4HZGA

Structure of haloalkane dehalogenase dhaa from rhodococcus rhodochrous
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
b'EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
molecule tags Hydrolase
source organism Rhodococcus sp.
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hzgA00
5AO9A 4BDTA 1WB5A 3PICA 3LIPA 4G9EA 2VEOA 3WK4A 3CCCA 1GPNA 1BN7A 1WM1A 3MUOA 4BRSA 2WIKA 3DLTA 5FXMA 2HRRA 5LYYA 1KU0A 4BTVA 5DYYA 4G9GA 3O9MA 5AI4A 1ZJ5A 1GQSA 4OYLA 3V9AA 4QEKA 1AC5A 1CVLA 5CH3A 2WUEA 1YASA 2Z5GA 4RGYA 5AI9A 4Y2SA 5SYNA 1QFMA 3FYUC 1NU6A 4IH1A 1R9NA 3WL6A 3PUHA 3DDUA 2BUCA 5JD5A 3HACA 1TCAA 2VTVA 4PSCA 4FKBA 1DT3A 1Y7IA 2HFJA 3OPMA 5F4ZA 5CBKA 1H2ZA 2XUHA 3C6ZA 2Z3ZA 4N8SA 2HA5A 5ALPA 3TJMA 2RGUA 4JNCA 1LNSA 3BIWA 1CQWA 2FJPA 1A8QA 1XRLA 1YAJA 1LPNA 2HU7A 1X70A 2HA6A 1LPMA 4D9JA 2C58A 1DWQA 1UOOA 4FLFA 3HYSA 4AMZA 5JADA 3DOIA 4FHZA 3IDAA 4A16A 4DTCA 1FFDA 4I3FA 2GZSA 3P2MA 1QIHA 4BB0A 3NOXA 2DHCA 4JEIA 2PVSA 2VJAA 3K6KA 2Y6VA 2NW6A 1OXMA 3DJYA 5DNUA 1CUYA 3NGMA 2XMDA 5KREA 2VQ6A 2QJWA 1VA4A 3OM8A 2BGNA 2H1IA 4X92A 3FSGD 1EDDA 3BL8A 3A2LA 4C4XA 5AKKA 1MO2A 5FPQA 2XQKA 2WLSA 3IULA 4FMPA 3AZQA 4BZZA 1N1MA 3AUKA 4H7JA 3SK0A 4BE9A 3D4LA 7YASA 2DCMA 3V1MA 1ODCA 1AUOA 4AO7A 5AI0A 1XZHA 1QIDA 2HA3A 4J0HA 1LZKA 4YX9A 2XMCA 4JYPA 3STTA 4BTLA 3WA7A 5KWJA 2XLCA 1ORVA 2WFZA 5K3CA 1XLVA 3IIIA 2WIJA 2I3ZA 4Y7DA 3I2GA 3SX4A 2VA9A 3VVMA 4BCDA 1EX9A 4AN1A 2HA4A 5FRDA 2QKYA 3C45A 5JYCA 5JIBA 1OCEA 5D6OA 2G5PA 1CUAA 4J0IA 4WY8A 4MJ3A 3QVMA 1YA4A 1W76A 2I78A 5IH7A 1S8OA 2AJBA 1D07A 1W1IA 3W9UA 3DQZA 4ZGBA 2IIVA 4J0KA 1UZAA 3CCBA 1A88A 3WKEA 5BV7A 1QJ4A 4OB6A 1GT6A 4UFPA 1XRNA 5AOCA 5LZ4A 5HK8A 2WFLB 4YASA 3PF8A 4BVKA 1E8DA 4DNOA 1QGED 1YSCA 3F97A 1XZIA 1ZJ4A 2HA0A 3GBSA 1WPXA 1H2WA 4AXBA 1EDBA 3FBWA 1QFSA 4AMYA 4TVKA 4GDMA 2PL5A 1J1IA 2Y2VA 4XIIA 3GFFA 1DWOA 2WJ3A 5K5EA 1W75A 5LZ2A 4Q05A 1VZ3A 4Y9SA 5C7YA 4BATA 5DTJA 4AN0A 4ZV7A 5EFZA 1UT6A 2QRUA 5AM2A 1VE6A 3ED1A 1AZWA 1EHYA 5AM5A 4PSUA 3WZMA 4K6HA 1XKTA 3L1HA 4LKOA 4RNCA 5AI8A 3WKDA 2RI6A 5AKIA 1CUWA 1TAHA 3IB3A 1SCQA 4UHCA 4G4JA 