2MWMA

Nmr structure of the protein yp_193882.1 from lactobacillus acidophilus ncfm in presence of fmn
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
151
structure length
151
Chain Sequence
GMAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEGTFDADMYKTSDIALDQIQGNKDFPEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEVASFFTSAGTNHKAYVSHFNEWADGLNVIGVARDDSEVDKWSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Putative trp repressor binding protein
publication title NMR structure of the protein YP_193882.1 from Lactobacillus acidophilus NCFM in presence of FMN
rcsb
source organism Lactobacillus acidophilus
total genus 27
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2014-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12682 Flavodoxin_4 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mwmA00
2QMYA 4LTNA 4R81A 3HA2A 2FZ5A 4Y9UA 1AKUA 1E5DA 4Y7CA 4ESEA 1DXOA 2Q9UA 2BZSA 4HS4A 1C7EA 2FAXA 2Z98A 4GQIA 4ZVMA 4FGJA 4GI5A 1FLNA 3W7AA 5NULA 2OYSA 3D7NA 4U7GA 1XYVA 3SVLA 3RPEA 2KLBA 3S2YA 1FX1A 4QOFA 3GFSA 2QWXA 4DILA 3NHKA 3QFCA 3NHFA 3NFRA 3F6RA 1B1CA 5B3KA 1YCGA 1CZHA 1OBOA 2XODA 6NULA 4LTDA 5F51A 3OWXA 5LJLA 4N9QA 5A4KA 2B3DA 3EDOA 1QBGA 1SQSA 3ES9A 3TE7A 1KBQA 2QR2A 2FCRA 3OWHA 3U7RA 1T5BA 1KBOA 4NULA 1D4AA 1CZUA 2OHIA 5NLLA 1XT6A 3GFQA 2QMZA 4QOJA 3NHRA 4PU0A 3U7IA 4F8YA 5FA6A 4H2DA 3F90A 2FDXA 5JROA 4YALA 1FLAA 4QOGA 3OJXA 2BN4A 2HNAA 3UXEA 4YAOA 3ESXA 3ESYA 4BMOB 2GSWA 2QX4A 1GG5A 3NHUA 5TGZA 2V5VA 2A5LA 1OFVA 3N3BC 3TEMA 1YKGA 4N82A 4LTMA 3O2NA 2X2OA 2M6RA 1XYYA 3GFRA 3N3AC 2KQUA 1F4PA 1RLIA 1CZRA 2ZKIA 3B6IA 1T0IA 2WC1A 4XDGA 2Z9BA 3W77A 1RLJA 4FGLA 4H6PA 4ICIA 2QX8A 3OX2A 3NHJA 4PTZA 3LT5A 1AKVA 5B3LA 1WSWA 3KAPA 2BMVA 3HLYA 4DIKA 3ZHOA 2OHHA 4QODA 3NHWA 4J8PA 3QE2A 5F12A 1AKRA 2ARKA 4HEQA 4YAWA 1FUEA 3G5MA 3N39C 3KLBA 2AMJA 3NHPA 1BU5A 1JA0A 4ZVKA 3GAMA 4QOEA 1OBVA 1AG9A 1TIKA 4QOIA 3TZBA 1ZWLA 3O73A 2FX2A 2FLVA 2FZVA 1YDGA 1BVYF 4QOHA 1YRHA 2R96A 2W5UA 1QRDA 2D5IA 1AKQA 3QFRA 4BMPB 3FW1A 3FVWA 2Z9DA 1RCFA 1DX9A 3LCMA 3ESZA 1J9EA 2MTBA 1DXQA 1XI2A 3OJWA 3HR4A 3W79A 1J8QA 1V4BA 3W78A 4XDHA 5ULLA 3B6KA 3K20A 4M0CA 5F4BA 2FVXA 3JSXA 3B6MA 1QR2A 4CF6A 2MT9A 3EYWA 1CZLA 2V5UA 4CETA 2F1OA 4C76A 1H69A 1AHNA 1YCHA 2OHJA 4YQEA 3K1YA 3L9WA 1H66A 2N1MA 1AKTA 4LA4A 4D02A 1WSBA 1ZWKA 2Z9CA 4LAFA 5LBTA 5LMCA 3OX3A 4N65A 5LLDA 1VMEA 4YAFA 3R6WA 2QX6A 3F2VA 2V9CA 1FLDA 5FUQA 4GR9A 1QHEA 1D04A 4FGKA 2MWMA 1D03A 2R97A 2BF4A 1NNI1 5EMNA 1I1OA 3L9XA 2BPOA 1X77A 3F6SA 2MOKA 1YOBA 4C14A 4C0XA 4FX2A 1AMOA 4Y9RA 3NHSA 4DY4A 1FLVA 2M6SA 1AKWA 4C0WA 3OX1A 5BUCA 1ZX1A 1JA1A 1SG0A 3KEGA 1FVXA 5EAIA 1CZOA 1J9GA 4U7FA 5FX2A 5LVAA 3UXHA 4ZVLA 4PTYA 4OXXA 1C7FA 3NLLA 4S24A 2RG1A 3NHYA 3P0RA 1RTTA 4ZVNA 1CZKA 3OVMA 4U7HA 3FX2A 1J9ZA 2QX9A 4NLLA 2X2PA 2FOXA 3KAQA 2HNBA 3B6JA 1AZLA 3NHLA 5EA2A 4YAUA 5LJIA 1TLLA 2XOEA 1CZNA 5LBUA 3FJOA 1YCFA 1FTGA 3FNIA 2Q62A 2HPVA
chains in the Genus database with same CATH superfamily
2WPDA 4X8OA 4PN7A 3HDQA 1J22A 4EEKA 4G6ZA 2QXYA 3WB2A 4LY0A 1KI7A 2QPTA 4MRNA 3PNVA 1PS9A 1Q7BA 4HEA6 2R0QC 4RJJA 3OTWA 3V1LA 4WUTA 2VP3A 4BKRA 1RR6A 4NWIA 2YWCA 4QBTA 5GINE 1F0NA 1ZOLA 4QXPA 2ZUUA 3UYKA 2UXBB 3CLUC 5U1PA 3H1GA 1OI7A 3MJDA 4Y7CA 2W8BB 4W5WA 1LWOA 3SZOA 2Q3DA 3PWZA 4ESEA 5C7OO 4TL7A 5AXDA 1C3VA 2YW9A 1NOKA 4AT1A 3KSDO 2QRVB 2BZSA 4OKSA 2Y4NA 4QG3A 1IQRA 5KX5F 3P2KA 2JGIA 5ALKA 2E4XA 3SK0A 1P61B 4KN6A 3VKWA 4RV5A 2F8SA 5DHUA 4XVCA 4BL5A 3I45A 2X86A 3Q5EA 4YRFA 3EBLA 2QQ0A 1V2HE 3RT7A 1X0XA 4C0LA 3HA7A 3K9HA 1ZESA 2JFVA 2BJVA 2J0VA 3HWWA 5C1IA 1WQ4A 1I9CA 3QF4A 4U4AA 1E0JA 4UM7A 3T3DA 4A6XA 1CQPA 3TCNA 2XQKA 1ODCA 1T8TA 2F1RA 2LIVA 3A1WA 3KLMX 3NB0A 4B0PA 4F45A 4GSLA 1HE5A 5EXDA 1ODLA 1GA1A 1W34A 3KSAC 4B8YA 5G1OA 1QC5B 2ATCA 2FFQA 2XOKA 4JN6B 2R8OA 3OICA 1EDOA 1UC4B 1AKEA 5TPZD 2A0FA 2FE1A 3OFVA 3Q7EA 3RG2A 4A91A 4OXQA 5JJLA 4IF4A 4WOBA 5HUQA 3MTAA 1GPJA 3EVTA 2VUIB 5FPPA 2RFLA 3C6KA 4Q9JA 2VDNB 4BVEA 5J2TA 3PB3A 1N2EA 5LZ7A 1V8PA 2XMPA 2QLTA 4RTSA 1ZIDA 3NHFA 4O0LA 3LT1A 3H9UA 4EKDA 3U0BA 4R6XA 2D1TA 4KFSA 4MTLA 1LB1B 3O9ZA 3IR5A 1LDMA 3OCVA 3ZWWA 3OT1B 3ICPA 5JZSA 2EJBA 1CZHA 3H83A 4KE8A 4NSNA 1G38A 1MT3A 3F5QA 3ZY4A 3ABZA 4Q7MB 2EYUA 3OFKA 2QTRA 1N2BA 2VNAA 3N2NA 5FL7D 4AYXA 5K4HA 1CCWA 3SXUA 1UQUA 1R8YA 4MDEA 4E07A 1CVIA 1J5EB 3H97A 1INLA 3HKDA 4TYYA 3RU9A 4JB3A 3ONVA 3ZPXA 4H60A 2RGRA 1QBGA 3N0TA 5CDTA 5EE9A 5BN4B 4G1FA 1PJAA 3LHDA 3TLYA 4KE6A 2CMHA 4GFDA 5ALZA 3MWDB 3PIRA 5DT2A 4X92A 3I92A 4F2PA 3IQDB 1UXOA 3EQ8A 3KSMA 1ZY2A 2GK4A 1NDQA 4FGSA 4OV6B 3FWHA 1UMDA 3HVJA 4R1NA 3IMCA 4LX0A 1XPUA 1EUDB 3HWX1 1VGVA 3KWFA 3RUIA 3M82A 3DFMA 1J1UA 2B7CA 2XMBA 3QK7A 3RAJA 1ISRA 4BZQA 1S3SA 4ARCA 8MHTA 1F17A 2RGCA 4YHHB 2GETA 2PQ2A 2PZMA 3DFKA 3IV7A 2WOOA 4QRIA 1OLOA 4UBIA 1EVLA 3IT2A 1WL8A 5DLQC 4ZAWA 2PUBA 1VPEA 1C80A 4WACA 4RVOA 3STWA 2NX2A 1X1CA 4YXFA 4LXQA 4ARZA 2GBIA 3VX3A 2HSEA 4O1MA 1NQ5A 1J06A 2VR1A 1KKUA 2WILA 3HB9A 4R5HA 4DSAA 3C8UA 2VDKB 2VWPA 1E9DA 3SY8A 2D1FA 3TM4A 4CIWA 5HKKA 2B1QA 2GQ0A 4RQAA 2JIOA 3VKGA 4JJKA 5IH3A 2BSAA 4PIMA 