4HZGA

Structure of haloalkane dehalogenase dhaa from rhodococcus rhodochrous
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hzgA00
2G4LA 2ZJ7A 2XMSA 3BL8A 4G8DA 5I7UA 1XRRA 2WUFA 4L3WA 1YA8A 3DEAA 4U2DA 2X76A 1XZEA 3ED1A 5EFZA 1QO7A 1GZ7A 2CUTA 3IIIA 3G9ZA 4L0CA 3VJMA 1BCRA 1FFBA 2WJ4A 3RK4A 1USWA 3RKSA 4N5HX 2AJLI 4LXHA 4H7DA 5AIAA 1UOPA 5A2GA 3ICVA 4BCDA 2WSLA 1ZD4A 4K2AA 1JJBA 1XZFA 3LS2A 4GLBA 3D3NA 5AK4A 1BCSA 4H0CA 5JD6A 4YASA 1CUWA 1EHYA 4XWGA 4W63A 4P9NA 3WLAA 4X7BA 4HAIA 1HQDA 1EDBA 1YS1X 4HZGA 1IMJA 5H3HA 3K9BA 4UHEA 1U65A 5JZSA 5IKXA 4Q82A 1DQZA 4BE4A 3F98A 1YB6A 3D7RA 4AQDA 2JGFA 3ESAA 4AZ3A 4ITVA 4KE7A 3WIOA 3FVTA 3CN7A 4C89A 3BF7A 4OCZA 4KJXA 3STWA 2O2HA 2J4FA 5LKAA 1CVLA 1UWCA 5HF6A 3V1KA 1YS2X 3G9TA 2XUIA 1WM1A 5HZGA 4Y2TA 3V1MA 1C7IA 1T4MA 4FBMA 3PUHA 2ORYA 4AO8A 1NX9A 2WKWA 1ODTC 3RLIA 3CCBA 5JAHA 3AZPA 2WIFA 1XZGA 1H23A 3QPCA 1JU3A 4HRXA 3M3DA 2BJHA 4BC0A 1QIEA 4BTVA 2WHRA 2XQJA 5CH3A 1IZ8A 2GZRA 5CT5A 4RNCA 1HKHA 1GQSA 1N8SA 2WUGA 4DTCA 1DWQA 5AP9A 5AM2A 3D0KA 2VJCA 4KRYA 1JJFA 4GHWA 4TVKA 4ZWNA 1ETHA 1L7RA 2DHCA 2H7YA 2WIDA 5I9IA 3WL8A 1ODSA 1E3QA 3QMVA 5AHXA 1X70A 4FFVA 1ZD3A 5AM1A 1W4LA 1XFDA 4P93A 3C8DA 3HABA 1CUGA 2CB9A 2HHAA 4KAJA 4G9EA 4HTAA 5C8ZA 1RYYA 5E4JA 3LLCA 4J3JA 1QJ4A 1VJ5A 3KWJA 4G5XA 4X92A 4G4IA 4G4JA 1XQXA 5LZ4A 4RE6A 4GBGA 3E0XA 1XRNA 1OCEA 5K3FB 5ALUA 3I2HA 5JAOA 2C0PA 3AZOA 3O9VA 2PPLA 2W6CX 3C6XA 3MVEA 1YASA 5DTJA 3STXA 1FSSA 2BUAA 2AJCA 4EHBA 3O4JA 4Y2RA 2ZSIA 2P8SA 5EHZA 2OG1A 3FLBA 2QXUA 3R3YA 3H18A 4X91A 2QJRA 5EI5A 4K6KA 2ONCA 1ZD5A 4DNOA 3I1YA 4DNPA 5HK9A 3WQHA 4QWMA 2WTNA 2FJPA 5CXUA 5HK8A 3ICWA 1RP1A 4B80A 2QUAA 1LPOA 2VJBA 4HS9A 4UBIA 4GI1A 4Y2PA 3QPDA 1FFAA 2QR5A 2HA4A 4AO7A 2HFKA 3AJAA 5FKJA 1YA4A 2XB6A 2V96A 2GYVA 3AINA 5A7GA 1PJAA 3W9BA 4AZ0A 2RGUA 5FOQA 2HU5A 2VAVA 3FBWA 5K3CA 5EHXA 4MQLA 2ZYIA 2XMRA 5C8XA 3U1TA 3WYDA 1G4HA 1OILA 4QA9A 4DM7A 1JI3A 5HFAA 2HU7A 4W9RA 4CG3A 1ZIXA 2QUBA 2K2QB 4TGLA 4CIAA 4OD0A 1AZWA 4DMFA 1UXOA 5IH7A 1CUIA 1DT5A 3SK0A 5J3JA 4OB8A 2XMCA 5LYYA 2OGZA 1ZI9A 2EEPA 3A2MA 4Y2YA 5E4YA 1UT6A 3G0IA 4JNCA 4LIPD 5KWJA 3OTQA 1SOMA 2VJAA 3SC2A 1F0NA 4MEBA 4U2FA 3OC0A 2VSQA 4H7FA 1SCIA 1XRLA 2EDCA 1MO2A 2OCGA 1CFJA 4G9GA 4Q1VA 5AOAA 3H2IA 1AURA 4EB0A 1XKLA 3M83A 1DWPA 3NGMA 2OPHA 2WFLA 4J0KA 1XZLA 3VVLA 3IUMA 2HU8A 2XMBA 2FX5A 1R9NA 2E3JA 3QM1A 4J03A 4P08A 3D2BA 1R50A 3M82A 3WL6A 2IIVA 3LIPA 2ZYHA 1XZIA 5IVIA 3FCYA 4BCCA 2XQGA 4CCWA 5ALEA 3NOXA 5ALZA 4ZXFA 1MAAA 2I03A 3LP5A 4U2EA 2OCKA 3C43A 1J07A 1CIJA 2CBGA 1ZOIA 4MWTA 4B0PA 3HZOA 4Q3LA 3IUJA 4W1PA 5EIAA 1MNAA 4ROTA 1IUPA 4QWWA 5ALPA 2X8BA 3R3UA 1R4ZA 5AM3A 1O6FA 5A71A 2WJ6A 2WIKA 4W1RA 3VDXA 1QONA 1X2EA 3C8HA 1ACJA 2ZJFA 5AK6A 5CBKA 1W76A 3OPMA 4NZZA 4C87A 1UKBA 1JKMA 4LKOA 5AKZA 1ZD2P 1F6WA 1N5MA 1QFMA 4FFWA 1TIBA 1Q0ZA 3I2KA 3WWCA 1QFSA 4AN0A 2PSDA 2ZYSA 4DIUA 3WJ2A 4XJVA 1QE3A 3HXKA 4C4XA 4BBZA 4X71A 4ETWA 5ALTA 4C4YA 2XI4A 5IVHA 2ES4A 1I6WA 2GBFA 4J0CA 5HQ3B 2BKLA 5EHQA 1XQWA 5DYYA 1BRTA 1CPYA 2G5TA 2XLCA 2XMGA 4J0IA 3C5WP 1IZ7A 3L1IA 2QXTA 4EUSA 2BUBA 4FOLA 1CUJA 1XLVA 1LPPA 1B41A 2B61A 3H0CA 2X5XA 1CQWA 4PSUA 2QVBA 4GECA 2JGIA 1CUAA 4BDSA 1VE6A 1WHSA 3R3WA 1GPKA 4K6GA 1C7JA 3S8YA 5LKRA 2YH2A 2VATA 2Y2VA 4AMYA 2Y6UA 2XUJA 3K6KA 1H2WA 2JGKA 5AOBA 1H2YA 1QIHA 5ALOA 3ESBA 1VE7A 2Z3WA 3DDUA 3DLTA 1WB5A 2PSEA 2GBIA 4BRSA 4W1SA 5I8PA 4IH4A 3EQ8A 3WK4A 1YAJA 3I2IA 4HXGA 5ALFA 1Z68A 5AKKA 1BU8A 3FSGD 3CCCA 3SWWA 2OQIA 3VVMA 2GZSA 3STUA 1ORWA 5EIEA 5AIBA 3YASA 1JMKC 4CCYA 4NMWA 3EF3A 1CRLA 5CH8A 2HA6A 4D9JA 3AZQA 3D2CA 1QO9A 1EK2A 4DSZA 3R3XA 1LPMA 1UOOA 2H9YA 2VA9A 4I3FA 1W75A 5ALIA 3JYHA 3OOSA 4BC1A 4H77A 1MTZA 4DYHA 3HJUA 4MWSA 2VTVA 4MEAA 2WUEA 3JWEA 3C45A 2PU7A 4H7KA 3DKKA 5LZ8A 3OM8A 2Z5GA 2V97A 3MUOA 3O4IA 2PSFA 4ZRDA 1L7AA 3IB3A 1O6GA 2G63A 4KRXA 1CUCA 1AX9A 1UK6A 3G0GA 4E46A 4B7ZA 1VZ3A 5AKYA 2HRRA 5A7HA 1THGA 4X6XA 2GYUA 3KSRA 3C6YA 4BAUA 4I4CA 2XUGA 4OYYA 3STVA 3IDAA 3ZLTA 1Y7IA 4BP8A 1JT2A 3HACA 4X85A 4FTWA 4UUQA 3GBSA 5ALXA 2PVSA 2IITA 3KOOA 1H2ZA 5LZ7A 4QDXA 2OXEA 4GEGA 4AX4A 2D5LA 3WWDA 4A5SA 1QGED 4PSCA 3KWFA 4M0MA 2AJ8A 3G0CA 2VAXA 5CT4A 3R3VA 4BYMA 5KWIA 4KEAA 4OU5A 1VA5A 2YYSA 2BFNA 2JF0A 2Z3ZA 3QMMA 5HF8A 1KU0A 5HF5A 4F5ZA 3I6YA 2WLSA 2RONA 5ALJA 3HYSA 2GBGA 1QOZA 3GZJA 2UZ0A 5JD4A 1EDEA 5DTIA 2ZVDA 4PW0A 3QYJA 5JATA 2WIJA 4PF1A 5D3KA 1GKLA 4MXDA 4A16A 3AFIA 3I1IA 2QMQA 5AKIA 4BTLA 2PUJA 5FPQA 1CUUA 4GWLA 1IVYA 4X3CA 1EVEA 5DNVA 3PDCA 5KREA 4DMCA 5ALVA 1CUDA 4QLAA 4CG1A 3WJ1A 1BS9A 1FFDA 1WPXA 1SCQA 1XQVA 1A7UA 3ESCA 2XLBA 5CT6A 1PV1A 3BWXA 4MYSA 2O2IA 3G8YA 3W06A 5ALYA 5ALHA 1CLEA 1FFCA 1T2NA 3W04A 1AC5A 2WQZA 4UHDA 5E4TA 1XZAA 2I3ZA 2VF2A 1TCBA 1AKNA 4J0GA 1E5TA 4AB1A 1XZBA 4FHZA 3R41A 5IVKA 2XUAA 2WG1A 4OYLA 3WKEA 2C5FA 4UFOA 3UUFA 4Q34A 3WK7A 4XIIA 5BWCA 4FDMA 4INZA 4J7AA 3TRDA 4KR0A 5HCUA 1CUVA 4BZWA 1CUFA 4BZZA 2XT0A 5AI5A 5LLSA 4MJ3A 1XRQA 1JFRA 4YPVA 1ZJ5A 4C88A 5T4EA 1W52X 4BRZA 3V1NA 2XMZA 2HL6A 2PM8A 1DT3A 5F4ZA 1LBSA 5A7FA 