3KU4A

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
293
structure length
291
Chain Sequence
NDLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAHPDYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 97
structure length 291
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ku4A00
1PK9A 4LNHA 2AI1A 3KHSA 1B8OA 1U1CA 3DDOA 4TXMA 4WKPA 3K8OE 1JDZA 1B8NA 4LZWA 1LV8A 1K27A 3FOWA 4PR3A 3ENZA 3ODGA 4TYMA 5DK6A 3OF3A 4DA0A 1RCTE 4YJKA 4L5CA 4MARA 1OU4A 1JDUA 3DJFA 4JWTA 1TGVA 1I80A 4GKAA 1PR6A 3O6VA 3E9ZA 2I4TA 1K3FA 4L0MA 1A9QA 3KVVA 3C74A 3U40A 5KB3A 4DARA 4QFBA 4DANA 4D9HA 2QSUA 4U2KA 1V45E 5C80A 2I8AA 1TCUA 1QE5A 1VMKA 3PNPA 3BSFA 1Q1GA 3LBAA 3DP9A 5F76A 5F73A 4LDNA 1ODJA 1RYZA 4EB8A 1JPVA 4BMYA 1Y6QA 1Z38A 1NC1A 1ODKA 4KN5A 1Y1QA 1ZOSA 4DA8A 4R2WA 4TTIA 2ISCA 4D8XA 1OUMA 1T8YA 2P4SA 4OGLA 2A0XA 4YMLA 4OY3A 1A9TA 4X24A 3UAYA 3EEIA 3IOMA 4OGKA 4TTJA 2HRDA 3NM5A 3F8WA 3OZDA 3FWPA 3LA8A 1V48A 1Y1TA 5EUBA 1TCVA 1LX7A 1M73E 4DAOA 3T94A 4GLJA 3BGSA 4LNAA 4NS1A 1Z36A 4D98A 1JYSA 1OTYA 5CCDA 3TL6A 2AI3A 1G2OA 3IEXA 1FXUA 3OZEA 1SJ9A 3DF9A 3MMSA 2PGAA 1RXSA 1NC3A 4F3CA 4OJTA 1TD1A 5IFKA 3KUKA 4UC0A 1CB0A 4GLFA 1RT9A 1SD1A 1PWYE 3QPBA 1A9PA 1RXUA 4M1EA 1PR1A 1YQQA 4R2XA 4OEHA 4E1VA 5CCEA 5F7JA 1OVGA 3UT6A 2QPLA 4OF4A 5F7XA 1VFNA 3O4VA 4G41A 4IP0A 3UAVA 5B7NA 4EARA 1Y1RA 3NM4A 4QEZA 4QASA 1JE0A 2XRFA 3KVRA 1OV6A 4QARA 2QDKA 2H8GA 5I3CA 1PKEA 4I2VA 4D8VA 1U1EA 3FUCA 1JP7A 4G89A 4BN0A 1RXCA 1PBNA 4TXHA 3P0EA 2AI2A 2HSWA 4M7WA 2OECA 3BL6A 1OTXA 2B94A 1ECPA 2OC4A 1Z5OA 3ONVA 1V4NA 4FFSA 3FB1A 4D8YA 4H1TA 3E9RA 1PW7A 5K1ZA 4LKRA 1RFGE 3OOHA 3MB8A 3D1VA 1N3IA 4WKOA 3GB9A 3EUEA 1JDSA 1ZL2A 1A9RA 1A9OA 4WKBA 1RR6A 2A8YA 3UAWA 3P0FA 1V3QE 1Z5PA 5EFOA 1ODIA 5CXQA 3DPSA 4WKNA 1K9SA 1PF7E 1V2HE 4TXLA 3FNQA 2QTTA 4R31A 4ECEA 2OXFA 2ON6A 1Y6RA 1U1GA 4L6IA 1U1FA 4WKCA 4NY1A 1PK7A 4F2WA 5F7OA 3PHBE 3OPVA 2BSXA 5F78A 1Z37A 1V41E 2HWUA 3NM6B 2HN9A 1YQUA 2IQ5A 4F1WA 5IU6A 2A0WA 4TXJA 5CYFA 5JPCA 1T8SA 3K8QA 3PHCA 4JOSA 1Y1SA 2A0YA 4JP5A 3EMVA 1ULBA 1PR2A 1T8WA 2QTGA 3BJEA 5F7ZA 1SD2A 3INYA 3OOEA 5EPUA 1WTAA 4DAEA 4DA7A 3EUFA 1Z33A 1SQ6A 4L5AA 4QAQA 3KU4A 4QATA 1A9SA 3NBQA 4F3KA 2AC7A 3KVYA 4TXNA 4BMZA 4GMHA 4RJ2A 5B7QA 5ETJA 1ODLA 3UAZA 1JDVA 1JE1A 4YNBA 4TTAA 5CXSA 3OZBA 1YBFA 1ULAA 5B7PA 2RJ3A 2Q7OE 1PR4A 4DA6A 2GUWA 4MCIA 4NSNA 1U1DA 4TS3A 1CG6A 1T0UA 1Z39A 1T8RA 4G8JA 1JDTA 3LGSA 1Z35A 3UAXA 2OC9A 1A69A 3PNSA 3SCZA 5B7GA 4MCHA 1VHWA 4BMXA 3OCCA 3OZCA 4K6OA 5F77A 1YRYE 1Z34A 1YR3A 1RSZA 1VHJA 4M3NA 5CYGA 1NW4A 3FAZA 1C3XA 1LVUA 4TS9A 1PR5A 4P54A 4DABA 3GGSA 3E0QA 1XE3A 4L5YA 4F2PA 1RXYA 1Z5NA 4YO8A 1TGYA 4PNPA 1PR0A 5FAKA
chains in the Genus database with same CATH superfamily
3PC7A 5TQ0B 3SIPA 3IQWA 4LV6A 1BVYF 2V45A 4ZVMA 2V4MA 5F12A 2GHQA 3VPDA 2VF4X 1A4XA 3BM5A 3ZWDA 1WVMA 3W34A 1C41A 1PP4A 2CNWA 4I55A 4QPZA 1SCIA 1C7ZA 2FXVA 3BB4A 4RYLA 3RYFA 2O5CA 3KAKA 4XCQA 3N0XA 4Z0TA 2ZCJA 5A71A 4JUFA 4C9BA 4CR8A 3AZPA 2XUPA 4ZOAA 3ZDFA 4EVQA 2FMFA 1CNMA 2VZ0A 3HJBA 2FDXA 1SKUA 2PCLA 1VYVA 3OQHA 3ZXIA 2O7QA 2XITA 3QXXA 4TLLB 3U5ZB 1BWSA 4B80A 1E98A 5TSDA 5GIOE 3OICA 4YASA 1QP7A 3LNCA 4DW8A 4RS3A 4JP3A 3LHFA 2E87A 3ODGA 2JH8A 3T3PB 4AAYA 3LAWA 1Q77A 4EEXA 4CG3A 2I2FA 3V2HA 4OLAA 3OJWA 2O2EA 1OZAA 5AWFC 4DQDA 3WHLA 1KVQA 3Q3JB 2H48A 1JT9A 4G3XA 1Y8CA 1RCTE 3T0FA 2WB2A 1NG9A 2X0KA 3I4LA 3IPLA 5KCZA 2GCIA 4DLTA 4WCDA 2EL7A 3BJIC 3RREA 1KNQA 4LZLA 4B2YA 1I8TA 3EUWA 4YAFA 5I4CA 4RE5A 1CY7A 3WY9A 4DBZA 3FPEA 4N7RA 5ECYA 3VI4B 2B4TO 4Z3OA 1TO1E 4FR5A 5IJAA 3KAQA 4DMCA 1J8YF 4YA6A 3N28A 1NPYA 1XMXA 3ZLBA 1Q50A 3KOUA 4OJKA 4Z7QB 1US8A 5I45A 3L0SA 3QELA 3GVCA 2C98A 3IAHA 3A4IA 5GONB 3UWDA 5DGTA 1XHEA 1Q0UA 2RKBA 3DDUA 3H1EA 1A3CA 4A9AA 1KSGA 1JNXX 1SHUX 1XZPA 3WQSB 3L46A 4FCVA 2JLXA 1JEEA 3U7IA 3LI2A 3N5KA 4BMNA 1D7OA 4BWGA 5JU6A 5GADl 3I53A 1OYVA 1QH8B 2BKUA 3ZE8A 5IEBA 4C3ZA 5CH5A 1XZKA 3TKAA 5TDHA 4PN7A 4RD3A 3C4JA 5AXBA 1GADO 1XCBA 4ZV7A 3SQMA 3TJMA 5D3MA 2C0PA 1L9KA 1Z15A 3U0BA 2DF8A 3ZDYB 4DCSA 1USKA 1XOIA 3NJ8A 1L7NA 1Q1GA 2PYIA 1R5NA 2NU6B 3V2IA 3WXMA 2G82A 2IPAB 4W1QA 2BP7B 3I34X 4TPKA 1DAFA 3ICEA 1VIYA 5F51A 3RAGA 4RW0A 3A36A 2I66A 4EB8A 3G0IA 3RS8A 2PK3A 4JLAA 4HRAA 3DOIA 5JJLA 1VG9B 4MQFB 2AHOA 2CYCA 2JFNA 3MYYA 4KGZA 3G2NA 3LCRA 4UFPA 1HNZB 1K0FA 2D5LA 2FWBA 4CEIB 2XCLA 4RFVA 1NQOA 1QCZA 1Z6ZA 1OUMA 1Z6XA 2IOYA 2O8BA 1XKXA 3AERA 1ADFA 1NNLA 1VFPA 4FDAA 4OHWA 5AHWA 4BNWA 5JRDS 5KSZA 3AUAA 3WIBA 2IXAA 2QV0A 1WU8A 3G0CA 1MO3A 1Z16A 1ZMBA 3O8LA 2GF9A 3Q3HA 5FTJA 4BVFA 2H2DA 1L5HA 3HDQA 1Y42X 4PS0A 4CQMB 2RMKA 1Y7TA 3N2ZB 4CU5A 4YMLA 2YXNA 4O2BB 1MFZA 3EOAI 2IRWA 3RSHA 3HXPA 4X24A 2MHCA 3W04A 4AP6A 1M0WA 5DYWA 3RIEA 3TRFA 2O8CA 4OGKA 4CKEB 2XDYA 4KGDA 2QR5A 5KPJA 2ZJ7A 4BO5A 1QHEA 1RAIA 2RK6A 3JQAA 1PVOA 4IHJA 1HDRA 1IG0A 4RK0A 5GVSA 3SQOA 3BFXA 2IYLD 1YZGA 1RZRA 1W85A 4HH3C 2PN1A 4XTCS 2D0IA 2H2HA 4Z8XA 5EUBA 4C3UA 4J1TA 4ZO9A 1X7GA 3QE4A 5JS7A 3GLHB 1QTIA 1JEYA 4OSPA 1PT5A 1CW2B 2BTOA 2QOEA 3IP8A 4XQ0A 1RMQA 1BEZA 