3KU4A

Trapping of an oxocarbenium ion intermediate in up crystals
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
293
structure length
291
Chain Sequence
NDLVQLCNPHIAAMKEDILYHFSLSTSTHDFPAMFGDVKFVCVGGSPSRMKAFIKYVAMELGFAHPDYPNICEGTDRYAMFKVGPVLSVSHGMGVPSIAIMLHELIKLLYHAHCSGVTLIRIGTSGGIGLEPGSVVITRQAVDPCFKPEFEQIVLGKREVRNTDLDEQLVQELARCSAELGEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQDYLRAAYAAGIRNIEMEASVFAAMCNACGLRAAVVCVTLLNRLEGDQISSPHDVLAEYQQRPQRLVGQFIKKRLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycal formation in crystals of uridine phosphorylase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 97
structure length 291
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2009-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ku4A00
3OZBA 3ODGA 4TS3A 3NM6B 4U2KA 4L0MA 1RR6A 4L5YA 4JWTA 3GGSA 2OC9A 2GUWA 4QASA 4IP0A 4KN5A 4L6IA 4TXJA 1T8WA 3O6VA 5F7XA 3OCCA 1ODIA 4WKCA 5KB3A 4QEZA 5CYGA 1XE3A 4R2WA 4OJTA 4WKNA 1SD2A 1A9RA 1T8YA 4DABA 1FXUA 2I4TA 1ZOSA 1TD1A 5IFKA 4M3NA 5B7GA 5CXQA 2AC7A 5F73A 1TGYA 5IU6A 1V2HE 1OU4A 1VHJA 3D1VA 1JDTA 2A0XA 1T8SA 4TXLA 1PR4A 3PHCA 3DJFA 1V4NA 1WTAA 1U1CA 3F8WA 3OF3A 4F3CA 2IQ5A 1OTXA 4D8YA 4G8JA 1A9PA 1RCTE 3OPVA 4QATA 1ULBA 1RT9A 4D98A 4DARA 4TXHA 3PNSA 1B8NA 4E1VA 2QPLA 3KVRA 5F76A 4TS9A 1RXYA 2QSUA 3DPSA 3UAYA 3FB1A 3FUCA 1Z37A 1TGVA 4JP5A 4BN0A 4JOSA 4P54A 3UAVA 4F1WA 1JPVA 3FWPA 1A69A 3IEXA 1Y6QA 3OOEA 4BMXA 1Z5PA 5DK6A 3ONVA 3FNQA 4WKOA 1M73E 2AI2A 1U1DA 1PK9A 1Z34A 3NM4A 3OZDA 4YNBA 2BSXA 1JDZA 1T0UA 3OZCA 1RYZA 3K8QA 3EEIA 3MB8A 4DAOA 2OC4A 4OGKA 1SQ6A 4WKBA 1Z5OA 3P0FA 3LA8A 5F7OA 3OZEA 3SCZA 3E0QA 1PR1A 4EARA 1JP7A 1YRYE 4M1EA 2A0YA 4PR3A 4OF4A 4YO8A 3BGSA 3E9ZA 1JDUA 1B8OA 1Y1QA 4GLFA 1VFNA 3C74A 4TXNA 1NW4A 1RXCA 1NC1A 1V41E 2PGAA 1U1FA 3FAZA 3DP9A 2QTTA 4D9HA 1JYSA 4LNAA 3GB9A 4DA8A 1ECPA 1Y1TA 2H8GA 4D8VA 1PR0A 3TL6A 1Y1RA 5B7NA 3ENZA 4NY1A 1LV8A 1Z38A 5JPCA 3EUFA 3KHSA 1PR5A 3EMVA 3IOMA 3BJEA 3P0EA 1OVGA 1NC3A 4F2PA 5B7QA 1ZL2A 3T94A 3UT6A 1Z5NA 4QFBA 2B94A 1A9OA 5CCEA 4QAQA 1T8RA 1YQUA 2HRDA 4R31A 1PBNA 1A9TA 1CB0A 3INYA 1OTYA 4K6OA 4GMHA 5K1ZA 4F2WA 1RFGE 3QPBA 4PNPA 5CYFA 1VMKA 4UC0A 1YQQA 1K3FA 3DF9A 1PWYE 3EUEA 4R2XA 1V45E 4TTAA 1PR2A 5CCDA 4YJKA 4GLJA 5F78A 1ULAA 2Q7OE 4ECEA 3PHBE 4DA6A 5FAKA 2AI1A 1YBFA 1Z35A 3KVYA 3NBQA 1U1EA 4MCHA 3UAZA 1C3XA 1K9SA 3U40A 1SJ9A 3E9RA 3FOWA 4DA0A 1A9QA 2HSWA 3DDOA 1Z33A 3LGSA 4H1TA 5C80A 1RXSA 4TTIA 1ODJA 4M7WA 4NSNA 2ISCA 2P4SA 1JDSA 4BMYA 4NS1A 5F77A 5B7PA 4QARA 3LBAA 1JE0A 4F3KA 2HN9A 4L5AA 1U1GA 4G89A 4BMZA 1YR3A 1PKEA 1PK7A 4I2VA 3BL6A 3PNPA 3O4VA 1V3QE 1ODKA 3UAWA 4LNHA 5F7JA 1LVUA 2A8YA 4G41A 4MARA 1I80A 2ON6A 3UAXA 5ETJA 4DANA 1JDVA 1RXUA 4MCIA 4OY3A 2QTGA 4L5CA 4D8XA 2QDKA 1PR6A 1RSZA 1SD1A 4EB8A 1V48A 4OEHA 4RJ2A 5EFOA 2HWUA 5EPUA 1Z39A 4TYMA 3KUKA 1PW7A 5F7ZA 3NM5A 1TCUA 3OOHA 3MMSA 4LKRA 1K27A 1PF7E 4TXMA 1QE5A 2AI3A 4LDNA 4GKAA 4OGLA 1LX7A 1ODLA 4YMLA 1JE1A 2OXFA 1A9SA 4WKPA 5I3CA 2A0WA 1Q1GA 2RJ3A 1CG6A 5CXSA 1VHWA 3BSFA 5EUBA 2I8AA 1Y1SA 1OV6A 1Z36A 3KU4A 1OUMA 4FFSA 1TCVA 4DA7A 3K8OE 2OECA 4TTJA 4X24A 1N3IA 1G2OA 3KVVA 1Y6RA 2XRFA 4LZWA 4DAEA
chains in the Genus database with same CATH superfamily
2IPNA 5FBWB 2ZRGA 3E7XA 3C4QA 4X66B 1RP1A 4NOKA 5CURA 3TSWA 2H5JA 3ONEA 3UMFA 1TUGA 2QY9A 1HQCA 3MA0A 4JZYA 1GFSA 2CL0X 2GAIA 2LV8A 2GASA 4KDFA 4KR9A 3WXBA 4E0BA 1T4DA 3IBYA 3DGFC 3WLAA 1MORA 2IPXA 2H4ZA 3MYYA 1AXEA 4KN5A 4NFLA 5T4FA 5CHYA 3LKBA 5DIFA 1RFLA 4DSOA 3EW9A 2CXXA 2H52A 4OHFA 2X5XA 3DZCA 4V2IA 1OMOA 2DLCX 4C3OB 5EESA 3FPEA 2VDMB 4LHWA 3W8EA 1KRXA 1W36C 2J5QA 1A96A 1I6WA 4DGQA 4ZOQI 3HHPA 1QORA 1A9XB 1V9LA 4UBKA 1FMTA 1O6BA 4EY6A 1MOZA 2COKA 4MJ3A 1KAGA 5ALPA 1G5TA 1JALA 3KDAA 1QHSA 1VBKA 3ETCA 2X19A 3IJEB 3R3ZA 4EX6A 5AESA 4K0KB 2AKAB 1P1RA 5DN6A 1Z0ZA 1A50B 3HB7A 3NORA 1U94A 1PFKA 4BPRA 5EUCA 1ORHA 3LQ1A 1PTJA 1PO7A 5IJ0A 5HS6A 5DGTA 3RC9A 2I9KA 1G9TA 3FMVA 5K0LA 2X86A 1Z4QA 2CL5A 2OTCA 1G2QA 3CC8A 3VU8A 3O03A 4NU5A 1A95A 1DJOA 4QOEA 1LF5A 5KSPA 2JDID 3HCEA 1E2HA 1RDFA 5DGIA 2ZGVA 4H15A 3OLQA 2QIPA 1CYDA 2X8LA 4XW2A 3ICEA 3CNHA 5CLLA 1ABEA 2A57A 2VJYA 1QG6A 1O77A 1MO2A 3D1VA 4AG6A 3H1AA 1PJ2A 4EMUA 4S35A 1GGNA 4JUIA 2PANA 2WDZA 3IFSA 4XD7A 3V2IA 1I4DD 1V4NA 2BSAA 4LYYA 4TZ6A 2RK3A 5DWQA 1CQJA 3DLAA 3ANYB 2HJSA 4FCWA 3R0IA 4AECA 2A86A 2BGMA 1U1CA 4L0QA 2FN8A 5D87A 1JZSA 3O7WA 1HQKA 1YB5A 3GNTA 3MWEA 3WIUA 4DCUA 4J1QA 3OJLA 2ZSKA 3WGZA 4BUCA 3VZCA 5FWXA 5AYVA 2GB4A 4I1UA 1P5JA 2CD9A 1Q91A 2X2FA 2F48A 3F5MA 2IYWA 1REQB 5DT2A 3AVUA 4TT3D 4AZ0B 5IVKA 1RMTA 3AHHA 4CVNA 3HBLA 4NYIQ 3U4QB 2SHKA 3DEFA 2LTAA 1GKUB 1V3TA 1JRLA 1FDRA 2HDNB 3CLSD 3GVPA 2H59A 4L4UA 4KVAA 1R64A 4MLPA 5D2CA 5F76A 2O50A 2BJVA 4PLYA 4I8DA 4Q12A 2CD7A 1E2JA 1HDOA 1SKYE 3M5PA 3SF8B 4PBRA 4QTZA 4DN6A 1JJVA 2P2CA 5C7IO 2WV9A 4J75A 1YNSA 3AJEA 1AMOA 4OQMA 4WY8A 3V34A 3GDFA 1IZ9A 1NUQA 4N4AA 4S0ZA 2OXRA 2EIHA 3ETEA 3PJDA 1DJQA 4BN0A 4R2JA 3ICOA 4HYYA 4NATA 3KZXA 4D4GA 5CTJA 4MKZA 5DPMA 4IMRA 4LHYA 2O8VA 3NIGB 2I03A 2IHJA 4FB4A 5CAEB 3AP2A 4DSAA 2VNIA 4IDOA 1QLJA 