4HZGA

Structure of haloalkane dehalogenase dhaa from rhodococcus rhodochrous
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hzgA00
5IVHA 2C0PA 3ZLUA 4H7FA 3DL7A 3DKRA 2IX9A 2HU7A 1QIFA 3G9ZA 4X90A 4DTCA 5AJHA 4YASA 3I1YA 2QS9A 2GBFA 3BDVA 4Q1VA 1LNSA 3KWFA 5AKZA 1BCSA 1MU0A 1E8DA 1GKKA 3VVLA 2HRRA 2Y6UA 1CUDA 2RI6A 4PSUA 5LZ4A 4OPMA 1FSSA 4OB6A 5LZ9A 2Y1KA 5ALNA 5HF9A 4Y2PA 3OG9A 4BCBA 2WLSA 5E2IA 3ZI7A 5HF5A 2Q0XA 2BUBA 5AKHA 3H19A 5IH7A 1YB6A 1EDDA 5JANA 1JMYA 5I7UA 5CT6A 4J0HA 2G5PA 1QIJA 3O4GA 1XQXA 4BE9A 1QO9A 1GPKA 3WMRA 5AK5A 2OQIA 4AX4A 2WQZA 1CUCA 2DFPA 3OC0A 1VZ3A 4B9AA 4ZRDA 3FAKA 3WL7A 4YX9A 3WKAA 2HFKA 4HXEB 4XWGA 4ZV7A 4XX1A 1ODCA 5FKJA 4G4JA 3FOBA 3QM1A 4FKBA 2DR0A 4QEKA 1IZ8A 2I3DA 3QMWA 1UK8A 5BWCA 3G02A 4WDRA 1F0NA 1EX9A 4H7DA 4MQMA 1FFBA 1THGA 1YR2A 4N8EA 4QDTA 3O4JA 1MO2A 4UHFA 5CXXA 3KWJA 2H7CA 1U4NA 4U2FA 2WM2A 4KRYA 1R9MA 2YH2A 1R9NA 4BATA 3W9UA 4W1QA 4QZVA 1HL7A 5AI9A 2X8BA 3QPCA 4U2GA 4A5SA 1XLUA 3FVTA 1CUZA 1DX4A 4H7KA 2V97A 2GBGA 1JJBA 2VATA 2OG1A 3FSGD 1USWA 4U2BA 2C58A 1GXSA 4LYEA 2HRQA 3BJMA 2WIJA 2H1IA 1U8EA 1GPNA 3V48A 4MYSA 4TVKA 4ZREA 1IUOA 3QH4A 3O4IA 3C6YA 1UK7A 4YK7A 3WL5A 3C5WP 3DOIA 3IDAA 4OUKX 3EF3A 5AKXA 4OYLA 5EGNA 2E3JA 2I3ZA 3H04A 1DQYA 4DYHA 3ZPXA 4FLFA 1ETHA 5ALOA 5AK6A 5ALGA 2Z5GA 3IUNA 2HA5A 1TCCA 4C6HA 3WJ1A 4Y9SA 3WL8A 3WIBA 1LPSA 1MNAA 3WA6A 4KE6A 3L1HA 3N0TA 1UK6A 3GBSA 4GW3A 3D59A 3A2NA 4LYDA 4Y2UA 3SK0A 4CG3A 4DNPA 3D2AA 1VLQA 2Y6VA 1OCEA 4V2IA 1UKCA 5EHZA 2PSFA 2XQJA 5I9IA 4BRZA 4KACA 2PUHA 4EZIA 3EQ8A 5AI6A 1XZGA 5C8XA 3LCRA 1ISPA 4GDMA 5LKAA 3TRDA 1VOTA 3DLTA 1ZOIA 5ALWA 2H9YA 4J7AA 3LLCA 2OQVA 1YS1X 2NW6A 3QPAA 3HJUA 3CCCA 4DMHA 2ACKA 4E15A 4BC0A 1HPLA 5HFAA 5ALSA 3RKSA 2VAVA 3DL4A 2WG0A 2JGLA 1P0PA 2FJPA 1CR6A 4DMFA 5AK3A 1YS2X 2XMRA 1TQHA 4MJ3A 5ALKA 2G4LA 4UUQA 1DTEA 1MX1A 3IB3A 4WY5A 3G9TA 4BVLA 2XUQA 1O6GA 2OCGA 1VXOA 3R40A 5HQ3A 3VKFA 1PFQA 2DHEA 3IUJA 3RM3A 5SYNA 5YASA 3PE6A 3EBLA 3AZPA 5DYTA 2XQFA 1W6RA 1EB8A 2AXEA 3OPMA 3CCBA 5T4EA 3TGLA 1THTA 3B5EA 5C8ZA 4PQEA 4BDSA 3ICWA 2RONA 2XQKA 2WU3A 3R3YA 5EHNA 2XUFA 3KXPA 3H1BA 2XMCA 3S2ZA 3PDCA 2B4KA 2VJBA 4G8CA 1LZLA 3C70A 2VSQA 2P8SA 1VKHA 1P0IA 2D0DA 3I2JA 3MUOA 4J3JA 2HM7A 3ILSA 1AC5A 2XQIA 4Y2VA 5AKKA 4BZZA 2ZVDA 5ALTA 1MPXA 3WYNA 4MQLA 1JU3A 4L72A 1MJ5A 3BXPA 1F8UA 4P9NA 1LPOA 1G5FA 2OCKA 5JALA 1UT6A 1XZAA 4QE3A 3FVRA 5IVIA 7YASA 1CUUA 5T4BA 4BZWA 5JADA 4WCVA 2RHTA 5JD6A 1DINA 5T4HA 4HTAA 4JNCA 1LPNA 2PL5A 2DQYA 2JF0A 3E0XA 5JARA 5D3ZA 1MT3A 3PICA 4C88A 1B41A 4NMWA 1XZFA 1ZJ5A 2ZYSA 2IITA 2XMQA 1XRNA 2V9ZA 3FWHA 3Q8WA 4HVTA 1DQZA 2VEOA 1VJ5A 4EB0A 1U2EA 4G8DA 4EY6A 3AZOA 2J4CA 2WHPB 4FOLA 5JAUA 1QIKA 2OCLA 2X5XA 4C4YA 4Q82A 4IH4A 4BVKA 4BTVA 3WK8A 1SOMA 5E4TA 1N5RA 3WK6A 5ALUA 4ITVA 1VE7A 5HZGA 1BE0A 2QZPA 3W04A 2OPHA 3FCXA 1J2EA 3PFCA 1ZIXA 3ZLVA 5ALXA 2WJ6A 5FPQA 1E8MA 1ZI9A 4CCYB 3BDIA 3C8DA 3IVMA 3R3ZA 1MNQA 4KR0A 1EK1A 1XQYA 3AIMA 4HAIA 1ODTC 2WUEA 2R8BA 4CCYA 1WM1A 2GYWA 5K3FB 4UBNA 4IHAA 4X85A 4Q3OA 3RARA 4Q3LA 2VJCA 4X00A 1TAHA 3QZUA 2QT9A 2VTVA 3AUKA 1JT2A 3BF8A 1QIDA 2HADA 1UOPA 3T4UA 4P92A 2BFNA 2QJWA 5JAOA 3M83A 2HIHA 1QIEA 4UFPA 3DQZA 3F67A 3W05A 2BAGA 1QO7A 1SC9A 1A88A 4LIPD 1UZAA 3WJ2A 2XUHA 4CIBA 1DWPA 2WFLB 1FFDA 3B12A 3V1LA 5JZSA 1WOMA 4N8DA 1MX9A 1EH5A 2AJBA 4X6XA 1CPYA 4PF1A 4JYMA 4BC1A 5JATA 2HA2A 3WKBA 3QYJA 1ZIYA 5ALMA 3C6ZA 1WPRA 2YYSA 3LP5A 5K3FA 2JGMA 3DEAA 4GWLA 5DTIA 1G42A 3AZQA 1F0PA 2WFZA 1X2BA 4M0EA 3I6YA 4FMPA 5AKIA 4L0CA 1W1IA 4QLOA 2WUGA 5HCUA 1C4XA 4C4XA 5H3HA 3EIOA 4N5IX 1X2EA 3FNBA 3QMVA 4NS4A 1DU4A 1Q0ZA 2ZYHA 4WJLA 1NU6A 2XMZA 2WKWA 4X94A 5HFNA 4EY7A 3WK4A 1UK9A 2J3DA 4B7ZA 4Y2TA 1AGYA 2XUIA 3JW8A 2WU4A 5ESRA 3FYTA 4LXHA 3BWXA 2WHRA 1IMJA 1LBSA 4J0KA 4QDUA 4Y2RA 4G8BA 1GPLA 4JH0A 1EI9A 4MWSA 4ZWNA 4P93A 1IUNA 4FFVA 5D7BA 4FLMA 4JUIA 5HF8A 4LXGA 1TRHA 4K6KA 3OTQA 4OU4A 4X7BA 4WY8A 1DWQA 4BBZA 3BE8A 4J0DA 3ICVA 1BROA 4IQ4A 4F60A 4MWTA 5DYYA 3NGMA 2V98A 3AILA 3IUMA 2XUPA 4C87A 4UBLA 1VA5A 2ORYA 4ROTA 1KEZA 4ARBA 4OB8A 3E3AA 5C81A 4X93A 2W6CX 2WILA 1QIHA 1JU4A 1LPPA 5AKJA 3IBTA 1ZD3A 1CVLA 2QMQA 1H22A 1CUHA 2H7XA 4M0FA 1J1IA 3R3XA 4BAZA 2XLBA 2QUAA 4EUSA 1TKRA 4QA9A 3PF8A 4X92A 4FFWA 4AMZA 2CEKA 3AIOA 4DMCA 3STTA 4CFSA 4AQDA 2C4HA 2HA6A 5JZ9A 5JAPA 4U2EA 3STXA 3H2KA 3FYUB 5CH5A 2EDAA 3Q0TA 4K2AA 1PV1A 1CUYA 1QFSA 3I1IA 4ETWA 2ACEA 4HZGA 3HXKA 4BP9A 4FWBA 4DGQA 3HACA 1Q83A 3K2IA 3WKDA 4PO3X 2FUKA 5F4ZA 1XRMA 3I28A 1WB5A 2XMDA 5JASA 2C5GA 1R50A 5E4YA 3O0DA 1FFAA 5DLPA 1YA8A 4RE5A 3ESAA 3STUA 4KAAA 1QGED 3HZOA 1H2WA 4I19A 2EEPA 3AINA 3FLBA 3WWEA 5LZ5A 2WTNA 1ZI6A 1XROA 1DX6A 3YASA 4UHDA 2G63A 4OD0A 4CG2A 4L9AA 3NOXA 1L7AA 3VVMA 1EK2A 3M82A 5K3AA 4B9EA 1YA4A 2YASA 1IUPA 5EI5A 4AZ3A 3H2HA 5ALRA 5A62A 1CFJA 3FSGA 4XVCA 3VJLA 5SYMA 3UUFA 2WG2A 3A2LA 5CTAA 4BRSA 2C5FA 3C45A 1Y7IA 4NZZA 3EQ9A 4Q34A 5JAHA 5LYYA 1OILA 4I3FA 5K3BA 2OGZA 4BYMA 1E66A 3ESBA 5CXUA 3H17A 4DLNA 5A71A 3QMMA 3QPDA 4FBMA 2DHDA 1YASA 2WJ4A 4AO6A 4UBJA 5JD4A 2VT7A 