2XVMA 1T36A 3AETA 4IJVA 4K86A 1ST2A 4NS1A 2PKEA 2GN2A 2W4MA 1YQWA 3Q1LA 3FHTA 5FUMA 3DMTA 2G1AA 5F3DA 2FUG6 2HRCA 3E27A 3ROMA 3ZGXA 5J2TB 3ND7A 3V2UA 2PUGA 3JVEA 4DA4A 5CCDA 4E4TA 4KN9S 1AXGA 4KSBA 5ICSA 4RHUA 3I9V1 4M1YA 3TGPA 1PR3A 4TRMA 1U7PA 1NLYA 5H7XA 1JJ7A 1HFWA 5ALKA 2B1QA 3PK0A 3SLKA 3KOZA 1YE8A 1I10A 1KU0A 4NBRA 4PO1A 3G8CA 1WB4A 3Q15C 2P4EA 4C29A 4FFOA 3K8ZA 2J07A 2GRAA 3QBEA 2E55A 1D03A 4KYUA 5CA1A 1JMYA 2NUBA 4NFHA 3GEEA 1TIKA 3F74A 1JJAA 3BMCB 1NE2A 3LPNA 1KEPA 1MLDA 2DFKB 1RXSA 1W9MA 3CE9A 1IN4A 1K8RA 4XIYA 5A9TA 3CUKA 3FR7A 4LXQA 3ZWOA 2Z5LA 5LB2A 2QMOA 3JQCA 1STOA 3GUHA 1FFDA 4LNUA 4M7PA 4M76B 2BONA 4RFSB 1XZJA 1GLNA 1VE1A 2RDMA 3P94A 5FBZA 2A67A 1OX6A 4XWOA 3QPBA 4XQEA 2JGEA 2WSSD 3DBIA 5IXSA 3M1AA 1J4AA 1GAQA 2FPIB 4V0MA 4M1EA 1PR1A 4YTEA 3GP3A 3LDFA 1GPH1 5DHFA 3QOXA 2X14A 4L3OA 4CTKA 1MEOA 4FHZA 5DXFA 5I47A 2W9XA 4ZEOA 1K4MA 3ELUA 5BWOA 1CD5A 3P1JA 3QPDA 3AU8A 4J0IA 1PLJA 1ENPA 4LXUA 4ZO6A 3ZN2A 1Y6GA 2ADOA 3DT9A 3WGVA 3O4VA 4GECA 4GD3Q 4B83A 2Q9BA 1R15A 2BSQA 1Z12A 3LL4A 5B7NA 4IS2A 2F4VB 4A2QA 4KRGA 3F3KA 4FKMA 4XVHA 1EFPB 3KT0A 3WK8A 3HMKA 1ODSA 1QVZA 1OSNA 2O3JA 2PMDA 5DX1A 3A14A 2Z09A 5EWMA 2HI0A 5HYVA 1M34B 3F3SA 5FNVF 3I3SR 2D54A 2LE0A 3KO8A 2VYVA 4KAXA 3RTEA 5BW4A 3RYIA 3HP7A 3C5EA 4J1QA 4D4KA 3U6BA 3UAGA 2A0UA 4JI3B 1BRTA 3LQ1A 3V4RA 3GEPA 2FMTA 1H6DA 2BR3A 3Q6IA 3SHOA 2PWBA 4W7HA 4YACA 3CX7A 4P86A 4UBNA 4CMHA 2G88A 4H0NA 1TJPB 3CV3A 2CLIB 2AI2A 1ZOIA 2OECA 2OZLA 3WLAA 2AMFA 2VZEA 2GYUA 2WF8A 1C8LA 3NJRA 3DCYA 4PRYA 3AHHA 2CB0A 2C58A 5EIBD 1MCZA 3GJ0A 3IX7A 4YQEA 3NXKA 2QYHA 1YZHA 2BEVA 2ZIEA 4FFSA 4UHEA 1M1NB 1UBRS 2QYTA 1JXQA 4LJLA 3A3YA 4P3NA 1ZK1A 4ND2A 3E9RA 1A9ZA 5EXSA 4C87A 4DDWA 4RIHA 1NDQA 3WRXC 1G9TA 1ZBQA 1MOPA 1KOFA 1O4WA 1U6JA 2A9PA 3C1UA 4KXLA 1BGXT 4Y2TA 3T5PA 1J22A 1LFDB 2QENA 1JQLB 4UU0A 2C2HA 1T4GA 1IBCA 1F7UA 2Q62A 3CSDA 2IYOA 2RJOA 1OT3A 2WF5A 3AUYA 2EGHA 3AHEA 3B85A 3IPYA 1NDUA 3KYDA 2YJ3A 4GKBA 4IH1A 2F9LA 5E1BA 2PZFA 3UXMA 3W5CA 2FGKA 3K20A 1N78A 1XDBA 4FBGA 2UV8A 4UHDA 5I7WA 4R05A 1KO1A 2AKAB 4OX9Y 5KHAA 4CEHA 2FH5B 2FUNB 5CXQA 1ADCA 3RK4A 5B3JC 3H11B 3C87A 1JHVA 3I8XA 3TZHA 2B30A 1TM2A 4G2TA 2I3BA 4EY3A 1M8PA 3KKOA 2X9NA 3MXTA 4OP1A 4WLEA 3L0ZA 1RDFA 4B4DA 1U5CA 3LUKA 4PPQA 4HH4A 3UNXA 4DR2B 1GGHA 1V5EA 4CTMA 3ZHVA 1E0DA 1THTA 4TS4A 5DTRA 5FO0A 3A6JA 3EWAA 3S70A 1JF8A 1XELA 1ZD1A 2YICA 2P9GA 4JB2A 4BNUA 1D04A 5TMBA 3LX4A 2BFDB 3GRFA 1JQ5A 1HTWA 2J5KA 3ZCRA 2KLBA 3UK6A 2FSUA 2JIPA 1LVHA 3C15C 3OQIB 4RV5A 3DVAB 1JFRA 5EXEA 1WMBA 1EBFA 1EFVA 1DC7A 2O8NA 3A9VA 4ZZ0A 3RSCA 3DKVA 1SEPA 2G4CA 4HDCA 1EBBA 5EN4A 5HF8A 5BW6B 5CDFA 2X8AA 4YYZA 4DSOA 2X6RA 3DUFA 4PSKA 4TMWA 5C18A 1ZMOA 1EVIA 2BMFA 3ZVLA 4IHQA 4EK9A 3L4SO 4B81A 2JIZD 4AQDA 1ZHOA 5DLDA 2PNFA 1L3IA 3FMPB 1AGPA 1VSBA 4HS9A 5K8UA 1A8HA 4HQRA 3V42A 1W35A 4PFSA 3D2LA 5T3YA 2DC1A 3RKSA 1GN9A 3BSSA 5DM1A 1GFWA 1TVKA 4R8MA 4C30A 4A6XA 2HX1A 1N2GA 4Y6OA 1R5OA 4JYCA 4JA0A 1FCJA 4RLFA 4OJNA 4PZ9A 4G36A 1HX7A 3C39A 1E9FA 2M98A 5DYYA 4CHTA 2C59A 5B6IA 3I2YX 4Y2VA 1PVDA 2C97A 1IZYA 2DWOA 3QHQA 4FHFA 5JSKA 3S5JA 3UO8B 1QGAA 1S8NA 5JPCA 3N58A 1OVMA 4EKYA 3KD2A 1TU4A 1FP2A 4J0HA 3PFGA 1U8UA 1L5LA 4M49A 4LUCA 3Q9UA 4EL5A 4WE3A 5B2EA 2ZSJA 2D1YA 4G6ZA 3V4FA 1CLUA 4EJSA 1DEOA 5BORA 3B5EA 3RHTA 4H7EA 5F7ZA 4NU5A 2V59A 4JJ8A 2GYWA 4V39A 2J7KA 3T7SA 4HAXA 4R68A 1N3YA 2XMBA 1VCNA 3GLQA 4AECA 3EPHA 1UBUS 4GOXA 1EH5A 3AOGA 1SCUA 1GUYA 1WD7A 4OPMA 4UZSA 3JS5A 3OE7D 4INZA 3WKBA 3EUFA 2HYDA 3LHIA 3B13B 2ECKA 5ALFA 3KEMA 2BR4A 1O7JA 2H52A 4D57A 1XPOA 4NOJA 4NBNA 3IUSA 2CW5A 3G9XA 4GGMX 3KU4A 2Z5FA 3SEQA 2ES4A 2QN9A 4D9BA 3IT3A 4TMFA 5H81A 1U31A 2B8NA 5D5HA 4ZEXA 4I66A 5SICE 5AHXA 3HCPA 3LCJA 1ZZEA 2XB9A 1CUHA 3DL2A 3LE8A 3O91A 3TTSA 4CT4B 1XAHA 2OUKA 4WI1A 3HMQA 4ZEWA 4XVQA 1WP9A 1MIOA 4TXNA 4X9XA 5BUSA 3AHGA 5LCXA 5FOXA 3TVYA 3GGPA 4HMPA 4EW2A 1SHKA 6ABPA 5KYXA 3KSMA 1UFOA 4YONB 1IZ7A 4NI5A 2WT4A 4FFMA 5FDFA 1ZP6A 4EITA 1R6VA 1QO7A 4MOWA 5K0FA 2IHKA 1WB9A 2R68A 5ALJA 3ND9A 2FRDC 4LY0A 1SELA 3MUFA 4QU5A 4YNBA 3LOUA 4TTAA 4NYJQ 4DDKA 1YGPA 5FBQB 1O77A 2CXTA 4C1NA 2H1FA 4FLMA 1V1RB 5L3ZA 1Q7TA 4DC1A 3IGFA 3BXPA 1C30B 4D4MA 4KPYA 4G5XA 2YZMA 4ZCSA 5EWLB 3G17A 1NASA 1XQYA 4JDPA 3IYLW 2Q1TA 2R00A 5JVDB 5LZ8A 1WTCA 3QKRA 1O9BA 4UUMA 4FBLA 3UFBA 1A8PA 4B8YA 5BSGA 2P6RA 4CHGA 2CJWA 3HJNA 4FXPA 1PWXA 3EGDA 3I2JA 4LYFA 2I54A 4OXIA 1I4DD 5EESA 5JARA 1TJ3A 4LXGA 3CH7A 1WULS 4TYNA 3ZWKA 1SVMA 4HNUA 4YV2A 1YE5A 3RJTA 2G76A 1NBMA 2OCGA 1LPBB 2GA9A 4MQEA 1W88A 1Y5IA 2XB2A 2RD2A 4HFNA 4DEXA 2HUNA 3WGKA 1CWUA 3KJZA 2DETA 1XLTC 5AIAA 4NBLA 1R4NB 3D5EA 3A1VA 3SU8A 3FZNA 1GTZA 4MCHA 3ICOA 5IC4A 1XVLA 3DT6A 1CQWA 1I4EB 3DWEX 4L9SA 5CJ2A 1UJMA 3RYHA 3T12A 4M0PA 2BUCA 1XP5A 2AR9A 2IYUA 4GXNA 3L49A 4HWTA 4DNXA 5D00A 2JARA 4EX6A 2WJWA 3OZCA 4LAFA 3RC7A 5KVAA 4H6PA 4LYDA 3NC0C 3THSA 4LOJA 3U4QB 5KQRA 1Y3IA 2DLDA 3CR7A 1XTKA 1JNYA 2Q3LA 3K71B 5LD2C 2OFWA 3PFHA 3GD7A 3MJEA 1OMOA 3WICA 3OKAA 3CURA 4L8YA 1F3OA 2NYRA 2AXEA 2ZYGA 1E9RA 2P4HX 3T7RA 3GFVA 