5FUMA 2XDWA 3I2JA 1CUXA 1VZ2A 3D5EA 1VOTA 1EINA 4UBMA 4N8EA 2XMQA 4YK7A 2DQYA 2C7BA 3DL4A 2WM2A 4WDQA 4ZV9A 1EDDA 3GFFA 5FPPA 2HA7A 4HXFB 3A2LA 2ZSHA 4KE8A 4WJLA 5SYNA 5CT9A 4P92A 2HIHA 3TJMA 3UMJA 3DL7A 5BOVA 1EH5A 4WDRA 4J0JA 2ACEA 1EVQA 5EHNA 3AIMA 5AKLA 3FLEA 3LIIA 1AQLA 4EBBA 1WCYA 3IA2A 1ZGBA 1MX5A 2ACKA 1CUYA 4RE5A 3WL5A 1BE0A 3OURA 1VXRA 2PU5A 4AMZA 2VJDA 2WIGA 1QTIA 5CURA 2DHEA 1VLQA 5ALKA 3GUUA 3WZLA 4KAFA 1G42A 5LZ2A 5ISMA 5C81A 3TEJA 1N1MA 2WILA 3KXPA 2YASA 5FLKA 3C87A 1L7QA 3DD5A 1EXWA 4K5QA 1LPSA 4X95A 3K2IA 1DINA 5FXMA 4LYDA 1U2EA 5K3DA 3SX4A 4DMKA 5YASA 1MX9A 2OCLA 3FYUA 4QE3A 4JUIA 1LBTA 1YB7A 4LXGA 1EB8A 2HA5A 4Z49A 4B82A 1NU6A 3F96A 2OGTA 3DKRA 1HLGA 3H1BA 3C70A 3PUIA 2BGRA 3H04A 3I2FA 4Q05A 3FLAA 1ZI8A 4QDTA 5AM5A 2BCEA 2FUKA 5AI8A 4QZVA 3T52A 4U2BA 3FAKA 4B6GA 4N5IX 4X00A 5CRIA 1JJIA 5AKEA 2OCIA 5K3EA 1H22A 1MT3A 3FNBA 3FWHA 1A8SA 3Q8WA 1YR2A 5HKAA 2JGMA 2H7XA 4QNNA 2WFMA 1LZKA 3FYUC 1B6GA 3HI4A 3C5VA 1FJ2A 1R88A 1ZICA 5DLPA 1FFEA 4KE9A 1K5PA 1P0MA 3O4GA 3IURA 4MQMA 4HXEB 2WTMA 5T4HA 2J4CA 3PF8A 4GW3A 2DR0A 2HA3A 1ORVA 3H17A 2NW6A 1R1DA 5FV4A 1QTRA 1XRMA 5T4FA 3DJYA 1W1IA 1E8NA 3U0VA 1XZKA 4CCYB 3ANSA 1JU4A 3HC7A 4LXIA 3WK6A 3H19A 2CMFA 2EDAA 1LPBB 1DX6A 3HSSA 4BCBA 1XLWA 3H1AA 4BP9A 1GT6A 2XUKA 1Q83A 2BGNA 5ALDA 1A8QA 3QPAA 5LIPA 4L9AA 1GKKA 3DNMA 1ISPA 3DYVA 3QH4A 1Q84A 4KYVA 4Y2XA 4FKBA 3E1GA 3WIBA 4BVKA 2CKMA 4E15A 3G0BA 4UBOA 2QRUA 4O08A 4DNQA 3B5EA 1J1IA 1XQYA 3O0DA 2GYWA 3TGLA 2OAEA 2BAGA 4E11A 4LYEA 3BF8A 2O2GA 1TCAA 1P0IA 1UOQA 2PL5A 3PE6A 2AJBA 5D3ZA 4B9EA 1LGYA 5C8VA 3QMWA 5AOCA 4ARBA 5ALRA 4QLOA 1LNSA 1N5RA 4LHEA 2V98A 3IVMA 4NS4A 1J06A 3I28A 5DWDA 1IUOA 3IULA 3DCNA 1RWQA 4H7HA 1MAHA 1XROA 4G4GA 2C4HA 2JEYA 4BVJA 4EZIA 3W9UA 1MN6A 1HBJA 4EY4A 3FVRA 3RARA 4L72A 5AKJA 2PSJA 4H7EA 1A8UA 2QS9A 5ALQA 3EQ7A 4XVCA 2QKYA 2R11A 4KAAA 4IHAA 5JADA 1QIJA 1WB4A 2J3DA 2OLEA 1MPXA 3WA6A 3GA7A 4ZV7A 3VXKA 4X6YA 1ZJ4A 7YASA 4N8SA 5CH5A 1HDEA 2D0DA 4WY5A 1AMNA 1LPNA 2CJPA 4FNMA 3ILSA 1SFRA 2OAGA 4NVRA 2JEZA 2B9VA 5DNUA 4OB7A 1UFOA 2O7RA 4UBLA 2JIDA 5AKGA 1XRPA 5HQ3A 4U2CA 2IX9A 3A70A 3F97A 3F8SA 4IH1A 5CMLA 1R9MA 5ALWA 5JALA 1VXOA 3H2GA 2R8BA 2VT7A 1VA4A 2WU4A 4G8BA 2ZYRA 5DNWA 2WHPA 1HL7A 5D7BA 3I6MA 5AI6A 5KBYA 4HRYA 3WKDA 1YSCA 4WY8A 4QDOA 2C5GA 5FP0A 1PFQA 1QIDA 2HA2A 2QJWA 4DSAA 3DS8A 4X6UA 1CUHA 4UBNA 4DNFA 1TAHA 3C6BA 3B12A 1D07A 4G1FA 1WB6A 1CUSA 3E4DA 4WCVA 3FCXA 3BJRA 3BJMA 5AICA 5CXXA 3WWPA 4CG2A 3ZV7A 4KE6A 5JANA 2C0QA 4WFKA 4F60A 5JASA 1W6RA 1QIFA 4JEIA 3IUQA 1CV2A 1YAHA 4PQEA 4DMHA 3PFCA 1K8QA 5BWBA 5C7YA 5AJHA 4BAGA 4B85A 2HA0A 1ODCA 3MGAA 1LPAB 3H2HA 3ZLUA 4E14A 5JYCA 1NU8A 1JMYA 4JH0A 4X94A 4V2IA 4X93A 1EI9A 4F21A 1DX4A 3OG9A 3BDVA 1XZMA 4B0OA 1TRHA 3W2TA 1CUBA 1WOMA 3MUNA 4H7JA 3R0VA 1UZAA 2HDWA 2JBWA 3V48A 4J0DA 1G5FA 2DSNA 5AI9A 1UK9A 5AO9A 1SCKA 3NWOA 4AN1A 4PV7A 5AK3A 1TCCA 1ZGCA 2YXPX 4OUKX 1G66A 5D6OA 2HRQA 3ANTA 1U8EA 3IBTA 4UBKA 5FDFA 1DWOA 1EK1A 1GPNA 4C4ZA 1GGVA 2WHQA 1TKRA 4Y2SA 4Y7DA 1E8DA 1BROA 1QZ3A 4FWBA 3D2AA 4GDMA 6YASA 1CR6A 3S2ZA 4YX9A 1GPLA 4EY5A 3EQ9A 4G8CA 3VISA 3G7NA 1E66A 3FOBA 2GBCA 2RI6A 3G9XA 4JYPA 4OU4A 4BAZA 4FMPA 4EY7A 4TPKA 4X97A 3WL7A 4S0XA 5AM0A 2I78A 2WUDA 1XZDA 3QITA 1BN6A 1H2XA 5LZ5A 1MNQA 3N2ZB 4BATA 3WZMA 1AGYA 5JAUA 3AUKA 4BVLA 1F0PA 1UKAA 1XZHA 5JD5A 4FBLA 4OB6A 1K6EA 3M81A 4MYDA 4ZREA 3WKBA 3O9MA 1BN7A 2Y2UA 2AJDA 1K63A 4Y2JA 2WFLB 4IQ4A 1X2BA 4UHFA 2ECFA 4B9AA 4W1QA 2PBLA 1CQZA 2Z8ZA 3JW8A 5K3BA 2JGEA 4EY6A 4C6HA 4FLMA 5LZ9A 3WMRA 2C58A 3W05A 3WYNA 3A2NA 2WU3A 1J2EA 1QIGA 1UK7A 2DQZA 1EX9A 3N0TA 4DLNA 4UHHA 1P0PA 3FYUB 3H2JA 2RHWA 1QIKA 1DQYA 5AI0A 4IH9A 3KD2A 2BUCA 2QOEA 5CT8A 1UK8A 2QZPA 3DOIA 3ESDA 3UUEA 5E2IA 4A23A 5HF9A 4IO0A 1EA5A 3D4LA 4M0EA 1THTA 3FYTA 1CUEA 2RIPA 2I3DA 3B3QA 5JZ9A 4ZGBA 4RPCA 3T4UA 4QDZA 5AI4A 3EIOA 3AILA 2PSHA 3ZPXA 3WI7A 4WFIA 5K3FA 2XE4A 1A88A 1IUNA 1HPLA 2WG2A 3BDIA 4H35A 5ALSA 1MU0A 5IVDA 3KDAA 4Y9SA 3WK5A 2AXEA 4BE9A 4U2GA 3BIXA 3BXPA 1SC9A 5JIBA 3PI6A 5DYWA 3NUZA 4UBJA 1VKHA 4XX1A 3LCRA 4N8DA 3CXUA 2DCMA 3R3ZA 5DYTA 2XQFA 1UKCA 5DJ5A 1WHTA 2RAUA 1ACLA 1QLWA 4ZI5A 3STTA 3WKAA 1LZLA 4AO6A 3VJKA 3ZLVA 1QIIA 5EGNA 4Q3OA 1CEXA 2G5PA 4BB0A 2O7VA 2VQ6A 2QTBA 4Y2VA 1YCDA 2LIPA 4CFSA 3L1HA 4CI9A 2VT6A 5CW2A 1K4YA 5AM4A 4UPDA 1C4XA 3DOHA 3ZI7A 2B4KA 1F8UA 4Q3KA 1XKTA 2QM0A 3A6ZA 5ESRA 1MJ5A 3I6ZA 3VKFA 4UFPA 4C01A 4EY8A 1EB9A 5AH0A 3QVMA 4PSDA 4B81A 2H7CA 3WK9A 1KEZA 4RGYA 2XUOA 3GELA 3VJLA 1Y7HA 4B83A 4UHCA 1BEZA 2V9ZA 1TK3A 1Y37A 2XUFA 4AXBA 3G9UA 4WFJA 1GQRA 5T4BA 3AIOA 3STYA 1BEEA 5SYMA 3WWEA 3E3AA 3L1JA 4QEKA 4KACA 2OGSA 3FSGA 4CIBA 2HADA 2CEKA 2Q0XA 5ALLA 1KU6A 3HEAA 5K3AA 1XZJA 4HVTA 4EA6A 4B84A 2XMDA 5CTAA 5ALMA 4Y2QA 2XQKA 4UHBA 3G02A 2ROQA 3PFBA 5BV7A 3X3HA 5AKXA 5HKBA 2WJ3A 2QT9A 4J0HA 4H7IA 5ALGA 3QZUA 4ARAA 1S8OA 4JYMA 3R40A 4QDUA 5JZBA 2WFZA 3WK8A 1CUZA 1WPRA 4H18A 2RHTA 3IUNA 4PNZA 2W22A 4BDTA 2XUHA 1OXMA 3PF9A 2J3QA 2WG0A 3GROA 2XUPA 1LLFA 3RM3A 2XUQA 1M33A 3WKCA 3WA7A 2JGJA 4I19A 1Q0RA 3H2KA 4GXNA 2JGLA 2HM7A 3WWOA 3F67A 3HRHA 4K6HA 1QIMA 2DFPA 3DQZA 2FJ0A 3QBJA 5JAPA 5LP1A 2Y6VA 5HFNA 5AKHA 3Q0TA 1AUOA 2HFJA 1XZCA 2ZJ6A 3F9CA 2DHDA 2Y1KA 1ZI6A 4FLFA 5A6VA 2VEOA 1ZIYA 3O4HA 3BE8A 5ALNA 4Y2UA 2PKYX 5K5EA 4OPMA 4PO3X 2WHPB 1MX1A 5JARA 3O95A 3I2GA 4FLEA 1GXSA 2PUHA 2CZQA 3DYIA 2XUDA 2PX6A 5FRDA 4X90A 3BIWA 4M0FA 1P0QA 2B20A 5AK5A 3D59A 5A62A 1DU4A 4OSEA 2OQVA 3CN9A 1U4NA 1R3DA 4DGQA 4UFNA 2XQIA 1E89A 3ZWQA 1TQHA 1DTEA 3EBLA 3P2MA 3HLKA 3G0DA 3C6ZA 2Z8XA 3AIKA 1XLUA 3V1LA 1E8MA 4FNGA 3PICA 3V9AA 5EIHA 4F0JA 2H1IA
