4HZGA

Structure of haloalkane dehalogenase dhaa from rhodococcus rhodochrous
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus sp.
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hzgA00
3A6ZA 3QITA 4KE7A 2C4HA 1CUVA 2WFZA 5AM1A 5FXMA 4PV7A 4B7ZA 5AKXA 2I3DA 1XZDA 4MWTA 2QR5A 4H7JA 5ALRA 1XZJA 3MVEA 2XMRA 3QPCA 4X6UA 3I28A 1Q84A 5LYYA 4BB0A 1XZLA 4RPCA 2YYSA 1EDBA 3V9AA 5BWCA 1W75A 4DTCA 3VXKA 5A2GA 3M3DA 3D0KA 3GA7A 3V1KA 4C4XA 3I2IA 2QXUA 1CUSA 4FNGA 4QZVA 3I2JA 2G63A 3IUQA 2DSNA 5ALVA 1C7JA 5A71A 4GEGA 4C89A 5LKRA 3R3VA 2OCKA 4PF1A 2H9YA 5CMLA 2OG1A 3F8SA 1GXSA 1CIJA 1BCSA 1XRMA 5AKEA 3D2AA 4PSUA 4Q05A 3M82A 1ETHA 2QTBA 2HU5A 3V1LA 2OQIA 4E14A 1CRLA 4FTWA 3R3YA 4HAIA 1WCYA 3ICVA 5JD6A 4N5HX 1AURA 4UBOA 1BE0A 3TRDA 4Y7DA 2PSEA 3WQHA 4I4CA 1J07A 2WHQA 1QE3A 2HL6A 4U2GA 3WJ2A 1J06A 4DMKA 4KE9A 4QDOA 1UOPA 4OYLA 4Y2UA 1P0PA 4B9EA 3H1AA 3WL8A 1WHSA 1FFDA 1VZ2A 1ZD5A 4BZZA 3OOSA 1CVLA 4CFSA 1CEXA 1F0PA 2HRQA 4CIBA 3A2LA 3AIKA 4OD0A 2HFJA 4FLEA 4DNQA 3H0CA 2XQGA 5JANA 5HK9A 1RYYA 3WYNA 4H7HA 1XRQA 1BS9A 2JIDA 1EB8A 2R8BA 1C4XA 3HACA 3S2ZA 2H7XA 4QDZA 3JWEA 2XMBA 1M33A 1UZAA 5ALJA 1VKHA 4C01A 3PDCA 1AKNA 4GBGA 5E4YA 4ETWA 2ACKA 3N2ZB 5H3HA 3DKKA 5CH8A 4I19A 4W1PA 1UK7A 3FLEA 4MYSA 4B82A 4G1FA 3OPMA 2O7RA 5IVKA 4EZIA 3R40A 5DLPA 1LPOA 4X00A 1EH5A 4Q82A 1TQHA 1QIIA 3QMVA 1BU8A 1EX9A 3PF9A 5K3FA 1CUJA 5LZ7A 3FYUA 2ZYRA 3YASA 1AUOA 5T4HA 3O9MA 4H7FA 3AINA 3BWXA 4P92A 4WDQA 5DYTA 2BFNA 1HKHA 3L1JA 3OTQA 3WK9A 3V48A 3C5VA 3H2HA 3WK5A 2JGJA 3EQ7A 2Y6VA 2WKWA 3BL8A 3VJMA 1R9MA 1JFRA 1MX5A 4OB6A 5C8ZA 2C0QA 2BUAA 1EK2A 3WIOA 4MWSA 4GW3A 4DMHA 1CUIA 2O2IA 2WUFA 1OILA 1UKAA 3WWCA 5K3DA 4X94A 1VA4A 4KACA 4PNZA 4WFJA 5YASA 4UFOA 2XQIA 2O2HA 5JD5A 1ODSA 1XQYA 4UFPA 3H04A 3GROA 2WJ4A 4UBJA 1B41A 1DQYA 5AKZA 3IULA 3GELA 3C45A 3DEAA 1YS2X 2GYWA 3I1IA 4P08A 4L72A 3LIIA 4M0MA 2VAVA 4PQEA 4PW0A 2J4CA 4F60A 3STTA 2H7CA 1P0MA 3FVTA 5LZ2A 3GBSA 4GWLA 1BRTA 4TGLA 4EHBA 1CUBA 2VJDA 2DQYA 2WM2A 4O08A 5ALXA 2WIKA 4A23A 3ESBA 2XMCA 1R9NA 4K6HA 1UKCA 4IHAA 1CUHA 4K2AA 3WLAA 2QZPA 5A6VA 4J0DA 1JJIA 2R11A 3QYJA 4H7KA 2RHWA 5JALA 2AJCA 2LIPA 3WK8A 2BCEA 5JZ9A 1QGED 7YASA 3H2IA 3A2NA 2H7YA 3QPDA 4FBLA 3CXUA 3IUMA 4BTVA 1AMNA 5K3FB 1XROA 4UHCA 5IVHA 2BGRA 1ZD3A 2RHTA 3FYUB 3DJYA 2PSHA 3PFCA 4BAZA 1DWOA 4BDTA 4LXIA 2WUDA 3G0DA 4Y2SA 1ZIXA 2ZVDA 1ZI8A 1DX6A 2ZJFA 1ODCA 2GZRA 2D0DA 4RE5A 3E3AA 4PSDA 3L1IA 4ROTA 3WWDA 3ANTA 5LKAA 5K3AA 2E3JA 3UUFA 4F5ZA 4BVJA 1MNQA 5CH5A 1R3DA 4BBZA 1AX9A 1EI9A 2RI6A 2CMFA 3H18A 3ZLVA 1IMJA 4UHEA 3C70A 1K63A 1G4HA 4EY8A 2WHPB 3D7RA 3IA2A 1GQRA 4Z49A 1G66A 1MX9A 1THTA 2ZYIA 4OUKX 4G4GA 1IUNA 1N8SA 2VEOA 5LZ5A 4UHHA 4BYMA 3QMMA 1QJ4A 3G9XA 1JMKC 1VZ3A 3H1BA 3F96A 3C6BA 3D2CA 3DS8A 1MPXA 1GKKA 4AZ0A 4IH1A 3SC2A 1ZIYA 3TGLA 2HA7A 3SWWA 3ZLTA 5EFZA 4H7DA 1XRPA 4JYPA 5ALYA 3WK4A 4KAFA 2Y2UA 1HDEA 5ALMA 4AB1A 6YASA 1XZIA 3R41A 4HVTA 4G8BA 1GZ7A 1VE6A 4B0OA 4BCDA 5FUMA 2B4KA 5ALIA 5K3BA 4DM7A 3BJMA 2Z3ZA 4KAJA 3E0XA 3MUOA 2RAUA 1THGA 2W22A 1UWCA 5AI5A 1R88A 2GBCA 3LLCA 5ESRA 1QTIA 5IKXA 4Q1VA 5I9IA 3FYTA 3GFFA 3DCNA 3I2GA 5AM2A 3KOOA 4LHEA 3C6XA 4AMYA 4HXEB 1JI3A 1U8EA 3WJ1A 3C8HA 2C5GA 2QKYA 5AI4A 4DNFA 3ANSA 5CT5A 3VKFA 1HQDA 2IIVA 1HL7A 3AIOA 1OCEA 5ALGA 5AOAA 2AJDA 1E66A 3AIMA 4H7IA 3DDUA 3D5EA 4C6HA 2XUIA 1CUDA 1X70A 5BOVA 4NS4A 5ALWA 5JD4A 1YASA 1PV1A 5E4TA 4B83A 2WUGA 5ALLA 5CRIA 4N5IX 4X6YA 5ALSA 3T4UA 1YA4A 5D7BA 4MQMA 2PBLA 2DCMA 4L3WA 5C8VA 1H2WA 3K6KA 5FV4A 1JKMA 4H77A 2WIGA 2XUHA 1KU0A 2WHRA 2RIPA 3ZI7A 1CUAA 1CUUA 4DMFA 4WFIA 3WKDA 3DQZA 1WOMA 5AKKA 3KXPA 1F6WA 3LCRA 1AGYA 3HXKA 4ZI5A 1LPNA 3CCCA 1B6GA 2BKLA 4G5XA 3K2IA 2CJPA 4OB7A 5HFAA 4BRZA 5HF6A 5AM0A 3V1NA 3AJAA 4X85A 5E2IA 2QM0A 3U0VA 4X90A 5BV7A 4BE4A 1A7UA 1A8QA 1F8UA 4FKBA 1IUPA 4BC1A 2OCGA 3FLBA 2X76A 1YA8A 5AOBA 2PSJA 2XE4A 4AQDA 5AKJA 3KSRA 5CT6A 2VF2A 1FSSA 3HSSA 1LGYA 2HDWA 1IVYA 2WIJA 5AH0A 2OPHA 3I2FA 2XMGA 1R50A 4TPKA 5C7YA 5AKIA 3BDIA 4UHFA 1CUWA 3K9BA 4WDRA 2QUBA 1VXOA 2WUEA 3WWOA 4OPMA 4QNNA 4CG2A 1MJ5A 4CI9A 2QMQA 4KEAA 2WIDA 5DJ5A 4BP8A 4AX4A 4N8EA 1L7QA 4B80A 3ZV7A 3BXPA 2V98A 4HRXA 5K3CA 4KE8A 4W9RA 1K8QA 2ECFA 3HEAA 5A7GA 3FSGA 5AKLA 2EDAA 5HF8A 1UK9A 2I03A 4I3FA 1BN6A 1H2ZA 3IB3A 2JGEA 3H2GA 4G4JA 3L1HA 1DINA 2CZQA 5JAOA 1NU8A 4QLOA 2XLCA 3FLAA 3IBTA 3Q8WA 4HS9A 3WI7A 3C87A 3KWJA 3H17A 4HXGA 5LZ9A 2FJ0A 5CXUA 1DX4A 1EB9A 4J0IA 3RKSA 2HA4A 3HYSA 1QZ3A 4ZGBA 1QIJA 2WG0A 3HLKA 3DKRA 5EIAA 4Q34A 1X2BA 5ALQA 4BVKA 2JGFA 1ZGCA 1L7RA 3ESDA 3RARA 4ZRDA 2VJCA 4X7BA 5ALDA 4ITVA 2WLSA 1XLVA 4LXGA 5EIEA 3BIWA 5JAHA 5HCUA 4UBMA 2PKYX 2Z3WA 3VISA 1K6EA 4DSAA 1J2EA 3KDAA 4EY4A 1Q0ZA 1EA5A 3DYVA 3F97A 5JZSA 3KWFA 5T4EA 5CTAA 3DL7A 1O6GA 2WJ6A 4P9NA 1LZLA 2WQZA 2WILA 4G9GA 3HI4A 1CUEA 2D5LA 3WZMA 1XKLA 3FNBA 5HKBA 4X3CA 5JYCA 3ZLUA 2JEYA 2HRRA 4ZV7A 1A88A 5D6OA 4DSZA 2CEKA 3WZLA 2WTNA 3ESCA 4QLAA 5EHNA 4AXBA 2Z8XA 5DTIA 1T4MA 4HTAA 5A62A 1P0IA 4YK7A 4GHWA 1QIHA 2HADA 1E5TA 4J0KA 1W6RA 4PSCA 2WFLB 1AQLA 3PFBA 4KR0A 1GPNA 