5KSYA 2VTBB 1RHKA 1SBHA 2VHVA 3C0KA 3GRAA 5BSVA 1SBNE 3RC8A 4AN1A 1O5IA 3CRMA 4YJFB 3GEDA 1LVUA 4X8HA 3WFIA 2ZZNA 3MCTA 4KUGA 1E1QD 1Z8FA 3B89A 3EZ9A 2C3OA 1HYGA 3JWGA 4RACA 1G19A 2W5UA 1SCBA 3ZYCA 1NSTA 1WPQA 2GMWA 5LOVB 1K5PA 4AJLA 3EK2A 2VQDA 3PDJA 1ZEMA 4ER3A 2VCHA 1RXYA 3PWSA 4Y1GA 1M7HA 5B58C 5FPHA 3JQEA 3ORQA 3PSHA 4TQ9A 1NMYA 1PU2A 5P8WA 1FRNA 4D3DA 2CL6X 1GZ7A 4U6SA 1I2DA 4TYQA 3CISA 1SVOA 1M1YB 1G6Q1 4WSOA 4RJKA 3TQFA 4F93B 3Q3GE 4LNHA 2Z2KA 1KY3A 5IYZA 1WJGA 1E3JA 3GUCA 3O8BA 4DKJA 4L7VA 1N6LA 4QGSA 3LO5A 3GN2A 1Z18A 2AE1A 2KBFA 2X0FA 4MUXA 2GVDC 1A5TA 1XEWY 2V96A 1PJSA 3B9QA 4RMGA 2C84A 2HHHB 5EUMA 1I1OA 5B2FA 2GZRA 1Z2CA 4Z2YA 4WKPA 5BYKA 2CMKA 3C5VA 2GVZC 3K8OE 4G09A 5DXAA 2R1TB 4HQ0A 3RS4A 4CF5A 5CIYA 2RHMA 5C1IA 5IRCD 2GD2A 5C35A 1GLGA 1ETUA 1W1WA 5EIAA 2BGGA 3W4IA 2FN7A 3JAKA 2EJTA 5IBCA 3G5MA 2ORED 2JGDB 4TYMA 3UV7A 2C9OA 5IP5A 5KC9A 2I03A 2N42A 1L4EA 4XGNA 1CERA 1Y8QB 3AQ4A 3FSEA 3O2JA 4FZRA 4RAOA 4DRZA 3WO0A 2AG1A 3WKCA 3ESXA 4L5CA 1DAEA 1EEHA 3KT6A 3V33A 1UBHS 2IYQA 2NP7A 1U3CA 1EDZA 1VLVA 4AWAA 4R98A 4ANFA 3ABRB 1KZ1A 1T4DA 4Q19A 4XOIA 1OJLA 1Y9AA 2E6KA 5LWHA 2XNSA 4L5IA 4OOFA 4Q0MA 2P2YA 4KOAA 4RJJA 2PAAA 2YCLA 2BGMA 1YB1A 1QPZA 4D25A 1W1IA 4MKXA 1GG8A 2FPPB 1Y4AE 3ZLUA 2OFFA 1N2JA 2IYEA 1V5IA 3KZKA 1XTJA 1NX6A 1XEWX 3MINA 5FBWB 4JD5A 3EWIA 4M9SA 1UPUA 4RWZA 4QX6A 1WHTB 1EZ1A 4OMFG 1I2MA 3B82A 2ZSDA 3PRKE 2QSUA 4WZ6A 2G5GX 1YJ5A 1YZYA 5AVWA 1Y9DA 2HM7A 2FPLA 1M2FA 5JXJA 4IVRA 2IXDA 3MGCA 1ZU4A 4UMVA 2JHAA 4ZYZA 5BVHB 5KYTA 3RIGA 3AOEC 4N47A 4TV8B 3VZBA 1B7GO 1L7XA 1OWMA 3ROTA 5DX8A 3TBKA 2YWBA 1RM3A 1ZK4A 5DTIA 3BSFA 3ASVA 5KX5A 4MWSA 3HO8A 1DOAA 1L4GA 5E4JA 4ZVVA 1E96A 3VO8A 4LDNA 1U4NA 2WP8J 5JJBA 4M0MA 3TLGB 3OZ7A 1C0KA 1Y89A 1BW9A 1GTG1 1KI9A 2CXNA 1M6HA 3ISVA 3WS7A 4EEZA 4NAVA 1E1LA 4IDCA 1NC1A 1G63A 1Q1EA 4IILA 2ZTVA 4HNAB 4JR2A 4P84A 4X66B 4D3SA 1ZAYA 3WRWA 1ZOSA 5B6PA 2EKQA 2BM1A 2Q9UA 3FMGA 3D02A 1ZBDA 3UB3A 4ALNA 2IIQA 3TLXA 3TKLA 1AK1A 1DIHA 3GD5A 4N4AA 3IHKA 4X94A 1XVTA 5HS4A 4XTRA 4BLPA 5THQA 5BO5A 4KPGA 1WCWA 5SV2A 4WFQA 3IHTA 2I2WA 3REOA 2WSBA 3NWEA 3HL4A 4YFVA 3CUTA 3B9BA 4MUNA 2EW2A 4P93A 1WDLA 5LFAA 1TVCA 3JTEA 1JHPA 2IZOA 1VJTA 3C14C 5EPEA 2BMWA 3UM9A 3V5NA 3VGPA 3WGZA 5ED4A 3HVHA 2HJGA 3RVKA 3EXIB 4IZOA 3CPJB 3AZOA 5KC8A 4H7KA 3ZHXA 4G0VA 1RYFA 3EPRA 2IW3A 4YUVA 4CM4B 4QNMA 2AFRA 1V26A 2GBLC 1BGWA 1XZFA 4MRAA 1OE0A 1C3LA 3UN1A 4WX2B 1AKMA 4K9QA 4H77A 3URMA 4NARA 3GLHE 3V7NA 2B1RA 4EY6A 3K2EA 1E2DA 2X2OA 5CFMA 1S2GA 2PV7A 4GYKA 3H2JA 2FPGA 3OOYA 1VKOA 4ZAWA 1O94C 1PGJA 2ZSBA 5F3RA 2B92A 5IWCA 4C03A 2VJKA 2WT9A 3D6NB 2CZCA 5U4XA 3KX2A 3DHWC 5C2JB 1SHJA 3O8QA 3CTMA 4XQGA 2NOAA 3CMMA 3S1LA 4V1CB 3ND8A 3AUSA 3ER6A 4XDGA 5DM60 3PZRA 3VR2D 4DPKA 2YYSA 1Q19A 2W22A 3OO0A 3PL5A 1TCAA 3LC7O 4DCCA 4JSRA 1E2BA 1EFAA 2YX1A 1G2OA 2Q3DA 3AXSA 3S2SA 1GTMA 4PO3X 4RAQA 4AS3A 2XJ4A 1VJ0A 5ERYA 3A2MA 2W0MA 3ESDA 4TKMA 5AI9A 1E6UA 4G5HA 1JHAA 5DSZA 1VHLA 3B8HA 2YDYA 3R0VA 5J5CA 4DMLA 1IK6A 1NVAA 4E3WA 3KALA 3ZY3A 1PO7A 3X0DA 5D2CA 3IT0A 3SBXA 4PO8A 1ZR2A 2JLCA 4MQMA 5COAA 5L4NA 3AY0A 3NMUF 1TK2A 1VSVA 2L17A 1ZJWA 4GNRA 1EUZA 3RBAA 1I3KA 1PBTA 4E5MA 3IELA 2B5VA 2GBGA 2QAGC 2XWQA 4EHFA 4FC7A 2EKZA 2HJSA 2M9MA 3D4PA 1H4TA 4E51A 1E64A 4O2AA 1RXUA 5KAMA 1PFYA 1NI4A 1WXDA 2QRLA 2ZP1A 2KB0A 1G17A 3F7NA 5GJWC 1MTZA 1NQWA 4BBPA 2CYAA 3IAXA 1EGHA 2YXLA 4OF4A 4EQ6A 2VT3A 2F67A 1PV2A 1FYFA 3RHSA 2OQIA 2V3CC 1G0OA 4DCNA 5GQSA 1XEFA 1Q3KA 4DQ0A 1XMVA 1YZLA 1J2EA 1T2FA 4ND4A 3KKPA 3QMVA 4MKHA 3TZCA 1V8BA 5CUQA 5JUWA 3EA0A 1VRVA 2I1LA 4QEZA 3GLIA 4YJHB 4QBGB 2HWXA 4BQRA 1M34E 4M86A 1U5AA 4TV9A 4X1KB 4UEKA 3CCBA 5DYIA 3ZUPA 1UK9A 4J7XA 5ISMA 1E1NA 4BU0A 2JLRA 2WIGA 3ZQ4A 4AF7A 1Z2OX 2IUSA 1RYNA 3NOQA 2C82A 3T1QA 4TKLA 5DKFA 4IQ4A 1K6IA 4ZD6A 4US2R 1NY5A 2V97A 4HDKA 3EGVA 1W6UA 3IP1A 3JD2A 1DWPA 1QB8A 2YV1A 5GONF 4CKBA 4D8VA 1EVJA 4H4DA 3W5SA 1YRWA 1JYFA 3OH8A 3H2BA 3DEIA 3VDNB 1G59A 1UBLS 2WWYA 2GZAA 4D9KA 2AN5A 1GXSA 3WGMA 4B0OA 5A3QA 4URXR 3R77A 4HJXA 3NNDA 3QENA 2MCFA 1AT1A 1BVHA 2P75A 4KV9A 3M6FA 4BN4A 2PJDA 2QGFA 3NTVA 5I9TA 2CHUA 1IAQA 1O3YA 4JITA 2DQSA 1E6EA 3V97A 2PVCA 5JSYA 1P7VA 4JJ7A 2A9VA 2SNIE 4Y2SA 5ALDA 4HLUA 1KERA 3FE2A 4WV3A 1XHLA 3K30A 3KUXA 3IR6A 4UUNA 4ZYTA 1N0IA 4ZGBA 1CCWA 2Y99A 4IZHA 2FZGA 2FHSA 4JN6B 2I55A 4JNKA 4KXUA 1VDZA 1Z62A 1ZD5A 2BUAA 1U28C 1JDSA 2ZR7A 5TC4A 5AW0A 4JQOA 5LM3A 1CUIA 2B1GA 1DBIA 4RK5A 4II3A 3L6BA 4YRAA 2FDCA 3AW9A 3G8YA 3OPYB 1X7YA 4EP1A 2QZ9A 4MMXB 3VR4H 1PJCA 2CJFA 1RFLA 3MW8A 1NOKA 1VHTA 2WYWA 2PH5A 1ABBA 2QN2A 3C2QA 4BTEA 1RMTA 5GPBA 4GM1A 5A5GA 4QKQA 3AHFA 2GR9A 4LCJA 4WWHA 5FTMA 2YMQA 2IP1A 1G2IA 4UHKA 5K3FA 1RS0A 3U2QA 3FNQA 4HX9A 3KHKA 1P80A 3UGKA 5KTRA 3T35A 5LMZA 2JNWA 3B9PA 5EJ7A 2JH3A 4GDMA 1R4MA 1X7HA 1G8JA 4BBZA 2AMLA 3FJYA 1P2DA 2V03A 3CO0S 3CLUD 3O2SB 2QRVB 4JVMA 3WJ2A 3PGVA 1Z5ZA 3VPGA 3TE6A 1GDDA 3TOCA 5BMOA 4JB8A 3DDHA 4TMYA 4RSHA 3ZW7A 1WHSA 4HPWA 4JVLA 1ORDA 4OHUA 3IKVA 1OR8A 5IEJA 3NO4A 5HEKA 5JMTA 1ZGJA 2DH6A 1XIVA 3HB5X 1ECJA 