2YY5A 1Y1KE 1FLAA 1WCWA 2JRLA 3ZWMA 2RK3A 1LDGA 3L02A 4WOJA 3W05A 1W44A 2WZDA 2VCYA 5BORA 3L79A 5HTOA 7ABPA 5HJ2A 1FSGA 2I55A 1OV4A 2QF7A 3QKWA 1Y82A 4JASB 5HCNA 4H3KB 3PHIA 3V34A 3WMWA 3ANYB 4K9NA 4CM4A 3BE5A 5AT1A 2ADFA 2YQ5A 4N5IX 1PX2A 3TLAA 4BMOB 1T4DA 4EZIA 5K0SA 5K8IA 2PS3A 2BYTA 4XQGA 5D84A 2YUTA 4R2MA 4NHEA 1HKUA 3PLNA 1GLNA 1EZZA 4OHVA 2NUBA 1JAHA 1X70A 1GUBA 4TKMA 3AUFA 2V4MA 5AUOB 2CLMB 1M67A 3HS3A 1KQ3A 1Q0LA 4HNAB 1ID8A 1U7PA 2A5FA 3I5AA 4F5EA 3EA4A 3AM4A 2WFMA 1EFCA 4AP6A 3WLFA 3IVCA 5KTRA 3AFMA 4IX9A 1SG6A 2ESRA 1MMFB 1SUPA 2C3MA 3U13A 4C0HA 4OQLA 1IAQA 1Z36A 2I0FA 4F12A 3A6JA 3U4QB 3SKYA 4K81B 4PFKA 5D5HA 3P97A 1OZGA 2A57A 1L6IA 3MPOA 1K5GA 1Z4JA 4MA0A 3WWYA 2GZRA 4H1UA 1V9CA 4MI9A 1H22A 4HVTA 3FCYA 3DVRX 5E95A 5BMVF 4S35A 1MJFA 2H16A 2ZKIA 5CH3A 3SSOA 4ZMRA 4K9QA 4EI8A 1H3FA 5HA5A 4LXIA 1WUKS 1RFLA 3M1IA 3W7BA 1UMCB 3NT4A 4UEOA 4OJMX 4CCYA 4PWZA 1BE6A 3MCWA 4W1PA 3WNQA 2WD7B 3SJBA 5K0FA 4YJ3F 1OE0A 2J07A 3U9TA 5KOHB 4D9KA 3KOWA 2WJZB 2C1EA 4QGGA 4X44A 5KJFA 4LJ5A 2FI1A 1V9LA 3VO9A 1WVGA 1QH1A 3ZIDA 4RTPA 1KEUA 3MC1A 4I46A 4RZ2A 5C8DA 2GGSA 3MS7A 5A5DA 1U5AA 2W98A 2WU1A 3E2PA 3GCDA 5IT4A 4EGQA 1OGYA 1LBQA 3CF6R 3RVRA 2PZBA 3O0DA 4LDAA 1MC1A 3U7HB 1FUKA 3F3MA 1MF7A 1GCGA 3D6NB 1NULA 2JAQA 3V4SA 1KP2A 3UJDA 2GAOA 3AZQA 4AMVA 2I9PA 4B82A 4GWLA 4B3SB 2XF8A 4QODA 1QB7A 4I4NA 2Z4TA 1K3UB 3LECA 2FDRA 1NQTA 4DC0A 3FOFC 4Q7QA 1EJBA 3QE2A 5TMEA 3ZEAA 3RTEA 2X9VA 2GCOB 4EY8A 4TZKA 1RCUA 2AI2A 1SXIA 1HWYA 2HJHA 2QD4A 3AFNA 4KMMA 2DJIA 4N01A 4D82A 2IYZA 4ECAA 3ZG6A 3FHLA 2ARKA 1PV2A 4U3JB 4BUJA 1SKUA 3GJ0A 5FFNA 5CIQA 2R1ZA 3VYVA 4BNDB 1SUFA 2FSVA 5JDIA 2Q9AA 1KZHA 2DFLA 4BN5A 2B2CA 2BR3A 2BFAA 2PKCA 4Y0VA 5JMTA 221PA 4S1VA 1GXSA 1E2MA 2QRGA 4COOA 1I4WA 4NL4H 4G0YA 1Q77A 1IQUA 3HVHA 4HGZA 5FI0B 1ODTC 1P0FA 1OH7A 2C98A 5AP9A 3KELA 1U8UA 1K7SN 2G9NA 2C3PA 2XEDA 4AJEA 2JAWA 1N2IA 4J2TA 2I1WA 1F6DA 3DP9A 1TZ2A 4OUDA 1JR3E 1E0KA 4BFVA 4QT0A 5LUAA 2ERYA 1YFJA 1MORA 1G4AE 4GXTA 3PR3A 3NWJA 4I4LA 2ZW9A 4XD7D 2PUGA 4NCAA 3UB2A 3ZKWB 3WDSA 2TMGA 3M6MD 3RSHA 1RAHA 3MSXA 1N34B 3IUSA 3KEFA 4L5CA 4V3BA 3VZBA 2PJRA 1ACMA 3SIRA 4B3GA 2AE2A 4ZAZA 1UFOA 2QLMA 3OM9A 4PE5B 3L07A 4BKMA 4JHLA 1SUEA 1XTJA 3QVOA 5DNWA 1RNLA 4JBWA 1CY6A 1G59A 2ZIEA 1F1BA 4PZEA 1LF5A 1AE1A 3GGOA 2QS9A 3KHTA 3NAGA 4JP8A 4X97A 1AH2A 4DV1B 3HKEB 1SN7A 3JASA 2FP4A 3S7ZA 4ETNA 1WMBA 2GBCA 3HXLA 4OFXA 4B3MB 1EVQA 1JDJA 4YI5A 1DRKA 4Y2RA 4HUTA 1WB5A 3CU5A 3OAAD 4CEIA 2BD0A 1MRZA 1NI4A 3BUSA 1VB5A 3DEHA 2WK1A 4B4OA 4GRIA 1N3YA 3D31A 2ONCA 3KSUA 3PNPA 2OL4A 1L1FA 3WGUA 2ZBUA 2O8NA 2YV4A 3A1EA 1DX9A 4RVSA 3ZW7A 2R1VB 3OFJA 4RF3A 3LC0A 2PA0A 5J58A 2IE8A 2ZCUA 1Y4AE 1RI1A 2WF9A 3GMIA 4LHYA 4ITVA 4DCGA 3TGLA 3OJWA 4RIGA 2ZPUA 2L82A 2XYGA 5T3YA 4S05A 3UUGA 4PAOA 1QIIA 3FRJA 4R7ZA 3AVPA 3NEYA 1VSBA 1XEFA 4EA7A 5EKTA 4CV3A 1DAIA 1F2TB 1KGSA 1DG3A 2HF8A 1ZOPA 5IMSA 2W0SA 1G5FA 2O8EA 1F8YA 2YZKA 2GVNA 2I87A 5JO9A 2XYRA 4H0FA 5CAEB 4F86A 3W5BA 3ZDFA 3PFNA 4WN3A 2XADA 2IYFA 2CBGA 3UJ8A 1FTQA 4E0BA 3PC3A 1XD9A 1GGHA 1HETA 3VC3A 1JP7A 5J5AA 3S4YA 4M53A 1C41A 3M81A 4Q3DA 1EG2A 3DD1A 4CUKA 4F06A 2HHAA 4WRRA 1A2KC 4Q1EA 4CMHA 3EDYA 3IB6A 2AOVA 4J0QA 4GLLA 3TZQA 3SS8A 2PL5A 2VATA 2XW6A 2CCKA 3WLJA 2QTBA 4EUHA 2XGJA 4O5OA 3TNYA 1KF0A 1ZD1A 3JV7A 4EHNA 5J4HA 3AVWA 1SKBA 5BPHA 3HDTA 1YRYE 1Z88A 2XYHA 2BJWA 1PVDA 1S1MA 3PUZA 4JWTA 4M0LA 3RK4A 1WBBA 3Q4GA 2ZJOA 3M1YA 2ZR9A 2X42A 1WA5A 4MEAA 5B6JA 2JFYA 4MIKA 3OO0A 2G06A 3EIOA 1NUQA 3H3FA 4XRRA 1HDGO 1VC2A 4LYDA 4N6GA 3WSVA 1TKCA 4LZWA 1G4HA 3H5AA 4HB4A 2OHGA 4CLRA 4A0RA 5C9ZA 2OV6A 3I6MA 4JIGA 4PHCA 1NHGA 3PEWA 1CJCA 3KQKA 1YQGA 3R6WA 1WMEA 1K0UA 2QX6A 1C50A 4TTJA 5DM0A 5GAJA 4I8DA 4CM8A 5ISMA 4R1TA 3GGGA 3ECSA 3R77A 4GPAA 4LBVA 1DELA 3M2TA 3REGA 2OGUA 3GJ3A 1Z6XA 2NVUB 1GR1A 3DZJA 3SI7A 1GYQA 1O2DA 5LD2B 5CDFA 2ID7A 3EIXA 1GVNB 1L8LA 3CINA 1GNVA 1R66A 3MINA 3JR3A 1FTSA 2QR3A 2UYHA 1G5IA 2PKEA 4N0PA 5DBOA 5BOSB 1KTIA 3WYNA 1OWOA 1OLUA 1HSOA 4BX9A 2HY7A 5JAQA 3ETLA 4R31A 2QRJA 5JRZA 5B4VA 1YWGO 1N3BA 4Q1CA 3OAAA 2QAIA 4D4GA 4EYQA 2G1JA 3AR6A 3DBOB 4ID9A 1LBHA 3W2GA 1OYWA 4BVFA 3GUUA 2HREA 3D6MA 4FJ2A 1C8BA 1ZO8A 4L5AA 1W1UA 3U7EB 4DAOA 1FDRA 4Z9AA 4B2IA 5COQA 3S1SA 5FEMA 2P2NA 3H87A 5ESDA 5D8DA 1GN9A 2XKAA 4PANA 3W6OA 1JLKA 3MN1A 4Q9KA 3A1SA 4NCBA 1IM8A 1QQ5A 5EJAA 3S28A 3R3HA 3T5CA 3ROTA 5FWNA 2DB3A 2HW8A 3B8HA 1NR1A 2Y92A 3I30X 3MJ4A 4YREA 2W6ZA 4C0AC 1SC6A 6GPBA 2HWWA 3IV9A 4URFA 3CUTA 2RG1A 2ZAOA 4RHTA 5E0OA 2XDQB 3IHWA 3P0RA 3V2IA 2ZI6A 2NT4A 3SF8A 2AQHA 4IM7A 5KKCA 4E5NA 4U7HA 1CTQA 3SLKA 1DE0A 1RIIA 2C94A 2VDVE 3ANXA 1JB9A 3T34A 2P4EA 4ZOAA 1N75A 5F1YA 2Z09A 1JLLB 4C3ZA 1CY1A 3NALA 4ZCIA 1M2EA 3RUEA 3G82C 3IAM6 5J2UF 3I52A 5CB4B 2RARA 1AZLA 2P5TB 2YICA 4AJJA 4JP3A 1QDEA 2SHKA 4Y1RB 4JROA 4QFMA 1M6VA 2DUWA 3N2KA 3T15A 1W2HA 1XEAA 1RQGA 3EFOA 3LPCA 3IH5A 2GZMA 3X1YA 3KQMA 4HVAA 1A76A 2PVCA 4CM9A 3B78A 3LX5A 1MNQA 4OB7A 5KMGB 2WKWA 4C7BA 3GR6A 3QV1A 4L1KA 2HGSA 2BGWA 1U0HC 2IW3A 3UC9A 3VOTA 4H7FA 4ZZ3A 2XMSA 1C3OB 1VKNA 1W5BA 1ESNA 3GUHA 4LKRA 4PZYA 4W6ZA 3EEQA 3T61A 1QRAA 4CPDA 1DUSA 