1A8UA 3MGAA 4LXGA 5AK3A 2ZSIA 3O0DA 1U8EA 4Y2RA 1J2EA 4DNFA 1H22A 1WPRA 4A5SA 3BWXA 1WB4A 3WL7A 4UBNA 1GXSA 2WHPB 1X2BA 5IVDA 4FLMA 1L7AA 4DYHA 3E0XA 1ZD4A 3UMJA 2BUBA 4XVCA 1LPOA 1USWA 2RONA 1XLUA 2JIDA 3FYUA 3G9XA 5E2IA 2OPHA 2ACEA 4FOLA 2UZ0A 3FLAA 3LLCA 3BDIA 5T4HA 1YB6A 3DEAA 4K5QA 5LZ9A 2PX6A 4OPMA 3UUEA 2R11A 3C6XA 3G0CA 5AM4A 3KWJA 2IITA 3EQ8A 4PW0A 3ICVA 4QDZA 2OGSA 5HF9A 1WHTA 5AI6A 1ACJA 4S0XA 1F6WA 2AJDA 4QDXA 3U0VA 3GUUA 5IKXA 1BRTA 2XQGA 4DMHA 4P92A 4KE9A 1ZGCA 1J07A 4O08A 1RWQA 3WK8A 6YASA 5AIAA 2AJLI 5DNWA 5JASA 5K3FB 5LLSA 3GA7A 1LPSA 2WSLA 4BCCA 1EXWA 3D0KA 4XX1A 2QTBA 2CZQA 1XRRA 4MWSA 4A23A 1YCDA 3DS8A 2XI4A 1CUZA 1R50A 5HFAA 1ZI6A 4HRXA 2HM7A 3ZLTA 2CKMA 1X2EA 1NU8A 2D0DA 2QVBA 1W52X 4EBBA 5JZBA 4J3JA 4UHEA 3PFCA 1H2XA 4M0FA 1FSSA 2XUJA 4OB7A 3O95A 4FBLA 3HSSA 4UFOA 2QJRA 2R8BA 2OGTA 1LBSA 1CUHA 4AQDA 1TCCA 2VAVA 5CT5A 4B0OA 2WFLA 5CT4A 2QXUA 1YS2X 1H23A 3AIMA 5E4YA 4J0JA 2BCEA 4OU4A 3N2ZB 2E3JA 4CG3A 4J7AA 3BF8A 3VJMA 2J3DA 1MU0A 4AX4A 3V48A 3FYTA 1CUCA 3EIOA 2JGKA 4FTWA 2O2HA 4X94A 3TRDA 3C8DA 3GROA 1PFQA 4W1PA 2HDWA 3ZI7A 1MNAA 5AKEA 2WU3A 5AKJA 4P9NA 2XUQA 2J3QA 3H18A 2OCIA 2XUDA 1XZDA 1U2EA 1CUDA 1MTZA 4MEBA 2PUHA 1CUSA 1K63A 3AIKA 4B82A 4QZVA 4C89A 2EDCA 1UKAA 2J4CA 4H7IA 5DNVA 1XZJA 2QS9A 5AM1A 3VJLA 1Y37A 3DD5A 2W6CX 4ARAA 4FWBA 1UK6A 3G02A 4Y2XA 2Y2UA 2QR5A 4UHBA 3FCXA 1VXRA 4M0MA 5ALXA 1MX9A 2YXPX 4HRYA 4PSDA 2RIPA 5CXXA 3PF9A 1UFOA 4AO8A 4GW3A 1MN6A 2WIDA 3DNMA 2WIFA 5CT9A 4J0GA 5ALRA 5I7UA 3FLEA 1ISPA 2QOEA 2HFKA 1XQYA 1QIMA 1XQXA 5ALUA 2XUIA 1HBJA 4J0CA 4X3CA 2YH2A 5I9IA 4F0JA 4FNMA 4RPCA 3ESDA 2DHEA 3H1AA 4DGQA 4UHHA 4Z49A 4OD0A 2BFNA 5CRIA 4DMCA 3IUMA 4AB1A 5FLKA 2GBGA 3G7NA 2WUGA 4H18A 1JKMA 1JFRA 1WHSA 1CUXA 3C6BA 1MPXA 3OOSA 5BOVA 2XMRA 5ALKA 1F0NA 2XT0A 1ORWA 1E66A 5FV4A 2CB9A 4G1FA 4F5ZA 5T4FA 4X00A 4G8DA 3M83A 4QLAA 3O4JA 1K6EA 2QXTA 1BCSA 2VT6A 1BE0A 2XE4A 3HEAA 3WK7A 2JF0A 1ZI9A 4Y2VA 4TPKA 5ALGA 1CUGA 2WJ4A 4JYMA 5E4JA 1HDEA 3PUIA 4UBMA 1F8UA 3F67A 1LPBB 5A7HA 1LZLA 3MUNA 5A62A 3FAKA 5DLPA 2DQYA 4KACA 3C87A 3WQHA 2H7XA 2JGIA 1C7IA 3BJRA 