1KOJA 3LMKA 3I1IA 2HXSA 4RM2A 4YLEA 3P52A 2M6RA 4JXZA 3NM6B 3BCUA 3H2HA 4QUEA 3KSRA 2OZVA 5BXYA 2AWNA 3EEOA 4ZARA 2VHEA 1YQUA 1XRMA 5J2TF 1R64A 4FFRA 5AVKA 1HURA 4KMRA 3AIKA 5IZCC 5CD9A 5J4HA 4IFTA 2FF5A 2VSOA 4ZCQA 2ODPA 2B35A 4JLPA 1EVLA 4JJZA 1O0SA 2OD9A 4JHXA 1UKBA 1WA5A 3V1TC 2O7VA 3E7PA 5CDUA 3M0EA 1C1DB 4XLTA 3IEKA 1PRYA 2ATIA 4EZIA 4YRZA 3PEFA 3CKYA 2A1IA 1N5OX 1T26A 4M60A 3AF2A 1UOPA 2QTBA 1EGMB 3G6WA 3GGJA 1N6KA 1Y1SA 1NMSA 1JXAA 2P6MA 2D2FA 3B51X 3JASB 4A0GA 3HJCA 4LFBB 5L3RA 5FUYA 3L0CA 2AD5A 3FHCB 4RHFA 3A32A 2EC5A 3D4OA 1VLQA 1X70A 4BX8A 3HBLA 1PT8A 3OCYA 3OOEA 4WW0A 1HH4A 2AHRA 3PNBA 1I2CA 4P31A 3VZRA 3LVRE 5INTA 3B52X 3TEJA 5HFAA 5A1TA 4FD3A 4L5AA 4JUBA 5FWAA 3VU3A 4ASUD 3LKZA 2R00C 1M6YA 4QAQA 1BJRE 3T3GA 4F92B 1CUFA 1JDPA 1UZUA 3BD6A 3D5QA 1LQ2A 1C5KA 1TOAA 1RLUA 2NQ8A 4Q93A 3TQCA 1CUXA 3H05A 4BO1A 2JJ1A 1N8SA 1DI0A 2AN4A 3IMKA 3NBQA 4ENTA 3KKMA 4F3KA 3CZPA 5DMXA 4U8HA 4KR7A 2QRKA 3Q3CA 4ICIA 3RRYA 1TZBA 4K8RB 3FCYA 1Z28A 4Q3LA 1YU6A 5BYBA 5B7QA 2EKBA 4X7MA 2Q2OA 4PLCA 5DGIA 2JHPA 1Q0TA 2WIBA 1NRWA 3HJGA 3UAZA 3WYEA 3ZGLA 2JFXA 3S28A 4ZAVA 4GMKA 4BGUA 1MG5A 1EYZA 1U9JA 3H9CA 4TSRA 3X1KA 4FR0A 3K0FA 5CXSA 4LZAA 3M7IA 2EIHA 1V9CA 4R2MA 4YCSA 4K2AA 2W6JD 1T43A 3U1TA 1JILA 3Q10A 2GF0A 5FEMA 3DMNA 3P20A 1IM8A 2ZREA 3OWXA 1SXJC 3GVHA 3GW8A 3EGWA 5T57A 4C20A 5IKPA 4KAAA 2Y2UA 4L0DA 5HMLA 3ZWXA 3SI7A 1DRJA 5WRFA 4FIZA 4YX9A 4C7OB 1DLJA 3IIKA 5IBPA 1M2VA 1FFEA 2COUA 3CX6A 4EBBA 1GAJA 4HQ6A 2L42A 4WCFA 3S8YA 4ARCA 1ZGCA 3PE6A 5ICEA 1UWLA 2ZAMA 1VI5A 1WD5A 3EDYA 1N2CA 3RFUA 3SEZA 3WNVA 1AQIA 3QMMA 3R0JA 4YI3A 2P0EA 2EHJA 4UTPA 1J42A 2ZR8A 4MXDA 1USGA 1Z35A 2VSQA 3N70A 3IE2A 3JYLA 4D82A 4TLCA 4XM1A 1NYRA 2IVFA 2OC9A 4U2GA 1LC3A 1EHYA 2RFLA 2XTAA 3UYKA 4F21A 2IODA 5KYWA 2AUTA 5FPKA 4PZUA 1H1LA 2JAPA 6CHYA 1ZR4A 5BNZA 1DXOA 1E4OA 2O59A 2XE6A 4IQ8A 3RC9A 2X2PA 2D6FA 4QULA 1T6XA 1U0EA 4NE9A 5JZSA 2ZE8A 3J7AC 2AVDA 1FW8A 1JR3A 1WXFA 2R6R1 1ATZA 1S6YA 4F38A 2RK4A 3VTFA 4YV0A 2O2YA 3OSZA 5M29A 1YR9A 3SLRA 2P3QA 2F8MA 3EH2A 4L57A 2J7PA 4K6OA 4AKTA 4FGSA 1BCRA 3ZCUA 1VJDA 4JL8A 4AROA 1OLSB 3C8MA 4RKYA 1BEUB 1FJGB 3I9JA 2GI4A 3AHCA 3ENKA 4MDYA 3DCIA 4M87A 3W9YA 4EMBA 5HXAA 4E6EA 3K7EA 3GRKA 2J3QA 5H5JA 3TE7A 3MT9A 4URWR 2QT1A 1QHGA 2AG6A 4W1RA 3PRYA 1JQAA 3TIFA 2IKSA 3WNDA 1NQAO 3K6SA 3DBRB 3HUUA 4GBMA 3IDSA 2KYRA 1ODCA 2R44A 3MJHA 1RM5A 5BOVA 4BQNA 1ZINA 4N65A 2Q49A 4YWHA 2RK3A 3WJAA 2C95A 2VDWB 1HC7A 3QXCA 4L5YA 3ORSA 4R8VA 5DHRA 2B82A 2QTFA 4N39A 3SNHA 4Z9YA 1JEOA 1GLVA 4AMBA 4BFVA 5K8LA 1G21B 1KH2A 4JKIA 5EE5B 3TOSA 5LQJA 5HTOA 3LK6A 4PPYA 2XF2A 5FAKA 4QYSA 4TVKA 3PUJA 1HNXB 3FOZA 1M1YE 1ZSYA 3T5CA 5FNVA 3AVYA 5FP0A 1KDRA 5KJ6A 5EMNA 1OAOC 3AM4A 4UBIA 4K9LA 3AB8A 2Z2ZA 4MUEA 3HO6A 2BM8A 1RKVA 2H3HA 2W43A 3HFJA 3Q85A 4GZLA 4JODA 4KYIB 2FW1A 5HK9A 3NFRA 3DDOA 2BELA 4ZKDA 5KOIA 3ZZ0A 5FX2A 3S2FA 2I6FA 2WU0A 2FMXA 3FGNA 1SULA 3P2OA 2AX4A 2OSVA 5FF9A 3DLAA 4KQCA 1HBJA 1JHYA 3QU7A 1OFVA 4TYWA 4YHHB 5BV8A 2BGJA 3UJPA 3JQFA 2XIQA 3CLHA 2HCTA 4DA0A 5EXDA 1U02A 3L4EA 1NSFA 2O0MA 3LDUA 3RTBA 2HK9A 3W79A 3RFFA 1IN1A 1RI4A 3L06A 1ZJ4A 1QE0A 4N5MA 2Q27A 3HJRA 3WMRA 5HKBA 2HK7A 1NVUQ 2AXPA 4R8RA 1DXQA 1AGNA 3FVQA 3A0UA 4C7KA 1QANA 2B7BA 5HSGA 4GBGA 1SHLA 2KQUA 4C2TA 1BKDR 2C2KA 3S29A 3ABZA 3SZUA 3ZWPA 3DMRA 4KMMA 3TQOA 4D6XA 5FLXA 4CQLB 3K70D 3E9ZA 1BFUA 1JKJB 2I4TA 2GLUA 3OM9A 4RHTA 4RZUA 3VMMA 4LJ8A 4CL0A 3FX2A 5NULA 4HGRA 3IV6A 3LQQA 4A5SA 3G2MA 4EJFA 4URFA 3EA4A 4NCKA 3G2IA 3P4UA 1KSHA 4NNOA 5DFAA 4UASA 3RVOA 1KQOA 2O1WA 4RH0A 1UK8A 4LSZA 2TMGA 3R7WA 5KQPA 4P5PA 3CT6A 1ESMA 4JLSA 1OI7A 4KAJA 4EA6A 1OXMA 1WQ3A 3DNFA 1GNSA 4EYQA 1FLVA 5M7EA 2QD3A 2ICAA 4JUDX 3BEOA 3ON5A 4LZZA 4RNCA 5BQ5A 2Q4EA 3KOYA 5AMXA 1YMQA 3SZOA 1G18A 3MT7A 2EGGA 1N6PA 1X77A 4IFBA 2ZXEA 4TRJA 2IV7A 2B2XA 2Z2JA 3H86A 3JCZA 3K0BA 3PNPA 2QA5A 4XUEA 1G20B 2BL4A 1OFGA 4NMLA 4A8PA 1PCXA 2NX2A 5EHQA 5CIQA 4LE2A 2IWHA 1A9XA 2BEWA 2ZG6A 3DP9A 3MPOA 2Q46A 3CEPB 4H1HA 2QYOA 4Z3KA 4AZ0A 1EFLA 2D2IA 2R60A 5JVDF 1EB9A 4D02A 5AR1A 3VKWA 5BW5A 1Y4SA 4ITUA 2YXDA 3PEUA 1I30A 1TM4E 1ACLA 1XA3A 4DBVO 3PF8A 3HHPA 3JQPA 3G49A 1AS3A 1G3IA 4EI7A 2JD1A 3C6MA 1W49A 3PUWA 4X3PA 2VF7A 1AQNA 2GEFA 2EBUA 1GZSA 4KODA 4OIFA 4Y2HA 2HF8A 1OASA 4HGNA 3BXFA 3X2FA 3QKTA 4H35A 3T7IA 5CB8A 1JEAA 1NBWB 1DBPA 4H60A 1Q0LA 2AV6A 3I6ZA 1Q16A 4FEYA 2Y6UA 5FQNA 5KOYA 2CEKA 2CLOB 5AKEA 2WTMA 1RWBA 3WGIA 1VCHA 2C2MA 2WHQA 3JYQA 4BIIA 1G55A 1GGVA 1O97D 2XNHA 3C1TA 4MV0A 1XZDA 1GVHA 1Z9BA 1TW3A 4PYOA 2BMDA 3SS8A 5JZBA 3JD0A 3D7NA 3AF5A 4CIBA 2A3NA 4GYWA 1DAMA 1Y4UA 3VC7A 3WQHA 4TTJA 2I2XB 3G89A 3VISA 3K0CC 3BWBA 2ZJZA 4AUMA 4C5CA 4WDRA 3T4PA 4DR4B 1JAZA 4A23A 5DMHA 2BMVA 1R66A 2OZPA 2HBRA 3FFTA 3QJYA 4LHVA 3I2KA 4W8OA 2J9RA 3T3IA 3KC2A 4Q4HA 4BEJA 4BCDA 1EK1A 4D9JA 2MIIA 1BG6A 1A5BB 3E48A 4QTTB 4ZQHA 2ARKA 2BBSA 3D6FA 4X8LA 5FI0B 3EXG1 3VNUA 2J5XA 2FCRA 3BGSA 1FDWA 3F5MA 4A03A 1THGA 1EFKA 1T0BA 1N4AA 3O94A 3IOBA 2HNKA 4YP6A 4ZI5A 4JXXA 4YLYA 1B0AA 1DDOA 2I2AA 3C7DB 1DKUA 3MYRA 2EF0A 