4NZYA 1GYPA 1IY9A 1V0JA 1W0KD 2D5AA 2FDXA 3P2YA 4ESHA 2IIBA 1DZ3A 4F9FA 2HSEA 5IKOA 1V5GA 5E0KB 2IC5A 4BFTA 4Q21A 4KLNA 2BIFA 4LDPA 1RC0A 5LDGA 1MOQA 4JCCA 3N2EA 4MUAA 4URUR 4F9TA 3S8YA 3OMXA 4UZEA 5KTNA 2C4KA 1RADA 4F04A 1AZLA 1K68A 1WU8A 2GEBA 2JK0A 3IB6A 2ZT7A 2F43A 1NNSA 4ZEXA 5I8PA 1PR5A 1YB4A 4O8ZA 2FPPB 4R31A 4AUMA 4YUAA 4C1BA 3IKMB 1J49A 3IMGA 4TROA 5KHAA 1XPJA 4MICA 4JVMA 2QV0A 1Z29A 4XFJA 4U0JA 5ADHA 5GY7A 3TDNA 4IVNA 4J3JA 2AFIB 1ZUNA 3AUFA 5KWJA 4NHEA 1DFHA 1PFWA 3L1VA 1WSBA 1U1IA 3QOXA 1P2BA 3FCUB 3IQEA 2HBYA 3DHWC 5AXCA 1X7YA 4BCBA 3O4JA 4D7AA 4FMPA 2Q1TA 3UT5A 5FI3A 1ZNQO 1W34A 2ZPAA 5K6AA 3HBFA 1K7YA 1S1CA 4Y2YA 3GAMA 4MQ6A 5CYFA 1ZIDA 3AFIA 2FR1A 2XMQA 3CO5A 4HUQA 1PL7A 2JASA 4OMDA 3LT0A 3KSAC 4RD3A 1TA4A 3OTQA 1P7ZA 3KWMA 4JA2A 3CXRA 4CR8A 4GMGA 1YZHA 2RCNA 4TSKA 3SS7X 1NNUA 1TCCA 4YUXA 1DEXA 4NQZA 3HU5A 3I09A 4XE5A 1WB6A 4WK2B 4FKMA 5F9HA 2BPOA 2HLDD 2O48X 3IJEB 4D0LB 2ATEA 1GTL1 2ZTLA 5EP2A 3ZE7A 4Z3OA 1GD1O 1FFAA 4IMJB 4GUAA 5AJXA 5LDHA 4NY1A 2BJVA 3LMKA 4O4LF 3HTXA 3HBMA 4XDZA 4ZZ0A 2YMLA 3P2JA 3RF7A 3MHPA 2YFQA 2G07A 3IIEA 3C1OA 4YAWA 1DI0A 3V1KA 5JCJD 3I9JA 2QRNA 4IEIA 3U40A 4QUAA 3O75A 3NAQA 3BDIA 3BD8A 3O8OB 3AUUA 3PRKE 2AEFA 2Y0EA 1HR0B 1AT1A 4I50F 4KB5A 1E3LA 3VPHA 2F9MA 2FUG6 2DFKB 4RCVA 3E1SA 5JAQA 2JA1A 1XALA 3TKAA 3K92A 2XCTB 3OBIA 1GAEO 3LTEA 4TSFA 2OB1A 3C3AA 4DW8A 2PGDA 2LE0A 1IEXA 3KV1A 4DNOA 2WILA 1SVOA 3U80A 1C9KA 5F51A 5FR1A 3RC2A 3D4LA 3KEQA 4ETMA 1D2MA 1S02A 3DZIA 2ZSJA 1N8KA 1X0XA 2BHSA 3D8HA 1DADA 2IYQA 3ER6A 4W99A 2CD9A 5BNTA 1U0OC 4Q9LA 821PA 1M8FA 4OGKA 2DFDA 3UF0A 2W2TA 3OLXA 4MUXA 5EIFA 2XHZA 1H6AA 2PG3A 2KSQA 2XNKA 3LP6A 1TW2A 3KD2A 3BWEA 1U1DA 3T35A 3ZHRA 4QOHA 1PT8A 1P4HA 5IAKA 2UYQA 3JQDA 4BWFB 3KG2A 3HA7A 5IBRA 4TKUB 2YHSA 4C2AA 1SVKA 2N47A 4GE3A 2WZDA 2OHOA 3PDWA 3BXFA 3RH0A 3TLBA 4ER7A 2W58A 3N6XA 5LC1A 3SM9A 3WNZA 3AL0C 1MCZA 2X7XA 3G02A 5I51A 1C1DB 4L4UA 5CJJA 3GAFA 2DP4E 2I87A 2VA8A 1C14A 3EHEA 5BQOA 4Z7NB 1A4IA 3ADPA 4W1QA 3KKMA 3OQOA 2DULA 2N75A 4OCZA 3ICVA 1TTQB 3B48A 3VH2A 3RAEC 3V00A 1LZKA 1P8JA 1O6GA 3BXEA 4QFMA 3L8CA 1DV2A 2NU9A 3ME5A 3HMKA 2PH1A 3GI1A 4RACA 3WWZA 1WPGA 3CLSD 3O0TA 7GPBA 1L5MA 3DT8A 3GQVA 1Y6QA 5D85A 2DB3A 5BV2P 4DCUA 2VHUA 2C9YA 3D7SA 4M3NA 1YVDA 1Z2OX 4JJKA 3SYKA 8GPBA 2YZGA 3V1UA 4WOJA 2CT8A 3B89A 4JYBA 4AZ0B 5BPFA 4C7XA 3MJCA 3GVCA 5B37A 4DR2B 1P73A 5H0IA 2C42A 3WWEA 1EB8A 1VJ5A 2G7MC 4QOEA 5LPNA 3VJMA 1TW3A 1H8HA 2QW1A 4W5OA 1OKKA 2BSAA 2WMNB 2QRGA 1RIIA 1SOVA 5DM70 4N0MA 5KVAA 1B23P 2Q3MA 4RV9A 1B7GO 2EL9A 2I7CA 4XYGA 5CVJA 1P1HA 4RHTA 1QH8A 3HEAA 2VP2A 1WO8A 3I6MA 4FX2A 4KH1A 3LUDA 3LX6A 3C6ZA 3CF4A 3EGWA 3RJ9A 4BQQA 1J2YA 3AFMA 5B7PA 2QF7A 1PT9A 1E1MA 3NFRA 1IM8A 3PU6A 1ZRHA 1E4EA 1G4HA 2GASA 3BDVA 3NVAA 3WBKA 3T7RA 1DHRA 3HWRA 2JBHA 1PHPA 1KZHA 1RWPA 4KXFB 4PLYA 2B2CA 2OCLA 4NG4A 3F1LA 3UGQA 2CFRA 4GI5A 1QCZA 1Y1QA 5K20A 4BVAA 2ZAGA 3GLIE 1S3SA 3WRXA 3BHNA 1KA9H 4N76A 4AP9A 2BEUB 1HQYE 1GWNA 1V1RA 1KIAA 1DC4A 2VNAA 3DPSA 3W90A 4D56A 3LUGA 2V4MA 2V7XA 4BE7B 4CKBA 2BMDA 2NAFA 1DINA 4PTLA 3N39C 3K0BA 5THQA 1V4NA 3EQZA 3SQWA 4MUMA 1X7HA 4PGMA 4QYSA 3VM6A 1U8UA 3DL4A 1SO8A 1F9AA 1VPEA 5KPDA 2CVZA 3QPBA 1A88A 5E8RA 5T64A 3TK1A 3WAJA 1XBTA 2ZUSA 2E21A 1JQ3A 1GQOA 1AKWA 1PTJC 3DE4X 1RC8A 2PR7A 2I8CA 2YW9A 4R1QA 3K9FC 2I1QA 3FDZB 3MXOA 4NBTA 4QTUB 3FCXA 4X61A 2OHHA 2OZEA 1N5JA 2ZETA 3M3HA 4JNKA 4DFDA 1XCPA 3H6KA 2FUKA 5TLSA 4RTNA 3CRQA 1HDRA 2XQFA 3PT9A 3WVNA 3QZUA 2QX9A 3H18A 1Z34A 1IHPA 2IYPA 2F3SA 3PLNA 2Z08A 2F62A 4Q5IA 3EDCA 4OI0A 1T15A 2OFXA 4LJRA 3PFHA 1MEJA 3O95A 1KFBB 4R7GA 1JL3A 1WKBA 5EWLA 4P08A 4YONB 3O91A 2IPMA 3RF6A 4DS3A 1U2SA 3VH4A 3SX4A 1ADBA 3JYHA 3O93A 2PSFA 1MX5A 4B3JA 1CLUA 1DO0A 2DECA 1L1QA 1UXJA 3CMCO 3QU5A 4MMZB 4E2WA 2VZ0A 3ASVA 