1CUUA 1W4LA 1EB8A 1EH5A 2YASA 3FSGA 2ZJ7A 1GZ7A 1EI9A 4BAGA 1CUEA 5AK6A 3U1TA 1IZ8A 3FVRA 4C87A 4N8EA 2XMBA 5HF8A 1XZCA 2EEPA 3FLBA 3FYUB 3ANSA 4DIUA 2X5XA 2FUKA 4X6UA 2PKYX 1ZD5A 2CMFA 5EHQA 4EY5A 3KXPA 2JGJA 3C5WP 2HA2A 4FBMA 4DLNA 4WDQA 1CUVA 2WKWA 5K3AA 2PSHA 3WJ2A 5C8VA 3BXPA 2JGLA 3M82A 1QIKA 4BAUA 3G0DA 4B84A 3STWA 1HPLA 4J03A 1LPAB 2FJ0A 5ALQA 2GYWA 3H04A 3FNBA 3QH4A 4LXHA 3PDCA 4X97A 2ZYSA 2XDWA 2PM8A 1MT3A 4G8CA 2QUAA 3D59A 5DWDA 1L7RA 5HKAA 1AKNA 4UUQA 2WU4A 3ANTA 1FFEA 3KWFA 2JBWA 4KEAA 5AK5A 4NZZA 3L1IA 4Y2QA 5KBYA 4PV7A 1VA5A 3O4GA 5JAHA 3S8YA 3H2IA 2W22A 1JJBA 3R41A 2FX5A 3DCNA 3NWOA 3HI4A 2OCGA 3A70A 1R1DA 1TCBA 3K9BA 5IVHA 4WY5A 4MYDA 1DU4A 4OUKX 4G4IA 1UK8A 3MVEA 4Q1VA 4IO0A 1BU8A 4UHFA 1YA8A 3WKBA 4B80A 1C4XA 3C43A 2ORYA 1QE3A 5AICA 4BDSA 2XQIA 3F98A 1Q0RA 4Q3KA 4KAJA 4B83A 2XUGA 3FWHA 2OLEA 3G0BA 3STVA 2P8SA 2IX9A 4KE8A 1WCYA 1UOPA 4KJXA 4JUIA 2QZPA 4WCVA 1ZIXA 3C70A 1YR2A 1DTEA 3F96A 4V2IA 5AKYA 3WWCA 3WIOA 1IZ7A 5HFNA 4L9AA 1CEXA 2ZSHA 3HXKA 1VOTA 1XFDA 3V1NA 5FDFA 2GYVA 1DINA 3ZV7A 2K2QB 3KOOA 4W1RA 4ZV9A 5ALDA 4I19A 1QIEA 3G0GA 1Q84A 2PSFA 3B5EA 3D7RA 5JANA 4IHAA 1JMYA 1EB9A 4B0PA 2XMZA 5K3EA 3FCYA 5LKAA 3E1GA 4GI1A 3DKRA 5EIHA 5EGNA 5HKBA 3QMMA 1DX4A 2AXEA 3HZOA 4X95A 4C4YA 5AI5A 4AO6A 3H2GA 2WIGA 1P0IA 3O4HA 4GWLA 1U4NA 2CEKA 2HA7A 3E4DA 5HF5A 5LZ5A 2ZYHA 3LP5A 3QPCA 4RE6A 1E89A 1B41A 5KWIA 1GQRA 3RLIA 4L3WA 3VDXA 1QIJA 5JAOA 5HK9A 2I03A 3WL5A 2XB6A 3WYDA 1XROA 3M81A 1DQYA 3G8YA 4QNNA 3Q8WA 3QBJA 3PI6A 1L7QA 3OTQA 4XWGA 5FOQA 2JEYA 4X85A 3IUQA 4DMFA 4EY4A 3ZLUA 1FFAA 4U2DA 4B81A 1C7JA 2G4LA 5CTAA 1VLQA 4TGLA 2B4KA 5AHXA 3VJKA 1IUPA 2PPLA 4GHWA 4EY7A 1PJAA 2XUFA 3ZPXA 2VT7A 2PBLA 1THTA 3AILA 3T4UA 4E15A 4AZ0A 3I1IA 4K6KA 4L0CA 5J3JA 1CUFA 2GBFA 4FNGA 4GXNA 5CT8A 2Y6UA 3HABA 2PSJA 4BVJA 3H17A 5ALWA 1EA5A 1MX1A 4H7KA 4WJLA 4GLBA 4CI9A 1QIFA 1YS1X 2ZYIA 4C01A 3UUFA 1IUNA 1P0MA 1XLWA 5FPPA 1XZKA 5FUMA 1J06A 3OURA 1B6GA 4UBJA 3WL8A 3IVMA 3BF7A 4W9RA 3BE8A 2OQVA 5IVIA 3FOBA 2BUAA 5JD6A 2DFPA 2CBGA 2ZJFA 3IUJA 3BIXA 2GYUA 1QONA 2OG1A 3W06A 1PV1A 5A2GA 1ZI8A 2DQZA 5ALJA 