4B6FA 1B74A 2QX6A 4QFCA 5LOVF 3E6AA 3WGUA 4ID9A 1ZCZA 2GN8A 5KIAA 4K26A 3MGKA 2WKPA 3K5IA 4RSMA 4D0RA 1UMCB 1OOEA 4IW3B 2GM9A 3T0GA 4WBNA 4Y98A 3IEXA 1XTQA 2QZPA 3TDMA 1WAMA 2GESA 4OKSA 1HA3A 1ZXXA 1YVDA 3D6MA 3GROA 2PT9A 2NUPA 1VJCA 3ND5A 3PNQA 3SF8A 1VGQA 4C05A 1MO2A 5E9WA 3IPXA 4W7IA 3OJOA 1WUIS 1FOEB 1YGYA 4N01A 1M1ZA 1YVEI 5JZVA 1P6XA 4R2JA 3D7MA 1RJDA 2XTZA 4IH9A 4PQFA 1MA3A 5EP1A 1C9KA 3ONNA 2AOTA 3GNQA 3KDAA 4F60A 5DTMA 5JMWA 3ADBA 2IBSA 1VE6A 4BGEA 1ZN9A 3LTEA 1SD1A 1KJYA 2PGLA 4YHBA 2C9BA 2ZXUA 1NBAA 1T2EA 1T6BY 3A4NA 4U6QA 2JBAB 4TZ6A 3GARA 5REQB 2QE7D 3ZU3A 4WY8A 1JHUA 3G1WA 5A1JA 1E79A 3DE5X 3OG9A 1QJ4A 3QTLA 2VA8A 4A0SA 2PJRA 3FYHA 1HNNA 1LJUA 1TC2A 1TRHA 4G41A 4LHXA 5F2OA 2W2TA 2OGSA 3O21A 4GPZA 2CVZA 4D45A 4HD8A 1FYDA 1TI7A 4DT1A 5J3JA 3K4PA 1DO8A 4MW6A 1Q7RA 4BWYA 1A8SA 5KWIA 4OLBA 1GPJA 2WQ6A 3NOOA 2OBYA 1JE0A 4YJDA 2OVFA 4G81A 1PZNA 1JFTA 2XRFA 3KOOA 1JIXA 3WBJA 3TLEA 1C9EA 1UINA 4WDQA 2YFQA 4JEMA 4PYNA 4G1CA 2R6AA 3EARA 4XKJA 2DE0X 1G4AE 3RU9A 3S1AA 4EUEA 3UJAA 5K7SA 1E99A 1FXWF 2VOEA 4RF5A 2CXXA 4L1KA 4R9RA 1SOUA 3KQYA 2EZTA 4Z2AA 3HSKA 4HL6A 2JATA 5JS8A 1QX4A 1XD8A 2Q21A 1X94A 3QEJA 1XT6A 3DA8A 1LBEA 4TUYB 2VXBA 1AD2A 2IK8A 2OC4A 1Z5OA 2X4GA 3AVPA 3ECCA 1ZNYA 4TN5A 3SFVA 3WK7A 5H16A 4BTVA 3UQYS 1YMVA 3NYQA 4KEAA 3FBGA 1YRQA 1CP3A 1E2EA 2GPYA 4TV8F 5JCJD 2GXQA 1N32B 2NO1A 1QIGA 1YS2X 1RPJA 2UVPB 3KR1A 5B64A 2QRMA 2A5GA 1Z5GA 1KMCA 2YBDA 3H42B 2I2BA 1JMVA 1PJTA 2JFBA 2WG2A 4DQKA 3K70B 4AUKA 4AF6A 2VZ8A 4LOLA 4B43A 2RAFA 3T1YB 1NP6A 3BRSA 4IEIA 1XZNA 2KLHA 4L8VA 1IIBA 2Y9MB 3I9V6 2LWIA 4YMGA 4EB0A 4AG6A 3T3OA 1R6TA 3GZ4A 4FOPA 3AEKA 3FVVA 3ZJ4A 3PG5A 1KK1A 5KWJA 2QL5A 3HDVA 3HH8A 5AVYA 3HNOA 5JNRA 2JIOA 5IMSA 4Q02A 2IEDA 4WA8A 4YRMA 4R81A 4XIJA 1JGTA 1V37A 1ZRNA 4NAUA 1XEXA 3A6DA 5M3BA 1S3GA 2ABWA 4LJYA 4YB8A 3N2KB 1T0IA 4WKNA 1PF7E 1W48A 2SHKA 1FW6A 3U4GA 3NB0A 3VJRA 2QTTA 1ONSA 4Q66C 4R3UC 5DT2A 2OHGA 1D6MA 1DAOA 1K6XA 2ZT7A 3ULKA 5KMGA 2QY9A 4QGAA 2NVUA 1U1GA 4Z0PA 4YUYA 3PJFA 2AF4C 3GY0A 3AYZB 4L6IA 1JR2A 2PFSA 1K6MA 2XSZA 5CW1A 4D96A 3T1TA 1BDJA 2ONCA 2C7VA 2O1XA 5BSTA 2ZRNA 3K2BA 4EHDA 2VQ6A 4CIYA 3PS9A 3PIRA 2X3UA 4FIDA 1VL2A 3PNOA 5DGCA 2FP4A 3BDVA 3ETLA 3ZQKA 1A1SA 4YR7A 3ZBQA 2QORA 2WPDD 4KZPA 4BO0A 4B6PA 1C1HA 1G98A 3AEUA 1X7WA 5AICA 2LPMA 1ZITA 1L5KA 5IHPA 3KDSE 5LNK1 1USIA 4NDAA 4L85A 5JFTA 4KO1S 1EQUA 2Q07A 5K4GA 3SMVA 2ODQA 1Y4DE 2PXXA 1YVPA 2JS7A 1DKOA 3D8NA 2HXYA 4KQ2A 1NI5A 2R96A 2I6TA 5FTLA 3RSQA 3EIHA 4AG5A 3IDAA 5L53A 4XQ9A 4PYQA 16PKA 3E8MA 2F2TA 1Z2EA 2DULA 3DFZA 1P7PA 3GOHA 1SR8A 1J7KA 1QIIA 3A10A 3AI3A 4WADA 1MG0A 1O58A 3G5UA 4D8UA 5L51A 1RRCA 3WIVA 1IHOA 2E1RA 5LZ9A 3RTCA 1ZSVA 3W2TA 4WXPA 3KYBA 4YRGA 4CLOB 1EUDA 1SGWA 2GEVA 1HDYA 3PHCA 1F2DA 4OXYA 1N0HA 2K2QB 2QLJA 2XE8A 1RP1A 3W5AA 3LRXA 4AZ3B 1QWSA 2XZDA 3RQSA 1HYHA 3G2LA 4IIGA 2JI7A 3LDGA 3T7KA 1U9CA 4HFRA 4WLFA 3UJ8A 1EX1A 3ASZA 1BTOA 2EX4A 2IYWA 3HHEA 1YR7A 1NBIA 2R25B 4UEOA 5EINA 4F56A 1N6NA 2QPTA 5E38A 4W5JA 2PWPA 4HT3B 1U0GA 2P91A 4S0XA 3I3OA 4NU8X 2ZE7A 2PS1A 2YFKA 1JVSA 1V1MA 4QHYA 2VLIA 4XARA 2WABA 5B4UA 2P77A 2PRIA 4FWBA 3NEAA 4ZC1A 2PH1A 4WUTA 1RLMA 3EZYA 3OT1B 1YIDA 5AKZA 4MQUA 3MELA 3QWHA 1AE1A 4BLQA 4W5WA 2ODWA 4S1NA 3THRA 4PSUA 3MJCA 2NUAB 1C14A 1I3NA 3OHSX 4LWZA 4P2GA 4H3HB 5BXQC 1XJCA 1JH9A 1DRKA 1FSSA 4QGFA 2O7SA 3R0IA 3UTCA 1QRDA 3JQ9A 5B2ZA 3VPBA 4EZEA 4TVSA 1AMOA 1N6HA 1H3FA 2IYSA 4LFAB 3TD2A 3EDMA 2R86A 3E23A 2XUDA 1WRBA 1ODLA 2BFMA 4LJ7A 5ETJA 4AM8A 1D4ZA 1G5TA 3CR8A 2C77A 1IC6A 1OTHA 4XAQA 4DXHA 4F4CA 4KXNA 1P2GA 2RBKA 1ZJZA 3H18A 4IOMA 5F21A 1K75A 1V95A 3WAKA 3SG0A 1EG7A 5EHXA 3HDTA 1HXHA 3NBZC 4LI3X 3BTOA 4P4SA 2EJBA 4CCAA 2FK8A 2QMYA 2DU8A 1FSFA 4Q3AA 4AYWA 1LJLA 3NONA 4JBYA 1TJ5A 2Y1WA 2ANBA 2Y0EA 2VYQA 3D6HA 3DT8A 1RE1A 3OA0A 4R9VA 4EGFA 3AVXA 3ABSB 3GGOA 3SVZA 3ZNNA 5IWAB 5EJ5A 4DSZA 1FPQA 2XIJA 3G2JA 4YN3A 1D5WA 1NW5A 1X6VA 2N1BA 1WB5A 4QJIA 1O9HA 3MWDB 4TS3A 4FUQA 3HP1A 1W34A 2P9YA 5EJAA 1PQWA 5KEIA 4OFXA 4L6AA 4M2LA 3UF0A 2DT5A 3KT8A 1PDOA 1OX5A 3M6LA 1GQFA 1FNCA 2HQ1A 3KXKA 4MAMA 1SVUA 3W2GA 3NATA 2YMLA 4OHMA 3ZE9A 3MTBA 1GAEO 1VYHA 3O3NB 4JLUA 4QNNA 1SC1A 4RCYA 3GFRA 3GJZA 4IMIB 4CL8A 3A05A 4BECA 4QPJC 4YRQA 4A36A 2MSEB 4KRYA 4RXMA 1PGNA 1GDHA 2NQTA 3ZU5A 3NNNA 5G4KA 4RY8A 3V55A 3DEKA 2AJBA 3FNRA 4DV3B 1L4BA 2PKQP 2B3DA 1ZRSA 3ET5A 3LUDA 4KGVA 3ROPA 5TQ0A 3GMSA 1KI3A 4IY1A 1BIFA 3QSGA 5TB5A 2Q8PA 2WM3A 1Z4KA 4ZK6A 4O0MA 4JUAA 4YJ2B 5J58A 1HSZA 1KZ7B 4NFSA 3B9RA 2Y66A 4JNCA 5SYAA 2CSXA 1Z63A 4IKPA 3FNBA 1E2KA 2X0IA 4JU8A 4RK6A 3NVKI 1C7RA 1T35A 1FRQA 2PKRA 2HXGA 3CKMA 3I6BA 4MCAA 1SKYB 1JLHA 1N5DA 4IF4A 3K6JA 1MO6A 1GILA 2NSHA 4G25A 4MR9A 1TMOA 2GF2A 2JVIA 2RH4A 4QM7A 5I9BA 4OG2A 3LHKA 2H63A 5G41A 1XTIA 3FF1A 1CHNA 3JQ6A 2ECPA 4ZV9A 1P0IA 5IDVA 3UY4A 3VYRB 1SU8A 3BKWA 4L22A 4MGHA 4ND3A 3R74A 4Y6RA 4G07A 3F5FA 1H0HA 1C7EA 3KOXA 1JA0A 3OIFA 1DRWA 3IBGA 2CJYA 4F5WA 1OKKA 3H04A 1SIOA 3JQFC 4RNDB 3RH0A 1WE2A 1OYWA 2J3MA 4QFDA 4AWXA 3HB7A 4GI7A 1FBNA 1XE3A 5HOEA 2QGZA 1EFHA 