chains in the Genus database with same CATH superfamily
1V16A 3T5TA 3IEPA 3JQ9C 4YIHA 4P36A 2QNRA 4DRZA 4G8DA 2QAJA 2AFIB 5FJJA 3BFKA 3B8EA 4MV8A 2NYUA 1EFCA 5CXQA 2BSQA 1YA6A 1OXVA 4LRSB 1I6KA 3ICEA 3C16C 2NX2A 3PPVA 1NNLA 1VLZA 1R2QA 4K8OA 4L3WA 3MQ4A 2O5EA 7ABPA 4HGOA 5LM3A 4CI0B 3TGPA 4JJ4A 4NMXB 4OGKA 1AGXA 1E9FA 4ND5A 4LGCA 2CL7X 1PZMA 4NFLA 2ADFA 1Z5PA 3LMKA 3WLSA 2YHBA 2ZANA 4OV6B 2RGNA 4RKWA 5LB4A 3UMMA 3VJMA 1BCRA 3V7FA 4ZJZA 1Q7CA 4EO9A 1RQRA 2WJ4A 3RK4A 2PFKA 4LJ8A 3DW1X 4LTNA 3CVOA 4M6WB 3DE4X 5L7WA 3JR3A 4P0PB 2X5KO 1DCKA 1GVNB 3S3TA 3NBYC 1FC0A 1XT6A 2C92A 3G8BA 3SC4A 3ZGOA 4BU0A 1E62A 1IVNA 3TBHA 1DAPA 3QF4A 4ZEWA 1UBTS 3FBTA 1PV4A 3ZE6A 1HUQA 5CLIA 3R74A 3ICVA 1P72A 4BCDA 2V55B 4BNWA 2QRGA 5LYJF 3GLTA 4JLNA 3E9EA 3HY4A 1V8BA 1GZDA 5AXDA 3SX0A 4K2AA 2OILA 2PX3A 1XZFA 4KK3A 3WGGA 1K9SA 3UHPA 4ER0A 4UE3S 1EUYA 1B8PA 1IMOA 2ZLBA 3ZK9A 3DAHA 5FAXA 3TTYA 1G3IA 2FOIA 1XCPA 4CKBA 4CTMA 4F06A 4RZQA 5KJFA 4OX9B 1WZ2A 4F3CA 1ZRHA 5JD6A 3JZMA 3I61A 4FI3F 1XNJA 4YASA 2IY9A 1KBZA 2RB5A 5JLAA 4D2IA 1DRJA 1GZUA 2ZAGA 3DC2A 3LQ4A 1V3QE 2CY0A 1F3LA 1W4ZA 5ANRB 4NP6A 3F6RA 1M54A 4RZXA 4YC7A 3TJZA 4ZOLB 3H0KA 3ZZNA 1H0RA 4XWGA 4BFXA 1KNXA 3KUCA 5AJWA 4FDTA 3MA0A 5IJXA 5IT0A 5TE9A 2LE0A 1QVWA 1U8TA 5KJ1A 4KHPB 1B0ZA 4FUTA 3EVDA 4X7BA 3P2JA 3NVMB 4XVRA 1KP3A 1PYOA 5IS2A 2X13A 1TADA 2EZTA 1YS1X 2VWGA 3ANNA 3LBFA 3NB0A 1FUYB 2VH5R 2WYOA 3LQKA 4PPFA 4TTTS 5NLLA 1C41A 1IAQA 1RYFA 4UEOA 2LZ0A 1ZIOA 3K9BA 1J9GA 4D9IA 5AW7A 5K6RA 2ZTVA 4O2LA 4RD1A 4KH0A 4WBNB 2B8TA 4K9DA 5JZSA 3FNIA 1GGHA 3ROEA 5BNFA 3ZCPA 2VP5A 2PT9A 1C3XA 2JD2A 1IOLA 5HSGA 3DSRA 3IJ5A 3AVQA 3D7RA 5JTTA 1Q0QA 2B8WA 4N18A 5FOTA 3OM9A 3COYA 1WCIB 3GJ4A 3C85A 3DV9A 3C3YA 4MDYA 5CA1B 4U9IS 4MVJH 4YP6A 1Z0JA 1L7OA 2CDBA 2DY0A 2OT3B 1U3CA 1T5HX 3PP8A 5D1NA 4BPRA 3MWKA 4F2HA 2IZ7A 3JU3A 4OCZA 4ND8A 3IMKA 1DOHA 1YACA 2XGGA 4TV8A 1AF7A 3L0DA 5LB2A 3C1UA 3QG5A 3TUJC 5IRCD 5BN4A 1UWCA 2CT8A 3KOWA 5EMMA 6AT1A 3FPKA 1Y4SA 5HF6A 1WSBA 2HRCA 4Q0MA 3WQQA 3G9TA 1NR1A 3ER9A 5B57C 1ZGJA 1GPMA 4YREA 1G6Q1 2PANA 4RX1A 2OZPA 1LBQA 4PRKA 4DC0A 2WFAA 1E60A 2HF8A 3BCHA 1T4MA 4KBFA 5EIXA 5H81A 1EJ6A 4U7WA 1GLGA 3MTIA 2CB0A 3NTUA 2IUFA 2OQRA 2JPDA 1U02A 4K9PA 1KJIA 1NUHA 5MHTA 5BMVF 1R8QA 4CN9A 4HAVA 1PGQA 4PONA 3VZBA 1FNCA 5JAHA 1DTWA 3B8HA 3AZPA 1CT9A 2X58A 5E3IA 2OKGA 4B3XA 3QPCA 2PMCA 2ZETA 4R3NA 1BVUA 4HRXA 4OHKA 2BJHA 4WKOA 2GXQA 1FTGA 3Q98A 3NLLA 1OOEA 4K26A 1E6KA 5IUNC 1OLSB 1E69A 4Z3OA 1LDYA 2QRJA 1QH1B 3E9NA 3SFZA 2V7TA 2XH8A 1DUIA 5EVJA 3OLVA 3R5SA 5CH3A 3FMGA 2YYYA 4D80A 1YQDA 3UPTA 3PNYA 4MQ5A 2MSEB 4TL9A 5KQSA 4DTCA 1NKSA 1LU9A 2LKCA 1T36A 2Q3FA 1DWQA 2V59A 3BGSA 4F71A 4AQ7A 2Q1YA 4MA4A 4BFCA 2BYTA 4BNMA 5L8VA 2NU8B 3U17A 2GPYA 5BXYA 4KRYA 3L0IB 3OCUA 4H4CA 2M6LA 1JJFA 2H00A 3KXKA 1YQWA 4O8CA 4OP1A 1L7RA 2DHCA 2FOXA 1S4MA 2VBCA 3CNLA 3O94A 5CVEA 1E1DA 3S1AB 3ZDZB 4IIBA 2FPLA 5JZVA 1SKBA 1KI3A 3EPLA 5ADUS 1GGEA 4L3VA 3P4YA 2OV3A 1BE6A 1JLHA 2HCJB 1X70A 2Z2XA 3G3EA 4JD5A 5AHXA 5DXFA 1KARA 2C04A 3BHIA 4FFVA 5FPSA 1MW8X 4EG1A 5AM1A 1Z4JA 3I1FA 1GSHA 1XRJA 2YHIA 4L28A 4TQAA 5DMHA 4H3KB 4R1OA 2FHSA 4D4IA 1QHHB 1VDMA 3KSZO 4WUTA 4P93A 4EPTA 5IBQA 4CM9A 5ESXA 5F1PA 3B6JA 3TSCA 5DI3B 1Y8QA 3DAYA 2EW1A 3N2KA 3T34A 5CHEA 1CK4A 1QJ4A 1YNOA 1IDOA 3ED5A 3PVZA 1QLHA 1PDOA 4F2WA 4L1KA 3GFBA 1DC7A 1LJ8A 4G4JA 3HNOA 4JY7A 1EGQA 1R6VA 3HADA 5LYJA 4HLDA 5LZ4A 5I9SA 4RVCA 2WWGA 3VBEA 4GBGA 2I2WA 5BUZA 1CRQA 1TJ5A 3ND6A 1H4SA 2NTYC 3JVEA 3KJIA 2F7SA 2FW1A 3KYJB 1OX6A 2HN9A 1B73A 1XTPA 3JVDA 3OT5A 4H3HB 4OK6A 5ALUA 5FCDA 3LRPA 3Q0EA 1RC8A 3GAZA 3AZOA 4WJKB 1T9ZA 1NR7A 4ESVA 1IB0A 2JFGA 3RYIA 2EBWA 5FUBA 1N9KA 4B3CA 1PK8A 3IMGA 4CMIB 1KFJB 1R6BX 4TXHA 2W6CX 3W5HA 1XWWA 2C4VA 1X7YB 2ODNA 4PICA 1Q74A 3P8ZA 2HIAA 3NAMA 1ZSNA 1NP3A 1T0JB 2FLKA 3JQRA 2YQ5A 3RSOA 1FB5A 4OFZA 3UKDA 4QEDA 5GZ3A 3ND9A 3WRYC 4ZZ0A 1VJ0A 4FFMA 3EDYA 5FOXA 1VKJA 2BTQA 5MN5A 4TTQA 3ZHRA 4OQNA 5JDCA 3GGSA 3BD7A 5AXAA 3BMCB 1TM1E 4UNNA 1SA0B 2JAUA 4WCFC 4OHWA 5EC8A 1U28A 4BNIA 3KPYA 3LOPA 3U81A 2ZSIA 2RKBA 3DOUA 5FR2A 4Z7QB 3EJ6A 1UR5A 3BWBA 2O1XA 3H18A 4MUIA 3UW3A 4BP1A 1M1NB 1GIAA 1QDLB 4ZYVA 3G79A 1SXHA 1ZD5A 1ZXLA 2QN2A 1LF5A 3LC0A 3OAAD 4YT5A 2AKEA 4EYKA 1IQ0A 3PX7A 1D2GA 1MABB 1RLJA 3FN4A 4LHYA 4O2AB 5HK9A 1T26A 2J08A 1KWGA 4HB2A 2H1RA 1Z8DA 4CFYA 5KHOC 5CXUA 1Z0UA 2E55A 2IXEA 1NQ5A 2DYKA 2ZRNA 1FYFA 3IH5A 4K86A 1JH8A 2OXRA 1A9TA 5HK8A 