2YYYA 1VKZA 2W4MA 3R0VA 1JFFB 5E7MA 5FP0A 3PB3A 3IMGA 4E2XA 3EQZA 3O1IC 1FZTA 3VI4B 5CDTA 3KP1A 1HL3A 1A4XA 2X0RA 2LWIA 4W9NC 2GYYA 5LXTF 2N9UA 2HY7A 3A06A 3R6TA 2W2NA 4I1SA 2XD9A 3W8NA 2QM3A 4EEZA 5JZMA 3B7PA 4H1WA 5LFAA 2ANBA 4K9RA 2NTJA 1U1DA 4D26A 2CMFA 4GEKA 421PA 1Z5GA 3EPLA 4Q37A 1OFIA 2AOTA 2QHXA 4CGZA 2ATEA 2VO1A 3UUGA 3Q9NA 4R8KA 3CM0A 4S1NA 4UFNA 5BYJA 1T2EA 3EQ6A 2HAEA 1JDZA 3DE5X 2IT1A 1SURA 3QUSA 2WB2A 1SVNA 3GLGA 1PP4A 3H5VA 3N2KA 1K5DA 5CXUA 4L75A 1J07A 2E5LB 3FX2A 1Q14A 1AUOA 3VOTA 1O97D 1FUIA 2FW8A 2F00A 3CE9A 4JBHA 1TM7E 2NNWB 2MINA 5F5LA 2PNJA 3X2SA 3OQOA 4TWIA 4DCCA 3DZFA 3VJKA 4AZWA 1NFRA 4UNRA 3M0EA 3KO8A 1X42A 2Y9PB 1LPBB 3DBLB 1XVVA 4MQEB 3ZI4A 3ORQA 1YZVA 1KHHA 3DKKA 3E0QA 2WD8A 1P60A 4GAEA 1KZYC 4ALKA 3ELDA 1XPOA 4LZNA 5BPFA 4TMZA 1FZQA 3EVAA 1XXHB 1MHTA 4ZJUA 1IJBA 1W0KA 5AKKA 4WLVA 4R1NA 3SY8A 1Y4AE 3I01A 3U7HB 1V5IA 4RZIA 3P1JA 3TW6A 2GESA 4C89A 1OBFO 3FVTA 4RCZA 3WL6A 1YUNA 1ZNQO 2BI7A 1CULC 5P8WA 2XT9A 1HOTA 2WIGA 1RBYA 3PF9A 3SZOA 2AYZA 3OM1A 1M76A 3JVDA 4P82A 4EEKA 3K6JA 1SC4A 3ITKA 1H2HA 2BWJA 3D7NA 4R0VA 3DR5A 3VR1A 4YLYA 3MUEA 4XLTA 2CWWA 3L0YA 4OQZA 2WHXA 1UPCA 2TMDA 1E1LA 3K9HA 2WWIA 2JFFA 3N5CA 1PJBA 2QG9A 3OFNA 1UXOA 3AVTA 5IX8A 3GA5A 1E1QD 4F4IA 3PQ8A 4W5HA 4EG6A 1GZ5A 1J8QA 3LU1A 3N8DA 2YDXA 1I4OA 2EKBA 4HDKB 4UHJA 4XD2A 2BFCA 4DA8A 4QYSA 1W36D 1X0VA 3JWJA 3PYLA 4RHFA 2ECKA 5C8DA 3VXKA 3PEYA 3RVKA 4EZEA 2HMUA 2I2AA 4QTTB 2CUKA 4BGIA 2I1QA 1IUOA 2NYRA 2O0KA 2V3WA 4HK4A 4QA9A 3UWMA 3BMOB 1YJAA 1IMOA 1TYDE 4IRUB 5HUJA 1CVIA 1WD7A 3GX1A 3P9RA 1SKMA 1Z13A 1WZIA 4RQBA 4HX9A 4IH1A 1NWCA 5KJ1A 3VNVA 2IZ6A 3RVRA 3GGOA 2VBGA 1LV8A 1Z38A 3N2LA 3PXBA 3U80A 2A9QA 3BMOA 5SY6A 1T9CA 4CM8A 3EUFA 3B5IA 2W4QA 3L06A 1F06A 1KL7A 1VBNA 1ZH0A 4E4TA 4CDNA 6REQB 3ZWVA 2FF7A 5AW8A 3G0HA 2BMFA 4YCAA 4YUXA 1U65A 4HB2A 2G1PA 2M6LA 3SF0A 3Q12A 2XLBA 4X8MA 5CJPA 3HADA 3SHOA 5HWSA 2C7VA 1I4TD 1XTUA 3WOVA 1P7CA 4F9FA 3DT9A 3IP8A 5K01A 3FKSD 3LCMA 5I4IA 2GN8A 2R7NA 1T15A 3QELB 4QBKA 1ZZEA 1YJXA 5TF4A 4EA8A 5ALNA 1T3ZA 1ECGA 3OG9A 3VO1A 1QRUA 3FYSA 1YQUA 3GOQA 2EARA 1ADCA 5FEUA 2VHEA 1KJQA 4UCFA 4F5ZA 2V0CA 3OVMA 3VDRA 4EHIA 2ZJ7A 3TE7A 4E5UA 5I01A 1ZSYA 2J41A 4YCNA 3PNKA 4BXOB 2IZ0A 1XTPA 3IDSA 5B3JA 2X0JA 4ZK2A 2PX8A 4TS1A 2CHUA 3SQDA 4M1QA 4PLZA 1M0EA 1NJ6A 1YNOA 2O2CA 1V16B 3QXGA 1NBMA 3GVHA 1ORRA 2GHTA 1F8GA 3ILYA 4MIYA 5CH8A 4RL6A 4TSFA 4EB0A 1NJ2A 1NRJB 2XCLA 3BS4A 1WY5A 4C07A 3FHOA 2VDOB 1Z8NA 2CYCA 5FTJA 3L84A 1H1LA 3S3TA 1UWCA 1XHEA 2G80A 1QGZA 4Q9NA 1OX5A 5ARDA 2GKGA 3AETA 4ZPJA 4IMIB 5EJIA 2UVDA 5I7FA 5GVRA 4AWBA 1KAEA 2Q3MA 3UMJA 5K9ZA 2RGRA 1WV1A 4ZRDA 1VOTA 3I5YA 4EG7A 3HXTA 4GC5A 5L3QB 2GXSA 1NXOA 2B7LA 1YRWA 2P4HX 4B6QA 3AR2A 4FMDF 1N6KA 4KMMA 2X42A 4R1LA 5EZQA 1BJKA 5AW5A 3UJAA 5K0FA 2FXIA 1N32B 2Q7OE 3IQWA 1YDMA 1XIVA 2C3OA 4NBTA 5DYGA 1OI4A 3SIXA 1GPLA 5LB4A 2BM8A 4YX9A 3OZIA 3ZGNA 1AO0A 1Z35A 3WNVA 4DYVA 4ZIRA 1DBIA 5LBIA 4IINA 2G83A 3BHMA 4G1BA 4QGHA 4RJTA 3MUOA 3AI2A 1NM5C 4IIUA 3GL9A 2A9VA 3ENKA 2BY4A 2QT9A 3ZWKA 1UBOS 3R44A 4MJ7A 2NGRA 3Q3VA 3EC7A 4F71A 2OZPA 3ADPA 3E9RA 4INAA 3GGCA 3LP8A 5FBZA 2AB0A 4QICA 4ITVA 3ZY4A 2ZS9A 5I9NA 3U3KA 3GCXA 4YJ2A 3Q3HA 5I51A 2QNIA 3ILXA 1AQIA 3B6EA 3HN7A 1P1FA 1IWPB 2WAAA 3RVOA 3LPNA 1XCGB 5ELMA 3PFFA 5TGDA 3QENA 5FL7A 1RD4A 2I4MA 2R8OA 5SZIA 4RY0A 4X93A 2QK4A 4FFBB 2AA3A 4EGSA 3JX9A 5LXTB 3ZJVA 2FR0A 2EW8A 4HDNA 3OX2A 2FR8A 4LE2A 1XZGA 2YJ4A 2C4HA 4FKZA 3T34A 1PS0A 4KGVA 1BH6A 3STXA 3WHPA 4DL9A 3DBIA 3UGTA 3OX4A 1DELA 5K20A 2Z5LA 3WGGA 5EEGA 2WQ7A 5CRIA 5HIIA 4BMYA 3G0CA 3CRMA 3TVYA 3UK7A 4DIDA 3CO5A 5LIRA 4Q9HA 4B7XA 1F4VA 1NATA 1UKYA 3MD9A 4KFRA 4OMDA 4IDPA 4ND8B 1JQDA 2HA6A 1GL7A 4CQMA 4WBNB 5JHGB 4QOIA 3SX2A 2YFHA 3T1TA 1Y4UA 4Q7KA 4UFPA 3RYIB 3L0ZA 2YXEA 3U9LA 3DGEC 1MIHA 3D8NA 3OZXA 3UW1A 4MS4A 4NQRA 5H4HA 4ALMA 3TZBA 3F4BA 4BMZA 3TQTA 2D13A 4X00A 1E2DA 2P2DA 3GIWA 4JDUA 1GTVA 2QM0A 4KAAA 1QR6A 1J0CA 3JARB 2P5TB 1NY5A 1NR1A 3OY2A 3ZV4A 3A9RA 5BW5A 5I9LA 2BEJA 4F72A 3W4KA 4GIBA 1ENZA 1GZ4A 2HRBA 3F6CA 5LDHA 2OM2A 1ZNWA 4C7JA 3K0SA 4WTOA 4P7KA 4U9IS 1FRFS 3IUSA 5F7JA 3OM9A 1TVKA 4Y2TA 1CDDA 2CJXA 5HFJA 4PV7A 3FJOA 1MOPA 2FPMA 1KGDA 1QIHA 2AG0A 2ON6A 4PONA 1N8SA 3QG5A 2IYNA 4Y9UA 4WUTA 1OZHA 1Y6ZA 3CZ4A 1WO8A 3GJ3A 1E2NA 3TZKA 1N5KA 1WXHA 4E5VA 4M0PA 4LRWA 3O2SB 2HNAA 3SJBA 5B1EA 1AB5A 5F2NA 1Q0PA 2NUTA 4PF1A 2Q3FA 4MTLA 4QE3A 3LLSA 1C2YA 3F6SA 2NUAB 4ETWA 2JGAA 1S9HA 1Z75A 3WISA 2F9MA 2XNDA 4K9MA 4P81A 3UT0A 4H3SA 4Z0HO 3WMRA 5DGCA 1NRWA 3AERB 3OCYA 4B40A 4GR4A 3P9ZA 1KY5A 1TK3A 2PMEA 3RR2A 3IAEA 1GYQA 5JSKA 5K5EA 3NWPA 1NBWB 4MWCA 5B2ZA 1QHNA 4M60A 3PIDA 3M4JA 3PD7A 2FUG1 5DTJA 4AY4A 1ZM3A 3HB5X 2FOIA 3U4IA 1T36B 1TQDA 3B6MA 3OKCA 4MVJM 2C9CA 3GFPA 2BCJQ 4P83A 5I5GA 3KE8A 1B1AA 1NBME 4PIPA 2H4FA 3V8RA 4DPLA 2QR3A 4JC5A 1Z4NA 4JI1B 5K8VA 4AO6A 3WA7A 2XOEA 4B6EA 3JVEA 3NHLA 2NU6A 3IKVA 3K3PA 4B6SA 1PUXA 1H1LB 2M9MA 2W71A 3I1YA 3W04A 4PAMA 4ND7A 3K72B 1P7WA 2O48X 2YZ7A 2Z3WA 1YMQA 4FGWA 2GTHA 4KAXA 1OGJA 2Y76A 1O54A 4KVZA 3X1YA 3DO6A 4Q3EA 1MX9A 2GEFA 1Z2DA 4B82A 3HXKA 2HLHA 1C9EA 