1YOVB 4GQBA 4DADA 2IS6A 5FBRB 5A6SB 1A9TA 2IYSA 4F4HA 3IC5A 4RD0A 3LY7A 2GM3A 1OAOA 1THGA 3CUWA 5HEKA 3AL2A 3EBOA 4I14A 5CVVA 1EK2A 1XKQA 1JT9A 4I9UA 2Q4RA 4R2IA 3BDVA 2NU8A 2CDNA 2QNIA 1XCGB 2XE7A 1E77A 4N5HX 3K9FC 2VA8A 1ESZA 2HXYA 3AONB 4QPDA 3VVCA 3PF9A 3Q72A 1MTZA 2QY9A 3KLNA 3ZOZA 3M34A 4L8FA 1JMVA 4MPRA 5IN4A 5J23A 4H1WA 2KX7A 1W48A 3JQGB 5KYKA 1SOAA 1DC6A 1CUIA 5DTJA 3UFXB 5ESWA 3L84A 4EL5A 3RLFA 3RANA 3GAFA 3AU9A 1K92A 1TA9A 2F4NA 2FPOA 4JZYA 4TV8A 4U2CA 2ON6A 2W4QA 4OQMA 2XA2A 4N40A 4CQJA 4UM9B 3UEOA 3VR5A 3EGDA 5A9SA 2QR5A 1ZD8A 1RRKA 1WP9A 1YASA 2IF2A 4I1SA 4J3FA 4Q03A 4C5CA 2R8BA 3H2IA 3LW7A 4LJYA 5I45A 3NIDB 1U7XA 2OQVA 4IEEA 1U9YA 3UWMA 4D25A 1A69A 3WLIA 1GUFA 2JK0A 2YY7A 3D7NA 3ZN2A 2P9TA 1XYVA 2ZXUA 1NY6A 4HQLA 4IVQA 5IVDA 4CQLB 1MAUA 4UPVA 5ITZA 1RYZA 2RI6A 1ZYUA 3HYLA 4M7PA 3TQTA 3ORRA 3SPXA 4YQYA 4L28A 1M2NA 3SGLA 3BKXA 3DLBA 4DR1B 3U48A 3LCUA 4NCNA 5FD8A 1MKYA 4QZVA 4WFQA 1RZVA 1PR4A 1DWOA 4BNHA 1O6GA 3DZCA 2AEMA 1D4FA 2FR1A 2CD9A 5DM2A 2Z08A 4DILA 4OSEA 3PQ6A 2OD9A 4UXIA 3C7TA 4P6VF 2XI4A 3VVLA 5L9AA 3IUJA 5BSGA 4MVJE 3CXUA 3F6RA 1C9JA 2JKVA 4QU8A 3OPYI 3DHEA 4NG4A 3K6RA 4WD3A 1NP6A 3R3ZA 1G20B 4YJKA 3DJYA 3CUSA 4HDMB 3WK5A 2H29A 2O1XA 2XODA 1G5PA 3CRVA 3NQ41 3SU8A 4HFNA 4YRKA 2J5KA 1P1IA 2O48X 1Y9JA 1H2BA 3GJ5A 4HJRA 3I72A 4DMKA 4L02A 1VLJA 5AVKA 1T2NA 3K9GA 4OHMA 1T8RA 2XDWA 2PUCA 3SXJA 3VKHA 2AJTA 2CF5A 2AFHA 1ZDMA 2FQQA 4G1MB 4F4JA 2G1PA 3E1SA 3PG5A 5IK2A 4CMKA 2E4WA 5AW9A 2EARA 1CF9A 2ZYAA 2AC4A 2MSWA 1G7RA 3N5CA 1C29B 4ESOA 3OQ6A 1ULZA 1CNEA 2Y0EA 3HU1A 3OE4A 5CA0B 3AL0C 2FZWA 2IHJA 2ZYUX 3A2LA 3LW8A 5F52A 4LK2A 1M6NA 1Y5IA 3EEOA 3JQAB 3GB9A 1SXHA 3PQFA 2X5JO 4RWZA 2O7VA 4GPEA 4RMIA 4X1KA 5CH5A 5ECDA 3REFA 4DNOA 1R4ZA 2DWCA 2P65A 3ML1A 2P67A 1NOJA 5H9WA 1WXXA 3ELDA 3JZDA 4KPUA 4M4SA 2NZ8A 3K2QA 4L6AA 1AUXA 4CT0A 5DNAA 3HJAA 3GJZA 5IYZA 5H81A 1QPZA 4WJLA 5CB8A 4MUEA 4TT8A 4Q3KA 4KO8A 2IBMA 2QN3A 3GFPA 3NHMA 2RGNA 5BSFA 3E7FA 4X71A 2UVQA 4Q3NA 4RQBA 5G4KA 4P4GA 1KDRA 4Z49A 2PH5A 1DJPA 4OX9B 1EX1A 1V11A 2UYQA 3PWKA 3V7NA 4RFSB 2Y67A 1IMJA 1B3BA 4C43A 1EFRA 1CY8A 3ITNA 1SVWA 2EBHX 4P93A 4QUGA 4U7JA 3SZGA 3LBAA 3BIJA 4KVAA 4D4LA 1TCAA 1YI0A 2F9LA 5DB4A 5B36A 3TTTA 1ORHA 3A0UA 3LPDA 3M9LA 3NUQA 4Y2XA 5EERA 1I2BA 5IJAA 4L5JA 1ADYA 1VRVA 2BKUA 1K8ZB 3AM3A 3CA8A 4ZAXA 2X8AA 2AF3C 4OHCA 3E9CA 4CJXA 4MRMB 4U9UA 2QVXX 3CHYA 3RS9A 3EY4A 4CIAA 2GEBA 4L0MA 2NG1A 3UJPA 4RZXA 2XMRA 5FBLB 4AJ9A 4GE0A 3FIJA 1KQOA 4ZDIA 3W4IA 1I7QB 1M1ZA 4NXNB 3L7AA 5HS4A 3BORA 2ZJ2A 3WAGA 2Y0CA 3VI3B 4ARUA 4DCOA 1YVDA 3BXOA 3L8CA 4TM8A 5A6VA 3L7LA 1UBGA 5DI3A 4N76A 1KK2A 2BM8A 3M4XA 3PLRA 4UAGA 3MLEA 1KE2A 5HGJA 3EZ6A 2GZSA 2GJ8A 3VZPA 5JH7F 4LHZA 2J09A 3AESB 4LS3A 4ETIA 1CC1S 4N3NA 2MYTA 2PWPA 2VUHB 4U39A 3UFBA 5JAUA 2R6FA 5HIAA 3FBWA 2Q3MA 3JQPA 3FLBA 4WK4B 2ACKA 3OZXA 4P92A 5EHNA 2V7XA 3FPSA 1NMEA 3HCEA 4GZ5A 5B1SA 1DKNA 5C1OA 1TGVA 1C4OA 3UCXA 1JFSA 4WNYA 1N78A 4INAA 2YNMC 3B60A 1DV1A 4OYYA 2AF4C 5E4FA 3BX1A 1PL6A 3RREA 3VDXA 4JYAB 4Q0MA 2JPDA 3M5CA 2PGXA 3CH7A 1M83A 5FOSA 5DBFA 4ZCSA 1QE5A 4AI6A 3V9PA 1I14A 2FQ1A 5FOTA 4AMGA 3OOSA 1TT7A 2XT9A 4ZD6A 4JYZA 2E37A 1M1NB 1R0SA 2VYQA 3ZHQA 5KTTA 5CD1A 2HDWA 3KB1A 4MA5A 4AVYA 3VPCA 4OB8A 4PC6A 1B8PA 4IO1A 1X8JA 1RXEA 4G0UA 4AWBA 2AT1A 3RRJA 2YRXA 4NV1A 1U0RA 1YA8A 3HSYA 1TO2E 5L6MB 4YP0A 3KETA 1WBDA 1ZPDA 1VKJA 4UD2A 1HRDA 1CX9B 5C2JB 2V9PA 3V4VB 2YCLA 4Y2SA 5DYYA 3W8DA 3ZDDA 3MMNA 3B9QA 2HZ7A 3IOMA 3N2YA 3H4MA 3P5SA 1PR1A 2XVMA 4YP6A 3UK6A 3NGLA 4X90A 4FSXA 2XHEA 1NN3A 3BDAA 3O1HB 4RFVA 3ZW9A 1SA0B 3FYUA 4DIKA 4PYMA 4ENQA 3PPXA 1VJ0A 1EINA 3ZQUA 4UFPA 2GPJA 2C8JA 4K9MA 3GPCA 3E48A 4KIWA 2WMDA 4WEOA 1YZFA 5BW8A 2IY7A 4OGKA 2PLNA 2EZUA 2QL5A 4WX2B 3WMRA 2H4WA 2WHRA 4GGPA 4DRXB 1JHYA 1QZ3A 4D9EA 1JYFA 2HHLA 3A06A 4BVAA 4DYVA 2JHGA 5AKZA 3C6BA 4HQNA 3G5MA 4TPKA 3PFBA 1GAJA 3BB1A 1NBWB 1H1LB 2NUPB 3P8ZA 4PYOA 4CDRA 2QRMA 5KWVA 3ZY6A 1IZ8A 3OZCA 2WYHA 3PFGA 3K2IA 4QECA 3MVEA 4EH1A 3W5AA 3LYLA 4OU5A 4O2AA 2NW6A 4WE3A 3RBXA 1UBTS 3IDOA 1XOIA 1J1IA 2IF0A 4UTOA 4PX2A 4C88A 4OSPA 1T6XA 4HTFA 1LLQA 2FPPB 3TVTA 4DJFC 1SXJE 5DNUA 4O6VA 4MWDA 2W93A 3PXDA 4QBFA 4P32A 1O5TA 3DULA 4FKZA 5CT8A 4FX5A 3ZXXA 1WW3A 1G20E 4MW2A 2WF8A 4R1QA 1GJRA 1RYEA 4OCZA 4XWYA 4CVNA 3P94A 3F96A 3GLUA 1X6VA 4IAOA 2BEKA 4XIFA 4BQEA 1P4AA 3T3HA 5CNIA 1YKFA 4Q1BA 4BB5A 4IIVA 4BP1A 4KWEA 4HMPA 3Q87B 3ISTA 4QYSA 5KJEA 3ZK7A 1EFPB 2CVQA 3ILYA 3QF7A 4G0NA 1L5KA 3X3HA 4XASA 2ZETA 1NLMA 4IO0A 4EW2A 4LF4B 4YA6A 1H9AA 3R1IA 2DC1A 1E2HA 1E94E 4QOHA 3T99A 4E88A 1R37A 1O0CA 1O3YA 4UCFA 5ALJA 4NXMB 3U16A 1FP1D 5TQVA 1D2AA 1IHYA 5ELXA 3IUQA 1OU4A 3WLNA 1O94D 2GPWA 2MINA 1NFRA 1KNXA 2DX7A 2ZVQX 1FMJA 4TKUB 4WGGA 3S8MA 5B12A 2IV7A 1XZEA 3N2GB 5K01A 2JARA 5KVVA 2IA5A 1KORA 1NTOA 1Q3TA 3L7IA 3DMHA 5F2NA 2VEDA 3VPFA 3KOXA 3E9RA 4QXRA 3RNLA 5HDQA 1BEEA 3SIPA 4FGWA 2F8MA 4GX0A 4TN5A 1E9FA 2PYIA 4Z7OB 3MTBA 3LWZA 4LW8A 5CXUA 4F7WA 4FBGA 3VPDA 1RLUA 1KZYC 4Q4JA 2H2FA 5CLLA 2NNLD 2WJ6A 3MB8A 4C21A 3PDWA 3NORA 1T3HA 3ST7A 4F60A 3WQRA 2GHTA 4NDNE 3TW0A 1AQUA 2Q2OA 1V35A 5DX8A 1KAHA 1OHHD 2JBAA 