1XL0A 1J0DA 1ORTA 2BF4A 3MS7A 4URVR 3AM3A 4BNVA 2BVNA 2VYND 1LPOA 3TRFA 2VJBA 2BHTA 2QTWB 2WZDA 5EXTA 1XA4A 3AEQB 1C9NA 4EFLA 2RFLA 2NSJA 2VPXA 2FJUA 2WAMA 4JXJA 4YI3A 1YFLA 1E2IA 1NI4B 1K88A 5JYBA 1KA9H 5KYUA 3IUPA 4PCAA 2HA4A 1NF2A 3PCTA 4LJ7A 2VJOA 3HBAA 1RWPA 3WLJA 4EDHA 1QF7A 3WGHA 4D1YA 5CDFE 3S8EA 4DE5A 3V7NA 1RM0A 1V7QA 3LXUX 4U39A 2VHEA 3E9ZA 1I6LA 2P9JA 1L0BA 3II6X 4GKJB 3JS5A 1XK7A 1YA4A 3DE2X 2IL1A 2RKOA 5TGZA 3N7TA 2GCOA 2BF7A 3O8NA 1DO2A 3JQFA 3EZ2A 3W5UA 1YQTA 1G5IA 1Z6XA 1EXVA 1LNZA 3K9GA 4KKVA 2BR5A 1PJAA 1OHHA 2IELA 2V45A 3W9BA 5KTOA 4WINA 4AZ0A 5FOQA 4U63A 3DDZX 2HU5A 4KPFC 3CF6R 4ZCTA 1G3QA 1OQAA 1Q15A 3QEOA 4REMA 4WE3A 1A72A 1EP2B 5BMVA 5C37A 1TQDA 2ZYIA 3PJEA 3FDIA 2XMRA 3HJCA 3Q10A 2KYRA 4J75A 5JFOA 1M2OA 3HN7A 1N8NA 3EBOA 3HV2A 3PGVA 2EHJA 1GYRA 1XMIA 2JA2A 4EKIA 1FNDA 2GAFA 3C24A 1AG9A 1A98A 5EJ8A 3W5CA 2IY7A 2DERA 2ZSDA 3HO6A 4AZTA 1JIKA 5K0GA 3ON5A 1P1FA 4O0LA 3ZHBA 4ZOQI 1N32B 1LTHR 1R0KA 2FSVC 1X38A 4QVKA 1U0BB 1PHRA 1L5MA 2WJZB 1RLTA 3MWDB 3P45A 4FEEA 4HAXA 5EQTA 3T3PB 4S24A 2P1ZA 2YRFA 4XSVA 4ZO6A 2X7HA 4TZTA 1Q1NA 3TB6A 4EABA 1ONSA 3R4VA 5LWHA 1OLXA 5J1TB 1C0IA 3DBLB 2Q1XA 3DNPA 3MPUA 4LZJA 4AKSA 1GU0A 5BSUA 1G9TA 3NORA 4HAZA 2DWUA 3GNTA 4BMZA 4ZO4A 2CLMB 3ZWBA 5I4BA 1NW9B 5J3JA 4ZYWA 4EH1A 5FBRB 2PGNA 3GNQA 1VL5A 1V6CA 13PKA 3KU1A 1NJ1A 4OFBA 1GSIA 5M7EA 2O3UA 1X1BA 3VAYA 3UGQA 5CB0A 3UJDA 1SZDA 5IXJA 1WCWA 4PNEA 3KZ1E 4PU0A 3Q9LA 3G2PA 1WAMA 4YCSA 3A2MA 3SHWA 4Y2YA 2B4YA 1NIJA 1RHMA 3UJ7A 4JNCA 3A27A 4B3JA 2GN6A 2QSJA 2AOWA 3KPJA 4BWGA 3VSBA 2FN8A 3C3KA 1PG0A 2YN2A 4F85A 2GZAA 2ATXA 1GPYA 1J8YF 2R8PA 3BJEA 3NRJA 4KQMA 3B1JA 4YNBA 3TIXB 2RARA 4Y6PA 2ZSEA 4KO2S 1LS6A 5FH9A 2A14A 3BMOB 1ZKMA 1UP6A 4B32A 2E82A 1NOIA 3VR4H 1UBRS 2Z83A 5CJ2A 4ALMA 3EGDA 3OJCA 4H7FA 4YPOA 1YI0A 1HO3A 2EYUA 4LY3A 4KQWA 2FETA 2Q0HA 1T6YA 2VNSA 4MR7A 3TLAA 1MO2A 3NHRA 2B35A 4G9GA 2G5GX 4Q1VA 4HWSA 4LYYA 5DF1A 3DL2A 1LDMA 1VIVA 4Q1FA 3L79A 4Y0VA 2QMYA 1T5LA 5AOAA 2VJKA 3JX9A 3VHXB 1UZLA 3E3MA 3IELA 2BGGA 3EAFA 2JH8A 1YDFA 3DO5A 3IIMA 1PR9A 2ICAA 2DUMA 2ZUWA 3MWEB 3L9WA 3SC3A 4KRFA 3WNZA 5DRYA 2OV2A 3ADBA 3ITKA 3PNPA 3BGDA 3LKBA 1CX9B 4J0KA 3KT0A 1S2NA 3ZI0A 4GDFA 4CTJA 4IF6A 1M3SA 1Y4AE 1F9AA 1XTIA 2P6NA 2XYQA 3VPAA 1XZLA 4EPYA 1VHWA 5DP1A 2J9FB 3VVLA 2B7CA 1D4ZA 1GA4A 4GGOA 3VHLB 4K05A 3WB0A 3M9XA 4QHTA 3HO8A 1OMOA 1R9NA 2A3NA 4M99A 4EYOA 5HIJA 4MB6A 2IUYA 2VZEA 3IPAA 1DBSA 3THXA 1KO5A 3DH0A 3HM2A 2BM1A 4I50F 5I45A 2E4XA 1P91A 2OG2A 2PUGA 2G28A 2OWEA 3AESB 5I6DA 2UUBB 4IX1A 3N6VA 4ZQCB 1PQPA 1JAXA 2FPPB 1O95C 2XVMA 1TPZA 5E2BA 3RUFA 1H4QA 3UBTA 4KYUA 1U3GA 1XDBA 4HV4A 1L6IA 1QJCA 2YV3A 3AHIA 2I1VB 3PL5A 4G84A 2GPNA 1PS9A 4KQJA 1WB9A 1PBNA 3NTRA 3LIPA 2FN3A 4KVZA 4B8WA 2R3SA 3R1IA 2AFHB 2VDKB 2J9RA 3GFSA 1J2RA 3B78A 3FCYA 3BERA 3M2TA 3MPOA 1JKXA 5SY9A 4NE2A 4XM1A 5DHQA 4WY2A 2C99A 2VRBA 2B1QA 3IPYA 3IQEA 1I51A 1PFUA 2W98A 1NONA 2B2XA 3PYXA 5H4GA 2GWRA 2OD9A 4NYMQ 3NHUA 2CCGA 1UBFA 4J0FA 4EUKA 4IWXA 5HGJA 1MAAA 2I03A 4MIOA 1ZNYA 2JI6A 1POXA 1Z33A 3MRVA 4AJ4A 4WLOA 1T9AA 3OO1A 3I92A 1ZMOA 4GZMA 2C0CA 4WMLA 1IXKA 1B00A 2IZ6A 4A2PA 2ECOA 3P9XA 4OK3A 2BEVA 5IM4A 3F47A 1J07A 1R00A 3TM5A 1Q6YA 4F6LA 1RKBA 2R7MA 2YZ2A 1T43A 1E1LA 2QD4A 3TL2A 3LPNA 1BS2A 3PNOA 2IHYA 2MSLA 3R9KA 4E5PA 4C06A 4MWTA 1KRXA 3CHYA 2EHDA 2IIBA 3IUJA 1K68A 1JXAA 4HLCA 3WMXA 5ADWA 1W8DA 2VTBA 1MNAA 2AMYA 4CU5A 3F4KA 3HHPA 2PBFA 3BCRA 1UXHA 5KOIA 3KLPX 2AQ8A 4D8TA 1CQXA 4XE5A 1X77A 1Z83A 3RHSA 2OHGA 3A9TA 4MWDA 5JU6A 2ZUTA 5IKEA 3R3UA 1B76A 3K0CC 3LRXA 3OEED 1JTFA 3OUUA 1LJLA 2CMHA 4JN6B 3TCNA 4AJ2A 4KPGA 4P3YA 1EUCA 5ICMA 1O6FA 5FWXA 1OTHA 4YV0A 5TS3A 2HGZA 4EKGA 1RAHA 1QONA 2AS0A 1X2EA 2HPHA 3VKUA 1JEEA 1UINA 2NM0A 4MO9A 4YRTA 1E0JA 4XWTA 4YRIA 3GGPA 5BVHA 4QGFA 3GDOA 2PN1A 1D9ZA 1ZM4A 4O59O 2DFKB 3E23A 4AWXA 1IVSA 3N2NA 4LDPA 3QU5A 1B8OA 1IE3A 4NZZA 4BX9A 4GMHA 1JE1A 3AF0A 4ZAWA 1XMQB 1Z2OX 1ZDMA 1JKMA 1UKBA 1YIAA 4I5DA 5AKZA 4IIXA 4U8HA 4UZSA 1CZRA 1F6WA 2MR6A 2OORA 3F46A 3PXEA 4JITA 5E0KB 3V8QA 1CY6A 1SR8A 3MOSA 4GR4A 1D6SA 2G4VA 2EQBA 2QUIA 4FFWA 4PYLA 2YUIA 3I2KA 1U7WA 4I5IA 3N7UA 3ZBQA 2BM8A 4PX9A 1J7KA 2FPGB 1GL6A 3GCZA 3DCJA 3QLUA 4LCEA 4F1KA 3KL4A 3OJOA 4XJVA 5K0LA 3T7RA 4D0SA 4C4XA 3G8AA 4AKTA 4IRMA 2HSZA 4UJ3A 4BBZA 3IQWA 3QYFA 5KNBH 2CFTA 4NZYA 4JFAA 2PT6A 1ZEJA 2CLKB 5ALTA 2R4QA 1QYXA 3BD6A 3GMSA 1U3WA 1UJ4A 1W46A 2PSSA 2V58A 3H9UA 4H15A 1JHYA 1I6WA 1GILA 2ES4A 4KQHA 4R3UC 1ZAKA 2GBFA 2H8GA 2XWQA 3UJ9A 4BRUA 5HQ3B 2AMFA 4DDUA 4CWAA 4M0LA 1X7WB 2OFFA 3I9LA 1V5EA 4R9VA 5C4IA 1KAOA 3Q7EA 4BVGA 2YFHA 1BKDR 4HGPA 1IZ7A 3K9LA 3L1IA 2QXTA 5KSPA 4DB4A 1RKUA 5FWDA 1RRPA 1CBUA 1NFRA 2PX5A 3RVRA 5LMNB 4XFDA 2ZUFA 2AG1A 2G6BA 2J8ZA 2QPOA 1CUJA 3G2HA 1QFYA 2FR8A 2V6BA 1AS0A 2YJZA 2Q27A 4LUCA 1S3GA 1I6MA 5KMGB 3ZWPA 4D45A 4EKNB 1IN5A 1US8B 1IDN1 2DPLA 3SBXA 4UTNA 3UA4A 1JTVA 3LTNC 2PGAA 2QVBA 4GECA 5F51A 2NXEA 4WH0A 2IU4A 4HYTA 1CUAA 2W6JA 4I50A 5EESA 2KE5A 3M6LA 4BDSA 4YRBA 5FA6A 5ILGA 8ATCA 3V9PA 4FIZA 2D3TA 