3DMRA 1P5FA 2I4RA 3MSXA 2Y9MB 2CF5A 1EYZA 3JQ7A 3KE8A 4Y2PA 2IYSA 1UBMS 2AB0A 3NMUF 1PJQA 1RI1A 3IO5A 1M1YE 2F1IA 3HPQA 2QU8A 4RIGA 1TF5A 3VPFA 1R3DA 2FX2A 2JI9A 2CJXA 3E81A 2OFOA 5FPYA 5G4KB 5KMGA 1E64A 2ZQYA 3SWWA 2G9VA 1WEHA 1QIJA 3KYDA 3QRWA 1ADGA 1PWEA 1YMQA 3BIWA 1ISGA 3N05A 3WP0A 4DDWA 3EZ2A 2ZWOA 3PZRA 1K2WA 4ZQCB 2JCSA 1U7DA 3UOWA 4ARZB 4M46A 4WFJA 4DUGA 4P7GA 3ZXUB 3CT4A 4XGRA 1S89A 3A58B 2P9QA 4ARBA 1U9ZA 4HDSB 2P35A 2ZW9A 4WLNA 4RXUA 2NXNA 3TLCA 2JKVA 4RAQA 4IDEA 3OT1A 5KS2A 4XDGA 2FEMA 2IBSA 3ANMA 2P6NA 2AOUB 3CSSA 4UPVA 3W1WA 4D92A 3IHKA 4DDKA 4J4HA 5DEOA 5AW2A 1YS9A 2PAFA 1NVDA 2VO1A 1Z0DA 3AGPA 3OKPA 4URHA 3WA6A 1Q95A 1EQAA 3TSWA 3AEUA 4HGOA 1G0NA 1Z4OA 1D4ZA 1SUWA 4DPLA 1NJSA 4GRDA 4YUZA 5IXYA 3VU3A 1LK0A 4IZIA 4OA8A 1D07A 3C3YA 3IUNA 4LVOA 5GOTA 3VISA 1AZSC 1ETHA 3FCCA 3FYTA 4JBIA 5JU6A 1G3RA 2P5SA 1YCGA 4HGYA 4L4ZA 1TAGA 2FOXA 4TV8B 3E05A 5DYWA 2R85A 4K5QA 4ZAVA 4M7PA 5KMGB 4N6GA 4CLEA 1NLMA 3HPRA 4MTCA 2ZKLA 2FFAA 3CPEA 3WRXC 1XZCA 3I9V6 4FYWA 2OZPA 3TLZA 4H1WA 2VAWA 2VDRB 2JGJA 3U39A 3OFJA 2GWRA 3W5VA 2AD5A 2FPKA 2QNBA 4C0WA 4GOJA 1E58A 1V6CA 4ZMSA 1WR8A 2VUHB 2AKEA 4M53A 1LX6A 3I9NA 4HSEA 1P1KA 3SF0A 1TKRA 3JAKB 3BCUA 2ZT8A 1MTZA 2P5YA 4LJ7A 3PGVA 4RPIA 5DNVA 1HNZB 4OFZA 2IOFK 4Q05A 3SYRA 5J5CA 1L4NA 2W7TA 4HMQA 1WUYA 1GGEA 3K72B 4CTJA 2YV4A 3DDWA 4UUPA 2WFLB 1D03A 1JU4A 3ONVA 3NHZA 1EVZA 2H9IA 4FFSA 4LRTB 1FDVA 2DWCA 4GQAA 4Q4HB 3MAJA 4TTPA 4WZAE 4ZVQA 2FPOA 1EFPB 3S1LA 3EZ6A 2AXEA 1UAYA 4ZZ1A 4RX1A 3F74A 5FORA 3N2NA 5IDXA 5BSFA 5REQA 4LXQA 2QVCA 3ZNOA 2ZI7A 4F5YA 3VU1A 4EW1A 1LWNA 4IPTA 1U2ZA 2QL5A 1NP3A 5KYVA 4C3OB 4L3OA 4Q6BA 5FIUA 4G0VA 4K28A 1U2TA 2X9NA 4K03A 1IRIA 4U4AA 2PEYA 2VT3A 3I8SA 1MO3A 2X0JA 4U5QA 5EQDA 1JI0A 1GNTA 1HWYA 5J23A 3A2NA 1BA2A 2Y8EA 4LQCA 3VNRA 4DL9A 2EYUA 3F96A 3GP5A 1ACLA 4MUYA 1ORDA 4EUSA 9GPBA 2EF0A 2BFCB 3AL3A 1UBLS 2MSNA 4KPUA 1IBCA 2J1LA 2BH2A 2O1WA 1J22A 1KHTA 1OXSC 4UU0A 9MHTA 1DBVO 4BLTA 1VG9B 1XF9A 1I4TD 1YR6A 2HF2A 5AMXA 2F43B 3O4RA 3WAKA 4QQ8A 4KMOA 4F5ZA 3VJRA 3U2QA 3FHLA 5B7QA 2II6A 3PUHA 4CMIA 3FOZA 3Q3CA 3E5MA 4A2QA 1GOTA 4EJFA 2AEEA 4GBJA 3B78A 1SCNE 3IMCA 5CYOA 4ZOCA 3H4MA 4COKA 1ZUNB 3PGA1 2BEVB 2ENUA 4I4TA 4D3YA 2DWPA 3DAYA 1FYWA 4EJMA 221PA 4I4LA 4M86A 3HNOA 3ROXA 4WNYA 3M4XA 2GN8A 1VYVA 2GHIA 4YT5A 2WM9B 4A0SA 5D84A 1HKHA 1HTWA 3GOQA 3UT5B 4TT3A 5E6SA 1ZGGA 1SHZA 1OXKB 1R00A 3P9QA 3QLEA 4P98A 4YRQA 4OSOA 3RS5A 3SLKA 5I7WA 1NNLA 5JV5A 1PKEA 1QFXA 3R3HA 3KWFA 3OX4A 5BWLA 2CV0A 3R0XA 3WV5A 2VUSA 3ILSA 1UXKA 1U8EA 1JHOA 3KB8A 3SDBA 4B3HA 1IVNA 3AHHA 2ADMA 2A2ZA 4NATA 5A4MS 3R3ZA 1L4BA 1MFPA 1W2GA 2QQFA 4Y98A 1OSNA 2XYRA 4H7DA 4CF4A 1P75A 4P84A 2IHTA 3C3JA 4IVPA 1IL0A 3F1KA 3MLEA 1U8XX 1YB7A 5HVNA 3VI4B 1OA1A 1BFDA 1FQKA 2QRQA 4OYYA 4J0KA 1BYUA 4X63A 3ZE1B 2FPSA 2A9PA 3K9BA 3MTQA 4KACA 2Q62A 4Z8XA 4F12A 1HH4A 5HGXA 4INOA 3ZWVA 1BJTA 3AHDA 4GL2A 4NH0A 4WZBB 3TEJA 3DKPA 3QWHA 2H9AA 3MJSA 3MHTA 4O2AA 1XAJA 5LIRA 3BDAA 3KQYA 1O57A 3V8NA 2QORA 1USKA 3C3CA 5ALUA 3ABSB 3B53X 1ORRA 3GZNA 2EJCA 1BXGB 3TQCA 4LY6A 4XW2A 2QZSA 5BNZA 3IO3A 1NF3A 2IE0A 3N7UA 4I55F 4OOFA 4F3YA 2VPTA 3A28A 4CCWA 5J2TB 5L6MB 2QSUA 1SUDA 1DTEA 3QBJA 1JQJC 1SHUX 2FEWB 4ME6A 4IWYA 2HNKA 4HNHA 3FBWA 3QWIA 2QYTA 3WGGA 4DSAA 3ER8A 1PJ4A 1G60A 2AYXA 2BMFA 4FVTA 4LJAA 4N3GA 4AJEA 1QGUA 1U31A 2GZAA 2QEQA 1WV1A 2WWGA 2X8AA 3LCRA 1ZICA 4KN8A 4NSNA 3ZUGA 2QZZA 4D6YA 1CUSA 4ITVA 1RAFA 1TIPA 3H4TA 4C7VA 4GICA 1BXKA 2C95A 1XFAA 2ZB7A 3HN2A 1CUEA 3HP7A 2JFYA 3RLIA 1C8KA 5DMHA 3UW3A 1PZEA 5LMCA 4MRPA 4LMPA 3SVTA 3NX4A 4HWOA 3MT0A 1JFFB 4ZGBA 3ZX4A 3IDZA 2QIPA 1U0EA 2GCEA 2C9MA 1OTHA 1Y7LA 1T3GA 1D5CA 5K05A 1MTOA 4MW1A 3UUGA 2B94A 3BB1A 3IBTA 3MCWA 1U8CB 2XYGA 4FQ7A 3C6XA 4RHUA 2WICA 2XITA 4RMHA 5DTIA 1QG6A 4NESA 4GQBA 1WXXA 