3KU4A

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
293
structure length
291
Chain Sequence
b'NDLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAHPDYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 97
structure length 291
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ku4A00
1M73E 3UT6A 4K6OA 1A9OA 2RJ3A 1YBFA 5CXSA 4DA0A 1WTAA 3DJFA 1XE3A 1SD1A 4I2VA 3O4VA 3E0QA 1PBNA 1V48A 5F78A 3K8OE 1K9SA 1Z34A 4LKRA 5EPUA 1T8RA 1V45E 2QSUA 4KN5A 1PF7E 5KB3A 1JDZA 3LA8A 1JE1A 4QATA 1OUMA 4DA8A 4PR3A 3EMVA 1K3FA 2P4SA 4F1WA 4WKNA 1JDUA 1Y1RA 1V3QE 2QTGA 1QE5A 1VHWA 1TCUA 1SJ9A 4YMLA 3NBQA 1T8YA 3KVYA 1PKEA 1NC1A 1TD1A 1Z38A 5I3CA 4PNPA 2XRFA 3EEIA 4DANA 1G2OA 1ODLA 5B7QA 2Q7OE 1Y1TA 4WKOA 1A9PA 3D1VA 3UAWA 1FXUA 4TXJA 2OC4A 4EB8A 1SQ6A 3INYA 4BN0A 4M1EA 1Z39A 1Z5OA 3E9RA 3IOMA 3NM4A 1Z36A 5IU6A 3FNQA 4R31A 3MB8A 3P0EA 4TXNA 1V2HE 2HWUA 4OY3A 3KU4A 2AI1A 1RT9A 5EFOA 4TTAA 4MCIA 1YQUA 2OECA 4OGLA 1Y6QA 1PR6A 1A9SA 1JPVA 3PNPA 3EUFA 3FB1A 4L0MA 5F7ZA 1OTXA 4QEZA 5CYFA 1ODIA 3BL6A 4EARA 2ISCA 4D98A 3UAVA 5B7NA 1ULBA 3K8QA 4QASA 4LDNA 1Z33A 4TXMA 4U2KA 2ON6A 1T8SA 1JE0A 4H1TA 4DAEA 4G8JA 4GLFA 4YNBA 2I4TA 3DF9A 4BMXA 5IFKA 3P0FA 2I8AA 3KVRA 4TS3A 2B94A 4YO8A 1V41E 4JP5A 5CXQA 4NSNA 3TL6A 1CG6A 1Z35A 1JDVA 4WKPA 3DPSA 4NS1A 5C80A 1PR0A 1RXUA 3OZCA 1JDSA 1ECPA 4TYMA 1U1CA 5K1ZA 1PK9A 4M3NA 1TGVA 3KHSA 4QARA 1Z5PA 1RR6A 3ENZA 1YR3A 3KVVA 2QDKA 3BSFA 1TGYA 3BGSA 1PR1A 5ETJA 5F76A 2GUWA 4F3CA 3OZBA 1ZL2A 4F3KA 4DAOA 4DARA 4D9HA 4UC0A 2A0WA 2AI3A 1ZOSA 5F73A 1PK7A 4D8YA 1ODKA 4ECEA 1RXSA 3NM6B 5DK6A 2PGAA 3DP9A 1VMKA 1Z5NA 1U1DA 2HRDA 5F7XA 3ONVA 2A8YA 2OC9A 3PNSA 3OCCA 4OF4A 1U1GA 3OOEA 4G41A 1TCVA 1RXCA 1JP7A 4L5AA 2AC7A 1PWYE 1RYZA 5F77A 3UAZA 4F2WA 3PHBE 3QPBA 1OVGA 1JYSA 1NC3A 1I80A 4QAQA 4GKAA 3OOHA 4TTIA 4DA6A 3T94A 1PW7A 5CCEA 3EUEA 4GMHA 4D8VA 4R2XA 1Y1QA 4BMYA 1YRYE 4X24A 3GGSA 4DA7A 4D8XA 4OEHA 1A9TA 1VHJA 4L5YA 4E1VA 1JDTA 3F8WA 4JOSA 1LX7A 3DDOA 4NY1A 3IEXA 1ODJA 4JWTA 3UAXA 1RCTE 4L6IA 4M7WA 4OGKA 4YJKA 1A9RA 5CYGA 1Z37A 1RXYA 4GLJA 4WKCA 4LZWA 1U1EA 3KUKA 4LNHA 1SD2A 5EUBA 3OF3A 1A69A 5FAKA 3E9ZA 1Y6RA 3FUCA 3FOWA 3SCZA 1PR5A 1LV8A 4R2WA 1CB0A 5B7PA 1ULAA 4TTJA 3OZEA 1B8OA 1PR4A 3O6VA 2BSXA 4MCHA 1T8WA 2HN9A 4G89A 2HSWA 3GB9A 2A0XA 4DABA 4LNAA 4WKBA 2QTTA 4OJTA 4QFBA 4BMZA 4IP0A 4FFSA 1RSZA 3PHCA 5F7OA 3OPVA 3LBAA 5CCDA 1NW4A 3NM5A 4L5CA 1N3IA 3LGSA 1Y1SA 3C74A 1C3XA 2H8GA 3MMSA 3UAYA 1YQQA 1A9QA 1LVUA 2AI2A 1T0UA 1VFNA 1OV6A 1Q1GA 4P54A 2QPLA 3OZDA 4MARA 3FWPA 1RFGE 3BJEA 4TXLA 5JPCA 2IQ5A 3U40A 5B7GA 1U1FA 1B8NA 5F7JA 1K27A 4TXHA 3FAZA 1PR2A 4TS9A 2OXFA 1V4NA 2A0YA 1OTYA 4RJ2A 3ODGA 1OU4A 4F2PA
chains in the Genus database with same CATH superfamily
4JA0A 4CMKA 1M73E 4HEA6 3RTAA 1DVRA 3CT4A 1RJGA 3LFUA 1IZ0A 3NFYA 3S7ZA 3DS8A 3WSWA 5EMJA 4F7WA 3M34A 3U7RA 5IJXA 4WUTA 5E1MA 5TS2A 1AMOA 5LA6B 2ESRA 5KYVA 2IYYA 2J3HA 3FIUA 2WLTA 3K5IA 1IATA 3NV7A 3OJLA 1QGYA 3LX8A 3QXCA 3N0WA 3R3VA 4US0R 1QPGA 4AWBA 3R5XA 4I2VA 4N4AA 3M83A 3TIIA 1N6KA 2B7LA 5B6JA 1SCDA 2HHHB 1XEXB 3VH1A 3FWYA 2WQ7A 1Z34A 2OP0A 2BR5A 4WBNB 4ND7A 5HIJA 1FVOA 4DCOA 5BSTA 3HFJA 3OY2A 1T8RA 2QD3A 3NV9A 4AIIA 3JATB 4O1IA 1THTA 3U49A 1ORHA 4F38A 1Z22A 1QK5A 2WTMA 4KN5A 1SOWA 4ZRNA 1R6UA 3DPUA 4B8WA 4AUNA 5HZKA 3IDSA 1RBYA 1G0NA 2GRAA 4NBTA 2D3TA 4HR7A 5I7VA 1G98A 2YWRA 4ERXA 3K0EA 2P7HA 1Q20A 3A6EA 2PS3A 4J7XA 4EQ6A 1MX9A 3N7TA 2I3ZA 4XYGA 3KKMA 1BXGB 1SBZA 4FTWA 3WK4A 3I0NA 3CH6A 1V1RA 1SUIA 3HCFA 2OFOA 4XIYA 1J25A 3L7IA 2GBIA 1ZW6A 3I23A 1EI9A 3CXUA 4NG5A 1LDGA 1GHTA 1YNOA 3ESRA 5CIYA 2VPWA 1JDUA 4UQPA 4B3HA 2V1UA 1RIIA 4Q3AA 1CULC 3IQGX 1EDDA 4JVNA 1MX3A 3DBHA 4UDYX 3AVVA 4FE4A 1TUGA 2J9GA 5BQXA 2PRIA 1Z4OA 5BPFA 2MYTA 1QKJA 3ND7A 4W1SA 4YK7A 4ZAYA 1NXVA 2YYZA 3PQ7A 3QWAA 4I5FA 4NWIA 3FWZA 4PNPA 5A71A 3SNHA 2XRFA 2R84A 2IU6A 3GI1A 1Z68A 2AR9A 1W2WB 2D8AA 4IDBA 4ZMRA 3S2FA 4UOEA 2QMEA 3CISA 1ODLA 2W90A 4OJMX 4P93A 4RD6A 1AKRA 1GJRA 4C3ZA 1ZPDA 1AE1A 1J99A 2ZI6A 3O4HA 3QFHA 3H5NA 1GU0A 2QLTA 3ZVKA 5L3RA 4DZTA 2NYUA 4CI9A 5F2KA 4G0MA 1Z4NA 1B93A 3RTCA 3GFVA 5BN3A 1SQ6A 2YYAA 3Q98A 1MQSA 1J9ZA 1DXOA 1WXWA 2W6PA 1K2VN 2FWAA 2ZJFA 2RJNA 5IEBA 5HKBA 5KJ6A 3GIDA 5KTKA 2FN3A 2K2QB 1XFDA 2RGYA 4MW1A 2D3WA 2DH5A 1CY4A 1UXOA 2IYZA 3TZEA 4QLBA 2WM9B 5K5EA 5ICSA 1OGYA 2IHBA 3CSDA 3BIWA 5KPJA 1OYYA 1CQJB 3PJEA 4YWHA 3V4RA 4TTQA 3V5NA 3FNQA 3AEUB 2UUPA 4A8PA 4KHPB 2VEOA 3UHJA 3A9CA 4XOUA 3ORHA 2Q0SA 4TMXA 5LLDA 4Q21A 2FEOA 4XGRA 4KIJA 4Q18A 2JHCA 1QGDA 4ZAFA 1RPTA 2PSSA 1KJ8A 1EXMA 3IUQA 5D1NA 2C8LA 2CLIB 4RY9A 3SR3A 1NLZA 1YBVA 2D6FA 2I4NA 1SUAA 1RT9A 1HE5A 2CKMA 2OFWA 2QW8A 3IAEA 1W5EA 4F6RB 1FUYB 1Z2NX 2PRZA 4KPGA 4QICA 1K6IA 4M1ZA 1E1CA 1YQUA 5EG5A 3BFJA 3ZJUA 4E31A 4MRVA 1Z8FA 2C5FA 3DH0A 1YQDA 4G24A 4MLDA 4O4IF 2DLDA 4FBLA 4J75A 4UZFA 2DHEA 5HIKA 1F7VA 1UPUA 1JEQA 1J49A 3GGOA 2PH7A 3EUFA 1BX0A 3BWCA 1L5SA 3CF2A 4BJ3A 4BRUA 4IV8A 1DNPA 4ZDJA 3ELDA 3JQRA 3RKUA 1KE2A 5JEDA 1Z7BA 1NVEA 3U4CA 5DI3B 5DGCA 5IMSA 4D98A 1CLUA 1KH3A 3IE2A 