1K5HA 1KEPA 1WU7A 4C2UA 1X42A 5AW5A 1RI3A 1A9QA 3PTZA 4KYIB 3B9PA 4NV0A 1TZKA 3H5AA 4JI6B 3S2IA 2VRCA 3E7WA 3S5UA 4QO7A 3BXHA 1C2YA 2CSXA 2JCGA 3S8YA 2JKZA 1KWKA 1O4VA 1GPH1 2FEOA 4LRQA 4F3RA 5H9WA 4C6RA 1GADO 5J40A 3K0FB 3RVKA 2VATA 1J5EB 5K6AA 4AMYA 1J4AA 4FOOA 3EGWA 3NDJA 4F6CA 3K6KA 1H2WA 2JGKA 4AW9A 2IRWA 3LE8A 3LM8A 4JP2A 4D74A 3W5DA 4JLKA 4P80A 1TL7C 2PVPA 2N47A 4COKA 4RJLA 5J5AA 1PUXA 2QZJA 1DHTA 4RQAA 2OCPA 2DXIA 2BEWB 4P2BA 3LFTA 2FXIA 2ZAMA 1TCUA 1ZAYA 1IN7A 2W48A 4DIOA 3CEAA 5CNIA 5H16A 5F1KA 3AUUA 3HWRA 4TLMB 2VF5X 2Z08A 3DDUA 1N3IA 2IXDA 3DLTA 1PL0A 3OFVA 3U6BA 6ADHA 1U90A 2BJWA 3ETEA 3Q7RA 3E8SA 3KSUA 1YJAA 4L73A 2WABA 5THQA 4WV3A 2Q6OA 3D3KA 3KQVA 3KR1A 2HTEA 3VR6D 1LW6E 2ZB4A 1SRQA 5GGYA 1V8PA 3CMCO 4EUFA 1ZJWA 3CF0A 2ZREA 1PP4A 3B53X 4QOFA 3ZZTA 2BFBB 3P2OA 1PWEA 2GVZC 1YAJA 3HKDB 4JAVC 4LEIA 4CMEA 3JQBA 1Z68A 1ULUA 4C0WA 4ZMSA 3FSGD 3CCCA 4QRHA 4BJ5A 3CTPA 4EW2A 3CLSC 5FUQA 3B1WA 1GKUB 1NMQA 2NXNA 3DMDA 2O5CA 3TW8A 1J2UA 4BUZA 3PXBA 3STUA 2ZRAA 1LRLA 3IHLA 3TO5A 2Z5VA 3IEUA 3YASA 3SZUA 1JMKC 3WLQA 4GP6A 4LXUA 4CCYA 3O4FA 1VGQA 2ZU0C 5HKLA 3HKEA 4V38A 5CVDA 4II7A 5HTKA 2BM9A 1WQ4A 3A4MA 3AZQA 4F86A 1M76A 1CJTC 4MP3A 2YINC 3E2MA 4MVJD 2O4CA 2VTDA 2X1VA 3KAPA 1GN9A 4QUBA 3T06B 3OMLA 3CPJB 3WIVA 1KL7A 4MLZA 2NACA 1LPMA 4CLEA 5HMMA 2PYZA 1VYHA 2OY0A 2LCFA 3NHSA 3KJXA 4XD2A 3IXQA 3DMNA 1TEXA 4QDJA 3R0ZA 1ULTA 1MO6A 1W75A 1VSQA 2PKWA 5EKDA 5JNLA 1NT4A 3FPCA 3JYHA 3DV2A 4ZALA 1PTJA 3QVGA 1TJYA 4H77A 5K01A 3A1FA 5B7QA 3GUYA 1MTZA 1M8GA 3KB2A 2GASA 5I7HA 3IC5A 4DYHA 1OWOA 3HJUA 3H6KA 2IW1A 4RANA 5HXAA 2F4VB 4MWSA 2JJYA 2VTVA 3H1TA 1PK9A 1V4VA 1V6AA 2GNPA 3PGA1 4MEAA 4MUYA 4OLFA 4UNSA 3JWEA 1Z37A 2OLJA 5IU6A 4NC9A 3C45A 5JZOA 2H3HA 4L02A 1QU2A 1YJ5A 2H2DA 3EXEA 1SIWA 1MZPA 1IXRC 1QK5A 1XOIA 3MRTA 1QV6A 3ES9A 4IHKA 3C6KA 5LZ8A 3VPHA 2QSUA 4HVAA 2RIRA 2V97A 3BKWA 4YRRA 4V1CI 2I34A 3E6AA 1JHDA 5BV0A 1L7AA 2JGAA 4ER5A 4PR3A 4YUZA 4BPBA 2GD6A 1YJXA 2FCRA 3AHDA 4KSYA 1AQNA 4AP6A 1CUCA 1T3GA 2QV0A 5KTKA 1UK6A 4OQFA 2JRCA 1C30B 3G0GA 4KMRA 5ITSA 3IQIX 2IUTA 3INTA 1O58A 3O47A 3VSCA 5IYZF 1N2BA 3QFHA 3BTVA 2P77A 4TWJA 1NW8A 3ONWA 4PY2A 1RDFA 1SD1A 4UAVA 3TXXA 1X9HA 3NTLA 4D3SA 4UNPA 4HDKB 1JHZA 2ECQA 3PQ3A 2W2LA 3DFKA 3ZGVA 3QXCA 1BE8A 9ATCA 2B3TA 4WZZA 4ND4A 1AOXA 2DBYA 3LG2A 5KYKA 5J2TB 3WGOA 1PFWA 3ZU6A 2ZROA 3TW6A 2HUPA 3U4AA 1UAAA 4GRDA 2WW8A 2FN9A 2VBFA 1BJRE 2JAXA 4I4CA 3AF5A 1MD9A 2ZTUA 4BKPA 1W4CA 4TXNA 1DOZA 2HBQA 5FHRA 3LUBA 3O7WA 2O3QA 3QWHA 1ZBDA 3T5AA 4RKFA 2UYCA 1XTUA 3HYLA 3LLSA 2DCUA 4OHMA 3OLQA 4DLTA 5BNTA 4MNTA 3STVA 4R51A 4YUYA 1XTVA 4OUDB 1J0BA 2IV7A 1FRVA 4TS3A 1Y7IA 2PUVA 1JL3A 6LDHA 4DN6A 5JUWA 1VE3A 3LO8A 3BN3A 3NTOA 5JVDB 2GA9A 4IZIA 4PTYA 4PE5B 3VYTB 2G83A 2XITA 3CZQA 3KJNA 4JR1A 1T8SA 3QE4A 4UUQA 4I5FA 1PSWA 5AD1A 4D3FA 1JYSA 4RWEA 4JI3B 4WECA 5HW0A 1X7HA 3QWFA 4XWYA 5LZ7A 2OA0A 1W34A 1N2OA 1NVBA 5BW4A 2D5LA 1SXGA 4H17A 4A27A 4X0EA 1SB9A 5DHUA 4NBSA 3ER8A 4CIVA 3IVCA 4TL6A 1P9LA 4KYTA 1RZRA 3G0CA 1MC4A 2C59A 2VAXA 3DGFC 3PUWA 2JIZD 2WJIA 4CZ2A 5G53C 3LK7A 4FSXA 3SSAA 1DJNA 4WNAA 2AG5A 1QPGA 1JG4A 2E4YA 3F3KA 4MULA 1E79A 4O4JB 1O9HA 4OU5A 2VP0A 3V4OA 2XNHA 3EVTA 5HKAA 3VNUA 2CL0X 3PQ7A 1KDOA 5EJIA 1KI1A 5WRFA 1HRDA 4PM4A 3QXJA 1BC5A 1ZH0A 5K0CA 4XEHA 3QFRA 5KYVA 5JWOA 1CQJA 4S1TA 2UAGA 1KAEA 3U3OA 1GV1A 4DZZA 5CDTA 1BQ4A 2G9UA 3HGTA 2UYGA 3FLMA 4M3NA 5AW3A 3WLEA 1Z0ZA 3NVAA 1KY5A 1LSUA 1N4AA 1DBQA 1T6NA 1R16A 2GTPA 3FA2A 4MAFA 4WGGA 3MWFA 1U0SY 4P3XA 4X45A 2PT7A 3P5BA 5DOVA 2ZFUA 1BG6A 3UKJA 1A77A 1QE0A 4S1WA 3OQNA 2AZTA 5EMNA 4NPHA 3B85A 4PLZA 4DCMA 5CDUA 3AR8A 4XWKA 2GJ8A 2BSAA 2Z57A 2VZ8A 3OX1A 2I8CA 2F9MA 1AV6A 1H65A 3ZGXA 2BTOA 3D8HA 2P0EA 4KMSA 4YCNA 1SCNE 1DB3A 1MUUA 3GZJA 3REQB 4CMKA 2FR1A 2UZ0A 5JPCA 1H94A 5BN3A 5DTIA 4LZWA 2QRKA 4I9HA 3ZUPA 4NCBA 1FNNA 1KMMA 3FVVA 2WIJA 4JENA 3A1NA 4JVMA 1QS0B 1GZSA 1N92A 2Q2NA 1GKLA 1JSZA 4V0RA 4US2R 1J21A 4MXDA 4A16A 1DDOA 2OK7A 2ZWIA 4TMFA 3U13A 2JFXA 2QMQA 1XXLA 4PZDA 4BTLA 5FPQA 1L9XA 1TZ2A 1XO1A 1TA9A 3EWIA 1IVYA 4X3CA 3P71T 1EVEA 3HY6A 4DDTA 4RENA 3EFEA 4MIYA 1RYZA 1UODA 2DLDA 5KREA 1WLYA 4S35A 4I8XA 4K9LA 4X8HA 1P1JA 1VI5A 2ZYDA 1IBCA 1E1CA 2A0FA 2E2WA 3AEUA 2QMHA 4CCSA 5ALVA 3RYHA 2R1ZA 2AX4A 1HG1A 2WI8A 1QAOA 3OKFA 4YMTA 4I9NA 4B48A 3IAUA 4YFYA 1TA4A 3REGA 3M49A 1TJPB 3CF2A 4MUMA 4LFBB 4YR7A 4O2RA 4ZT3A 2EX4A 2WWIA 4ZYXA 3ESCA 4XD7D 3OZSA 3HB9A 2XB4A 4RWZA 5LSAA 2X3FA 4BQRA 2NU6B 2P0AA 3BGVA 3SPXA 1TAQA 5CD1A 4OKIA 3KJFA 5TB5A 1TMOA 4MW9A 5DULA 1ONNA 1FFCA 3GZNA 3UV6A 1I4OA 4KVGA 1KAGA 1VBNA 3E9YA 2R48A 4GM4A 1AC5A 4LWOA 3TTXA 3Q9NA 1ZRMA 1RM5A 1JR3A 2E85A 1K5GA 1QLJA 4IWYA 4FOTA 4EEKA 3U4QA 3A6PC 3BMQB 4WBXC 2VF7A 3DFFA 4WEQA 3OH8A 4M55A 2HMTA 4EI9A 5AR1A 4A15A 3PB3A 5IYZA 1JHPA 4MHTA 2C2BA 1TCBA 2HAEA 1AKNA 2I9KA 3V7UA 2LVBA 4ZVLA 4R7TA 3H9CA 5JTUA 5C80A 5FQNA 3NBKA 1FMJA 4YDHB 4LVOA 5C8YB 4ITUA 2W2KA 1XP8A 2FYTA 4HDMB 1XZBA 4DRYA 2X40A 4R8LA 2I71A 4BLSA 1WXQA 3NZEA 1L5LA 5AHKA 4B7CA 5JS6A 3EDMA 