1EVQA 2PL5A 3FVRA 1XLUA 3O95A 3R3WA 5FP0A 1LBSA 1SFRA 3F98A 5AKYA 1MU0A 3JW8A 5AJHA 1EVEA 3O4GA 5DNUA 1QIKA 1CUFA 4J0CA 4UBKA 3NUZA 4JH0A 3WL6A 1A8UA 5D3ZA 2OGZA 1ZICA 5IVIA 2J4FA 4K6KA 2PUJA 3RK4A 4H18A 1O6FA 2XUFA 1FFCA 1LPMA 4FLMA 3SX4A 4EY7A 2X5XA 2J3DA 4RNCA 1X2EA 2OGTA 1IZ8A 3R3ZA 2CBGA 3WA7A 1W1IA 3TJMA 5AM3A 5CXXA 3RLIA 3R3XA 2DR0A 1MTZA 1FFEA 3BIXA 4KRXA 4AN0A 3O0DA 3OG9A 5EI5A 4W1SA 2FUKA 3D59A 3I6MA 4FNMA 3PE6A 2RONA 2B61A 5KBYA 1SOMA 2ZSHA 3DL4A 4KAAA 3AZPA 1GPLA 2PVSA 3MGAA 1XRRA 1HPLA 2WHPA 3GUUA 3I6ZA 1TCBA 1E8DA 1XZMA 4X91A 5ALNA 3W2TA 4U2CA 5EHXA 3H2JA 3G9UA 1FFBA 2XMQA 1MN6A 5AO9A 1QIMA 4AO7A 1WM1A 3ESAA 5AI6A 4IH4A 2JF0A 3A2MA 3IDAA 4LKOA 2BUCA 1QONA 2ZSIA 1LNSA 5ALEA 3WYDA 1QIFA 5LZ8A 3PUHA 3BF7A 3QH4A 3S8YA 1XRNA 2JGKA 4OB8A 4CCWA 3M81A 2BJHA 5HF5A 3I6YA 4C88A 4UBLA 1DT3A 1H23A 4JYMA 2PM8A 4IQ4A 5AI0A 2PSFA 5LIPA 4U2BA 2WJ3A 2QXTA 4OU4A 1XFDA 2XQKA 3WL7A 1AC5A 3HRHA 2DHCA 3G02A 2XT0A 2WSLA 1N1MA 1U2EA 1U65A 4B0PA 2C58A 4IO0A 4QDTA 3WKBA 4YX9A 1DT5A 5AKHA 3T52A 1TK3A 3ILSA 2ACEA 3G0IA 1LBTA 4J7AA 5A7FA 3WKEA 2ROQA 2VAXA 4WY5A 1CFJA 1QIEA 4H7EA 4UBIA 4RGYA 4ZWNA 5DYWA 2ZJ6A 4S0XA 3E1GA 2J3QA 4HZGA 1U4NA 5AI9A 1R4ZA 4JUIA 1XZGA 4CG1A 2WIFA 4GECA 1ODTC 1VJ5A 4E46A 3AZOA 4ZXFA 1ISPA 1EHYA 1PJAA 2XUQA 4X95A 1YAJA 2B9VA 4V2IA 2GYUA 3O9VA 4RE6A 3JYHA 4DIUA 5HFNA 1F0NA 3OM8A 1ZGBA 2AXEA 3IIIA 2PPLA 1ZI9A 4B85A 5EIHA 1USWA 1XZEA 3AILA 5ALPA 4Q3KA 1CUZA 2OXEA 5HZGA 2V96A 1E8MA 1EXWA 3C6YA 2VT6A 1WB4A 4BTLA 4W1QA 1GGVA 5DNVA 1XZCA 1YAHA 4UBNA 1JMYA 3FYUC 3G0BA 3CN7A 5SYMA 4YASA 3W04A 3BE8A 5ALOA 1QTRA 5FKJA 2BUBA 4MQLA 5CT8A 2FX5A 1G5FA 3FCYA 2QS9A 2EDCA 3EF3A 1RP1A 3D2BA 4J0JA 1BEZA 4Q3LA 3QVMA 4HRYA 5J3JA 1Y37A 2G5TA 2VT7A 4XIIA 2XMSA 3UUEA 5HF9A 3C5WP 3EIOA 3I2KA 2K2QB 3H2KA 5AP9A 1XRLA 2WG1A 3DLTA 3UMJA 1MO2A 1VOTA 5T4FA 1K4YA 3F9CA 3C8DA 3OURA 4LYDA 4QA9A 2OCLA 4EUSA 4Y2RA 4FLFA 5AK3A 1CUCA 2RGUA 3RM3A 1CUXA 1LZKA 1H22A 4G9EA 2OLEA 4Y2TA 3LIPA 3M83A 3I1YA 3O4IA 4X6XA 1YS1X 2XQFA 3DNMA 4MYDA 4XWGA 3A70A 4NZZA 2JGMA 1GQSA 4G8CA 1CQWA 4A5SA 1XZKA 5FPPA 5FPQA 1Q0RA 1YB6A 5KWJA 5AIBA 1XQXA 1XZAA 4E15A 3DOIA 4Y9SA 3AUKA 4AMZA 1T2NA 1MT3A 1VA5A 4KE6A 1ZOIA 3Q0TA 4KRYA 2ZJ7A 2QJRA 1EDDA 1EK1A 3G9ZA 2QUAA 4EY5A 3STWA 2PU7A 2WFMA 2O7VA 4J0HA 4J3JA 4J03A 5AICA 5AKGA 3HJUA 1TRHA 4L9AA 5JADA 1SCKA 4NVRA 1BCRA 3W06A 1HBJA 2BAGA 2HIHA 1D07A 4M0EA 2Y2VA 1DU4A 5FRDA 2WFLA 4AO6A 3BF8A 2O2GA 1LPBB 3VJKA 1MX1A 1E89A 2OAEA 2CB9A 4WJLA 3C6ZA 2JGIA 2Y1KA 5EHQA 5HKAA 3DOHA 1RWQA 3QMWA 5K3EA 4BCBA 2WTMA 4OCZA 2CKMA 4X71A 1UK6A 2G5PA 3R0VA 3WK6A 4H0CA 4BZWA 4LYEA 2B20A 3G7NA 1CV2A 3E4DA 4B81A 5IH7A 5IVDA 1WPRA 1SCQA 4K5QA 3HABA 1PFQA 4MJ3A 1JU4A 1FFAA 2DFPA 1TAHA 3HZOA 4JNCA 2HA6A 1BROA 1SC9A 3NOXA 1I6WA 2HU7A 3CN9A 3WL5A 1JT2A 4X97A 1W52X 2UZ0A 5KREA 5FLKA 1XKTA 1TCCA 1UOOA 1YR2A 1Q83A 2QVBA 4FDMA 4FHZA 4UHBA 1Y7IA 1WB5A 4GLBA 4QWMA 2DHDA 3B12A 4P93A 1UK8A 3VVMA 1GKLA 4X92A 3LS2A 1DTEA 4Y2XA 2XMZA 2H1IA 4YPVA 2JEZA 3EQ9A 4Y2VA 3O4HA 1L7AA 3ZWQA 3I2HA 1UFOA 3QBJA 2YXPX 1DWPA 4BVLA 3P2MA 2XUDA 4QE3A 2VATA 1QOZA 3PF8A 3D3NA 2QRUA 4B6GA 2GBIA 4UPDA 3WIBA 2VTVA 1W76A 5EHZA 2DQZA 4ZV9A 2WU4A 1MAAA 3X3HA 2AJ8A 3FAKA 5HQ3A 2OQVA 3IVMA 4FFWA 1KU6A 2IX9A 3FSGD 5KWIA 1CR6A 5F4ZA 2GZSA 1MNAA 1UKBA 1WHTA 2QOEA 4OYYA 1Y7HA 4JEIA 5AIAA 5A7HA 3WKCA 1S8OA 5D3KA 3HC7A 2YH2A 3PI6A 4OSEA 4BE9A 1XZFA 3AZQA 3IURA 3C43A 1QIGA 1XLWA 3WWPA 1IZ7A 4PO3X 4DGQA 5AM5A 5ALFA 2VQ6A 4CIAA 1DQZA 5LP1A 2PX6A 5CURA 4DNOA 5FDFA 5FOQA 3ZPXA 5K5EA 3QZUA 5ISMA 4KJXA 3FBWA 3WK7A 4C87A 1VXRA 1AZWA 1LPSA 1WPXA 4G4IA 2DHEA 3VDXA 1CQZA 4U2DA 1TCAA 2PUHA 3U1TA 3W05A 3WWEA 4CCYA 2VJAA 2GBGA 1E3QA 2V9ZA 5CT4A 1H2YA 2NW6A 4W1RA 3TEJA 5DTJA 4BC0A 4FBMA 2XUJA 5ALZA 2HHAA 2WG2A 5DYYA 4ARAA 3PUIA 4DMCA 1QFMA 3KD2A 3W9BA 3G0CA 5JIBA 4MXDA 1MAHA 5JATA 5ALHA 2XUPA 1LPAB 2Z8ZA 3V1MA 1WB6A 2VJBA 3QPAA 4X93A 4J0GA 2OGSA 1ZD4A 5AHXA 2Q0XA 5AK6A 5JAUA 4N8DA 5JAPA 4HXFB 2VA9A 3VJLA 1YB7A 4Y2YA 4ZREA 4G8DA 2HM7A 3B3QA 3MUNA 4WFKA 1CUYA 1NU6A 2GYVA 4WCVA 4UHDA 4F21A 3B5EA 3CCBA 4BATA 1XZHA 5HQ3B 2XDWA 2HA5A 2ZYSA 1ORWA 1K5PA 4BCCA 3WKAA 5BWBA 4Y2JA 4EY6A 5I8PA 3NWOA 4GDMA 1VLQA 3FOBA 1GPKA 2XUAA 3STUA 4L0CA 2WU3A 2QT9A 1G42A 5CH3A 5CT9A 1CUGA 1XZBA 2XB6A 3EBLA 3STXA 4AZ3A 1W4LA 4BAGA 4INZA 3FCXA 3D4LA 2V97A 5JZBA 2EEPA 4C4YA 1C7IA 3ED1A 1R1DA 4B9AA 2X8BA 2XLBA 5C81A 5AI8A 3NGMA 3AFIA 3H19A 3G9TA 5ALUA 1TIBA 5DNWA 2ES4A 1H2XA 1BEEA 5ALTA 1DWQA 5CW2A 1N5MA 4EBBA 2JGLA 2AJBA 1VE7A 3FWHA 3QM1A 4MEAA 3STVA 4GI1A 4H35A 4W63A 4EB0A 1QO7A 4CCYB 2C0PA 4FMPA 4XVCA 1YCDA 1QLWA 1SCIA 3WMRA 5EGNA 2Y6UA 3BDVA 1N5RA 2W6CX 4D9JA 2PSDA 5JARA 4TVKA 3WA6A 1LPPA 5AK5A 1P0QA 1JJBA 2IITA 4B84A 1J1IA 3IUNA 1Z68A 1KEZA 1XQWA 3SK0A 4NMWA 1EDEA 4F0JA 3PICA 2C5FA 2QJWA 4IH9A 1ACLA 1UT6A 4DYHA 5AK4A 3LP5A 1CLEA 5C8XA 4GXNA 4C4ZA 3GZJA 2G4LA 3OC0A 2XQJA 4Y2PA 2XMDA 2XI4A 3ICWA 2XUKA 5AM4A 4DLNA 4FOLA 1ORVA 2I78A 5LZ4A 3EQ8A 1YSCA 1HLGA 3DD5A 4ARBA 2HA3A 2HA0A 2YASA 4Q3OA 1QO9A 1TKRA 3BJRA 4BAUA 1UXOA 4UFNA 4WY8A 4DNPA 4AN1A 4N8SA 4BDSA 2OAGA 2ONCA 5SYNA 2C7BA 2Z5GA 2HA2A 4FFVA 4KYVA 4LXHA 5CBKA 2AJLI 1LLFA 5ALKA 1QIDA 1BN7A 2ORYA 3F67A 5I7UA 1XQVA 4U2EA 2CUTA 1IUOA 4QWWA 2I3ZA 1CPYA 5JASA 5AOCA 1FJ2A 1ZD2P 3R3UA 4A16A 4QDUA 4BP9A 2BGNA 3VVLA 5LLSA 4BRSA 1NX9A 1ACJA 1UOQA 2VSQA 4EA6A 1GT6A 3IUJA 1ZI6A 4QDXA 1ZJ4A 2JBWA 4LIPD 2P8SA 4K6GA 4UUQA 3G0GA 2OCIA 3DYIA 2PU5A 1ZJ5A 4QEKA 5DWDA 4M0FA 3O4JA 4AO8A 2XUGA 4XX1A 1JJFA 2GBFA 4Y2QA 5HK8A 1E8NA 1QFSA 1A8SA 2HFKA 2ZYHA 4E11A 4MEBA 2XUOA 4FWBA 4XJVA 1OXMA 3W9UA 4OU5A 1EINA 4U2FA 5T4BA 5E4JA 3N0TA 2FJPA 3STYA 4CG3A 2HU8A 1JU3A 3G8YA