3QM1A 1GPLA 5DTIA 2ONCA 4HS9A 3V1KA 5AK4A 5ALMA 5ALTA 4QE3A 4JH0A 2XUAA 5FKJA 1RYYA 4B7ZA 2WJ6A 5K3FA 4IH4A 1KEZA 4YK7A 4G5XA 1FFCA 2DHDA 5AJHA 1E3QA 1VE7A 3F8SA 3NUZA 2O2IA 4OU5A 1GKKA 4LYEA 4J0DA 1XKLA 3ZWQA 1CPYA 4H7EA 1ZOIA 5D7BA 3QMVA 4HXFB 4EUSA 1EVEA 2WHQA 1I6WA 4PQEA 5EI5A 3ICWA 4W1QA 1QTIA 4G4GA 5IVKA 1XZAA 3L1JA 4DSZA 5LIPA 2OCLA 4DNQA 3QYJA 5JZ9A 1UKBA 3VKFA 3D5EA 5ESRA 3CN7A 2OQIA 4N8DA 4K2AA 3W9BA 3N0TA 3QITA 3PFBA 1XQVA 1ETHA 4CIAA 3QMWA 2PSEA 4INZA 1Z68A 3WWPA 2C0QA 4EHBA 1TIBA 2HU8A 3IA2A 1QTRA 4KR0A 1QLWA 1XZEA 3YASA 1UK9A 1M33A 3D2AA 4CIBA 3IBTA 5AKLA 2JGEA 2ACKA 2QT9A 1XZGA 4B6GA 3WJ1A 4GBGA 2H7YA 3GELA 1G66A 5C81A 2VATA 2VF2A 5BWBA 4IQ4A 3A2MA 4ZRDA 1ZIYA 5FP0A 5D3ZA 4DM7A 1UXOA 5ALOA 3H2JA 3AIOA 5JD4A 1LBTA 1JT2A 5LKRA 3E3AA 2WUDA 5LP1A 2C7BA 4NS4A 3I1YA 3PE6A 4H35A 2B20A 2YYSA 4U2CA 4U2BA 4Q82A 4WDRA 1K4YA 1MAHA 4CCYB 3DKKA 2QM0A 4BCBA 3WMRA 4Y2PA 1JMKC 4HZGA 1R88A 4B9EA 1CLEA 4DNPA 3JWEA 4QDOA 4C6HA 5JALA 4HXGA 4UPDA 3GZJA 2O7VA 3I28A 4GEGA 4X90A 5A71A 2Y1KA 1EK2A 1CFJA 2QUBA 3DOHA 1CUIA 4N5IX 4EY6A 4M0EA 1AMNA 1SOMA 2BJHA 3LIIA 1HQDA 2H7CA 1R3DA 1TK3A 3EBLA 3JW8A 1H2YA 2X8BA 5ALZA 4NVRA 4N5HX 1CIJA 4Y2UA 3WI7A 2WTMA 5JZSA 5HF6A 1E8MA 4BAZA 3RM3A 4MYSA 2C5GA 3QPDA 3W2TA 3QPAA 1FJ2A 3R3VA 2JEZA 3AZPA 1XRMA 3CXUA 1BS9A 4LIPD 1GPKA 1T4MA 5DJ5A 4PF1A 4Q3OA 4L72A 2WQZA 3JYHA 3STYA 1QIGA 1LGYA 3ILSA 3IURA 1EDEA 3WA6A 1R9MA 4WFJA 5ALHA 1QO9A 2XLBA 2XQFA 3A2NA 1A8SA 2ROQA 4UBKA 2PSDA 2XUPA 4H77A 2DR0A 5D3KA 2WFMA 3R3WA 5ALIA 1ZD2P 5H3HA 1CQZA 3DYVA 3R3YA 4LYDA 1Q0ZA 1JJIA 2HIHA 4MQLA 2X76A 1YAHA 1EVQA 3WWDA 2VJCA 4CCYA 3K2IA 4H0CA 4W63A 3WZLA 5AP9A 3WKCA 1CR6A 5ALEA 2J4FA 2HADA 3AFIA 4U2EA 2H9YA 3H2KA 5ALLA 5JARA 1N5RA 2AJ8A 2B61A 3I2HA 3R0VA 2WILA 1XZLA 3Q0TA 5CH8A 4ITVA 2QMQA 2EDAA 5JAUA 3ZLVA 2PU5A 2Z3WA 1UK7A 1ZD3A 3KSRA 4CG1A 1N8SA 4UHDA 2PUJA 1XZBA 3R3XA 5ALSA 4F60A 3LCRA 4FLEA 4KYVA 3S2ZA 4Q34A 4CCWA 4B9AA 2OCKA 4HXEB 4I4CA 1AX9A 1G42A 4BP9A 2CJPA 2JGMA 1ZICA 5K3BA 4CFSA 5AKXA 1UOQA 1XRQA 1IVYA 5AIBA 2BGRA 4U2GA 3RK4A 2WM2A 4BC1A 1IUOA 3M3DA 1W6RA 2GBIA 4RE5A 