4PZZA 3P5SA 1R37A 4QATA 1QANA 2NU9B 4BNGA 3MWYW 4H3VA 4B3GA 3E35A 4DADA 1GQQA 3ZNPA 4WBNA 2R6GA 1AUVA 2GJ9A 3L07A 4E5MA 1YDGA 5AP9A 3C41J 4FFVA 2R8ZA 5IAOA 1WXHA 1RAIA 5JPIA 3AVXA 4E5YA 5HRCA 1O0BA 4LCEA 2W4MA 1VKOA 4WADA 5LQAA 3TGPA 5DZSA 5JNUA 1AV6A 5C8YA 1RU3A 4AZSA 4DDMA 5JEEA 3R9XA 2OYSA 4ZCRA 3FA2A 1GQFA 2JIZD 3X2EA 2OTCA 5KJCA 4DIOA 4AIRA 1RSZA 1F8UA 1P2DA 1NY5A 2CDNA 3VDNB 3ZDAA 1C8VB 5F1OA 2WWWA 2QX4A 2NYRA 4AMBA 5HOQA 4A5OA 1IJEA 1Y5LA 1OU0A 4ENWA 2A0YA 2IU0A 3WGKA 3RVOA 4BTLA 3R5TA 3DMDA 4YUYA 1LTQA 3A4IA 5MF6A 4PIVA 3ZHUA 5GVSA 1B6RA 3IAM6 4KC0A 3U1BA 4K3VA 1FU4A 3AI1A 2A67A 1QS0B 5KHLB 3PX7A 3UB2A 1UFOA 5G0TA 3ZCTA 5JSHA 1L5VA 1SXJA 1RWOA 2PMCA 2VWHA 5BT9A 2Q2OA 4D44A 2RHDA 1LPOA 5KVQA 2Q8PA 3U7FB 2XB2A 4J0HA 2B7BA 2WD8A 1V1RB 2OBFA 4DIDA 4QTYA 1CIPA 2YWEA 5KYUA 4R7TA 1HDCA 1IUNA 1IXSB 1R0RE 1UT8A 4B6OA 4BWYA 3HCCA 2DMRA 1RKUA 2MYTA 4CKBB 4CTMA 5IK2D 5EIXA 3STWA 1G5QA 2FPGA 1I10A 4QUKA 4ZQGA 4F6LA 5J4YA 1F5SA 3GGGA 1T13A 2ZBVA 1KDOA 3RPEA 4U2GA 3H1EA 2QGNA 1QRSA 2FPUA 2HMWA 2Z2IA 3JYOA 4KQ2A 5DW0A 5HXAA 4LGMA 3SBEA 3CUTA 3R6WA 4HRXA 3O92A 2C61A 4IOMA 3KOZA 5FLYA 1I94B 1E69A 5LLTA 3E4DA 4DM4A 5EXEA 1U9IA 9LDBA 1IB6A 5JTUA 4G5YA 3TQIA 1V7ZA 4YACA 7REQA 3ED5A 4E30A 4GC5A 4X91A 1Y98A 3ROPA 4ASUD 1QHXA 5CW1A 3BILA 4JBHA 1JAIA 1VE1A 1ZC4A 2FJUA 4RD6A 5HJ5A 3DP9A 5C7OO 2Y0PA 5EWLB 3UTDA 3ENNA 1SQ0A 2OM6A 2DFNA 4YIKA 5IJXA 4BZXA 3KHUA 1K7FB 3SQOA 4W63A 2BSQA 1FBNA 3B20A 3DNFA 3RBXA 4E03A 4GI7A 1RCFA 1SEVA 3O3NB 5J2UB 5EPUA 3UUWA 5DHFA 3I1IA 4B8ZA 4ZTBA 3SJUA 2A57A 2OE2A 1U4NA 2GETA 2IYTA 3PUKA 1WU7A 4X9XA 2IOFA 3GGJA 2GBIA 1CHNA 5FOQA 1WIWA 1JAYA 3O38A 3AFOA 4FNOA 1JE0A 1PHRA 1JDPA 2CHQA 3E58A 2V7QD 4O0MA 1VFNA 2VDNB 3KYDB 4LBZA 4EMTA 1PWZA 4BNIA 3IYLW 5FNVA 1BROA 3TQOA 2YIJA 1CS0A 5WRFA 5KNBD 3M6IA 4Q3CA 3TWOA 1TAQA 2CMGA 2GDZA 2R8BA 3OICA 1VIMA 2WTBA 3G5LA 2P9FA 3UAZA 4YAGA 5JUWA 5LM3A 1A8UA 1VKJA 1LPAB 2IF0A 2ZZKA 3EVFA 1KFCB 1NPTO 4XX0A 5D6OA 1ZZGA 4HX2A 4W5JA 5DRYA 5TMDA 2WQ7A 4QPPA 2DR3A 2XUHA 2Z3ZA 1X74A 1UCFA 3AESA 3E0XA 3GJYA 1DFGA 3OECA 1NF9A 3QSYA 4NYMR 5PGMA 3ND9A 3X2FA 2A88A 1ZCJA 1SCIA 3VR0A 2NV2B 1FUIA 1B8UA 1TZKA 2PFSA 3AEUB 3N2GA 4GWLA 4JUBA 1N3IA 3CE6A 5COBA 1V9CA 5HFAA 4OKSA 1P3JA 1UXHA 2CXXA 2B1QA 3HA3A 4K8RB 2K6GA 3RKUA 4UEJA 1BFKA 1RKXA 5FX2A 2D0PB 2BR4A 1XCLA 3DDSA 3TJRA 4JENA 5IF9A 3PC6A 4AY4A 2NO0A 2B92A 4EF6A 5JADA 1FNDA 1IZZA 4X20B 3RUDA 4HAZA 2HLNA 1M34B 1YBAA 1ST2A 4RV5A 3U09A 4QYXA 2QUHA 3Q7SA 2M98A 4JC5A 3AHCA 3RJ5A 4RGVA 4UPEA 4W5TA 1EIZA 3B1ZA 4W6ZA 4EZIA 4NBLA 2O1EA 3A9WA 4CUZA 1KKUA 3CLTC 3K0EA 1CR1A 1EP3B 1N4AA 3WFJA 1EESA 3D81A 3E7PA 3NALA 4XJTA 3KLBA 4L3VA 1YR3A 3UMJA 2ZBRA 4FIDA 4Y9TA 2JIOA 4D9NA 4K6OA 4O4IA 3HDVA 4MQLA 5LMUB 3IE1A 1M75A 1OGIA 5C32A 5GJVC 1FFBA 1HE3A 3O9MA 3TQFA 2ZR8A 5D7NA 4GQIA 1VG1A 5TE9A 4LNUA 1C3LA 1Z6ZA 1GRVA 2ATIA 2IOHA 2IU6A 2AK2A 4MAMA 4ZDKA 5KQLA 5DKFA 4EYQA 4KXQA 4EG3A 2DXIA 1ZD9A 4NU0A 2C77A 5REQB 3P9IA 3L0ZA 1W52X 3SIPA 4EY7A 5B1EA 1E20A 1QK3A 5AOCA 3TRFA 1Y7PA 1NQUA 1DC6A 1XL1A 2FG6C 4CT4B 1QCDA 4NTZA 2FMIA 1RZUA 3ORHA 4DSZA 1VPWA 2WB4A 4X1YB 4EARA 2IW3A 2O05A 3OZAA 1ZD3A 3B12A 4PAQA 5KQRA 2P2SA 5GJBA 1QRAA 3AZPA 3ROQA 4OLHA 3D7RA 4IIVA 1A5AB 2VYVD 3KSDO 5F23A 2G1PA 2ZSHA 3L6RA 4RPGA 3GLGA 4DGSA 2Q41A 4JFAA 4KPUB 1C0EA 4MIOA 4Z7JA 1FLVA 4RWEA 4B0PA 3S2SA 1R9MA 1AUXA 3H9QA 5GV7A 3AQ4A 3PSHA 3EXIA 5IBCA 2NQTA 4DEVA 1FVXA 3Q6NA 4ZVSA 1JIVA 2ZCVA 5LN1A 2CC2A 4BFSA 3GFOA 5BWMA 1Z68A 4G8JA 1P0MA 4EI8A 3T34A 3W6UA 3IVGA 2W0MA 1OYWA 4MV1A 2PV7A 3WLEA 4Z4HA 5EAIA 5FOXA 2YRXA 5CLIA 1CSEE 2FZ5A 1G6OA 2J3DA 3KU1A 3X0DA 2GJSA 4JASB 4CJXA 3M49A 3SNHA 1I3MA 1QKKA 2R1TA 1B76A 5E6SB 1Q22A 4GPIB 4CF5A 3CX7A 5J4VA 1WXEA 2JGFA 1CLEA 3IEIA 1QAOA 3WIBA 1O95A 1WP4A 4BTEA 1NRIA 3MBKA 