chains in the Genus database with same CATH superfamily
2YMPA 3KUCA 4OBBA 4QOJA 3T9CA 3GVHA 3SXUB 1JEQB 2OZPA 3EY4A 1KKLA 2C4HA 1Z7BA 1CUVA 4S1VA 5IC4A 2C2MA 2OHJA 2WFZA 4IMPA 5AM1A 1BXRA 5FXMA 1I2MA 3WP0A 4MI6A 3QMPA 5AKXA 3OIFA 1K6IA 3ZD7A 2V59A 1Q2UA 2V6IA 1JVNA 1N2GA 1WF6A 2XCUA 3EA0A 1UMDB 1ISIA 1CVIA 4RABA 1XZDA 3GEEA 1KZGB 1X14A 1ZRMA 2CUKA 1MRSA 3QBTA 4MWTA 1TO2E 3AI3A 3KR1A 2BF7A 3KPVA 3SEAA 3O3OB 2JCBA 1GDDA 5C31A 4UU0A 4ZHQB 5AVZA 2D62A 2X4IA 1JR6A 2VTKA 3NRCA 4OXNA 5LB4A 3RUFA 4C0KA 5LLTA 3P9ZA 1JTFA 1QCYA 5B3KA 1EFCA 3TQRA 1RRCA 1QP0A 1ULAA 5G0SA 3FCSB 1VJTA 3EVNA 3JZAA 4J4BA 3QPCA 3ER6A 1W96A 3H2SA 1CRQA 1JEJA 4HYEA 3I28A 1Q84A 3U44A 5LYYA 1QZUA 2YIMA 1JX6A 1XZLA 2JHFA 2VPWA 4BB0A 5BYAA 1ZL2A 2KLHA 4QIHA 1X38A 1E99A 1D0IA 1QRDA 2GD2A 3V9AA 2CXPA 2VZ0A 4FOOA 5FBLB 3WGIA 4LF9B 4MVJD 3BMOB 1FDSA 4WCFC 1P9LA 4LZNA 3DCIA 5A2GA 2AL7A 5CIYA 2BH9A 1K68A 3D0KA 1KF0A 2OBNA 4GO1A 5IK2A 3SM9A 4BQRA 3K71B 1QO0A 1T26A 3OIYA 4D0NA 3I42A 3DB1A 5T64A 3KZCA 1MHTA 2TMDA 1WD7A 2H2WA 4JX8A 4ZAFA 4B5LA 2Y0PA 4P7FA 1EFDN 2FSPA 1AQJA 1BQ3A 4I9UA 9LDBA 1S1MA 1R6XA 3UHFA 4WCDA 2OBMA 3FF1A 2WSSA 4GEGA 4W5JA 3L6CA 3I9JA 4TZKA 4C89A 3VC2A 4DVGA 1LXCA 2GAOA 4UZEA 4E3ZA 4CEHA 4LC1A 4C6SA 1QQTA 2OCKA 2RGXA 1U31A 5BNFA 1G9TA 3KQYA 1M75A 3IXQA 3NIGB 4BQNA 1DIRA 5B57C 3F8SA 2JCYA 1SXJA 4WVFA 4EG5A 1WVMA 3ZGNA 1XMXA 4WKOA 3SS9X 2F4NA 5BSEA 5IXYA 3WIEA 3L7JA 1LSJA 1UUFA 3TGWA 2OFOA 3JATA 4ZP1A 2FRVA 2IUSA 2YY6A 2RHMA 4J6EA 1XRMA 3OA0A 1OAKA 2XDQB 2GGSA 3QUQA 3GFGA 4QJBA 4UU8A 1UFVA 3D2AA 3NJRA 3P0HA 3DBRA 1GAJA 4BJ3A 1BFDA 3GJ4A 1RCFA 2G1JA 1ORIA 1ETHA 2YN2A 1T9ZA 1C0IA 1GHTA 2QTBA 2YQZA 3EVDA 1G8GA 2AXPA 1Z6YA 2OQIA 3MYYA 4PTZA 5JQGA 4AQ7A 1CRLA 1Y81A 2GZAA 1JA1A 4MZDA 4L4RA 1GRCA 3AR3A 3S40A 4IHQA 1VPTA 5HUJA 5I7HA 3LC0A 1F06A 1HFKA 1YC5A 1VL8A 1CY2A 4DR2B 5A4KA 4ESOA 1EXDA 5LYJF 1PYGA 4B4UA 3MC1A 1T8SA 3TPCA 5CA1A 1DKRA 3NCTA 3CE6A 1AURA 2TRSB 3EMKA 5JECA 5CYFA 2PQ6A 3GFOA 4TRJA 3PKZA 4Y7DA 2PSEA 3WQHA 4LCBA 1ZMBA 1GN9A 4BGEA 3QRWA 3REGA 4EABA 1M6EX 1ZM4A 2P9ZA 1KI8A 1OYYA 3GJQA 4U2GA 2RBGA 1J06A 1QCDA 1Y3HA 3A1EA 1UT8A 3A14A 4KE9A 3RGWS 1UOPA 5BN5A 5DN6D 1H94A 5CDGA 3CSDA 1ZSNA 4HP8A 5LBUA 1Y3DE 5IS2A 3RVSA 4ZI7F 3HP7A 1QX3A 3NWPA 1AO3A 1LC0A 2VAMA 3K9WA 1IN7A 3CX4A 3P5BA 1E96A 1BMTA 1ZIOA 3EF0A 3G0OA 5JHGB 5JH7B 1AE1A 1HNXB 5KNDD 3EXHA 2CLHB 2FKNA 1J8DA 5FHQA 5HXAA 1ZD5A 3EPPA 3JTMA 1XTZA 2DH6A 2QUHA 4CKWA 4WMLA 4CFSA 3U56A 721PA 5E6RB 1SKQA 1ZN2A 3IEVA 4CIBA 1NW3A 4WFQA 3AIKA 2V6JA 2I5PO 3PDHA 4OD0A 3K5HA 5LC1A 1NONA 3K1AB 4DNQA 1T2VA 2J9FA 3FOEC 2OZLB 1EG2A 3H0CA 1L0BA 5C37A 4Q1AA 2BGLA 2HV9A 3L0YA 1KK0A 4JJGA 3RODA 3NOOA 2WU1A 4LYFA 2JIDA 2PMBA 5EQDA 3VR4H 2DTDA 2R8BA 821PA 2EFGA 1AKEA 4XJSA 2ZJ5A 3RFVA 3S2ZA 1BXGB 3CRRA 4U2KA 2RHBA 2ZYAA 5KNBA 4OUDA 1EK6A 1JE1A 4QDZA 3QVSA 3ORHA 3PNQA 3WIDA 1H1LB 5DKFA 3E7WA 3B85A 3N2LA 4CMIA 5GJWC 1YHZA 2KB0A 3ZVKA 5BUSA 3O0TA 2ID8A 1AVTA 2A33A 1T5LA 3K2BA 3PDCA 4Q7LA 5BSUA 5FPYA 4YRLA 1WW2A 3CW2A 4IDHA 4BO8A 2GR9A 2IZ1A 3PWSA 4DQVA 3G88A 4ETWA 4FBGA 1MO5A 5AQEA 1A98A 2EYQA 3DKKA 4XPIB 4CDNA 1DXHA 3HB0A 1TJPB 3ZXIA 4TLAA 3D1VA 2XR1A 2C20A 3B52X 2PUBA 1UK7A 2C3UA 2FR8A 3Q7EA 5FUWA 4G1FA 2XBLA 3OPMA 2VJMA 4W7HA 2I6QA 2ISQA 3L41A 4BLQA 5IVKA 2OCDA 5SZHB 3VU3A 3M5WA 5ITVA 4ILEA 3HDHA 4DCMA 1CJCA 1I94B 3TTWA 3NHBA 2DCUA 4PFKA 3GIWA 2VCEA 4HG2A 2ZFUA 4HQFA 3AUSA 1J8VA 1GA4A 1T9BA 4MW7A 1B2RA 4HMPA 1GLGA 1OSNA 2EX4A 2OORA 3T9FA 5DT2A 1TQHA 2B5WA 2BLNA 3IBYA 4M76B 3FYHA 2LCIA 4MYUA 3QMVA 3VV2A 4LF6B 4YUVA 3YASA 1YFLA 3H4IA 3N76A 3PF9A 1EX9A 2GZ3A 4DW8A 1NVMB 1QR2A 1R8XA 3I12A 4ZJPA 1CUJA 1AA6A 5DHPA 3USCS 4O6VA 4KPGA 2FMTA 3UJPA 4D8XA 1IATA 1X8KA 2JJYA 1G19A 1ICEA 1TADA 2ZYRA 3DWFA 3IPLA 3PNSA 1SQFA 4H4EA 3GLHB 3HJAA 1AQ6A 4LXTA 3UCFA 1AGRA 4OM8A 4DY4A 1WBJB 5JY6A 1JLKA 1K89A 1ECCA 1BA2A 2Z2YA 1NT2A 3ETCA 1R0RE 1XA0A 2WJGA 5FEMA 5GQSA 4TWBA 5ADVA 2IBTA 2WJIA 2YVAA 4IDEA 4BV2A 2B5OA 2X8JB 2Z4SA 4G01B 4GZ5A 5CNKA 1DXOA 2GNPA 3IE1A 4FM9A 3PPVA 3I5XA 3HCEA 4HDMB 1QUEA 2W5UA 3JQAA 4Y9UA 5IKMA 3OTQA 1G17A 4JXJA 3NTRA 5I7WA 1E4VA 5FFMA 3Q6IA 4JMLA 3C5VA 2CNDA 3QVWA 3H2HA 1Z0FA 2JGJA 4JB8A 3PLNA 4RMGA 4RZUA 2Z6AA 3R8XA 4ED9A 1NN3A 2CBXA 1T35A 2Y6VA 3CZPA 4HBGA 4KO3S 1GKIA 4F6LA 2FN9A 2H59A 3D6MA 4FILA 1O96A 2D4AA 1ZUWA 3BZUA 3VJMA 2B2NA 5HA5A 1MQ9A 1RKXA 2QNBA 4D8YA 4YUAA 3X1KA 2XGJA 4F5YA 