1WIWA 5CR9A 2BFFA 3FYDA 1L8AA 5J1TB 4E6PA 4JXXA 2I2DA 3WNQA 2DUWA 1T4CB 3R6WA 4CLOB 1KKMA 3LCUA 3H4VA 2V6FA 3DMNA 3H1TA 5ALLA 1PLJA 1PZFA 3T4UA 4WBNA 3NIGB 4I50F 2JL1A 2I1VB 5IUJC 2N1BA 4FNOA 4B7AA 1E66A 4A03A 2PUJA 4PAQA 1YDMA 2OVBA 2X15A 4D4JA 1BRMA 3I3SR 4OPMA 5K0EA 1BMDA 3TD2A 3VKFA 3K7EA 5B53A 5L3SA 1E6CA 1K6JA 2GK4A 4RJIA 4GT1A 5AI6A 3CNEA 1WM1A 4PAGA 3QX9A 4RPKA 3U4DA 3B2QA 1BXGA 2WVGA 3ZE8A 3CLUC 4AJ2A 4DYVA 4IX1A 4B3SB 4M4SA 2C7VA 5IFKA 5FBLB 4LXYA 3GUCA 2DY0A 2R6DA 1L7OA 4B7ZA 1L7NA 5H4HA 3Q6MA 3V1YA 3OJ0A 1NN0A 3CYFA 3SX2A 3AYXB 4KGZA 1WXQA 5K03A 4WACA 3HGTA 5FORA 4GF5A 4EYGA 2FG5A 1K06A 2YJ4A 4XDYA 4Q1VA 1Z35A 1E9RA 1DG3A 2FPGB 1TVMA 4O4HF 2GBPA 1CFJA 3QE3A 4GMKA 3AR3A 2AOWA 2OZLB 4JDPA 3GVCA 1JJAA 4RPCA 4MUNA 3WYNA 1I32A 5D5HA 1RQPA 4IUYA 4DILA 1NJ6A 3F3MA 3LVQE 4ZQGA 2B82A 3M3DA 3VV2A 2YR0A 1JF8A 2YV3A 1RZ3A 3VC2A 1NUQA 2D0IA 3IPYA 1R8YA 4D9JA 5IVPA 3GJ0A 4Y6SA 3DD5A 3S8EA 1M6HA 1ZAKA 2HMTA 5SYAA 4QPPA 3M4NA 4CLEA 4YRZA 4ZJZA 5CDUA 2C42A 3EPJA 1VL0A 2JIPA 3K72B 4D9EA 2C9CA 1TK9A 1W19A 1X1AA 3L8FA 4G1CA 3RFUA 1VSQA 2HBQA 2YDXA 3H7AA 2V59A 4UBNA 4PLPA 2HLHA 2JLZA 4JU8A 3ML1A 3FH0A 2QL6A 3D2AA 3QU2A 2EAUA 2PHZA 2GA9A 1EFDN 1P9NA 1QGUA 2GUWA 2RHDA 2D00A 2RHWA 2VBCA 4JCCA 4Z9BA 1J8FA 1PZNA 5CVVA 1NXSA 3GOQA 3NCHA 1ZWLA 3JD2A 5ALDA 1DQPA 4DARA 5A3JA 2Y2UA 2GK3A 2QP9X 1DEHA 5JZSA 5LIRA 3TDMA 1TK2A 4NFYA 3OZTA 1S7CA 4H3SA 3NBXX 5A04A 1AK1A 5JXGA 4XR9A 3B1KA 4YO7A 1IN1A 2R2AA 3RC9A 4AQ7A 1TQHA 3WP0A 2JIDA 3ZZ1A 5IHXA 5EVJA 3N2KA 1HY3A 2DAPA 3CUTA 5KDOA 3HDGA 4KFTA 4LCJA 4IWYA 1E1QA 3MSXA 1I10A 1NBOA 4URVR 3GLHB 4M2LA 3M6AA 1AQIA 2QVCA 1NVTA 4ZCSA 3DV0A 4FSXA 5KYKA 1FFWA 2GJSA 3QUBA 4UM5A 3IQIX 1CR2A 2B9VA 1XV5A 3UEOA 3HP1A 5LBUA 4YYZA 1U8ZA 3H42B 2VBFA 5I9BA 1E1RD 1XWWA 3SC4A 4M0DA 4HMPA 2DPLA 1FYVA 2I6UA 2KB0A 3IVRA 4OH7A 4P3PA 2Q3MA 4YCBA 1XMIA 5IAGA 2W93A 4EG1A 3IMFA 1FTQA 4G84A 2BZ1A 5T6MA 3ZQUA 5A5EA 2PDAA 5TPWB 1RXCA 3FRHA 1N1MA 1G3RA 5ECDA 3R44A 2YFKA 5DI3A 1A9XA 5I9IA 5BYAA 2IXEA 2ZBUA 4D2IA 2YWDA 3CRRA 1ONPA 1OX4A 5AK5A 3P9CA 5FT9A 3U56A 5FH9A 3NBKA 1E6KA 2CYAA 3UTCA 1FIUA 3AKDA 1PGJA 5K9ZA 1JB1A 3CF4A 1JVBA 2EJWA 2X5KO 4PC3A 2YBDA 4UFPA 5HRUA 2EJVA 2VPTA 1DCKA 1O5TA 1V3VA 3OFJA 3DTTA 3L7AA 5H5JA 3VU0A 3VMMA 4E94A 1TI7A 4XM1A 5ER6A 2Q9BA 3AG6A 3HJGA 1Z6TA 3JD1A 5CFZA 3OTOB 4AG6A 4OXYA 2CL7X 3LC2O 3U81A 1OXMA 3N05A 2G9ZA 1KJJA 3INGA 2I2FA 3MELA 4FMBB 3K0CC 4GD3Q 5EUMA 3RYHB 5ALNA 4HDRA 2HWXA 3GJTA 4U7GA 4DQVA 2ENWA 4I2NA 4JELA 4U00A 5G3ZA 2GZ1A 3SVZA 4CIVA 1JIVA 2O52A 5F5LA 1D2EA 3DW1X 1NP7A 1TPZA 4RTKA 2QTCA 1ST3A 1YR9A 4DJFC 2VSNA 1MEOA 1GSAA 1HDXA 1YJBA 2YZ7A 2Z4TA 5LZ5A 4BEBA 2G0AA 3TLZA 5FFNA 2QNRA 2HMUA 2JLBA 1T2NA 1YC5A 3BK7A 1CEYA 2FWMX 1LLDA 3PQ5A 3MCTA 1BWSA 1JLLB 1RLMA 1S0UA 4WVFA 3ZG6A 2ID8A 1L5ZA 3PFCA 5JY6A 1AO3A 4BWFB 5ISMA 2VNHA 3TW6A 3GD5A 5IMBA 4ZYUA 1IM2A 2GPJA 2O2XA 5EZSA 2C4KA 3GWZA 3AL0C 2G3YA 2HM7A 2I62A 3C3BA 3P0RA 4XX0B 4V0RA 2XD9A 3F6EX 4QJ3A 5KYXB 2OXRA 1S3GA 3OJEA 4OP3A 1PJBA 2YJ6A 1GNTA 3S6JA 3UIEA 4OQZA 5DCYA 3AC0A 1PGPA 4KLNA 2PRKA 3THXB 2GTPA 4NI5A 4CMEC 5FOWA 1SVSA 4LISA 4GLJA 1VPVA 1QAOA 3KEFA 5PGMA 3KWJA 4QTZA 1P0QA 2ODWA 1YRHA 2X13A 3TZQA 2VI5A 3O1JC 4NU6A 1XTIA 5I7RA 3N2LA 5F52A 1H93A 4UQOA 3LG2A 4FMDF 4JC4A 2I29A 3V33A 3A4MA 2AKEA 4D99A 2J3MA 4CCSA 1WNFA 4L8YA 4IIJF 2D06A 1XMSA 1GN8A 4URHA 2O7NA 4Y2QA 5BR1A 4N40A 1VI5A 1OFVA 1QG6A 1WKBA 3IEUA 4HPJB 3A27A 3KWFA 4AZ3B 3UA4A 4UU8A 4US1R 3MXTA 1YHNA 1E9SA 3VR6A 3LI2A 4EUHA 5BV7A 1Q19A 1JG7A 2BR3A 2WF6A 5HKKD 1W4ZA 3AU8A 2CNOA 5I9LA 5LP6B 2BDUA 1U7OA 4HG2A 2WVAA 5IP5A 3SCZA 4CIYA 5BNIA 3GLHA 3ZZMA 1T0JB 3W04A 4C30A 4OYHA 1EDZA 3WLRA 4NR0A 4CFZA 2DB3A 1E2BA 5IF3A 4Z7QB 2H0QA 5TGDA 5ALWA 1Y1LA 2AOVA 3AZOA 3DVAA 2WKSA 3N76A 3MTGA 4BNKA 1U0BB 1QIMA 4PXSA 4WLEA 3B9QA 1VE6A 4R68A 3U7HB 2E4XA 4IF4A 3GHHA 1JGTA 1Y8RA 1ZGHA 4HGPA 4ER5A 3U0VA 3QG1A 5JECA 3QFSA 2QX8A 3R09A 5TPWA 3RVBA 4YALA 2ZZKA 3V2UA 3GB9A 2F67A 2ZWIA 3AW9A 3VAYA 3T7CA 3B51X 4WD3A 2R85A 2ZCVA 3QKWA 5AJTA 3QXXA 3UO8B 3HUFA 4QFBA 3USCS 3MJVA 4W7IA 4BMZA 4TL7A 1VCHA 2EARA 4QL3A 2QN9A 4R2LA 3G0DA 3HR7A 3SIWA 1XN1A 1XRLA 2ZVJA 3EASA 2GO1A 4E14A 3WGNA 5F7OA 5MGNA 1CS0A 1JNXX 1O77A 2P6MA 2YJZA 4Y2UA 5F2OA 5GV7A 3SSMA 4PN3A 2JRLA 4HEJA 3TSOA 3PQEA 1UM9A 2XECA 1T6BY 3IR5A 3RH0A 3TXAA 1P4RA 1YUBA 3T1QA 5LL6P 1EESA 1EIWA 1A5TA 3JYPA 4ZI5A 1TM7E 5TEWA 1K86A 3ZHQA 4MSUA 2A33A 1VKZA 1T36A 3RWOA 2H8GA 3LRTA 3L6RA 3T3OA 5BVHB 5HM6A 4ILEA 1IIBA 2YZGA 3R1IA 5T4HA 4IBOA 1JA9A 1QLWA 2O6HA 1H8HA 2C4WA 2KSQA 1KQGA 3BMQB 2WU4A 4O2AF 1EUZA 2DC1A 5B3KA 1LVUA 5J4HA 4A2PA 1LDNA 2QKYA 3VR4H 1FL9A 3OMWA 3D81A 1RZRD 2NU6B 1C14A 2JGFA 2XWJI 1O4VA 2H65A 1G2QA 2C5LA 2I4IA 3BREA 5LN1A 4MVJI 1E98A 3VYUB 4D46A 5AK6A 5JJLA 2ZUBA 1Q92A 1UXJA 1IB6A 2ICAA 3ED5A 4JUAA 1WP4A 4I99A 4ZP1A 4BLOA 3AWIA 5JW6A 3C48A 3KZXA 1VJ0A 2REQB 3N70A 4CCYB 3BD9A 4R98A 5LYJA 2BFAA 1JQ3A 4LRQA 4W5RA 1P4AA 3TL3A 5I7OA 3QVJA 1WSAA 3Q3IA 2A58A 1A7JA 1Q7BA 1T35A 2VWQA 2YV1A 5EEGA 4EVSA 5KYXA 3W8EA 5IVIA 5D85A 