4X3PA 4IIHA 4ZTUB 1E9CA 7AT1A 1PEDA 3DWGA 4UMFA 2BDUA 2V6JA 1PFVA 3RUAA 3GJQA 3THWA 3PGJA 2IFTA 5G1OA 1WKVA 2C4TA 3INGA 2AZDA 2JLYA 3RRZA 3ZDYB 1KYXA 1XTBA 2Q5CA 2QGZA 1G3UA 3DE3X 3FXAA 2R87A 4GYJA 4KJZA 5DN6A 4DHWA 5JY6A 3T3OA 3GBSA 3HV0A 3ETEA 1W7AA 1OE0A 1L4MA 4G81A 3K6RA 4EB8A 1AMNA 2ZVQX 4R9RA 1FXSA 2IW1A 5IN5A 4YXWA 1U7HA 3I5UA 2HU5A 2BBSA 2O0JA 2G88A 2A1TS 2JD2A 1OC4A 4RYDA 2D0IA 7MHTA 1U3VA 1AXRA 3MOSA 1J9ZA 2VK4A 4YVFA 5H80A 1N2CB 4MEBA 1N33B 3ICWA 5BV1A 2P78A 2XZTA 3QLVA 4KFRA 3Q6IA 5KWVA 2ZRBA 4FFLA 4O2AB 5FBZA 3V97A 4B17A 4C2TA 3EGEA 4R2XA 2LP4Y 5MGNA 1V5WA 2Q4DA 2WYUA 2ZI5A 3E9CA 4HWTA 5LZ5A 2CVFA 1JEYA 5FEUA 4J2HA 4BX2A 2GERA 3AM4A 3OWXA 3EXEA 3HDYA 4GP6A 2NO7A 4GX2A 4ECAA 4MZDA 1EINA 2J46A 5IMBA 1H22A 1ZI8A 3WL7A 4YRGA 3OD5A 5MN6A 4IYJA 1UODA 5FPTA 3BSYA 4LZJA 5DP1A 5ILQA 2GFHA 3E4CA 4MRRA 4YRBA 1UMCB 4TV8F 1D8AA 1XA4A 2VBFA 1QVVA 4IOJA 3RS9A 1QGUB 4NPCA 4B82A 4HH1A 4YV2A 1AGNA 2VJKA 4PSUA 4RIIA 1I2AA 4UREA 1PAUA 3RWBA 3M33A 4BNXA 2D06A 1ZXLA 1CUUA 3PFGA 1NRXA 1E0JA 3OTGA 4QECA 4BZZA 3RCBA 4ZI7A 5E2BA 4QDOA 2Y4NA 2Z5GA 5DK6A 3MCVA 2XAAA 1NP7A 5LLDA 4OOEA 2Q1YA 1IY2A 5C8DA 1JJ7A 3KUXA 2FMHA 2MYUA 3MOIA 1E3SA 5TPZA 2EWVA 4CLHA 1MC1A 1COZA 4OPMA 3HHPA 3O9ZA 4BB9A 4C89A 4YRDA 4I2VA 1P44A 4MTLA 2GEUA 1COWD 1UKCA 2YVAA 5AVQA 2FSSA 2Z4TA 1RQPA 5CVVA 1Y1TA 5L40A 1EFAA 1XKQA 1T1EA 4KV7A 4ZJPA 2XVAA 3F8SA 1YOVB 4WJLA 4D26A 4MHOA 4WBNB 4OQDA 2CNBA 2Y1XA 3B8EA 2QDKA 3GW8A 1BIFA 3I9LA 4H31A 2E1PA 4ARVA 1KPHA 1F20A 1IULA 1RRVA 3OX2A 5K9ZA 3C8HA 1THMA 4F1JA 1ZBDA 1R66A 3HM2A 4B75A 1UM9A 4AUNA 2PFKA 4PIPA 4CKEB 3K9LA 2D13A 1HDYA 2PKXA 1FZQA 1T9CA 4ZT6A 4K1XA 5C8YB 2O8DA 1O95C 3GRYA 4WKBA 3DDCA 2OT3B 1A9XA 1B16A 5H8WA 1VLMA 1KZ7B 1JHUA 2FZCA 3TG8A 2FQ1A 3GXOA 3PEVA 4LE2A 2WUEA 5DGCA 4ZKDA 1X7WB 1FNMA 2Y71A 3TTXA 2YFYA 3OOSA 1O5OA 2OV2A 1VRWA 2Y67A 2AJLI 4MVYA 4Y9RA 4BAZA 4LRSB 3T1TA 5EE9A 2B3TA 2C8KA 4TWZA 3HUFA 1TQ4A 3OY2A 2YWFA 3OJLA 2CD7A 1NN3A 2LTAA 4CM3A 3IFSA 3A36A 1HE2A 3OZUA 4N7RA 2O2XA 1BCSA 1VBNA 1EVQA 2W2NA 4XWWA 3EIOA 3ZHVA 5AUNB 1NJ2A 4PE5B 4ZHQA 1SN7A 2BSXA 1SXJB 3LP5A 1GSIA 5KEIA 2Y0BA 4QLOA 2XWBF 4NZOA 2G09A 3QLVC 3EHDA 3ZU6A 1XXHB 3ENVA 3U26A 1KBQA 2W4QA 4J75A 5HP4A 1HEIA 2B9EA 2OLEA 1T9GS 4GLFA 5J1TB 3QU7A 2XTAA 4B79A 3RTAA 1P2FA 2PXXA 5GAJA 2J0QA 2FPGB 1Z0SA 4KRGA 3TECE 3DM5A 4RCZA 3IDSA 4OHBA 4XSHA 1FU7A 3I83A 2I0FA 5BOSA 3GN1A 1TL7C 1M6NA 4O6VA 4TMZA 3EPKA 2BT4A 4QBHA 3DQZA 3G17A 4LNAA 3VI3B 4B2YA 3K35A 3GROA 4JUCA 3CIOA 4BC1A 4PFSA 2OO3A 3A3NA 1QQAA 1EEHA 2HXYA 1LB1B 3BICA 2GWHA 3I2YX 4TPKA 1RZRD 3PFIA 3RV4A 5EJ8A 1G42A 4DCGA 4UOZA 2YTZA 4OKIA 5CEFA 5IZCC 3L6EA 2OGTA 1RM4A 4HPWA 1H42A 3EGOA 3QOFA 1KSGA 4DM3A 4PN3A 5TR9A 4A6EA 3A0UA 3ELYA 2YIDA 3K05A 1KFKB 2IHZA 4FN5A 5FT9A 5HMMA 3DOIA 3WGHA 4D96A 1XDBA 5DWVA 2BGNA 1Z07A 4P38A 3ZNNA 5I9IA 4EPXA 4B6GA 3NV9A 4L8GA 1BKDR 3ADBA 3HUDA 1XHLA 4YMWA 1FTQA 2CLDX 3KXLA 3WGMA 5JJIA 3WKDA 4ER6A 4RF4A 3KEFA 3NFYA 1YI1A 3OZ7A 5ERYA 2JCBA 1PS9A 5HTKA 1MB4A 3L0CA 3AFHA 3A04A 3AWIA 3ZYCA 3HACA 1XNHA 3I1YA 4QVIA 3U4QA 4MI3A 3D0KA 3OAAD 5J2TF 2C2MA 3P0JA 2BOVA 2I29A 4V02A 5IF3A 2HPAA 1IHOA 2J7PA 4YCLA 3HGQA 1RAGA 5E7IA 2H7VA 2EFDB 3DTVA 2JHCA 5JZSA 5KNDH 2JIQA 2BZ0A 5ALOA 4DA7A 2CLFB 2OBBA 2JLVA 3QVXA 4PXSA 4V24A 3UMGA 4QKQA 5BORA 1MMFB 1DAKA 4XX0B 2IDJA 1DC8A 1E9RA 3DCYA 2VTEA 5DTRA 3ON5A 2MSEB 3PXBA 1JECA 1DDOA 1T2EA 2VC2B 1AHIA 3AESB 4LSWA 3H11B 3IVMA 4RNCA 4P3NA 1L4UA 1P7YA 2XOKD 3MWDB 4BNMA 3N1UA 3LX5A 4BQEA 3ZZTA 3EUFA 4JNCA 2PDAA 1F0YA 3S27A 1R0WA 2FP4A 1LQ2A 4AW9A 4OFWA 4KFSA 2EKDA 4L5CA 1GCOA 3DOJA 3MWFA 5CTAA 1L5YA 4ANFA 3S5JA 4DPMA 4LF9B 3ODPA 1RWMA 4WXEA 2W2QA 3AXTA 4K9NA 4CHTA 4WBXC 4Y9SA 4V1CB 2GARA 1P2GA 1C50A 1NVXQ 3DYVA 3OC6A 1PQYA 4FFOA 4H6VA 1Y7TA 4IM7A 3ZE6A 1W76A 