1U90A 3A6KA 4GP7A 2FDRA 4M8LA 1ZXXA 2ZJ8A 1N92A 4NZOA 1RJ9A 5EPEA 4E6PA 4PGFA 5ICCA 2W70A 3WRXC 1PWYE 3ZOZA 1A95A 5IG2A 5ELXA 5REQA 3PFFA 4NPCA 3UPUA 1Y8CA 4X8OA 2FP3A 3MAGA 4JUFA 1UCFA 1E3IA 5DHTA 2IEGA 2I2CA 2WUFA 1HT0A 3G68A 1G5HA 5H3CA 2FQXA 3TUIC 1OILA 3WWCA 7ADHA 1AV6A 1NRXA 2FW9A 1M7BA 1PAUA 1KDTA 3QUTA 1N77A 2ZCJA 2H08A 3GYGA 4YJHA 2JI4A 2QTMA 5KYYB 4N76A 3EQ6A 3BWBA 1T43A 2F8LA 4NBWA 5DGXA 4IL5A 5F7JA 1B16A 1JBQA 3B3JA 3BXHA 3DZKA 4TMVA 3B9BA 4BX9A 5BUZA 1TTHA 1V39A 1PV4A 3WE7A 2WZCA 1OI2A 1OB2A 1UDWA 3ME5A 4E33A 4UBJA 2V1UA 1B41A 1YE3A 3T3MB 5K2OA 1MC1A 3F9RA 3DH0A 2PX4A 1A2BA 1UL1X 4ARUA 5BSWA 3CU5A 3EUAA 1XPRA 4F92B 3AKYA 3W3AA 4FGSA 4IGKA 1KJWA 3OPYA 4MO2A 5ARCA 1Y1RA 2F3PA 4BVEA 1N6IA 3K9FC 1ZG3A 3M0EA 3L06A 4P34A 1N4AA 3R7AA 1GO2A 3QIVA 2WMNB 4RTRA 1EXNA 2VPYA 3UJHA 2QQFA 4RJLA 3NBAA 1L1QA 1HT3A 4JOQA 2HSJA 4M0UA 3ROQA 2O54A 3C3XA 3EZ2A 3ZE2B 4K9OA 2GUWA 3FVTA 2F1KA 4EK9A 4B47A 4R0MA 1Q16A 4PINA 3B20A 4Q3NA 1USVA 5LZ2A 1A69A 1HLDA 1R6DA 2BHNA 4XCQA 4GEKA 5CVJA 2GK4A 1IY0A 3T5PA 5GVSA 4HDRA 1PSZA 1Y89A 1M8FA 1X19A 3DV9A 4XWOA 4ZGGA 4JHLA 1VIVA 2VPQA 4M8KA 1TJ5A 4RBNA 3L8MA 4RH0A 1KI4A 2DQYA 3ML1A 5DX0A 5EXPA 3ZHYA 2HR1A 1IXKA 4MUAA 5BQXA 3GLGB 4FONA 2RHOA 4QDKA 4Q9KA 3RVPA 4RDXA 4X7MA 3OCXA 3VNQA 3UAGA 2YZ2A 3LL7A 4K6HA 4HH1A 5LJIA 3TJZA 4I55F 4EG7A 2ORWA 3TMYA 2F48A 4JEMA 4XYGA 3GLIB 3SVTA 3HBNA 3QX7A 4LDRA 4B4KA 2ZANA 4J8PA 1NW5A 2HRDA 4FJ2A 3IELA 4IQ0A 1PT8A 4J29A 1NNLA 3H9BA 2DJ5A 5A6VA 2LCFA 3CNLA 2JZNA 1JJIA 4MGZR 1WXHA 5FNZA 2Y1XA 5FOTA 2D7JA 1HDGO 2RHWA 4PAWA 5B4VA 3B13B 5JALA 3TW4A 1Z73A 3MWEB 4OXQA 2ZG6A 1IN1A 1EX1A 1T4CB 1QGED 4BTEA 5CBPA 1MA0A 1OTHA 3HBFA 1NJ5A 3H2IA 2BDEA 1U5AA 1J7JA 3A2NA 3LLMA 5KYXA 3QEMA 3ETNA 4C6TB 4FBLA 5FTJA 2Q9CA 1NHGA 5E95A 3VU8A 4BTVA 3T0FA 2ZJ0A 2JBAA 4MPRA 3P2IA 4MI9A 5CM9C 5IZ4A 3G7UA 4NQZA 5JAIA 4PAMA 1T6XA 1SBYA 5F1PA 3VR5H 4UULA 3M4YA 2JFUA 3FI9A 5KYVA 3DJYA 3EIFA 4I5IA 1D1TA 2YYAA 4WBXC 3PFCA 5A03A 1EFUA 3OY2A 3ONNA 5K0NA 4O3FA 4P4SA 2OAQ1 1GA1A 1GLVA 1F7UA 1DWOA 1R74A 1ICIA 2YJ6A 4FGKA 3NR2A 4PZCA 2VQFB 4ZO4A 1ZJWA 2OKGA 3EVEA 4D9FA 5JJIA 1HE2A 3KPUA 3UAXA 2Z9DA 2XHEA 3PLRA 1YCHA 4NDNE 3COVA 2XZOA 4MYTA 1Z0AA 1IB0A 2OHXA 1ZIXA 1NASA 2FPIA 2ILTA 2J9RA 4Y2SA 1ZI8A 2Q99A 3A06A 1YZ3A 5IM5A 2QE6A 1QRRA 2ZJFA 4LXQA 3UIEA 2D2VA 3TMAA 2BR5A 2WF5A 3AF3A 4FHEA 1GPAA 3JZMA 4LFCB 2X1MA 3QK7A 4E70A 2DY1A 1MTOA 3IP8A 4MAMA 2Z9BA 4AY3A 4BDSA 1V6CA 4CKCA 4ZFNA 4I2NA 2LNDA 5IYZF 1B00A 3SYKA 1JQBA 1XR3A 4ZZ3A 1OC2A 2QU7A 3WWDA 4HAXA 3ANTA 1SBZA 4A2WA 5LKAA 1RAFA 1STOA 2E3JA 1RR6A 5K3AA 1F5NA 3NG1A 2ONKA 4Y0AA 4BVJA 1MNQA 2I29A 2V3WA 4K8OA 4DGSA 3HXOA 1NF3A 3EGVA 3UXEA 5G53C 4DYVA 2UAGA 3CJQA 4AG3A 3UJ3X 2B4QA 4Q4HB 1AK2A 1EI9A 2JFGA 1D2GA 2RI6A 2CMFA 2WE8A 3H9QA 4NJMA 3UA4A 3ZTWA 2FPKA 4PAGA 4XEHA 1OXUA 4MQFB 3ZLVA 1E9AA 1Y3CE 1RJFA 1OI4A 4BXOA 3SZ3A 1DE0A 5BOSA 2CL5A 1U1IA 1PS9A 3OZIA 1XD2A 2W2KB 3ITDA 1KAQA 7MHTA 3BOSA 3D7RA 3IPAA 1NE7A 4EPXA 4IXDA 3FOFC 3PVZA 4Z49A 3FW1A 1SCNE 1CNFA 1QG6A 1QKKA 1J42A 4I50A 4N0MA 3NAQA 1UPUA 3UUWA 2NLOA 1E1QA 2R97A 1KTIA 1MX9A 2AUTA 1THTA 2E82A 1Y3AA 2EKPA 4HYTA 3V4OA 4LAFA 5FWXB 5AUQA 2QSUA 1EA7A 1SVUA 3AKEA 5IAAA 2VEOA 3QE4A 1IBKB 5TQ2B 2RC6A 4G3XA 1YI0A 3WR5A 3V33A 4TSKA 4C7BA 3KKQA 2J3HA 3AIIA 2AZTA 3HSYA 1KL7A 3SZGA 1G5RA 8AT1A 1E5QA 4ARVA 4D9HA 3IL2A 5HVNA 4EGSA 2ODEA 1O77A 1YZUA 5A5FA 3KYIB 3GT7A 1EQ2A 1KEEB 4BLSA 4ZOLF 1JMKC 1YR6A 4YT5A 4WGGA 5JSUA 4J7CA 3H1BA 3NALA 1SC4A 1MPXA 3SJCA 1IY8A 3OAAD 3QKTA 4UXHA 5JJLA 1U6IA 1T2CA 4LOKA 3VZQA 4IH1A 1W36B 2ZBEA 3TGLA 3GOQA 2D3TA 3FUVA 3LUHA 4I8DA 4DDKA 1YFJA 1EP9A 3JPWA 3LM8A 4MX8A 5FJIA 1E69A 1FA9A 4G5SA 1E1DA 1M2HA 2NUPA 4JYPA 3H9UA 2QL6A 2PZJA 5DB4A 4RLFA 2Z5VA 4WBNA 2QY9A 5SY9A 4KAFA 3MWDA 2J6IA 3VPXA 3A9WA 1N6NA 2R60A 4BGIA 4AB1A 6YASA 1ADBA 2VA8A 3GAAA 3J81k 3RU2A 1XALA 1J39A 2BVNA 1UJNA 4MPPA 4D43A 1JHOA 2BONA 3IMEA 3NNNA 4GLOA 3GH3A 3B5IA 3LE8A 2ENUA 3DA8A 3IT2A 2ZZKA 5B3AA 4KGZA 4D4JA 1Z0IA 1RWVA 1YDHA 2BGTA 1VE6A 2VWHA 3TKAA 5FUMA 2MHCA 1F2DA 5ALIA 1H4TA 5K3BA 4DM7A 1NYRA 2Z3ZA 3B3AA 1TO1E 3BJMA 4O4HB 3SQXA 3MUOA 1IN4A 1TW2A 2RAUA 2W8BA 4HRVA 5SZKB 2RK3A 3WB1A 2W22A 3MCVA 2IIBA 3W2HA 1R88A 3EZXA 3AOEC 1QTIA 4KMOA 2CV1A 1GIAA 3FYTA 2P2DA 1PR3A 4NH0A 4YUXA 4UU1A 5L7WA 4XB6B 1EIWA 2FCRA 3JQPA 2JAUA 3ZTYA 2M1XA 1GZDA 2W4QA 3BSWA 1AGNA 1P1IA 4HXEB 5IKPA 2F64A 1JI3A 1N7HA 5EOVA 3C8HA 3MQ4A 3KAJA 3TLXA 4HB3A 3V46A 2QKYA 5AI4A 2NTYC 1EFRA 3UWKA 3ZIAA 4RHCA 1E20A 2QEQA 2ZUSA 1PJ8A 1W19A 4YXFA 5CT5A 1L9KA 4PSVA 3GLSA 3HCRA 4AU1A 2WU0A 4U5XA 1C9MA 3V8RA 4MV0A 5CHYA 1YQEA 2NVUB 3AIOA 1P4AA 3E15A 4O4IB 4C0XA 4P6VF 1ZQ9A 3M4XA 3CNQS 2VP3A 3NX4A 1WXQA 1LK0A 3IAFA 1BXKA 4KX3A 2V7TA 3TTYA 2DFLA 4BJ6A 3G8DA 2G7ZA 3B3FA 4LHVA 3FOAA 3SE7A 3PX2A 3WOVA 3P2OA 1KBOA 3ZHVA 1XOIA 2XUIA 3M8KA 2EOAA 1GFZA 1NBEA 1NI5A 4FFSA 4RA9A 2NQTA 1X70A 2YOHA 5BOVA 1IWPB 2I8CA 2XCSB 1FTYA 3OCUA 3K70C 1OTXA 1ONSA 1RYDA 1XDGA 1P2VA 1X8LA 1YASA 3I0NA 4PPFA 1Z4OA 2PD6A 4ZQBA 3AVQA 5FFNA 4EENA 