4LGYA 4XJVA 3SR4A 1RWMA 1XKLA 3G2QA 2VQEB 5DIZA 3JATB 2X2EA 3H9UA 1G21E 5JS1A 2EP5A 2ZJ4A 1SQ0A 3BHIA 3DCNA 4EELA 1AS0A 2PA0A 3TLZA 3M89A 3UJ6A 3WO1A 1E3EA 4E30A 4RULA 5KKAA 1PK9A 3OCUA 1TNDA 4PW0A 3MTAA 4H31A 4YPFA 1I4LD 5CP8A 1NXOA 1JEJA 1QLJA 2AI1A 3O95A 4G4JA 1Z07A 3TH5A 1T1IA 1VL0A 3JZDA 2Q5JA 4IH4A 3VXKA 3NTOA 4ARIA 5DLEA 1IN7A 2HSJA 2ZROA 3ETEA 3KR9A 1U1CA 2NXNA 4DVJA 3ABIA 1S8AA 2WE7A 3QV2A 1NUSA 2PUTA 1EWYA 2A86A 1Z29A 4J4HA 5GONA 1J0XO 2C8LA 4CLRA 3GZTB 3PYXA 2AYZA 3ZE2B 4DYHA 2FUKA 3IIJA 1G4UR 2FAXA 3LBNA 3MN1A 1KY4A 2ZE6A 4M98A 4EGSA 3R9XB 2AFHB 2BGRA 4RTSA 1RBMA 1QZZA 3LHSA 1GGNA 5AH0A 1QH8A 1RIIA 2CNLA 2ZYWX 3T3MB 3BIFA 7REQB 2TMKA 3HWRA 2BGUA 2Q1YA 4KFSA 1O6ZA 4F5DA 3D81A 5C7YA 5IUJC 4WK4B 3N7UA 4WY2A 1N9KA 2POQX 4M8LA 1U2ZA 4UCFA 4AZWA 1JDUA 3GT0A 5F9HA 4WJZA 4UM9D 4HEA1 1VGRA 4BQFA 1BVRA 3OT4A 2QQFA 3BRWA 3LQ2A 2DX7A 4GKAA 4H3SA 4RMNA 3V3KA 4E5PA 5AVXA 4R7GA 2NT3A 1PR6A 3C3CA 1XXLA 2RCNA 5T7BA 3K0SA 1G2QA 2XCQA 1W5EA 3QPUA 1YNSA 1R8JA 4MQFA 4NAHA 5FL3A 1VYTA 3MBOA 2VC2B 3C3DA 3FTPA 3JV7A 2KS6A 3RV4A 3VJLA 2PGJA 3CGWA 3LXUX 1HT2E 2WYHA 1DKNA 3E61A 4P7GA 4QUGA 4UUAA 4JLNA 5TPZD 1JAHA 5IAAA 4PC7A 1DGQA 4DARA 3GJ8A 4BP3A 4DJJA 3U4CA 1USUA 4FI3F 5GOTA 4QODA 3B2NA 1P75A 2GYVA 3IMFA 1YRLA 5E7MA 1ZX1A 1N5IA 1NV9A 5KU1A 3IQFA 3DV9A 1IM2A 4M21A 4DANA 2R2AA 2YV3A 4CQMA 3PJRA 4QXOA 4QUBA 5D7BA 3W5VA 1OA0A 1PUXA 2FZVA 3IQDB 4MI1A 2I99A 4W9NC 4LBVA 1U0NA 2WYOA 3EISA 1UT5A 5IXYA 1QOPB 1JLLA 1XDWA 1G20E 3IDOA 1ULHA 1KAOA 3AF0A 1EP9A 1XWIA 4GMDA 2PL5A 3A9SA 1G9SA 1P0PA 5A06A 1SQSA 5JPIA 3WB1A 1TM5E 3D6UA 4BRUA 2GZMA 3T9AA 5B1SA 4KE7A 2V0GA 5IARA 1FU7A 4JX9A 3GLHA 1M1XB 2Z8XA 4FHDA 2GILA 3VYWA 4C4ZA 4AK9A 2D5CA 4IIBA 1JH8A 2R6FA 2NVOA 4XQCA 1DS6A 1M2JA 2ZSEA 2ID8A 4D46A 3Q3EA 4IHAA 2ADMA 2DWUA 1DFGA 2XKAA 1PNVA 5CBPB 5J2TA 4NBKA 2A0FA 3U3ZA 1ZD2P 4IFEA 2A9KA 4NX2A 2W37A 1SVNA 4EF5A 3DZIA 1K88A 2WTXA 3D7SA 2AGVA 4EHNA 4WFIA 3P9KA 1JIUA 2PG3A 1WU7A 3IMEA 1QCYA 4DHWA 1CS0A 1V4VA 4FEAA 6LDHA 1RABA 3FCCA 3TQTA 2QAJA 1U2QA 1CDDA 5JV5A 1SY7A 3TTWA 3ACDA 4X3OA 2XUHA 2TECE 3UAYA 1WL8A 3HC7A 4I5IA 4OQLA 4PHCA 4NXNB 4OFZA 1IFXA 4N7BA 4WNIA 3B38A 3C3WA 2RC5A 3O93A 4FZ3A 3BMCA 3SFTA 3FWPA 2O57A 1GRQA 4DBLE 5LMNB 3HWSA 2W6ID 2WWHA 1KSFX 2D06A 3Q40A 3TNJA 4M6WA 4E88A 4Y6QA 5CH3A 5LZ7A 2OHXA 2IYAA 3IAS1 3LHDA 4GKKB 3DOHA 4TWJA 4RFSA 3F96A 3GHYA 5BR4A 4K05A 1LRJA 3HACA 3QFRA 2D5IA 2JKYA 4KPEC 1T1JA 1E20A 2H7CA 2X9VA 5CA1B 2KBEA 2F3RA 2FPIA 1Z45A 1A27A 1HGXA 1XU7A 2BH9A 1CUYA 4FSXA 3S2IA 2AJ8A 4D3ZA 4R3NA 3IIEA 3O31A 3RS5A 3U7RA 2X6QA 1FNDA 2WHEA 5DCWA 1SBIA 1M54A 3UC9A 4RIEA 4QT4A 1GEGA 4HUJA 3ZIDA 3OQBA 2N9UA 4GRDA 2F55A 1UMBA 4A4DA 5DHPA 4DR5B 2NZWA 1TPYA 5AESA 1EFPA 5LQSA 1WCIB 4D9GA 2BEKA 5HJ7A 3DWIA 3SY8A 2IPLA 1M34A 1Y9EA 4E2FA 1QM5A 2A7XA 2GEJA 1HE8B 3KEQA 2GBFA 3BL8A 2QUIA 4IUBS 4A0QA 2VNJA 3T3NA 4EMUA 3SSOA 2J48A 4FOOA 4V0NA 3H99A 5AJVB 4B8WA 4X20B 2R6DA 5B3KA 2ZBPA 2JIRA 3FTFA 4QXAA 1U3UA 5K0NA 1GL7A 3T3HA 4BXOB 1Y3BE 1W59A 4NE7A 1U1IA 2ONJA 3C70A 1CB0A 4GLFA 1QZTA 2ISSD 1ICIA 2AN9A 2R7NA 4Y6PA 1IN8A 1Z08A 1RRGA 5K05A 5EVCA 2K6GA 4EJ0A 2GEDA 3EXFB 5GWXA 1P9WA 4L4RA 5C8YF 1TLTA 2EGUA 2RHCA 4HSEA 2HJ9A 3M9LA 4J1SA 4JVOA 4QOHA 1AGYA 1TUBA 3GIDA 3EJWA 5B12A 5L45A 4PG7A 4HUTA 3U9SA 4NYMQ 1EXWA 1JJFA 1YSCA 4RPKA 4FQ7A 1IH8A 1DXHA 4L4UA 3NEPX 2RGCA 1PT9A 1ZGHA 3AR6A 5ERXA 4BNLA 1WUTA 4I6JA 4HZGA 2LUOA 2WT8A 5JEDA 2ST1A 4B3DA 1V8DA 3RG8A 2PPLA 2XGMA 3N0RA 4C2BA 3A9UA 1V7PC 1EXNA 2FWRA 1EESA 1AXRA 4MV3A 4G2NA 2FW0A 4IRXA 4HVTA 3RWBA 2H4HA 1CZUA 1HDOA 1RJFA 2NVWA 3BGIA 2J0QA 1EJBA 5G0UA 3LUCA 3TBHA 5I3CA 4CIAA 4REMA 5F1PA 4UAJA 3DOOA 4OHXA 3KKEA 3TSOA 4H17A 3WI7A 2RIPA 3H11A 1RXCA 4M1TA 2JJ2D 3CRW1 4C01A 4KE6A 4LJ9A 3TOZA 1L5FA 5HIMA 4FS3A 4XR4A 4JBWA 2IS4A 5DGHA 1ONOA 3CRZA 3TEFA 3D8HA 5H9WA 1DINA 1W4CA 2UKDA 1E61A 1J0CA 1ZN2A 4UM9B 4CCYA 4KXQA 4UPVA 3HXOA 2WM9B 4DSNA 4UUOA 2DWPA 2QUZA 2IDMA 4RXTA 1CRQA 2BFDA 2H54A 1VPDA 1DQSA 1QV6A 2ADFA 2D4HA 2PO7A 4PSCA 4LKRA 3LQRA 4MVJD 3DVAA 2CDRA 3TL2A 1GPDG 3I5UA 3DOUA 3JR3A 3DAHA 1Q1NA 2HJWA 4HAWA 4V2IA 4EW1A 1G291 1IRIA 1ZICA 3D4LA 3LQYA 3IV9A 4KV7A 1JG6A 3GEBA 3UHJA 4YPOA 3FDZB 1XNRB 2IEGA 4A6EA 3GJYA 4ENVA 3I9LA 1RR6A 4HSGA 4BBJA 4PN3A 1DCKA 2IZZA 3IUJA 3RRBA 3DVQX 1PVVA 2CK3A 1DJQA 5HFNA 4EVSA 3WIOA 1R3DA 3F90A 1EP3B 2ZSKA 2HCBA 2NGRA 1BXGB 3DPSA 3FMFA 4G5QA 2CXHA 4E3ZA 5IM4F 1DCTA 1G8YA 2AXQA 3E2PA 3EOZA 3EQ2A 4QDXA 4R31A 4UAUA 4JOQA 1XWWA 5E9JA 4CE6A 3HG7A 5EKXA 2C4MA 3FYCA 3WYFA 4JI0B 4E07A 4WOKA 4BNMA 1Y7PA 2HV9A 1YV9A 2ON6A 2QN8A 1JWAB 2ZI7A 1O95C 2AH5A 2WKQA 2J0EA 2XDAA 3AZQA 1IQUA 3EVFA 3KHUA 3Q11A 4J90A 5IAEA 4F4UA 1WBBA 2DUUA 1H1DA 2HMVA 1V71A 5BMVA 3GA5A 3ROZA 4EJMA 1T91A 4HAYA 1BZYA 1E9AA 1UJ2A 4DZTA 5CA0B 3EGOA 3OBBA 4X93A 4NY1A 2GKGA 5AM2A 1P0MA 4O4IB 5F7OA 1KO7A 2G80A 3PX3A 4BJ3A 1K7XB 3LU1A 5A7HA 1FU4A 4OA5A 2RHTA 3C45A 3HKDB 2VUTA 1PWEA 1YRAA 3BHMA 1Z37A 1B15A 4FCCA 4Z6KA 4BVAA 1XF9A 4ZYUA 4WN3A 1WY7A 5ALQA 3KQWA 2GOYA 2WE8A 4QT0A 4YP1A 2R4QA 1G8SA 5F4ZA 