1ODLA 1YDWA 2HHJA 3O4HA 3IOYA 3PLRA 4GI1A 4K7JA 1F0KA 3CGGA 4EG0A 1CQWA 3BJZA 3WB2A 2CHVA 1RLMA 1FMFA 4HVLA 4J7AA 2FZ5A 1A9SA 16PKA 1H2YA 2HB6A 2BBTA 2LDBA 2WJWA 2BM9A 3AZPA 4M98A 5DSTA 5LCXA 2YFQA 5I3CA 2VH1A 3GRVA 3KR0A 5LOVF 4W5RA 3EULA 4RNDB 3H8WA 3AY0A 2XODA 1T1RA 2BZGA 2CUZA 2I2WA 4GPIB 4KQEA 3VC3A 3UKOA 1PZXA 5JCJA 4G5XA 3ROGA 4HPXB 2E4VA 4L8LA 4E4YA 1J56A 1O3YA 2HUPA 2IDMA 5G4LA 1T2VA 5KU1A 4I6GA 1R4MB 3HYSA 4BNKA 2CHEA 3CO0S 4JT2A 1W19A 1Z5UA 4HUJA 4HWOA 1QGUB 2IITA 3IVCA 4XM0A 5SICE 3U3JA 3WO0A 1BEEA 1YWGO 3OUZA 5JC8A 5C3MA 4MYDA 4HLUA 3L40A 3EF3A 4QM6A 4DLBA 2FPUA 2WF6A 1ZOLA 3TQSA 1G2OA 2WUGA 3BB3A 1WVMA 3JYOA 4BV3A 1OAKA 2VP2A 3K7EA 3NHRA 3LQQA 4AMGA 4IIHA 4S0XA 3CUTA 5LMUB 1PFUA 5CYPA 1QKJA 4JV5B 3L0PA 1ISRA 3DCJA 1P31A 1RBZA 3HCWA 5G2OA 4RTJA 2DHEA 1I3MA 5ITZA 3KLNA 4JWTA 4DHEA 2ZR7A 3ZY6A 3ZIAA 2PIDA 1FFXB 4DPMA 2O8EA 1FVXA 3AJAA 3D6MA 4DREA 1I32A 2JLQA 3QJ5A 4MDHA 4CE6A 2C0CA 2XKJE 2E89A 1DG9A 4KYUA 2AXEA 4XWAA 2GXAA 1NVGA 1Y33E 2RAFA 4A10A 2WTEA 3R7DA 4MV4A 1R6DA 5GM2A 4CM9D 4F9TA 3GEMA 2DYKA 3IQDB 3KTFA 2M1XA 1N2JA 4CEJA 4RTKA 3DG9A 1V5WA 4JEUA 5HCIA 3FOCA 3DEYX 5ADWA 1DRVA 3CSSA 3P26A 3G2OA 4PYMA 4CCYA 3BRQA 3NETA 1RI2A 5A4IS 5A0FA 2I4NA 4KOEC 3KXDA 1DPFA 3I58A 4U1RA 5FTLA 4EPVA 1G9SA 2P2SA 3FCAA 4GWLA 1PGQA 1Z0KA 4I50F 4TKUA 4WCFC 1TJ5A 5FYDA 3ABSB 1VP3A 4JASB 3A6EA 2VDVE 1RLOA 1Z07A 2QI9F 4QBTA 1BE6A 1ND5A 1O97C 3VKFA 2PWZA 4W5JA 1FDIA 1KI1A 2JJ1D 1MEOA 1Y37A 2B4YA 3T9EA 4BJHB 3VTAA 1BG6A 1DXQA 2ZWIA 5EJ6A 2W6CX 1NOJA 2WVGA 4TRRA 1VKJA 2JRLA 2KYRA 3ELBA 4Q3CA 4RQTA 5B5SA 1EFPB 2C9BA 5CLHA 3FCEA 2HJGA 3HZRA 5FTNA 3SYNA 3EJWA 1NVAA 2OHVA 1XU9A 5IT0A 1NJ1A 1L7XA 3DAFA 1AE1A 4YUWA 4PZ9A 1F4LA 5I7VA 4JLNA 4L6AA 3DTVD 4LF4B 1Y3BE 2H4HA 1OWLA 5AXDA 1CEEA 5ED0A 1TXGA 4F4DA 1R0RE 1KYXA 1T3HA 4DWWA 2F1OA 4YXWD 4BMDA 4DCNA 1EGQA 2W2PA 1ZD4A 4P4TA 4EBBA 2IWHA 1A2QA 4K6FA 3ETGA 4X94A 1EFUA 4C1BA 1CZOA 3GJTA 4IZIA 4B45A 1GQSA 2CJWB 5IAJA 3UANA 3BTOA 3ZGVA 2AVDA 5CDFE 1NBHA 1ISIA 1KEEB 2PKEA 3QI2A 2RCNA 2G7MC 4ZJZA 3FCYA 1G20A 2YIJA 3RV4A 2X9NA 4JQCA 1KSFX 3OURA 2E48A 4DRXB 3QXHA 3IAFA 4B4VA 4Z2AA 1O5TA 2AH5A 2O9JA 3CG0A 5BMVA 4ZMRA 1XZCA 2B4AA 2QX8A 2ZTSA 1YJCA 3I09A 4CZ2A 2C88A 5BPHA 2C0QA 2WNSA 5BW6B 2BMDA 4A6PA 4PQEA 3WNZA 1VSBA 3GUVA 4BTEA 4ZCPA 5CFNA 1A5TA 2RGNA 3A26A 1TMGE 1I2DA 2IYRA 2OCLA 1DXHA 3M81A 3ELYA 2X8WA 3DV9A 2PUGA 1AXRA 4IH4A 3CEJA 2UZ1B 3KAQA 4YUZA 1OIVA 3FWPA 1IQPA 3ZQUA 1A69A 1FC0A 4BNJA 4FWTA 2AGVA 5HHTA 3IEXA 2Q1SA 4BCCA 4CL2A 621PA 3K9FC 4QWMA 4BMXA 4EDFA 2C58A 4YBRA 1CUCA 2H9AA 5BYBA 3VDXA 1KEEA 1LW6E 2VT7A 3HSSA 3VHQA 1F9EA 4YAJA 5AVYA 2XHZA 5HTOA 2WOOA 4B7AA 2FMXA 4OAPA 1SCKA 2ICAA 1KKLA 5FV4A 2WUVA 2EHDA 3I73A 5TNXA 3M4XA 3MXTA 1PJ4A 1Z8HA 4BLPA 4J9VA 2BFDA 2OV3A 3ZHRA 1WEKA 1QZZA 1R9GA 2VG8A 3I53A 3MTBA 3WLNA 4RS3A 2C77A 5JJKA 4F7DA 3GQBA 2QLTA 3PDIA 2HZBA 1FJGB 3PU6A 3UF0A 5C8VA 2O2GA 1SUIA 3QJGA 3Q2IA 2ZIGA 1FJXA 4UFOA 1CUJA 2PY6A 3E7FA 4TS4A 3GDHA 1FQKA 1G8SA 2IP2A 4JOBA 2AFHB 2XQVA 4MAMA 2GN2A 4KXQA 4M9RA 3CMMA 2VQFB 2HT1A 4OHPA 3I39X 4JJZA 4HWRA 3RHZA 3GRKA 2P9FA 3LGAA 4IOMA 3V8EA 3JWHA 4BDSA 3A4VA 3BB4A 2DWQA 3NMUF 5ECWA 3PX2A 1N6PA 1CUSA 5G4KB 1E2IA 1QP8A 2ZXFA 1JV2B 4FGJA 4CMBA 4M8IA 4EARA 4UNIA 1UEIA 3RVBA 4X41A 3SBOA 4KR7A 4UE6A 1A9YA 4YRNA 4OF4A 1W9HA 4IXMA 2C7PA 3ZZTA 1J9ZA 3ZPXA 4ER7A 2V58A 5ER6A 1KVUA 2B1RA 4QTXA 1WUHS 1CR0A 1IBCA 2VJCA 3DDCA 5LOVA 1SC6A 1VG1A 1G3QA 5IN5A 4TVKA 1E2PA 1EM8A 1PVDA 4IXWA 4J94A 4LZOA 4MTCA 1UPBA 4I1PA 1R16A 2XMQA 4DJJA 1QQBA 3FMPB 3T7DA 1W581 1CC1S 1P17A 4ND1A 2EW2A 4DT1A 1C81A 4L9WA 2AIRA 2DQ4A 2ODNA 5I8WA 4QBIA 5FF9A 4NMHA 2F3TA 1Z6TA 1GCOA 2CLHB 4HX5A 4IX9A 1Z2AA 3AB7A 1OLUB 3LT5A 1G64A 4GBGA 2CMGA 2HHHB 2TMGA 1CRWG 1UJCA 2OO5C 2WTUA 1USGA 1YJQA 2E82A 1YS1X 3EMBA 5FPHA 2Q5QA 4OHZA 4Q3KA 3WI7A 4D6XA 1BH2A 4NDAA 2QGFA 2E4XA 1N7JA 1C3JA 2DLDA 2VZEA 3TTYA 3KQOA 4N1AA 1RTTA 5K8JB 3AHJA 3DKRA 4RKRA 4BKMA 5JI3E 2XUAA 4X61A 3C1AA 3P9SA 2EFYA 4L2IB 3IILA 3EQ7A 2SKDA 1T9AA 4XQGA 1N6RA 2J9YB 4BQOA 3N70A 1LPPA 2NO4A 3IIJA 4IILA 4DQLA 4R83A 1Y98A 5K3SA 4OKNA 5I47A 3EIQA 3PC2A 1C8LA 2XKBA 1VCOA 3GNSA 1AGPA 1PSDA 1XCJA 2GXQA 2Y0EA 1XAHA 1WL8A 3R5JA 2PCLA 3MMPA 4ZVRA 5ALFA 5E6SB 2Q4OA 3TTUA 1HXHA 3BJEA 5DIZA 3NBZC 2BAGA 3QWIA 4Q01A 1TTTA 3DUFA 2PGXA 2QL6A 1AQNA 3TRIA 3DW1X 3LVFO 1UOOA 4PVCA 3VR5H 4DV0B 3V1UA 1QHHB 2O3RA 1XP8A 2ZVQX 4I2NA 3VSBA 1U7OA 1W0CA 2ZKLA 1T26A 4XEHA 1YIDA 3CKLA 2OXTA 3V8PA 6PFKA 4FOPA 2G1KA 4PO8A 4REQB 1IMJA 2E4YA 4MKRA 3Q15C 5HRUA 3DDZX 1KE2A 2OK8A 5A3SA 5JXWA 2V6IA 2AFIB 2EZUA 3THWB 3FDZA 2XD4A 4R31A 4EJ0A 2ZE8A 4NZ9A 2UZ1A 4UQOA 4F6RB 1A9TA 1CB0A 1YVRA 1RQNA 2FI1A 2NTYC 2GOYA 2PL9A 4PGHA 1NUTA 4JLWA 4B7UA 2ATVA 3SHFA 4F1KA 3GN1A 4EL5A 5BVGA 3LNCA 3R7WB 3S81A 4K1LA 4Z7JA 1YAJA 4YMWA 3ICQB 1O95C 4ZANA 3THWA 4RVNA 1DJNA 1JGTA 1N6OA 2ZTMA 3OHSX 2AG8A 4ZQIA 2ZU0C 5HIMA 3L7KA 4H3VA 3G88A 1TTHA 3NPMA 4Q3OA 5KNCA 1EB9A 3QE0A 4CT0A 2WMOB 1WUIS 4AO7A 5K0BA 2EJUA 3PC8C 4P2BA 3WKDA 4NOLA 1JAXA 2HSDA 2IYPA 3N7AA 1E62A 3PITA 4LBWA 1FPQA 2H7CA 2P6NA 3PNYA 4W1SA 5TEVA 4HNTA 1XRPA 