5JASA 1UXIA 1YA8A 3KB2A 3FJOA 3H2YA 4P5PA 4GWGA 3WC4A 4XUCA 1YDGA 3MW8A 4HJRA 4EUEA 5GJBA 4I1YA 2PD6A 3FLMA 2XD4A 5LMUB 5CGQB 2BW0A 3OFSA 2V3WA 2IGTA 2BGGA 1T9DA 2VWPA 2UZAA 5B3LA 3OUZA 2OBFA 3AHCA 4MXDA 4URWR 2BHSA 1E62A 4ZOCA 4UE6A 4DYHA 1TEHA 1OREA 3JWEA 3SBDA 4YYEA 4A8HA 1P9OA 1V96A 3LUDA 1TCCA 3RIMA 3WLFA 2WU1A 3PYMA 1A5SB 1LW6E 1RKVA 2H2IA 3AR2A 3ZTWA 4BNWA 1MV5A 2BFPA 2V9PA 3O4VA 3C3AA 3DGEC 4XFJA 3TIVA 1RABA 2PPVA 5CA1F 1NNI1 1P1HA 2ZIUB 5F78A 2IY8A 2CXRA 3R4VA 5M34A 4ZT4A 2VXOA 1XZLA 2Q4TA 2N46A 1IULA 2C2ZA 4B87A 1KMIY 4UEWA 4QX6A 3V1MA 2PZ8A 2JKVA 3E05A 3FZQA 4QPZA 1D2AA 4KYIB 2ILVA 2W70A 1AS2A 1OC4A 2JFQA 3AUTA 2OT3B 2QTLA 3EVTA 3L8DA 4DSAA 4YUWA 1T3GA 4BAZA 1FW6A 4MRAA 1VMEA 2J4CA 3C5CA 4GS5A 4Z4GA 2WEKA 2FWJA 4E3ZA 1KO7A 1RAFA 3EIEA 4YCNA 1V5FA 1LC3A 3IUSA 2B4RO 5DISB 5I4KA 3WIVA 4D6XA 2VT3A 3MJHA 4EHHA 2YNMD 1MB3A 1N6HA 3IGFA 3G13A 3AVWA 1TU0A 1ZN2A 3WL5A 5HBGA 3TLAA 3A6KA 3L0DA 1SJ9A 2JGNA 3DAOA 2HLDA 1KAQA 3FLAA 3UT0A 1MO3A 1A2BA 1WCIA 2P9CA 2DY1A 3AERA 4GP7A 3NBQA 3IOYA 2A9KA 2P5UA 3EC1A 1Y1PA 3GWGA 3ECSA 4CTOA 3AVYA 3NCTA 3A06A 4BU1A 3WGZA 2QT9A 2FSPA 4J90A 2IOYA 1K0UA 3O2NA 5FNVB 1G8SA 1EKXA 2YNMA 1WB4A 3GGJA 4AWAA 1SBYA 3VZDA 3AP2A 3M6IA 4FFPA 4KFUA 1P60A 5LBIA 4DR5B 1JKIA 3IP5A 1TDJA 2I65A 2XYPA 4JLDA 3HH8A 3AFOA 1A9PA 1HORA 1KPIA 3MERA 2GN6A 4LK3A 3RM3A 4EVIA 4UHHA 2PKCA 4G0UA 5C18A 3VJRA 5IRCD 4XR4A 3HYCA 5K20A 2O5VA 3UUGA 1TVKA 2FFAA 1JA1A 4B76A 1YT5A 5A03A 1J1ZA 1U8FO 2WA2A 3DZIA 4N7MA 2GA8A 3R7LA 2NU6A 2XT0A 3IXMA 2REBA 4ENWA 4HF7A 2BI8A 5LKAA 2HCFA 3KDAA 5IAAA 5DLEA 3RSSA 1ECJA 4Q39A 1BYIA 1XK7A 5EMLA 3ODPA 2YX1A 1U2DC 3SJAA 4OCZA 1XN4A 4N9QA 3WTBA 1GA6A 2WYOA 4CCYA 5HUJA 3LHFA 5CAEB 4E1AA 4GR5A 5CLLA 4GYWA 4BO9A 4C0SA 3IMKA 3R77A 4B4OA 5K8UA 3QVWA 1GTVA 3QELB 3R5HA 1XZEA 3D31A 3GDFA 5CX1A 4B6SA 1MVOA 3LO5A 4FHZA 2DETA 4RVNA 1DE0A 2OGZA 1OI2A 4RENA 3I4CA 4GUDA 1DKLA 4FFDA 4ZO8A 2G9QA 4TV9B 4XD7A 3GUUA 2EERA 4BLVA 5A3QA 5ITZA 4E1BA 1D6JA 1Y6QA 3QXJA 4HI0E 4BQPA 5DASA 3CZAA 1FQOA 3CVOA 5F5NA 1WMBA 5JANA 3FPGA 3GEGA 5FHRA 3OU2A 2Y93A 2X9VA 2HZBA 621PA 1YR2A 3TG2A 3QX3A 4CKEA 4D9GA 1QYIA 4RH3A 5SY6A 3ZWWA 1VSBA 3AP1A 5J63A 4BMDA 3ZHSA 1II0A 2W2LA 4ZC8A 4UU0A 1ZMTA 3G2MA 2GFHA 2XR1A 1T34A 4YJFB 4EJ2A 1H2WA 5E4YA 4E09A 4X6YA 2X0EA 2JKZA 2WWHA 3K8QA 2D1QA 3VPGA 2GDJA 4A0SA 2PS9A 3DAFA 3LT1A 1EFTA 3LZ6A 2LZ0A 4W5NA 2X40A 2WWRA 5EXSA 5C5EA 4EG0A 2XTJA 3DXXA 3IA2A 3WKDA 4PBRA 4WCFB 4CLDA 3G8YA 1FBNA 1K8XB 5ALZA 4YLYA 3DFZA 1F1BA 4Z53A 1UPAA 4CF3A 3CLSD 1HZZA 2CHVA 4J6EA 4LECA 4CETA 3OU7A 4J76A 1GKLA 2GJAA 2MSLA 2IZ6A 4Q1EA 1APBA 4FS8A 2FZWA 2XWQA 2QGFA 3JVIA 2R96A 1Y5NA 3J81k 1RCFA 4X97A 3FOAA 1RC1A 3AL2A 3PFBA 5KJCA 4TS3A 2ZTVA 3CG4A 4JP5A 4L50A 1Z83A 3KB6A 1JIXA 4EHNA 2VDWB 5H3CA 3AF1A 4RS4A 4ND2A 5E4JA 4WKPA 1Y7PA 1WEHA 5K3CA 2TRSB 1RPJA 5C8ZA 3ZVNA 2EKZA 3PE4A 3CLRC 4B7CA 2HMVA 2OZVA 3A1DA 1M83A 1AQLA 1U1CA 3PC7A 4BKRA 4BKUA 1XNJA 1YKFA 2BFMA 5FNVA 1DIAA 3EQ7A 2Z0MA 3RU7A 4AN4A 1KDPA 3M5DA 1JJBA 1CLEA 3OLQA 2NP6A 1OPXA 5H8WA 4EW1A 2EL9A 4MDFA 3S3TA 1QQ6A 3FPFA 4Y0AA 2RHOA 3QLUC 1A2OA 1I2AA 3KTFA 2QIOA 3CONA 2P1DA 1XZCA 3KVVA 1HV8A 2MSDB 3QYPA 4UVHA 4KKVA 4DR4B 2OCIA 1X0XA 1BIFA 3W5AA 4B3MB 3BTSA 1GA4A 3TRFA 4G5YA 3VYVA 3KJEA 5AUNB 2O8NA 3KOUA 4ZVNA 1SVUA 4CQJA 4H1VA 4GMXA 2G7MC 4R81A 3BSSA 3G7SA 4X1KB 4YRRA 5EP1A 4GFDA 1C3LA 1VLMA 4L9SA 3IRVA 4XTRA 4M9RA 1AZLA 5CAEA 1M2HA 3BM5A 3U09A 3CR7A 3ORRA 1RVDA 3ZDAA 3QELA 3T5MA 3T9AA 9LDBA 4RV4A 4JP8A 1QGOA 4BVFA 5IWCA 2LXNA 3O93A 4KHZA 3T5DA 3UXEA 4CTNA 1RWMA 4Q34A 4JC0A 3CF0A 3GFBA 5KINB 5ESRA 4B48A 4D8YA 1LQ2A 3CCCA 4H0NA 1I9CA 2JFVA 4OJNA 1I1OA 4UVEA 5B4UA 2BFWA 2PL1A 3QVVA 1LSSA 1RCUA 3B2EA 4JXZA 1VMKA 2C2OA 3OECA 1PJLA 1W5TA 2QYTA 3LY9A 3IPCA 4P4NA 5LQNA 4OGWA 4PZ9A 2XNHA 4ONEA 2A8YA 2PWAA 4FHFA 3GLFB 3DLPX 1VMIA 2VDLB 4KQ2A 1L0BA 3BRSA 4OF4A 2HMYB 1TJ4A 1KJQA 4FFBB 4IMRA 2Y92A 2CFTA 3U60B 1YR8A 5ALIA 2WSBA 3IAXA 2XLCA 1HKHA 3C6YA 1J2TA 5DRTA 3BL8A 4H77A 3LQQA 4O6VA 5KPDA 1CKEA 4LV5B 1T4MA 1VI6A 2Z5GA 3AKZA 2NVBA 2WFAA 4KU4A 3AXSA 5KMGA 1WSDA 3H1GA 5LQJA 2IW3A 3ROEA 4UW9A 4FDAA 1GZVA 1ZH6A 3A6ZA 3P9KA 3GOHA 3OICA 2E9SA 2NUPA 2EHJA 3CNBA 3QA3E 5EZYB 3SI7A 5CFLA 1I80A 2QS9A 2A0FA 3QBDA 4J0GA 3HCEA 2NZ8A 3LS2A 1BMFD 3LWZA 2B30A 4OXQA 4P7GA 3BZUA 3NAMA 2M6KA 3HN2A 2PWBA 4ZZ3A 3JYLA 3UMSA 1MC4A 1FU7A 3U3ZA 1UJMA 3PPXA 4Q7EA 3RBVA 1JAZA 2C04A 3O3MB 1PN3A 2OPHA 1B0AA 1KO5A 4V0SA 2G6BA 2NO5A 5HIMA 2AWNA 5CCEA 2NAFA 1ZK2A 1J8YF 1T2FA 2JAOA 1C4WA 4RH0A 3IBCA 4X71A 4J43A 4DSZA 1TRKA 1DDOA 4AP5A 2ZRHA 3HVRA 1J5PA 1N78A 4X7RA 2WOJA 1L4MA 2IIPA 1A8UA 2ZWVA 2OFPA 2VDWA 2V4ZA 3HJRA 2WD9A 1FFDA 2X4IA 3QV1A 4CI0B 1LF0A 5AVKA 2XXAA 1DV1A 2IZOA 2EFDB 4FX5A 4L75A 5JI3E 2C0PA 3D02A 2WG1A 2VHXA 3GJ8A 3E3MA 4DUGD 1FFGA 4MGZR 4OIFA 4XM2A 5IVKA 1Q1AA 1SVOA 3BIOA 3FFTA 3JXEA 3HG7A 3E81A 4YAJA 4FU0A 3C14C 4D74A 1ZQ9A 3KB1A 3DSRA 1XZ8A 2R68A 3I45A 3UAXA 2ZSEA 3V3TA 5GM2A 3DF7A 1Y1KE 1Q3TA 4U9UA 4TLAA 1OIWA 4OGKA 4JIGA 1G38A 4B84A 1NV8A 1W34A 4D9NA 1J70A 