4C76A 1MDFA 3JW8A 3K0HA 1EFTA 3JR7A 2I3DA 5CLGA 4I9UA 1U4SA 1L4MA 1GJRA 2FK7A 4W5TA 3SHVA 4H6VA 1IXSB 2I3AA 4G1FA 4A92A 1CRZA 3L7KA 2EEPA 1KZHA 4I1RA 1DT5A 3QX8A 1CUJA 1ZJYA 4H7JA 4PSVA 1VP9A 3LCVB 1QWOA 2WWGA 4BZQA 2XVZA 2BV3A 1PEKE 1NL3A 4LBYA 3NDBB 4R1SA 1MQ8B 3GQVA 2G36A 1BO6A 2HRQA 1PG5A 1PJZA 2X15A 2OV2A 3T5DA 2PAFA 1TT7A 2R7LA 3D0RA 3HXQA 2FPWA 1FUUA 4OQMA 3ZXUB 3RFVA 1R0RE 4DE5A 3EMVA 1J8DA 2J6HA 1UEXC 4FGLA 4G0OA 4IDFA 2C54A 4QSHA 1QTNA 3BJEA 5TS2A 1JUDA 1RXWA 1W73A 4AKHA 4IQ0A 4C88A 3FI0A 3QMPA 2B7CA 3RJMA 4K9KA 1EIZA 1C30A 1NKVA 3FWKA 3MRSA 5GVRA 2OYCA 2WTBA 4Q6BA 1OU0A 5EWLA 3TXXA 3OFJA 3OCXA 1YACA 5JVDA 2IBMA 3BOSA 1X87A 1P19A 1EE9A 2QF7A 3RB8A 4OO3A 1F4LA 2GA8A 4I4LA 3OTGA 3UKDA 3V7WA 1U4OA 3H83A 1B8UA 4DRXB 5MDHA 1UAGA 4CGZA 2HKIA 4NNPA 1N1GA 3MWJA 4C06A 1A9SA 4FDTA 1S2OA 3UMMA 3KB6A 4YO7A 2IUUA 4MS1B 2IE8A 2R8YA 1I6LA 4UARA 3AKDA 5EJ6A 5JO0A 1JI0A 1REQB 2EXXA 1KTIA 1ODFA 4QGGA 1Q0QA 4RJ2A 5DNYB 3OQOA 1CJUC 2B9EA 2LZ0A 3TG2A 4YDQA 3M6IA 2QRUA 3GBVA 1CE8B 1ZLXA 4JBLA 2IX9A 1R4NA 2REXB 4L75A 4JI6B 2VUUA 2HPVA 5ILQA 5LXTB 1MQSA 4EFLA 1JDVA 2A5FA 2ODEA 3ID6C 2FN8A 2HBYA 3I58A 1ULAA 2OBFA 1E7RA 3OTQA 3VR4A 1COZA 2C92A 5GOZA 3H2ZA 2AZXA 1ECFA 4BUZA 1OGJA 2J46A 5AKKA 3ADCA 2PUFA 1JDBC 1FSZA 2SKCA 2C2GA 2ZSFA 3U4QA 4B3RB 1EGQA 3BA6A 2MOKA 2ERYA 3C8UA 3Q41A 1Z06A 3MUEA 1GNLA 4QATA 5AVZA 5JBNA 5I4KA 4TUYF 1PEDA 2IHJA 2F8LA 4CIXA 2Q2WA 1I2ZA 2BR5A 4GF5A 3RK1A 4INJA 1KYTA 5A02A 1VSUA 2VTBA 2YTZA 2K5UA 2XNCA 4LX0A 2Z98A 3W6UA 4CG2A 1S2IA 3UATA 4D0SA 2P2NA 4WPGA 5JYBA 3PEYA 8LDHA 1H2WA 2XXAA 4YJFA 1TYEB 2P9TA 1QLHA 2I62A 4HQKA 3HZHA 4H4EA 1W5TA 1JTFA 3TZEA 1J70A 2X7HA 3LWZA 3X2EA 1OCEA 1V7CA 1YDEA 4U2FA 1RHRA 1OXUA 2WUDA 3SJUA 4IZIA 4LYEA 4FT2A 4LOIA 2D7CA 4PS1A 5LOVA 2PWZA 4WH0A 5JAUA 3UMVA 3WADA 3QG1A 2JIBA 2JFOA 3DAFA 3GPLA 5F2KA 2BZ0A 1BKYA 8OHMA 4E12A 1FDRA 1WR8A 1KFJB 3S44A 4AJ4A 4CV0A 1N3BA 3F5DA 2X3YA 2ZCVA 3BDIA 4L8GA 5CK5A 5AOBA 3UCFA 3DKIA 5F5XA 1BNCA 4P3OA 3JTMA 5F23A 1G5FA 2Q3JA 4GWGA 5JNUA 5HP4A 4NICA 4RTPA 6NULA 5IVDA 2UUPA 2V7QD 4MV1A 4B3IA 1QHHB 4E5YA 1WZCA 3I0MA 2Y4OA 5BOSA 1SKYE 4C78A 1W5FA 2Q5HA 5D5PA 3QKWA 1E77A 5TNXA 5KYUB 3T8YA 4KWTA 3DOCA 3SE7A 5EMLA 3AVUA 4U5XA 1U90A 2JGDA 2A1UB 1MQAA 1LWOA 2NO7A 2CJXA 1SUBA 1UPBA 3E1KA 4LZOA 4UD2A 1E1MA 3SC3A 8ABPA 4DABA 2GPJA 3GGSA 4NZZA 3Q1KA 1R9NA 3PNYA 4JT2A 1MV5A 2FWJA 3HFGA 3VJMA 1OH5A 2Y05A 1IBSA 3URKA 1P3DA 2G5TA 3LT5A 4YO8A 3ZK7A 3CN7A 2E4WA 1V5WA 1F3LA 1D4AA 1S4QA 5E8JA 1BCSB 4EO4A 4M8IA 2JB9A 5IH3A 1RVDA 3H5WA 4C08A 3COJA 4J29A 4MYDA 4DCVA 2XMPA 1ZI8A 1LQUA 3L8HA 1G8PA 1ZM7A 3SSMA 2HSDA 2C7RA 4YCMA 3L01A 5HIAA 1JHZA 5H68A 1C3OB 4BP9A 5EL0A 4EY7A 4AS1A 4RA6B 2HK8A 1WW8A 4N54A 2OKGA 1XVUA 2R8PA 1TMGE 4TSKA 5G2OA 5F2NA 4DV4B 2PWYA 3STHA 1FXWA 5C1BA 3DOFA 3RAPR 1IB6A 4OB6A 2GASA 3ZKWB 2E4XA 3EY4A 4PBSA 3DLCA 1ILWA 1DE0A 2NU9B 4BFYA 1HLFA 2AFHE 2JANA 2OD2A 1U9YA 2QN1A 1Y7HA 3DTNA 3VV2A 1U2GA 5DE3A 2QP9X 1YDGA 1OB5A 2H31A 4UOQA 1H4VB 1ZXLA 3JQGB 2EZ4A 2OORA 2VH1A 4TV8A 1Y7LA 2HLHA 2O2CA 4KGXA 5KJ1A 3IVGA 1MJNA 2OYRA 2XUIA 3SNKA 1Z0KA 3TAXA 3KR2A 3PNLA 1VOTA 3H5TA 2QRPA 1QP8A 1ZD3A 4TWRA 1I7NA 3R75A 3TLGA 1AQJA 2WILA 4MUIA 2IHZA 2I34A 4I4IA 4G4IA 1AO3A 2XGGA 4HNAA 3HCRA 1K3FA 4QJ3A 4L9AA 5GTDA 3VR5D 1I3CA 2XQGA 1HR0B 3D43A 3PC2A 3UHOA 3CGGA 4X45A 4CDGA 3DOJA 3RAFC 2OB2A 3UWSA 4XJXA 4FB5A 4B71A 3ZTYA 3ZWWA 1KVUA 1QH1A 2RI1A 4CM6A 3HXTA 3RADC 3L18A 4I8DA 5HPYB 4RKWA 2JASA 5JD5A 2I2DA 4EENA 5C80A 1KIMA 2OAQ1 3NIWA 4FR2A 4KDCA 1U5BB 1JLMA 2P9HA 4PM4A 3OT5A 4DY4A 5BNWA 2P5YA 1PLLA 2EYQA 2ZXFA 3KEOA 3ETNA 1P1KA 3WYBA 3EGXB 1W4ZA 3EXIA 4C4XA 2GFIA 2D59A 3GEGA 1GITA 3HR4A 4CM4A 4CG1A 4RPLA 5EHZA 1F5NA 5GY7A 3UTDA 5KO2A 2DWCA 9GPBA 4TKVB 2VZLA 4HY3A 4I9FA 2B34A 3CF4A 3EEYA 1DJLA 4B47A 5HHTA 4BMDA 3AUXA 3IL2A 3V34A 1P6QA 4DWWA 1SH7A 1FDTA 4GS5A 5TLSA 1K63A 2H2FA 3KKQA 4ER7A 4HUQB 4JI5B 3PITA 1GRRA 3MB5A 4KLRA 4ZO8A 3UICA 2IHNA 1XRNA 4EPYA 3IDQA 5IDXA 1ZEJA 2P8SA 4D8XA 4P0PB 4H4CA 1NN1A 1RPTA 2ZI4A 4V1CA 2G4VA 4JT4A 3OZSA 3QRWA 1BXZA 2PGDA 3OEWA 3AB7A 1DBRA 2B61A 4JQYA 4N3CA 2HAEA 2OFPA 1K1EA 1QFSA 3B6JA 3LO8A 3TFOA 1GM5A 2A78A 2V54A 3B53X 3GJ4A 2GTIA 3HA5A 4J3JA 4OMCA 1E4EB 1OFIA 2XH8A 5B57C 1RAAA 1Q1ZA 1GRCA 2BBTA 2R3SA 5MGBA 3F8WA 3GVXA 4R8SA 4YJ2F 3PPIA 2OCKA 2XE4A 4IZ6A 5CK4A 5AK6A 3VKUA 5IXJA 2ZS9A 5LQAA 2R9VA 3MK31 1XD2A 5D5QA 3QI7A 4NECA 1N0VC 2QB5A 2QJFA 3IJRA 3E81A 4IS3A 3UB4A 1VP3A 4D74A 1R0LA 1GPUA 3BEDA 4KQGA 4CKZA 5D1NA 1ZSNA 2CLMB 5E4FA 4HN9A 3N8DA 3QJ5A 3GXOA 4C4TA 3ET4A 3JWIA 3NKLA 4HQNA 4Q18A 4GLJA 3MA0A 4UM7A 2QYSA 3OESA 5E1DA 2B78A 3WGYA 1DIOB 3RF7A 1DWQA 4M0FA 4BOYA 3HCFA 1AK2A 3FCSB 4Z1MD 5IPFA 4U9IS 4DIDA 1C50A 1QVRA 3KEFA 2YZKA 3CZAA 2XVAA 4LYAA 1YL5A 3UJBA 4KI0A 3SJBA 4ENUA 1KMHB 1ZESA 2Q5LA 3RS3A 4IG9A 1S7CA 5E9AA 4MA4A 3DE1X 3F78A 1QDEA 4C0XA 1EPUA 1NMEA 3GC6A 3NG1A 4Q39A 1BX1A 4B35A 1EFCA 3GCXA 4YJHA 5DNDA 1CB7A 3EB9A 7MHTA 1W76A 4X1KA 4DLWA 3GLRA 2HW8A 5ELMA 4ARVA 2JI9A 3SHQA 3TKYA 1UJCA 1EK0A 2G1UA 2W11A 2OV6A 