4G09A 4RPKA 2VKTA 1OFUX 4YP7A 4QO7A 2C2BA 2P2GA 1LQUA 3BB1A 3F6RA 3K0FA 2Y1GA 4UKDA 4MRRA 4YAOA 4BQQA 2O14A 3DBHA 3T0FA 4AUNA 1NNUA 1TF7A 1YQTA 3F67A 1MC8A 4JVLA 4NENB 4Y6RA 4KKVA 3ND6A 2VDKB 3AHDA 2EWVA 2JASA 1RJDA 1NUPA 2H0AA 3IAAA 4OGWA 1I14A 3T8YA 3V1NA 4ENQA 5LJIA 2Z2YA 4LYHA 4X62B 3CQ9A 3EVZA 3Q7SA 4RF2A 1ACJA 4H1VA 5K4AA 3R8CA 1IEVA 2QLNA 3DW3X 2J46A 1AK2A 5TS2A 4KHPB 3I12A 3PLAE 1JN0A 2R7AA 2XUFA 3QUBA 3DD5A 5EP4A 4E5DA 5IRCD 4L5JA 5L53A 2RDMA 3LF1A 3KSBC 3KE9A 3RU7A 3RS2A 2M98A 1XFDA 2C3YA 2PRSA 4I3GA 3RUHA 4C0HA 2ZB3A 5BWLA 1V9SA 5I5EA 5CEEA 3DKVA 4D4LA 1ORIA 5BN4A 1SOUA 1TA0A 4MDYA 3T9AA 2C9MA 2WNHA 3L7IA 3LW8A 5GZ6A 2ODBA 4UOZA 5FA5A 3MT7A 4LHVA 2VA9A 2UYGA 4WZ6A 1DTSA 3C8ZA 1YGPA 3UJHA 2VJBA 4IGAA 3DDOA 4FJ1A 5HQ3B 1GT91 4HNSA 4PHTA 5DYWA 3OEEA 5K0TA 2OAP1 5DX0A 4YRZA 3H3JA 1T3SA 3E81A 5CX1A 3QBVA 3TQHA 2JBAA 2C98A 2ZIVB 3E82A 3FZGA 3LVRE 3I9LA 4XUDA 5FA6A 5ITWA 2W98A 5K2OA 2P1ZA 1MO6A 2FSSA 4MA5A 1ZMBA 1T5LA 2LR0A 1I4EB 5GONF 2GNAA 3KOWA 5G41A 1KEUA 1JDSA 4LI3X 3VDNB 2IYOA 3QEMB 3QVGA 1W30A 5B1IA 3EASA 1TK2A 2V7EA 4P0TA 3RIEA 4C0XA 1VKHA 4EO4A 7REQA 3BCUA 2VH5R 2JVKA 1EK5A 2XIQA 4UNNA 2DQSA 5IKXA 1CZLA 1R6UA 1HDGO 2ECOA 2WYWA 3UHFA 4B43A 2G5GX 2RAPA 2ZUCA 3ZLTA 4US0R 4EZIA 3ZDFA 4ARAA 2YVQA 3HACA 5AK3A 4K9LA 3LLMA 4Z53A 5IAKA 4MUFA 3WWPA 5A6VA 4LXHA 5TQ0B 3GFRA 4XI9A 4KGDA 1NAHA 2C95A 2O8DA 3PC7A 1WM1A 3DQPA 1ZJ6A 4PG4A 4HN4B 4CN9A 1H0SA 4PQYA 4A0SA 1FSSA 2NSLA 2V7QA 4YFYA 1T9KA 3LPAA 4HGRA 1W4BA 3VR4H 3V8QA 3ZY2A 1TRKA 2H2AA 1C7RA 3DZJA 4ZJPA 1ODKA 4O1IA 3GG9A 5CM9C 3COWA 5FFMA 5EJEA 4YVFA 3T7CA 2KLHA 1K08A 2A8YA 2FSHA 3AIOA 3KL2A 2FCRA 1XA0A 2QE6A 3GUYA 2PSHA 4MULA 1GPUA 3HFRA 4LQ4A 3WL3A 3H5NA 3CPHA 3ZV3A 4ER6A 2GZHA 3OCJA 3VISA 1F0YA 1THZA 3RT7A 2OORC 3P19A 1PZFA 4JROA 3IL2A 4G0QA 2H00A 3OQIA 3SZGA 5LMZA 3Q2OA 3ELUA 3WRYA 4YP5A 1RRFA 1TM5E 3SJCA 1FYXA 3FLAA 2DXIA 2V3VA 3EPPA 5JAPA 1FUYB 2QD1A 4YRJA 5JAUA 1VLHA 4DXAA 2AD5A 4IIFA 5JJBA 1JTEA 2HHLA 3W9UA 2CLSA 2R6DA 5B2FA 3K5HA 4QJ4A 3P5SA 4KEAA 1AMUA 2C1XA 4RL4A 2O7SA 3MT8A 4FVTA 1V6SA 1RLUA 3GBSA 3RC3A 5H9WA 1ENPA 3UT5A 2J9ZB 4FN5A 3RUFA 2W11A 4KLZA 4BLWA 1R9NA 4DLSA 4OD0A 1C3OB 5GIPE 1YFZA 2JIZA 2PPLA 4JKYA 1U6IA 1P18A 1PSZA 3D7RA 3GFSA 5BWMA 2B2XA 2VFAA 4KUGA 3KB2A 1ZW1A 4GMDA 2Z98A 4LKRA 1NQAO 2N3ZA 3QMVA 2MMGA 4WAUA 4DDUA 4J0HA 1NPTO 4LN1A 1W2HA 1PS8A 3CB2A 4RYDA 3WIDA 4G1CA 4YIKA 1O58A 1LSJA 2NPFA 3U2QA 1XPJA 3SLGA 3WMFA 2IXGA 3PWSA 4JI6B 4A2WA 4G0OA 4X8HA 4YY3B 1SR8A 3H99A 2XAUA 3BIOA 1HQYE 2ADOA 1WBJB 2VAVA 4FILA 1VXRA 4BBZA 1M5RA 1P7VA 4C0KA 1Q7TA 1YJ8A 1MR3F 3X1WA 5AI6A 1RYEA 3AY3A 5KX5B 5EIBC 4O2AF 1H05A 1NXPA 4WNIA 4WK2B 2Q6VA 1QTRA 2JGJA 2EKLA 1GFZA 4NG4A 5FJJA 3SZUA 4DIBA 4RZHA 2OV4A 1PDWA 4JYZA 2VRCD 3ASZA 3TIIA 1M1NA 1UZUA 2VTDA 3OZ7A 2FK7A 1W87A 3U61B 1AQYA 1OTHA 4FJ0A 4JJAA 5AKGA 5EHXA 5M7EA 4D25A 1P5FA 2PD3A 1CJSA 4A8JA 1KZGB 1YC5A 1ZUWA 2NV6A 2OECA 2WP8J 3THSA 3KOUA 1W2WB 4AUKA 4R9UC 1PBTA 2P1RA 2XB4A 1NT4A 4PZAA 1P6UA 4DQ0A 1HGXA 1R5OA 2XE6A 5AJUA 4XASA 5JCZA 4DTIA 4BFSA 5ES4B 3AF4A 1O08A 4RLSA 3UJ7A 5DM1A 1I1QB 2NZ8A 4J2HA 5KOJB 4LBZA 7MHTA 1BROA 4NHOA 3O8CA 3SYTA 3HR8A 3AU8A 4Y6PA 1RQGA 4X6LA 1P4JA 3VX4A 4F85A 4RTQA 5AKYA 1JJAA 1JIQA 1YBMA 4AJJA 5ABPA 4JUBA 2IW3A 1UP7A 1BA3A 3RU9A 5JCOA 1QCZA 4V0NA 3VC2A 4E5SA 1ZFNA 1FNSA 1O96B 1XLTC 2PFSA 3I92A 4L6IA 5CLIA 1OH5A 4HHEA 4OI1A 4JODA 2DUMA 2ZULA 3UJ9A 3ZDZB 4J0CA 4TXJA 3WFIA 2R44A 4Q00A 2FSFA 1G8HA 3H2JA 4GE3A 1NF9A 3FWYA 3RIGA 7YASA 2QRGA 3O8NA 4PBTA 4B3DA 1K8QA 1ODIA 2I7VA 3JZMA 1HO3A 4ZT3A 3QVXA 4BV2A 3OQMA 3ADBA 3I3SR 1BE1A 1XE3A 1R4AA 2WSYB 3AVOA 1Y1PA 2XZDA 3OZRA 1NN5A 4C0JA 3UMYA 1TU4A 2GYUA 4NOMA 3B12A 3PJRA 1IQ0A 3GEBA 4CTMA 3D31A 4DDMA 3WFZA 1TIBA 3KFLA 2GM4A 3J7TA 1E69A 1Z6ZA 5JD3A 3RNLA 3F6EX 1R4MA 4ZODA 2VDWA 3H5TA 4F1JA 2EEZA 5FCDA 4XARA 3A2KA 3X43A 1ZW6A 4X3OA 3S5JA 3JQQA 4FCVA 4E2ZA 1XYGA 1O7JA 4K9QA 1YVUA 2YOHA 3FCSB 3GAFA 1OYVA 1TVEA 3R6LA 4JVSB 4NFSA 4Y6SA 3TB6A 3TLGB 4RWZA 2ZI6A 5BWCA 1ZG3A 3A4IA 3BMXA 4U2DA 1AO3A 4J0EA 5J5AA 4ZVVA 1KDYA 3SF8A 4DFDA 5I7HA 2GZ2A 2AEEA 1SMKA 3PC6A 3DOEA 1WP9A 1JIXA 2Z1MA 3KHTA 1U2GC 3W79A 1MB2A 3QMMA 3BE5A 2Z2IA 3QKSA 4LOKA 1BN6A 2DPYA 1P7YA 1WMDA 2NZWA 1BKSB 2P27A 1TW2A 3EQ2A 4F5YA 4CG1A 4RQUA 1O6ZA 1U8XX 2BONA 1B2LA 3CJQA 1H94A 3BD9A 3MWGA 5LMNB 4AJPA 1USVA 4I4TF 2ZT5A 4L27A 3FIJA 3I5MA 1SBYA 4BBAA 5JTUA 3QEJA 2IGBA 4P7FA 5FB3A 1JHDA 2M6KA 2JHCA 2NPIA 4LKOA 3WK9A 5ADHA 3C3BA 5JATA 3RRZA 3LJKA 3G8CA 5CYOA 3RSLA 5IHXA 2XWJI 3ZJ5A 1LDEA 2PIAA 1XMOB 4TUYF 1OAOC 1OZGA 3JQGA 4GLBA 4P35A 4R3WA 5E4JA 3JYLA 1MXFA 1IXZA 1RXIA 1L1FA 4F8EA 1WKVA 4JQOA 4Z51A 2P6RA 4YJGA 3D7SA 4M9SA 4R68A 2YH2A 4G1UC 2CVQA 2QPLA 2OGSA 3OWXA 4G0ZA 4X45A 4K5QA 3V1KA 1KQ3A 1W5EA 2R87A 5B57C 3RTAA 1ML3A 1T2NA 3KJNA 1NY6A 2P40A 5CLGA 2PHZA 3AVVA 1QC5B 1MU0A 1RMQA 3VNQA 2CC2A 2Q8NA 5LA6F 4CF5A 3J80A 3KT3A 2LP4Y 4JJEA 4X44A 3UHAA 5IVPA 4D0GA 2BKEA 2G04A 4MUAA 4XB2A 4LISA 4RF3A 1NZFA 4I19A 3ZCUA 4BVJA 2XHEA 3BCRA 2YHUA 2VT2A 1X1RA 1XZ8A 5T4BA 3TUZC 2Z09A 4P38A 4XUCA 1VLQA 4L50A 1U3WA 4DILA 1NL3A 4DLRA 