3BCSA 3IDZA 1L5HA 3V2GA 3WB0A 3FHOA 4ZI2A 5IDQA 4FFWA 1TYDE 1E3WA 4HLNA 1A7KA 3UW1A 4LZLA 3N0XA 4EO4A 2J32A 4UULA 1A7AA 3T5PA 5IUKC 1JQLB 1P1FA 3SKXA 3EH2A 1GL3A 4Y2VA 1NP7A 2DHCA 3QIVA 1P8AA 1UC9A 3LRPA 3H16A 1BWSA 2R6CA 4ZQFA 3SX0A 4MHTA 2DETA 2H1WA 3DMYA 2XTNA 3IBFA 4UNIA 4ZXFA 1QHHA 1DPGA 2DQZA 4L3OA 5JWOA 1EM8A 2G9QA 3TLEA 3JD1A 4KAJA 3FOCA 1GQ2A 5CYPA 5EJMA 2IOYA 2Z3VA 5E2IA 3GLIA 3KOMA 5HYVA 10MHA 1ECFA 2YVUA 1SKAA 3FM9A 2RAUA 3BTVA 4TXHA 3DMRA 5IAJA 3RAGA 4BLPA 4IDFA 3L46A 1TM3E 2VK1A 3DEZA 4YQEA 5A3VA 2ROQA 4DL9A 2W71A 3JQ8B 1ORDA 1Y7LA 5EHXA 4DS3A 2KPOA 4MXDA 2EIXA 3VTAA 5I7SA 1BOFA 2WWTA 4HHEA 4YCJA 3WKAA 4IRUB 2ZYRA 1V3QE 2VQDA 2F8TA 3NDJA 3ZZNA 4OATA 4ZYTA 2O2CA 3LX4A 3CPSA 1JH8A 4P82A 3V8RA 3V4ZA 4CV0A 5J4KA 3A05A 2R25B 3B1WA 2QE7D 3GD5A 2NN3C 4MB0A 4LAFA 4RVNA 4RYLA 5EYPB 2D7JA 3LBIA 3GPDG 3UQYS 2Q3HA 4BBZA 1N1GA 2EFCB 1XQ9A 2VHVA 2H1CA 2Y6VA 2AYYA 3JYNA 3PP8A 2B6NA 2PXCA 3WWDA 1RWBA 1WUYA 1YVEI 4MO9A 3HNRA 4Z2AA 1EGMB 3G5LA 3IPXA 5F21A 4CG2A 2WABA 5CITA 1SCUA 2MJLA 3V8PA 4EGSA 2DH6A 2BP7A 4XX0B 4E5PA 4L9SA 2X3UA 4EFDA 5EPOA 4QTUB 3WVNA 4A6DA 4EG8A 3AHIA 1SBQA 1MFZA 1ORVA 2QT0A 1AKWA 1N1MA 1YQUA 2WQ6A 1AK1A 1BDHA 3KQNA 2TSYB 4WESB 3L6OO 3Q2KA 2VJBA 3OX1A 1XF1A 2AUTA 4E94A 1HK7A 1Z22A 1O94A 2AOTB 1IY1A 3H04A 2RGWA 3IEPA 4WWHA 2GFHA 1FXWA 4ARBA 4C04A 4NQZA 4RHEA 2WG1A 2Q1WA 3AL3A 4NCHA 5ILGA 3HN6A 3AHDA 1J9GA 3LUPA 4EYSA 5DHAA 2PO7A 1IBKB 1NAHA 1B00A 2C2MA 4CRWB 1Z06A 3DOJA 1ILEA 1J97A 2IYQA 3OTIA 2CKMA 2WAXA 3N86A 3BWYA 2P2YA 4DPMA 1OHHA 2WIDA 1EWYA 1XVIA 2NU6B 3QOYA 3IMFA 4GMGA 3UAVA 1ABBA 4LHVA 1IQPA 3OOWA 4ZO8A 3KJGA 4FJ0A 3UJ3X 1U3UA 2NXCA 4ZTZB 4Z8YA 3HY3A 3DZBA 1V96A 1K9SA 2VAWA 3RGGA 4JCCA 5KQPA 3BMCA 1RLMA 2X1HA 2GXSA 1X8LA 4EMUA 2XR1A 3KM0A 3KDAA 1GAQA 1Z15A 3HU3A 3LFHA 3ODGA 1UBCA 2PO5A 3A9WA 3OUUA 3E1GA 4GVXA 4IGKA 4O4HA 3PHHA 5FCDA 5K2MA 4DCJA 1KRHA 4EP1A 5BV1A 2IU3A 3OLXA 1GA4A 3KFXA 4F3RA 2B25A 3EPKA 1O96B 4N12A 3M4JA 1EFAA 2A3NA 5LU9A 4CMCA 1MW9X 2P30A 3LS2A 4TV9B 1RXCA 3AERB 2IX9A 4JU8A 3HJCA 4P7BA 5IKEA 3EVAA 1GARA 1COWD 3HJFA 5E2BA 3P9IA 1I2AA 1P9RA 2C58A 5BN3B 4S1PA 5TY0A 1SUBA 2ZBGA 1XRLA 3EQ7A 4V0RA 1RZUA 2YXBA 4XZ3A 4DA8A 4BEVA 1NQUA 4DAEA 3G85A 3JVUA 4E2ZA 1P31A 3I8SA 1U28C 2R85A 4R98A 1MXHA 5EIBD 2VLBA 3OCYA 6YASA 4X9XA 1IZ0A 3EHDA 2FV8A 2QE7A 2YWBA 1U1FA 2GAAA 2JLBA 3EK2A 5E8RA 2HPVA 1BX3A 3PFFA 4AN1A 5DYGA 4O2BA 1CEQA 4JJ7A 4M9SA 3I01M 5KNDA 2ZRNA 1ISGA 4J49A 2BKXA 2FZ5A 3CPHA 3DOFA 2Q5JA 4KQ2A 5CX4A 1F9EA 5C18A 3UOAB 5B7QA 1P33A 1EIZA 1UZNA 2RHCA 3DT6A 3P52A 1EXDA 1JHQA 3ZV3A 3P0EA 4OI0A 1OXXK 1ZA1A 3EZ9A 5CLHA 5IDXA 2O59A 4K9PA 4F4UA 3LBHA 4B6GA 4PO9A 1P6QA 3D6UA 4O4JA 4UJ5A 1NASA 1N5IA 2BFFA 4C0QC 5ALLA 1IY0A 3FFWA 1BAPA 1R0ZA 3PFHA 5E6UA 1RC8A 1A96A 1RRFA 4YTEA 2IEIA 3H0EA 2VHZA 1ODJA 4KHPB 4D45A 3H84A 4ONEA 3FE2A 1P73A 2ZU0C 2ZXEA 3FJYA 1WDLA 3N58A 4PRYA 4Q82A 1GT6A 3K30A 2A9FA 5EZYB 1FP7A 3SSAA 1YF3A 4UD6A 1NA5A 3ND6A 4YRPA 3WP0A 2VDLB 1QOQB 3IBTA 1L1EA 3RJTA 3BCRA 4BBPA 1BXZA 3MZ0A 2ZCJA 3FMFA 2D4HA 1DHRA 4QYTA 4ZYVA 2IC5A 1QIEA 2IK8A 2XAUA 2AB0A 2REBA 4KH0A 4KQ1A 1AQYA 3RF7A 2CK3A 3UOGA 2PK3A 1EVIA 1VE7A 3S2YA 1MX5A 2WTEA 3KFLA 1PR2A 1A8UA 1T0HB 2I1LA 3KUUA 3CO5A 4HAXA 2XUIA 4XGNA 3N8NA 1ZP6A 5PGMA 3EXEA 3O3MB 2EHDA 1BXGA 1O77A 1BHJA 1TYAE 5COBA 3WYDA 2FUG1 4DG9A 3E7DA 1W73A 1DMRA 3HWRA 4RAQA 8LDHA 3E3NA 3JQ7B 3RTCA 3LQ1A 4O4LB 1NVDA 1LX6A 2B83A 3GRVA 1JQEA 3PBKA 4Q9AA 5EZQA 2AQIA 4M1SA 3ZC3A 2D54A 4D5GA 3DCYA 4TN1A 3H1AA 3SJCA 4HL6A 1VFNA 1CHDA 4EX6A 4EGJA 1ULAA 3THYA 4A36A 2DFTA 3I76A 1ADGA 1JEAA 1OZHA 1WY5A 2GJKA 4I9NA 4Z51A 1BFDA 5JSUA 1XK7A 1XK6A 4EQ6A 4CYMA 5KWIA 1MCZA 3HB0A 1G7CA 3GD7A 2FKNA 3Q1KA 4YUYA 5IXSA 2HMTA 2ZAIA 4N5NA 4YO7A 1N33B 3WGLA 1W35A 1OXSC 1Z8DA 1N9GA 2P3OA 3AOEA 1FS5A 1MDBA 5K0NA 3R7NA 4B79A 3K5WA 2GVZC 1H6CA 1COWA 1I2MA 2WJ3A 2VJDA 2ZT7A 1Z74A 1G9SA 3CF4A 1GGNA 2ONYA 3KYJB 1URPA 1G9XA 1H65A 4BKOA 1AZSC 1QFMA 1Q3HA 2PV0A 4CWAA 1M2WA 3AR5A 2IYWA 1LFAA 2ZI9A 5M3BA 4L0QA 4FIDA 1TTPB 3IEUA 2A33A 3MJTA 1GITA 2ZUSA 1UPBA 4TUYB 5JLAA 4FJ1A 4CLDA 3DEFA 4KZPA 3GDWA 4AO8A 4EJ2A 2G4LA 3LC1O 4ZRDA 3QX9A 5NLLA 2X0RA 1N4DA 2H2IA 1V7PC 2HR1A 1YR6A 2PKQO 4NYIR 1QGZA 1CULC 3E2IA 3QYAA 3O3CA 2IWHA 5JDIC 1KQGA 1ZIYA 4BLWA 2HIAA 2BGLA 4MVJF 2E3JA 4PU0A 5IRCD 3HSSA 3VOBA 1U9JA 2JC3A 4BNXA 2VJQA 4EECA 3AFGA 2IPAB 1GPUA 4TVOA 1I01A 2F67A 1IU9A 3GRFA 1O08A 3H8JA 3HWSA 3L1UA 2OYCA 4TS3A 1YXMA 2FLWA 4EFNA 2ZJFA 4JUFA 1SUDA 1D09A 2X8WA 5L3RA 3HA3A 1L8AA 5DWDA 2OQIA 5K7SA 1U9CA 4R68A 1Q7CA 3GGCA 3Q7IA 2YYSA 1NU6A 3VDNB 2Y0PA 4HCJA 2ALJA 4J16A 1QYVA 3GDHA 3KLPX 1Z08A 4NFYA 5FWXA 1BXRA 4B74A 1B15A 4I1RA 1QH8B 3SM3A 1W2WB 2JJ1A 5FWYB 1CV2A 2ZJ0A 3ORFA 2PGDA 4OJYA 4BRSA 3RRYA 4D44A 5MGNA 3MT0A 1GG5A 3CX3A 4JBLA 5JDCC 4BATA 6AT1A 4M1MA 3SVZA 1TQDA 2XBUA 3L4SO 3CH4B 5JATA 5U4QA 3ZHCA 3NHUA 1E20A 2K5UA 5AMXA 1B8OA 3K0AB 2HU2A 3MXOA 4JH0A 5CVUA 3KUXA 4A9AA 3VUEA 2QTLA 3GYBA 2XWPA 2WAYA 3F9RA 3KSZO 4MAMA 1DRJA 4ZHQA 5JALA 2PN1A 4DA9A 5DIFA 4OXNA 3VDMA 2OFPA 3IQEA 2X2OA 2Z1MA 3N8IA 3OCWA 3Q0IA 4GSYA 4MRVA 5JSFA 3ZE9A 4MPJA 3C85A 5CVCA 