5EFZA 1ZGCA 3OM8A 1C7IA 2LIPA 2BKLA 1MTZA 1XQVA 2R11A 4KRXA 1E89A 2PBLA 4BCCA 2QVBA 1J07A 4DNFA 2XUOA 1GQRA 2WTMA 4EHBA 2RAUA 2OGTA 1Y7HA 4PW0A 1Y37A 2XMSA 3IUQA 5JIBA 1EHYA 3BIXA 4U2DA 4C89A 3HI4A 4AXBA 1A8QA 5ISMA 5ALQA 3CXUA 1UOQA 1Q0RA 1AZWA 2PVSA 3A70A 2RIPA 3KOOA 4Q05A 3O9MA 3DJYA 1CUXA 4G4IA 1K4YA 2AJLI 3V9AA 3DDUA 3OOSA 3H2IA 5CH3A 1UKAA 1LPAB 1QTIA 3HSSA 2WHQA 3DCNA 3WWDA 3GFFA 4YPVA 1NX9A 1KU6A 2O2GA 3R41A 2O7VA 1BCRA 1GKLA 4BB0A 1CUAA 3M3DA 1VE6A 4QDZA 1EVQA 1BN7A 4TPKA 3FBWA 1ZD5A 2QUBA 1WHSA 4BVJA 1HLGA 1QIIA 1HQDA 3NUZA 1O6FA 1BEEA 4IH1A 4MXDA 1FJ2A 1XZBA 3C43A 2PSJA 2PU7A 1QFMA 1XZLA 4BAGA 5JZBA 1TIBA 1TK3A 1GQSA 2O7RA 2G5TA 1CUFA 4QDXA 3VJMA 4OYYA 5EIAA 4RPCA 4F0JA 2QXUA 3G0DA 2BUCA 5FP0A 4B0OA 2J4FA 4B85A 2RGUA 2D5LA 3HRHA 5LZ8A 1XLVA 3IIIA 3FCYA 2K2QB 2XB6A 4GECA 3TJMA 3STWA 1QIGA 3F98A 1SFRA 2WJ3A 4RNCA 5DNWA 3L1JA 2O2IA 4BTLA 2HU8A 1XRQA 2XI4A 1DT3A 3WWCA 1EVEA 4X3CA 3GROA 3SX4A 3T52A 5HKBA 1QTRA 3V1KA 3H18A 2JGIA 4INZA 3HC7A 1W52X 2WFMA 3UUEA 5FXMA 3R0VA 3O95A 5AH0A 2ZJ7A 3DYIA 3D0KA 4PSDA 2PM8A 5FUMA 4B82A 2JEYA 3WA7A 3D7RA 1I6WA 1ZD2P 2QM0A 2OAEA 5K3DA 1GZ7A 1SCKA 4G9GA 1ZICA 1MN6A 2VJAA 3STYA 1B6GA 1J06A 1N8SA 3HYSA 4UBMA 1XQWA 1VZ2A 1CUWA 2WUDA 4K6GA 5ALJA 3K6KA 5AK4A 1LPBB 4A16A 1EINA 5ALLA 3FYUC 5K3CA 1AQLA 5AOCA 2XUGA 2YXPX 2JGJA 4BE4A 5AKYA 2AJDA 2PU5A 2ZSIA 3G9XA 3G0GA 1YB7A 2DCMA 5JD5A 4Z49A 1BN6A 1P0MA 4G1FA 1W76A 3R3VA 2WFLA 5JYCA 1TCBA 5EIEA 4AB1A 2XUAA 4UHBA 5A2GA 2XUJA 2BUAA 1DWOA 5BOVA 3S8YA 3SWWA 4AN1A 4W1RA 4AZ0A 4XIIA 4Y2JA 3UMJA 2BGRA 3B3QA 3OURA 4D9JA 4GLBA 1L7QA 2CUTA 1G66A 3WK9A 4B81A 4FLEA 2WIGA 3I6MA 2HA7A 1QONA 1L7RA 1GGVA 3SC2A 3WYDA 4C4ZA 4RE6A 1ZGBA 3RK4A 1CUBA 5FRDA 3LIPA 5KWJA 3BIWA 5KBYA 1BEZA 3GELA 3PI6A 1IVYA 4EA6A 1BRTA 1Z68A 3WWPA 1TCAA 1UOOA 1FFEA 4X91A 4ZV9A 5LIPA 5BWBA 4GXNA 5I8PA 2HU5A 3CN9A 1ORVA 1UXOA 3HEAA 1FFCA 2QJRA 5EHQA 4EBBA 4UBOA 5CH8A 3ZWQA 1UKBA 2Z8XA 4UFOA 3R3UA 5HQ3B 4HRXA 4B83A 2ZSHA 3HABA 1CQZA 1R88A 3JYHA 3WWOA 2GYVA 4WFJA 3LS2A 3JWEA 5AICA 4K5QA 3MGAA 2QKYA 2GZSA 5IKXA 4IH9A 3LIIA 4DMKA 4J0CA 4Y2SA 4BP8A 1M33A 4ZGBA 2XUKA 1XKTA 4W9RA 3E1GA 2B20A 4JEIA 3FYUA 5CRIA 3STVA 1JJIA 1QE3A 2WSLA 4J0IA 1U65A 4L3WA 4UBKA 2VF2A 3C8HA 1EDEA 4E46A 5CURA 1IZ7A 3QBJA 1CUGA 2XE4A 2BCEA 1VA4A 2OXEA 3C6XA 3WL6A 4X95A 1ZD4A 2HL6A 2PKYX 2AJCA 1QOZA 3GZJA 3WKEA 4BCDA 4UHHA 4W1SA 4BDTA 5LZ7A 1XZIA 3ED1A 4EY8A 4DSAA 1S8OA 2V96A 3I2HA 1MX5A 2Z8ZA 1XRLA 3G8YA 5E4JA 2I78A 1AX9A 5AI0A 3AFIA 2HHAA 4WFIA 4J0JA 4DNQA 4OB7A 2VAXA 2HFJA 4E11A 5AM4A 3H0CA 2QRUA 3D2BA 1CEXA 1K8QA 4FNGA 2JGEA 4N8SA 5LKRA 1LLFA 4CI9A 2QR5A 2Y2VA 4KEAA 3CN7A 4QNNA 3NWOA 5AM3A 3KSRA 4H18A 4B84A 3I2FA 2GZRA 4QWWA 3VJKA 5ALEA 4DM7A 4Y2QA 3DNMA 4PV7A 2GBIA 4KYVA 1BS9A 5CMLA 3WZMA 4E14A 2CJPA 3DS8A 2BGNA 2HA0A 3P2MA 3U0VA 1A8SA 1BU8A 1DT5A 5FLKA 4K6HA 2OCIA 1YCDA 5DYWA 1N5MA 2VT6A 2JBWA 4AO7A 2PPLA 5DNVA 5FDFA 3WK7A 4M0MA 4B0PA 2ZJFA 1H2XA 2EDCA 2XUDA 2FJ0A 3WLAA 1W75A 4MEBA 3A6ZA 4AN0A 3F97A 1QIMA 4PNZA 1JI3A 3EQ7A 3A2MA 4G9EA 1E5TA 5AIAA 2HA3A 1W4LA 1AURA 5AM2A 4HXFB 3DKKA 3IA2A 2ECFA 2Z3WA 4B6GA 4HRYA 4KJXA 2ZYIA 2WIDA 3ESDA 2JEZA 1JFRA 3BF7A 5AOAA 5CT8A 4KAFA 3C5VA 1Q84A 4PSCA 1AKNA 5A7FA 2CB9A 5AM1A 5C8VA 1K63A 5LP1A 1RYYA 2JGFA 1LGYA 1A7UA 4KE8A 2B9VA 1XKLA 4UHEA 5HKAA 1ZI8A 4G4GA 1QJ4A 5LZ2A 2UZ0A 4HXGA 4DIUA 1WCYA 1R3DA 5AOBA 5ALHA 3I2GA 1XZKA 4UBIA 1WPXA 1ACLA 4Y2YA 2IIVA 3KD2A 5LLSA 1CUJA 3IULA 5K5EA 3W2TA 1CUEA 3D2CA 1YAJA 3FLEA 1MAAA 3E4DA 4FDMA 3H1AA 2QTBA 3WIOA 1LPMA 5K3EA 2VJDA 1K5PA 3V1MA 3ANSA 5AI8A 2O2HA 1R4ZA 4GBGA 5D6OA 5ALPA 2XT0A 3QVMA 1XZEA 4HS9A 1EDBA 5BV7A 1JJFA 3W06A 5AM5A 2ES4A 1UFOA 5HF6A 4U2CA 4H77A 1K6EA 2WIFA 3MUNA 1CRLA 1XLWA 3W9BA 5CW2A 5ALYA 3VXKA 3D4LA 1ACJA 3IURA 4H7EA 1AMNA 5DNUA 2J3QA 1SCQA 3BJRA 3X3HA 1JKMA 5AHXA 4EY5A 1R1DA 4JYPA 1YAHA 2GBCA 1H2ZA 4UHCA 6YASA 4A23A 5T4FA 1RWQA 1MAHA 3PUHA 2CBGA 4RGYA 5DWDA 4MYDA 2CKMA 2X76A 4LKOA 2PSHA 4FNMA 4CCWA 5ALDA 2BJHA 2JGKA 5EHXA 3H2JA 4EY4A 3DYVA 1HKHA 4QLAA 5ALFA 1F6WA 1G4HA 4AMYA 4ZI5A 4I4CA 4OSEA 1CUSA 3G9UA 2ZYRA 5AKGA 5ALVA 5FPPA 2HA4A 4F5ZA 4MEAA 1QLWA 5J3JA 3ZLTA 1EB9A 4WFKA 3O4HA 3V1NA 2JIDA 4LHEA 2B61A 1T4MA 3G7NA 3M81A 4W1PA 1XZJA 2GYUA 1HDEA 1XRRA 4G5XA 4X6UA 3KDAA 5AKLA 2PSEA 4P08A 5DJ5A 1XZHA 3O9VA 1LZKA 4X6YA 4CIAA 4KE7A 1WB6A 3WI7A 2WUFA 5C7YA 4KE9A 2I03A 4AO8A 4H7IA 4QDOA 2C7BA 4XJVA 1XZDA 4C01A 2C0QA 1C7JA 1E8NA 3DD5A 3WK5A 5AI5A 2PX6A 3ANTA 4J0GA 5IVDA 5AKEA 2AJ8A 1EXWA 4BAUA 4GHWA 5A7GA 3H2GA 3GA7A 4F21A 2ZJ6A 1SCIA 5HK9A 5CT9A 5CT5A 3D3NA 1XFDA 3D5EA 3N2ZB 1CQWA 4Q3KA 2CZQA 4S0XA 1GT6A 3F96A 1CUIA 1P0QA 1D07A 1ODSA 2XQGA 3GUUA 1UWCA 2OLEA 4UPDA 4UFNA 3DOHA 3WQHA 2OGSA 3AIKA 1KU0A 1CUVA 2PUJA 4DSZA 3I2IA 2WG1A 3WKCA 3ESCA 4QWMA 5HK8A 4FTWA 3G0CA 1AUOA 4ARAA 1ORWA 1HBJA 4CG1A 5D3KA 3VDXA 3TEJA 2XMGA 2Z3ZA 4N5HX 5KWIA 4FBLA 5ALZA 2OAGA 2DQZA 5CBKA 4FHZA 2WHPA 2XMBA 4TGLA 1ZJ4A 5EIHA 3L1IA 3BL8A 3WZLA 5ALIA 1WB4A 5CT4A 4ZXFA 5DTJA 4GEGA 2DSNA 2HDWA 4H7HA 4B80A 5AO9A 3I2KA 5IVKA 2QOEA 1H23A 1OXMA 4Y2XA 5A7HA 1PJAA 2QXTA 3VISA 2PSDA 3G0BA 2WIKA 3MVEA 2VQ6A 5FV4A 1N1MA 3PF9A 1XZMA 2ONCA 4H35A 3K9BA 1WHTA 3AJAA 4J03A 5KREA 2RHWA 2XLCA 4NVRA 5AM0A 4OCZA 3PUIA 1H2YA 4WDQA 3ZV7A 5AP9A 1A8UA 2W22A 1XZCA 1RP1A 3QITA 2XDWA 3F9CA 1X70A 2DHCA 3C87A 5AI4A 1YSCA 5FOQA 1E3QA 1JMKC 2H7YA 1CV2A 4H7JA 1NU8A 1VXRA 4W63A 3PFBA 2ROQA 1EA5A 3F8SA 4LXIA 2CMFA 1XRPA 1LBTA 1CIJA 4O08A 3C6BA 2Y2UA 2VA9A 4OU5A 3HLKA 5AIBA 1T2NA 4X71A 3RLIA 4GI1A 3I6ZA 3FLAA 1QZ3A 3G0IA 4Y7DA 4KAJA 4H0CA 5A6VA 4X97A 4DNOA 4IO0A 2FX5A 1CLEA 3U1TA 3R3WA