3EEYA 3DMYA 4OUKX 5T8KC 4RTSA 1QK5A 1M5TA 2F8LA 2FXVA 3FVWA 1Z06A 3SEFA 2R1TB 2CLDX 1RJGA 3BILA 3Q3CA 4US1R 1DQNA 4WKOA 2JEYA 5AI8A 4YAIA 3B3FA 1NP7A 2PRYA 2V9PA 3NV9A 4FT2A 3E9YA 2IEIA 3AYZB 4D96A 4DLXA 5DV9A 2GM5A 4CIXA 4E2YA 2QPTA 3FDIA 4EKIA 1H0HA 4D4MA 2V4MA 4LY0A 2CNLA 5BVHA 2CNBA 3C6XA 1SU6A 3IQGX 4RJJA 5KNLA 2WWTA 2FOLA 3IV9A 3O82A 5E4TA 1UC5B 5FOSA 3T3PB 5JV5A 5F1KA 1V8FA 3MB8A 1NR7A 3C7CB 5KNBH 2FN7A 4CNBA 5UKDA 2QJFA 3TQCA 3OIVA 1IZZA 1P3DA 1RADA 2OILA 2Q27A 1K6XA 4PCAA 1VJDA 3M6AA 1CR6A 1XTZA 5FTWA 3PC4A 4RGBA 5K3AA 3STTA 1O0BA 1ZAYA 5FULA 1RXWA 3F3KA 3IR6A 1QBKC 3QLTA 4IFTA 4ZOBA 4AYXA 1WXIA 3OTQA 1TEHA 1ZGHA 1UUFA 4E07A 5JQGA 3OZEA 2J9XB 2Y1KA 5EE1A 4EK9A 4UDXX 2GXUA 4PLGA 1VA4A 4DNPA 3CPEA 1SOWA 3KT8A 1PQUA 1S7CA 2JS7A 2VEDA 1T4CB 2PXHA 3FFAA 3NC1C 2J30A 4M1EA 1R6TA 1UT8A 4BYMA 1C8KA 2IEGA 1G8JA 1UJMA 3BKXA 3C7DB 3EDCA 5JR3A 2XRMA 2XJ4A 2PX3A 3SMQA 3KQMA 4OYRA 3B9PA 1MC1A 2PL5A 3IOBA 3HB4X 4GM4A 1ZA2A 5F51A 4Z4IA 5JT1A 2CUTA 1HEIA 4D0RA 4GL2A 3F71A 1YMUA 4CNQA 1C1HA 4NFYA 4PLFA 1Q5PA 2B30A 4MS1A 3NBAA 4NYIR 5ALSA 4ZEXA 3OFKA 1V6CA 4BP9A 3P32A 4ZI2A 1R0SA 1JA0A 4F46A 4DG8A 1Q19A 1PT7A 1H2WA 2AN9A 1FF9A 13PKA 1IZ7A 2Q50A 2VATA 2OBNA 2ZRAA 4H1HA 3IGFA 1C3EA 1G5RA 1M2FA 2PKRA 3L7LA 1U5BA 3F3MA 3QWBA 4IO0A 5AI5A 4RVDA 4CN8A 4J0DA 2B36A 5AH0A 4N8SA 2X4DA 5AR1A 2WU4A 4POAA 3MSXA 4C01A 3ZK7A 4I3FA 1OX4A 3LS2A 4G84A 2ILTA 2ORWA 4C6TB 1JLLB 3FRHA 2BKLA 3ENWA 4RIEA 3TFWA 1USKA 1XNGA 4M1WA 2F2TA 4RELA 1OY1A 2OGTA 3ELWA 3GLVA 4UUNA 5DNAA 2CB0A 2V9CA 3ENZA 3OA2A 1E5VA 2CFRA 4LTDA 4ND6A 4U2BA 1VIAA 3HWSA 2LIVA 5EY5B 3HXLA 3FFXA 3HYRA 1GPJA 1EWRA 4ZVLA 1J21A 1DAKA 3E1KA 3RDPA 4ADSG 2WYIA 3ACDA 1L3BA 1ZVJA 3QE4A 3T5DA 5CFOA 3CIFA 1UMCB 4QO8A 3U7GA 2O54A 4GYKA 3EZNA 5JADA 1D6SA 3P0EA 4K03A 3AR9A 1IAVA 4TRMA 3OQVA 3CRVA 1TAQA 1EG2A 1PGNA 4ZHQB 2CCKA 4LDZA 4N6NA 3E03A 3HI4A 5D8DA 3O4FA 1D4FA 3B6ZA 3H75A 1IUNA 1QK3A 3PNBA 3I52A 4BJ5A 2BEWB 4HDRB 4RS4A 2DCUA 2AF3C 5JALA 2ZUFA 3COSA 5IJXA 1J6UA 2TSYB 4XQCA 3IIKA 1Y9ZA 4HLUC 4YCDA 3WLPA 3DM9B 1J1UA 4ESVA 2CVHA 1WUKS 1YOVB 3PVCA 4TLMB 3RSOA 3PFKA 1X70A 4LVUA 5LQRA 3KYDB 3WGUA 4B44A 4AZVA 3VZDA 2AX3A 1H22A 1BAPA 4C04A 4F2WA 2DTXA 2GCEA 2XB2A 3D2AA 4HMQA 2R8PA 4EUEA 1F6WA 4JS0A 5ESDA 2CK3D 2PD4A 2ZI5A 4L4ZA 3DZIA 3OC6A 1S8FA 1Z0AA 5KEIA 4OK3A 1KVQA 4BNTA 1CZKA 3D0RA 5HKKD 1QG4A 2P91A 4IOJA 5KPDA 3TEJA 2RGBA 2BZSA 2G09A 2XMRA 3BXGA 3IIIA 3CN9A 3OLZA 3LQ2A 1P45A 3H1TA 4BNDA 1FTWA 3OT5A 4O3FA 1FLDA 3T3IA 3N6RA 4ALNA 3EH1A 3IBTA 3U5TA 2X1MA 2YZ2A 2A3NA 2OHIA 1Y9EA 3JYNA 1HDXA 4WXRA 5F1PA 3WGOA 2GBFA 3EQ9A 4ZI7F 3BGVA 3GBPA 3QQ5A 4DEXA 1Z4IA 4UULA 5D3MA 3WRYC 3CNNA 3L79A 4ABYA 1ULAA 5HUQA 2BRUC 2GO7A 1Z7GA 1N4DA 2B2NA 4O33A 4QULA 5F35A 3PHBE 2H6EA 4JELA 3C97A 1SA0B 4K6HA 3MCAA 3CZRA 3PHLA 4RK7A 4EF4A 3KVYA 4XYBA 2C5SA 1VIYA 2JPDA 1GUBA 4XDHA 1ODCA 2DB3A 2BI8A 2O3SA 1F6DA 5DX8A 2YXLA 1VMDA 4MUKA 4QPCA 1SQFA 2VXOA 4CM5A 3SWWA 4NICA 4IV5A 2GERA 3ZHTA 3GP8A 2R00A 2D3WA 2F4NA 2B69A 1Q17A 2PMBA 3KHKA 2A33A 1XHFA 1SQ5A 5NULA 5KOHA 4EUKA 5LA6A 4TQ9A 1IK4A 4HAXA 2QKYA 5CD9A 4H1TA 4DB4A 4GOKA 4AJIA 4ZYXA 1IUKA 3H18A 1BXGA 4PAWA 5KYUA 1WCXA 5JSZA 4L8GA 5DHQA 2D1QA 3W6UA 4J7CA 4NSNA 1N4AA 3FPSA 4H7DA 3U7QA 3X1ZA 4WW0A 1V96A 4QTUB 4B0OA 3UYKA 4EA9A 2VHTA 3VR6H 4NMLA 2G4VA 3ANMA 5JMOA 3Q7IA 1XMVA 4GS5A 1R37A 2GK4A 4F06A 5EIBD 1DVRA 5CB4B 5HBRA 1YS9A 1A9ZA 5I7AA 3T3MB 5C2JB 3IXQA 3CB4A 4P36A 4P53A 2EOAA 4CMJA 3UGJA 1JQLB 1N8TA 1VI5A 2A0FA 1GZ7A 2QAIA 2XYHA 5ALGA 2HN9A 4OJYA 3WGTA 1TEZA 4F4HA 4KBGA 5KUTA 1IY9A 1X7WA 1DLIA 4LJAA 4MQMA 1DBWA 1XZNA 2ZS7A 4IPTA 4YGYA 3TJZA 3DMRA 5AVZA 5EXTA 2ZIXB 4MYSA 2B34A 3NNSA 4CEIA 2EFCB 1S3IA 2L0XA 3OZTA 4MR7B 4N3AA 5H7XA 4NCXA 1IXYA 1QYIA 4G4GA 3WQHA 2JJQA 3SVLA 1ZS9A 1AK1A 4P4SB 3ZU3A 4YACA 1P33A 5CT8A 1KQGA 5B4VA 3RBAA 2G70A 3EB9A 4RW0A 3ZYZA 2DR0A 2Y1OA 1WBBA 3HTXA 2R66A 2ZSEA 1N5IA 2VNJA 2ZBVA 4G41A 4TTSA 5CDGA 2A58A 2VF5X 1UOPA 4IXDA 3D54D 3IBFA 2ZQYA 3SJZA 3WS7A 3DMTA 4HGOA 1VP9A 3AOGA 3UZUA 3QVUA 3QY0A 4IXNA 4F9EA 2A30A 2P7HA 3UK0A 4D9KA 4V0MA 1PTJC 4RY9A 4HDSB 1UMDA 2Q0SA 1KP3A 4REQA 3WMXA 1EP2B 5M34A 2JAPA 4N6OA 1MPTA 4D8XA 1IU9A 2FZKA 3H5OA 221PA 3ZK9A 1M3SA 3PRHA 4LJSA 4G1FA 4FBGA 3EBLA 3ZGOA 4XAQA 3QLEA 3IR7A 3ZDAA 1HNWB 3ML1A 1YU9A 1HNZB 1IHUA 1RM5A 2ZAMA 4XJTA 4BNLA 2J33A 4RENA 4U9HS 3FGNA 4HWTA 3VHLB 1XZDA 3DA8A 3HDTA 4OJQA 4IJKA 4MVJH 1ARZA 3WLRA 4A0RA 4ZTUB 4H3KB 1CYEA 1VI2A 3BK1A 1ATIA 1E1CB 4PR0A 1PN3A 2AF4C 3M6LA 4MEBA 2JGNA 4RBNA 4PE5B 2NU8A 3VZRA 1PW7A 2IELA 3QWFA 3HLYA 4P98A 3I2GA 3SVZA 5A1JA 2NXJA 2VJAA 3JQFC 3H5WA 5KTKA 1XPRA 5GWXA 3BZUA 3QUCA 4F9GA 5BWBA 4BUJA 3AVXA 3W3AD 2YJ5A 3MD0A 1NXVA 1TTQB 2G5CA 2GM9A 2OEPA 5C8ZA 1RM0A 2EFHB 2WIAA 4LWOA 2R8EA 4MITA 3RH0A 3T7SA 3U13A 1MPXA 3DO8A 1VQ1A 4WCFA 2UU9B 3LAWA 3QBDA 3NTOA 4PGMA 3MLEA 4UZSA 3UMGA 4ARZB 1L4HA 4I5EA 1SVUA 2IXBA 1DAGA 3L43A 2FEPA 1LX7A 3BE4A 1L7MA 3NWEA 4HRXA 4OGLA 3WGMA 1F5NA 1W85A 5JBIA 2BGUA 2TRSB 4DC1A 3EVEA 1S8NA 2V7XA 1AUXA 1EA5A 1UH5A 3HUTA 3HZHA 4OM8A 4W5TA 4KX3A 4A0HA 1JIKA 1SM4A 3C3JA 5L4LA 5FR1A 1QC5A 