4C4ZA 2G5TA 5AM3A 1GKLA 3HJUA 3HLKA 1G5FA 1DT5A 2HU5A 3C5VA 4Q3LA 3KDAA 2Z8XA 2VJBA 4QLOA 3A6ZA 2VAXA 1G4HA 2G63A 2XQJA 1HLGA 5AKZA 2RAUA 5AH0A 3R3ZA 4BRZA 1E5TA 1QZ3A 4UBLA 2D5LA 3R40A 4QDTA 4QWWA 4OB8A 3G0IA 3G9UA 3SC2A 5A7GA 2V98A 2HL6A 1T2NA 1SCIA 3DL7A 4U2FA 1OILA 2LIPA 3WYNA 1VXOA 4BZWA 3X3HA 4Y2JA 3RKSA 3I2JA 4KAAA 1GGVA 3HRHA 1AQLA 5AKGA 2XUKA 4X6XA 3D3NA 2ZJ6A 5ALYA 5C8ZA 4WFIA 1VZ2A 4B85A 1SFRA 2OGZA 2HHAA 5HZGA 4BP8A 4LHEA 3TGLA 3OC0A 4QWMA 3WWOA 4KE6A 1UWCA 3OG9A 4KAFA 5C8XA 2PU7A 2V97A 5ALFA 5A6VA 1EK1A 4EY8A 2WG1A 2V96A 3VVLA 2OXEA 5CW2A 1IMJA 4UBIA 5AM0A 3WLAA 1E8NA 4H7DA 1CUBA 3F9CA 1EINA 4WFKA 5HCUA 2C4HA 3V1LA 1A7UA 3KD2A 1MAAA 3CN9A 2OAGA 3WKAA 5DYWA 3B3QA 4KRXA 3DL4A 5EIAA 4FFVA 1XQWA 1AURA 3AJAA 3STXA 3H19A 5LZ7A 4IH9A 4KE7A 4FFWA 3AINA 4W1SA 5CMLA 3W05A 4HAIA 4ZI5A 1BN6A 1JI3A 5YASA 2O2GA 4K6GA 4UBOA 4G8BA 1VJ5A 4E11A 5ISMA 4MQMA 3IUNA 3I2KA 1ODTC 4Y2YA 2XMQA 1F0PA 4ARBA 2ZVDA 1P0QA 4UFNA 5E4TA 5HQ3A 3R3UA 4PNZA 3T52A 1ODSA 4ZWNA 1CUJA 4P93A 2XMSA 1HKHA 3C8HA 1MNQA 2CUTA 3VXKA 4EA6A 2BAGA 3VISA 4YPVA 3D2CA 3H0CA 3WK5A 5HQ3B 1WOMA 1MX5A 3I6ZA 2VJDA 5EHNA 2GZRA 2XMGA 3I6YA 3WK6A 5AKHA 4NMWA 4BBZA 5CXUA 1AGYA 5ALNA 3C6YA 2ES4A 3QZUA 2V9ZA 5T4EA 2JGFA 2AJCA 4MEAA 4OYYA 5A7FA 4OSEA 4QDUA 4X91A 1BEEA 1K8QA 5JAPA 4ROTA 3BDVA 4MWTA 4ZREA 4PO3X 3EQ9A 2XUOA 5AOAA 1Y7HA 4XJVA 1YB7A 1CRLA 1SC9A 2VSQA 1DWPA 1O6FA 4X93A 2Q0XA 3TEJA 2B9VA 1TKRA 3D2BA 1HL7A 3RARA 4MXDA 4HTAA 1XZFA 1SCKA 4LXIA 3ESCA 3EQ7A 2WG0A 5BWCA 1THGA 4FDMA 4X6YA 3SWWA 4EZIA 2C0PA 3LS2A 1XZMA 4BC0A 3O4IA 4EB0A 1Q83A 4E46A 3G9ZA 5SYMA 4AZ3A 4KRYA 3H2HA 3ESBA 4DMKA 1U65A 1UKCA 1XRPA 1DX6A 4Y2TA 3STUA 1TQHA 4QA9A 5CURA 2OAEA 2C5FA 4BVLA 3DYIA 2ECFA 2ZYRA 1VKHA 3FVTA 4OCZA 4F21A 2DSNA 2BKLA 4H7HA 2RHWA 2WTNA 4E14A 3I2FA 1TRHA 5CT6A 3B12A 3W04A 3I2IA 3AZOA 5JATA 4P08A 3EF3A 5I8PA 1QO7A 1NX9A 4GECA 3H1BA 1JU4A 1K5PA 5EIEA 5AOBA 1BCRA 3I6MA 1RP1A 4ZXFA 3ESAA 3G9TA 2WUFA 3WIBA 1P0PA 2WG2A 4X71A 1MJ5A 4DSAA 1WB6A 3WWEA 3BJMA 1BEZA 5ALVA 1ACLA 1KU6A 1LPPA 1R4ZA 5LZ8A 4C88A 1JU3A 4ETWA 1QIIA 1DQZA 5K3DA 1ZGBA 2RHTA 2O7RA 1O6GA 1N5MA 1CV2A 1QOZA 2Z8ZA 4HVTA 4BYMA 3HC7A 1FFBA 2I3DA 2WHRA 4H7FA 5EHXA 4BE4A 2HRQA 3WK9A 4CG2A 1JJFA 5CH5A 2WHPA 5EHZA 1BROA 5T4BA 3O9VA 5DYTA 4X7BA 1LLFA 2GBCA