2I8LA 1NVEA 2GA9A 2C5HA 3H2GA 3N3AC 1WF3A 2JIBA 2ZREA 3EQ2A 2QM8A 4GI7A 3KHSA 5LP6C 1F2UA 2GBFA 3M3DA 1V8BA 1Z73A 3LM8A 3Q40A 1H23A 3L6DA 5F7JA 5ER9A 2Z6UA 1KJIA 3OZRA 1HDIA 2C29D 2O1SA 5JMPA 2XUHA 1FIUA 2Z04A 3C70A 3EMKA 4W9RA 3O91A 5JQWA 3TZLA 4R2JA 3LGSA 3ZHZA 1CFJA 1UWCA 5B7NA 1XCMA 1E9BA 1OTXA 3BJMA 4WHMA 1Y7TA 2AKEA 4FQ7A 1OXUA 2CEKA 4XI9A 4H7JA 3BBLA 5HE9A 2H4XA 4V1CI 2X58A 1B4DA 3QVKA 4ICIA 1ZIXA 3VU3A 4BKUA 4UBNA 5L53A 1NOIA 4PRLA 2QX8A 1T8PA 1AMUA 5I47A 1JXMA 1ZJ4A 4YV0A 4LV8B 1MX9A 2NT3A 5K3SA 1AS2A 1FFHA 3RVKA 2OZLB 4BKQA 3NEPX 5BT8A 5IZCA 2R11A 2WLTA 1P1RA 1ZK2A 3IHTA 2TECE 1U7ZA 3KAPA 3OEED 4JITA 1U2GA 3HYCA 4IXMA 5JZMA 1H9BA 1YL5A 3R74A 5HILA 1O8BA 2FPMA 3C98A 1R15A 4B9AA 2NTEA 3HLYA 5FDFA 621PA 4GF5A 1RACA 4LCBA 3OMWA 1E89A 3OECA 4Q34A 1Y81A 5CB4F 1ZA2A 2R7NA 3KU1A 4J8PA 3W5JA 3E53A 4OI2A 1M2HA 1EBFA 1LXCA 2CYCA 1T0PA 3QBJA 4KQWA 2JGAA 1P9WA 1PP4A 2QW8A 4LQ4A 3ZBTA 3D2BA 3DFZA 4D46A 1RU3A 4XM1A 5DOVA 1TI7A 3HP4A 5CTJA 5B58T 3RUFA 3O92A 3WK9A 2NOAA 5EOVA 1ZXLA 3ZYZA 5J2UA 1FJGB 1MIOB 4OAPA 1VIVA 4FQ8A 4XQ0A 4XVRA 3UAXA 2VPIA 5F76A 2WVGA 1DRVA 2SKEA 1D8AA 4I08A 4DCSA 1I5OA 2QGZA 4V24A 2BMWA 4RHCA 2XUDA 1LU9A 1PHPA 3CT4A 4D99A 4DBLE 3Q7TA 4D4HA 1VQ1A 1VSTA 4DB4A 4TTPA 2ZZMA 4K05A 3QWAA 3PT5A 2ZUDA 1T5SA 4F1WA 2XITA 3WIEA 4KDFA 3B2EA 1DADA 2LE0A 5AI8A 2D2VA 4F21A 3CVOA 2V5AA 1AQIA 3EWNA 5D3KA 3GARA 3GA0A 5HCUA 1E6KA 3JYHA 1K7CA 1YS1X 5TPWB 4I5DA 2ZYSA 5IANA 2OCAA 4OFZA 4DBZA 3ND9A 3AG6A 3PU6A 3RBZA 2W2LD 3LHFA 2NYUA 2IXAA 1D7AA 5ALNA 4NJMA 5EIEA 2NZYA 3HBFA 3P27A 1II8B 4TMKA 5EHGA 4BGUA 4YCSA 1SEVA 4RANA 3CEAA 3GPIA 3N2EA 4CKCA 4E5DA 3OG9A 2VWQA 1DB3A 1YJBA 3P5BA 4ZQBA 1XZHA 3NBQA 1U0SY 4LVCA 5TNXA 2EGUA 3QEMB 4UBMA 3M5WA 1WPXA 2G3YA 1E3QA 1MLDA 3G7NA 3P4XA 4KO4S 1XHEA 3TMYA 2HQRA 2PRSA 3I09A 4W7IA 3T7EA 3WIOA 2I6XA 4I50B 4EI7A 3COVA 1ULSA 2CCGA 3ILSA 4QXOA 4X1OA 1UM8A 1E59A 5G3YA 3ZHUA 4D4IA 1EJ6A 2X2EA 1FYEA 1UZAA 3FLEA 3FVWA 2ZI5A 1XRNA 3COSA 4JVSB 3KQYA 1R0LA 3EEIA 2E82A 3G2OA 2NUTA 5I4KA 3AKZA 4A26A 3WE7A 3EXHA 1NWHA 2A6PA 1VSVA 3FWNA 1MN6A 3HA5A 1UADA 1KPGA 2BFWA 4ND8B 1TZKA 4WASA 3EVZA 3TRIA 2KE5A 3DTNA 1KOJA 5T4HA 4ENPA 1HE1C 2QOEA 4FYPA 5FPKA 1C9KA 4N54A 4OGFA 3FGZA 1GRNA 1YBHA 5F73A 5JSYA 5IBCA 2BMJA 1JPVA 1I3MA 3RQSA 1AGRA 1EXWA 4KITB 4YPVA 1BDMA 2VRWA 3EGCA 3E5RA 4DKJA 2G63A 3SQLA 2WYWA 2WTNA 3ETDA 3IVAA 4H59A 2H7VA 4IKOA 1KMHB 2PT6A 2X5OA 1DNPA 5FPTA 4FWTA 4OQEA 2DWOA 5K0CA 1GO2A 5EXXA 3NDIA 2HA6A 1FA9A 5I48A 3KD3A 2XNJA 2CZCA 1P3Y1 1B6SA 1QHNA 2BISA 2VHXA 3QLUC 3A1UA 4HH1A 4UHCA 4IQFA 3U9SA 1AO0A 4NBVA 5FBHA 3EH1A 4G4SO 4AW9A 3AHEA 3SBEA 2J87A 3C6XA 1O8CA 4GWKA 2MCFA 4R0MA 4X61A 1ZH6A 2XB9A 3LX6A 3OC6A 4C7JA 4ZYYA 5CA0F 3IKMB 521PA 1FUIA 3M6IA 3KKEA 2D3WA 1LLDA 5DVZA 4UE2A 1Q15A 1ZIPA 4B6FA 5JCPA 4AUKA 4KQFA 4LJRA 2P75A 1Q91A 2P6OA 3IMGA 2IZ7A 2HGZA 3UV6A 2IXTA 3GEPA 3PIDA 5SYNA 4KVFA 2I3DA 1FYVA 2Y66A 3NVAA 4ZVQA 1R5NA 1SHKA 4CDMA 1W47A 1EDZA 1DG9A 2C5SA 2O2HA 1QG4A 4KXMA 4LE2A 4Q4HB 4ZAYA 1EX7A 5LBIA 4D79A 2CV2A 1IG0A 3PYLA 4K1XA 2DY0A 2ZRCA 2O4CA 2A92A 5CA1A 1XE3A 2R9VA 3OX3A 2A67A 1SC4A 2ZUCA 5LLDA 1U1DA 2NXJA 2P0YA 4FP9A 4MV4A 4AJ2A 1GNPA 1QHEA 3K8ZA 1ZNQO 3UK1A 3KPYA 1KMQA 1T9GS 2C2YA 3DV2A 1CUYA 1JE0A 1HYEA 1GTVA 4G3XA 5GJWC 3TOSA 3EAGA 2YH2A 1E1RD 4AFNA 2MSEB 2YYAA 5EP1A 4GRAA 4QHSA 3QQPA 3O4VA 1VDMA 1IY8A 3FI9A 1L6RA 3A2MA 4KWCA 3EXFA 4MS4A 3ON5A 4UPDA 2R4TA 4EI2A 3QWIA 3ZHXA 3KCNA 3ZVRA 4CTNA 2VBCA 4LSWA 3WIBA 2B4YA 3L0OA 3ROXA 4DLSA 2YN2A 3P2EA 2F1JA 1ZVKA 3MSCA 1S2NA 4L9AA 3NO4A 3ROMA 5I7RA 4KIFA 4O5AA 3VR3A 1MOQA 1FVXA 1QUEA 4OI1A 1VL1A 3KZKA 2Z95A 1H0HA 4L8GA 3SSMA 3A7EA 4ZDKA 2I2XB 2ZE6A 5FLYA 2JB9A 1K7EB 3FG9A 3G49A 3WRXA 2PVSA 3CS3A 3I61A 3DEKA 1UZMA 1A88A 2IRWA 1SBIA 3HKBB 1XLTA 3IEIA 4KXFB 1CR6A 1W5SA 4EEXA 4MI1A 5LXTA 2EW8A 2PZKA 3H9CA 4BO7A 5KNCA 5AJVB 4US1R 1PJCA 2YXPX 2B99A 3M6WA 3T94A 3EZXA 2Q4TA 2AK3A 3S70A 4GG1A 5A0TA 1O03A 2HHCA 1RQLA 3PDCA 4HFRA 1Y8AA 2GM5A 3MMZA 1OF1A 4MMZB 3F3SA 1MVNA 2JANA 1ZISA 2O5VA 5HRUA 3U4DA 1JNXX 1G42A 2OOSA 3GMDA 3I1JA 4WKBA 4UDXX 1C3XA 2PZFA 3VH2A 3PXGA 5HOQA 3AR4A 3KP1A 3ZX4A 4I5EA 4K8RB 3WLLA 5LPNA 2R62A 1PJRA 1JPNA 2QRLA 3RT9A 4ZTUB 3AB3A 4RL6A 1RZRA 1UBLS 1E1LA 5JS1A 4GHWA 1A2QA 2AGVA 1JE1A 4KRGA 3N6XA 4CDGA 3H6HA 4N03A 4PCVA 4QQRA 5I4BA 2BFEB 1SULA 3RFFA 4XFJA 4IILA 4CL3A 3PDJA 4LMBA 2REXB 3GT7A 1NGSA 4RLFA 1RIFA 2PTHA 5D01A 4QO8A 3OKAA 2VPPA 4JC5A 4M76B 3LVQE 5FNVB 4LXTA 5SZHB 1XMPA 4KPEC 1SKMA 2VAVA 3LIIA 1H5QA 3FGOA 1ZEJA 3RRBA 3U3OA 3V32A 2PS0A 1USIA 5EA2A 2QBYA 1S8OA 4YAUA 3VNVA 2IEDA 2PJDA 2YZ7A 2WWIA 4PG4A 4EW1A 5EGNA 1ZZGA 2XWBF 3D4NA 4RCVA 4TQGA 4XIYA 3W2FA 2AUNA 2ZIFA 4ZICA 3ICWA 1JSCA 3WJ7A 3H9QA 3NTUA 3I4LA 4ISCA 2WWXA 3COYA 4FNOA 4ILEA 1OPRA 4BB6A 1UFVA 4CIBA 5J5CA 1LBSA 2CV0A 2D74A 4GMDA 2RK4A 3FWYA 3CN9A 3FR7A 3HBJA 1P62B 1WW2A 2I7TA 1DIOB 3LP8A 3LXRA 4ZI5A 3TOVA 3SC2B 3FNIA 4UMEA 1JX6A 3DOEA 4J6FA 2V7PA 2GPBA 2AOUB 2QN6A 1XZ8A 1ZZEA 1Z07A 2X9NA 1UJ6A 4RA6A 3VUFA 3D8RA 3WJ1A 2I1VB 5F98A 1J7KA 4B71A 4GDMA 2GCIA 4EF4A 4UTVA 5IT9A 1N8NA 1GKLA 2PD4A 3T9DA 5IKXA 1E1RA 3EXG2 