1XP5A 2CNOA 1LGYA 2G9ZA 1Y5RA 3QKWA 3O8BA 4GYJA 1IN5A 1DBVO 2B7BA 3VYRB 4OSOA 2ZRCA 1RPNA 4C7KA 1G8KA 1ZPDA 4RVCA 3VNSA 5JJLA 3KT0A 4PZDA 1B0ZA 3ZHOA 3WRVA 4YMGA 3EA5A 3W9SA 1VIVA 2YHIA 4I6JA 3SS7X 1I2CA 3BIFA 2JAOA 4G5HA 3ZV7A 1BYUA 3ESZA 3AKDA 1L4BA 1WCYA 3TLGA 1VHDA 4D3FA 2GBLA 4DV4B 4B7CA 3CZ5A 2XZOA 4C4XA 1O5OA 4K9KA 4EKDA 3D6VA 3N28A 2XCTB 1CUUA 1SHZA 5E6UA 4CDRA 3ZVLA 2AOVA 3QYAA 2IEBA 3GC6A 4O25A 4BL5A 4NBSA 2G0NA 1Z22A 1GCUA 4MZXA 1JAIA 1UQUA 3QMPA 2EG9A 3F49S 4GPAA 2BUAA 2CB9A 5FLYA 3WLOA 3IUJA 5E2IA 3EIFA 3ZZ1A 4CR6A 2GJKA 1RP7A 5JS7A 3OFSA 1U0JA 1L4GA 5IARA 4O29A 2P68A 1JKJA 2CEKA 4ZVUA 5EWMB 3MOIA 1Z4OA 3OWOA 1H65A 3AF1A 4XGIA 4UHKA 2GF0A 4UNPA 3GLIA 3ROFA 4MV1A 2HW8A 3TQQA 5EMJA 1RPAA 2DECA 1PV1A 2VWPA 3KEGA 3TXAA 1QP4A 1NYRA 3TSYA 3OCCA 3CX7A 3E18A 4KWHA 1V2GA 1UT5A 4WKCA 3SIWA 1QF6A 4TL7A 3PDCA 1VMEA 4BNNA 1L7PA 1EWQA 5AOCA 1TAHA 1XR3A 1JEOA 2P9TA 3O4GA 4I81A 3HO8A 3JXEA 1OILA 3OECA 3I2HA 4GMFA 4U7JA 3ZLVA 5LDGA 3TTSA 1R88A 4DJFC 1DT3A 3X1JA 2HBQA 4YDQA 2HXSA 2NSJA 1UK8A 1YZNA 4HUQA 2CDCA 4L8VA 3BSSA 4N7RA 5E9WA 4ZALA 1Y6FA 3C3PA 1BWPA 1KJ8A 2AQIA 2WQZA 3BZWA 4UM9B 5TGZA 1E1RD 1JWAB 4WA8A 2FY8A 2ZVDA 1VGQA 3ASVA 1US8B 1D5CA 1ZRSA 4TGLA 4WEQA 4W9MC 2I76A 2QP3A 2WJVA 4FDTA 3SSAA 4LF7B 2VWGA 3W5SA 4BYGA 1CV2A 1QVAA 1EVYA 3KJHA 1CR4A 3KB1A 2H85A 1BFDA 1GRNA 2BBOA 3JWIA 3MTIA 4IJQA 3TB4A 4BGEA 3DBRA 1VHJA 4Z9YA 3T1QA 2Q2QA 1GDHA 3E53A 1A8SA 1AN9A 2EL7A 4KTVE 4NX2A 3DJFA 1E63A 4W6ZA 5FWAA 3ND5A 3K5PA 1SKUA 2GYWA 1MW9X 2YZMA 5EWJA 2C1EA 2JBHA 1MJGM 1PW5A 3ESXA 3K6KA 4FT4A 3KKQA 3T5BA 1ZAKA 2B9EA 1D2MA 1YKFA 2R1TA 4BFCA 2N42A 5I4CA 3QFHA 4QFMA 3IQHX 4DRZA 4E11A 4ETNA 2ZM5A 1U0NA 3RANA 3MUFA 4A92A 2PLWA 2A5GA 4LY3A 2FFHA 1WPXA 1HYBA 1FL9A 3EZLA 1GEGA 5K3OA 3BWVA 1ULBA 4PZLA 3DD1A 2Y27A 2XR1A 1DZ3A 4D79A 2GEJA 4FFNA 3F7TA 3JALA 4IDEA 3Q5DA 2SNIE 4K3UA 4E1VA 2MINB 5B3JC 1TYAE 1FVOA 3ICWA 1CJMA 1JR3D 3YASA 1MF7A 1N0UA 6ABPA 1PVVA 4HXGA 1Q1EA 5B53A 3WLSA 1HPLA 3VMMA 3UAYA 3NYQA 3MLAA 2YHAA 4RSHA 3CG4A 1C0IA 1CUAA 2R97A 4RZQA 1PUJA 2WA2A 2PR2A 1NBOA 2I8LA 2WF8A 5FPPA 1WU7A 4EJFA 1J0DA 4PZPA 2FWJA 3L6EA 4O5OA 4F1WA 2HOQA 1QH0A 4AG5A 4DEYA 1HE4A 3D8HA 3QUTA 4TSFD 2V8BA 3HB0A 4D57A 3X44A 1SXPA 3VV2A 2HKIA 2ORVA 2ZJFA 4UEWA 5A3QA 2ZB4A 3H42B 3N0WA 3O5AA 1NUUA 2PPVA 3DPIA 2ZSFA 3OOEA 3RO7A 3U56A 2YS6A 4GUAA 3KUXA 1XKTA 3TJMA 1NQ5A 1ST2A 2BBWA 1X80A 1YR7A 4X91A 5COAA 3E3MA 2G9UA 2AN3A 4YMIA 2BELA 1Z18A 3BKWA 4JB0A 1L7BA 1ESDA 2HQRA 5DBOA 3ICVA 2OVFA 2WM2A 1GGMA 2WG0A 4MROA 2RGEA 4O4IF 4AX8A 7MDHA 1HR0B 3JQPA 5EN4A 3VBEA 4K9SA 2ORED 3CF6R 4RPJA 3C15C 1B74A 1U8CB 4X8OA 3LY9A 3N3BC 4CKYA 3C3CA 3QTTA 2XYVA 4DEVA 2V7QD 3OBBA 4Y1EA 2PGJA 4DV2B 4FOSA 7ADHA 3L18A 4A16A 2HHAA 4PZYA 1ECCA 5CFLA 2ECPA 3EEIA 4S1PA 4B17A 4CCWA 4WACA 1WZNA 2VT3A 4UU0A 1P2VA 5AI4A 5CW1A 4O2BF 1T4GA 4FDAA 2N47A 3KYCB 5FQOA 1YZQA 1FB5A 2OC4A 1OI3A 2TYSB 4OGKA 2JG3A 1YE3A 3DLPX 2PT6A 5L7WA 1GCIA 1RAGA 3KPVA 4JT8A 5YASA 4I1VA 2ZBPA 1ADBA 1V26A 1KTIA 5LDDC 1R3UA 1JEQA 1TZMA 4MWBA 2CV2A 1XAIA 2DTEA 4Q34A 1C5KA 2CZCA 3ANXA 3SCZA 4DMLA 2Q41A 1DAMA 1XVUA 4EELA 1REQA 4OA5A 5K0JA 5CVDA 1UMCA 4YS6A 4Z3DA 4RFVA 1JG1A 5EXDA 1DFIA 3UB2A 1U98A 1GU0A 1EZ4A 4LJ5A 3REFA 1E8DA 5DHTA 2YMMA 1C7ZA 4NPCA 1Z4JA 3A1NA 3W5VA 2BRUA 1LPMA 1QH1A 3FHTA 5BNTA 2J3QA 4RK4A 2D5CA 3X1MA 2I7DA 2D2VA 5IZCC 2O6HA 3QJYA 2BDEA 4RXMA 3HRIA 1G38A 2IIQA 4MVJE 3DV2A 5DDIP 1ZRHA 4DCPA 3ICPA 3FWKA 3H9GA 4PRLA 3GOHA 4JJKA 1L1EA 4KWTA 3L8DA 2IYFA 1FRZA 2RGCA 2XT6A 3HPRA 3ZCXA 4ZHQA 1C7EA 4TL8A 3H4TA 2BJWA 4FYVA 1ZGCA 2X77A 2Y9MB 2YOGA 3PCXA 2CXHA 2GFHA 3HB1A 4TV9A 3W90A 4Q16A 5CAEA 3ZWBA 2ZZNA 4OHXA 2X0DA 4YAUA 3K4QA 1T0BA 3KQYA 2AXQA 2PQ0A 1E6WA 1SZCA 1Z4KA 4XVCA 3ADDA 2XXAA 3WDKA 3WZLA 4YT8A 1XQVA 1Y1TA 1JG2A 1FLVA 1LFDB 1TDJA 1PYOA 1JUDA 3BMQB 1TQ8A 1X1SA 1FJ2A 5H1YA 4RIFA 2OAQ1 2C2HA 4QOJA 5IK2D 5TMPA 2XVZA 3P2MA 5LYJB 5CB6A 2Q46A 3KU1A 4WBXC 4DBLE 2ZCUA 1KY4A 3TW4A 3F6PA 1DQRA 2GO1A 2E55A 3TQRA 2YX1A 3HJGA 1XNQB 2D3TA 1VLZA 3IE2A 2AMVA 3K2BA 3G1TA 4S3MA 4HWPA 2C61A 3V32A 1Y8QA 2I5PO 2RHGB 2ISSD 1EX6A 2RKOA 2W0SA 3P71T 5JQWA 1UMBA 3EGXA 4D0SA 3VA7A 4M9ZA 4E2WA 4IG4A 2JEZA 2II6A 1TD9A 4BB9A 1GAXA 4LXYA 4ZO4A 1DS6A 2QR2A 4YO7A 4RHEA 2QGZA 4KREA 2ODTX 3C3EA 3K0FB 5B7QA 5DO9A 4FOLA 2FA9A 2YY5A 5DH9A 1RNLA 1N2EA 1ICIA 2O2YA 5L3SB 2JFWA 4IJ6A 4CMKA 1K6MA 2ZUVA 1XKXA 1I7SB 3ZWOA 2VOEA 5AHWA 3P97A 5IMBA 1LV7A 4D45A 2QA5A 3ECSA 2PUVA 3LTNC 3J81k 3GEIA 3L49A 3REQB 2FZWA 2VC2B 4AKSA 4EYQA 3BK7A 3I6YA 2PWAA 1QTNA 1IB6A 1T9DA 1YZUA 1R6AA 2YWDA 1XO1A 3HCNA 2PN1A 1ZI8A 2I3GA 4C2UA 3QNUA 4GMHA 5E6RB 3SQMA 3JZFA 1WHTA 3GY0A 4I36A 4FFDA 4XM1A 5BW8A 3MFYA 2C5AA 1V1MA 1C1DA 2VK1A 2J3LA 4RVFA 5CYFA 4D97A 5K99A 1PWZA 4BLSA 2QRVB 4CTJA 3D1LA 2B5OA 3Q8WA 2JAXA 2PFKA 1QIIA 1XJ5A 1FSGA 5JYBA 2CVOA 4D1YA 4PNEA 1XMSA 4E6PA 1ZK2A 4Y2SA 1CY0A 3LFUA 4NZPA 5A9TA 4AZ3B 5KQSA 3AVQA 4WZBA 3ABZA 5HK8A 1QPZA 1DEHA 1I1HA 2JD2A 2PX0A 3LUKA 4QOGA 2MHCA 3W9BA 4KUHA 3OT4A 3UKJA 3A58B 5MGBA 1AK9A 1VJCA 4S04A 1ZOIA 2RGXA 1ECJA 3S4YA 3VPCA 3E5RA 5KTMA 4KPYA 4OX9B 3WLEA 1FFWA 1JR3E 