chains in the Genus database with same CATH superfamily
3RUEA 3RBZA 1F3LA 2FA9A 2WWHA 3EQ2A 5DK6A 1FMTA 1VG0B 3BFVA 3H1TA 3PGMA 2I87A 3DMGA 2CYAA 4MHOA 1M6VB 1FF9A 2IS2A 3V80A 4IQ8A 3KR2A 1JAZA 2Q27A 5T6MA 3AOEC 3LIPA 4ENSA 4X5OA 3AX6A 1WMBA 4A8PA 5C8YA 5J59A 3CLHA 3L2OB 3MTAA 3IYLW 1N9KA 1C14A 2LCIA 4JI0B 4RGBA 2GF9A 3MUOA 2GCNA 2JLBA 3MQ2A 3D31A 1LF5A 2GOYA 3DLTA 3IP6A 4HGPA 4JSRA 5FXMA 1U2GC 3SYTA 3UT5A 3HJTA 3SNKA 5C3UA 4QO7A 1TADA 4D0LB 5DYYA 3NGXA 2EBHX 4DEXA 3IHWA 3C8UA 3O9MA 4RELA 4BX2A 5I6DA 5L7TA 2O2XA 3EMBA 1ZJ5A 4BFLA 1RQPA 4IO1A 4BPBA 5EIBD 3HO6A 1QHYA 2IEDA 2P6PA 3PWSA 1UPFA 3RVQA 3WXMA 4YCCA 5JS7A 3NHPA 2ZPTX 3LPAA 2OBYA 4NSNA 1C8VB 2WABA 5DX8A 4UUPA 2JZOA 4TRJA 1IM8A 2JFFA 1O87A 3TQRA 3BB1A 4KR2A 3EHDA 2ZJ8A 4S1TA 2RHDA 2C7RA 1N2GA 2DLCX 3PUWA 5SYNA 4MUHA 1RWNA 3FYUC 5M5BA 4L3OA 4OGKA 2FZWA 2OD9A 3O21A 3RC1A 1QV9A 1Z74A 2QSUA 4ASUA 1DFHA 1DS6A 1NXPA 3KHSA 3ZK9A 2ZWAA 3QXSA 4O4HA 1JAYA 3IQGX 3DDUA 2R1TA 4MQEA 3KUUA 3V6MA 5CLJA 4MWGA 3WFZA 2YDXA 1Q92A 3VQTA 1MHTA 1T5IA 5J4LA 2I9KA 1GAEO 4DR4B 1VL2A 1BC5A 4KYIB 3LFTA 3PFFA 3R5HA 5EHIA 1TK9A 5F4ZA 4ESHA 1H2ZA 5KC9A 2NP6A 1VL6A 3K92A 4IW3B 2XUHA 3C6ZA 4GRDA 4QTUB 2QENA 1CZUA 1F4VA 3CRRA 3KOMA 4R8SA 3ORRA 2OC9A 4Q9NA 5ALPA 3CLTC 3CV3A 3I42A 4HAYA 2NU7A 3ENKA 3TJMA 2I3BA 2HGSA 5LB2A 1LNSA 1RPZA 2PQ2A 1VRCA 1XMJA 1B16A 2PA3A 3IMEA 3QFHA 3KR0A 4GMGA 3RRYA 3VFDA 3WNDA 1QGZA 3ZWCA 3AUYA 2ZYAA 1GDHA 2OZPA 1MB4A 2A33A 5COQA 1I0IA 3HDHA 4JLNA 4ACBA 3MTBA 4D9JA 1EXNA 3DDSA 4AZ3B 5FR1A 4ZI7F 1DWQA 3MZ0A 4V39A 2FR8C 2IP2A 3K70D 1WG8A 3O3MB 2VQ3A 4JB8A 4Q9IA 3Q7TA 4AS3A 2JLWA 2WYIA 3NBFA 2V58A 1ZH8A 1Z4NA 4JL5A 4D4MA 5TB5A 1MJGM 1R37A 4WKBA 3OQOA 8ATCA 1X9GA 1VHDA 4BNZA 2A4MA 4CFYA 4DTCA 1FFDA 2YW9A 4GL2A 8MHTA 4BXOA 3SAJA 1V8DA 2HW8A 1E9RA 2C8JA 1KDYA 4DXHA 4ZYZA 2V3WA 1I6LA 4QHSA 5EJEA 5IASA 2Z6AA 1IQUA 2C84A 1A9PA 3ZN2A 2YJNA 3HUUA 4M1SA 2ZS7A 3SQDA 5G40A 3SR0A 