3BIXA 1KVRA 3I6YA 4JBNA 3K71B 2V8OA 1L5OA 3D59A 2JLRA 3ZOKA 3KTDA 1Q74A 3FPKA 4EOGA 1HO3A 5IG2A 2P2LA 1ISHA 5HFNA 3AJEA 2Q3JA 1E2DA 1JQ5A 3RVJA 5B58C 1XTIA 3R6DA 4OPMA 4HYQA 3FTFA 3B3QA 1E7WA 2J6CA 1C7EA 4J3NA 1WXFA 2Z4RA 5BR7A 3I5YA 2PMWB 5ED4A 3DPIA 1LTHR 4JKYA 1UBJS 3OUZA 4NYJQ 5E38A 3CVWA 3G9QA 2JFHA 2WJIA 2YXLA 1EWQA 1H0KA 1XTKA 2WHEA 4DDUA 1FLNA 1E5TA 1QP8A 1TEXA 2LKCA 5TQ2B 3W7AA 2P9BA 2IPMA 5NULA 1W5TA 1WD5A 2WJYA 4EPWA 3ZD6A 2IH5A 2X8BA 2HTFA 1L8QA 4MB6A 5T67A 4OIMA 3RSSA 4QT4A 2XMGA 4JXJA 2PCLA 3K09C 1RKUA 2YZMA 2G36A 4MB2A 1UEJA 2V3WA 1E2EA 3E03A 3L7YA 3ABIA 2I6SA 3A4IA 4LI0A 3SYMA 1W0CA 5DM60 4TTIA 5AW4A 4KXNA 2A9KA 4YCCA 5F5XA 1YVUA 2D59A 1XEXB 5G0UA 3FFXA 3K9NA 4KH1A 3IQGX 3Q3GE 2R6DA 4WLUA 4DWJA 4UQOA 4I2VA 4X7PA 1F1JA 1VLHA 1LQUA 2OV4A 1KP3A 3LRXA 3BMOB 3BIWA 1PSWA 2EG5A 2PX5A 4JDPA 1ULUA 2WB4A 4C0KA 2WJGA 1GQOA 4P98A 2Q5CA 1X7GA 3PD1A 4IDQA 3B1ZA 8ATCA 6NULA 1IN8A 2DAPA 3H8WA 4JS0A 4UHJA 4YMIA 3TTSA 5BR4A 3D0QA 3VYWA 3V4LA 3BMQA 3GDOA 5F51A 1N6HA 3OJOA 1W36D 3USES 2GWHA 3OWXA 1HZZC 4NCKA 4ACBA 4I4TA 1AQNA 3S2FA 4B6OA 3MGCA 5JXIA 5LMNB 1E9CA 3HP1A 4U9HS 5A4KA 2VK4A 3U61B 3GUZA 5E6RB 5HZKA 3DE0X 2I4OA 2C2XA 2PZEA 2QRQA 1P6UA 1IONA 1GQRA 1ODKA 1OZAA 1EDBA 4K2HA 2XMCA 1JHMA 4AG3A 2XXBA 4BMZA 4M8LA 3A2KA 1Z6YA 2BOVA 4C0JA 3U4MA 4E22A 5L40A 4LX8A 2ZIZA 1JR3A 4BWYA 4CCWA 4BXOB 3L8FA 1EKXA 3REQB 1W1IA 5HNKA 4PPGA 1S3GA 5KNBD 3P9CA 16PKA 1CZUA 2OHIA 3ZCPA 2CJPA 3IT3A 3JALB 2BMAA 2VYFA 4R9VA 2O05A 5U9CA 2VF8A 3FOEC 2OEPA 4L8VA 1TK3A 4A0QA 2O54A 3O26A 3OZGA 1ZJ5A 4CMIB 4DLTA 2OTCA 1X14A 1QR6A 3PXAA 1OSNA 2QMZA 4MJXA 2GEDA 1DHTA 4YJ2B 1LQTA 2QENA 5GOTA 5EUBA 5AHOA 3HM2A 3FPJA 4DXAA 9GPBA 5BN4A 4RUKA 4BFWA 5HPYB 1L5NA 4DDVA 1EK0A 3A3OA 1E1QD 3FMGA 1M0TA 3MWDA 1YS7A 3IDAA 3TRHA 4RY0A 1X7HA 1Y80A 1ZJJA 4RPIA 5CFZA 1UDBA 5CDSA 1EUDA 1VLQA 3I3SR 2BN4A 1S7GA 4MQBA 1BMFD 2HIMA 2OO7A 4YP5A 1G17A 5AUQA 4DXDA 5AVSA 5KTSA 4RPGA 5KSPA 3ZDXB 3WL4A 3D54D 2IUEA 3TAUA 4W9MC 1B0ZA 1O94C 2RDMA 1V6AA 2FW7A 4Y18A 1DTWB 4Y3UA 3UMCA 4X66B 1EFDN 4H08A 3FPHA 1IN6A 2XRMA 4IOJA 4J90A 5JARA 4V0NA 1CWUA 4OJTA 4D9NA 1RXWA 1JJAA 5MGBA 3K4QA 3EF1A 3SOZA 1MD9A 5CG2A 1Q0TA 1RBYA 2AXPA 4EX7A 1FFDA 1XCJA 1JECA 4PSKA 3TQSA 1NNSA 1X0VA 3QUCA 4P53A 3QGMA 4ROTA 4RZQA 3V1MA 3WXBA 5BUQA 4P0QB 3OF3A 3MXTA 1T1GA 4QDOA 3UENA 5HBRA 1JDUA 3H4IA 1R7RA 4MYHA 2A94A 4BNFA 2RKBA 1XJ0A 1BHO1 5BSRA 4E09A 3KQUA 1WV1A 1UZLA 2DEUA 4MR7A 1SVIA 1KEVA 1R6UA 4QTZA 5CK4A 4YQFA 4PW0A 1ZK0A 1DXYA 1M34B 2HUPA 2JKYA 2X0EA 4D9FA 2YL2A 1E3MA 1QAMA 5CU7A 3PX2A 1F3OA 4R8LA 3ZBQA 2V0CA 1Z39A 3COJA 1ANKA 3HPRA 5E4TA 1SIBE 5ITWA 1XPRA 4MRPA 3CVYA 1XQ1A 2H5EA 2FUCA 3W4JA 1LDEA 1Q12A 2XMDA 4LZNA 3T7IA 2L19A 2RHOA 2KW5A 3T95A 2CT8A 3W77A 2RCNA 1DOZA 3HY6A 2HQ1A 3GEDA 3K1AB 2DECA 7ADHA 2FXVA 2BH2A 1JQJC 3PJDA 1NVKA 4G81A 4L5IA 4C6TA 2FUNB 4CNQA 3J7AC 4DW8A 2B0JA 1MU0A 3BERA 1E2NA 1GR0A 3J81k 1KFBB 1DQNA 1GU0A 4HX2A 2H0AA 3MJFA 5E7MA 4MP6A 1IUNA 1DFGA 5FORA 3S3TA 4DQLA 4ZGGA 2GT1A 5HXAA 3RBVA 2HL6A 3R7WA 3ZJVA 2FMFA 2QRPA 3S27A 1JHZA 1IDN1 1UXGA 1NUPA 1RLOA 2ODAA 5ADUS 3WYAA 1QM5A 4NOMA 2FOIA 1ABEA 1P8JA 1UDRA 3ZU2A 3NHWA 4TL6A 2D1SA 2H5LA 5JFTA 1PQYA 3AQ4A 3H8SA 3NS7A 4XD2A 1XTQA 5DHPA 1BRMA 3QPBA 3GVCA 4U6QA 4TV9F 1T3ZA 1UMCA 3PHLA 5HMMA 1E7YA 3N75A 4QNNA 5EP3A 4D96A 2WD7A 3ZCTA 2HMYB 4AS3A 2O2XA 2DPMA 2QM7A 1KEKA 4FFMA 1IZYA 1JMYA 5SZIA 1AXEA 1E1QA 4FYIA 3DBRA 2AYZA 2VP9A 3D4OA 1KMIY 1BWRA 1E92A 2WHYA 3QSYA 1I4EB 2XLCA 2HSWA 1FSSA 1NC1A 3LNTA 5H70A 4XWWA 3LT4A 2CSUA 4FDTA 3MIIA 1U3DA 5AM1A 1KPHA 1SVMA 3DR3A 1EG7A 1K2WA 2BGMA 5EJ6A 5DHRA 5JG7A 2VNSA 1NSTA 3KKLA 4K8OA 1TE2A 5KQRA 1DIRA 4J9UE 5EE3A 3ZVMA 4NHOA 3K70B 1J0AA 5JECA 1TECE 2FPLA 5C1PA 4N8DA 5LWHA 4OP2A 3E18A 3GHYA 4UTRA 5KVSA 1R0WA 5GZ6A 1P9NA 2XJ9A 4MVWA 3FDIA 1TJPB 5DMHA 4Z3KA 2AOWA 1OX4B 4JEMA 2UYOA 4PXYA 1BMQA 4HX9A 4X7BA 4D3ZA 1VE3A 2PXXA 3C87A 5D86A 2AW3A 1OTYA 2WUWE 2APJA 1B0AA 4PZ0A 2W5UA 2WE8A 1A5ZA 2V65A 5KQSA 2WYVA 1YGPA 1BS2A 2ATEA 1SVLA 5EZYF 2WU8A 5JJKA 1FFEA 1KEPA 1Z4NA 4BN0A 2R00A 1BD4A 1TVEA 3KS9A 3IP6A 4UEKA 3VR1A 3NG1A 4O08A 4NZOA 4GPTA 1NVXQ 1ULHA 2IJGX 3EVCA 4CIVA 2GOYA 4OSOA 3JWIA 3QG5A 1H2ZA 3Q6MA 3GN2A 4Z9FA 4P8RA 3D2LA 2ZDGA 3OU7A 1UL1X 4RABA 3ZK9A 1FXUA 3C16C 2E0IA 2XT6A 4Z1OA 2G5PA 3ZKWA 3VR4D 2PU5A 5JPIA 1Y6RA 1ZKMA 2WWRA 1SCNE 3NCTA 2YS6A 2WKSA 3DZDA 4LMAA 3RUCA 4QWMA 3SE7A 4EHDA 4NK5A 3QXXA 4O4LF 1PHRA 4RPHA 5AM2A 1V3UA 1JGTA 3AOEC 4MKFA 5H3CA 3TI9A 4R71A 5BQOA 1JJFA 3VH4A 5ALVA 2W2OA 4EQZA 2EOAA 4D8UA 3L43A 4I3GA 1Q1BA 1XZKA 3X2EA 3Q1LA 5T8KA 3JD4A 4J2HA 4B5LA 2FU5C 2PSSA 3HKEA 3C3YA 3PXXA 1J2YA 1MG5A 2A0YA 2FRDC 2IGTA 2EFJA 4IJWA 4PTLA 1NJ8A 5ALRA 4X3PA 2QQGA 1KFEB 3QY0A 5EIBC 4KR9A 5DTMA 1E61A 4XFDA 2D2FA 1PT9A 3EZ7A 5C51B 1GNTA 4TYQA 3C1AA 4IYJA 2ZIXA 4NBUA 2EL7A 2FE4A 3IP1A 1ZLYA 1WVIA 4GIBA 1J8VA 1F20A 1P2VA 4CM7A 1AGNA 4GYJA 5IVIA 2IHUA 2X13A 1M33A 2XE4A 1GY8A 4ZZIA 2R1VA 4J0CA 4PPYA 2R48A 4M88A 3ZV4A 4W5QA 1W25A 4JL5A 5HF8A 5LU8A 3DVLA 3O21A 1H4VB 3LIPA 2PRYA 3RTBA 1ICEA 4KJXA 1Q16A 4B6JA 3IKLA 1YDFA 2QVCA 3PFIA 4Z4QA 2JI6A 3VM6A 3BFJA 