1J20A 1W0KD 2PMCA 2WM8A 1XRNA 1IWPB 5ICEA 2Q3HA 1QRUA 1XDGA 5SYMA 3G82C 3GBSA 2SCUA 4E5KA 3BIXA 1AURA 5BYJA 3SE0A 2XBLA 9MHTA 4MQMA 1I3OA 4UQLA 5C1DA 3WGOA 1GRVA 1QO0D 2VAMA 2BM8A 3ILYA 4JHLA 3BK1A 4QUKA 4UEJA 1AY0A 1NN1A 3CUEF 3LDUA 4KO1S 1C3EA 3AT1A 3L8YA 1Z4IA 4II7A 4JEIA 5TJ9A 1ML3A 1WTCA 4RYLA 1EVEA 3HA5A 1J24A 4U6QA 3L8MA 3U31A 4XDGA 1M8FA 4LZLA 5CFQA 4UE2A 2OLJA 2WHPA 5CVTA 3QQ5A 1SUPA 1UJ2A 2H2AA 5JSFA 1BVRA 1SXHA 2UVDA 4NCXA 4DVGA 1C7QA 4C0BA 3EDQA 2IPNA 4ZU1X 3FUCA 1T6ZA 2WYUA 3AY3A 4XSVA 3DEKA 2GFQA 4PHGA 4Y6GB 4PE5B 4KQKA 3PF9A 1FLAA 3MUOA 4IQ4A 4LV8B 4OD0A 2FMUA 4JYBA 4MPJA 2CFOA 3JRNA 3IV7A 4JQZA 4YBRA 3W4JA 2DWPA 4JLAA 2WRZA 3KBBA 5DH9A 3T1TA 5B7PA 2FN8A 5AOCA 4EGFA 2NSDA 4DBLE 1VRVA 5JQGA 1Q0SA 3PGMA 3FG9A 1USGA 1YO6A 5FA5A 3PJGA 4P3XA 4TTJA 3RB8A 1OX5A 1GCAA 1D1SA 2PZMA 2VUTA 2O8DA 4LSWA 4AJJA 1SKAA 5IF9A 5FWYA 4FFBA 1JEYB 4EPRA 3EIUA 1WMDA 2ORIA 2D4AA 4G89A 1C9YA 4O4JA 4B6OA 2FEPA 3Q8LA 2HSWA 3CG0A 5BN4A 3NRBA 2OYRA 2FFBA 3OWXA 2C00A 1IB0A 4NQZA 3RG8A 4BJ1A 4DC9A 1MH9A 2C2WA 2HQRA 2QRPA 3R3JA 4LMPA 4RIIA 3I01M 1LI4A 1LLQA 5HG0A 4WKBA 3AETB 4H15A 4NJMB 4YDQA 5LSAA 5SY4A 1LJLA 1QTQA 5FB3A 4P58A 5BXQC 5K0GA 1O95A 5K2OA 2IDMA 2VDOB 3KQOA 1W94A 2HK8A 3C1UA 5DX8A 1PO7A 5AOBA 2EBHX 2XGMA 2Z8YA 3PVCA 1TYCA 2PUTA 1TZKA 4X0EA 2RGWA 4TUYF 3ZDZB 5FBVB 5IH7A 1E9CA 2FUG1 1UFQA 3NM5A 3WYGA 2IPAB 3DZBA 4PW0A 4W5QA 4LRXA 3VRHA 2JBHA 1T2VA 4CKBB 4MCAA 3DE5X 4KRFA 1BD4A 4W5JA 1IY8A 2H92A 3T7EA 2WWIA 1SKYE 3KRTA 5LP6F 2HLPA 3H0KA 3SAJA 2I6QA 5INTA 1U7PA 3G23A 2WQZA 1SXPA 2JGKA 1ZNQO 4AG5A 1FW8A 4U9HS 4BNLA 1M5TA 1BCRB 3AM3A 2WAYA 3MCUA 4JYMA 1CJUC 3RW9A 2ALJA 3ZWVA 5LNK6 4R1QA 5L7TA 2VS1A 3IP3A 4G4GA 4EABA 4FP9A 5BOSB 3RAEC 2PSEA 5ALXA 4YP7A 4DJEC 1V9CA 3IO3A 4Q4HB 3URKA 1P17A 2VR1A 2AW3A 5AHRA 4YROA 1JIUA 4NATA 5FWAA 3T0GA 5A06A 2OP1A 2BGJA 2FAXA 4MARA 4GPIB 4HS9A 5KO2A 1CP3A 2REOA 2GXAA 3R2JA 2FXIA 3HSYA 4C3UA 4PYIA 4ARZB 5AICA 3RS0A 2E6UX 5IZCC 2FOXA 4YV0A 4MUIA 1IM5A 2VDMB 3HCDA 3ZLBA 2IIVA 1J22A 3D8TA 3VNQA 5F7JA 1U3TA 5HFNA 3ONFA 1DC5A 3VR0A 4DHEA 5JMWA 1P2FA 1QP7A 3ER8A 1N2OA 2NUAA 3KUUA 5DULA 3F73A 2ZYGA 5BSEA 5C2JB 1ZISA 5CTAA 3NWOA 1NUAA 2CC2A 4Q6BA 1TT7A 1UMDA 2I7VA 5GZ3A 3EQ2A 5EKTA 3CNNA 3EODA 1WF6A 4MPRA 2FZ5A 4MNTA 3DT8A 2PBFA 4Y7CA 1Y4UA 2JG3A 3VPAA 5F12A 3QVKA 4PTZA 2CLEB 1H6DA 1RXVA 2XGJA 2OHVA 2VUHB 3F74A 3KWLA 4Z0NA 4ZVSA 3KP1A 4IQFA 4YCDA 4AMGA 2G80A 2D1TA 5IKOA 3UT5B 3UW3A 4QJ4A 4G5XA 1CVIA 4OFXA 2VQDA 1F5NA 5JDCA 2ID4A 1WTAA 3DJFA 4CFSA 1JI3A 3HE3A 5LQCA 4CT0A 1ZD4A 1AZSC 4R1LA 4W8GA 3NFRA 3DCNA 4YAOA 3R7FA 3ZBUA 2DYKA 3KAPA 3ZCSA 1KP2A 3IEMA 5J2TB 3E9QA 4RIHA 4RLSA 1QYXA 3JVDA 3CA8A 3HA3A 3K8OE 3OZUA 1X9HA 5FJIA 1R10A 4G5HA 3TKLA 3CGWA 3WLEA 4DV4B 1I2ZA 3JQ9C 1Y8AA 3GUYA 1NG1A 4HYEA 3HUDA 3L7DA 4E15A 1Y81A 2Q8QA 4ITRC 2J48A 5ENDA 1ILEA 2RFLA 1O94D 3JZIA 3G3EA 3HO6A 3NONA 3ETEA 1EVLA 1BX1A 2HGSA 1PJ3A 2JIRA 4IH9A 1L3CA 4JT8A 1PDWA 4EY3A 3CZ9A 4A92A 3RVJA 2Y1LA 4PBSA 2P2DA 2GEDA 4QLOA 1I5RA 3Q9NA 2I78A 3ESBA 3PL1A 2VT2A 2XWPA 1NXQA 2HDNB 2J5XA 1S5PA 2VTEA 4D9KA 1NSFA 4DA8A 3LQ1A 1R4ZA 4BMPB 3QU9A 5CHEA 2R48A 1PNQA 4LHZA 4WKNA 1E63A 2E87A 2WF7A 4MEBA 4YLGA 2O2SA 3G8AA 1QE5A 4LX0A 1CZNA 2UUAB 3LC7O 4LDRA 1W85B 5LZ7A 3STTA 4LXXA 4M9SA 5EIBD 1VXOA 2QSYA 3N59A 7MDHA 4CHGA 3QM1A 4B4DA 5JXWA 4J0EA 4KG7A 3UB4A 2J7PD 2V5AA 5I3CA 3MBOA 3PQCA 4CIWA 2G9VA 2VP9A 4CKBA 1TC1A 2VNAA 3G5TA 3K0KA 1LS6A 4MUBA 2FZEA 3R9WA 2XJ9A 4PLHA 2BGNA 1CFZA 4CQNA 4RHUA 2VA8A 4ZOLF 3STVA 3WGTA 3KO8A 1PS9A 1AQYA 2XUKA 4UXJA 4OL0A 3PC3A 1VKRA 1G3QA 3JALB 3RG2A 1BS2A 3ANXA 3BGVA 3GX1A 3OHMA 2PSDA 3PNVA 4OYYA 1R88A 2FGKA 5BOSA 4LOHA 3INYA 2H5IA 2AJLI 2OB1A 5L53A 1AUQA 1S02A 2G1JA 4Q4HA 3AM1A 3W9YA 2ASEA 4UU7A 3FRJA 4LHVA 2KBFA 4LF5B 2LDBA 2H1FA 3EGCA 1QH1A 4NONA 4P7BA 2JBAB 5A6SB 3OEED 3QVXA 4J0QA 7YASA 1KFEB 3SSOA 3KZ1E 1SVNA 5DYGA 1R50A 1N2GA 4JHXA 4ARZA 5A1JA 2B3TA 1XCJA 4E0BA 1PFGA 1XXHE 2L69A 2FMTA 4C1BA 4K28A 3RRZA 1Q7RA 3MTEA 1M6EX 1ZN7A 4L16A 4P9NA 1TVCA 1XAJA 2TYSB 3SEQA 4OSOA 1GDTA 4QUHA 1LLFA 1CUGA 3VR3A 3OQOA 1ECFA 4MQBA 2DPYA 4WUVA 3P7MA 2C8VA 2UV8A 4XM0A 1UPXA 1WKVA 2YW9A 5G40A 2M9MA 2ZTUA 3EHDA 3K9BA 2Q2QA 4DQUA 2NUTB 4XB6B 1E2KA 4F11A 1B1CA 4ZYZA 1Z6QA 1CUXA 2O3RA 3EBOA 3E18A 4HDMB 4I08A 1QFZA 2IELA 1P61B 4REQB 4ZODA 5FV7A 2R8XA 4BC0A 4DGSA 4ACBA 2C5GA 4H7FA 5FPPA 3TW0A 2Z95A 4IL5A 3ZUPA 2GN8A 1L7BA 1TTPB 2HC9A 1FS4A 1SBNE 2PR7A 4G0ZA 1NI4B 1GXSA 4GOKA 3CC8A 3KVOA 5AUPB 2JIQA 3ZLTA 5IDXA 2WYIA 2G4LA 3RVKA 1LSUA 2UKDA 3QHAA 2R4UA 2VPXA 3EZXA 2GK6A 2WZBA 4NC9A 5DCWA 4IPTA 1AQUA 3IBSA 1PZMA 5J9FA 1A4IA 2OCGA 1UBKS 4GW3A 4G1UC 3CH5A 3W6UA 1KEEB 4K05A 4H1TA 1GUYA 2Y0CA 3R3XA 5ERYA 4K81B 2I54A 2F2TA 3BERA 4WK6A 4COKA 5ES4B 1ADYA 4LY0A 1NUSA 1C7ZA 5HK8A 2D5LA 5DT9A 3CUUA 1WHTB 3T95A 1KYXA 1A72A 1RJEA 5FQOA 4HEHA 1G20A 3JQFA 3NBMA 1RJWA 2C4UA 2QZPA 3PEUA 4REMA 1DC3A 1UDBA 2FSSA 3FJYA 3AEZA 4I9FA 3V8RA 3RS2A 4Q37A 3ULKA 4FC6A 2G4VA 4U5XA 2DXIA 3RUFA 2C2KA 2HBRA 3K9LA 2PMEA 1ZJ6A 4L3VA 1KDOA 5BURA 5KOHB 2WVHA 