3DEZA 4I6EA 1T4BA 1TCCA 1XALA 1P9RA 3HCBA 1ABFA 1M6NA 1N2XA 3UOAB 4B4UA 3U7FB 1XVVA 2GZ3A 3K1JA 1I14A 4U39A 1G60A 4Q82A 3ZDBA 3GX1A 1TD1A 3A6HA 1N0UA 2OM6A 4BWFB 2AX3A 2WFLB 4DQUA 2F3QA 2ZUEA 3DQPA 3LUGA 3A6ZA 2Y1LA 5CH8A 3LJKA 2J30A 3VR3A 4YP5A 2YIMA 4K03A 2JA1A 5HJ5A 2OHOA 2V8BA 4PAGA 4JYBA 4UUPA 5ED0A 1L7RA 1ESEA 3N8HA 2NACA 2EATA 3PRJA 1KEEB 3H9QA 2Q3CA 1T5TA 4EZBA 4L02A 4IOJA 1CVLA 1SMKA 3EVGA 4MWGA 2LCIA 2H11A 2KE5A 2ZRIA 1GN8A 2OMKA 3OY7A 4HH1A 3EFOB 4IP0A 5DULA 4EG1A 3CLRC 4NU0A 3ZHTA 4LSWA 4NCAA 2C2XA 4U7TB 4ZP1A 2GVNA 1Y1RA 2B4RO 3RVDA 3NM4A 3P9PA 4CM9D 1MX3A 3JYHA 2PQ0A 1V6CA 1PQUA 3EZXA 4P9NA 3PWKA 5EZ5A 3T9DA 1UAAA 4ZODA 2QJWA 1RYBA 4RM3A 1ZD8A 2PANA 2R1ZA 4QARA 1G3MA 4X71A 5K9ZA 3OPYA 3NC1C 2FOIA 3LGXA 2Z30A 2FKAA 3OEED 1Q92A 5EGSA 5EXPA 3V4LA 5CM9C 5CD1A 4Z7NB 5HTKA 3DEAA 1AF4A 3R6LA 3MUNA 3FUCA 2GAOA 3VUEA 2VFAA 3GJSA 2GUGA 1RRVA 5CLIA 3H8WA 5DT9A 3P9IA 1RADA 3FNFA 1I51A 2W0SA 2D7JA 3DLTA 1U3FA 4N82A 2K2WA 1QOQB 1FUEA 2LKDA 3CLVA 1A04A 1VLHA 3F67A 1HE3A 2B8EA 3FB1A 4FGWA 4PYIA 3TQHA 5BQXA 5IT4A 5G1PA 3VR6A 1SUEA 3F6BX 2QLBA 4YIKA 3HJAA 3DM9B 1N6RA 1BX0A 3AY6A 3AY7A 2QR3A 3RT9A 1NXQA 4EI8A 3N87A 5JCXA 3NH9A 5F35A 2QROA 4CLHA 3I2HA 5B7PA 3ZJYA 3AVWA 2MSKA 3NBXX 3LV8A 3WB2A 2O6HA 1OH6A 2QTRA 2GEBA 1N77A 2RAVA 4R1OA 3KWFA 1YB4A 2O5RA 4ISBA 4N8EA 4AP5A 4Q01A 1XCJA 4UBOA 3ZV6A 1WQ4A 2YS7A 5ER6A 4WKBA 2PH7A 3FMOB 2ZYRA 5HBGA 3ZG6A 4AY4A 4FKBA 4Z7JA 3K1TA 5GJVC 4QZVA 3AFOA 3GP8A 3V80A 3NETA 3G7UA 3GJTA 3IAUA 4Q24A 5EFOA 3LUPA 1E2JA 3DVRX 3REFA 1ISIA 3VO9A 2E18A 4IYRA 4OHVA 3H3FA 4KIWA 1XQ6A 3VOBA 5J1SB 4P5EA 1KKUA 3F7TA 1V2HE 5KSPA 3BMQB 4HDMB 1AOXA 4IGEA 5HIJA 2C88A 4LC0A 3RQIA 1SHZA 4IDHA 3VH1A 3CF2A 4R0MA 4MVJH 1BWQA 2ZBFA 1ZGBA 2ZUVA 3NLLA 3TSWA 1J1IA 3MBIA 1C1DA 1UJ5A 3DB2A 2O8FA 4FFWA 2F3TA 3WBFA 3I28A 1KPGA 4JLOA 4EUSA 3PFWO 4DKXA 5HQ3A 2XBLA 2P9EA 1SA0B 1U1FA 4PQEA 3V1LA 1E5XA 2GK4A 3BCHA 3JASA 4Q1BA 4GX2A 4U1RA 4E94A 1A5SB 1M8FA 4X7BA 1QQ5A 2P9JA 2TRSB 3OF5A 5ES4B 1GTSA 3UPTA 4OHFA 4BGIA 3AIOA 4B34A 1PL0A 4ONEA 1XYVA 1T15A 1LI4A 5C31A 1UPFA 2AVNA 2GAJA 3DVSX 3WNCA 2XLCA 1T5BA 2IPMA 2X0DA 4TMTA 4MV9A 4KJZA 3DBHA 4UVIA 4KXMA 3T34A 1FVFA 2XD4A 2Y76A 1QV7A 1UJ4A 2AG0A 1KE1A 3TTVA 3BJZA 3USES 3ELYA 4MYUA 4C1BA 2XB6A 3ZI0A 4GDFA 5I8ZA 3NZEA 3BXHA 3RVPA 5AFSA 1TKAA 3FN4A 1TU3A 2HU2A 4FJ0A 3OLWA 2V1UA 3K1AB 3ICQB 3EFBA 1H22A 1E2PA 5G02A 5TF0A 3UH1A 3ZWMA 2QU7A 1C9JA 2B37A 1M2OB 3TIXB 4F86A 2J3LA 1BS2A 3QVKA 2CHEA 3KSZO 4EWLA 2DUNA 4OVKA 3KU1A 4CG0A 4M37A 4L95C 1F7VA 1MJHA 2NZXA 1AQ6A 3D8BA 3NKFA 3QFSA 4BB0A 4F3TA 3H9BA 4ARBA 3WMEA 1RI5A 2ODBA 2V5UA 3NDRA 3DMFA 5GMOA 1EVZA 3DW3X 4ALLA 2JLZA 2IX3A 4QL3A 5KQSA 1YC5A 2DERA 1UBNA 4INAA 3SXUB 5DWDA 3FFAA 4IUYA 5A4DA 3WBKA 1D2MA 3BTSA 3SM3A 4BNIA 4Q48A 2XZOA 3AU9A 3FUUA 4S1WA 1SD2A 2Z2YA 3D1JA 3ELWA 2I4OA 3EZGA 4TLDA 1B43A 5EZQA 1YF3A 3MC1A 2VO1A 4C7OA 1H05A 4WQMA 5HQTA 1CS4C 3G0GA 3K15A 1Z4LA 5BRJA 3O9VA 5JDCC 1FTGA 3ANTA 4GWKA 1FK8A 3GN1A 2HSZA 2XYGA 1GRNA 4HP8A 5CFLA 1OFUX 4RHYA 2ZR9A 5J5VA 2HMWA 2VHQA 3HDYA 4QXPA 3OOWA 3PR3A 4DDHA 4N0MA 5GZ3A 3SN6A 2VJQA 3FZQA 3E9QA 4L3VA 1S3SA 1Z0JA 1GSIA 2J08A 1YR1A 5EZYB 3VC3A 1FXSA 2OK7A 1F1BA 1UBSB 4R16A 4RXUA 2XQKA 3LWBA 2BUBA 4OKNA 4LJAA 2SICE 1TTQB 4K9MA 4URYR 3G6KA 5EE0A 5BRNA 4RTMA 5CVUA 2KW5A 3KOMA 3FVTA 1B2RA 2ZJFA 2IYXA 2X8LA 3ZS9A 4BO9A 2XVXA 4QBIA 1AUVA 4LK3A 1GAWA 1DG1G 2G5PA 2C2ZA 4MKRA 1TJ4A 4IEFB 3MILA 1P3JA 2RJ3A 4EO7A 1MAAA 1J06A 1ZH0A 2H29A 3THWB 3KL2A 3O8OA 5JNTA 1X38A 4XOUA 1E5QA 4LQDA 4YEDA 5B37A 1WG8A 1ZN7A 3OAAA 3ZCSA 1QBKC 2YHAA 4XGQA 5FRDA 2EFDB 1XHFA 4FYXA 4LMAA 4BFUA 1YJCA 5AK3A 3GFTA 3KYCB 1LI7A 1U0RA 1TX4B 1YTLA 3DBRA 2BKEA 4QUAA 5EHIA 3TIGA 1IY1A 1RC1A 4CM1A 8GPBA 2NP6A 2P62A 3OX3A 2RKOA 4E21A 2XUAA 5GIPE 3FYUC 1JZTA 2OE2A 5HFJA 1UM9A 2ZCUA 2V7UA 5J4LA 5JRJA 3LLSA 1U7HA 4XPIA 4BUCA 4EG0A 1IVYA 4JI4B 2E21A 2VDLB 2H8KA 1H65A 1GPWB 2QM3A 1FP7A 1CJSA 2VDWA 3X1JA 2ZS7A 2JVJA 1P1HA 1TZKA 3K53A 1E0SA 3H87A 5DNEA 1G21A 4OI1A 3SAJA 4UCXA 2ZDHA 5KAPA 1R5JA 4GHWA 2FMHA 3R9KA 5E7IA 2J45A 4UE3S 4WRRA 5FAXA 1IUNA 3RSOA 2GZ2A 2XQJA 2ZYVX 4RVDA 5EJ4A 1GL9B 3AF4A 4DIFA 3EXEB 1WO8A 3QK7A 1G5PA 3OM1A 3QVSA 4GXRA 4S3MA 5KDDA 7ADHA 2ZIXB 1XTUA 2ZJ0A 1BWPA 4L50A 2FX5A 5BSHA 2C5LA 1P18A 3U7QB 3KZVA 4O4JF 4DLZA 2XAUA 1NVMB 4MVJE 3TPZA 2KX7A 1KBOA 4B9AA 4G86A 1NW4A 4JKYA 4OMDA 4DXDA 1CQPA 1KZGB 2O3TA 4P08A 3EF0A 4MPTA 3I37X 2I0FA 5C8YA 5CA0F 1H8ED 1R27A 4GE0A 1I1NA 3NAZA 1GGJA 5KTOA 4UAGA 4XZ3A 3HQ4O 1JYEA 1PJBA 3G02A 1ZOLA 2OORC 2PZMA 3VZPA 4EHHA 3HU5A 1XJQA 5A0FA 1X42A 3GAFA 3R5HA 4R1TA 3EPJA 4PYJA 1NJGA 3KE9A 2Y92A 4HXFB 1FRVA 1XNHA 2GX6A 5E4YA 3ZX5A 3A37A 4KSYA 2R1UA 2B36A 1E5VA 5T6BA 3G5TA 4ZT2A 3KQKA 3LP6A 1ETHA 1E1RD 3O4HA 2JH9A 4G8DA 4AX4A 4B6GA 4CQLA 1JKJA 3L4JA 4B2PA 2VDVE 3BTUA 1UPTA 2VLBA 3MWFA 2ZLBA 5CITA 1YR6A 1VPEA 4M89A 5MN4A 1QIHA 3IQIX 1RHMA 3IA7A 2NTVA 3HSYA 3KPUA 3ISTA 4I19A 3IQZA 3GRRA 1I4TD 4ZZIA 3AVTA 2Y71A 2OESA 3D3WB 1JHOA 1KL7A 1XGKA 2C8JA 2EBWA 2FX3A 2GS9A 3AILA 3DYBA 4QUKA