2RH9B 5JMPA 2V3CC 4I99A 4KLCA 3CEAA 1BJRE 4P1ZA 4PZEA 4KE6A 5AJWA 1JTFA 2ZAOA 3KJIA 4D4MA 4KRFA 1ZG3A 2PWBA 1ISMA 1TB4A 3JYQA 5BVGB 3TS1A 3DE5X 1KETA 5F2NA 5HS4A 3IHTA 3M7IA 3HU2A 1QTRA 2ZROA 3H9JA 2C2HA 2LVBA 4N1AA 4WCFA 3B5JA 1YZUA 3Q2KA 2X8JB 4OXYA 1W4BA 2BGIA 2Q3BA 1VYHA 4ACAA 3Q0TA 3OA2A 4GX0A 1KJ8A 4DIEA 2FW9A 4O4IB 2C92A 4P86A 4S1TA 2PVCA 5CAEA 4CG2A 2JKZA 3GG9A 4L5YA 3IPXA 5D87A 1N2EA 3Q3IA 3RVJA 4ALKA 2XA1A 2YWXA 4CIXA 1CEYA 4O4JA 1Q0ZA 5MFZA 1RRKA 4HADA 1JJFA 3OX3A 4RMIA 2GF2A 3SMQA 3V8RA 3QE3A 3CNLA 4M2LA 3KIPA 2CCKA 3GD7A 1MV5A 4J6EA 4LNUB 5EJGA 3LM8A 3UWKA 2V4ZA 3VJKA 2ZUFA 4BGEA 1VTKA 3H3XA 5KINB 1M6YA 1FNNA 3V1NA 2P4EA 1DWQA 3UPDA 3QEMA 4IKPA 4HPXB 4UDOA 2HWYA 4XQ0A 2REQB 2ZBQA 2HCJB 4FN4A 3KJZA 1ORTA 1HE5A 1FRNA 1N25A 1JT9A 2CLHB 1BWRA 2AF3C 2O23A 4OQ4A 2C94A 4YP5A 1TVCA 3AI3A 3MJHA 5G0SA 4ESOA 3H0EA 4F7DA 1DAGA 4F3RA 2V7TA 4KPFC 2XZDA 5FLEX 4C2BA 1NMSA 3KOWA 4RHCA 4E21A 4CF7A 4LF8B 2GPTA 3I2HA 2D2VA 4C29A 1BVYF 4K46A 1GPWB 1UK7A 1EXWA 3CWZA 3D0OA 4KWIA 1ISJA 4BNYA 5ITSA 1UBNA 2WKSA 1EZ4A 2RI6A 2BJHA 3KSZO 1U3TA 3CURA 2C4VA 1E2UA 3K9WA 3U6KA 5EESA 4CKYA 2GO1A 4YAUA 4I8DA 1K92A 4MQMA 3UV7A 4YRMA 3GRVA 2XUDA 5G2OA 3PENA 4FHFA 2OCXA 5HFNA 3H2KA 1L6IA 4AJOA 4FMDB 4QT4A 4WE3A 4IX1A 2Q3EA 4YBRA 3CNBA 3CB4A 1KYIA 4IR7A 4ZZIA 1O96A 2FK7A 3EVAA 1I7QB 2CW5A 3HJFA 4BLOA 4QFBA 3VR4H 3CVVA 1YDFA 1ZD2P 1X7ZB 2JFGA 3LY8A 3QX9A 4L3WA 1ZJZA 4WAUA 1NYTA 4G85A 2DUNA 1NC3A 4KAJA 5CM8B 1EHCA 3E70C 3MW8A 5AK3A 2CF6A 3DEIA 3SLRA 1JG6A 3AILA 2XIJA 3M4NA 2VUIB 3K6KA 2GA8A 4DJTA 5I7AA 1VJDA 4IOKA 4JJ6A 5J2UF 1EWQA 1SVLA 4J7UA 4R0NA 1L8XA 5F77A 4GKVA 2HCRA 4IDBA 1RJGA 3W34A 4HNRA 2RHLA 5KYNA 3VR5D 2PZAA 4E22A 1DSSG 4JU9A 3HKDA 1I4LD 4FHDA 4BKRA 1XZPA 1L7MA 3PE4A 1ZMBA 3NUZA 1N2IA 1YZLA 1UBCA 1VE6A 2GR9A 4YPVA 2WHXA 3DXXA 4OP2A 2MIIA 2X0KA 2QTZA 1NXWA 4BWVA 3GJ0A 3ZQ6A 3HWSA 3IALA 2LBPA 2V0CA 4ITUA 1KVUA 4WCFC 3RFCA 2QROA 3SZUA 3R76A 4B6SA 1YBVA 1LKZA 4HB4A 3FMGA 4XOIA 5JNWA 3TNYA 2AGVA 3P2EA 4I4NA 2CVOA 2V9PA 3BFPA 4IQGA 4X1OA 5IH3A 3SC2A 4B9EA 1HT3A 4PPFA 2RI0A 1OZGA 2ZJZA 1KY4A 3GJTA 1T43A 2VF8A 1TEZA 3DZCA 3RG8A 1JEYB 1ZMTA 1VLHA 3FD8A 1RRPA 2WWIA 1THGA 2YZ2A 3EXEB 2CLLB 4HFJA 4HP8A 4M6WA 5FA6A 4YREA 1MB2A 1G8AA 4IINA 1KVQA 2NU8A 2Z2XA 4DLRA 5KIAA 2P6RA 4UNNA 4X84A 3ZGVA 1P62B 4GOKA 3K2EA 5JANA 1O1YA 1CF9A 3UMMA 5FJJA 3R7DA 5D3KA 3NONA 2G5PA 5FWAA 3D7NA 2QD4A 3DZDA 3TDMA 3H99A 2B1RA 3C1UA 4RZ3A 1HQDA 3FB4A 1TIBA 2I1VB 3TZEA 4PWYA 5IC6A 1R5OA 2J3IA 3HA5A 3CVUA 1GGKA 3LL7A 3O84A 1C4KA 1SKMA 1E6UA 1T2VA 4AMGA 4DV6B 1QC5A 2EIXA 1HYQA 4IDNA 3A06A 5AKZA 4JLNA 1G18A 2AMJA 4ZI7B 4JT9A 1TVMA 1M33A 3BMOB 1PUJA 3SLGA 2HWUA 4MLPA 2VAVA 1DC3A 1OJ7A 1Y34E 3R4VA 5CBKA 3QELA 1CJTC 1L7BA 1SIUA 1E94E 4IMPA 4BKUA 4PG8A 4EBBA 1YQQA 2VBIA 4H7IA 4C7BA 1D1QA 1ZH6A 2NXJA 4F5DA 1I0ZA 2IYYA 4MYCA 3TSZA 2KB0A 3B1JA 1FLNA 2NZJA 1IATA 4HNGA 4EHKA 5IVPA 4BEBA 4PHCA 3EFOA 1FJXA 3BZUA 4M87A 3VR2D 3VR6D 2ZVPX 1XPRA 3V46A 5K3SA 1ANKA 4K26A 1MIHA 4MW2A 1NG9A 2ZAIA 2FR8A 1A3CA 3M2PA 1U0JA 5AKYA 5DNAA 5KKAA 1UQTA 3D43A 2VHQA 2YJ3A 3EA4A 2BFDA 3EXFA 3QPWA 4I4IA 4UBOA 4RJTA 1UM9B 2XTZA 4MITA 4ZYXA 1UMBA 3U9LA 2EWWA 4O2BA 4Q18A 3IUYA 4H27A 3NDRA 2ZE6A 2PLNA 5BYJA 3REQA 4Z4FA 1CUFA 1EVYA 3NKVA 3PCRB 2Z6QA 3DWFA 4B85A 3Q1KA 1PCXA 1R8JA 4TTTS 1CIJA 3KT3A 4PTZA 3SIWA 3VNBA 4RIHA 1FJ2A 2H65A 4PFQA 1KQPA 1WY7A 2TSYB 2QZ9A 3KXPA 4NWIA 1RBMA 3VFDA 4A3SA 3V48A 1ESZA 1NT4A 3AJ8A 3LWZA 5BR1A 4E5KA 4L8VA 1HZJA 2FQYA 1ZXXA 1IZ8A 3ZHQA 1ECLA 3AT1A 2N42A 4MVCA 2XXJA 3QVUA 4Q4AA 5GZ3A 1GL6A 4DLSA 1ELOA 2I7XA 3DBRA 1QUFA 4XVHA 4X7PA 1NNI1 4ZHQB 1ZKDA 4V3BA 4MVJA 3UWOA 4CT5A 4I4TF 2FLKA 4G3XA 3L1IA 3A4LA 4X7RA 4BASA 1T2FA 1DQNA 1KJ9A 1QH9A 3EVEA 4MJXA 4QDZA 4EKDA 3WB1A 4BJ1A 3OFVA 3COSA 4BVFA 1QPGA 3KJHA 