1N9ZA 4W5TA 5DXFA 3C6MA 1WP9A 1W85A 2NZXA 1JECA 4F4FA 1FC0A 1HYHA 1KVRA 1FRFS 1G42A 1PR0A 2IL1A 3WGQA 1JG1A 3BRQA 4XDZA 1UC8A 4R5MA 1ECPA 1VPDA 4BO2A 4URZR 1PE0A 2GRJA 3JY6A 5B1EA 2AWOA 3MYYA 1VE9A 3E1SA 1RQXA 3O47A 2B2CA 2JHGA 1CUJA 1FDWA 1FEZA 1ID8A 5ALUA 2DHRA 1G8JA 2V7QA 4MWEA 3GMTA 1BGVA 1Z4MA 2VHUA 3HKBA 4NZYA 1Z06A 1W581 2C8JA 4FN5A 2FX3A 2AG5A 4IVNA 4BE7B 1LFDB 3VTAA 5C5IA 4RXUA 3FBWA 3GJRA 5T41A 5A7HA 1Y37A 2BRUC 3JALA 1JIIA 4FHEA 1GZ4A 3FE2A 4AY6A 3VUEA 1MQ8B 4YRSA 1X1BA 3DT9A 3OAAA 3I12A 3HEMA 4KAXA 3LP8A 4O29A 1EE2A 5L4LA 1QJCA 3EZLA 3FYCA 5H9VA 4X8MA 1E2DA 1UT5A 3KAQA 4RF3A 1TNDA 4HZUB 4C89A 1BD3A 2JBAA 4FWBA 3ST7A 4DAOA 2YQ4A 1KYVA 1CR4A 1YVDA 2C9DA 2Q6TA 3BD6A 4FDMA 4LAFA 3VPDA 1DHRA 2JHFA 2YINC 5JFTA 2VN8A 3EXG1 2J0SA 5JARA 5CCBA 4IIVA 2SHKA 2H29A 3DQPA 4C4TA 5F98A 3BWBA 3AFNA 3NBAA 2VSYA 3SN6A 1DC4A 5ESWA 2AJCA 2G9UA 3QW2A 5AJWA 2A5JA 2A0WA 1QE3A 3SKYA 4EDFA 2FP4B 1SHLA 2AEEA 1MV8A 5ALGA 4AS2A 2JASA 3CS3A 2ZQZA 4KSBA 4LJRA 3MK31 1NULA 3AHDA 4O4IB 4RTNA 2W6ZA 1CY7A 3F7OA 5JBNA 1BVUA 1Y4AE 1ZRSA 1TIBA 2Z57A 4G9BA 4RUKA 2QTAA 2I87A 1Z0KA 1J06A 3FVTA 3DP9A 4YECA 1UQRA 2X9NA 4EF4A 4DB4A 2D7JA 2R1VB 3D7SA 3FMGA 3FMFA 1H5QA 3LKDA 3R0XA 3SJBA 3UHFA 2G28A 1GQOA 2B4KA 1OXBB 1QIDA 1NMQA 1AKEA 3ECCA 4JDUA 1GQYA 1KNXA 3BGDA 3HVUA 4REQA 2ZIWB 3WWOA 3NHKA 2AYYA 1AGRA 3OP4A 1Y3HA 2GAIA 1QIHA 1KEZA 4NMHA 4EPVA 2HW8A 1Y6GA 1JP7A 1NI4A 4L5AA 2J4DA 4ZI7B 2PMWB 4I50B 5F5XA 3JWHA 3IOBA 2XYGA 1GL7A 2I2XB 4Z54A 3W1VA 1JR2A 4KR6A 1Y9ZA 3O94A 1EB9A 1N4DA 5SV2A 3GJ6A 5ADUS 421PA 2Y1GA 2PT9A 1R0RE 5BPHA 2DPHA 2AYXA 2GD1O 4UXHA 3U4GA 4DLSA 1HDZA 3PPIA 1IVYA 4HB0A 1ORRA 4KFSA 1KEEA 4WTOA 3AGPA 4YRGA 4RSGA 4WOCA 2XY4A 3DZHA 1WVMA 4WJKB 3COPA 2I6XA 3GQBB 2QLFA 3TTUA 5HOEA 2AOXA 2VP2A 1IN8A 2FJUA 3V6LA 3WYCA 3U3XA 1NIPA 4Y6PA 2P0EA 4ESVA 1XMQB 1PT7A 4AP6A 4CQLB 2P79A 3RIEA 4B6QA 2JLXA 4TWBA 3RHFA 1OC2A 3PDJA 5JCOC 5I3ZA 4DKJA 2HJHA 3WA7A 1AK9A 2FY8A 1YRYE 1Z3CA 2C5HA 3HL4A 5CT9A 5DGDA 3A4IA 2ZDQA 1R6XA 3Q10A 5AKGA 3TZHA 3AU9A 4RJTA 3P2KA 2Q1YA 3SICE 3VX3A 2EFYA 3VNRA 1RAAA 4HGYA 4LZJA 2A9JA 1G21B 4LCBA 1RYBA 4M9UA 3UGQA 3L8EA 2UDPA 4E1VA 1NBMD 3MZ0A 4DEXA 1DG1G 2QXTA 3OIGA 3OX3A 3R3HA 4AXXA 4NBUA 4A0HA 4X8OA 1HYEA 1MIHA 3NBUA 4RS3A 3QBJA 5DBGA 2O5CA 5IARA 3ND6A 2NO9A 4OTZA 1JFSA 2XGGA 4HLQB 4TLLB 3WAKA 3GLIB 4LC0A 3D6TB 5J43A 1V37A 3LBYA 4KLAA 3K0AB 1C1DA 1G3UA 1Z0UA 1KERA 1R4MB 4JKOA 2E1RA 4NRDA 4P4GA 1M2WA 1DO2A 4CF6A 2YJ5A 2C59A 2QR5A 3RO7A 3G6WA 3ADBA 2CMHA 1BXZA 4X8HA 2X7HA 3DOUA 1HH4A 2OBNA 2XCOA 2H1WA 3A4TA 3AILA 4D9CA 4EA9A 5AJHA 3B3AA 3DKRA 5ALJA 2XCRB 4EHDA 1ACJA 3ZEIA 3BCUA 4IVQA 4A73A 3O95A 4JLSA 3PDCA 4HZUA 3AFGA 2FWBA 1HXHA 3KUKA 3PZBA 3TCKA 5EUBA 1Y5LA 2EFEB 4HO1X 4LRSB 4KTVE 3GCZA 2ZTMA 2HA5A 2WNIA 1D09A 2X8WA 3Q40A 2VH5R 4LSMA 3E9EA 3NHFA 2QTMA 4RDHA 2H7VA 1RAEA 2HJSA 1WR8A 2JCXA 1NZDA 1JAHA 4WT7A 2R6JA 3PDWA 4C7XA 1TTQB 3R3WA 3U5TA 5J5VA 2I67A 1XZNA 5HNKA 5DM70 2X2PA 3ZCPA 4MV8A 4ZREA 3PGJA 4O4IA 4R0NA 4EGAA 3A3OA 1BHSA 2VJOA 1CE8B 3C5HA 1Z25A 1B15A 3R5JA 4KQCA 5JZOA 5L51A 3QKUA 1EM8A 4KB5A 2VTBB 1HEYA 2FCAA 5JAUA 2YVLA 2YHIB 3MYRA 4K8RB 4TV8F 2Q2NA 3FWNA 1VRWA 1E0KA 4A0FA 1PGOA 4CN8A 2BD0A 4X65B 1LVGA 2JDID 3V4PB 7GPBA 3NOQA 1BEUB 4MV4A 4GAEA 2GJ9A 2WKQA 3I8XA 4M55A 4OFBA 4MCHA 3NHLA 3NYIA 4W63A 3DE4X 2NXEA 4RORA 3BTUA 1WSBA 5DIZA 5EPEA 3KVNA 4MVJM 3SPXA 1QYCA 2CBXA 1HDEA 5IC6A 4O2BB 3RK4A 3KG2A 4RVCA 5C5DA 1P80A 1Q0LA 1LRKA 3M7IA 2E6KA 3VH2A 2EQBA 2WM3A 4O02B 3D43A 5CJJA 2BMJA 4JBGA 4I50A 3BKXA 4LCEA 2C4HA 1IJBA 1JN0A 4WLVA 3LBNA 4KACA 4DT1B 4HVCA 4PCUA 4IILA 1NRWA 2IVFA 5K01A 3AIMA 4ERNA 2J45A 4YMTA 4NPAA 3MXOA 4A8JC 2CNKA 2FRXA 4TLEA 3JD4A 4OREX 1VYHA 2P5SA 4MX8A 4TZKA 5DNCA 1H0RA 1JSZA 1DTWB 4RYDA 5ITVA 3OMLA 1ZM3A 3WKEA 1BE1A 5CCDA 1F3OA 2HB6A 3F47A 3ZU4A 1NW4A 2JIMA 4IF6A 4ITVA 3PC4A 1T43A 1GLGA 3RGGA 3JAMA 3KBOA 1LWOA 4HVAA 3AQIA 2QJRA 4UATA 5A4KA 2WPDD 4MS3B 4OKIA 4PX2A 5JSKA 5CFMA 1M5RA 1P2GA 4BBPA 3VFDA 3ZDRA 1XDUA 3NVDA 5FI3A 4HRYA 4COOA 1EQUA 4CQLA 2WU0A 2GN2A 5TMEA 3LVBA 3TD9A 1QF9A 3M70A 4CNQA 5E2BA 2Z6QA 1E5DA 3PXCX 3KFVA 4O4HA 3QWHA 3C8DA 5J40A 3S7TA 3HXOA 2IZ5A 3NS7A 2AI2A 1N2BA 2NPOA 4Z8XA 2R5FA 3VPFA 4ZCTA 3CTPA 2LDXA 3S2SA 1Q1GA 4OL9A 4N01A 2BH9A 1YR7A 4IS2A 4MW4A 5FPYA 2XITA 3R7AA 3TBHA 2QPLA 2OV3A 4IHQA 5M04A 1G21A 1KO1A 2FMIA 2PTGA 3IJPA 5EHNA 4DDMA 1US8B 2FPIA 1QG0A 3LWDA 1IUKA 1WPRA 4XI9A 1G1MA 4XWOA 5AMXA 3CXRA 3O4GA 4RKEA 2Q6VA 5TT0A 2XZTA 3SC2B 3HL0A 4CKYA 1XAHA 5IS2A 1N2SA 4DIDA 4PX3A 4WNAB 1OH5A 4V39A 5JDIA 1P1CA 3HS3A 3IUNA 2WE7A 2LKCA 1Q91A 3NXSA 3R5TA 1GRCA 4PINA 3L9WA 4XJTA 3H87A 3UMFA 4X66B 5JNSA 1QG4A 1D3AA 1Z5VA 3LECA 3LHKA 3II6X 2P2GA 4DLRA 1WDWB 2PAFA 1R4MA 1XMXA 2PTHA 3FNEA 4Q01A 2Z5VA 3W6NA 4C06A 1UP6A 3SXJA 3QX8A 1R6BX 4I7EA 1CDDA 5IT9A 3A10A 4NE7A 3WDLA 2WJ4A 2AK2A 3BN3A 3HM2A 4FGWA 4FILA 2ZI9A 3ZW9A 2YQ5A 5K3OA 3ITNA 4LRWA 4BASA 1ZXLA 3N0XA 3M9XA 5LU8A 3AJ8A 5TVKA 3IDAA 5K99A 1R9MA 1ULZA 2FPLA 1FX0B 3IEIA 5D3ZA 3BHMA 5FO0A 4AUEA 3TF5A 4ARIA 3WJ7A 2AN1A 