3T1OA 3HKBB 2NZJA 3ZXUB 3BMQA 3NOXA 3T3PB 5KTTA 1W5SA 3W2IA 3GV0A 4BO5A 3AUFA 5TGZA 1BE8A 1SOWA 3DEJA 3F5QA 3K6KA 4I2VA 5TVGA 2PKWA 4HNAB 4D9HA 4DOMA 5BSFA 2Q49A 5DNUA 5EERA 4G8JA 5ABPA 1PRYA 4UAGA 2JIMA 1N9ZA 5KVQA 1QRSA 2UYHA 2DFTA 3AKDA 4JR1A 5FL7A 2QJWA 4FJ1A 3PITA 3SMVA 1VKJA 2L82A 2AMLA 1O54A 2ODEA 2C5EA 2Q7OE 1ZVJA 4DWJA 5ITZA 5CNKA 4MWCA 2KQUA 5DSTA 4C0WA 1IK4A 4FFBB 3GMSA 1YS9A 4HDNA 4ZVRA 4CDNA 4EECA 1A1VA 3SQXA 1JDJA 1EFUA 2AXQA 3TZEA 1NR5A 3A2LA 5CB6A 4MRAA 1FBNA 5AKKA 4LQLA 1DUVG 3WGQA 2CK3D 3GDWA 3IPCA 4IVPA 4JVOA 2UYQA 5I8WA 5BP7A 2D5BA 2JAOA 1GLVA 2J0UA 3OOEA 2BGLA 4RTSA 3EXEB 3GUVA 4N82A 4CIVA 2JAQA 3CCFA 1UC9A 2QJFA 4QEDA 1ECFA 3CE9A 1Z83A 2OZKA 1TZKA 3QOYA 3EXHA 2VPYA 2Y4NA 3H9JA 4MJXA 4WCFC 4RTPA 4AO7A 1RTTA 4IIUA 2WJJA 5GJCA 5D01A 5GOTA 1A4RA 3U48A 4ZK2A 5C8DA 2PG3A 2VHJA 3CLKA 4K6OA 4NICA 1LH0A 2YQ5A 4KDFA 1JDTA 4BTLA 2C3OA 3OTWA 1XDBA 2ZWPA 4LZLA 1XTUA 1IY9A 2JFQA 4FHCA 3UJCA 3AM3A 1PVDA 2XLCA 1Z0IA 1OQAA 1XYVA 4XYBA 1XLVA 3L41A 5K3CA 2HV8A 1FLVA 1SXPA 3ZH2A 3IIIA 1L4FA 1ZL0A 3EPJA 1Z2AA 4BX8A 1OYWA 4MCIA 2O7SA 5F98A 4Y7DA 1C3JA 3I39X 3SX4A 1ZJ6A 3GGJA 1HLFA 4W8OA 4MKHA 3JD4A 3SSNA 4PQRA 5MN4A 3VVMA 5FWXA 1GTZA 2PX5A 1JQLB 1ORIA 2VWPA 3VAYA 4LNAA 3KZOA 4IDPA 4BS9A 3KPJA 5FRDA 5TS3A 4NZOA 2QKYA 4QXAA 5KC8A 3B20A 2D00A 2AKEA 1OCEA 4IIJF 5F35A 2G5PA 1EESA 1YNOA 4AX8A 4FFBA 4Z7NB 3B3GA 4KI7A 4PFJA 3AESB 4XEHA 3PKIA 2JIBA 1PO7A 2I78A 2IOHA 3FPJA 3A10A 3PFHA 1L4BA 2H29A 2B30A 5DM60 3ET5A 1QUFA 3HR8A 3OPYA 1FA9A 2AJBA 1N6PA 3P2OA 3CWCA 5DHFA 1PJSA 2EATA 1G41A 4PSAA 2XR1A 2ZSKA 5DGIA 1TECE 2I1VB 3MEQA 3PD1A 3JYOA 3BM5A 1XL1A 2QE6A 4KZKA 5H1YA 3U09A 2RGXA 1NJ6A 1UZAA 2R7KA 3CCBA 3KYIB 4BGDA 2SCUB 1GT6A 2B1GA 2VSFA 2P9CA 1K5GA 3R6WA 5CLHA 5TXGA 4NMXB 4Q4HA 4JI6B 4O2BA 5LZ4A 3OMWA 4YXWD 4CF4A 1G2IA 5CDGA 1UJ6A 2IYNA 4PZLA 4BO2A 1REQA 4OG2A 4YASA 3PF8A 4P4NA 1IBCA 1QGED 1SXJC 3DL0A 4TVSA 1TVEA 1VCIA 2C57A 5ED0A 4Z4QA 2RHLA 3BCHA 2NU7B 1GGHA 3UH1A 3CZ4A 2I54A 3LWDA 4KQFA 5JMPA 2FPGB 2VK4A 2WEKA 5HM8A 4PO9A 1XEXB 1YQXA 5L3QA 4MUEA 5AVWA 1WPXA 4BNHA 2VBCA 2ZSEA 3CC8A 1RHUA 