5IF9A 1PV1A 2PKEA 1Y9AA 5E4TA 3S5JA 1PRYA 4D7AA 5EUBA 4EFMA 4OMFG 1MGPA 5GOTA 4AJHA 1ZA2A 4N5IX 1LRKA 4WK2B 1NG9A 5F1YA 2YV1A 3EW9A 3D6NB 1DC6A 1YA4A 5D7BA 3BXXA 1DGQA 4MQMA 3H3FA 1FCJA 2QMUA 1GQQA 1H85A 2PYDA 3RUAA 2PBLA 1JWBB 2DCMA 1BHSA 4H7PA 3C16C 5DFAA 3IV9A 5IFLA 1A8IA 3K6KA 2QPOA 4DYDA 4BO1A 4CQMD 3UK1A 2C29D 1JDTA 2OBYA 1CQPA 1ESCA 4WZAE 1NLMA 4Y6SA 1TGVA 1XIVA 5A4IS 4CMEC 5L4NA 4CN8A 4TV9B 3ZBQA 2H63A 3O94A 1CUAA 3K8ZA 4RQTA 2X0DA 3UYLA 2RHCA 3ZI7A 3WKDA 1D04A 3I4FA 1JJVA 4CGYA 4O2AA 4RK1A 1T4GA 2PD3A 3KXPA 3U7QA 5ADHA 3CRZA 1YI8A 3GDOA 1WB9A 2AR9A 1JIUA 1F6DA 4PGMA 3GQVA 1Z7EA 4ZI5A 3IAS6 5G4LA 3TEMA 4CNQA 4Z9AA 3K09C 2GBLA 2P4HX 5JQWA 1IFXA 4YO7A 4FYXA 1MJGA 2ETXA 3ABQB 5LU9A 1P4SA 4OB7A 3ZY5A 2EP5A 3GZNA 4L5CA 3BK7A 2V58A 3MERA 2OOSA 2V5UA 2VYND 3UV6A 3OHMA 5L3QA 1KI3A 4Y30A 1JSLA 2O6LA 3OFSA 4RENA 3GRFA 3ZDZB 1IBMB 3TDMA 5IX8A 4EKIA 3LDUA 5EP4A 3ADDA 5BR1A 1LA2A 5KQLA 1Z36A 3HPQA 3U0VA 4OIMA 2ZU6A 1TU4A 3CV3A 4X90A 3P96A 3CIOA 1I0IA 4QPJC 1JAZA 3A1SA 4FKBA 5HTKA 1E79D 4UJ3A 1IUPA 3OCWA 4RESA 4F45A 3ADKA 1CP3A 3AP3A 3E7PA 4P80A 2FF5A 2PR2A 3ZLBA 5AOBA 2GM4A 1K8ZB 3K5PA 4Q9DA 5CT6A 3WL4A 3PHBE 3OQMA 3W5BA 4JIMA 1LGYA 1U9IA 2HDWA 4Z3OA 3HFSA 2YIVX 3NHSA 3OH8A 2XVMA 4HNAA 4NNPA 3U09A 3VOAA 1CZLA 3L43A 1N7JA 5K0SA 4Z4HA 5EIXA 4Z5XA 3W0LB 4MKRA 2OPHA 3MWYW 1E7YA 2JVKA 3LA6A 1PQ4A 3BWEA 3OZDA 3TS1A 5AQ1A 1LCIA 4OX9B 3KEMA 5HE8A 4RVSA 1GNQA 3CBGA 2BKEA 2IDMA 1QC5B 3DZDA 3V4SA 5IT0A 2FPOA 1ZW1A 1PG2A 1PZNA 4I7EA 4WDRA 3COPA 5CVEA 4ZARA 1N2BA 4ZZ0A 2WUEA 2FCAA 2HN9A 5JR3A 1GRNA 4B35A 3VI4B 5DULA 3HMQA 1QHYA 2OHOA 4V2UA 4IIYA 3CZCA 2V3CC 4Z6KA 1G60A 1R5JA 4ZCRA 4FW9A 4JU8A 2COUA 3PEEA 1R7RA 1YMVA 2DWPA 2G9RA 2JIMA 3FTNA 1QHEA 1Z6TA 2WIDA 2GXAA 4BP8A 4GICA 4TV8A 4FFLA 4MPJA 3PVCA 1U5BA 1PZMA 1V1RA 3ZDBA 1P74A 4RY2A 1DBQA 1U2PA 4B80A 2VDMB 3RBXA 3VPHA 1XTSA 2V98A 1Q14A 3BXPA 1LVUA 2XY4A 4HRXA 4LJ9A 4UE2A 1FBTA 4RY0A 2N9UA 4X20B 1T3TA 2PLAA 3MJRA 5AW7A 2XCTB 3GLGA 4H6WA 1I33A 4HLUC 4D4LA 4K2HA 3JZIA 3JASB 1CTQA 1GNVA 2XCQA 2WD7A 3HU5A 5A7GA 5IH3A 3ZTTA 4ZJYA 1KVQA 1KA9H 2E4ZA 1C41A 4CIDA 3W8DA 4KR7A 5HF8A 3NW9A 5JROA 1YCFA 3LPMA 1S1CA 2IOHA 2I03A 4XQEA 2PXAA 5FAXA 3DEZA 2IS2A 3THYA 1H2ZA 3E58A 1GCUA 3AI2A 1ZD1A 2JGEA 3L7MA 3WNBA 5F76A 3SYNA 2BD0A 2ZE8A 3L1HA 5JQGF 5K0JA 4G2NA 1M6NA 1P4HA 3EFOB 3CYFA 3FWNA 4RY8A 1NU8A 4FMDB 1MOZA 3G6KA 4ZOCA 1JIJA 3AR9A 3CR3C 2C98A 3IBTA 3NKFA 2ZDHA 4HS9A 4HGYA 5BSGA 5CA1F 3C87A 4GI7A 1ISRA 5LFAA 1I8TA 1K5DA 4JZKA 2QVYX 3HH8A 4NK4A 2IY9A 3RVQA 2FJ0A 3CINA 4OFWA 1ZCAA 5DOVA 3LXXA 3CUUA 3FNRA 4M9ZA 2IZ0A 1U7UA 2QZ4A 1PS8A 4IDPA 1DKNA 1QIJA 1Y6GA 2YMQA 2OYRA 4BEVA 1W9HA 1NQTA 1CWUA 5KOIA 2CXUA 2RGWA 4R9UC 5EIAA 4ZT2A 4B4OA 3ITEA 1BWPA 2VTBA 2PG3A 3QVGB 1P8JA 1A82A 4JL8A 3HB7A 2Q29A 3IAUA 1ZGCA 1XVTA 2Q1TA 3RF7A 1OZ0A 1ISHA 2VJCA 4C29A 1GTRA 4F06A 3GDFA 1UBOS 2WLSA 1Y48E 3B9QA 4LXGA 3UMFA 5EIEA 3L92A 2HCJB 5CJPA 5DRTA 1T3ZA 1Z4JA 3ZH2A 4XDZA 1QTNA 4BB5A 4D57A 4HMOA 2BGWA 1A76A 5KNCA 4MV4A 2PKYX 3KT6A 1GGEA 1XTQA 1ZOPA 1WA5A 1K6EA 4KXMA 4DSAA 3O93A 4NE2A 3SZUA 2TMYA 1EQUA 2ZS8A 4F12A 3H65A 2FZWA 4LC0A 5B1HA 4B71A 2B92A 3AF1A 3FHOA 1UJ5A 2N75A 4MJXA 4BV9A 1JHRA 4CQJA 4XTCS 4DMGA 5FV7A 3ZV4A 1K66A 1UWKA 4EATA 3DKIA 5IJ9B 4B2LA 1T9DA 1SBNE 4I8IA 3FPKA 2I1VB 4JLKA 4QDJA 3FGNA 4E94A 4EPWA 4L08A 4K0RA 1DNPA 1FRQA 2H5LA 1NR7A 3CUEF 3GHYA 5CTAA 5T4EA 1UP4A 3U13A 5K8VA 4QREA 3CR7A 2Q2QA 2Q7XA 1JSRA 2PK3A 5IK2D 4JYAB 1QO0D 4QU8A 4FEEA 2P40A 3G17A 3GGPA 5KTYA 2WQZA 4ZYZA 3IESA 2WILA 3V4ZA 2JGNA 2X6TA 2C00A 3IOBA 4B6FA 1CUEA 3LF1A 3ZHXA 3ITNA 2ON6A 2QLMA 5AVOA 4MW6A 1ZH6A 4LX0A 2C8VA 3GG9A 4X3CA 2XEDA 5JYCA 2WSSD 1CSEE 1V11A 3HA2A 4R0VA 4WTOA 1BX3A 4PX2A 1IEXA 1S02A 3HNPA 4KCGA 4YQYA 3ROFA 3WHLA 1X80B 4IEFB 1SGWA 2WTNA 3T35A 3CNHA 5DBFA 3I9V6 3KBOA 1QQ6A 3C2QA 2YN4A 2BEUB 5FL3A 1HYQA 5FWDA 3P9PA 4WKPA 5JG7A 2FX3A 4LY3A 1B15A 1SXJD 3MOIA 4KR9A 1HE4A 2I2DA 2BPOA 4R2IA 2WKSA 3ASYA 4BFLA 3QVKA 1QIHA 2P1DA 1MX3A 3SHFA 4W9MC 2E4VA 4ND5A 3R7WB 4AY2A 1XDWA 4A1FA 4U7GA 4UM8B 3JARB 4N0PA 3W2IA 1SC3A 2WFLB 3ZU5A 3MNFA 3MINB 2AVNA 3ZYCA 3SICE 1CG6A 2FNAA 2VDUE 4PHCA 1FDRA 1MQAA 2FW0A 4FDUA 1Z0JA 2ASVA 2P1RA 2IEBA 4O4JA 4IPTA 3OE7D 5AJUA 2B8NA 1KJIA 2CW5A 2CJWB 4E5NA 2A92A 3SI7A 3FVRA 4E5YA 4F72A 1AKVA 3SEZA 2ALJA 3EXIB 4EEZA 2DKNA 2BM0A 3PGVA 3R3WA 5FP0A 1WCXA 4TSFA 1NZFA 1QV6A 2VWQA 1SU7A 3MLAA 5BW4A 1SFRA 2QPLA 1QXSA 3L4BA 4C9BA 4A8JC 1MU0A 1SWVA 2CFOA 2GQ0A 2CEAA 2NX2A 3P4XA 1FX0B 3L8YA 4IHKA 4WXYB 3VH1A 3IEIA 4Q4JA 3HXLA 5DNEA 5EZ5A 5L53A 3ANNA 3KFVA 3ZZUA 2B1GA 4RZ2A 3DMYA 2AMLA 4UMVA 3PUWA 1VJDA 1CUFA 4AMBA 1VPWA 2KI5A 3WL6A 3O91A 3DHYA 4BNDB 5AUOB 5GGYA 4MB6A 5D3ZA 1ZH4A 1V2HE 1ZICA 2OGZA 4LVOA 4FFPA 5KJEA 3L7CA 4EJMA 1QHSA 3NOQA 3ZGLA 3KYCA 4BQPA 1LVGA 3W2FA 3PL5A 4IKPA 3I1JA 5I9SA 1ZOOA 1TEVA 3NEJA 5DLQC 1NJ1A 1T10A 1L8QA 3BTUA 4EY7A 2ECQA 2ZS7A 2X5XA 4KIJA 5JMOA 4B32A 5M04A 4AKGA 1P33A 4MUNA 4DB2A 3V2IA 1X2EA 3NDRA 3FI0A 4I99A 1DBRA 4MRRA 4IIJB 3WA7A 3NXKA 1TB4A 1V3UA 4ROSA 