chains in the Genus database with same CATH superfamily
2AI3A 3ZLUA 3GUVA 3UH1A 4HB3A 2P27A 1ZONA 3P9PA 4NAUA 5AJVB 2QVXX 2JLSA 1A8PA 1NXWA 3P96A 5KO2A 3DL7A 4XGNA 4Z1MA 3LXMA 3A0UA 2R3SA 1D2NA 3VPSA 2IX9A 4Y30A 4DLSA 2GJ8A 4JY7A 3TVYA 3JQEA 4PTYA 3QG5A 3CF0A 1D6JA 2DPMA 1NHGA 1T91A 3KKQA 1G2IA 5FORA 5AJHA 2Y0BA 4QDKA 3WMFA 4DTCA 5C7OO 2C1EA 1XIVA 3I1YA 4KTTE 3OJFA 4I9HA 2EWVA 1WZUA 3FUTA 3TG8A 1KA9H 3KUCA 3T0GA 1JVBA 3OZVA 1P4HA 1TM1E 4Y9RA 4F72A 2BHLA 4HDNA 5BN1A 3O38A 5CDUA 1Q1ZA 3WGMA 2RKWA 1H8ED 4AYWA 3RIXA 2CNNA 2WF7A 1EAYA 1PEAA 3U80A 3OT4A 4IDAA 1IY9A 3F5MA 1ZSYA 2GPBA 3LQQA 1CUDA 4G0NA 3TNFA 2V59A 4CHTA 4KBYA 1QUEA 4PSUA 3AESB 1USVA 1W0KA 1W44A 2B2CA 3OHSX 4MKFA 4BQOA 3ZLBA 8AT1A 5GJBA 3B51X 5CR9A 4OB6A 1WP9A 1XEXB 4I3GA 4UCXA 1MDBA 4UKDA 3RSZA 5LZ9A 1SXGA 4X8LA 5HF9A 3GMSA 3PD7A 4Y2PA 2QRKA 4BCBA 1PZMA 2Y4OA 2AI2A 4Z9BA 3H4MA 4FT2A 1J0EA 1UXKA 2Q0XA 4QOSA 2J9RA 3Q7PA 5FHRA 5AKHA 1FX0B 4TOIA 2QRZA 1E94E 3H19A 3U44B 3S8EA 4JUFA 2FF5A 1O96B 1DIOB 1LX6A 1TMGE 3MWDB 3AF4A 4RCZA 4MW5A 1T0HB 1UMDA 1XN4A 3I9JA 2ZATA 3FKSA 4FYIA 1U1EA 3MPUA 1JMYA 2OHIA 3PUZA 4F91B 5JANA 2ERYA 4J0HA 1QIJA 4W5RA 4ARVA 1XQXA 4G5OA 2IYQA 2P65A 4LPSA 3FDZA 3GFSA 2JK0A 4NJEA 4BE9A 4MITA 1Z3IX 2PZEA 5DYGA 5ER9A 4UMFA 4DZZA 3USZA 4JVMA 5EERA 3NBKA 1PFUA 2V1XA 1OBHA 2AFIE 3QOWA 4IFEA 2OQIA 4R1TA 4L1KA 4BN0A 2WQ7A 2WQZA 4HAOA 4JITA 2GXQA 3ZG6A 3OC0A 3GRVA 1PSDA 4B5LA 1F60A 4TMTA 4U7PB 3E18A 2EKBA 1DFIA 4YV2A 2IS4A 2QPTA 1YGYA 4ARIA 2ZYVX 3UT0A 4KC0A 2O5RA 4H4EA 1XHLA 4BMXA 3GD5A 3PL1A 4Q9HA 1R4MB 1ZAKA 3WKAA 4A2CA 1BD4A 2HFKA 4TTAA 4BASA 1MZVA 4HXEB 1C0IA 2P5SA 1WUKS 2VZLA 3U3RA 3KR2A 4MR7A 4XLLA 4XX1A 3L92A 4ZTBA 3I62A 1OAOC 2EFEB 2HGZA 2PGXA 1XTSA 3ZI4A 4URUR 3GGJA 3ER6A 3IQHX 3FOBA 1VDMA 4G85A 4QEKA 1WQ3A 1PCXA 3GDHA 1E5XA 4YCMA 3E3NA 3OQ1A 3RV4A 1LA2A 1E2JA 3PUVA 3H1PA 1EIZA 2WKPA 5B1SA 4HH3C 1EX9A 5I4BA 1R66A 1Z62A 3AF1A 1XJWA 1ABFA 3F7NA 3ZS9A 1THGA 3QXXA 1YR2A 2N0SA 1Z5UA 1IULA 1VDZA 1PT5A 2IYEA 2VRBA 3ENQA 4OF4A 1EZ4A 4NR0A 1YMUA 3ULKA 1KYTA 3LC2O 5IT5A 2Q7DA 2EZUA 1AS3A 4HDMB 1GPUA 2Q45A 4LTMA 3B52X 4HOYA 3RT1A 2ZSJA 2PRKA 4JJEA 1EFRD 3RYFA 5LL6P 2JH9A 3HCDA 3NU1A 4DLBA 4HLQB 2WM2A 2Z6QA 4O2LA 1FA9A 3C3CA 1OWLA 4ZOAA 2M6LA 2FOLA 1GNLA 4KJZA 2FXVA 5CYPA 2GB4A 5KJ6A 3O31A 2YHIB 1NKVA 3LYAA 1HL7A 2X8BA 1JDTA 4MV0A 5FUQA 1MF7A 4YDQA 2OV2A 5J4HA 3PNKA 3AHCA 1AQ6A 1T2UA 2ZBQA 4I1RA 4U2GA 5LQJA 4JB0A 4HGYA 1I24A 1X38A 5C1IA 5K2MA 4XVUA 1W0CA 4JKIA 1TYEB 1DVRA 3DDSA 1GM5A 1SCAA 4RDIA 2H65A 1E60A 1T8WA 2QD2A 1M1XB 1E9AA 1NW4A 4F3NA 3PG5A 4TXLA 3VR4D 5F9FA 3ND6A 3KR0A 4U2BA 2Z0MA 1V5FA 1GXSA 3CJQA 4LYEA 1QCCA 3K05A 5F7ZA 1ONBA 3RUDA 1R37A 1V7CA 5TGTA 2NVUA 2VA8A 3BJMA 4BKMA 4OH1A 4I55B 3HB9A 1U8EA 1GPNA 3V48A 3AJ9A 4PQFA 4MYSA 3OPQA 3TQFA 5A03A 4ZREA 1MAVA 5BN4A 3DDNA 3TSOA 2RHCA 1GG9A 1UBMS 2V6JA 3QH4A 4FHGA 2KQUA 2DX7A 4IEEA 1UJNA 5A3RA 2JGDB 3PTAA 4JVOA 4KO3S 1UK7A 2ODTX 3MGCA 1INLA 3DV9A 5L3ZA 3WGGA 4G81A 1NZFA 3L0DA 5DGIA 4EB3A 4NBKA 5BNWA 1QH9A 1QS0B 1RM3A 4OYLA 2WE8A 1EVIA 2XYHA 2DQ4A 2I3ZA 3H04A 4ZDWA 3AX6A 3ZPXA 5F7XA 4ZI3A 3M3PA 2NQTA 3GHHA 3ZDFA 1JLKA 2WJIA 1X1EA 1MEEA 4ZANA 2G25A 1Y9ZA 5ALGA 1LJ8A 1SNYA 3MG9A 4B6OA 3I1FA 1XQ6A 4EYGA 5CVTA 2YIJA 2QVGA 2XTZA 2BGTA 1YJCA 3IUNA 3PUWA 4L08A 4NE7A 1GL9B 3C85A 3LO5A 4BO6A 3U56A 2IHZA 1UXJA 1MV8A 1UXIA 5JCJA 4P4NA 3EZXA 3HBMA 3CNLA 1IJBA 3GGGA 3OLWA 4TLDA 4BB5A 4N0DA 1N6KA 1I5EA 1Z25A 2V4MA 1DEKA 3WLLA 4FJ2A 4DKXA 5EZYA 3ILXA 4HGQA 4IXNA 2UKDA 1PNQA 1ZK3A 4YCAA 4WBSA 5IP5A 4KE6A 4B0OA 2ISSD 3VUFA 3TRKA 3ADCA 4YO8A 3RSQA 1L1RA 1UK6A 2DY1A 1OC4A 2XNJA 5CJ2A 4EIWA 3DZIA 4AURA 4BMVA 4U7WA 3DHVA 2PLAA 4LDPA 1VYHA 3WGIA 3EPJA 3SX0A 1CEQA 3CYFA 2ZRFA 3JWGA 3OO0A 2XOKA 3B2EA 5K9ZA 1AB6A 5HPYB 3TX2A 5EWJA 3RYIB 1DKOA 4RGVA 2EJWA 3P5BA 3O0TA 3UK2A 3QBDA 5TPZD 3FCSB 2FMHA 2QRLA 3JD1A 2JEOA 4OJTA 4OM8A 2W93A 1CTQA 4L4YA 4ZVTA 2L18A 1ZXLA 1KDTA 4UEQA 5CU7A 2C2GA 3FHOA 4KQHA 4D8XA 4L9WA 1HDGO 1RWKA 1D2GA 1RXIA 1Z2DA 4QBGB 2EHDA 1WD5A 2WZBA 1ADJA 3EQ8A 1R0ZA 4FMBB 4CKEB 4E5NA 3GEPA 1GKYA 3GT3A 1RJFA 3D2LA 4HRAA 4PZDA 1KIAA 3ES9A 2QNBA 2XA2A 4R41A 2FMUA 4ZOEA 4EHDA 2JLUA 2JFZA 3H99A 5T64A 4KFRA 3OD1A 1QB8A 3RKUA 4EB6A 3VHLB 4CI0B 5ADUS 3U6KA 4GDMA 1F20A 1XHFA 3SQXA 4UNPA 1V4BA 2GKSA 5LKAA 5LMCA 5BRJA 4RBNA 4NJOA 4G0ZA 2I2DA 2GJ9A 4YRCA 3JQFA 2MSWA 1Y3IA 1FVOA 1P4SA 2H9YA 2JD1A 1YVUA 3KP1A 1U9ZA 2X13A 3E2MA 2SECE 2G1KA 3LLCA 