1MVNA 2WF7A 2PKCA 4BWFB 2DX7A 1PDOA 2ZDHA 1RKBA 2POQX 2Y93A 4NEQA 2F3PA 4KQKA 1OAOA 4P4SA 3RIYA 2HI0A 2LXNA 1B3RA 1EGVB 1TT5A 4MCHA 4IW3B 4BVEA 5CM8B 3K0CC 5EE3A 4WI1A 4HFNA 5HA5A 3CZPA 5TMDA 2LCFA 2ZUSA 3R4CA 2FRDC 4PHCA 3W8FA 2OT3B 2KPOA 1MRZA 3DP7A 4W63A 3S2UA 3ZCPA 2IV7A 1GPYA 2DF8A 4PSUA 4G3XA 5AVQA 4PLVA 2WRZA 4KQIA 5F12A 4M1TA 2KBFA 5F9FA 3QKRA 4FBLA 2HSWA 3N2GA 1J39A 5A6SA 1AHPA 1MIOA 3F6BX 1ZCJA 2DRIA 1GXSA 5BOSB 2PFGA 3WB0A 3VH2A 3AR3A 3HI6A 3TLYA 2Q3CA 2JGFA 2QSZA 3RLIA 2FGKA 4BVAA 1TTPB 4U8HA 1ZHFA 1C8BA 3N2GB 4KAJA 1C14A 3DOOA 5LYJA 5E1MA 2GBPA 1KH1A 2RMKA 3HVKA 1GU7A 4XCQA 5JD5A 3KQNA 4KQGA 3TZLA 4QARA 2ZTVA 1JI0A 1Y7IA 1PCXA 2X0KA 2BTQA 3RGWS 2VPXA 3R7NA 1XTIA 2JJ8A 3LBAA 1J70A 1XMIA 2VUSA 3N05A 2AJ8A 4L5AA 1DARA 4XVHA 2P67A 1J0EA 3C8UA 2I7XA 4FW9A 2BGJA 4NZNA 3RAEC 2BE9A 3G68A 4DLVA 4D9EA 3T1YB 2IYEA 4WOPA 1QRTA 3D9QX 1E5LA 4I55B 1H2XA 4REOA 3K1AB 2A1UB 5T4HA 3T61A 1Q0LA 3TLBA 2WFLB 4R9RA 5ALHA 3ESDA 2GDZA 1JPNA 5AVWA 4J2TA 4Q7MB 1A2BA 1YF3A 1BU5A 3OFJA 3OQBA 1CRLA 4P8RA 2C97A 3DNPA 2BEUB 4Q6WA 2Z3VA 2JJ1A 4AN4A 1C0PA 3CPSA 3DDSA 1K6JA 4J03A 2MYNA 3IAM1 5LBUA 2QP4A 3QEOA 4H4DA 4MUJA 5EYPA 2OZLB 3MMXA 3GJ4A 1LZKA 3Q1LA 1ULHA 4DXHA 4JVOA 1M8PA 1X7GA 3KCNA 3KCQA 1NSTA 3RAPR 3RAGA 4BHTA 2J59A 3D81A 4HMPA 1X39A 1XZQA 1MQ9A 1CR1A 4FR5A 4HDOB 1K7EB 3RHTA 1K2VN 3TNDA 2JF0A 2OFOA 4BKUA 3Q3IA 1CUGA 2OENG 1N92A 2QN3A 5JBNA 2GZ3A 3OUTA 2GPWA 2FQQA 3QLUA 5HF5A 3C6KA 4LY9A 1JPUA 3KR2A 4Y2VA 2J5XA 2DETA 2ZB8A 4IVQA 4RJ2A 1G5IA 4MYHA 1IY2A 4MRAA 5DRTA 3GFVA 1C41A 4PVDA 3ZWXA 1II9A 2CMHA 1SCUA 2JARA 5ALWA 2WU8A 2Y0PA 3SS8A 1WUYA 4EHJA 3WJ1A 3IP7A 2H5IA 1U9JA 2OESA 2NM0A 3EXHA 4U6SA 3SHQA 1UQTA 2V55B 1EFHA 1OLSB 4WINA 1NJ8A 5JMPA 3RODA 3EYWA 1JZTA 4QEDA 3A6FA 1X14A 3KX2A 3WAGA 3M3PA 1YV9A 1R66A 4RSMA 4INJA 1JIUA 3LYHA 5BW4A 5C18A 4J0KA 3K0KA 1FEZA 3EZ7A 3G23A 4UASA 1J06A 1L4NA 1QV9A 5IC6A 4TYWA 2W5UA 3CURA 1WDMA 4MW0A 1AT1A 4QSMA 3RS8A 3F98A 3ZWMA 4CM1A 4JGBA 2DR3A 3L7MA 1PEAA 1PNTA 3VSEA 1TZJA 2LGJA 5BQXA 1W5TA 1ZUIA 4HDKA 4M83A 3TCKA 4EL0A 3BH6A 4DRXA 3Q72A 1NF2A 5TJ9A 4C03A 1NP6A 1NW7A 2OOKA 1GGJA 2LPMA 4OVKA 3EXG1 5AW3A 3A6DA 4MB6A 1J90A 2JI7A 5MN6A 2BFBB 2VHZA 5DRYA 1SHUX 3V7FA 3A6LA 2AG6A 3NT4A 4EY4A 2RJ3A 4K28A 1BQ4A 3IKLA 3R5TA 4EH1A 1AD2A 1LJ8A 1RPZA 1UBLS 1WF3A 4ME6A 1Y3FE 2R11A 3G9XA 3HWWA 5LR6A 1MZPA 4XIYA 3QVKA 2FG7C 1JJFA 4L76A 5EIOA 1VHQA 4F4UA 3CIOA 1C2TA 3HY3A 1EH5A 1Z6YA 1YZ3A 4X1IA 5DI3B 4XSHA 4M21A 1GA4A 3RSHA 4DUGD 1M6VB 2CHFA 4M0KA 4PG8A 3RC8A 3PUJA 4Q3BA 5H02A 5BN3A 1NG1A 1OF1A 5AVKA 1RWOA 1CIJA 2G8LA 4WPGA 4BX8A 2Z5FA 4CG0A 5KWVA 3EVNA 4OXKA 5IBPA 3RTDA 4RYLA 1R00A 1TO6A 3U81A 2QZZA 5J4KA 3BMNB 2ZB7A 2OSVA 1C3OA 3OZBA 4WBNF 3Q98A 3ODGA 3S8EA 2H4JA 3KEQA 4R2IA 3TIVA 3IDZA 3K30A 1P2FA 2RFLA 1Q21A 1YD7A 2CHQA 3NEYA 1TZKA 2R1VA 3QA9A 2QJRA 3Q8XB 3U7QB 2QD3A 3VTFA 4E5NA 4EPWA 1CY6A 5IM4F 3N8NA 1JEEA 1NGSA 1YB6A 2IBMA 2WWRA 4P7JA 3ZVKA 3R7SA 3JY6A 3PTAA 4L95C 4BGVA 1UPTA 1D4AA 2IVZA 2YXDA 4B2YA 1HLDA 1KJWA 1M2WA 4Y2RA 1N2SA 3AG5A 1GQFA 3QK7A 2QMQA 2QNRA 1KJYA 4PCLA 4KSCA 3ZX4A 3JATA 1B14A 4LHXA 1JA1A 4EF5A 4I9FA 1LSUA 4WCDA 3OLWA 2BEWA 2ZAYA 4HDRA 9ATCA 2DP4E 1UBJS 3LUBA 3GN2A 4TSRA 3RAFC 4GR5A 2Q2VA 1ESNA 3D8RA 2BMVA 5AK4A 3W7VA 3W8DA 1ZUD1 2NV2B 1SD2A 2J7PD 4W7IA 4F8YA 1OBVA 1GLVA 2O1EA 4MVXA 3KC2A 1OZFA 3R7FA 5FLKA 1RPTA 1TJPB 4YMTA 1NSFA 1CHNA 2ONCA 2WLSA 3B85A 3DULA 3UAGA 1KJ9A 2M1ZA 1ZLYA 3HQ4O 5L3ZA 3T3GA 4C6HA 3C3DA 2NO6A 4B73A 1NLFA 3FCOA 4JSRA 1ECFA 2XJ9A 5LU8A 3H9QA 5JOQA 4FEGA 4I9NA 1XBTA 4MGYR 4IHKA 5C3UA 2I6FA 2G9NA 3JQ7A 2WMNB 3H5AA 4JIGA 1KK1A 5JDIA 2ZJZA 5AHRA 4MVCA 3WRXC 2NSHA 4BX9A 2WDPA 4C2BA 1JFFA 3SHTA 4RHCA 2DWPA 2R86A 2ZPTX 1JSZA 4JHXA 1X2BA 3F5DA 3KM0A 5DJ5A 1KGSA 1OWPA 2AW5A 4MQUA 2OKGA 1LPAB 1XFAA 4W1PA 4Z7OB 1X80B 1I0IA 2FEOA 4ZXFA 3CRQA 2E85A 4BNVA 1T2UA 3QF4A 4NBRA 4YPFA 4Z4HA 3PUIA 4AJHA 4RPLA 3GT7A 3IA2A 1G59A 4MA4A 2V6MA 2VWQA 3MBIA 3PXDA 2GAAA 4ISCA 1B00A 3SC2B 4D2IA 5HW0A 4ABTA 5JSFA 2Q1UA 1J8YF 2NAPA 3KLBA 4BO4A 1YRBA 4ZD6A 1I4LD 4QD3A 1MKYA 2I29A 2I8CA 4IGFA 5E4YA 3L6UA 4K81B 1U9ZA 5EKSA 2DUNA 1XMPA 1OFTA 1HLPA 2PZ8A 4X1IB 3O84A 5KAPA 3JQ9A 2ZBEA 5IC5A 3FWNA 3HNOA 5CA1A 3D5EA 2Q5EA 3AEZA 3IVXA 1GTJ1 1XEWX 2NUBA 3IQEA 4R84A 1G20B 4A8JC 4F93B 3BXZA 1TKCA 2GCIA 5BP7A 5AW7A 3ESQA 5DEOA 2OXIA 3DVQX 4ZT6A 2GMWA 4C3ZA 3IPAA 3GELA 4MKXA 3SIRA 3ZZ0A 2CKMA 4JD5A 4JUDX 4ZVMA 1NI4A 1MDBA 3CW2A 3TCXB 4ATNA 1DMRA 1R0KA 3OO1A 1W8DA 3DR3A 5CBKA 4MAFA 1YJ5A 4R0MA 4DB2A 4ZCTA 4BEJA 3KLPX 4V1CB 3I4LA 2YYAA 3FNQA 2XGJA 5E1BA 2E3JA 4JBXA 1C30B 5F1OA 5LP6F 1XCMA 1XMXA 4TV9B 3SOZA 4PZZA 4NYMQ 3C3KA 5CDFA 4TT3A 4CM7A 2YZGA 4CIBA 1NQWA 1UBTS 4HZIA 4DYDA 1DAIA 3T95A 4OUDB 3M9XA 4LDPA 1S02A 1ZGJA 3D5TA 1JR2A 2X5NA 3QSYA 2CMKA 3EVTA 3ZTTA 3IAHA 3OZDA 1VPWA 4TTVA 2AFHE 2TMYA 1B2RA 3BF7A 3AEQA 3ZEAA 2XWBF 5HQ3A 3B1YA 1KMMA 2VHQA 2HLPA 4QYMA 2B8EA 3ESYA 2YFYA 1DBQA 3KOZA 3S55A 3EZ6A 4XWOA 5LP6A 1E3MA 4YC7A 1H3FA 2WA1A 4KQ1A 2W2TA 2YY7A 4Q1EA 1D5WA 4RY8A 1MQAA 2C84A 2X7JA 3Q6MA 4QOFA 5AK0A 4O4LF 2RHWA 3KUCA 4H59A 2HA7A 3GGPA 4KXVA 