2CF5A 1SU7A 4WUVA 1L5HA 4AJ1A 3EK2A 2WG1A 1LY1A 3GLVA 3NONA 4RQBA 5IAEA 1M2HA 3ELUA 3O1LA 3RT9A 5IK2D 4BQFA 1VKZA 5LA6A 4BNJA 4ER3A 2P4SA 3P0IA 2O8EA 4Q34A 1KMHB 3B1YA 2EQ5A 4DABA 2P69A 2D1FA 2WWTA 4OMFG 4URWR 2OESA 2OHOA 1I7QB 4IIHA 2A9KA 3HDHA 4JBYA 1ZMRA 1FA9A 1OKKD 1MO4A 2Q45A 3RJMA 4Z8YA 3ESYA 1ISMA 1K0FA 4DPLA 3AFGA 5FA5A 2DGDA 2GDJA 4KR0A 4P3NA 3ZZUA 2X2FA 5HCUA 4ZO7A 1SBYA 4HNAB 3M5WA 4XUGB 1ZM2A 1CUFA 4BZZA 5DCUA 1CF4A 3QWIA 3UN1A 1NM5C 4Y9DA 3JQEA 5LLSA 1WRBA 2L19A 3CNNA 1QG6A 3R9XB 2IUUA 3OCXA 1JFRA 1Z62A 2HNBA 3JAKB 3NYRA 3ZJ5A 3K0AA 3DF9A 2Y68A 1MLDA 4C88A 4QYWA 6GPBA 2H9IA 3PBKA 3UBMA 1PV2A 2WM8A 4C1NA 1E4EA 3NHZA 4M1OA 3ZDFA 1IJEA 5G1NA 3OEWA 1I14A 2F9FA 2HDOA 3HP7A 4RZ3A 3V1NA 4WA8A 1LLUA 2FPXA 3LYLA 4FMDB 4MLCA 4M21A 5LLDA 1JLSA 5F4ZA 1NY6A 2ZUVA 2X3YA 4IVQA 2HCRA 3JQ8A 1GDDA 2EV9A 4QULA 2BFWA 2H1WA 5GZ6A 1ZVVA 1RYMA 3I2JA 4Y8VA 2QAIA 2WYVA 1VZ2A 1NLMA 3OIWA 1AS2A 3GLUA 2JAOA 2ZR8A 2XMQA 1KK2A 2DQYA 1Z22A 2ZTMA 1U63A 4M1WA 3KS9A 3IIEA 2CXXA 4JA0A 1RWVA 4CCAA 5HNKA 3IJEB 2B9EA 1O96B 3RV3A 4CUKA 2HYIC 3H16A 1FXUA 4WDQA 1K98A 1ULBA 2C42A 1SBHA 2A1UB 2AH5A 1EDDA 4UHJA 2YZNA 1AK2A 1JQLB 1LBIA 1N2CE 2AN5A 2PRSA 2XWBF 4LTDA 4FEYA 2VNIA 2I7CA 3WGTA 2W4MA 1GAXA 3T0GA 2C3UA 5GGXA 1B0AA 4WJLA 5DHRA 2MTBA 4AX8A 2P2LA 2QX6A 1GT91 3NEJA 5HRCA 2PWAA 4AL4A 5HIKA 1TIPA 1UBJS 5G40A 1LH0A 1VL8A 2EFGA 3RVOA 2NU9B 1RKQA 3RC8A 3TI9A 1QFJA 3ZDYB 2OAQ1 4HQ6A 2G3YA 1EH5A 3ZBUA 4AK9A 4EQ6A 2HHJA 2YHAA 2W83A 4QM7A 1EVQA 1AGPA 2EG9A 3FR8A 5AW6A 1YQEA 1Z5GA 3GFOA 4MCAA 5EHNA 1Z4QA 3A1DA 3C3WA 3CRW1 4RVSA 5CPBA 1YDWA 3EF1A 1V71A 2AR7A 3SS8A 3D8NA 2IFTA 4WESB 4RK7A 4CMJA 1M74A 3E3NA 4IKEA 1K92A 1LI4A 2Z2KA 4HGQA 4EJSC 3OJFA 1GP2A 4UNIA 5DGDA 2E9SA 2NZ8A 4UM8B 3C7DB 1ESNA 1G4AE 3NIDB 5TEVA 1L8XA 1M7BA 3B38A 3ERCA 3BXZA 4XLTA 2JBHA 4I5EA 1QNLA 5EYPA 4V0NA 2QTAA 4RE5A 1W87A 3X0DA 5J4VA 3HVJA 3OU7A 2PU5A 4Q9IA 2B0CA 3I3SR 5AJYA 2L18A 5EJ6A 2J3LA 1FFGA 5DBOA 3V4ZA 4C08A 5JY6A 3ABIA 1N3BA 3CG0A 5DP2A 3CZCA 2PS1A 3ESRA 4G85A 3PFNA 1I4WA 4PO8A 5KTPA 1NPDA 1IOZA 4Q3BA 4L9RA 4DM3A 2OECA 2EZUA 5BQFA 1RD4A 2CLSA 3MXOA 3TZHA 4R2KA 3VHRA 4KXUA 1UJ6A 1Z0IA 3AFNA 3L18A 2A59A 3DOOA 3WL4A 5HZKA 3PA8A 3IFSA 5KI6A 4CGZA 2QX4A 4K5QA 4RCYA 5KJCA 1UM9B 2EWMA 1MQAA 1YBMA 1GKYA 1DBWA 1UBKS 2J87A 3G6WA 3RIYA 4YRJA 3U9TA 3LW8A 2BFDA 2JFPA 5ABPA 3CVYA 5FXMA 4X84A 3O8LA 1B15A 4J0QA 1IEXA 3EXFB 1G7TA 1FP7A 2ZRIA 5H68A 4DM4A 4ZTZB 4C7OA 1O8CA 5A3JA 3L8MA 1W85A 3EHDA 1L4BA 2QTMA 4ICIA 4CEJB 1E58A 2QGFA 1MX9A 3SSOA 1RXSA 2XNCA 4BLVA 3I04A 5CJJA 4JUIA 4HDOB 3DYBA 6NULA 2FUEA 1BVHA 4LXGA 3K53A 3WFJA 3AHHA 4DZTA 2D5CA 1SQSA 1J9ZA 4EF5A 9GPBA 2G25A 1NU6A 4ETNA 2OGTA 3I62A 4FGLA 1PGOA 1VB5A 3RG8A 3MERA 2O8BB 1HLGA 5JAZA 2V7QA 1T0PA 1XCGB 3GVCA 1J33A 4HSGA 4FE4A 3RNOA 4HKTA 2IEZA 4UTPA 5DGXA 4JKYA 1EM6A 1QYCA 1WHSB 3K09A 4RFLA 3H04A 3MAJA 3T94A 2RMKA 1A9XA 3BZBA 4TZ6A 3IDSA 3CWCA 3FLAA 3STHA 3GLFA 1SWVA 3T54A 3T3EA 1E5VA 3FTNA 4WK2B 4J1TA 5IM4F 3R7DA 4P38A 4TRMA 4O6VA 4EFMA 3K2EA 1U7XA 3CLUC 2EC5A 3EULA 1EFPB 2QQEA 1Z4NA 1ULSA 2FSUA 2EL7A 4MUHA 3FAKA 4CM4A 3GWGA 3H5LA 3I3OA 4B6GA 3J7AC 2BKEA 2E5WA 2VK8A 4EHAA 3FNHA 1N3LA 4HG2A 2BBTA 1UP4A 1SC4A 5E3HA 4I5GA 3TIFA 3OBBA 3ZXXA 2A5DA 1MT3A 4BMDA 4KFCA 3ROQA 4G6ZA 3FNBA 3O8OB 4M1EA 1A8SA 1SZJG 1MEOA 1YR2A 3PR1A 1U99A 4BO3A 2CBZA 3P97A 1CRZA 1NW4A 1YK0A 2Y1WA 3D3WB 4GOXA 1T34A 4EHIA 2O19A 3H87A 3AEYA 1LZKA 1G19A 4ZVVA 2ZB8A 3LHDA 1IN1A 4C0LA 3HI4A 2VNKA 2OP0A 4JBWA 3CLTC 4XDGA 2I0FA 3C5VA 2Q6KA 2BGWA 3EMKA 3TDNA 4OBXA 1FJ2A 1KY3A 4BMSA 1YCHA 2REQA 3ZE9A 3F0TA 1JHOA 2JAPA 3EE6A 4QQKA 5TPWA 3SF8A 3MZ0A 3BHMA 2YXBA 4X1OA 1KE1A 4MQMA 4EQZA 4TLLB 1GO2A 1G21B 3MJFA 3GLIA 2HJGA 5A2QA 2I87A 3EA5A 2IHJA 5DV9A 2D4HA 1SEVA 1QQ5A 1GNTA 1DKQA 3GJ6A 4PR0A 4WX2B 2ZUCA 3TN7A 5REQB 5FV4A 1O6CA 2C82A 1A9YA 2BMEA 3NX4A 3DJYA 3QUQA 4L8WB 1W1IA 1G7SA 1PT6A 1E8NA 2Y92A 4RY2A 4BGEA 1OH7A 3U0VA 5EHGA 4PGHA 4UUPA 3F3MA 2X15A 1CZNA 2ZWVA 2PKQP 2WB4A 2Y3IA 5JZMA 2C98A 3UOAB 2BKUA 5CFNA 3HC7A 2GM4A 3QI2A 1D4OA 3FCUB 1TT5B 3TFWA 2NP6A 3H0EA 1WDTA 5F7ZA 2CMFA 5JC1A 3O2SB 1K8RA 2AI3A 4ADSG 1LPBB 2P9QA 2PS3A 3CKLA 3QUSA 4LZPA 4NBLA 3VMMA 1PVOA 1EEHA 2V1UA 2D0OB 3CRMA 1IPHA 1O95D 3AETA 2CJYA 4EVRA 1KJ9A 1M1YE 1TZCA 4X3OA 1BCSB 1A1SA 1TUBB 2RJNA 1OUMA 1FDTA 4GXRA 1SUFA 2M98A 1KVSA 2AF4C 4YAIA 2VDWA 4L16A 3NHBA 2GBLA 4AYWA 2ODBA 4WKNA 3DVRX 5DBHX 3FCCA 2XEDA 4DQKA 3QY0A 3LCVB 4JI5B 2RHMA 3QPAA 2AI2A 4L9AA 4QUDA 4L07A 3V8PA 3NHJA 1SUSA 1YZKA 3L2OB 3QLVC 3DNMA 2G1UA 2OV4A 3HV0A 3GJ7A 4JASB 1NAIA 3UXEA 1QKKA 3PC2A 2UUCB 3E1GA 3F74A 3UMSA 3QVJA 3WIBA 2KB0A 4OEHA 4RY9A 3K96A 3T3MB 2HC9A 3G0BA 2ZSBA 1UKVY 2P91A 4E15A 2BBOA 2QRUA 2ZJAA 3R0JA 5BSTA 4O08A 3COJA 4URYR 4R7GA 3L8HA 3KETA 3UAZA 4RIGA 4IDQA 3LYUA 4Z51A 4H27A 2ZJ5A 2G7MC 1JLLA 4W5OA 5DNDA 2J5BA 3U7HB 1VE1A 1RYDA 2AMJA 4FFRA 1CDDA 1NI3A 4L0MA 3UYKA 3TGLA 4L27A 1E4VA 4E11A 5ADHA 2RGYA 1MXHA 2ASEA 2O2GA 4EITA 3RODA 3ZNOA 4HATA 2C2KA 4AZ3B 3P9NA 1TCAA 5K0SA 4GWGA 4R71A 4E1AA 