4IIGA 4P4UA 4G24A 1SUSA 1ZGAA 1PL0A 3SC2B 4CF6A 1YS1X 3QPAA 4Q1FA 3CCCA 2P3QA 2OVFA 1RXVA 4B17A 3JWPA 3IT0A 3RABA 5JO9A 5AW9A 5JISA 1PZEA 3VC1A 2C98A 4OQDA 5BYAA 3OE5A 2OHVA 4D3SA 4E15A 1EVKA 1HPLA 1TTHA 2NVOA 5EEHA 1M1UA 4U3JB 3QVOA 5HFAA 4BNUA 3P9QA 1NBWB 2GSDA 3HN7A 5H02A 4RH3A 4Z8XA 1JFLA 4DJAA 1P8JA 2FJPA 4P1ZA 4P7JA 3T61A 3V33A 3WXMA 1VHWA 2NO9A 1AMUA 1FU4A 2MCFA 3WV5A 1AM4D 1HQKA 4M76B 4NYJR 1GUFA 2XMRA 4WKOA 3RK1A 3T7AA 3GJYA 4M8NE 4FFLA 5KHAA 5EIBD 5HJ7A 1XNRB 3H2BA 4M9SA 2ZCUA 4EDHA 3P2JA 4OK5A 1NG1A 4RANA 1YS9A 1XDDA 1E5DA 1RXUA 4DQDA 1OZFA 2C9MA 4JKOA 3H97A 1VE5A 1NY5A 3FDIA 1Y4ZA 3N8DA 4FFOA 1Q17A 4BLPA 1ULUA 2VH5R 2HD4A 4C6SA 3FX2A 4RD0A 4RORA 1JDJA 2XUQA 4JT9A 1IWOA 1Q95A 2DP4E 4CCSA 2HNAA 1P1CA 1SXIA 2CDBA 4WNIA 2QAGB 4DEVA 2PXAA 3L82B 5HQ3A 3QNMA 5TS3A 3DDZX 2DHQA 1PFQA 2DHEA 2NPOA 3JQ9C 1ZISA 2W4QA 3IV6A 3DPIA 4P38A 4P2BA 5FAXA 5SYNA 5YASA 3PE6A 2ZULA 4MUKA 3DZ8A 3OO1A 3KKLA 5A2GA 3LC0A 3AUFA 2VN8A 1FSPA 3V2IA 1UEJA 2ZWIA 1YJAA 4PQGA 4L74A 2VYNA 2YIMA 4BGUA 4JHXA 1I01A 3ZGOA 4P0PB 3QKWA 4IRMA 3N2NA 1A9YA 3E5RA 3GVCA 3EXEB 1UMBA 2GT1A 2PA0A 3W7BA 1THTA 1S1MA 2UUPA 4ZU1X 5IT4A 2IDMA 1L5FA 5LN1A 4IS3A 1NF3A 3BWEA 3MAGA 4P5EA 1IM8A 2WYVA 3VI4B 4EGFA 5MFPA 2JAPA 1MTOA 5EJ2A 5E2AA 4GLOA 5I47A 4EG7A 1IBCA 4N3BA 2XQKA 3KYCA 1NBEA 1PJRA 4P6VF 1DQNA 4DMGA 3DE3X 5EHNA 1SUBA 4ZZIA 1YBAA 2P30A 4YDHB 2XUFA 4QOEA 3ZY4A 5IJXA 4ZAXA 3GAMA 4CM9D 2E4WA 2ZXEA 3KXPA 1FRQA 4YMVA 3EHDA 3ZUPA 1NJ6A 3BOSA 1CJCA 2XMCA 3MN1A 4M1ZA 1GQFA 2VJBA 4PHFA 1DKLA 1N2SA 3QLUA 2PD4A 2ZS7A 4ZU3A 3UHAA 1J24A 5GOTA 5DNCA 3Q8KA 2NTNA 1VJ0A 2JZCA 1BJKA 3L43A 1P9NA 1VKHA 3W5DA 3S1AB 1W4CA 1P0IA 4ZJPA 3AFHA 1NPTO 2ZUSA 4O59O 1KSGA 4CM8B 5E1OA 4RFSA 1G1AA 1UM8A 5F1YA 3QVXA 4CUJA 1LLDA 4IOMA 3JQAA 4R16A 4RPHA 3SC6A 1AC5A 3E5HA 4LNAA 2IHKA 4RVUA 1CT9A 1U0HC 4ICIA 5AKKA 1M0SA 3HXPA 4ZZ3A 2QQEA 1UBRS 1NIPA 4YPFA 1AGPA 4L72A 3EDRA 3ZXSA 4B3GA 4XVQA 3NRBA 3R6TA 2A4KA 1T4CA 4JJIA 1GYRA 1X7YA 1UAAA 5DIZA 3BC1A 1FJXA 1IIBA 1DRUA 1LPOA 1UM9B 3TUZC 4Q3CA 1Q0PA 2G06A 1YRHA 4WINA 1NN0A 2GK3A 1AK9A 2VJNA 1HRKA 3G0OA 2IF2A 4NBVA 3X2EA 1RWMA 3A27A 1UT6A 4BNIA 1JG4A 4JX8A 4TMYA 1XZAA 2YVAA 3M70A 4G36A 5B37A 5BQ5A 3TLBA 3ONWA 4NONA 3FVRA 3OPVA 4I2VA 1FTQA 3L0IB 4RJIA 5IEBA 4B33A 4DL9A 1G291 4BJ3A 4I99A 1EVJA 2Y4NA 4FYXA 3FKSD 1CWUA 1EBUA 1JVNA 3SYRA 2C20A 1DXHA 3LG2A 4GVLA 3WLPA 1G4UR 5EJGA 5T4HA 4HTAA 1RKXA 1E0SA 5KIAA 4JNCA 1MIOA 1SEVA 2OCPA 1FDOA 2XZPA 4U4AA 4YXWA 5TF0A 4BO5A 4U7TB 2P5YA 1ONOA 1UUFA 3PC4A 1P6UA 4ASUA 5BR1A 1MLDA 2X15A 3CEPB 3E0XA 4KNWA 3PJEA 4YJFA 4C88A 3PICA 3CUEF 1LB1B 4NMWA 3OEWA 1L8XA 1OROA 2EGHA 2ZYSA 3LOUA 4X1OA 4XDYA 5E9QA 4KQGA 1KBQA 5IYZF 2YCBA 2X0JA 4RWZA 1BKYA 4ER5A 1ZMBA 3R7LA 3FWHA 3PL5A 1I80A 2W71A 4HVTA 3ZE1B 4F7DA 1O94A 1VJ5A 2BZ0A 1JDNA 2QN6A 1A5SB 4K03A 4LI0A 1JEEA 4U9HS 2ZI3A 1AGNA 1YR1A 3IUPA 1ZM7A 3NBFA 5TGDA 4DY4A 4FILA 1VBMA 1JQEA 3MMNA 1V1JA 4R31A 1Z73A 3AZOA 3ZGYA 4DRXB 3JQQA 5E2BA 5BSEA 2J4CA 3BXGA 3H5LA 4MHTA 1JUDA 4TN1A 3I1JA 5J9FA 3ZS8A 4LISA 3E7WA 4TTTS 1OWOA 3PQ8A 4TMKA 1QP7A 3JTEA 1RTKA 2W00A 3ZE7A 1OFHA 2PL9A 5J5VA 1E4YA 1JDZA 2OCLA 1D6NA 5FWDA 3S8MA 1Y34E 4GMDA 4OQYA 2XF2A 3SIRA 1M34A 2MSCB 4GI5A 4C4YA 3ETNA 1PUIA 1T3ZA 1A9RA 3ZHXA 1PGNA 4C1NA 4D57A 1K27A 3WXBA 4F71A 5GINE 4MYUA 2GR9A 1GAWA 3DVLA 3S2SA 4LVOA 1QU3A 4KFCA 1OU0A 4INPA 5I5EA 2RI0A 2X0RA 2Z2YA 1P19A 3PGXA 1UF9A 3L8CA 4R2JA 3MAAC 2ZPAA 4LQ4A 1KYQA 4TVOA 2B82A 1GGEA 2J6BA 2J46A 3AU9A 1KI2A 4NEGA 4F12A 1EBFA 2OOSA 1PWEA 5LQCA 5JUWA 3QX9A 4WA8A 3EXIA 3FMGA 2FFQA 1KDVA 3HUUA 3UMMA 4EX6A 4IXDA 1ENYA 2KSQA 4CKBA 3B1FA 1UINA 3NBYC 2X8JA 4RTOA 1GD1O 3W04A 3RSSA 4ERNA 2C4VA 4QGFA 3DYBA 1MC4A 2J9GA 1CY1A 1J97A 2VCEA 3PFCA 1QF9A 2EC5A 3F5SA 4KXWA 1FP6A 3ZLVA 1DOAA 2AI1A 2O7QA 2VH1A 3DZCA 5B36A 3MJCA 1IDN1 5AK0A 2WF8A 4BVEA 3WB1A 1QGAA 3VR2A 2GKGA 2PX0A 5A4KA 4CKBB 2F4VB 1TM2A 2VHQA 3BDIA 1WABA 3C8DA 3LXUX 4A3SA 3CUYA 4OL9A 3R23A 4BFLA 4KR0A 1D2EA 2MSLA 4B4VA 2PYDA 4G0MA 4EH1A 5I8WA 2C2ZA 1RYNA 4E3ZA 1KI9A 2FAXA 2Z1MA 2IYWA 1XQYA 3C3WA 4OQEA 5JJCA 4HGPA 3D81A 1XXLA 5JNUA 2VZEA 2WUEA 1OFTA 3MA0A 4IFBA 2CXTA 4RPIA 3S28A 4RACA 2WWWA 4LSWA 4YJDA 1NM5C 5DCLA 4UTNA 3WYGA 2GYWA 3DE7X 5K3FB 1YFKA 3GEGA 3KS9A 4EFLA 3P19A 1I3CA 1J99A 2F17A 3BERA 1R4NB 1SQFA 3N6VA 4IHAA 5DSTA 5FAKA 1NF8A 4UARA 3Q7RA 3KV3O 3T7RA 3B6ZA 4FB5A 4Q3OA 3BVPA 4OHOA 1KEWA 3U16A 1Z13A 4MP8A 4PC7A 2VJCA 4Q3LA 4X00A 3TOXA 1G55A 1TAHA 4PS1A 2FSVA 2F2TA 3ESRA 2Q3LA 4QYXA 1JAZA 5AT1A 1NNUA 1C50A 3BF8A 1GZHB 2HADA 3R5SA 1NVVR 2WD7B 4R81A 4R2IA 1T26A 3PFFA 1DMSA 2QV7A 2ZTLA 3K0AB 5JAQA 3D3EA 4AUKA 2CY0A 4P7KA 3NR2A 4C6RA 3HJFA 4YRGA 4MVJE 5BMOA 1YB5A 2WE7A 3T99A 2BDUA 3WV4A 4EUKA 5JAOA 1ZIDA 3DAFA 1J90A 2O2ZA 4YI5A 1N34B 1CCWA 4OQLA 3UKDA 1RSZA 4EELA 3LYLA 4U6SA 3KYDB 1RE0A 3IUEA 2I66A 4GZ3A 2Z98A 4R2WA 4TTPA 4XRGA 1NIJA 4PAMA 4KX3A 2MDTA 2B30A 4RDHA 4AG6A 5HUJA 1A50B 1L4KA 5KQMA 4MTCA 4XX0B 1HYQA 1V25A 2ZUTA 1FNCA 3L6DA 4EW2A 3ZJTA 1M0WA 2H3EA 3W05A 4QTUB 2BAGA 