3D4IA 3QEAZ 3L7DA 4NL4H 2HZ7A 3GPDG 1LBQA 3IBFA 4PQGA 5IKXA 3WDLA 5BOSB 3V32A 5EMNA 3TW4A 1TZCA 3GELA 4K9QA 3G49A 3CE9A 1Z75A 3I3OA 1XAIA 1NQ5A 2E7ZA 1MIOA 3HCWA 3OQ6A 4HBZA 1H9CA 3ZEIA 4LW8A 1LSJA 1P4RA 1XT6A 3NATA 1E2KA 3R0JA 4QULA 2O8CA 5DLDA 1XQ9A 1NYLA 2QLJA 3DOUA 4RJIA 3ANNA 2WOJA 2Q1UA 4A16A 2X2EA 2JH3A 2QD3A 3ETGA 3L2OB 4Q7JB 5H3HA 3ZKAA 2JEZA 3ZTTA 2KJQA 1AM4D 1D2RA 4IZHA 3PTZA 4GP9A 1B1CA 1G2QA 4C2UA 2HPHA 1GZVA 5GTDA 2W00A 4F92B 4B3MB 1ISHA 1UFQA 4PONA 5AKIA 2JVJA 5EOVA 5LCXA 4QGAA 4O2AF 5HK9A 3VKUA 1DBSA 4H7EA 2FPIB 3K0AA 2R1VA 1R3UA 3NVDA 4D3FA 5IABA 1RC1A 3RG2A 5ENVA 1E9DA 1E6EA 1P1CA 2HSDA 3PXDA 5H1YA 5SV2A 3U48A 4TSRA 2YZNA 1G5HA 4NFHA 3VHLB 5CFOA 1H93A 5TS3A 4I3GA 1ZI6A 4YJHB 2NO6A 1I1HA 3B51X 2K4MA 2VATA 3F9CA 3NPMA 3SX2A 3T7SA 2W2LD 2RG7A 2ZJ6A 1FUKA 1RLJA 2FR8C 2ZTMA 1LV7A 3IXQA 3M8KA 4OYRA 3S7TA 4U2EA 4WSOA 3C6YA 3CW2A 3IPAA 1A50B 2HBZA 2Q5QA 1ORHA 3VJLA 1UJBA 2GZ1A 2YJTD 4YV1A 2GCGA 4IS3A 3PNKA 4MV8A 1G9SA 1KEWA 1W87A 3IURA 1G55A 4NS4A 5FA5A 3TDKA 2JRLA 3BTUA 3EYWA 4XOUA 1H9AA 2OZLA 1FW6A 3TOCA 2VI5A 4MR9A 4P93A 4KQMA 3V2IA 2WD7B 3L5OA 3WLHA 4NU6A 4B6JA 5KKNB 2ACVA 2C04A 1NDQA 1DRKA 1NFRA 2V7BA 4B7CA 2HC9A 3M6FA 4S1OA 1X80A 2PSDA 2R6AA 3B60A 4PS0A 4DJAA 4IIDA 3T7AA 3O8CA 3ESBA 3ICOA 2P1ZA 3DT6A 5DGXA 1I6LA 2XCUA 5DBIA 4CI9A 3G89A 4NOLA 3AKYA 1BHO1 4WBNF 5FWDA 3AJAA 1GKUB 2HU8A 3MLAA 1VIYA 1IQPA 1HRDA 2GYWA 4V0SA 5DX0A 1QO0D 4EHAA 1EK6A 1KEUA 2BHLA 4NJEA 3LCUA 2RC5A 1BD3A 4PYIA 4LJ9A 5KX5B 1X7DA 5C8YF 1J8QA 2IV2X 3OKAA 3W5JA 2I6SA 3K31A 1SXGA 3OLYA 3GUUA 4PYOA 1E2HA 8ABPA 3PEUA 1TU3A 1NUHA 2PX3A 2VJCA 1K3FA 2BTQB 1UDRA 2VSFA 4FFBB 5AVSA 4AQDA 4KHPB 4FFMA 4L6AA 2HRQA 4N9QA 1EM8A 2F7SA 1PTKA 1WNFA 3G2IA 3FIUA 4GVLA 2HRRA 2F8MA 4RH3A 3U4DA 5ED0A 5IAAA 3E9ZA 3RQIA 3B1XA 3DCJA 5A62A 1TNDA 4PRZA 2W6IA 3EEBA 3PJDA 4OJMX 1MFZA 3OF3A 2AN9A 2NLOA 4FDLA 3PQEA 2PMFA 3PFCA 2WJPA 2JLRA 4WKNA 3JTEA 2Z56A 1B6SA 2QE7A 3FYDA 3H6HA 4YMVA 4CEJA 1CUCA 4G9GA 4BLQA 4DY4A 1WHSA 2QMOA 3SYTA 4ND2A 4BGUA 5K51A 2O7NA 1Y63A 1B3RA 3DR3A 2ILTA 2JZCA 1SQGA 1EFCA 1H5NA 2VPYA 3DCNA 3H8JA 3G5TA 1OV4A 4TXMA 4C0LA 1CY8A 1M8PA 2I33A 3CIFA 3DPIA 1QOPB 2JGDA 2OAEA 2IEZA 4HNQA 4JJEA 3SYMA 4WDRA 3BBLA 3QHAA 1F3OA 3QMMA 3VPAA 1ZR4A 3AF5A 4TVOA 2R7NA 3VVLA 2CDBA 4FYPA 1UOEA 1UIRA 3FR7A 4OGWA 3RVQA 3EPLA 4UHKA 3VKFA 3PQCA 1LSUA 1T0PA 4MKHA 2ORIA 5BMOA 4OUDB 4NF2A 4EYKA 2PFGA 2VCYA 5IJAA 4A03A 1O3YA 2RB5A 1T3SA 3NYRA 3Q9UA 3T5PA 1GZ3A 2NAPA 1XQVA 5HKAA 1C4WA 3ZIAA 4HQFA 1RDFA 3DQPA 2OCPA 5EVCA 1JYSA 1O96B 2VNIA 2BFOA 2JBAA 3DUWA 4UUNA 4YJ2B 5CT9A 4C4TA 5CDGA 4JEUA 1TMGE 1O03A 3TZKA 4LC1A 1QWSA 2DPXA 3BWVA 2W6JD 4CE6A 1SK8A 4E2ZA 3FKJA 3DLTA 2WJIA 2Q6LA 3ADKA 4RTQA 1W5AA 3TEMA 3BGDA 4IZ6A 4M1ZA 5F2KA 5HA5A 2GYUA 3O26A 1H2AS 3NWPA 1L1FA 4QDJA 3RTGA 2VJBA 4XTRA 1QP7A 1R0KA 3B9QA 3AJRA 3LKDA 2CXNA 4KRYA 3AVWA 2V7GA 1DWOA 2RIRA 1OIXA 1RM0A 2JIBA 4XFDA 1QCCA 4CM8B 1OF1A 2FE4A 2IZZA 4Q39A 4D41A 4Q1AA 1RXSA 1XFDA 2ENWA 1VPVA 1DL5A 1FK8A 1NVVR 2O1SA 3FSJX 2J3KA 2AZ4A 3OJFA 3K15A 3W3AA 1P1JA 4YRLA 1TYZA 2C20A 3VZDA 2QBYA 5FNVF 5FYDA 5DW3A 2OBYA 1TUEA 2AFHE 3BHIA 1NBOA 2V55B 1TCBA 3KZKA 4XKJA 4UQLA 4AJNA 1GQ2A 5DM1A 4BX9A 3H5TA 4G63A 1Y4ZA 2R6R1 2WWXA 1GV1A 4JB8A 4KLAA 5GZ6A 5AT1A 1QIKA 5LP6C 4MP8A 3RAJA 2VR1A 3BZWA 2PQ0A 3EE6A 4HN4B 3SC2B 1ZAYA 4YWJA 2ZUEA 1R0SA 2AMFA 3DKIA 3WQHA 4YIHA 4AQ7A 1Y3AA 3T94A 4K2AA 4R9VA 1I13A 4R8MA 4YJDA 3AERA 2GTPA 3NC4A 3OUUA 3X1ZA 4KO4S 2H51A 1Q21A 2GPAA 3OEWA 4Q4JA 3T4EA 5KREA 2NU8B 2J6IA 4RFSB 3ESCA 1QIIA 2WHYA 3REFA 4AYXA 5K8UA 3DZHA 5CCXA 2XW6A 1HKUA 3WK4A 3GCXA 3D6VA 1E1QD 3PQFA 4NENA 2QUIA 4KYIB 1CQJA 5ALNA 1WXDA 2BF7A 4ZVLA 3R7NA 3OZCA 1TZ2A 5GWXA 4IILA 3URKA 3FGPA 2LCQA 5LMZA 1BMDA 1IEVA 1ZHFA 1SKQA 2V8OA 4ML3A 4M1MA 2X4DA 3LC7O 