3GLTA 4I46A 3RLIA 1ULSA 2EW1A 2QJFA 3SLKA 1GUZA 4B3CA 3O83A 4HQKA 1E18A 1SCJA 1WMAA 2PNJA 3X1JA 4GPZA 1YJXA 3NUGA 3ENWA 2I6FA 3BIXA 1X8XA 3K3PA 3S55A 3WB9A 1YVPA 3O0DA 2LCQA 2QVZX 4X3OA 2WF7A 3B38A 1MKYA 1G18A 1GZHB 2QM8A 1ULZA 2YS7A 1GUBA 3EDYA 3I6MA 3MMXA 1BVUA 4YO8A 2Z2IA 3H4MA 3DE5X 5H9VA 4EJ0A 1E1YA 1XF9A 1CR2A 1Z0UA 4ZOAA 1RP7A 4MV1A 2D8AA 5AVXA 5HIMA 2C2HA 3FCAA 1NMYA 3M4NA 1SOMA 2K5UA 2XF8A 4J94A 2WAAA 1T9KA 4Q4LA 4TL6A 1U2QA 4TTPA 4ZQGA 5DN9A 2N46A 4J43A 4ZAZA 1JR2A 2X3YA 4H4DA 2R6AA 4I6EA 2FSIA 2P9TA 1ISJA 2XGSA 3A2KA 5DIFA 2A5YB 1PK9A 3IV6A 3QNMA 4S35A 4HUJA 5UKDA 5H16A 5CFRA 5EL0A 2R1UA 3ONVA 1N2CB 3KLOA 4CIWA 1XBTA 3I6ZA 2D8MA 4LOAA 1EFVA 1ZITA 1XZMA 3GD7A 2FMIA 1H2FA 1I6MA 2OK7A 1H93A 3AVOA 3BIOA 2W6JA 1S89A 5CK5A 3VPAA 3PNPA 4U2CA 5EHXA 1QHGA 1ZQ1A 1PVDA 2H2GA 3H2JA 3LX4A 4XARA 4C07A 3G9UA 4ITRC 3K53A 1FFBA 2F62A 2ENWA 2FOXA 5AO9A 3ZBUA 2H16A 2A5DA 4RIEA 5K4AA 3F49S 3PFHA 2QL7A 1K8YB 1K6JA 2JAOA 2JAHA 1AN9A 4LW8A 4R1SA 4N3CA 2P6OA 4JLSA 4AS3A 3AM1A 5CYGA 4JLVA 4GZ3A 4D0RA 4YCLA 2ANCA 2GRAA 1JS1X 1H6DA 1YWGO 3DT6A 3MK31 5CNMA 4M0PA 4ALKA 1U2TA 2IPNA 4BWGA 2IZ6A 2ZSIA 4CYMA 2QX8A 1VBFA 1AK1A 1QIFA 2C2ZA 3LC7O 1LSSA 3PXAA 2J59A 2WTEA 3PUHA 3QXGA 2IYVA 3BF7A 4UNIA 2NU8B 3RF6A 4WADA 3SYRA 2R1TB 2FPGA 2V4UA 3T7JA 4E21A 5FO1A 3OJFA 2CWDA 5IUNC 1DTWB 4BVHA 2MSEB 1XRNA 1W35A 2BP7A 3G23A 1HY3A 3I58A 4W9NA 3M81A 4CCWA 4F4FA 1OBFO 4KXUA 5AW3A 3I9V1 3DAOA 3WGNA 1VLLA 2WEKA 1X94A 2X9LA 1P19A 5E3HA 4YAKA 1SNYA 1M1YB 4GXQA 1H23A 3M1LA 2AC2A 4YYEA 3RH0A 1RDFA 3GGOA 5EHGA 4WX2B 1QH8A 2QRVB 4JYMA 4EHAA 3JWPA 2Z58A 4KG7A 2DUUA 4A0GA 1KMNA 1WDMA 3C97A 4PYQA 3QFFA 3NWEA 4U2BA 1I4LD 2FPUA 1XCOA 2R6R1 4Q00A 2WICA 3AVYA 3OUTA 2PAFA 3N8DA 1FNMA 3WL7A 3GARA 4QICA 2C7OA 3B1KA 3JQAD 2P5SA 4XWYA 1E7MA 4L7VA 3FY4A 5AYVA 5HGXA 1TZMA 2RHRA 5J1SB 1UMKA 3IA7A 3SX2A 5B2FA 1IK4A 2GLXA 1WCWA 2AOUB 1EBUA 2VTDA 4HFRA 5EXXA 3O1JC 2LTAA 1X7ZA 1B8OA 2MYPA 3DP9A 2Q8QA 3PD1A 2AFIE 1L7MA 2HYDA 4GMHA 4EB6A 1QK4A 1I5OA 1WMEA 5KC8A 3R7SA 1J2YA 1JKIA 1U0JA 3B1VA 3PFKA 4B0PA 3QY9A 4IO0A 3RC9A 3S1SA 1NNEA 3V34A 1E63A 1A9XB 3Q10A 1G38A 1E3MA 4FSXA 2O3JA 1PWXA 4IIUA 2LE0A 1U3TA 3JWJA 1CJBA 3OT5A 4YT4A 3KEOA 1E3JA 2FU5C 3G0IA 4KQHA 5GONA 4KFRA 2LXNA 3KQPA 1FMFA 2MT9A 3N0XA 4AP6A 4B3HA 1TJYA 2EKDA 3OIDA 4KN5A 1XEFA 4R05A 1YRHA 3SC3A 4FKMA 5DTQA 3BXEA 3IPYA 5FTWA 2JIOA 4XOIA 1A04A 1CDEA 1PGNA 2E5FA 1VJGA 3QG1A 5FTNA 3X43A 3BRWA 3K4QA 2BFWA 1GFSA 2FK8A 3PIDA 2BM9A 4Q1BA 4RGYA 3HE3A 4UBIA 5KSWB 3UMYA 2HGSA 4B8ZA 4J90A 2BHSA 4JLUA 5T67A 3FBTA 4S0XA 1ZM9A 2IYYA 1E1RA 1WZUA 1ZUNA 1JXMA 1Y3IA 3E1GA 2J3QA 2QVGA 1U4NA 2CVFA 3EPRA 3NYIA 3W3AD 3R8FA 4JUIA 2HYIC 3DEFA 2B6HA 4BVAA 5A4AA 3WMFA 4DJJA 2OL4A 1YUBA 4WOCA 1Z0KA 3U3XA 1WUHS 3QWBA 2PBFA 3AR4A 1KEUA 4ZC8A 3NANA 4NYIQ 4C08A 4CM4B 4DE5A 4GVXA 3EN0A 1U63A 3OE5A 2Q5IA 3AERA 3P0RA 5DZSA 3N7AA 4GE0A 3S2SA 4E46A 1XE3A 1C3XA 4F9GA 1D7OA 4OA8A 3KL4A 3SF8B 1RWBA 4LK2A 2B7BA 4FR0A 1IOVA 1O3YA 1VJ0A 1MG5A 2E4UA 3L3BA 3B2QA 3MXTA 4HB2A 5KYUB 4D44A 3BKWA 2R5FA 2IS6A 3IVRA 3O9VA 3FSJX 5IN5A 4G0XA 2YVUA 3PGLA 1NLFA 2ZSAA 3OM8A 1ZZEA 4X9XA 2JC3A 3SN6A 1L5HB 1N0HA 2WWWA 4UXIA 5L3RA 5F1OA 4NC9A 4MGHA 4TLDA 1W0JA 1G64A 2BW0A 1XVLA 4HNRA 1TTPB 4Q7MB 5FOQA 5ALPA 4OAOA 2QDKA 2CE7A 3RK0A 3TOSA 3EGXA 5EXSA 1NMEA 2ZUUA 3THWA 1Z5GA 3LL4A 2OXEA 4OXRA 4C6RA 5A4MS 5HZGA 4YCNA 2A1TR 2GTPA 3NDPA 3ZHCA 2ZJOA 2GVNA 4TYWA 1KETA 1U3FA 3C6YA 3E9ZA 4GYJA 3TZCA 1WB4A 3ZWWA 2R86A 3L0ZA 2FFRA 1W93A 3C8UA 4W1QA 5DNVA 5DM70 4Y1EA 4LMPA 4EKGA 3W5DA 5CCBA 1O9GA 1RWKA 2ZRDA 2NU7A 3GLRA 3TCXB 3O6VA 1DAGA 3SYMA 1MJHA 2I4NA 3WYBA 2DQKA 2GSDA 1RXYA 3A9RA 3CN7A 3LHFA 3BFVA 4FCWA 5EGSA 3B6JA 1GL9B 4YASA 3JQFC 2WIAA 3DEHA 3W04A 5ALOA 2C4NA 3TXYA 4BWFB 4UNQA 1R5BA 1QVRA 1GARA 4IG9A 2I2AA 3AF5A 5AXAA 2Z4RA 3UC9A 5LXTB 4MQLA 4PLHA 3IEUA 5CDFE 2DKOA 1PFVA 4I9NA 4MAAA 4OM7A 2FX5A 4RIGA 5E7MA 4ZVNA 5HCIA 3WJ7A 1YHYA 4NZPA 5KYNA 3T1HB 3FCYA 3L0IB 3CRNA 3P9IA 1EK5A 1JH8A 2EDCA 3MJ4A 2BTQB 2AHOA 3EF3A 4W6QA 1KE2A 3T7SA 1J23A 3LXRA 1GCOA 5FF9A 1DL5A 1JIVA 4Q0MA 4DCUA 4MV3A 1V96A 2IYSA 1O5IA 2M6RA 2DBQA 3JCZA 4KXNA 4R1TA 4TT8A 5A3VA 1HDZA 1U2SA 1EUCA 1TVMA 3HUUA 4JD5A 4YI3A 3EG9A 4CFYA 5K0CA 2GO1A 1UJ6A 1Z18A 2G5TA 4UEQA 4LMAA 4WLNA 2VT7A 3O03A 1TJNA 4PQGA 4DV7B 3G82C 2JHGA 3C5WP 4HJRA 1M1NA 1FS5A 5JS8A 3OWHA 2DTXA 3DV0B 5KTMA 4CDGA 4O4LA 5LA6B 3O7MA 5LR6A 4FP9A 3GFSA 4ITUA 2IHTA 3Q9LA 1T0BA 2A5GA 3CUKA 3CRVA 3BB4A 1VB3A 1QHIA 1QKJA 1OJLA 2XOKA 2EAUA 1RLOA 1XMJA 1I24A 2HK8A 2I4TA 2IE8A 2O20A 3C8DA 1JIXA 2O4UX 5EPUA 1ESEA 4C03A 2OVFA 4C1NA 4FUQA 4E09A 2PUCA 3OMWA 1QFJA 1KBQA 5FULA 3E9EA 1TD1A 2G9UA 3L46A 4N03A 1IM2A 3NO4A 3O8QB 2X4LA 2OCLA 5LDGA 1IVNA 2VH1A 4CM3A 4F11A 3ZCQA 3OU7A 4RSRA 5I45A 4RLQA 5D1HA 1XPOA 2A9QA 1C7FA 1EJBA 3RVNA 1LFDB 2WD8A 4L4ZA 1ZC3A 3GLHE 2I65A 3VZBA 2P6UA 3L07A 5BR7A 5AK3A 3RRXA 1CUCA 4KDFA 2LWIA 2ADOA 3E53A 5HZKA 2CK3A 2Z09A 2GEBA 4Y9DA 5ES3A 5H1YA 3RTAA 2OEPA 3D7KA 4JBNA 1Y82A 1H22A 5K3SA 2OLEA 2GSWA 2BM8A 2WYWA 