1QO7A 3T7IA 3KYDA 3W7VA 5FWXB 3SY8A 4LZOA 1D03A 1A5ZA 3QKTA 4JMPA 5BR7A 5I7RA 4AF6A 3F78A 1NR5A 4MA5A 3BQMB 3ZV3A 2X40A 2XUHA 3EULA 3MBKA 1ZO8A 2BFWA 3KO8A 3O4RA 4GX5A 3WJ2A 1PZXA 1JQJC 2WFLB 3RSCA 3ZV5A 4R9VA 2WUWE 3ZYZA 4PPQA 5MN5A 2ZIGA 3KVVA 2BMAA 1B16A 2VT3A 3I04M 4QYIA 2ZAYA 4RKQA 1DCFA 1RZVA 3NHLA 1F7UA 2B36A 1TPZA 2ZBVA 1QQTA 1GA6A 1CPYA 1GZ5A 2XGMA 3WGJA 2EKLA 4YJKA 3TIGA 3V8NA 1DOHA 3BWVA 3DD1A 3F6YA 1GZSA 2HBYA 4KV9A 1U0FA 5DHRA 1PNVA 1FDRA 2IYVA 3OMXA 3VGPA 1SD2A 1Z5VA 1Z9BA 3DV0B 1PHPA 2CLKB 3RD5A 3RHSA 1ZRMA 2VSFA 2JK1A 1WMBA 3EODA 1EU1A 2P9CA 1TF2A 3GWZA 4QYIB 3FXAA 3WOVA 1RYHA 2SCUA 1IQUA 2R87A 3C0KA 4KWEA 4HC4A 1L7NA 1C7FA 2JGMA 4Q1DA 1TOAA 3I23A 5IDWA 1HE8B 2VQFB 1J23A 1Z2OX 2AK3A 1X87A 5KNBH 3AZQA 3Q1LA 3K0KA 4PLTA 9ATCA 2I55A 1YDHA 1E9SA 1FYEA 3QEMB 1M8JA 1PG5A 3R4VA 4I9GA 4GRIA 4YUXA 3GVXA 3AY7A 3I6YA 4FMPA 5TQ0B 2P9EA 3RWOA 1RHQA 2R7NA 1P44A 3K4QA 1NPDA 3OBIA 1ISIA 1O94C 4JAVC 1AKRA 3R3JA 4WZBA 1U9IC 3RYCA 4BS9A 4M0LA 3MMZA 1ZH4A 4PPFA 5K0LA 1FTWA 2OXFA 5D85A 1BDIA 5AWFC 2YZNA 4N5IX 3P71T 3MLEA 4H7PA 2HRCA 1TCUA 1KK1A 2NO5A 1HDYA 1R3UA 1Z4MA 2HMUA 3FNBA 3QMVA 1Q77A 4REOA 1DU4A 3U26A 1NOJA 4IIXA 4GPIB 1M6HA 1GNVA 2ZLBA 2OBFA 4NV3A 1S7GA 3CINA 5TT1A 2WA2A 3K1JA 4LS3A 2IPMA 2FA9A 4M98A 3DOOA 10MHA 1Z5GA 2UUBB 3DFFA 2XMZA 1TUBB 3CB4A 1DIRA 3ILHA 4EMTA 1N2BA 3EGDB 1NVWQ 2IQIA 3MRXA 5JPIA 2WJJA 2G6BA 4JASB 4B3MB 3VSDA 3PJDA 2ID8A 4S24A 1AGYA 3S5JA 3TI9A 2F59A 2D6FA 4PO9A 1GQOA 3CUVA 2DE0X 3AI7A 1E3SA 3BUSA 3DLPX 1PSWA 4HT3B 1XZQA 1V8BA 3KNZA 4BO2A 4P4SA 4UUNA 2CHUA 3JW8A 1JPUA 1AS0A 1XAIA 2IOFA 2VDJA 3C7TA 1Z82A 4TS3A 1M6NA 3VSCA 3OPNA 2LD4A 3HUEA 4CM3A 1U90A 3R7WA 5ED4A 1XCBA 4HDOB 4QDUA 5EPEA 2DFDA 5B3KA 2C8VA 4TWBA 5BYKA 5IAGA 1SB8A 1CDEA 2QT1A 3V1UA 5FBVB 1MEOA 3R5JA 5JTTA 2FOIA 1SBQA 2KW5A 5UKDA 4JH0A 3ADBA 2PXHA 3I42A 3LLVA 1H93A 2YXBA 3SPXA 3GJ4A 3AW8A 3E9DA 3ZIDA 4EPWA 3WGZA 1ZSNA 2PA3A 4P93A 3T1QA 2RBEA 5D7BA 4JUIA 4Y1EA 1QH8B 3IP8A 2F43A 1QR6A 2A94A 1BD3A 2O3UA 1YIAA 2XXAB 1BYIA 2OK8A 1ZS9A 1YBHA 1V3QE 2GTIA 2EL9A 2VDQB 4ISCA 4X7BA 5EUCA 2OORA 1JILA 4WY8A 1BDMA 3FB1A 3JASB 2CVQA 3FMOB 5DI3A 2EARA 1X7WA 4BBZA 4L8WB 3DSRA 3TNYA 2VYVD 2J9YB 1N6NA 4AJKA 4HNUA 1T25A 4F60A 1KI3A 4MWTA 1C1XA 1SUFA 2GVDC 5EP3A 3CKLA 2XCOA 2Z4SA 2UZ4A 4GR5A 3WYFA 1ZHOA 5D3QA 1LEHA 1P7YA 2JRLA 4YBRA 2BCJQ 4BJ1A 3SE0A 1E4OA 3SJBA 4C07A 4L3VA 2IGTA 4ID3A 4QUDA 4LJ4A 3EZ2A 3OQVA 3G13A 1NKTA 3Q3JB 4AU1A 4F11A 3SLGA 1WKVA 2ORYA 4JLDA 1PZNA 4ARBA 3VDRA 3BHJA 3GP3A 5U9CA 4IG4A 2YMQA 4BLRA 3IEPA 5CLGA 1EX1A 2J9FA 3PEYA 1KDRA 4MQ4A 4R2MA 5DXAA 3O90A 1DZ3A 3CMCO 3DDOA 3NONA 1U5AA 3VQTA 1CY8A 1GGJA 2VP0A 3OLXA 1GTVA 1QOQB 5KQSA 1V2HE 1ZD3A 3IBTA 5TC4A 3ZHSA 1UPAA 2BM8A 3H5AA 4NNOA 3PXCX 1H1LB 2NGRA 4O2AA 4A8JC 3U4DA 4H59A 3HBNA 3C3AA 2H7XA 3N86A 4MEJA 1FJGB 1J1IA 1IWBB 3O2JA 4ZHSA 1NMXA 2JNWA 3ICPA 1RCFA 2PWZA 4MO9A 3UENA 1OLXA 1TKRA 1Z8DA 4HG2A 4RY9A 4EUSA 1GPDG 3MILA 5ULLA 4X92A 5L3QA 1NC1A 5CK4A 5JC8A 3BB4A 3COWA 4UXIA 1V35A 2YWGA 1SCUA 2CVOA 3S6JA 4D3ZA 4MUYA 4P81A 1CEEA 1C3JA 2FEAA 4OHWA 3K9LA 3TB4A 4RAQA 1LVUA 1NVXQ 2I3GA 4FONA 2VXBA 2HA6A 4NV1A 4QKQA 1EP2B 4RXMA 4RK1A 5JLJA 2R65A 1WUIS 1D7OA 2FMTA 3FYHA 5JZ9A 4DDWA 5JAPA 3PC7A 3KLMX 3KDPA 3RYHA 2DETA 3NETA 2DULA 4U9UA 2V65A 2Y3IA 4I2NA 4PX5A 4PLPA 2CZGA 2E4ZA 1JFFB 2IU4A 4ZMBA 2NUAA 4KO2S 3I30X 4ETWA 1KNQA 2NNWB 3OUUA 4WKNA 3MYRA 1T0PA 3JAMA 5HCNA 1W4AA 5EP4A 3DAPA 4OI1A 4L78A 1EFCA 2C4TA 3M1AA 4BP9A 3VJRA 4DGQA 1ZH6A 5A9TA 3T0IA 6AT1A 4YRBA 2W83A 1Q83A 2AXQA 4KNVA 4KUHA 1YR8A 3K2IA 1NBMA 2VBCA 1N2JA 2HT6A 3HYRA 4PO3X 2XTAA 4X8OA 4YRZA 2B6NA 2WJYA 4GD3Q 4UZFA 4A0SA 3D6JA 1WB5A 2XMDA 4LWPA 3ADPA 4ZQBA 3ZV6A 2C5GA 4CV2A 4EG1A 3F1LA 4Z1OA 1SU7A 5E4YA 1GKUB 4Z0TA 2HJVA 4FEGA 3KK0A 1FFAA 1FYVA 3SBDA 3I4CA 1MC8A 4RE5A 1G1MA 1KJWA 2LVBA 4BV2A 4N7RA 1PJ2A 1GLGA 1CETA 1XTKA 3HZOA 1R15A 5EE1A 4EPYA 1W36B 3C1TA 2D4AA 1TADA 2QZ9A 4I19A 3NEYA 5KTOA 4M1TA 1IJKA 1E6UA 1KR2A 3AINA 4DC9A 2XOXA 3OTOB 3FLBA 3TF5A 4XEHA 3KQKA 4DUYB 3LFTA 4H6XA 3C41J 4IVQA 4PN7A 4TM7A 3DVRX 1ZI6A 1VLLA 4JBWA 1XROA 3IUYA 3BMOB 5F76A 1IEVA 4GX0A 3SQOA 1KZHA 1X3LA 2NACA 4JI7B 1DBVO 1RQGA 2CHVA 2H29A 4NL4H 3SXPA 3KU4A 2UZ1B 4EJSA 3L4BA 1JBQA 3LA8A 4OD0A 4CG2A 5KDOA 3NOXA 1U3DA 4BBPA 4MUMA 4F1JA 4HLCA 4GPBA 4Q4DA 1G8AA 1ICEA 2I4MA 4RHFA 3RBXA 2P4QA 3BSYA 3BGOS 3QXJA 5HW0A 1Y6QA 2CMDA 3VR5H 5C52B 1GZVA 4F96A 2YASA 1JALA 1BH6A 3F90A 1IUPA 4CT0A 1EP3B 1US8B 1UP6A 3H6KA 1HEUA 1OBOA 1TRKA 4I9UA 5GJWC 4DTIA 5GVSA 4IHJF 2VDWA 1T8SA 4H1VA 4AZ3A 1NGSA 1P0CA 3OQPA 1NZDA 3UJ7A 4YN3A 5LWQA 3ZCTA 4C03A 1OTYA 4JJKA 4F04A 2FEKA 4DA6A 3JAKA 2PZBA 5SYMA 1MFPA 4KP7A 2QW1A 3R24A 1I0IA 4KXYA 1PFWA 3ABOB 1JHQA 2WG2A 4ZVPA 4HEA1 3WB9A 3MSCA 3AXSA 5CTAA 4DRZA 5A3QA 5IF3A 3PPIA 3OCZA 2DWCA 2C5FA 4TV8A 1Y7IA 3EQ9A 3I0MA 2P35A 3VO2A 4EARA 1N7IA 1QCZA 3ETCA 5K3BA 1RAIA 2C83A 2BFCB 3AFNA 3KM0A 1NUSA 1E66A 1KPHA 3Q3IA 4XTCS 5CITA 1QTNA 3QF7A 3KOMA 1VFNA 3T9CA 3H17A 4I5DA 2Q8QA 5EVJA 3UMRA 5J58A 4D9HA 4AZSA 