4DMRA 3E35A 3MWLA 4I7EA 4N18A 4TUYF 4ML3A 3QI2A 3JYPA 2IP1A 4J76A 4QSHA 2HPZA 1KR5A 5CP8A 2GB4A 1LRJA 3OM8A 5E0KB 1WG8A 1N5RA 5DGDA 4C6SA 4I9GA 4ZCPA 2DTXA 3HXOA 1SWVA 4H4CA 4TLAA 2JI4A 3HUUA 4LV5B 4B09A 3I1IA 1LI7A 2RD2A 4MUFA 3UAOA 3SXUB 1HDCA 1DINA 3MTDA 3NTQA 5K0TA 1YFLA 3HKDB 4ALIA 4GKKB 1S2GA 1PNTA 2JEOA 4ZCRA 1CF4A 5BMOA 2C8VA 1USGA 1VA4A 3EIFA 3MS4A 4CKBA 3OO1A 4HN2A 4ES6A 2HF9A 1ONSA 1I3KA 2IOQA 2BPOA 1E2LA 4OHBA 3KOYA 2CJWA 1PBNA 1IUKA 4C0XA 2XCSB 3GL9A 2QHXA 5LMUB 1UMDB 2WEKA 4Y6RA 2BZGA 5DXJA 3HJGA 2GR9A 2UZIR 2ZVDA 3TKAA 2WNSA 3AXSA 3GQBA 4M9QA 4FOOA 2NAFA 6PFKA 3AF3A 3D8BA 2DT8A 1XFAA 4I1OA 3NUZA 5C3UA 1Z5NA 4RTLA 4ZOCA 1KVTA 1GGKA 1MJHA 1MOSA 4IHJF 3MB5A 3I6IA 3ROKA 3KEGA 5J5VA 2HA0A 3ZHRA 1YB1A 2WICA 2X4DA 1AO3A 1MRSA 3RARA 1ESCA 3TR0A 3SC4A 3W1VA 5K6TA 3U7QA 4KGDA 2P6UA 1MABA 4S2UA 5FF9A 3LHIA 2LP4Y 4Y6LA 1A4UA 5EN4A 5JD6A 1RAIA 1GTZA 4YMLA 1XCPA 2VI5A 5CXQA 1K5PA 4ZCQA 1OXBB 1Q0PA 3KIPA 3OPQA 1SBTA 2AH5A 1DOAA 1OWPA 3QU2A 1II9A 4Y2JA 3SHFA 3E9EA 2YHAA 4K9DA 1WM1A 1HT0A 4ZVLA 3T9EA 4D3FA 4ER0A 5F64A 2IU0A 3UHOA 3NV9A 3VV3A 2EBFX 3I01A 1SU8A 3WKEA 2FA9A 5BRAA 4DLZA 3NLLA 2VYNA 4BC1A 1ONNA 3AV0B 1MC5A 2VJAA 3FKJA 4S24A 5CB0A 3LFTA 2ISCA 1IUOA 3M4ZA 2YMQA 1XMSA 3F5DA 1PFGA 4AJPA 4FZVA 3BE6A 1E2QA 4ZVNA 3B1VA 4CM4B 4ENWA 3UMVA 4KNVA 1GPMA 4C5AA 2IOFK 4D0SA 5A5FA 3PCXA 2QTAA 3NYQA 4FFRA 4EDFA 4HRVA 2ZI4A 3K1JA 1CS4C 3IULA 3EARA 1QTRA 2VZ0A 2FSPA 2G4CA 4FBMA 4MQUA 3GT3A 4RETA 4B73A 4D98A 4ZEMA 4F4FA 2OG2A 4S12A 3TOCA 1RSZA 3B6JA 1NZFA 1U9IC 2J7PD 1EGVB 4U5XA 2WMYA 2GLXA 4RZUA 4B4VA 1WY7A 3SEAA 4F38A 5DK4A 3MAJA 2GF2A 3DMTA 3OJ0A 2ZPTX 3B1XA 5B1HA 2YJ6A 2Y1EA 3MWJA 5LP1A 5FAKA 2O14A 3P32A 3R0ZA 5HF6A 4WY2A 4K28A 1VGQA 3L4BC 1NI3A 1TLLA 3NWEA 2BH9A 3AJRA 2AKYA 4KN5A 5DT9A 3IIMA 3H05A 3HRHA 1EBUA 4U6NA 4HWKA 3PWSA 2FSIA 1KVSA 2XTMA 5LBUA 3RRXA 4AY3A 5I8PA 1JU9A 3PS9A 3BRCA 1FEZA 1PZMA 2XDQA 3G6WA 1I10A 3CT6A 3TNJA 5K8VA 3C6MA 4BVKA 4M38A 4EPVA 3FVQA 1NPTO 2VAMA 3FCUB 2RBEA 4UU0A 4MR8A 3I9V1 5TX7A 4DTIA 5H3HA 1NZDA 1VE1A 1GDHA 3ORSA 1JLLA 1U3GA 1QV6A 4CCYB 3QEKA 4CIYA 2CLIB 4ME6A 2X9GA 3UJ9A 2W90A 3A7DA 4IKEA 3FZQA 1ZONA 2V1UA 1T6NA 2GZ2A 3MRSA 3EPRA 3WG9A 1WXDA 1B6RA 1C1DA 1QH1B 1R6VA 3G2IA 4IIXA 4M6WB 2Q21A 1SEPA 2C9YA 2CXUA 3DM9B 1W0JA 3ZIUA 3F7MA 5A05A 1ZGCA 2A0KA 1KJ9A 5BY2A 2PWBA 3DVAA 4GMXA 4KL8S 3STHA 5JQGA 1EB8A 1HORA 1U0TA 1ZD3A 3KT0A 2PMCA 4YDSA 4OA5A 4ZDWA 5K3FB 2J08A 5KMGA 2QORA 2JCGA 1BQ3A 1WSDA 2WM9B 3ILVA 4O29A 4TWJA 2DQYA 4UUBA 2OXEA 1F06A 3HCWA 1Y8ZA 4OBWA 4RJ2A 2PAFA 2PDAA 1FRZA 1ZM2A 4ZAFA 1BVHA 3MLAA 4NBTA 1YOVA 1OBFO 5T4BA 1OUMA 2B0CA 1DO8A 1Z68A 4S04A 1PAUA 1JHPA 4DCVA 3TG2A 3HYNA 5JCJD 1J2RA 1JSXA 3G5AA 3ENVA 5TRTA 3AEKB 1JFVA 4RKYA 2OZKA 3ZBPA 3LP6A 4MEBA 4C2UA 1Z82A 1N5KA 3T52A 3HZOA 1LZLA 3TZHA 3X1MA 1E1CA 4E1BA 4ZC1A 1J90A 3W3ZB 2HRZA 1CYEA 2F17A 3ETHA 1GXSB 3GFSA 3C3XA 4AROA 2QWXA 4QUBA 4NYMQ 5F2KA 3EXHC 4XPIA 3CZCA 5ARCA 3R44A 1LD3A 2H52A 2A0XA 3GCZA 5FP0A 4Q47A 1POWA 5IHXA 3V1NA 5HG0A 3ZEIA 4GKBA 2PMDA 1RWOA 3O38A 4I50F 3ZHTA 3ZD7A 1KO8A 2C3OA 3KJIA 3FFTA 4IY1A 3A4MA 4QJ4A 4OUDB 3STUA 3FPLA 3SQWA 5MDHA 4K87A 1DJOA 1IHXA 2WR8A 4K6FA 4MGKR 3MWKA 4PPQA 3KKOA 2Z0MA 4L50A 5FYDA 3X1XA 2XA1A 3FKSA 3T7KA 4ZJUA 3U09A 3GJTA 1RPJA 4R1SA 3A25A 3V3TA 1PN3A 4RJKA 4CQLA 4J3JA 3X0DA 3WYCA 4EG0A 2QRZA 3CE9A 3NYRA 3NTXA 2X0NA 4IW3B 4KSBA 3BQNB 1Z3IX 3DTVD 4U2KA 4EYGA 4ZVOA 4MP3A 1FS4A 2N9UA 1Y1TA 4NMLA 3NRJA 3AR9A 5GIPE 2XLBA 3DKRA 4JI2B 3NNDA 4C7MA 3RIHA 1OFIA 3K35A 1TT5A 3JASB 4CMGA 2FP4B 2YOFA 4KQCA 3BXZA 2C9OA 1P1HA 3WISA 2BLNA 2Y0BA 1YS6A 3RYHA 3AEXA 1SXJA 2P68A 5IF3A 4FC6A 3WYBA 4CEIB 4QU5A 3OEHA 3WK4A 2KWIA 4DE5A 5H1YA 4WZBE 3L92A 5AKGA 1PG0A 2Q3FA 3GWGA 1G20A 1FFBA 1T6ZA 2KYRA 1PWHA 1PTJA 4LXUA 1KAOA 1RBQA 4EPRA 1CR4A 1G3RA 2BM1A 2JD1A 4XQEA 3NM6B 3SM9A 3AJDA 4RK6A 3HCFA 1M2VA 1UWKA 3JQFA 5IDVA 3IPCA 3T41A 5ADWA 4M9CA 3GROA 3L18A 4J1TA 5AOVA 3AF1A 4FYJA 2ECOA 5FA6A 1QORA 2WAOA 4WBNA 3A28A 1HLPA 1P2DA 3S55A 1SC9A 3VR2D 4KXQA 4DMCA 3NVDA 3MHPA 3QYJA 2F2TA 2RKOA 3FVRA 4FB5A 5AFSA 1P6XA 1N5OX 5IHPA 1LBTA 1J7JA 4XTCS 4EUKA 3PTAA 1FUYB 4PIVA 4GXQA 5AK3A 2WY2D 4YT2A 2DBVO 3KJEA 2VVTA 2G1UA 4PWYA 1QO0A 1AK2A 3UQZA 3ZE2B 2IOFA 3RD5A 4N5LA 4NK4A 2YV3A 3SG0A 3UXEA 4U63A 4TQUS 4LYGA 5D1HA 4KWIA 2GSWA 1T6BY 1V2GA 3C3KA 3ZV7A 1GTRA 5INTA 1TU0A 1NBOA 2F00A 2QQEA 2V6MA 3EXAA 4GGOA 5IDYA 3PHGA 3W5VA 2EATA 1U7WA 5AVYA 4EHKA 1HM5A 1H2YA 1RBMA 3FBGA 3WRXC 1TK2A 2IS1A 2EERA 1BROA 2WZBA 2OAEA 1KDPA 3LUBA 3BL6A 3PR1A 1KRXA 8AT1A 3WBKA 5EEHA 5L4NA 2ECKA 2H4FA 4HGRA 2Z2KA 1E9SA 3BS4A 3I3OA 4AF7A 2QXUA 1NBMD 2OCXA 2OO5C 1ZJYA 1JBQA 4WKPA 5EIHA 3TSZA 3EB9A 2W83A 1Q1EA 4NFLA 1Q7GA 4HDCA 5B57C 1RWXA 1U7HA 3K53A 3QBDA 4FFNA 5FPQA 2ZSAA 1ITZA 3MJRA 4Q16A 4Q7KA 4Q3CA 1T5TA 1NNEA 1KEZA 1MXFA 2C2BA 2HCRA 5DNEA 4NARA 3DHWC 3EVDA 1TMGE 3G0DA 4CM8B 1QGOA 1V45E 2VF2A 4FE3A 3AUJB 2X7HA 3EQ6A 1E0DA 2G5CA 4JLKA 3UM9A 4ECEA 2Z9BA 2GPTA 1VPVA 1R8SA 3CZ4A 1X1EA 5HHTA 4DMHA 1E63A 2JFGA 2D5AA 2COEA 3MF4A 1C1XB 1J5XA 3IHKA 1UFQA 1XQ6A 3NONA 2C57A 1BCSB 2PX0A 1ORWA 3FUUA 3ICVA 4M7OA 1SBCA 