1KQFA 2GN6A 3UICA 2IP2A 3DMHA 3Q0EA 3VNAA 5U4XA 1E1QD 4JVOA 3ZJYA 3PU6A 3OIVA 2Z6QA 1SUFA 3I1YA 3O4IA 1R8JA 3FGZA 3UJ8A 4DJTA 1VECA 1GUYA 4WCFB 1GPMA 2OD2A 2H5EA 1GY8A 221PA 3KDPA 3PB3A 3GJSA 1Z39A 1UBSB 3DNMA 3MTDA 1ZVQA 3R7FA 4EKEA 5EMJA 5IANA 1NUQA 4TMKA 4R1UA 4U7WA 5JLAA 4NZZA 2F1IA 3ASUA 5CVTA 3KKLA 3I62A 3C98A 2I2BA 4FR5A 1PUJA 3Q2IA 2B9EA 4G8CA 3ROZA 3DT8A 4GX0A 4LGCA 1YS9A 1T5HX 4AVYA 5HIAA 2R87A 5FPPA 5DMXA 2NT3A 1OD6A 2XIJA 4Q48A 1Z8HA 2OV1A 4XM1A 3RJZA 2O8DB 4KO4S 1Q0RA 3F7OA 1NXOA 3W79A 5CM8B 1ZHOA 4K9SA 5G2OA 4O2AF 2W2VA 4NJEB 4U5QA 4CL2A 4DR4B 1C7EA 4HVLA 1XQXA 1BNCA 5AXBA 4QO8A 3TZBA 4TYPA 4QUAA 4S2UA 2YC4C 1C9KA 2VK2A 1D03A 1KNQA 2ZP1A 4C0HA 1Q0TA 5BN4B 3PCTA 5CB4B 5T8KA 1K1EA 1CF2O 4JMPA 1NI3A 4PGHA 1B0PA 3PXUA 2RSLA 4LZPA 1T2NA 4EZBA 3UHPA 1MT3A 2YXEA 2AA3A 3QY0A 1ZOIA 3Q0TA 2ZJ7A 4Q1FA 1F12A 3O5AA 2KHZA 3KYJB 3UT0A 5JV5A 1ABFA 1EK1A 2YMLA 4QG3A 1DPGA 1NSTA 4Z1OA 5LP6A 3OVMA 1KGDA 5E6UB 3T3IA 5TNXA 4RVCA 3VR3D 1WV0A 2QN9A 1WY5A 3A31A 4TZ6A 1Y5NA 2MYTA 2ACWA 2PU7A 4L2IA 1T24A 4NI5A 5BNTA 1P3JA 3RSGA 4GKJB 1PZEA 1DKMA 2Z2JA 4TN5A 4MTLA 3VSAA 4CQLA 1D6JA 5IKEA 3EZ7A 5B4TA 2G76A 4KRGA 1G21B 3HJUA 1HTWA 2DFVA 1EEHA 5A9SB 1TRHA 4LF4B 4H1TA 2JKYA 4CF6A 3FWYA 2L42A 4MRMA 4PLFA 5BQFA 3W06A 2D1RA 3NXSA 5IRCD 1WVGA 1TF7A 3BA6A 5HYVA 1DU4A 1EFRD 4K3VA 3AUXA 3ZIAD 4RIIA 4XVQA 4CTKA 4TVSA 1NYTA 4YAEA 2O2DA 3JQQA 3N28A 3PL1A 3OZSA 4QPZA 5FRDA 3SIXA 4AO6A 1YA6A 1T9AA 1XXHA 2G5CA 2EFJA 1E89A 4KK3A 2PWYA 3GLGE 2PEZA 4K8RB 5I4BA 2HSEA 3E22B 3ND8A 2YYYA 3IPCA 1R15A 3VUEA 4TZ0A 1R66A 2GHRA 5L4LA 5G1PA 2JGIA 2ZUTA 3VOSA 2YFQA 1IRXA 2BFFB 3VR6H 4TV8F 2W2PA 4E51A 1MZVA 3OLZA 3GLIE 2FW1A 4POAA 4MARA 3TVTA 4OLFA 3D43A 5BN3B 1T0JB 2V6FA 3CH5A 1F17A 3H86A 3Q7PA 1ZJ6A 1CJVC 4PS1A 1FS4A 2CXRA 3LT1A 5B6IA 4NYIR 5TMDA 2BYTA 4L6AA 3UKJA 1U1DA 2PYIA 4FNAA 4MKIA 4I36A 4F5DA 1P6UA 1T15A 2IZ7A 3R0VA 5JEEA 1W8DA 1MEOA 4U63A 1M66A 1SR8A 4XSGA 1ZR4A 2B20A 4RZQA 1Z5ZA 1CV2A 3AF0A 4E22A 2ZQYA 3FUUA 4JP5A 4YT8A 3CMMA 3M3HA 5IH7A 2VYCA 3LK6A 5EJFA 4WW0A 4IG4A 3C3CA 2XA2A 3AG6A 3G5MA 4HBZA 1BS2A 3D1JA 4IXNA 4YQZA 4AF8A 5BSTA 1EVKA 4K6FA 1PFQA 4KH0A 2J9GA 3F3YA 4F93B 5I8WA 1F2UA 2VBIA 4XLZA 1J0EA 2HBRA 1DEHA 3E03A 3HKCB 1JU4A 4UTVA 3KQTA 1FFAA 3FVWA 2UUBB 2AJTA 1RABA 1P2SA 3HZOA 2OY0A 3HYTA 5K0ZA 4HDSB 1HE1C 4GM4A 3U6BA 5D84A 1JA9A 1US8B 4QJIA 2A30A 1SC9A 1RWPA 1RBYA 1I6WA 2QTZA 4GOLD 3DDWA 4JC8A 4Q7KA 3W7BA 1MJNA 4C7XA 4Z4FA 2HU7A 3I3SR 4MKZA 3JAWB 5KQSA 1JT2A 2BEWB 4P0PB 2R751 4L0QA 1JTEA 4MRPA 5EAIA 3WLOA 3U7GA 1W52X 3N7UA 3LY7A 2V7WA 4GM1A 4NV0A 3RYHA 2P9BA 5KREA 1VJCA 2QRJA 3LBFA 1E5DA 1VG9B 4I1IA 4D1YA 4B2IA 4MV5A 1F9AA 4F3NA 8ABPA 1UBHS 3JYNA 1BVHA 5IVPA 1Q83A 3CO5A 1XEWY 4YQEA 1T3LA 2B98A 3ZU2A 1S2DA 3ZZMA 5J23A 1NMZA 3EWAA 5IBRA 1QCZA 4YCDA 3ZGOA 2QUIA 3HJHA 2R9VA 5HGJA 3AESB 1UXKA 1T3GA 1SIUA 1B4DA 1Y7IA 5BSVA 3HR8A 4GLBA 2WJVA 2DHDA 5HRUA 2QIOA 1NUAA 4G1EB 1J5PA 1VI5A 1KYYA 4WZAA 3WYCA 2MYNA 1EWKA 1P80A 3P26A 4QG7A 1VCMA 4V0LA 1LB1B 1VE5A 1Y5MA 1SKMA 4WNYA 4EITA 2HQRA 4B3GA 3PXCX 1HF3A 3TN7A 4ER5A 3JY6A 3ESQA 3NTQA 3PVSA 3C3MA 2CD7A 4INOA 3R20A 1SBQA 3JD0A 3QPUA 4P5EA 4Y2XA 5EQTA 1RMTA 4G56A 1O6CA 2C9YA 3WDKA 1FMCA 1EJ6A 5TVGA 4UVEA 2RIRA 1YMUA 2G67A 2Q3FA 1BW9B 3WGMA 2ZSBA 4MLPA 3TI7A 3ZHOA 3ORYA 4HF7A 3GH1A 1CC1S 1L7AA 2P5TB 2W6NA 4EHFA 4W5TA 1H4QA 4QU5A 2Z83A 1U9ZA 3QBJA 1E6CA 3MRSA 3RAGA 1N2OA 1DWPA 2NYUA 1UXIA 5EN4A 4F46A 2XCLA 3NNDA 1MO6A 2ZJ2A 5EJGA 3TZKA 1I32A 2REXB 3NAZA 3DVAB 2VATA 1Y3BE 1Z38A 5E7QA 2ZT6A 1UM9A 4PEVA 1MVNA 1MW8X 3O47A 4RKYA 2QRUA 1JE0A 1U2GC 4CKEB 2A0UA 5TGDA 2FHSA 1HE5A 1RHJA 1VYTA 3KXLA 5JAMA 1ATZA 1F48A 2D5BA 2ZU0C 4FX2A 2PL1A 2Q3JA 1H3FA 2BY4A 4A0HA 5C1DA 2IXFA 3KLBA 5GMOA 3DOJA 3I0ZA 3WMXA 1PHRA 3KAPA 1IOZA 2PWBA 3EDOA 4XIJA 4XSHA 3GO4A 1VBKA 1J8FA 1NPYA 3QELA 1U11A 3WLFA 1GGHA 3VQTA 1WXGA 4YRMA 1NLZA 2ZAYA 5GONB 1KVSA 4FGUA 5HG0A 3A1FA 1KU6A 4DXDA 3BL5A 3OUUA 3UWDA 3H5OA 3TM4A 5JW6A 2BT4A 2EFCB 4U3JB 4XRRA 1NVEA 2EZ9A 4D9IA 3MTGA 2NTNA 2V6MA 2IS4A 1PJTA 2XE6A 4QFMA 4R40A 2NU6A 1O58A 4MQ4A 4BLRA 2QLBA 5IFKA 1UKBA 3ZV5A 5HMLA 1J0XO 3UANA 4LECA 2OHIA 4HJXA 1BRMA 1ND6A 4U00A 3UV7A 2VOJA 1P17A 1YXMA 3JXEA 1Y7HA 4D9KA 2FSGA 1GVNB 1FSFA 1BEUB 1YULA 2HPAA 1P1BA 3VHRA 1KAMA 4XEUA 2F6RA 4JEIA 4U6QA 1UQRA 2IC5A 4C7KA 4W5NA 5I9MA 3T38A 2JA2A 4BFSA 1GYQA 3WKCA 4TTAA 1GQYA 4YAOA 5KCZA 1PR2A 4J3NA 2B99A 3KZKA 4NLLA 5F77A 2PKXA 2NP7A 4G5QA 4ENTA 4UOZA 3TNYA 2YH2A 4L5YA 2CF5A 4Q3AA 1XZFA 4KUGA 4L3OA 4BMCA 3T5GA 1P2TA 1XLWA 2ZREA 1GKYA 3C5HA 3WWPA 1IZ7A 3ICEA 4F4UA 2PKQO 2VHZA 4X1IA 3AUJB 3VO1A 3E7FA 2FRXA 4NCXA 5C4MA 2VQ6A 3DOCA 4DDWA 2F3RA 2JKVA 1DG3A 1KY3A 1I0ZA 2JH8A 1D09A 4ZYTA 2PX6A 4P8RA 2A88A 1SBCA 2CBZA 3ZPXA 3OFJA 4R54A 5E1MA 2WYVA 5FBVB 1GG2A 1K98A 1N2IA 1V0JA 4KJXA 3GEIA 4MR9B 4NPAA 4ZAVA 6Q21A 5AW6A 3KQQA 5AXCA 2I7DA 4C87A 2PFGA 3SS7X 2E87A 4WQMA 3IP7A 2P0EA 1XYYA 3AETB 2YBEA 2YWDA 3H5VA 5KNCD 3EGOA 4BMXA 4UHKA 3QUAA 3HVUA 1R6UA 3VZCA 1NFQA 1W581 2GO7A 4G4IA 3FCCA 4HK4A 2HPZA 