4KR7A 3QY0A 4XDZA 3QWHA 2IDJA 2ISCA 1EJBA 1PJSA 1AG9A 3QPDA 4FBMA 5BV2P 2DHDA 1URPA 3DMTC 4IJWA 3JQ6A 4KUGA 2ATVA 1YASA 2WJ4A 2H9IA 1V11B 4IWYA 1QAQA 4FYYA 3WTCA 5JD4A 4KR3A 1B7GO 3U61B 4EBFA 1OWPA 3K96A 1ZGCA 1C7IA 4L7VA 2LIPA 1DFHA 2QV0A 3R44A 4AJLA 2O4UX 1A2OA 1WMEA 4Q18A 2GN8A 3EZYA 1M2HA 1JYFA 1ZIOA 1C0KA 3A3PA 4HGRA 2R11A 4QPPA 1Q1AA 3EVCA 1FFYA 3BGDA 4YAEA 3VH2A 1E89A 2NU9A 4R2KA 2J3LA 3PRHA 1SVKA 2RB4A 1G63A 1IRIA 1J07A 3RT9A 4L2IA 1JKJA 4Q47A 4AL4A 2OSVA 1GCOA 5FBZA 4C7BA 2XUOA 2UYCA 2FSSA 5C35A 3CNOA 3O75A 3TJZA 1ISMA 2BLNA 1PBTA 3JQ8B 5JT1A 3CRQA 4MUBA 4G84A 2Q3CA 2WTMA 4Q3DA 4BP3A 4EHBA 3M5WA 2RAUA 4LF4B 1EEHA 2JFWA 2RBKA 2OGTA 4FYVA 4M21A 4O0MA 1R00A 1Y7HA 3GAFA 5CNIA 4F56A 4QVKA 2XMSA 2XSZD 4ZQIA 2FSFA 3IUQA 4RJKA 4ESOA 2PUDA 4MVCA 5LBTA 4PQRA 2XBMA 2O8BA 2QU8A 2XAUA 3R0XA 1XDWA 3OBBA 5A5DA 1W4RA 4A73A 4H27A 3UPTA 1SQ5A 3QE0A 5IM4A 4OMUA 3U7IA 2VP6A 4BVBA 5KNDH 3ABIA 3QNUA 4LRUA 5CFNA 1NATA 3W90A 1NBAA 1NMEA 1UR5A 2ZSAA 1UZNA 1VG9B 2QF7A 5IKOA 4ZCIA 4V0LA 3THOA 3P4XA 4RHXA 4HF7A 2FGJA 1N6IA 1CRPA 4HRVA 3HBJA 2PSSA 1UXHA 4UE6A 4EJMA 3BDAA 1T35A 4I9NA 3DW1X 2VXCA 3UJCA 1OB2A 1K4YA 2AJLI 5KU7A 3UWDA 3NP7A 2DPYA 1XEWX 3X1WA 2W2KA 3H2IA 1XNGA 5HE8A 1UKAA 3HGTA 2PXCA 4J2TA 3VU9A 5BNIA 1F0YA 1QE0A 1DLIA 2GH1A 2G9ZA 2XB4A 4MB6A 1X9HA 2VWHA 2YIDA 3Q0IA 1RI5A 2WHQA 3GV0A 2E55A 4DJ5X 2QUJA 3Q98A 3R6DA 4B3XA 4TLBA 4DCPA 5D01A 4JC5A 1FQOA 1OFUA 3W5BA 2W6PA 1E1RD 1BCRA 3ASYA 1X15A 3MBIA 1SXJA 3TQQA 4FDTA 2WF9A 3FYDA 4BB0A 3VU9B 1KR5A 3M3DA 5F5NA 5I7SA 4D0GA 1NVVQ 3MEQA 3TKLA 1T1JA 2OENG 1QXSA 1GHTA 2JFPA 3HL4A 2RE8A 2J4DA 2QUBA 1ZNXA 2I54A 1WHSA 2AFHB 3HBAA 3GLTA 1IFXA 2CMKA 4FMDB 3R7DA 4DQXA 4C0LA 4BVJA 2OUKA 2CGEA 3EVBA 1QHHB 5H5JA 1M7HA 1N6OA 3LD9A 3THRA 1UMCA 4B4OA 4B47A 1CG6A 4US1R 3UGJA 1GEGA 1PK7A 2GLXA 4Q39A 3SVLA 4KXLA 2HEIA 2QHXA 4TTVA 3NUZA 3GF4A 1NXOA 4IH1A 4MXDA 1W47A 4O0LA 3WP0A 4ZMRA 2VP3A 3BD6A 4LYFA 5FTMA 1S4QA 3UK1A 2PSJA 1YZQA 4JBHA 1OLUB 2EAUA 2NTVA 3QU4A 1Y81A 2NXCA 2C9ZA 2YV4A 1YCGA 3KQSA 4BNYA 5JZBA 5EMMA 4UMDA 4E22A 4RA9A 4BKOA 5EIOA 1Q0LA 2P9QA 2PJDA 2K4MA 4BIIA 4DW8A 1E7QA 1QZXA 3IE0A 3KZVA 4OHVA 1GQSA 2ACWA 1YHZA 2AN9A 1CUFA 3QTBA 4IUYA 2XNKA 1PS9A 1U2TA 1YZYA 4QDXA 4V1CA 4M9XA 3OLCX 3USES 1ZY2A 3FNGA 3H3JA 1E9RA 2QXUA 3G0DA 3IAXA 3ORQA 3ZHYA 2BUCA 3ANYB 3B5IA 2HRZA 4YA6A 2ONKA 2Z6VA 3QOXA 5C81A 2MINA 2JJQA 2G88A 2GAAA 2AX3A 3K0CA 3PQ6A 1LCIA 3FWPA 4NP6A 1ZSVA 4QU9A 3RTDA 3TIIA 1T0BA 3E4CA 1NXXA 1OV4A 3S4YA 4PZLA 1IBKB 1FQWA 4PFQA 4FFRA 2RGUA 1N6PA 2YV3A 4GO1A 4P83A 4BGVA 5JMTA 3ROPA 2X7XA 5TQ2A 1A8IA 4M86A 3IIIA 5EMJA 3DMFA 4AJJA 1K1EA 5IMBA 3DE5X 3RYFB 4F86A 5JEEA 1AQJA 4LFAB 4A82A 3AETB 3A9SA 3H4IA 5KUTA 4QECA 1XEAA 2Q5JA 4LCBA 1IY2A 2O2IA 2A14A 2NO0A 4PSVA 3RSFA 4CBVA 1VLJA 1JMVA 4U5QA 1O7JA 1XRQA 3CW8X 3PUXA 2NIPA 4G07A 1H9CA 2AR0A 3URKA 3PSHA 3C3PA 3ZH9B 2V9CA 3SX4A 3IHTA 4J43A 3IA7A 1QTRA 1YZNA 1EQUA 2XGOA 4H6VA 3V1KA 1WVGA 1IHOA 4N12A 3D9QX 2BGUA 3PX7A 2WFMA 2G3YA 3RC2A 1E92A 1TECE 2OM6A 2G36A 3NHRA 5FWYA 3LWZA 2FE4A 2GVNA 4D9NA 3ZBQA 5JMWA 3DYIA 4AC9A 5JCZA 3N76A 5FUMA 4DV2B 1JJ7A 3CEHA 2QN2A 1JECA 2FN3A 3BTUA 3BA6A 4URVR 1NMQA 4D8TA 3EY4A 3UAVA 5DM70 3B20A 4UU1A 4QG3A 1RQ7A 4JLMA 4Z4FA 1R0WA 1E2EA 2LRHA 2WF6A 3N0VA 1FFWA 2JGDA 2PKCA 4KSYA 4L57A 4WNYA 5FH9A 4RJJA 1ZEJA 5U4XA 4A6DA 3SBEA 2QM0A 2OAEA 1K3FA 5JNLA 4NDZA 4EVRA 3ZDXB 5DULA 1WZIA 3GO4A 5JAMA 5K8LA 1QS0A 3L7YA 2NZUG 3EXFA 4OKSA 2A0XA 4G9GA 2DPLA 2AQ8A 3ABRB 2DWQA 1V8DA 1MN6A 3FTQA 4ODIA 1DIHA 4KMRA 1NJ8A 3WNQA 1S3GA 4YY3B 2H31A 1GUYA 3LCCA 2AOXA 2ZSDA 1N8SA 3HYSA 1N3YA 3KYIB 2O0JA 2OLKA 1XQWA 3G6WA 5T41A 2NU8A 3RJ9A 3TAUA 4B76A 4K6GA 4UQPA 3K6KA 2H1OA 1XDBA 5CCDA 2OD9A 5HGJA 2PJRA 2ZBGA 3T9AA 4IXWA 4IBOA 3DGFC 2ZROA 3EGXB 3L49A 3MLBA 1SHJA 3TVDA 1I7SB 4EWLA 3IIJA 2QJOA 4WV3A 5K0TA 3G5MA 3FYUC 4CM4B 5F1KA 3GRKA 1KSHA 1JLLB 2F4NA 4QBFA 4AIRA 2G72A 2MHCA 2VNHA 5AKYA 3PYLA 1JEDA 4F6LA 1YQEA 2ZSIA 1FFHA 4XPIA 5EJ4A 1VL5A 3MTIA 2GGSA 4JYZA 1U7HA 2EWWA 2YUIA 4QOJA 4AKTA 3JPYA 2Q5HA 4KNYA 1ANKA 1GUBA 4FI3F 2JFOA 1Q92A 2E82A 4HD8A 4YV1A 5FLXA 1PJCA 3MCUA 4Z49A 2A9QA 2BJWA 1EKXA 4G1FA 3WIEA 4AY6A 2H5IA 1DAKA 1F12A 1R6UA 5EIEA 1GCGA 1RJ9A 3E3OA 1F4VA 2QMEA 2CNBA 3LBFA 1TU0A 1N0WA 2H48A 5JLAA 3K94A 4GR4A 3OE7D 2QP9X 4ZEXA 3T5MA 3M4ZA 4OV6B 3PP8A 1RBYA 1NL3A 5COBA 3VYTB 3N7TA 4MIEA 4NCNA 5FIUA 4E32A 1N2EA 2ATCA 4LWOA 5M7EA 1DWOA 2G1PA 3R7FA 4ZAVA 3CFYA 1EK0A 3L7BA 3SWWA 4CKEA 2OECA 3PNYA 2JLXA 4W1RA 4AS2A 1TM7E 1AKMA 2HNKA 4XIIA 4PNEA 4DQLA 3M4XA 4Y2JA 1NW7A 3ZBUA 3OURA 1HF3A 3FZEA 5IS2A 2IA5A 4GLBA 1G17A 3FMPB 3TLMA 4V0OA 3RUFA 1PZGA 2O1SA 4CMEC 5KSZA 5B3JC 3T5AA 4DLWA 4JA2A 3UK6A 1Z34A 2HK9A 1ECGA 4FLEA 4RHUA 4FR0A 4MRMB 3GPBA 3U09A 1QWOA 1QONA 3DL2A 2BGIA 1XI2A 3KDSE 5AVVA 2R1VA 2W2PA 3BRSA 3BILA 3SC2A 5J4LA 4WUTA 1M6VA 3WYCA 1ZGBA 4HAWA 3PXAA 4HI0E 2J6IA 3O21A 1KXJA 4MS3B 1CBUA 1KFBB 5FRDA 4PPNA 3V2HA 4OXRA 1RKUA 4FGLA 1M8GA 5M3BA 4JP3A 2AOTB 3GAZA 3X44A 3ZXIA 4E4TA 2PWAA 1Z4IA 2A7QA 5KBYA 3GELA 