4NCHA 3EGXB 3L92A 4BVEA 5BRJA 3L4JA 3RO7A 1LPPA 1XQXA 4QXAA 3ND5A 1JHDA 4RQUA 3WNQA 4LBVA 4UHDA 1XVTA 5ESDA 1OI3A 5FOSA 2XF2A 1NR1A 2QRUA 3QKUA 1QU3A 4UZFA 3DEYX 1TCUA 2EXXA 2X6TA 2WU8A 3O73A 4D4GA 3KS9A 1EX7A 4I66A 1JVSA 3V5NA 2G76A 3AB7A 2AUNA 5BSHA 5LNK1 4LYDA 3TIFA 4UNRA 2XT9A 3VYVA 2F48A 2VUUA 3Q5GA 4O4IF 4F9EA 3ZS8A 4C0HA 3LBHA 3DV0A 2IYAA 1IWOA 2Z95A 4QEZA 1WV0A 2Y77A 2AFIE 3D64A 2DHQA 3CHYA 4QXQA 2VSOA 1L4FA 4IGKA 1BKYA 3EFOB 1JG1A 3L8GA 1RBYA 3EY4A 1E9AA 3I73A 5K8TA 3T5AA 2W0SA 4Y9DA 1H0SA 5CDUA 3OPYA 3CC8A 2E4YA 4DCSA 5IWAB 2ZTHA 3U81A 2BM1A 4FFNA 1NV8A 3CSDA 3TAHA 2PUDA 1X94A 2VT2A 5ITZA 3EXFB 4WX2B 2I2WA 2G77B 3O8DA 3SI7A 4Y6RA 1UMBB 4O2BB 2H63A 3BGWA 2V59A 1KO4A 2VF7A 3NNNA 3BD9A 4DEYA 3U19A 3REQB 3WGLA 3Q10A 2K2WA 2XBMA 2HA2A 3DZFA 3V8VA 2YVKA 2VPWA 5LKAA 1E6CA 1FRVA 3HXTA 4RSRA 4YJ3A 5AUOB 1UJ5A 3LX4A 3O4HA 4WCVA 3IOBA 3FAKA 3W8NA 1DQZA 1I2MA 4GZMA 2A4KA 5D3MA 2HIAA 1U0GA 3DL7A 1QONA 3F6EX 1KIMA 1QZXA 3IQHX 2J45A 2XB9A 1BQ3A 1JN0A 1SUSA 4IHJA 1AO3A 4I6GA 4I3HA 3W2EA 2QYOA 3SCZA 4RD2A 4D9MA 1XJWA 5D8DA 2DG2A 3DBRB 4QHSA 3CRW1 1N1DA 1I1OA 4D3XA 4A0HA 3IE2A 3FOFC 1E7MA 4BDSA 2XNCA 4OXIA 1U3GA 1W6RA 3KKLA 3T12A 4DCTA 4D9HA 2HQOA 2EFHB 4G5FA 2CB0A 2P1DA 1KQGA 3G0CA 3JVVA 4FMDF 2GVDC 4O5OA 3ROZA 1EZZA 1A5ZA 4FFPA 4HDCA 1TOAA 3CWQA 4DVJA 1C7RA 5DJ5A 4DQUA 4CEIA 1GNLA 4GH5A 3OZGA 4WASA 1QUEA 3GMTA 4BZQA 4YLGA 3BKXA 2W42A 2FFBA 1CUHA 1Q7TA 5L3QA 3G2MA 3GLSA 3GMSA 2JFBA 3NIWA 1DEHA 2XQVA 2AKYA 4IQ8A 1N7GA 4L8WB 5CK5A 5JC8A 1HF3A 3WLKX 4G4GA 3FNEA 3STYA 4ALLA 1X8JA 1KYZA 4D6PA 4PSAA 3USZA 5GGYA 2AL7A 2YY6A 5ALGA 5JYEA 1PFQA 3C5EA 4D4HA 4PSDA 3WHIA 1UDWA 3IIKA 2WJWA 2N1BA 3NHMA 4MARA 3FKQA 4MA5A 5BSVA 1P4GA 4V0MA 2FX5A 4AY3A 2CMFA 5DHPA 3U37A 3E9YA 1JDZA 1NJ8A 5CK4A 1KAOA 2JDID 5C7YA 2GBPA 3OJXA 2J3LA 4DJFC 5GP1A 4PZPA 2OXEA 3D6AA 4Y2TA 4BECA 4D6XA 1TM2A 1XRNA 3ORQA 3K1JA 5ERGB 4KQGA 2D3TA 3UKOA 3BE6A 3GEHA 1CU1A 3IUSA 4EKNB 4ZYTA 2EJUA 4HDQB 1RW4A 3A6LA 3DAPA 4IKEA 1T3HA 4LYEA 2JFZA 1UMKA 3OFKA 1BA3A 5C1PA 3QY9A 4LF7B 5HM8A 1SIOA 2P9HA 2BN4A 2FA9A 3B3GA 4NYJR 4B6QA 2D8MA 1V9SA 4MI9A 3WTBA 3OKCA 4R05A 2ZBDA 2GBCA 4Z51A 2RHMA 1WZEA 3IVXA 1OX5A 2VTVA 4U2BA 5EQFA 3EIUA 3KKEA 3QUSA 2VEOA 1ULZA 4FGJA 3CH7A 5B2FA 5JNRA 2AG0A 4US0R 4M7WA 1XPOA 2WTNA 1Y1RA 5EE3A 2IUUA 4ZEWA 3C16C 2H1VA 4HSGA 1U0RA 2F1OA 1WW8A 4AKEA 2QJOA 2DHDA 5E9JA 3NNSA 1OWNA 2QX8A 3AF2A 3GRKA 1O89A 3ZWPA 3AONB 4ZPJA 2I9KA 1XAGA 1YR2A 2O0HA 3K2BA 2IE8A 4ZV9A 4HZGA 2XUOA 1R0BA 1T8SA 4QXPA 3P27A 4ZI7F 3KU4A 3FB1A 3QF7A 3RFXA 4M7OA 2PCLA 4ZJUA 1J23A 1PUXA 2VF2A 5GONA 1N6HA 4FYIA 1RAAA 2JFUA 4MR9B 2VDUE 2Y0DA 1FC0A 4LN1A 5L7WA 2BKEA 4BVJA 3DYIA 2H1RA 2C82A 4O3MA 1AKYA 2ASEA 4RBNA 3W6OA 2YQZA 3ZBUA 4D4IA 4UBLA 1KJZA 2BR5A 1EUCB 1OBOA 1SWWA 4ALIA 4CDRA 1D0SA 3QFCA 1W8IA 4GOND 3KQPA 3NT4A 3LK7A 2PO5A 3EWAA 3RVDA 4EKYA 3RC8A 4CNBA 1U3UA 2H7CA 3D54D 3UMVA 1XSEA 1ZCFA 1HSOA 1FMJA 2ZOSA 4GX1A 4BO2A 3NHPA 4MIKA 1WZ2A 2JAQA 2VRCA 3R0ZA 4A7PA 1OLUA 1P0QA 4ROSA 5FTJA 3KTDA 3GV0A 1ESEA 4LXIA 2B1GA 3U7HB 4HGRA 3FRIA 1C7IA 1QX3A 1R88A 2FRVA 2WJVA 3GH1A 3N7TA 4HS4A 2BFEA 4Q1BA 4QREA 2Z8XA 4XARA 4G23A 1ATIA 1SC3A 1DHTA 5THXA 3IPYA 5EZYA 3SSAA 1W96A 1DO2A 2GI4A 2BHNA 4D4KA 3GPLA 2YBEA 4IHQA 2EKBA 1NUSA 4YP7A 2CZQA 2P91A 1WXFA 4ZO8A 1RCTE 5FPQA 1GUBA 3Q88A 1DP4A 4JP2A 5CJPA 1ZY2A 3AINA 2ZRIA 1EM8B 2WM3A 3T7DA 5EJEA 4N40A 4RXTA 2TMKA 3QE4A 4KR3A 3PDCA 4AFNA 5I4BA 2QDXA 3IR6A 2NO5A 4XWTA 1R5BA 3EARA 4EB0A 1Q74A 2EG5A 3SC3A 1YUMA 5CB0A 4EO7A 4DKJA 1FJGB 2XEDA 3KVRA 1WHSB 1IEWA 5KBYA 2GLXA 1JJIA 1Z28A 4DLUA 4WUVA 4ZHQF 5U9CA 2VS1A 1AKVA 3GJ3A 2Y92A 3O74A 4MUGA 2CNWA 3GIWA 4EELA 2KLBA 3KT8A 5KWSA 5J4HA 2BGKA 4NBRA 2GXSA 4A8TA 4PO1A 3VVMA 2DT8A 3HB9A 1VXRA 5E6UB 4AX4A 1CQZA 1HEUA 2BKVA 2P9BA 2JGDB 