4G63A 4R9VA 1OW3B 4LJYA 3GFPA 1WL8A 4I1OA 1JFFA 4O4LF 4OO3A 4QA9A 4KOEC 3VNBA 2RJ3A 4HQNA 4IJ6A 2B36A 4DA0A 4G5SA 2CJFA 1ZCJA 1WCXA 2COEA 3JZFA 4H1WA 5UKDA 4N0EA 2HREA 1E3MA 5DU2A 2UVPB 3TOVA 1KIMA 3FUTA 3GAMA 1V48A 1Q16A 3KQVA 4QQKA 1IK6A 4WXYB 1IBRA 4ENSA 2FR8C 2GWHA 1C3JA 1OZHA 1DCFA 1XQ1A 2LWIA 2OGSA 1CE8A 4GSKA 1F8YA 2Z2KA 4FB4A 2J5BA 4P1ZA 2ZXUA 5HJ7A 3HPRA 1M34B 4Q3NA 1C8KA 4GVXA 1MT0A 1RM0A 4YUVA 3TR5A 2PZFA 4C14A 1NU8A 1G8PA 1OB5A 3OEYA 2PZLA 5HF9A 4EB6B 3PWKA 3CEJA 1SUDA 5YASA 5FLYA 1C9KA 2I8LA 4UJ5A 2J6BA 1R37A 3OESA 3A9VA 1AG9A 5CT4A 1L5QA 4CEJA 1LA2A 1U0RA 3H4MA 1ZMRA 1R16A 1JX6A 1GG5A 1MR3F 3DEYX 4D0GA 3QUAA 5CIQA 2ONYA 4PLZA 4PONA 1L4BA 1N8NA 5DBFA 1V3QE 2C58A 3NWBA 1TCUA 4DSUA 3M9WA 3AI3A 1NM5C 1T5SA 1Q1ZA 4MKFA 3UQYS 2EZ8A 4XZ3A 1CEEA 2M98A 1ECGA 5COBA 4Z1MA 2WY2D 3LYAA 1V26A 3RRMA 2JIBA 4G81A 4QQFA 1U2ZA 3WLJA 3T1HB 1P6XA 1YZTA 5FI0B 2YFHA 4JLMA 4ZEXA 4BJ6A 1AS3A 2H63A 4MS3A 3L2OB 4TROA 1X1RA 1NZFA 1P7WA 3J80A 4H6VA 2EF0A 1O08A 5EP3A 2ZEJA 2IBTA 1NI5A 3INRA 3DMYA 5E6UA 2Q7OE 3ZDYB 3BPSA 3J81A 1Y1TA 2OGUA 3D1JA 4NDAA 4WKOA 5DHTA 3SLKA 3MQ4A 3FTNA 5KCMA 5JNWA 1FZTA 2WMNB 3DMTC 2YJ3A 2LUOA 3L1HA 1D8TA 3SF0A 4JJAA 3OC0A 1M6VA 2B25A 2CXNA 4CGZA 4EO7A 5K0CA 2YVQA 1V47A 3WFZA 3KE8A 4ZYWA 1W0JD 2BELA 2FZCA 1Z2CA 2EGUA 2WAAA 2Z5FA 3GRAA 3ETDA 3LHSA 1T9HA 5AI4A 4DWWA 5BWBA 3MFYA 5E0KB 1JR3E 3KR0A 3BCRA 3FTFA 1MT3A 3STWA 3L05A 1I94B 4OK3A 4V2UA 5BQFA 5TPZD 3RKSA 1Z36A 2I2CA 1Y9JA 3RYIA 4JWKA 4Y30A 4QXQA 5ILGA 3GW8A 1HPLA 4LDZA 4WNAA 4QDJA 2H4XA 3WYAA 1IZ7A 1X3SA 1NLMA 2DPMA 4P3NA 4EKDA 5TV2A 3OBIA 4EKEA 3DLBA 2B6HA 2HWUA 1OZ0A 3KYBA 2ERYA 1W0JA 4HGOA 4JVOA 5ERGB 1K1EA 4XCXA 4F9TA 1CRZA 3FUWA 1IBMB 2J07A 4KUHA 3DPIA 5AKLA 4MCIA 2QP4A 3P4YA 4GMFA 4V03A 5DBIA 4WDQA 4YRKA 3L4BC 1HTBA 3HUTA 4IIJA 4INOA 1SBHA 2ZWAA 5DGXA 2ZUFA 4KK3A 2P90A 4KXNA 2G70A 1SCKA 5JSUA 1L9KA 3IUPA 3ONWA 3OZVA 3BH0A 1NTRA 4LVNA 4S1VA 4AY5A 3OJFA 1C0EA 5CXXA 4LYYA 5EY5B 3RRBA 4B2IA 3D9QX 5AIBA 2IEIA 3PD1A 3GBPA 3PFHA 4WI1A 1AA9A 4LF9B 2JCGA 4CBVA 1UC5B 2X1LA 3E2MA 4B4WA 1E1KA 2VNKA 2E2WA 4YRMA 3G2KA 3TINA 1HDYA 3LPLA 1U6IA 2UVPA 1Q0PA 3Q12A 3WGGA 1R74A 1MRNA 4HWKA 5FA6A 3KQNA 2FUNB 1OT3A 1E5LA 4A4DA 3D0QA 4R8VA 4GXQA 3TZCA 4PSAA 1Z33A 3PEFA 4D9BA 1J8MF 5FBWB 3T3EA 1T1SA 1B42A 2B83A 4A27A 2R9VA 3BULA 4M1WA 1M34A 3EBLA 4L28A 3QLVA 5EIWA 2XNKA 2BC9A 1OXUA 3R8CA 5GMOA 4OUDA 2XUDA 1YQTA 1ZH2A 1TJNA 4ZWNA 1DBSA 4QDOA 3GLRA 3LIIA 4EB6A 5L3ZA 4DUZB 4FEGA 3VMFA 3P97A 3O3OB 1O58A 2AD1A 3V2IA 4BMXA 1Z5WA 3B6MA 3C1OA 2G8LA 4LWOA 4PAMA 4CV3A 4ZEWA 4HBZA 2DJ5A 2YRFA 2QM3A 4KE9A 4MQUA 1IOVA 1XVTA 1S3FA 2X2OA 2AE2A 1E3LA 2HIGA 3DMPA 1E4EA 4WZAA 2YWEA 3UK6A 3E4CA 2Y1FA 1KXJA 4KWCA 1ZGAA 4Q7JB 2WWXA 2C5BA 1LV7A 1BDJA 1JHUA 2HHLA 3GEHA 3OU6A 3C3WA 2XPCA 4NOLA 1AK2A 5KSPA 1AH2A 2WKPA 1VECA 3K9HA 1T5OA 1W44A 4MUEA 4G0YA 5E7MA 5GV8A 3R3UA 1KEKA 4M3NA 3A0RB 2EWMA 1K4MA 3HRHA 5BT9A 2B0JA 1GSIA 1K5PA 1PDOA 4RBNA 1N5LA 4E22A 1OASA 3GFRA 4O2AA 4RGYA 3AESB 3N1UA 1J97A 2WINI 1I7NA 1QYVA 2BEWB 3HZHA 3HYNA 2I66A 4TWZA 1NTOA 1QKIA 1LX6A 2Q27A 3FN4A 3SGLA 3SZ3A 3QE9Y 2IYNA 4TT3D 3R74A 4YUXA 2NMVA 3EDMA 1IY9A 2M6RA 1I3MA 1X1SA 2MWMA 4WZBB 1QRDA 3QKSA 3IQZA 3NP7A 5CH5A 1XJ5A 1L5LA 3MGGA 4KOAA 4R3UC 2MINA 5FI1B 1ZBQA 4F97A 1MABB 1RBMA 2JH3A 1JHVA 3UC5A 5EE0A 1DINA 2PX0A 1GDDA 3DM5A 3GPIA 1Z7EA 5D84A 3MINA 3UKOA 2PVSA 5JS2A 5CRIA 4PRZA 4B31A 4CMGA 4MGIR 2NZWA 2VSQA 4NXMB 3NYQA 2W4IA 3NC1C 1WZEA 1Y8QA 4NFLA 3K1ZA 5IDVA 2ZU0C 3RYCA 1T24A 4TT3A 5JLAA 1PV2A 4H3VA 1HMPA 4MTLA 4LZZA 2ATIA 3FRIA 3LXUX 3VR5A 1B14A 1UBOS 2GD6A 2BTOA 3GMDA 3HFRA 3I6QA 4Z9AA 4BGIA 5KSWB 2WI8A 3PZRA 4ATNA 4ID3A 1Z26A 1DG9A 3PPWA 2BDTA 5A3SA 2NXWA 2D2XA 2ZSUA 3BJIC 3FZNA 5EJGA 4Y8VA 2O48X 4I14A 1IH8A 1AS0A 2ECKA 3O84A 3WQBA 3IQFA 5LOVF 3IIJA 1YI0A 3PT5A 2XA9A 1UL1X 5B3JC 3CX4A 4DR3B 3A4LA 4ASUA 1DO0A 3ABQB 4LXIA 1D8AA 3NPMA 2HRDA 1COZA 4JL6A 1WSWA 1NGSA 2ZIFA 4X6UA 2HA3A 4YDHB 5LKRA 2G77B 5F7XA 4NMLA 1QANA 4JC8A 2BM1A 5K0TA 1IXKA 1ENOA 3HI6A 2CSUA 2NV0A 4UPVA 1GCIA 5DYYA 3U37A 4BNFA 5CA1A 1JEOA 2DEUA 3E7WA 1PWXA 4EG3A 3CLUD 1KK1A 1J5EB 4LTDA 1EZ4A 2IUFA 4FZ3A 4Z49A 1XKTA 5CB6A 1LSJA 2HA4A 5BQ5A 3RCBA 2W0SA 2HSJA 2XADA 4ISBA 1WB5A 5AIAA 3TNYA 2PG3A 5KAMA 4Y0VA 1J0CA 4U2DA 1RWXA 2CF6A 4PFKA 2A57A 2IDZA 3OFKA 1IAQA 4NICA 2W8BB 1TEVA 5BWCA 1BC5A 1J9GA 1D1PA 3D59A 3MVEA 1X8LA 2CL0X 4V0KA 4OU5A 1FRNA 4U6NA 3U4QB 4Q4CA 1HSZA 4ZT3A 4E13A 4YIKA 3L06A 1NVWQ 2MDTA 2YOFA 3OM9A 2H00A 1VDZA 1Z4JA 2QMZA 2ZATA 4BV9A 4PYJA 2XLBA 4QOHA 4QAQA 1R8JA 3CCBA 3LO8A 3HJFA 4UBJA 3OOHA 4WOPA 2K87A 3NVAA 4UNQA 2XW6A 1QIJA 3LSTA 3WK8A 2FU5C 2V55B 4DG5A 1N0IA 1UK8A 2C82A 3E7XA 3HUEA 3BXOA 3TQIA 4GX5A 3UJBA 1CDOA 3AVQA 1DC8A 2JJ8A 1QBGA 5A9SA 5BR4A 2ZREA 4ETWA 4CTKA 3PHJA 1M1XB 4G85A 4NU0A 2Q41A 4HAYA 3A6HA 5AVSA 1Z74A 4J3NA 1URPA 2WTAA 3ZPXA 3H6GA 1IXSB 1M8PA 4RA9A 2NUBA 3FPCA 1Y7LA 3BDAA 4P3YA 4S1PA 1VHJA 2MTBA 3SYTA 1U7UA 2CJXA 4YV2A 1B73A 3EYAA 1RI5A 4RZ3A 3IQDB 3KYDA 4CR7A 4JLUA 5TY0A 1KI6B 2E48A 3TLXA 1LX7A 