1ESZA 3FPAA 1IVYA 1F1BA 1F3OA 3FCEA 4M1EA 4LX0A 1V4NA 4RELA 4ZEWA 5LDGA 4W9MC 1Z56C 2A5DA 1E1DA 3Q88A 4NY1A 4PC1A 4DCTA 1J09A 4UVGA 3U7GA 1U0GA 3A05A 2UVDA 3BM5A 1UOOA 5IVPA 4MROA 4MI6A 4RNDB 3CW9A 3NHPA 1R0YA 3DR3A 5LIPA 2QDXA 4IJMA 1H5NA 2DKFA 5EIWA 1FBNA 1N2HA 1MPTA 3L4SO 4EYKA 2I7VA 1UXOA 2K87A 2VHWA 3ELYA 1FFCA 4PYQA 3EG9B 4RVSA 3QU9A 3WGYA 4HTFA 1B93A 1J8MF 2LP4Y 4NC9A 4IS2A 4EBBA 4M37A 2QL9A 621PA 4U7HA 3TLZA 9LDTA 3RC3A 1LSUA 3REQA 2W4MA 4U8GA 3TQOA 1NSTA 3A10A 1YS7A 4I1YA 1TQ8A 3CR7A 3DE0X 4GOLD 4YO7A 5AHKA 4DMMA 1ZCBA 5BVGA 5HQ3B 2ZZMA 4YNBA 3SHOA 2NOAA 2PLFA 3BXHA 5DB4A 4PYJA 2NPFA 3HQ4O 1FLNA 4YMGA 3WLSA 2HZ7A 3KWMA 4WAUA 3WWOA 1T5LA 4D26A 1G8SA 3ONDA 3B2QA 1BKDR 3H8WA 5AICA 5H7XA 2RGNC 5FBLB 5IAOA 3FBTA 1Q91A 2QKYA 1HH4A 3IVXA 1JFTA 2DUNA 4KXQA 4XLTA 5IKXA 4DV4B 3L0CA 5EUBA 1HOXA 3NRCA 3GOQA 2H5JA 3SHWA 3AEUA 2F9FA 2JFBA 4BKRA 4Y6LA 4AKIA 3WY9A 1M2JA 1E4VA 2QQ0A 2W2VA 4NEHB 1G3RA 3AUXA 1B74A 4KQJA 1A71A 3DG9A 2J7PA 2H9AA 1O89A 2XYVA 4AMBA 3AKEA 3FYUA 5CRIA 2NSYA 4ZCLA 1P1KA 2WPDD 4TYWA 3C1OA 1KVUA 5GJCA 3P8ZA 4J0IA 4OI2A 1U65A 3D02A 4FC6A 4C4TA 1ZL2A 2EP8A 2V7QA 4Q19A 4UBKA 3KQPA 3QG1A 3AH8A 4Z0PA 1PG0A 3BFJA 3T5DA 1K89A 1B00A 2C9YA 2ZB3A 3EC1A 3O82A 5CURA 4E46A 4EVIA 2FG5A 5DTQA 4BNTA 2NUPB 3CO0S 2RK4A 1AKWA 1CRQA 3GWGA 5C5IA 3GFQA 1RAAA 2F67A 5F3DA 3DXYA 4B73A 2NXWA 3WNZA 1FUIA 4HLUA 4XI9A 4X95A 1L5GB 1U5BA 3FCOA 1YZVA 1JHPA 4QBHA 2AJCA 4O2AF 1QOZA 2WP8J 4I8XA 3S1AA 1OZ0A 3GZJA 4BCDA 5B6JA 1Z0AA 2FVXA 3Q11A 4UQLA 3FPHA 4NCHA 1XVAA 1YE3A 4GMFA 4GDFA 1WSWA 3VMFA 1JX6A 4EY8A 5SY4A 2JLYA 2QD4A 4ZVOA 1T2CA 4O8ZA 2UYHA 4O3MA 3C3BA 5DXJA 3WIUA 4N5LA 1Q20A 1FXWF 1XRLA 3G8YA 1KK0A 4WERA 2G83A 1AX9A 4GP6A 4NSNA 2HPHA 1DDGA 2PJZA 4JT2A 3AFIA 4WNAA 3BULA 3E8SA 4WFIA 4DNQA 1DARA 5SZIA 3R74A 4ED9A 1SVWA 4JLUA 4E7PA 1S2GA 5LA6B 4K0KB 5K51A 4LF8B 5EMLA 3ADOA 2B37A 3HJAA 4E11A 5CDYA 5L3SA 5AM4A 1XA4A 2CL5A 1RFLA 2OWEA 1MCZA 2XKJE 3C16C 4Y1GA 4FMCB 5EWLB 2QIOA 4FW8A 4AMGA 4F2WA 3HJNA 2AXNA 3IEKA 3BK1A 3FGPA 1X7XA 4FNGA 4YGXB 4EHNA 1XE3A 4ECEA 4MWEA 4TRMA 3KLBA 4TZKA 4Y8VA 1VKRA 2NT4A 1NJ1A 1K6MA 4D9CA 3C5CA 4N8SA 5IASA 1M9NA 1LLFA 4HZUB 4L5YA 1F4PA 5GOZA 1Y5NA 3P2IA 4HR7A 4JQYA 4WKPA 5DTMA 2DPHA 4NX2A 4WZ6A 4HYYA 3JD0A 4KEAA 1YFLA 3NWOA 3OFJA 1TEXA 3PGMA 3KPVA 2JAUA 4RK6A 1L4HA 3UMCA 3KSRA 1U2DA 3EQ6A 1HLPA 2IH5A 4B84A 5DHQA 1TI7A 1DCTA 5IPFA 5J4KA 2GTHA 4RA6A 4AQYB 2ZDGA 3BFXA 4NICA 4W82A 5CP8A 3JQ9A 4RHTA 2IYPA 3D1LA 4IJVA 4Y2QA 4YJHB 2ZBRA 4AD8A 5TT0A 3DPSA 4AY2A 2GBIA 3VDNB 5DLDA 4AZ0B 2C9DA 3IX7A 3WB2A 4L75A 2EKZA 1TM5E 4S1WA 2FE1A 2QTGA 2YDXA 5CMLA 1TFRA 1XVVA 1F17A 3DS8A 1FTSA 3ENZA 1E2HA 3KTDA 3LQ4A 5DLQC 1NY6A 3P2MA 4KQIA 5FUXA 4PLHA 4IMRA 1EGAA 4HEHA 4IDQA 3JQ7A 2J0UB 4JJ8A 5FLKA 1J25A 1E1RA 1T13A 2VHCA 1JJAA 2Q6IA 3BD7A 3OM0A 2VP4A 5K0NA 5DYWA 5JCOA 3EVAA 2C92A 3FKJA 4YCBA 4B6QA 2JBWA 5FDFA 2JIPA 1Z88A 4FFNA 1O0BA 2ZP1A 3SYMA 4Q0MA 2RGAA 3KVRA 1MUUA 3OCJA 2ZJFA 3IQWA 2OC9A 2VNSA 1EAMA 1WW8A 2EDCA 3HEBA 2FSHA 3K32A 1WCIB 4P22A 2XUDA 5REQA 4J0FA 5T8KC 5KNDA 2FSUA 5AVWA 4M0KA 1W75A 2IPLA 4A9AA 3HDVA 1NX6A 2IYTA 3HFSA 1SHTX 1DADA 3AR9A 3ENVA 3H9UA 3TE7A 4AXXA 4BMOB 1ELOA 3N3BC 3QP9A 4O4IA 1TLLA 4PC3A 4TKLA 3EXHB 5EA2A 1QIMA 5AW8A 3PWSA 1J5XA 1JI3A 3QFSA 4LWZA 3U13A 1ZUWA 1O3YA 3ZD8A 1WCIA 4GVXA 4UPEA 2IZ7A 3KEGA 3QE3A 5K8TA 4M53A 1GTJ1 1BXGB 1IXKA 1E2QA 1YQTA 1U6JA 2CLLB 2PT5A 4JT8A 4TTRA 3KQWA 3RVDA 1Y3BE 2VOEA 1O1YA 2XBLA 1OFGA 2ECFA 1ORTA 3UMSA 2Z3WA 4B6GA 4HRYA 4KJXA 4K8OA 1T3HA 3A36A 1Z6AA 4HO1X 3BF7A 3MWFA 2W58A 4OGWA 3S29A 5LFAA 1XRJA 1T6YA 2AFIA 2WTEA 3IS3A 3JR7A 1B23P 2P0YA 3HH8A 3GXBA 4J6FA 4R8KA 1YZ3A 3NTUA 3SJAA 2W2LD 4B3DA 2AN4A 2WAXA 3ONEA 4TSKA 5LYJA 4DG8A 2YJ5A 2FW7A 1CW2B 3PIRA 5D51S 1L1QA 1MRNA 5A7FA 3QE2A 4M9UA 4B46A 5L6MB 4IGAA 2IZOA 1G0NA 3STHA 1SCBA 1U8TA 1K63A 4ACBA 1QDLB 4ND8B 1U8UA 3LF1A 3PUYA 4ZYTA 1ESMA 1AK1A 1H2FA 1YZLA 2PT9A 2XNDA 1FLVA 2KHZA 1AH2A 4IDDA 3TECE 3NVAA 3VMMA 1N6RA 4E13A 5KOYA 4P7FA 1U3VA 5GPBA 1JA9A 4OREX 2C8LA 4R1LA 4C2AA 2OCXA 1S0UA 1SA0A 2IQ5A 2YXEA 4HQNA 5K3SA 5I7OA 1XA0A 2PYIA 3T94A 4O4HF 1SVLA 3UT6A 2SKDA 2Z8YA 2PMDA 3HSYA 4OHKA 4XJSA 4QQNA 1AQIA 1Q21A 4NK5A 4RFVA 3ZN2A 1UMDB 2ZETA 3NVMB 2UZ0A 3V8MA 3U4QA 3L7MA 1QG0A 1N7GA 2W8ZA 4OI4A 3QTTA 3OU7A 1SA0B 4KPUB 4LC0A 3G59A 4JQCA 1XZKA 3GLGB 2FK7A 4C0WA 1RRPA 4L28A 2GARA 1Q5PA 1W85A 1Z0KA 2FQQA 2VP5A 2GAFA 3O8QA 3OPXA 4H3SA 4IWNA 2IIVA 4S2EA 4WKCA 4Y2YA 2IYUA 4DPMA 1XNQB 1E6MA 2UXCB 3KWLA 3COPA 1Z28A 3IULA 2GZMA 4YAJA 2ZCVA 3AVWA 3IEIA 2E1PA 1CS4C 1CVIA 2R00A 2X23A 4UJ3A 1GLVA 2YOGA 3VKHA 2FDRA 2H1WA 4N03A 1G20E 1A96A 4RZ3A 4TS4A 5BY2A 4TSFA 4YS6A 5CB4B 4RZXA 2ENWA 1KDPA 4UDNA 1Q1GA 2GAIA 3RTEA 1H0RA 1ID1A 2A59A 4FR5A 4C20A 3CX6A 2FF7A 2M9MA 3IQEA 4C4RA 4K46A 1JDSA 4MR7B 3NVKI 1FPMA 4I8IA 3DZDA 2VJDA 1I6LA 2JZOA 1DPFA 2IHJA 2D74A 4JHLA 5CB4A 1FU8A 4DCVA 3LCUA 4V0KA 2A78A 2HPVA 5ARBA 4GBGA 1KJNA 3P9NA 4HMQA 4YBZA 4B7CA 4BYGA 5BR8B 2GQ0A 3JZAA 3UQZA 4HS9A 4JV5B 1M75A 1PJTA 1SU4A 