2FWMX 2O2JA 2DJIA 3ZZNA 1RXIA 4AIIA 1ZU5A 3FDIA 2WHRA 5KVVA 3VR1A 4URYR 3R6LA 1L5ZA 3AU8A 1G63A 2J9FA 4MRNA 4XSVA 3AVPA 1XZIA 3CKMA 2V7UA 4OSEA 1VLVA 2VQDA 3P2OA 4INAA 4NFSA 2A84A 2NUBA 1YE5A 1AF7A 2EGHA 1H1DA 3D2BA 1IYZA 3T1VA 4P4UA 3T7IA 4Q93A 3A7DA 4D8TA 4KMRA 5ICSA 4KPEC 3OQMA 2A1IA 1AX9A 3DC2A 5F7JA 2H1CA 1D1SA 3K0FA 1OASA 4JAVC 2V3VA 1J42A 1FX0A 2O8BA 1K8XB 4YN3A 3EAGA 1U8ZA 2AZXA 4CM6A 4GPEA 4L02A 3YASA 5BSKA 1YDMA 1YRYE 5FXMA 4NARA 3Q2IA 1LV8A 2G1JA 2NV6A 2ZSBA 4H1VA 4TMTA 1KS9A 3I4FA 4YCDA 3WB0A 4DLKA 5FTWA 3VMMA 4NJOA 1ZW1A 2PIDA 3JD1A 1R6VA 1F2UA 3OPNA 5DEIA 2WWHA 1D6NA 3I04M 4YMLA 3E9MA 3L0BA 4A8PA 4EHLA 3MN1A 2Q5HA 1RR6A 1AQ6A 1AS2A 1HYEA 1KRHA 2A8YA 1UDBA 1Y9AA 2AE2A 5AW1A 1KH1A 3IE0A 1P2TA 4QPZA 3H3FA 5JAIA 4F8YA 1B0UA 2BISA 1J9EA 3A2MA 4PLWA 2HMUA 1Z35A 3TIVA 2BUBA 4J1NA 2Z1DA 3X1WA 4EPYA 3HBNA 4EYGA 3K0SA 1BRTA 2VYCA 3K3PA 2OM2A 1FQWA 1X38A 4UE2A 1ZW6A 3AY3A 1NLZA 3R9IA 5AVTA 2DUWA 3FOAA 5F2OA 2UVQA 3BTOA 2CEAA 1C9DB 4OM7A 3U13A 3GH3A 3GEIA 4HRAA 2YWGA 5F1YA 3R7LA 5C3MA 3RVLA 4Z86A 1AN9A 3V80A 2V65A 1UQRA 2IXAA 4AICA 3ECSA 1GLNA 2Y1LA 4NIMA 2YX1A 4PZAA 3ZPXA 4M1QA 2I8AA 3FUCA 1M5RA 4ND3A 5JSFA 4C4ZA 4UAUA 1CB7A 1DWPA 3UBMA 4TM7A 3KRTA 3AERB 4B5LA 3I2JA 2EKQA 1UWLA 3OZDA 4D1YA 1FDTA 1MPXA 4KYUA 3JU3A 3D3NA 3FPEA 3SC4A 2OMKA 3DBIA 4JOBA 4HB0A 4X5OA 2WIKA 4WY5A 4AN4A 3FLAA 5ALZA 3VYRB 2ZSUA 5JISA 3HNRA 2XRYA 5T3UA 1HC7A 4J0GA 1CEQA 1V3UA 4GXTA 2XMCA 4ONEA 1WPXA 2NACA 2W22A 3BULA 1CQJB 1XD2A 3CLVA 3F4LA 4FS8A 5G53C 3WDSA 1VYUA 1XKXA 3PP8A 2X77A 2H4FA 2RAVA 3FJYA 4FOTA 3KQMA 1LK7A 3VPGA 3ZWWA 4W5NA 1YASA 3CX4A 4B76A 1ILEA 2PLFA 4PG5A 1ZX1A 3A6EA 4II7A 2ZREA 3COWA 3PGXA 4PPQA 2V5VA 4OMFG 4IP0A 4ZOEA 5I7RA 1H6DA 3BFXA 2P75A 2J3EA 1G1AA 6ABPA 1ZN7A 2W98A 4M99A 2H18A 5DCLA 1A7UA 5H81A 4RORA 5D3ZA 5KX5F 3AYZB 3ESRA 4P81A 3B52X 4FCCA 4U7JA 1KQ3A 5JQGA 4RMGA 3IOMA 2OXCA 3DFIA 1LGYA 2XKBA 3W8RA 4GF5A 1ZJ6A 2PUHA 4O4JF 5AH0A 1M2OA 2IXEA 1ADFA 2Q5JA 5FUWA 5I8WA 3L46A 3MTAA 3OJEA 2G9ZA 5C4GB 4BLWA 3GP8A 4JYZA 4P22A 4C01A 2AA3A 2Y93A 4AN1A 3N3AC 5CPBA 4NZ9A 4NR0A 4G4JA 3RREA 2PL3A 4LZWA 3EEOA 1G19A 1H69A 4YT4A 2XKAA 1N1MA 3GUHA 1SBHA 1W5SA 3COVA 3QUTA 4LJSA 4Q9IA 4N8SA 5ITZB 4X41A 4RHFA 5B1YA 1CZLA 2D1SA 4KQHA 4YI3A 5FQOA 1SD2A 5CA0B 5JDCA 4YAFA 5A02A 2XMRA 5B3AA 1TF2A 3K4QA 2XDYA 3MMPA 4FS3A 2WY2D 2XR1A 3IS3A 1XCJA 1DBIA 2XCOA 1T2DA 1SU7A 2HXGA 4J0FA 4YJ3B 1ICIA 3AKZA 1J8VA 2VOJA 5FI1B 5D3MB 1SJ9A 4HQOA 3TZBA 4R1NA 4CT0A 1L7OA 4YAKA 4F97A 1YCDA 1GRCA 4KSCA 3SHFA 4A0QA 1N4DA 3TZLA 5EIHA 2NVBA 1OXBB 1Q7EA 4D9FA 4BLUA 3NTOA 4C07A 3PFKA 4FILA 3LD9A 4OJQA 4DPKA 5U4XA 1A2OA 2GEDA 4QIHA 4TWIA 3OO1A 3L77A 1W8DA 1M2WA 4I1UA 3MM4A 1T91A 4TUYA 3EASA 1PX0A 1VSVA 3KXKA 4LHEA 1ML4A 5SYNA 3TQTA 4WERA 2X1MA 1R8SA 1V8ZA 2D5CA 1JR2A 4JGGA 1O9BA 3P1JA 2OHVA 4KUHA 2XVYA 2FRXA 3FKSA 4PGGA 3FDXA 4X8LA 3FPFA 3VV2A 1W0CA 4ROTA 1K75A 4KXVA 4Y2XA 2HCTA 3C1AA 3KFXA 1DWUA 3B1KA 3F5SA 1M2GA 4W7IA 3FTDA 4EDHA 4YLYA 1GCAA 2X3FA 2ZTVA 5JXWA 4B6FA 4AI6A 3F2IA 3TVTA 4BNWA 1U2DA 3AF0A 3R44A 2ZUCA 2F67A 4OX9Y 1JGTA 2ERXA 5T41A 4DTIA 3KQKA 3SHVA 4WEOA 3W7AA 5EJMA 1IDN1 4G0NA 1ZAKA 3ZD9A 3N8DA 1E3TA 3OTOB 1VXOA 3KFLA 4EQZA 2IGBA 2XMPA 4CMGA 1P72A 3TRDA 4BVHA 1SVNA 3NEYA 4LGCA 3QVVA 3WHKA 4JDUA 3HP1A 3O4FA 5A1TA 2C8VA 4COOA 4EEKA 2W83A 5C31A 5TS2A 1HUQA 5ESWA 5T57A 4PAWA 4X94A 1G4AE 3K8ZA 1WF3A 5C18A 3X1JA 4RKEA 5LQNA 2H2DA 1TJ3A 1H8HD 4R8LA 4UULA 2J5RA 1OKKD 4PNZA 3KELA 5TB5A 1Z36A 3IP8A 4MRSA 4QYTA 4P7FA 4PFKA 5CVUA 1GPLA 1UXOA 2UZ1A 3LI2A 4XPZA 5GJWC 1MO4A 1JDSA 3AUSA 3CBQA 2KM1A 2KWIA 3H2SA 3IUMA 1J90A 4JX9A 1V41E 5TY0A 4CQLA 4V2UA 5DT9A 2IYFA 4MKGA 1U6KA 2FZ4A 2V7PA 4EYEA 2XTMA 5HQ3B 3SOZA 3S68A 2QLLA 1ZN8A 3FYSA 2BI7A 3C85A 3DVSX 1MQ8B 4QTTB 1YS1X 1DVRA 2BEWA 2FWNA 2MMGA