5BSHA 2HQOA 3KWMA 3FZGA 4FYIA 2O0KA 3BSYA 1GGJA 2UZAA 2PUHA 3LHKA 4QGBA 3DJFA 4NEGA 5IDQA 4EZEA 2Q3BA 4CCYA 3ON5A 5LD2C 5JPIA 1OYWA 2GBGA 3KM0A 2ZI5A 3QV2A 3MLBA 4GAEA 3RNLA 3UH0A 3U4MA 2EF0A 1W87A 4IVQA 5B64A 2X2EA 3N2KB 1NVVQ 3ZWVA 2RH5A 2IFTA 1B0UA 1DBSA 2AWOA 2LIVA 3KSMA 3OZTA 1H2YA 4RF3A 4BMPB 2X0KA 4RF2A 2H29A 5L7TA 1X8JA 2OUIA 3OFNA 4WACA 3ECCA 1DDIA 2VJLA 2JB9A 2X6RA 2Z5FA 4PLZA 4QBTA 4V0KA 4W1RA 5DTJA 4JASB 1OB5A 4FBMA 5ALZA 4LGMA 5EKXA 5DE3A 4EI9A 4UOEA 3V2UA 3PC7A 4QYTA 3EA4A 5AW5A 4BMVA 4F3YA 3OM0A 5JYEA 1C0LA 4WK0B 3HHEA 4AECA 3ND6A 2N1BA 2VHEA 2UVDA 4PR3A 2Z8ZA 1LPAB 1DIGA 5CYOA 5J2UB 5KVVA 1WB6A 3FNFA 2VJBA 1W4CA 1X7XA 1DKQA 1F9EA 1PK8A 1QK5A 1FNCA 1Y4UA 2AFHB 3M4JA 4CF3A 1TEZA 1X7GA 3EGIA 3LF2A 1Z6ZA 3HJBA 1ISFA 4G84A 3M33A 1W5BA 3AKDA 4KWIA 3HR7A 5AHXA 4D45A 1IEVA 1QH1A 4N8DA 1FRFS 2JRLA 2NO6A 5JAPA 3R0JA 1KR5A 1MC4A 2FOLA 3HCBA 2YWBA 1CQIA 4X1YA 1PEKE 1CKEA 3VJLA 3MUEA 4BB9A 1E3EA 4G8DA 1GYPA 4BEBA 3B3QA 1B74A 2NUTA 1JDJA 1ECPA 3JQGA 1U3UA 1CUYA 4TSFD 1U8AA 3PUYA 3P0JA 3RT9A 1Z7GA 4Q15A 1T1SA 3FNIA 3D6JA 4N6GA 3LX6A 1TT7A 2ZJBA 3B5EA 3CCBA 2HREA 4IV0A 4RD2A 3D3QA 4CLOA 4MUKA 4AD8A 1Y9ZA 3I73A 1AXRA 3GFQA 3N8KA 5D3MB 4RS3A 3G0HA 4ND7A 3T7RA 3KUDA 2FW7A 4URVR 2XDWA 4P35A 5HQ3B 5C7IO 4AJOA 2X3FA 3OOWA 4Z53A 1GG5A 1BQ4A 4HC4A 1YGYA 4LMRA 1GJRA 5ICFA 3ZIUA 1E0AA 4BB6A 4G0NA 1JHMA 5BWBA 3VPGA 7GPBA 2AI2A 3EDCA 4OXIA 4UMEA 2P9GA 2XF2A 3MSCA 4EY6A 3UOGA 2E4XA 1OIXA 2ZE5A 5I8PA 4XJXA 2FUCA 3HY3A 1YZQA 2WSBA 1P61B 1VLQA 2UKDA 4CKBA 4DN6A 3FOBA 1XMSA 4IZ6A 1GA6A 1G291 1K4KA 5IN4A 1U28A 4RU1A 5BWOA 3KAQA 5CG2A 4AMGA 2WU3A 2WJJA 4WSOA 3RRNA 4GKKB 2CLCX 1N9ZA 2PJUA 5CH3A 1LLDA 3ZU3A 1TAQA 3OEEA 4Y3UA 3AM3A 3W5AA 2XB6A 1N5JA 2IYWA 2J9XB 3KL2A 2RGBA 5AT1A 1NTOA 2HMWA 3WLEA 5JJBA 1XHLA 2KJQA 3KQHA 1ATIA 3OMXA 4BAGA 4ZYWA 1OOEA 4QUDA 1V48A 3EOZA 4TKUB 4MIYA 4ZK6A 2V4ZA 4NNJA 3HNOA 3DBIA 4XKJA 1C7IA 1ZISA 4M86A 3AHHA 3PHIA 4M49A 4BO9A 4CFZA 1QQ7A 1U2DC 4RJ2A 4XVHA 3ELUA 1F60A 2R4QA 2AG1A 4JLMA 4ZU3A 1UM8A 1CR4A 1G8KA 1ZC4A 3BWMA 3L4SO 5AI8A 4J0EA 3NGMA 3HB9A 1A2KC 2BC9A 5JS7A 3AFIA 4KPFC 1JXAA 5AW4A 4DF3A 3N8HA 2QQEA 3G9TA 5DPMA 3HLTA 4WGFA 3EVAA 2PD4A 3R0ZA 4IOLA 1SUEA 2FLVA 4O5OA 3FPLA 1BEEA 1QGAA 1RAIA 2XWJI 2O23A 1UBCA 3BL6A 4OO3A 3WBBA 1YVEI 5ALTA 1XVUA 1DWQA 4A3SA 3CB4A 2LBPA 4S24A 1XB2A 1JH9A 2BFBA 3ZGYA 4KYUA 1RC0A 2FZCA 4PG4A 2X2OA 1VE7A 5KX5F 1C8LA 2HDOA 3CC8A 3PA6A 2O4CA 1M3SA 4YAUA 2W6JD 3CE9A 3Q11A 3ETGA 3D8SA 5TQJA 5BSKA 4DDTA 1GFWA 3CVVA 4Z4GA 1RM3A 5CCEA 1Y9EA 4KQEA 3HTXA 4MEAA 4N01A 3STVA 1DJOA 2DFDA 3KT3A 5IT4A 4B6EA 2IU4A 3GFRA 3JQAB 1NV9A 2VBFA 3B70A 2VRWA 4KODA 2WHXA 4HDQB 5L8VA 2FZEA 2H0AA 3HDJA 3LBYA 5HZMA 1PJRA 3I6IA 3ZBTA 2QK4A 4D42A 4D99A 2D3WA 5JFOA 1J8MF 3UK6A 5E38A 3AR6A 1ZDMA 1C7RA 1NVBA 2C4MA 3LQFA 3Q6MA 2Y6UA 3BDVA 4NONA 1N5RA 4DR5B 2YC2C 4EO4A 3Q2OA 5CNIA 4UZSA 3GP8A 4MVJE 2I3AA 2BGGA 1E5LA 1U0NA 1YZGA 4I4TB 2Q8PA 3THRA 3I5UA 3DWEX 4BY9E 2GPNA 5HM8A 4ENRA 3FTPA 5LJLA 3SFZA 1JP7A 3EOBI 1UMCA 3DE4X 5CX4A 3WB0A 3ROGA 5TT0A 1LBHA 2KWIA 2HNAA 1QG2A 5REQB 3TSYA 1S3SA 5JAUA 3RU3A 1WNFA 3TTSA 2HX1A 2V1XA 3BGIA 3DQPA 4PTYA 2VLIA 1SZPA 3VJRA 1OW3B 3EARA 4B84A 1KVUA 2ZUDA 3EXG2 1J1IA 3GJXC 3F9IA 1E9CA 1POWA 4GMDA 5E2BA 3IOEA 1KEZA 1H0KA 2FX2A 2IF0A 4PU0A 5AWFC 4XR9A 3UV3A 3BICA 3PDIB 1EUZA 3OFKA 3RUHA 1OXSC 1KOJA 1YBVA 2YW9A 1PTJC 3OZFA 1KZ6A 3PXEA 2C5FA 3FHTA 3JQRA 4N7BA 1B6TA 3LLSA 3VAZA 1M2OA 2X9QA 4IH9A 1P5ZB 2HWKA 3KLNA 2OA0A 4MR7B 3RANA 2I4LA 4LSGA 2PZMA 2DFKB 1UT6A 2J3KA 3C6QA 4HGZA 1YL6A 1WY7A 2C96A 2FVXA 2H18A 3INNA 3K5WA 4RZXA 2LP4Y 1Y80A 1M2VA 2XKAA 1VBMA 3N6XA 4YDQA 3LP5A 1JEQA 4JJZA 1GZVA 4A6PA 4AXXA 1DAPA 3W8EA 3SFVA 4A6XA 1GCAA 3OC0A 3W5HA 1A27A 2XMDA 2ZM6B 1UJMA 1EXMA 2DX7A 3ICWA 1UMDA 3NBZC 1FTNA 1M6VA 5AM4A 2JI8A 1VL5A 3PITA 4CRWB 3R7LA 4DLNA 4MZXA 4EW3A 4XXHA 1LJ8A 2Z43A 4HEJA 5A0FA 1XL0A 4HDCA 3IEPA 4LBWA 2FFHA 2G5GX 4YAFA 5EEGA 4ZHQA 1B3RA 5TJHA 1Z8DA 4K6OA 5H4GA 2QZ9A 2AI3A 3IQHX 1ORVA 3PQ3A 2OHGA 3DKPA 3NIDB 4HDRB 4W5HA 5JOQA 3LFHA 1ZMOA 3GRUA 3QE3A 4KLRA 4UHCA 1XEXB 3O74A 5NULA 3OLCX 1PL6A 1YACA 1P6QA 2NUAB 4ENPA 3IAAA 1IWOA 4HEQA 3MWKA 2V55B 4MJLA 2HA0A 1AMOA 1SXQA 2MDTA 5TC4A 3ZEIA 1E9EA 3EUFA 2X3UA 3HP1A 4KVZA 5ESXA 3BS4A 1S0UA 3PTLA 3BRWD 4BAUA 1J33A 4F56A 2AFIA 2FR1A 2H2IA 1BDBA 2R6DA 4BMNA 1PFUA 2W83A 4JOSA 3BMOA 5KTKA 4O4LF 3S4YA 4YT2A 1FQWA 1E1RD 3V1TC 2YRFA 1M8GA 1FMTA 1BDHA 2PKCA 3B9RA 4EYGA 1J1UA 1SK9A 2PUWA 2C7BA 2Z5GA 1NVVR 2IDJA 3R75A 4RYLA 1QYIA 5BNIA 3I9KA 4ZCTA 5JISA 3EAQA 1WTCA 4TUYB 4LXHA 1JQKA 4KH1A 1LWOA 3C7AA 3JAKB 2KX7A 4OJKA 4UNNA 4B79A 1HH4A 2BISA 1OROA 1PWEA 1VI2A 2ORYA 1U1FA 3F5DA 1WUJS 3F67A 3TOZA 1PFKA 4F1JA 2Q2VA 3TNLA 2CLIB 4AF7A 3GL9A 1JPNA 4D02A 5EC8A 1LQ2A 3SBEA 2CUTA 1IUOA 4QWWA 3RD5A 1Z75A 2D7CA 2JBAB 4M2LA 4O8ZA 4FINA 1V5WA 1DO2A 1KXJA 3JALB 3FMFA 3GK3A 1M7HA 5JASA 2OFWA 2PS9A 4D4GA 2QZSA 5AOCA 2GPJA 4CV2A 1DO0A 3DEJA 4DMUB 3RCBA 2A9PA 4R1LA 4OH1A 3IR6A 3TR5A 3Q1KA 4P4SB 1S3FA 1E5XA 3F5SA 1RWMA 1A4XA 3TOVA