2JJ1D 1J2JA 3VKUA 5IKPA 2FW9A 4JLKA 3CSSA 5BV7A 1ZJWA 3FB4A 1JJFA 2R1UA 3EG5A 1XU9A 4XR9A 4JKYA 4P4LA 3FFAA 2PBZA 3W06A 3OHPA 5DOVA 3ZQUA 4PTZA 5I3CA 5IJWA 5JRDS 3DLBA 2ZYAA 4TYMA 1B0PA 2XCTB 3AG6A 1NI4A 2DBVO 1YVRA 1AA9A 1BVUA 4KLAA 3QBEA 5DW3A 1UPBA 1HDCA 3C97A 1I6KA 3D31A 3GMDA 4REQB 2O2SA 4COOA 1JEOA 4ZO4A 3W9BA 4P5PA 3HA2A 5B64A 3D4LA 5A9RA 3EA0A 2EFGA 2G71A 4WOPA 5I45A 4H7EA 2WHEA 4JU9A 1D7AA 1QMPA 2ZJZA 4WJKB 3D6UA 3GEDA 2BEKA 1K66A 4MUJA 4Q01A 4Q6WA 1P80A 4MARA 3X3HA 1TQ6A 1T9BA 1J9EA 3EJWA 4BNXA 4PLCA 1PS0A 4ZVUA 2Z2ZA 3PEWA 4BY9E 4XD2A 4Q15A 3TOVA 3BWMA 1KYXA 4O4LB 4WXRA 5GADl 2WTBA 3CZ4A 3O8NA 3MJDA 3OQNA 4TLEA 3T3NA 1PT8A 4YFYA 2HWKA 3GLHA 3M3HA 4UHCA 2X9GA 1BEUB 3OD5A 5FYDA 4AKSA 4A23A 1Z6QA 2RC5A 3BG5A 3N2KA 4PZPA 2AL7A 2FG7C 1X0VA 1VMEA 4HDAA 3K1ZA 4WD3A 5FUYA 1MAHA 4EPXA 1YNSA 3A14A 4I81A 3TLAA 4EYEA 2D0OB 4P7GA 4LK2A 3TTTA 2IY7A 1DV1A 1XTTA 1VE1A 2Y0CA 2N1MA 4P34A 1NR1A 1S2OA 2O57A 3JAWA 4WHMA 5L3VA 1ZOOA 4LKOA 1SZDA 4F4DA 3V4RA 1XZNA 3OCUA 4M8SA 4GL2A 3N2KB 1E3WA 1VFPA 3BN3A 3GA5A 2JGKA 4TUYA 5H3LA 5TGZA 2YS6A 3RUAA 1JH8A 1G6Q1 3PFWO 3K5IA 1Z7BA 2QX8A 1ZVKA 1M7BA 2PH7A 3LX8A 2N46A 3NC0C 4J9UE 4K9RA 4OYRA 3A06A 5ALFA 1KDZA 3KZMA 1TCVA 4PAGA 3CNEA 2LIVA 5IYZA 2DBRA 1AIPA 2JCGA 3AB8A 3DXFA 3L41A 3PQEA 4COKA 3L9XA 4H08A 1WO8A 3RQSA 2ZRMA 3FOCA 2VK1A 4OO3A 1M2NA 4TV9A 4YROA 4E5YA 3ZWDA 5AW6A 2O2YA 2HSEA 2Q41A 4DVJA 3ORRA 1ZJZA 1XMPA 2FZ4A 3UPUA 5L53A 4ZQGA 4ZI5A 5ERGB 2AZMA 1PR5A 2OT3B 2F43B 2Q8NA 3DUFB 4ZT3A 4JDPA 3RV3A 3GIWA 3QUQA 3G9UA 3W5UA 4QO8A 2Q4OA 4JOCA 4NH4A 5E6UB 3EH2A 4PHHA 1XDZA 2HA4A 2J31A 2X0FA 1MORA 1CJKC 2C2BA 3RS3A 4MULA 5AUQA 4F5ZA 2GXAA 4L4UA 3IPRA 4AJPA 4BNNA 1YTUA 1QLWA 2I1LA 1U7XA 1SIWA 1ACMA 2Q9CA 3A9CA 3NRJA 3GJ3A 5EE5B 1DAOA 2ZUDA 1T3SA 4BO1A 3VPXA 3N0WA 1JDBB 5J3JA 1C9KA 3U4GA 1RRVA 4HWTA 4OXIA 2GAOA 3TNJA 2QPLA 4Q9KA 5FEMA 5A06A 5HJEA 2H92A 1O95A 1SBZA 3DR5A 4FZJA 2E85A 3R0QA 2VR1A 1JAXA 3V1NA 5LP6B 3ZKWA 4BNFA 4C3ZA 4KIJA 1W581 2IU0A 4LHEA 1K2VN 1ZEMA 2ZS8A 4TT8A 3UC5A 1DAEA 1KKLA 1VIMA 2PGAA 2VAMA 2YQ5A 2GPTA 2XGJA 5KCMA 3OPYA 4KXXA 2RH5A 2LV8A 4QATA 4CLDA 4ZKDA 5BVHB 2LE0A 1U6IA 4IY1A 4P4GA 5FBKA 5J23A 2CJYA 3AFOA 2J5BA 4K6MA 5IARA 2AZ4A 4XUCA 2CNWA 3I5AA 4UREA 3DZFA 3O8OB 4HSGA 1G60A 5B7PA 1DLJA 3KDAA 1NVEA 1WE2A 2QMYA 4JP5A 1U98A 3B70A 4XE5A 3W2EA 5A9SA 4TTIA 5I7EA 2ZRAA 2O59A 3BREA 4XB6B 1C4WA 3I9FA 3NT2A 2NSLA 3TQSA 1WD7A 3WMWA 5KOHA 2JFNA 2WWFA 1DXYA 1XZHA 4QYWA 4R7ZA 1LZKA 2P1RA 1NBIA 3PRJA 4QJ4A 5AJYA 3Q72A 2XGSA 4HX2A 4YRQA 5A5FA 2NO6A 1RLJA 2EQ5A 5CVDA 1Z35A 2NM0A 1NONA 2GWRA 3WLIA 3A3NA 3IAEA 5KHOC 2UZIR 3B1ZA 2GM5A 2X2OA 5A02A 3Q3EA 4H7IA 5KOHB 4LHZA 4QDOA 2HRDA 3T1TA 1UKEA 4XJVA 5AR1A 2RGCA 4LY0A 3L6RA 2C0QA 5ES4B 2XCIA 2J3JA 3TTWA 1CE8B 1NASA 3KQTA 3FFXA 4FJ1A 1ZBDA 4E70A 1MC1A 3G8DA 2NWQA 1XUOA 3UW3A 2PX6A 1LDBA 3ZY2A 3BMQB 3S1SA 4DJJA 2HDOA 3DZHA 1HO3A 1GTG1 5IVDA 3A0RB 4P2GA 1BXKA 2FMIA 3TW8A 1X7ZA 3RASA 1J9GA 7GPBA 2ODPA 2A0YA 4KPFC 1Y1SA 1I36A 4AJEA 1PFKA 1Y8ZA 2BFMA 5KCZA 4FGUA 3CGWA 5EKXA 1ENOA 1MMFB 2ZJ6A 2O05A 2ID9A 3BJEA 5TX7A 4A4DA 3W9YA 4G86A 3OZIA 4GYWA 2W48A 2ST1A 3ZBPA 4DT1A 5BMVF 1QJCA 2I65A 1N3LA 3MCWA 4TVBA 1NWCA 2LDXA 4NTZA 1Y4DE 4Q9NA 5AUNB 8ABPA 1J4AA 4FIZA 1CQWA 1PR4A 3B9PA 2R47A 3DE4X 5E7IA 2Q27A 2K7FA 2GSWA 4L16A 5BSWA 2R6FA 1NURA 3E9EA 4OOFA 1I6MA 2PUGA 1CJBA 1SUCA 4H17A 3TFWA 1CZUA 1UBHS 2XQGA 3H8SA 4KRFA 4TXNA 3BH7A 5C8YB 3KB1A 2NU6B 3GUUA 1UWCA 2CL7X 3P0EA 3CVJA 5T7BA 5GIOE 3ST7A 3EXEA 1VKNA 3A9TA 1PVDA 1UP4A 3CM0A 3LP6A 7REQA 4UFNA 4XARA 5JNRA 4NDAA 4F5YA 1DG3A 2HEGA 2M2IA 3HP4A 4BXOB 5H4HA 2R6GA 5LBIA 3ZDAA 4X44A 3ZCQA 2YFKA 1JKFA 1IC6A 4OBXA 2AR9A 2Q3JA 1UAYA 4TL6A 4DLZA 1KU0A 2ZE5A 2D54A 3KJIA 3VVCA 2E7ZA 2V6GA 2PUJA 3HCPA 4DSZA 2D1RA 2WWHA 2NAPA 2WG1A 1OSNA 2VCHA 3LHIA 1NBOA 1D1PA 1QBGA 3WKCA 3HO8A 4QWMA 7REQB 2QE7A 2UZ1A 3TTYA 1YL6A 5C80A 2P2SA 1W88B 1QHSA 1U8AA 2P5UA 4MS4A 5T3UA 4ARAA 2W70A 3UWSA 4CLRA 4JFAA 1SY7A 3CWCA 3R6WA 1VYVA 4FSHA 3DEIA 1HE1C 1FB5A 4YJ3B 3RRXA 1JHRA 2GZDA 4Q7EA 1COZA 1H8HA 1HBJA 1XCJA 3NHAA 4LOLA 4MKIA 1XMXA 2HN9A 2IYSA 1YS4A 3K5HA 4K2HA 4MPDA 1C2YA 2PNFA 2ZS9A 4DQUA 3TEJA 2FWIA 1K7FB 3FZQA 1US8A 1A5AB 4YJ2A 2X7JA 2QPOA 4ENWA 4FBLA 3PGKA 2F3RA 2GPNA 2OAGA 3SXUB 3V32A 1PGOA 2R8EA 4A0GA 2WHPA 4GL4A 4TGLA 1ZJ4A 2EJCA 1KMHB 3KCNA 1ISGA 1RWNA 1JA1A 1HMYA 2UVPA 2ZT8A 3CRW1 5ALIA 4G41A 2O3TA 2OCAA 4MZXA 5FL7D 4CLOB 2IYFA 2PUAA 5CT4A 1CR1A 1YUMA 3RI3A 5GVRA 5KC8A 5JAZA 1RKQA 4FFBB 1W1UA 2A9PA 3LQFA 4YMIA 3CV3A 4H7HA 1M8PA 4QTYA 1W34A 3U48A 1H23A 2AN5A 5BUSA 3EPHA 2GPWA 5A7HA 2HDNB 2PGDA 2WIBA 4X7RA 1M66A 1XCMA 2P6OA 1EUCB 2R1TB 2UVPB 3DOFA 3HUTA 4BQRA 4HPWA 5AW7A 3D43A 1Z6YA 4FIDA 3IXQA 3MVEA 4D74A 4J29A 2VQ6A 3DHYA 5JCPA 5JSZA 4YACA 1PD1A 3GY0A 1W94A 1BMQA 1KFKB 3C8MA 1HSZA 5EKSA 4C05A 3L6CA 1WSBA 2AK2A 4FGWA 4PFJA 3HTXA 4J03A 2R1TA 2RHWA 3CISA 3UB3A 1PU2A 5AM0A 3W1EA 3PUIA 3L77A 4TROA 3FJYA 1ORHA 1NTOA 2J48A 4PLYA 3QIVA 5BQXA 4FKZA 2X0KA 1OYVA 1WCXA 5E38A 4RZSA 2IUUA 3ZV7A