2H2IA 4RMJA 3II6X 4AJ9A 1VCNA 3SIPA 1NNEA 4OL9A 4KGXA 1JNYA 1XAJA 3H2SA 4TTPA 4UAVA 2JK1A 4OIMA 2YTZA 3WRWA 3WLMA 1OT3A 5CFMA 2X5OA 5EIEA 5K05A 2Z56A 1MQSA 3OTGA 3CR8A 5DASA 5FUWA 2Q7DA 3FZYA 4DKXA 2W37A 3DDNA 1I10A 4C20A 4KX5A 5FUXA 3DUFB 1ZHOA 3IMCA 4IUBS 4JQZA 2IUEA 3G5TA 3LUAA 4LJLA 1KAQA 4LY6A 3A8TA 4I5IA 4KYIB 4YQYA 4AROA 3EAQA 3GXOA 1Q15A 1FSFA 2PH1A 1XMJA 4FZRA 2BFOA 1QH8B 4Y2JA 1AKEA 4HQLA 4U3JA 4GLFA 4NK5A 2ZRMA 2BTOA 3H2IA 4EGAA 4FFBA 1V1MB 2WZCA 1YI0A 4LS3A 4B9EA 1IVNA 2O3QA 3U26A 2IZ7A 4RLQA 1YQWA 1IOZA 4B79A 2NXEA 3H6GA 2A78A 2N75A 3NANA 4YJ2B 1SRQA 1XF9A 5AK5A 3L6OO 2VAWA 3PUHA 2VCEA 2ZJ0A 1RJ9B 4LNUA 1R74A 3U4HA 3LVQE 4RJKA 1IPFA 1BE8A 4WBNA 2R1ZA 4I46A 2C8JA 2OK7A 2UKDA 2BH9A 2WJ3A 2YJGA 1QIJA 3N76A 5H59A 3RM3A 3A6HA 3AF5A 3MWYW 2LDXA 1JTVA 2V6FA 1R27A 3OF2A 5BVHB 4FHGA 1KK0A 4PNHA 2BGIA 4GECA 5C52B 2UZ4A 4N76A 1JFTA 3DZ8A 2OBXA 1SG6A 1GRVA 1UC9A 1R0YA 2H0QA 3C8HA 4BWGA 1GY8A 1YRHA 5LWQA 1YZTA 1JVBA 4OQDA 4RQAA 4LOJA 5A5DA 5ALVA 2VJQA 1EVEA 5CIQA 1T6YA 1QQ5A 2BN4A 1AHIA 4LK2A 2YC4C 1IULA 3IURA 1QWSA 3VHXB 4EFNA 1FQJA 3ITNA 2HU5A 3KYBA 5J4YA 2WYHA 1T0PA 3SGLA 3HGTA 3TW0A 3GLHB 2B25A 2YJTD 3ESCA 1ENYA 2XMCA 4N5IX 4RETA 2XE7A 3BXFA 3VMFA 5FNVA 3IQFA 3VYSB 3D8SA 3W3ZB 2MR6A 4HAIA 3T12A 4DCGA 4E88A 4TMKA 2XBUA 3Q2KA 2PU5A 3QKIA 1RQXA 5C8YA 2IU0A 1CPYA 1X8KA 1NT2A 3TD9A 5KVQA 3ZGXA 1E6MA 4HGNA 4BE4A 1T8RA 2LCIA 1YB1A 3F78A 1P2SA 5KYVA 4AMZA 4BB6A 3L1UA 3ANLA 1Y9DA 4OHBA 5T41A 2W0MA 1XNJA 2PZEA 3PFIA 2ZT6A 1EE9A 1YHZA 1Q92A 2DPHA 2GKSA 1ZYUA 1BXKA 3OH8A 3OE7A 3ORYA 3QHPA 2PBZA 2KE5A 4GNKA 4L4RA 5F2KA 5JNRA 1G8FA 2WJPA 4RMIA 4A23A 3QUAA 2GPNA 1BEZA 2IA5A 3AEKB 4ZVNA 1SHJA 4AWAA 5F3WB 1U0RA 3QWHA 1FQOA 3K9NA 1K7CA 3GT0A 1LTQA 3EZ2A 1Y80A 2QRKA 1LZLA 1HDYA 3DPUA 4GDMA 1S89A 3IVGA 1DO8A 2GHQA 2COUA 3LUCA 1WXDA 1SXJA 3ADCA 4DWVA 3ZI7A 4BP8A 1ODFA 2AR0A 2R65A 1GU1A 3LDUA 2XQKA 1U0TA 3QPWA 1S4MA 1R12A 2AK2A 2GPBA 3LK7A 1G6HA 1LI7A 4LMAA 1S7GA 4M4SA 3TNJA 1SUDA 3R7LA 3I9KA 1XWWA 3KXPA 5LP6B 3RJMA 4MR7A 3U17A 4YRLA 4ITUA 3FHCB 4WGFA 2VUTA 4Z4GA 5NLLA 4ZCSA 4CKCA 1JEQB 1Y8AA 5A7GA 2E6UX 3RRBA 4GOOD 3HBFA 3TNFA 2O5EA 3KSZO 4MHOA 1SVWA 5HEKA 1WCV1 2G5TA 3GAAA 4EZBA 3PEWA 1P1HA 3A1DA 1I3CA 1L5YA 4IF4A 1NBMD 4TWBA 1GO2A 4HCJA 5KX5F 2IHNA 1KDZA 2XUGA 3ILHA 3FF4A 4LYAA 5TDHA 1NLZA 4A2QA 2ZREA 4B8WA 2PQMA 2FDXA 3DVAA 3ISVA 3SQXA 1EDZA 3H5IA 1ISSA 4R40A 3V1LA 4DA0A 4G0WA 3WGLA 2QXTA 4FS8A 3WNQA 5KNDA 1SIWA 1Z3CA 4PHFA 3TZEA 2EYQA 2IZ1A 2L19A 4D92A 3LGSA 4OXRA 4N0PA 1SBCA 4C4PA 2A84A 2CDNA 1T9HA 3IUNA 2Y68A 5EZYA 3VAYA 1CP3A 1SIBE 4RABA 4UUBA 1S1MA 3COJA 2WU3A 5AW9A 2IF0A 1T5TA 2EXXA 3ZD9A 2XKKA 2X9VA 3KTDA 4NZZA 4PNZA 1M6WA 1WLYA 1VDMA 4WNCA 2QAJA 5G0SA 1BU8A 2Q1TA 3NVDA 4P6VF 5JXIA 3ADOA 4NPHA 2IGTA 5BSMA 1S2NA 4I9UA 1I7NA 1BVHA 4JAVC 2B1JA 5LVAA 1RU3A 1JDPA 2Y77A 1RZRD 4O6VA 4J1NA 1TQHA 5IVHA 4H7IA 1LBHA 4ZCMA 5DYTA 3TR5A 2FV8A 2O8NA 5B1DA 1GUAA 3DO5A 4KQHA 1VL8A 1FQWA 4UU8A 5FV7A 5TQJA 4C08A 1JKXA 1HA3A 1QSGA 2AEFA 2R5WA 2GPTA 4XWYA 1N9ZA 1PWHA 2QBYB 3BFPA 3PGMA 1VLJA 2EX4A 2G71A 2Y05A 3JZIA 1IPEA 3O4VA 1JDNA 4HSGA 1EHIA 4R05A 2WG2A 5IASA 1Y8QB 4JDPA 3WIEA 3LWBA 5TVGA 4Q18A 2VYCA 2ZJ3A 3GVCA 3CKMA 3OIGA 4R1MA 2F9LA 1N9GB 3KTOA 3IERA 5E0KB 1JX6A 2XNSA 4P4NA 4W7HA 3SFVA 3L1VA 4NXMB 1I80A 5ADVA 5EIAA 4AU1A 3FHJA 1VPDA 3JS5A 1ZI9A 3DHEA 3DEJA 2IEAA 2FPKA 1M6VA 1X7XB 4BMNA 1XTBA 4CQMD 4O2RA 3M3DA 3BG5A 4BQSA 2B20A 2YW2A 4I1OA 4ZEWA 2JCYA 3EOZA 3V33A 4QXOA 2O8DB 2XTJA 3TBKA 1T2DA 3FKQA 4PYRA 1CSEE 4O4JB 3ISJA 5B6PA 4CEHB 4QU5A 4DMUB 1Z62A 1DZIA 4G6ZA 4EB8A 3WTBA 1EQAA 1M1YE 2MMCA 4RFLA 1T5HX 1XZFA 1DX4A 3MEQA 3UHOA 3GFFA 2B37A 2FW6A 2D4AA 2RI6A 4GQBA 2ODPA 3U60B 1H0RA 2BYTA 1EGAA 4FC7A 2F1JA 3WK8A 3ZGYA 4MINA 3JAKA 4KKXB 1ZD5A 2DY0A 1XZAA 1MT3A 1M1YB 4EECA 3HH8A 3D43A 2QX4A 4Y2XA 3M6XA 5DCWA 4CFZA 4ED9A 4MWDA 2P3SA 2BKUA 2E4UA 2Q7XA 3D4OA 4HVTA 1P4AA 3DLHA 1PF7E 1TCBA 1F38A 2LD4A 4CYMA 3AJ9A 1MN6A 1O9HA 5JY1A 3T7IA 4DW8A 4URVR 5E95A 2WTMA 4Z1MD 1AY0A 4AJ4A 1QO0D 2W58A 4M46A 3I1FA 1E20A 4XSGA 3UA4A 2FX3A 4YDSA 2I65A 1NA5A 1KAOA 1S8OA 3NBXX 3TR0A 1YA4A 3BFKA 1H6AA 3A3YA 3PFHA 3K92A 2R6ZA 4IZOA 1GSHA 1CZUA 1T4BA 1XKLA 2O8EB 1AQUA 1N7GA 1JLRA 4ENRA 2NVUB 4EI7A 4P2GA 3ABRB 1NU8A 2PLFA 5DM70 4B5KA 1NNSA 2FP3A 2EKPA 1Q12A 2P9CA 2XMDA 1U9IA 3B3GA 4PINA 1RE0A 4RZUA 4U0KA 3RHSA 4CF6A 1L5GB 3B8EA 5TJHA 5C4IA 1H5UA 4IDFA 1YE5A 2PV0A 5HKAA 2XQFA 5F5NA 2OCDA 3LYAA 1Z2CA 3QQPA 1E6CA 2O05A 2YMPA 4NBKA 4YYEA 1Y3CE 2OD7A 3BERA 5KNBA 4LF5B 5KCZA 2WILA 3UB4A 1T5BA 1SXGA 4KQWA 4LJ7A 2LCQA 4Q15A 3T7AA 3U37A 2X4IA 2AJBA 3DT8A 3JQAB 3WOHA 1QGUA 3ZCRA 2FU5C 3L1KA 2Y66A 3C45A 3R4VA 4MGZR 3MM4A 3D2LA 4D9CA 4IEIA 4TLBA 4D9GA 1B0UA 3QVGB 1QO7A 2D74A 1HF3A 1V43A 3BUSA 3KJQA 1OH6A 3TR6A 4R8MA 5H5JA 4DLWA 5TQ2B 1Q2XA 4JR2A 3PX3A 3G2PA 1IDOA 4FHZA 4UDYX 3VPDA 5KC8A 1SU4A 2ZBUA 1YRAA 5ER9A 4A0GA 1Q0ZA 1UAAA 3ZDCA 1H3NA 3FYTA 4JJFA 4BLOA 1G16A 3K15A 5EWLB 4LDQA 4TT8A 1NW3A 2WSMA 1JQAA 5HJ2A 5EJ7A 4QXAA 2Y0BA 4KCGA 1PTKA 1U63A 3EVFA 5AM0A 3WDLA 3OZFA 2D5BA 3PQDA 3NOXA 2JFGA 2EV9A 1OXUA 3KEOA 1RRMA 1UKVY