3DLAA 3QLEA 3F71A 2JARA 4ZCSA 3R20A 4B9EA 2F8TA 1W88B 4NOMA 1JZQA 4A2WA 1Q1EA 2JH9A 2VSOA 2IYLD 1Q5PA 8LDHA 3K6SA 4QUHA 4BNKA 1KNQA 3BWDD 1EGVB 1GL9B 2X4IA 5ALRA 3ZX5A 1JVNA 1OT5A 1H5NA 4KO8A 4NMHA 3X1JA 2X5NA 1XTQA 5LCXA 1E1KA 4P2GA 4UU7A 2QW0X 1M2VA 1PCXA 3MG9A 2JIPA 4IF4A 4TOIA 4LDJA 3IVMA 3UJ8A 1M7GA 1B74A 1J06A 2EZ8A 3I28A 5EWMB 3TMYA 5K05A 2WEKA 1X9GA 3ZW9A 2Q3DA 2H11A 3L8GA 3JSAA 4WCDA 2Z1DA 1VCOA 2ZAOA 3C41J 1JKFA 4B74A 4CNQA 2EOAA 2OBFA 5KTMA 3C8UA 4V3BA 3UK7A 2WTEA 5H02A 3DCNA 1RWQA 3LXMA 2ZBEA 1GRNA 1MAHA 1SOWA 3SJCA 3WIEA 2F8MA 2FI1A 2SICE 3HXMA 4G4GA 4HWGA 1IJBA 3ZY6A 1DIAA 5D6NA 1NVDA 4P7KA 4X64B 3EB9A 4EZIA 2AG8A 3S7ZA 1MN6A 3GFRA 10MHA 4UVEA 4EY4A 4KQ2A 5A9TA 3FVRA 3NI2A 5JJKA 1CE8A 2JI7A 1PS8A 1ZOOA 3RK0A 3WMEA 2O3RA 4H7EA 3ZUGA 3F5MA 4LVUA 4ZGGA 2CUKA 1PF7E 1H4TA 3K1AB 4HUQA 4MIKA 3EQ7A 3CMMA 3HCFA 1NRWA 2GLUA 5FLXA 1WXIA 2QKYA 5AVYA 2PNFA 3PKIA 4TL7A 2I2CA 3MYRA 3ZY3A 3ZJTA 4F7WA 2UYHA 1JALA 4YFVA 4E94A 5EJ5A 3EQ6A 2VQEB 1QIJA 3GUHA 3H75A 4L4ZA 4UOEA 2OLEA 3GVXA 1PNVA 1MPXA 3EZFA 5TDHA 4WWHA 2W43A 5TT0A 2XUZA 3B70A 5B2EA 2XE6A 2ANCA 4DLWA 1E63A 2BGUA 2P2DA 5KZMB 5E1DA 2ONJA 3I32A 7YASA 2BBWA 2X8JB 2H4WA 1F5NA 3T3GA 4TQ9A 1DAIA 4ZOLF 4N8SA 5BNWA 1NZFA 2C97A 1CZKA 1D2CA 3A9RA 4LDAA 5IAGA 2FW7A 5M34A 1R0CA 1SIBE 4CLOA 1Y89A 1YJQA 1UCFA 2XE7A 1G1MA 2P6RA 1C3OA 4J16A 1EDOA 2CJPA 4GXQA 1I30A 4RJIA 1XDZA 2K5UA 3ILSA 4G8JA 3PHGA 4G1CA 4NVRA 3FTEA 3UJBA 1YR1A 2B9VA 5DNUA 1G7RA 4PEVA 1HF3A 3FI9A 2W6QA 4RTNA 4ZC1A 3LJKA 4C0QC 4KXFB 2ZS9A 5H8WA 4LBVA 4UBLA 1C8BA 5F1YA 2JIDA 1KVTA 4WBNF 1F2TA 2P7HA 4MS1A 2HLNA 4B4UA 3F8SA 4A82A 4QXRA 4JJKA 3O83A 3ACDA 5CMLA 4RPKA 3FTFA 1R9MA 4QBKA 3EISA 4WI1A 1TFUA 2WWFA 3MF4A 2D1RA 1QQ6A 4EBFA 4EGAA 3Q41A 2ZYGA 5CA1F 1RRGA 1NJ5A 1VA4A 3SZLA 3HU1A 3OTOB 1RC0A 1O5TA 4UCXA 1XCLA 4PANA 5JR3A 3OAAA 2M1XA 1P2VA 2MSWA 3IAEA 3OWHA 3ZH2A 3V42A 4QFDA 1Q12A 2HK7A 4BEWA 2BHNA 3GPCA 4R9UC 1KI4A 2F48A 4HRYA 5J5CA 4UEWA 3LECA 4HC4A 3OIDA 1YSCA 2QIOA 4KXVA 2C5GA 3EZNA 4PRYA 2Z9BA 5IFLA 1PFQA 1QHEA 2HA2A 2ORVA 4DSAA 2B1JA 2P2NA 2HPVA 3TOCA 3R7LA 5FYDA 1JE0A 1ZR4A 2HBRA 1AHPA 2O8DA 4B3SB 2JLRA 2VIIA 1TAHA 2GGSA 2VYNA 3WGMA 1OSNA 2PO7A 1CR1A 3EY4A 3QEBZ 4WL0A 4XRRA 1JKJA 2UV8A 4CM8B 1WB6A 2GJAA 3LSYA 1CUSA 1PE0A 4X1IA 3SR0A 1PU2A 4E09A 4WCVA 1KEEB 1VLHA 3I05A 2VPTA 2XYHA 3FCXA 3L6UA 2E5LB 1DFHA 2ZRDA 2Y9MB 5AICA 2HSEA 2ZSJA 3WWPA 2QRNA 4ZT5A 3UG7A 1ORIA 1BKYA 1ELOA 1ONOA 2JAHA 1TYDE 2TMDA 4MW4A 5EUQB 5IJ0B 4XM0A 2WF5A 1AHIA 2PZLA 3C3JA 4QPPA 3TD2A 1QCYA 1YRQA 1WPQA 2YY7A 3NBXX 2P7IA 1XX6A 5FADA 1K6XA 5DOZA 1H5UA 1SH7A 1ZINA 4ZVUA 3VTFA 3VTAA 5I7FA 1TO2E 3EBPA 1OPXA 1Q3HA 1WVGA 3N9IA 5DCLA 2OHIA 1DADA 1YL5A 4QJ5A 3NKLA 1PJBA 2VRWA 3OMXA 4DR1B 1AKRA 1QIFA 2VK1A 1VMKA 1LWOA 2LWIA 1CC1S 5BSEA 1C3VA 4W9MC 3I0NA 4ZVTA 1YAHA 2ZYWX 4O1MA 5JXWA 4RF5A 1XLTA 3RF6A 4KR2A 1J00A 1F0YA 1BA2A 3G7UA 5EAIA 3S2SA 4KQCA 3SD7A 5C7YA 1JR4A 2O6HA 1M6HA 1ODCA 1YH3A 2P2GA 3EY9A 3I0ZA 1R8SA 1E3JA 1YONA 3CB2A 2WNHA 4G5FA 4K6OA 3R7WB 2PY6A 4GR5A 3ZLUA 3TBKA 7MDHA 3R8FA 4V0MA 3KTAB 3ACCA 4GO1A 3PUZA 2R4UA 1GNSA 2FDCA 1DX4A 5KNLA 2IIPA 3OG9A 2V6GA 3CZ4A 3C14C 2YMLA 4TMZA 3CRZA 1ZH8A 4XGNA 3SNKA 3F49S 3HG7A 1WDKA 4BP3A 4M6WA 4Y9UA 5FD8A 3KB1A 3W2TA 1R74A 1DE0A 1WOMA 2O3SA 4FB5A 4H7JA 1URPA 4NDNE 5LL6P 1LK5A 4J2TA 2A1IA 5L4NA 4U7JA 1YZHA 3LTEA 1G41A 4I46A 2FFAA 1UK9A 2X0NA 3MFYA 3HFRA 3IERA 1HG0A 4HI0E 4MDHA 3OWXA 4D9FA 4RLHA 3TEFA 4LN1A 1L5RA 2X1LA 4AN1A 5FNVB 1GZ6A 5DM4A 1UJMA 1HDIA 2VKQA 5AK3A 6ABPA 4ED9A 4RHYA 1TCCA 1IEQA 4I1PA 2JAQA 1ZGCA 1IN8A 2OCBA 2R6DA 2YXPX 4PTZA 5DNCA 5JWRA 5D6OA 3FCOA 3FXAA 3IBTA 1YFKA 3BAZA 1GPJA 3I09A 3VU3A 3OTGA 5FDFA 2IE8A 3ONFA 3E03A 4HDAA 4AUKA 3R7FA 5D86A 4LFCB 4ZOLA 5G2OA 3T4EA 2PZFA 2IPOA 5ARBA 4Y2SA 2VZ0A 1A76A 1VJGA 1QDUA 2F9LA 2SCUB 3WLOA 1E8DA 4HQLA 2GEBA 3UWDA 1UMCB 3NT2A 1RI2A 2GBPA 1W2GA 4J9VA 1N6LA 1T1RA 3AONB 3LF1A 1QZ3A 4BB5A 3RH0A 3WXMA 3NU1A 4CL8A 6YASA 3S2ZA 4LCBA 3UV3A 4TWRA 2Q21A 5E9WA 4MVJI 4ES6A 5A04A 1V7CA 3AT1A 3OOJA 2ZEJA 4EY5A 4FB4A 5BRNA 2VCEA 1XYGA 1ZD8A 3O3OB 4HRVA 4WZAB 3HWSA 3SFVA 3LY5A 5DW0A 3OCYA 1GITA 3U09A 2BKXA 5BRAA 2O8CB 1ENPA 4BZXA 2GBCA 3U37A 4UOZA 3CG4A 3HVIA 1HDOA 4O33A 4HWPA 2FVXA 2Z8YM 3EH2A 5F5LA 1I3CA 1O5IA 4O2AF 4EY7A 4J1NA 3A04A 4ZT2A 5ULLA 3WP0A 3PQ4A 4LZNA 1SEPA 3I23A 2XD4A 3SYKA 1OGIA 1WCIA 2FEAA 2V7XA 2EF0A 2QDKA 1P4RA 2GNAA 5CA1A 4FFNA 1YOVA 4E3WA 2H57A 3HXQA 4K3UA 2PQ2A 3G9QA 2EERA 3N2ZB 3BB4A 4MUXA 4LW8A 4WNCA 1UL1X 4UASA 2IEGA 3JD2A 4IYJA 5CLLA 3AUKA 3ZNQA 4D8XA 3TSOA 1YZQA 1F0PA 1FLVA 1QG0A 4NS1A 1T8WA 1CXZA 4RO0A 3C4JA 2G1AA 3LQFA 3SGLA 1PNQA 2PS0A 3VZDA 3VYSB 2VH2A 3DT9A 3KJZA 3WMGA 4DPKA 3QW4B 3ROPA 4DLLA 3COVA 1TUIA 1XBTA 2D4AA 1K6EA 1W6UA 1E20A 4J2HA 1BS1A 2DBQA 3CPSA 5AXBA 2XJ9A 4UOQA 3LQRA 5GQSA 3N86A 3I2YX 3SZOA 3UT6A 2QMUA 3CZAA 4D82A 3ORFA 3IRVA 5THKA 1CIPA 2Y2UA 1FDIA 2Q5FA 3EXHC 4OXYA 4OQXA 4RTPA 2WFLB 1QHGA 5EKXA 4V2UA 3UK2A 4A0HA 4RORA 1X2BA 5JCJD 1YZFA 4OA5A 2VH1A 1E2PA 1E64A 3K1TA 2VR1A 