4WOKA 5JV5A 2FFRA 1GUAA 2FHSA 1ODJA 3EAGA 5CB4F 1N7IA 1N0UA 3EGDA 4CKCB 3AESA 2BEWA 4F9GA 2BFDB 4GR9A 5CDGA 3PLAE 5BSGA 3WKAA 4JI2B 5EE3A 1RQNA 1IC6A 1W1IA 2Z58A 3CNLA 2ZYSA 4YJKA 1S4QA 3QU5A 3VJKA 5ALEA 4TMTA 1QIIA 3T7KA 3ZCVA 4EZEA 5JYCA 1XNRB 1RXYA 4QVIA 1ZGZA 2I55A 3I37X 1TZCA 1YE8A 4MV3A 5AVRA 2G67A 4Q9JA 1HNXB 2GJKA 3G2NA 3OM8A 1UINA 1VJ5A 4MULA 3V1KA 4E5NA 4F1KA 3RBXA 3B13B 1F2TB 3KJXA 2QRVA 1G9XA 4OKNA 3L18A 1RWWA 2FW0A 3WNCA 2QXYA 1DRVA 2AC4A 3DLCA 3H5VA 3UMJA 1E2UA 1OIXA 1XTPA 4XJSA 1OAOC 5BOVA 5IKMA 3AUKA 4KN8A 4HHEA 5ICCA 1JLMA 2BF4A 2YXNA 3E9ZA 1G6HA 2PANA 3P9RA 4KCGA 1JT2A 3V34A 1KZ4A 3TJRA 4KP7A 3O4FA 4L7VA 4EFDA 1HR0B 5EL0A 5DK4A 4NFSA 5EXXA 4RKRA 1J0XO 1LQUA 3MMPA 1E1MA 4H7KA 4U7PB 4ZC1A 2EX0A 2C2MA 1JPNA 1G3IA 3FFAA 3PXUA 5HBRA 3QEBZ 4AMBA 2BMVA 5G0UA 3G9TA 4GDFA 3O83A 5AFSA 4LN1A 4MP6A 5FKJA 1M8KA 3M6XA 4G1EB 3EWIA 1FNDA 3DAYA 3ESQA 1T3TA 1I7PA 1OGIA 3I05A 2A9QA 4TZTA 1V1MB 1H05A 5DBOA 3RUHA 2TMYA 1NVFA 5AVVA 1NT4A 3U44B 1W7AA 3UKJA 1UXHA 2QD2A 1ZSNA 3O6VA 4EPXA 2IYQA 3EXIB 3K96A 4IMPA 4KLCA 1IRIA 4EHBA 1FQWA 4ANFA 1UM8A 2FP3A 4HZIA 1T8WA 1W0CA 2L17A 3I92A 3NNDA 2PV0A 2A94A 3L0PA 3LFTA 3KXLA 4MO9A 2ORWA 3G5AA 5E6SB 3Q6NA 1JQDA 1VBNA 2VWHA 4BECA 4NCAA 2ZVDA 3VZQA 3AUYA 1Q3HA 1XUOA 3RFFA 4DNPA 2CXOA 1SOUA 3NTLA 4KKXB 3SLRA 2I71A 4J1QA 3K0CA 3E6AA 3TEFA 1M0SA 1BA2A 2J5KA 1BQ3A 4EMUA 1H94A 1YC2A 4O3FA 3T0IA 5D3QA 5JVDF 1EWYA 3CRQA 3PWSA 4GUAA 3O38A 1E5XA 1KWGA 4MR7B 1CQXA 1WV1A 1VSUA 1IQ0A 2QAGA 3I6YA 3MMSA 3MWEA 4FWTA 4R1UA 5F51A 1XK6A 3R9KA 2ACKA 2VYVD 1A2QA 2XVAA 3GZNB 4PO8A 4X3CA 1AHPA 3FOEC 1SD5A 3FNIA 1SPXA 1NR1A 4FJ1A 1EPUA 4DLKA 3DHVA 3ZNOA 3WRYC 1XTVA 5LZ9A 1G7CA 1PSDA 1SG9A 2KM1A 5B55A 1T91A 2IYFA 4NAVA 4W4TA 5KHAA 4BGVA 4P54A 2OBBA 4EJSC 4Z4FA 2J32A 4NL4H 4ZVUA 3E2IA 3GLSA 3DAHA 4LSZA 4BP1A 2ZFUA 3MRVA 1DQNA 1DAEA 3UOGA 2HCBA 4LMAA 2PXAA 4D26A 4N7JA 4P81A 4ITUA 1H2FA 2HF7A 3CZ5A 3HVJA 3RUCA 3WJAA 3FUXA 3EFHA 4R83A 2PFKA 2O3JA 2YJGA 2Q3EA 3U4AA 4UM9B 3N9IA 2YWGA 5JCJD 1F8GA 1SC6A 1CDZA 2R86A 4K6GA 3T35A 1WULS 4J1NA 4CKCA 3L1JA 1U1FA 2WHXA 4L8VA 3BDVA 4DIOA 4IJUA 4I4CA 2YN2A 1G5QA 5IVDA 1NJSA 3A1SA 3M4XA 2HSGA 3DDUA 1UAYA 4X1YA 2E1PA 5ALMA 1F9AA 4C76A 4F12A 3TQCA 3FA2A 2FPKA 4MPPA 4QUAA 2YJNA 3IOCA 1XQ9A 1AD2A 2GASA 3KFLA 3OQIB 4LQDA 3IURA 3ODGA 4QFDA 4C7BA 4EGSA 4GNRA 1P0CA 1GAQA 3B36A 4GM0A 5JCJA 3IBYA 2JI7A 3ET5A 4UDNA 1W2HA 3ANLA 4IRMA 5GJWC 3NJRA 3V00A 4KXWA 5G0WA 3GJSA 4KQMA 2J30A 5KCZA 3KM0A 3ZHVA 1NI3A 1J5XA 4OHMA 1G8MA 1MH1A 16PKA 4PZLA 1T9CA 1S4MA 2I80A 3CBQA 1SC4A 3M33A 4KMOA 1UBSB 3GLTA 2XVYA 3U4IA 2PU5A 4GI1A 1PT6A 3G88A 1BGXT 1THMA 1YZQA 3AM4A 4E7OA 1FJGB 4L72A 1GPH1 1Z0SA 1XZQA 2JFOA 1R5BA 1YSCA 3DWGA 3VZPA 4B35A 5HZHA 4OK5A 1G5RA 1TW2A 1ORIA 2C2HA 4DPKA 1UT8A 2ID7A 2FSGA 2JS7A 3AZPA 3QLEA 1ULTA 2PFGA 4EGCB 3KZMA 2ZJ8A 3H2BA 2VDRB 4WCVA 3P32A 5EYPB 1EU1A 5JOQA 1E59A 2XEXA 2Q07A 2CNDA 4UAVA 1YCHA 2CHGA 4R3NA 1Q0RA 3QJYA 3GGPA 4GI5A 2BI4A 2C83A 3AO0B 1NLUA 4OB6A 5HMLA 5CA0F 3T9CA 4D56A 2CBZA 1MLDA 3Q3CA 4BFTA 1SXJE 1MTZA 4RVSA 3F9CA 5C4GB 2OXIA 5CDSA 4C20A 5IAOA 4UHKA 2GHQA 3NOXA 5E6SA 1BJKA 3NZEA 5AM2A 1Q84A 2GPYA 2COKA 3QOXA 3RFVA 3S44A 1LBIA 3E58A 4JBLA 1WW3A 4L3OA 2CXQA 3SM3A 1SXQA 3HXPA 1XCLA 4Z9XA 1WZUA 4HX5A 3VHLB 3M81A 1FQJA 3I28A 5LQSA 4M0LA 3WO0A 5KNBA 1N6IA 2XUIA 3V8MA 4OHBA 4IM7A 5IJ9A 4WIAA 1M1YE 5IXJA 1ZK3A 3KLMX 4NS4A 3GVPA 4XUGB 2DUMA 4DMCA 4MR7A 2RIRA 1EUDA 2W6IA 5JAHA 2VH1A 3U1BA 4LZAA 2C3UA 1H3NA 4LC1A 5B5SA 1W9HA 4GZMA 4FYHA 4X92A 3SJCA 4PO1A 3EW9A 3QWIA 4KQEA 3EPKA 2H2GA 2C9BA 3A9TA 2EGHA 3GUVA 2RH4A 2H2WA 4UM9D 2GKOA 1KYZA 1REQB 4WEOA 4B6EA 5KYYB 3UAOA 4GLOA 2BMDA 2HMSA 2I2WA 4BEJA 1FFSA 3H1AA 4C08A 2ZKIA 4M8LA 1IXRC 1GD1O 2DCUA 4QQNA 4PLVA 1NVKA 2I7XA 3U7QA 1KKLA 4PG4A 2RMKA 5AHOA 1RAGA 3ECAA 4E3WA 2R25B 2G72A 2PBRA 3TZKA 3DAPA 1PT9A 3NM4A 2PEYA 4G0QA 3ETJA 1FNCA 1RVV1 4L2IA 2CMKA 3DOEA 5IBQA 1AGXA 4AJNA 4D5GA 3WK9A 5FD8A 1UEJA 4N0DA 1QQ5A 3GEEA 3HZZA 5FLKA 4M86A 1EZZA 4Q1DA 1D0IA 4Y2PA 3DULA 2PGXA 3FFXA 1O03A 4B4VA 1IHYA 1W2GA 4EK9A 4ZCQA 5DFAA 3ZQJA 5JTTA 1I7SB 1Q11A 4NHEA 3MGAA 1Z13A 2PJRA 4IZHA 3KU4A 1TK3A 1SCAA 4L4YA 3BORA 3W2TA 5AW5A 3C3EA 5DX0A 2KYRA 4FBMA 5BP7A 2PPLA 3P2JA 3Q6IA 1V9LA 1CV2A 2QENA 4RHTA 4XSGA 5HFJA 2OORC 4EATA 3PXGA 4HKTA 4MKRA 3GLIE 3EGXA 3OQIA 2XRYA 4OU4A 2IXGA 2OO5C 5HF5A 5HQTA 2NSYA 4B71A 2ZZMA 2DBVO 2M32A 2XVXA 3O1HB 2G1PA 2XA1A 3A9WA 3FPEA 2ZYHA 2I1LA 4XWYA 3PNPA 2DQYA 3TR6A 4C5BA 3EXFB 1O1YA 4HAVA 1ESDA 3FPAA 1Y3DE 4QEZA 1WY5A 3C87A 5A9TA 5A6VA 3JR3A 4N5LA 3ZHTA 1YMUA 3BL6A 5K3DA 1FFAA 1T1JA 2PKWA 4WX2B 1VZ3A 1IQRA 2OQRA 3IUEA 3L7NA 4AJ4A 4F8JA 3WIDA 3KKZA 4LXHA 3JRWA 4RZHA 4YPOA 4QBGB 5B7NA 3OLZA 3M5CA 4PPFA 1CUFA 2Q1UA 3DQQA 3VVCA 3IO5A 5TGZA 1FQKA 5AW9A 4LDNA 2BM9A 4MICA 5MGBA 4B3RB 2Q5OA 4FCWA 3NT4A 2PGOA 1A77A 1YZHA 2G5CA 2QGZA 1RYEA 2PYIA 1N6NA 3N2EA 3GV0A 2AOUA 2DFKB 4YVFA 1KK2A 4I3HA 3T6KA 2TMKA 3VV3A 3F6SA 2GNOA 2I3AA 5K05A 1DBVO 2JVIA 1SVLA 1JKMA 2P2ZA 3QW4B 4QUGA 4X1OA 4KITB 3DCIA 2CEAA 3D1LA 2NU8B 