2EQBA 3RROA 3MBKA 1ZH2A 2GHRA 1W9HA 2VJKA 3ESRA 5DTEA 4UHDA 3VXKA 1GV0A 1OLUB 2P90A 1CVRA 1PZGA 2HDNB 4LYJA 4L08A 4IDOA 2I9KA 4HDRA 2Q4OA 3DH0A 4HNQA 1B2LA 1SB9A 4IXWA 4X60A 4B46A 4BO0A 1YIDA 3AM5A 3K0CA 1XJWA 1FMLA 2VTEA 3MTIA 1PZNA 2J3QA 3NRCA 4MV7A 4RVHA 3U5ZB 3GU3A 5C5DA 4Z4CA 1Y1QA 1RPNA 5AK0A 3LWNA 4MWGA 4I1VA 4GVPA 5BSMA 3QX3A 5FNVF 5A7GA 3B70A 3M1AA 4TSKA 2QUZA 3LLSA 2I2CA 2CF6A 4RNCA 2ZULA 2H4YA 3K1ZA 1W9MA 1IXYA 4A73A 1XRQA 4F84A 3WGMA 5KHAA 3L7MA 2YXNA 1FJ2A 3CX7A 5TT0A 4IIEA 4F3KA 5BOSA 2CL0X 3Q3VA 1FTNA 3FNBA 4K40A 5EVJA 1L0BA 4MWBA 5LP6B 1M2FA 3VR2A 1WX1A 3RADC 4DR5B 2BMFA 1RE1A 1UT6A 1PX0A 3QVWA 1DC5A 3GG2A 3GUYA 3SF8B 3TL6A 4CDNA 1BU5A 3AYXB 2QV7A 3U3JA 1PGPA 4RF5A 5C80A 4U2EA 4CR8A 2CDCA 1C8KA 1G19A 1AG9A 3HN2A 3ZH2A 2P5YA 5GJCA 1Z0UA 1P0MA 1VXRA 2ZRGA 1JLSA 3DYBA 1PEKE 1JDNA 4M3NA 1AURA 2RHMA 4Q02A 4EW3A 5BYKA 1PZXA 1OMOA 2UZ4A 3VISA 2VT6A 3AIIA 2BLLA 5T3UA 1IG3A 3OOEA 3MGGA 3TZBA 4NBRA 5C32A 4A2WA 2CL5A 1C1HA 3LGAA 1XHFA 2LCIA 1BMDA 1RPTA 3O2QB 4TGLA 5DM4A 1X1TA 3N2KB 4HB0A 2NPOA 1P1CA 2Z2ZA 4P2BA 3LDGA 4FFOA 1XNHA 3D6JA 2AXQA 2C03A 3OPMA 3EMVA 4XOIA 3RR2A 4KX5A 3ZQJA 5JJCA 3N5KA 1GZ4A 3QW4B 2ZWIA 3CNBA 3URMA 2QVYX 3NJRA 3UWSA 2ZJ4A 1W52X 3B1KA 3WR5A 3WZMA 1REQA 2A35A 2AR0A 3CISA 4QGFA 2EEZA 5BUSA 1E5XA 1TOAA 2NUPA 3DKPA 4KLRA 1QAQA 2HRCA 4LJ4A 4B4DA 4EUFA 1BVYF 1SQ5A 3QLVC 4LSMA 4X84A 1M74A 3MBIA 4G24A 2UYGA 1W85A 3U62A 1WHTA 4I3HA 1G21A 2FPPA 2HMWA 1H2FA 1WXIA 3R20A 1CRZA 2X4LA 2W6ID 4FMPA 3BIOA 3GQVA 2QMHA 4GOND 3Q2OA 2P91A 1THZA 3TIIA 1XLUA 5FOQA 2KB0A 3I1YA 5AW5A 1L7OA 3EGIA 3NTLA 5FPYA 2O7QA 3VDRA 4K7JA 3RB8A 4AZTA 5AOCA 5LZ4A 2NP7A 4GLJA 1SBNE 3UCEA 2JFFA 5K05A 3MQ2A 1KVUA 1KU6A 1BA2A 2RC5A 2WHXA 3AOGA 2QNBA 3OZVA 4AZSA 5L3SA 4TV8B 2R8EA 2BGKA 4HTAA 4GI3A 3DAHA 4KR2A 1WLYA 4R1LA 3W78A 1T43A 3EGDB 3JU3A 3R3SA 3VAYA 1UPCA 3FCXA 1MVOA 2ZS9A 4HGYA 4B7ZA 3U19A 5JAOA 3SHTA 2FMUA 4JR2A 4R8SA 3EF3A 4WCFA 3TGWA 2XMZA 5CT5A 4D0NA 1T1SA 3QA3E 2ZB4A 5E9JA 3GRYA 1Y98A 1W4CA 4TKUA 4F4DA 4B4KA 4OIFA 5ITZB 3KV3O 2IZ1A 4REMA 3IDFA 2Q0HA 3FTEA 3CLKA 3HL0A 2PPLA 4JXKA 2V4ZA 3TH5A 3EGWA 4XEHA 2QLBA 5HDBB 2HQOA 3K72B 2TS1A 2ZJZA 4NDZA 5ANRB 4C30A 3ZWBA 2B2XA 2AKAB 4EVQA 1J09A 1OROA 1KMNA 3RFCA 1NXWA 1T24A 1P4RA 2X6RA 4ZJYA 1X19A 3CLVA 2FG6C 3GNLA 1AHNA 4PN3A 2GN0A 5A06A 5C7LO 4HAYA 3M1LA 3W0LB 3WLRA 1B8VA 3CSDA 4TYMA 4IVRA 4BEJA 5A3RA 4HLQB 3GLTA 4L4UA 1Z38A 3ONFA 2CN1A 3G0IA 4PGGA 3T12A 3SJUA 5L4SA 1RVV1 4TVBA 4FHZA 1AXGA 2E4AA 4RVUA 4V3CA 3RTGA 3MRTA 2BI8A 3EPJA 3RKSA 1SQGA 1MUUA 2NXNA 2JHFA 1IB0A 3RG8A 4ERNA 2EYQA 2OBXA 5F3WB 4YJ2F 3R6GA 3UMFA 3ZKAA 5K8CA 3DOUA 4LNUA 5MN6A 1JS1X 2ZIWB 2ONJA 3OIFA 2PQMA 1E3IA 4URYR 2AFHB 1D03A 2VDWA 1YE5A 1HQYE 2R97A 1UBFA 5F2EA 1XPJA 4ID3A 3ZI0A 5FNZA 5TMBA 5K6AC 3H4VA 4RW0A 3DFFA 3U39A 2MHCA 2YZGA 4J0EA 3V1UA 5CDFE 5JAIA 2NMVA 2QL7A 4GKJB 3D2AA 2P5UA 2UUAB 1U0BB 4EAAA 5GZ3A 2IHNA 4HOYA 4HF7A 2H1SA 1OU0A 2D5CA 3JQ8A 1QHFA 3H1FA 3O2SB 5L95A 4X1KB 4AS2A 4F6RA 2EWVA 1NBIA 4L74A 3NXKA 4LG1A 3B13B 4G8BA 3U0VA 4ZCTA 3FPCA 1JA1A 2M32A 1N8TA 2DFVA 4KPUB 3GJYA 4MPDA 3VPHA 1OOEA 3SS9X 1IWPB 1IIBA 5IYZB 4KQEA 4YCNA 2W6IA 4RFLA 4DWWA 1Z4MA 3IHLA 1EVEA 3JVEA 3UNXA 3TAXA 1YD7A 5EYPA 5AOAA 1MHPA 2BC9A 4PC2A 5G4KB 3A1NA 2PH7A 4K6GA 3VX4A 2VXOA 4U7FA 2HKIA 3ENNA 4X1YA 5DLEA 1NRJB 1V11B 1SFRA 1MO3A 2OPHA 5A9RA 3TFWA 2ZTVA 4DRZA 1W36C 1P5JA 5EIFA 1NJ1A 4MS1B 2Q1SA 3E6AA 2GD2A 4DDKA 5I7UA 3ERCA 2JCBA 4FSHA 2JZNA 2GD6A 3K0EA 3NOQA 4M0FA 1GUDA 1Z18A 3PC6A 2IS4A 1QHGA 4NOKA 1C7QA 4YVFA 7YASA 2QUKA 3P0JA 2WSBA 4OHZA 5IKMA 4XR9A 3ANSA 4QYWA 2AHOA 3ZJ4A 4HNUA 4ESVA 1QG6A 3EEYA 1JZQA 1OZ0A 2P69A 2P4HX 3EA0A 1GTG1 2QX9A 3P9XA 5T4FA 1XAHA 3NBUA 2W8ZA 4DT1A 5I7VA 2CDAA 421PA 2ZFUA 2ZSUA 3TYXA 5ERXA 2OOKA 4D7AA 1U0OC 1NURA 3PK0A 4NZ9A 2KHZA 3BXHA 3H65A 5DGHA 2C4KA 4KOEC 4DEVA 3LUGA 3HP7A 1NE2A 1MV8A 4LDJA 1I1HA 4MVCA 5E9WA 3T4PA 2SICE 1VI2A 2G09A 1V47A 4JT4A 3P2JA 1LK7A 3HADA 2V7TA 2XF2A 4IFEA 3QVUA 4WLFA 1YO6A 1IIRA 3TL3A 4E12A 1CZNA 1G64A 4RGQA 3EPLA 1D0IA 3OKPA 1CEYA 1SB8A 1QK3A 3PUVA 4R4JA 2I2FA 5K3OA 3TXYA 2VH1A 4QD3A 4RE5A 1EVJA 4RX1A 1FTGA 2WF6A 4A0GA 1QHYA 3ETJA 2D2EA 3PKJA 2Q62A 4YYZA 4Q18A 1M1UA 2Q50A 2EJVA 4MLPA 4D56A 4WW0A 2BI7A 1PK9A 1Y5MA 3R5SA 1Y3IA 2GEVA 4TT3D 1DEXA 2WIFA 4O4IB 1RWNA 1FPQA 3HO6A 4YR7A 4IICA 3RK0A 3HH8A 4DYHA 2DBZA 2WINI 2WIBA 1VKRA 2CUNA 2EX4A 4QEKA 1V7QA 1ZCBA 4PS1A 1JUDA 1O96A 4WPGA 3CNHA 5FA5A 4CTOA 2YV5A 3WS7A 3UK2A 3WXMA 1L7EA 4GBMA 3FYTA 4DV6B 3H9BA 1GPAA 3BICA 3DT8A 1DI0A 3RRZA 2IZ5A 3SR4A 3DEJA 4Q3AA 1GZ6A 1O97D 1CE8A 2FAXA 4AMBA 3G0CA 2B1GA 1Q22A 2A7XA 3FYUB 1B16A 1WZCA 4FIZA 1Z34A 4L5YA 4MO2A 1T3SA 4QC2A 3A3KA 1E2JA 5AVRA 1A27A 1WDMA 2Z6AA 4WINA 5D5QA 1QYWA 1IUPA 1PW5A 2FW0A 4PINA 1MX1A 3DGEC 1MW8X 3OA2A 3ZY2A 1EDEA 1Y4UA 1ZVMA 5C52B 2QT1A 3BREA 3IVMA 4KR3A 3D3QA 3BXEA 2FN7A 2R00C 4RTJA 1R1DA 1JQDA 1XIVA 3P0IA 1L5VA 1P5RA 1G3IA 3RPEA 4E7PA 1AJEA 4Z54A 4HH3C 3TRFA 3GFGA 1PUXA 1YB2A 4S3MA 1CY7A 4CKEA 3E82A 1VSQA 2FEAA 1FRNA 4O2AB 2CVOA 2YBEA 4BLUA 1GZUA 2NO4A 3HGTA 3ACDA 2PCJA 4CKWA 3OE7D 5I9TA 3ZTTA 2OHXA 4RPCA 4RWEA