1HNZB 2WD8A 1K97A 1TNDA 3NCTA 5JXIA 4B9AA 5IH7A 3MC1A 3AR6A 2HBYA 4TYQA 3BM5A 1LX7A 1KDTA 2Z8ZA 1F60A 2WSBA 4ZAYA 3LCJA 2IOQA 1GG2A 2IS1A 2XDAA 1W49A 2JLCA 2Q6IA 5AJZA 3PC8C 5FHQA 4X8LA 2EKBA 5E95A 4DLXA 4FLMA 4HDRB 4LISA 3OLCX 3MQ2A 1OLSA 2J6BA 4Q02A 3WMRA 3R23A 1TF2A 4Z9AA 1FYXA 1N0WA 4XI9A 4U9HS 3MTJA 2H5LA 2XDQA 2IDZA 3GJZA 3EVFA 3DEYX 1GTVA 1IZ9A 3JTMA 2VK4A 1RXWA 2XYGA 3IR7A 2P2SA 2A4MA 1EX9A 2DQZA 4W9NC 1T5OA 5E7JA 4B47A 5T64A 4DLNA 5L7TA 1PNRA 4AS2A 3H2JA 4V39A 1TVKB 3WDMA 2Y1CA 1QIKA 4JJZA 1O4WA 4PZ9A 4UQPA 2ZRGA 2NQ2C 3PS9A 4MV0A 1JS1X 1PSZA 3ZLBA 1S0UA 3TD6A 3KD2A 2V65A 2WKPA 3W90A 2HHHB 2Z0MA 1UH5A 2MOKA 1I3KA 3SHQA 5GONB 2ZB2A 1SHUX 3IA7A 4K7JA 5C3UA 1UK8A 3DOIA 2FKAA 3DDCA 1PDVA 4RY0A 3L0SA 1YQUA 3QTTA 3OEEA 5E2IA 3WRXC 4A23A 3ZYZA 4DJAA 1OY1A 1KF0A 3DMHA 3L0CA 1Q77A 4G0MA 4NKRA 5IVPA 1FOEB 3RIXA 2QTVB 2DEUA 3PLAE 1EA5A 2JGDA 3EA0A 1KO1A 2Q28A 1UUFA 3LWNA 3R6GA 3VR1A 4D8WA 2FQQA 3OO0A 1ISJA 1TF5A 3LUFA 4G1VA 4MVJF 3DDWA 1EK5A 3INNA 3BWVA 1WZUA 8AT1A 1E2EA 1QORA 2Q1TA 2X5JO 3T4UA 4V0SA 1EFHA 1OC4A 3L8ZA 4HGRA 3EIOA 3SC6A 2OCAA 3AILA 3D81A 4FR0A 1OXKB 3AJ8A 4KDFA 2PSHA 2ZG6A 4P84A 3TIGA 2AC7A 4ZCMA 1KC3A 1P6XA 1YBHA 2W37A 1DCMA 2J45A 2YN4A 4ZOCA 5K2MA 1V3TA 1U94A 3LY7A 3WO1A 3WI7A 1MX3A 4TLCA 1E9SA 4D81A 4TLAA 1E2JA 4PXAA 3HGQA 3I01A 4PQFA 3VPSA 2ZE7A 3B3GA 1LFAA 1PVVA 2IKSA 4PAGA 1SCDA 3WJ7A 4H35A 2QM3A 4Z6KA 3WYAA 4CMHA 1T3HA 3OE1A 1X13A 1BE1A 1QGZA 3G68A 4RSRA 3TNDA 3MJCA 4CMIA 3HU2A 4MV3A 4ZCRA 2RGRA 1X7YA 3NTXA 3TL6A 3V3KA 4FYJA 1PEYA 4GH5A 2GCIA 4CKZA 3RI3A 5ITZB 5P21A 3RUAA 4ATNA 4N5NA 2C4MA 1T4CB 4GKBA 3BIXA 1G8SA 3BXPA 4M46A 4F45A 4RAOA 1H4VB 2AK3A 1MCZA 3EYWA 2XKKA 4LXQA 4NYIQ 2P4QA 1AKVA 5CA0B 1B0UA 4ACBA 1SA0A 4X8OA 5CM2Z 4XM2A 4Q24A 3WFIA 4GPTA 2DCMA 3ZEAA 4HAOA 4AF8A 4U00A 5DYTA 2N46A 1W94A 3G5TA 1UPCA 1UKCA 1E2BA 2JHAA 3AY3A 1YXMA 1FUUA 4IDCA 4IGIA 2X1HA 4BU1A 4UQLA 4FCCA 2XW6A 1QLWA 3Q3CA 2WVAA 5IX8A 1ORDA 4O2AA 2V3CC 1XJ0A 4PS1A 1AVTA 3UJCA 3VGJA 4YRZA 1E2LA 3NNDA 3ADKA 2VHCA 4DEVA 5HYVA 3VJKA 3ZLVA 5JXGA 2XXJA 3PFFA 3PD1A 1QIIA 2IBTA 3NV7A 5I7RA 4D8VA 3L4BC 2DUWA 3ZIUA 3OHSX 4DSUA 4A1OA 4IW3B 2FEXA 2SBTA 3JCZA 1W7AA 4MTCA 1CEXA 4J9UE 4Q4HA 4ONEA 3AI2A 3S2UA 1KAHA 4NJMA 4LY6A 3NR2A 3Q8MA 4DB2A 4RVFA 3WQSB 4Y2VA 3EN0A 3GAFA 3K20A 1YJ8A 3GG9A 4D99A 5BYAA 5I7AA 4CFSA 3IKMB 3L1HA 2FP4B 1H6BA 3CZRA 5DYIA 5KYXB 4IUBS 1QQAA 4NENB 3TKAA 1OFHA 3AR9A 1JJVA 5CW2A 1G60A 4KI7A 5F35A 4E33A 4G01B 5AM4A 1M1XB 1N5OX 3E82A 1C4XA 3M4NA 4IMPA 5KTRA 1IUKA 3KKEA 1GN8A 3RUPA 3O74A 5B1DA 4GBJA 2JLQA 1F8UA 2C9MA 4LS3A 3E9MA 5ECGC 5C34B 1J49A 3PNKA 3RKUA 3TI7A 1I3MA 1IXZA 1Y5NA 2R7LA 4QARA 2WYWA 5ESRA 1EFRD 2PRZA 5D5HA 1L5YA 3BH0A 3VKFA 4UFPA 1GFSA 3TKYA 3EA4A 3HUEA 4EY8A 4DMGA 1YC2A 1EB9A 1SPXA 2C7GA 2QIPA 3QHQA 2ODEA 1SVWA 2UVPB 5FOUA 2BISA 5TLSA 2WC1A 4PSDA 3ENKA 3CEPB 4Q01A 5FEMA 3BFVA 4A0SA 3UXHA 5KC9A 2QG9A 2VP9A 3FPHA 1BWSA 1T1IA 2R0QC 1R10A 3L6CA 3VJLA 4LYJA 1EZ4A 2PIDA 3B60A 2HQ1A 4KSBA 5I3ZA 4E31A 1K3UB 3LWBA 3A0UA 5TX7A 2JJ2D 2H3EA 4AXBA 3H9JA 4N65A 3V3TA 2GEFA 3OC6A 1JAZA 3VUEA 2Z1MA 3KHKA 4WFJA 3L07A 3MWDA 5EIWA 2BDEA 2B5VA 2FSIA 3IOCA 3VR6A 4Z4EA 4NMLA 3RFFA 2VHVA 5SYMA 2PKXA 4R0MA 5HZHA 4UC0A 3E7PA 2NYVA 1U5AA 4L5JA 1WMEA 2FSSA 3E3AA 3TX2A 3DBLA 3QSYA 4QEKA 4JB2A 4NRDA 1BH6A 3HVKA 4REQA 3B3JA 2X7XA 2XT6A 5CIYA 3FSGA 2ZT8A 4CIBA 4DMMA 1DHRA 2IGTA 3FFXA 2CEKA 1KI2A 4LC1A 1WV0A 3MNFA 3F7NA 1FU7A 4I4TB 1VIAA 3M34A 3O5AA 3MAAC 3A4TA 4A0QA 1JW9B 5EGSA 2WTXA 3Q6NA 2NTJA 2A88A 3KD3A 2AF3C 4DV5B 4UUAA 4FCTA 3OQHA 4ZIRA 4RZIA 1DAFA 3ULKA 1Z7YA 1ADGA 4HFJA 2FZ4A 3P26A 1SOUA 1XD9A 2QAGC 1G20E 4F11A 1DKNA 1P5FA 1CULC 2ORED 1D09A 4MH0R 3KUKA 3H13A 3QVTA 2C7PA 3T7SA 4MP8A 1H3NA 4M1ZA 3RBXA 3PFBA 3DEZA 3L7OA 2GN4A 1EX1A 2QI9C 3ET4A 4M36A 4O1HA 4QHYA 4AJ9A 3V80A 3IAS1 3PG5A 1ADJA 1BJTA 5ALGA 3JPWA 1X87A 1XHLA 3BMOA 4S0ZA 3QZUA 2NPOA 5FTJA 1JHVA 4YQEA 1AKTA 1JU9A 4WXMA 4DBLE 3WLHA 3OQMA 4Z2AA 4B75A 2E1PA 1LW7A 2C9YA 2LKDA 5CDFA 1DCFA 1Z0FA 2HY7A 2PWPA 4EFNA 4GMKA 3QNMA 3BA1A 3KC2A 3T41A 3TLYA 1X8LA 3D1JA 5CNKA 1OXMA 2BELA 1MOQA 1WF6A 4I1RA 4R2HA 4YMUA 3C3XA 4HDNB 1N2HA 1EQ2A 3K35A 3PUVA 1KYVA 3F4BA 1UKEA 2QORA 1XL1A 3PXCX 1EDZA 2G08A 4FKMA 4LYGA 5DTQA 4TMWA 3VHXA 1PZFA 2NZUG 1VC2A 2Q4BA 1CU1A 3MWEA 3RTEA 2J07A 2W2NA 2YWRA 4JP3A 3RKRA 3RM3A 3IP7A 1ECGA 1NXPA 1GTG1 1NW7A 2XUQA 3AOGA 4KQFA 1H0HA 2JGJA 4MQUA 3PSAA 4JT8A 1Z8NA 1Q0RA 5HUJA 4GZ5A 1QP4A 5E0OA 3TZBA 2J9FA 3H2KA 1V2HE 4DV4B 3BXFA 3MWGA 2HM7A 2VSYA 2MR5A 2HSDA 1OZ0A 1RRVA 3WWOA 4MRSA 3X1KA 5AVXA 4RZ2A 1P19A 1RJ9B 3L06A 2Z3VA 3HYNA 3QBJA 1NVTA 4NFSA 2XVZA 4YMWA 3BL5A 4HX5A 1T9GR 2PGLA 4BJ6A 4D9MA 5LP1A 4QVIA 4K1LA 4LMBA 2Y6VA 2PAAA 2YWJA 4B4VA 1BYIA 4DR3B 4AUNA 4MSUA 3AESA 5LMUB 4QAJA 4W7HA 4PWYA 4URFA 1SCUA 1WR8A 4U7GA 2ZWMA 2KM1A 4OLBA 4FHCA 4QEZA 2VTKA 2J5RA 3Q0TA 1MRSA 2FPPA 2PMBA 3CY6A 3AY6A 3L0ZA 3G5LA 1ZC4A 1QHIA 4BBAA 4GI3A 1BMDA 3AI7A 3V7YA 1YKFA 1P4GA 3TG2A 3WYCA 5D3QA 2A92A 1S02A 3O4HA 1ZIYA 3K9FC 1D1SA 4BEJA <