2X8JA 3K8YA 1RPNA 5BRNA 5KI6A 3LQFA 1D2CA 3NTXA 3LUAA 4KQGA 3GJ5A 4V3CA 5CH3A 3ZS8A 5B30A 4JYZA 2X77A 4LDAA 1VOTA 3HUUA 1JS1X 2Z1DA 3F2VA 3P0FA 4KE7A 5LM3A 3TOCA 4DJTA 1CUAA 4TUYA 3O9ZA 1CRWG 3LY5A 3PI7A 3KEGA 4QT0A 5IXSA 1I4TD 1QXSA 2IOHA 1FSZA 5ALYA 5AKZA 1V5WA 4ZAVA 1P4GA 2AXQA 2HXGA 4BFXA 4CV0A 1PVOA 3HACA 4NS1A 3M1YA 4FDUA 1N2IA 2QQGA 4EEKA 5LP6A 4YT8A 4A6XA 3DO8A 1MX1A 1GUZA 2ES4A 5IUKC 3UANA 4EA6A 3RLIA 5LQAA 4MP3A 1IPHA 1KL7A 1K7XB 2FX5A 2K6GA 4FYWA 5GONF 3WGIA 4X7BA 4H7DA 4HAOA 4HSEA 4W7SA 4RD0A 1H5UA 2OHFA 4GE0A 1GAWA 2FYTA 4UTNA 3KKEA 5K8JB 5TQVA 3PFNA 2BBSA 1BH2A 1REQA 1UQUA 1D2NA 1E3WA 1RI3A 3DE1X 2Z2ZA 1TAUA 1XZMA 5AVYA 3BCSA 5DT2A 4C0HA 3OC6A 1WETA 5EMKA 3FWHA 4J0CA 4F60A 4BO5A 2WUFA 3RWBA 1IJFA 3ZDQA 2J41A 2QRLA 4EG5A 3VYRB 4BO6A 1ZL2A 3UWPA 1DARA 2JF0A 1O0BA 1WNTA 3FPLA 4D4IA 1OLXA 1T13A 1SHZA 3MFQA 2X0DA 2BGWA 2PH5A 1ONSA 2FE1A 1N5OX 1X7HA 3THWA 1QR6A 2VJQA 2GXUA 5LP1A 4I36A 4K9OA 1HMYA 1MBZA 4M8IA 4JP1A 2O3QA 3VH3A 3H04A 2A5DA 3KAJA 1KZGB 1LNZA 3F6RA 5EZ6B 3RS5A 3SLGA 2SNIE 4G5FA 1MOPA 5M29A 2I6GA 4UEOA 4TVBA 5EP4A 1JHPA 5JI2E 1GVNB 2O8EB 1X1QA 2C7OA 3A28A 5ALRA 2O54A 1JFRA 1Y63A 3ESZA 4ICIA 1XTUA 3BFVA 3GIWA 2IUSA 4C87A 3V8VA 4MWDA 2OR3A 2WAMA 1GILA 5FLEX 1NVBA 2V7PA 1CY1A 1Y8CA 4KDCA 1ESMA 4MGEA 3K32A 5FTLA 2DQSA 1T1GA 4N5MA 4A7PA 2IE0A 2QLLA 2GD0A 4LPSA 5C8YF 1ZZEA 4JGIA 1UZUA 1GKUB 2IYXA 1NFRA 2ORYA 3BJMA 4JB8A 3PGXA 3NIFB 5EJFA 5H70A 3JWJA 4KPFC 2W2NA 3QUQA 5DNUA 1BXKA 3I9V1 2OG1A 3D8BA 4H08A 5KWJA 3DBVO 3PT9A 2AC7A 4IAOA 1U28C 1CEXA 5EHIA 3C5VA 4MQ6A 4TQUS 4QOGA 3BFXA 4CM4A 5IYZB 4OHPA 1Z9BA 4XLZA 3C8ZA 4Q0MA 4CF7A 1LY1A 4N7BA 1JSCA 2FPWA 1DBRA 3Q2KA 2GBCA 4KQJA 1NRJB 3QPBA 4ZVLA 4RK1A 2J6CA 4YRQA 2IXTA 4X8LA 3A58B 3ZGYA 3CLRD 1FYWA 4RABA 4ODIA 4G3XA 2IF0A 3DVRX 5E6RB 5CBPB 4NZ9A 1XT6A 2PLFA 1DAOA 4YP6A 1KVSA 2ONKA 3U3JA 1H8ED 1N5KA 1H0HA 4FB5A 2PUGA 4MVWA 5CK4A 2GZ3A 2NU8A 3F67A 4HLDA 3FW1A 2QF7A 3UMCA 1NX9A 2WJHA 4L8FA 5AUQA 3QYFA 4YPFA 5DM0A 4NBRA 1GGHA 3GARA 1DKUA 1KQFA 2AKYA 4HMQA 4ZMSA 2Z6UA 1P4HA 1EFRD 3PF8A 4N3BA 3PHGA 1FVXA 2XWBF 3IP8A 3KSDO 2WIFA 3Q5GA 1KJNA 4BQRA 1MDFA 1QTRA 3BWXA 5GVRA 1JFLA 1L7AA 2HQ1A 2PLWA 1DUVG 4UZSA 5EJ4A 2FPMA 2YFQA 4I55B 1NVXQ 1X7GA 2OHGA 1EFPA 1Z7WA 2ZITA 3RYTC 3VPSA 3MJFA 4UD2A 1H8EA 1DAHA 1MTOA 4DLXA 1V43A 1ZWKA 2KPOA 2HAEA 2V96A 4FMCF 2H9AA 4DV1B 4UKDA 2Q2WA 2GCGA 1BDBA 2JGLA 4PTLA 4ZOLA 3K0FB 1OBOA 4MGHA 4DHWA 1GEEA 2RGCA 3TRKA 2J3LA 4IX9A 1K8YB 3AW8A 1N9GA 2O50A 3F6YA 3BWEA 2ZR0A 3SXUA 3WLPA 4J0DA 4YJHA 4UULA 2VHCA 4ARBA 1TCBA 4L6IA 2GCOA 3THSA 4LG1A 4YQZA 1TMKA 3UJCA 5KWIA 5MFZA 2CZQA 3FOFC 2H4WA 4IYRA 3ELWA 1K98A 2NNLD 4DF3A 2FEXA 1BYUA 4Q1FA 3U80A 2XTMA 3RS8A 1VGQA 3WXBA 1AJEA 2P9HA 2WHEA 4AZ0B 1SR8A 2B99A 4R2JA 2KI5A 4OQDA 4DCMA 2UXDB 3Q7TA 4HD8A 4MR8B 2WQ6A 2JANA 1H23A 3PYXA 3UHOA 4LZWA 5I9NA 4JFRA 1GPAA 4FSHA 4MLCA 2XKAA 3V8QA 1SD2A 3JQCA 4QUJA 2RD2A 1YKGA 4MVJE 2X86A 4A26A 3S2ZA 1MKYA 3WGYA 2PUAA 4DM7A 3KZOA 3O8DA 2ODQA 4EO9A 3NU1A 3GP3A 1E94E 1EINA 1V35A 2J31A 5H81A 4KXYA 1BEEA 4G1FA 4B0PA 2L42A 4FW9A 3T1NA 1B16A 4PZYA 2HBYA 1Y80A 3PE6A 3Q85A 1SOVA 5EMHA 1GPUA 2O8EA 5CDFA 1QWOA 3ZY3A 5L8VA 3CX6A 3G17A 4YAIA 1O96B 1WW8A 1HZZC 3NEJA 3PR3A 1A50B 1V3TA 2WT8A 3K5PA 5AR1A 3BF8A 1KGSA 2RAFA 4CTMA 1Q0ZA 2ODAA 2ZK7A 1W49A 4MWBA 1DV2A 3GLQA 4U2CA 1A5AB 1TMYA 3BXHA 5CLGA 4RZIA 5E1BA 3UJ6A 4EG4A 2PWYA 4QWMA 5WRFA 3CUVA 2AL7A 4R9UC 3W5SA 3HKCA 3TNLA 2VHJA 1JW9B 2RHGB 3W5UA 3E82A 2ZSHA 4S1TA 1BMTA 1GIAA 3CKMA 4HH0A 4EG8A 3K9QO 3QYAA 4R2MA 3TR0A 4JT9A 4TSFA 1J09A 1W1UA 2ZBEA 4X61A 2MR5A 1FDUA 4OA5A 1QF6A 2DLNA 4WNYA 1NSTA 4RL4A 2DGDA 5A9RA 4DCPA 2RG7A 8AT1A 3O1LA 4HFMA 1MG0A 3CWZA 3RODA 5BSHA 3OPVA 4LI0A 1BSVA 2UXBB 3R41A 5C1OA 3OEWA 1JXOA 3PSAA 4J3FA 1VJDA 5CW2A 4AVYA 2BZSA 1NAIA 2Z8YM 1K08A 2N9UA 5D01A 1PFQA 1B0ZA 3LGSA 4RAOA 3ZGXA 2X9LA 1DKPA 1GG9A 1NF3A 2ZBDA 3TVYA 4P84A 3K30A 3VVBA 4Z7OB 2Q5FA 4NOJA 1YRQA 2LP4Y 3DNPA 5ICGA 4S0ZA 1J6UA 7ABPA 2CJWB 3PC6A 2BCGY 4GXNA 1JR3D 1OLUB 5CVCA 5C35A 3KSAC 4QDXA 4NCBA 3VO2A 1GFSA 3COJA 3MOGA 1KO4A 4KTTE 2IEDA 1EFHA 1U2QA 3KQQA 2I7CA 3PU6A 2DT8A 1VFNA 4YY3B 4RO0A 2WD8A 1Q57A 3HV0A 3K8ZA 5EXDA 1DUSA 3BQMB 3G2HA 3HP4A 2IOFA 4DPLA 1QCDA 4G2TA 3C3JA 3KJZA 4N47A 1LDBA 2F9MA 4TKMA 4Y6OA 5HZMA 2VLIA 3EK2A 2X3UA 3BJEA 5JZBA 1XWIA 4HDOB 3WHPA 1EK0A 4A6PA 3RVQA 5JPCA 3OIFA 4DL9A 3K0FA 3TGPA 3KQHA 5FXMA 2QVYX 1YFLA 4DTCA 3BEDA 2FUEA 1NMYA 2ZI4A 1GYQA 1W46A 1YIDA 2O2CA 2V5VA 4TXHA 5C52B 4TRMA 3AI2A 1GL9B 4H6PA 4UBOA 4ZKDA 2HO5A 4Z3DA 4KMRA 4TS9A 3QVGB 1G2PA 2PXXA 1Z6PA 2CLSA 4Q3OA 1DDGA 1A95A 3TNJA 3RYFA 2PMDA 4JVMA 3T06B 4AZ0A 1DI0A 3G68A 4QLAA 1DGQA 2IEYA 3K0HA 5HE9A 4X6LA 2B2XA 1T5TA 3L3BA 4YJ3B 2A9RA 2IK8A 1TF2A 2WB2A 2IBSA 1I4OA 1N8TA 2IBMA 2VCHA 4MRMB 5J3JA 4H7JA 4YMVA 5JJCA 3G02A 4A1FA 2K5UA 2CVHA 4R1PA 1RXEA 2OM2A 3DXZA 2H06A 3OLCX 2OTCA 3MLEA 4NYIQ 3L6OO 2IYOA 4YACA 1U7WA 5L4SA 3PEWA 1Q6ZA 4MZDA 3MS7A 4IIGA 3S28A 2YYSA 3FY4A 5EJ7A 1YNSA 3EIFA 3LLMA 3JYQA 4K40A 1G3MA 5LIPA 1SPBS 1XRPA 1QH9A 2L19A 1W30A