1YB2A 4KNYA 5ED4A 1UCFA 4TL7A 4UW9A 5CFRA 3DVAB 3ULKA 3ILYA 4GM4A 4L85A 3PTLA 2BYTA 3RG2A 3OZUA 4TVKA 2FPWA 1JSZA 3IMCA 5B1EA 4ZTZB 1WSBA 5K99A 3ZU4A 5A4IS 2AZDA 2QN8A 3GFFA 3USES 2WJ3A 1E2IA 4AY5A 2WB4A 3LLSA 5LA6F 4JSYA 4W5WA 4B43A 2LDBA 5DIZA 5LZ2A 5A4FS 4Y9SA 1U9ZA 5CGZA 2QD3A 5IHPA 4FD2A 1N2OA 1OXXK 3G2HA 1IZZA 3KSMA 3COJA 4RK1A 4RPJA 4DIOA 4N54A 5JUWA 1HTWA 4RLSA 1JPUA 1UT6A 4KWHA 4EHHA 1UQRA 1C1DB 1NBWB 2A5YB 2FPIA 4Q6BA 5EZYB 5FI3A 5CDFE 1DCTA 4V03A 5DGHA 3I83A 1W94A 2XNJA 2JJ8A 3D81A 1YULA 1SB9A 3PXCX 4LDQA 5AM5A 3L7BA 1FNCA 1E3IA 1U2DA 1EP9A 3D3WB 5J47A 1MEOA 4S05A 3B52X 4DBZA 2WD7A 4MLZA 4ERXA 4RJJA 3I76A 1KFEB 4RBNA 4C0LA 4EVSA 2I1LA 2F17A 3P9NA 2Y1XA 2VZ9A 1PWXA 4O6VA 4KB5A 2AC7A 1GZVA 1CUWA 3KJNA 3HN6A 3MC1A 2JHCA 4C2BA 1I7SB 1WKVA 3MSCA 1JLHA 1U9CA 3UJ9A 3LJKA 2O3RA 2WAMA 3KKZA 4RFLA 4E2FA 1DLJA 1JEDA 1UMDB 2AF4C 5AK3A 2G28A 1R4NA 1NIJA 1OY1A 3T7RA 3FUTA 3C14C 1LS6A 3GPIA 1ITZA 1Q1NA 1JIIA 1JL3A 4KIWA 5E6UA 4Z7OB 4WNAA 3VZPA 2EW1A 5JDIA 3BFJA 4F8YA 1VSQA 2RKWA 4KIUA 4OGFA 1WPRA 3L0PA 3M5PA 3KU1A 3RYCB 1V7ZA 3LX4A 2BP7B 4ZXPA 3NIFB 2QRNA 3DTVA 1PQWA 1Z15A 3WL7A 1HR0B 4XCVA 1DOZA 3M33A 3QELB 4NE9A 1GRVA 3VO9A 5LOVF 1RMQA 5KCZA 3CE6A 2GTIA 2W6QA 3P9KA 1AT1A 1MQAA 3QX7A 4L76A 4BGIA 4BKPA 4AY2A 1VGVA 2ID9A 3WIVA 4AUNA 4TXLA 5IVDA 1CRQA 3QKUA 1T1RA 3JQBA 1N1EA 2PZKA 2WUVA 1L7AA 3RR2A 1X14A 4GKJB 3T3HA 1M0WA 1C9YA 1II8A 2DPGA 5HRAA 1ZRHA 2Q5QA 4IS3A 1NZJA 3KLOA 4RZUA 3VOAA 3HSKA 1D2RA 2RONA 4KK4A 5DRTA 2JIDA 4GOND 5EJFA 3TIIA 1A4XA 4JASB 4DIDA 1KR2A 1KP3A 1SIOA 4TX1A 2GWRA 3FG9A 4LYYA 4L8GA 4MW2A 3U3OA 1IZ9A 4E4RA 4YBRA 1SVNA 3OIUA 3ZDAA 1Y1QA 2YW2A 2BM0A 2FLKA 1K9SA 3BDIA 3LLCA 4J1SA 5T4HA 4HDRB 1RVDA 1I32A 2GFIA 3DEAA 3K09A 4LSZA 3RS7A 3QVOA 4OPMA 4ZU3A 4LI0A 5AM4A 4CM3A 3KWJA 4ENTA 5JO9A 3EN0A 5F5LA 3ZTYA 1XOIA 4IIBA 4MEJA 3M1IA 3ICVA 4FPXA 3GLHA 4QDZA 5HF9A 4JX9A 1G8GA 2OFXA 4Z9XA 3TVTA 4PLCA 1ESCA 1UBEA 3O3OB 3SYKA 3ZYCA 1PJRA 1T34A 4BIMA 1RJFA 3ZCRA 3K0CA 4RZHA 1N5KA 1V2GA 2ZIXB 3GUUA 5JI3E 5IKXA 3I9V1 3W8EA 3ID6C 1KVUA 3QG1A 2OVBA 2LR0A 3K2BA 2OWDA 4B3XA 1YQGA 3ND6A 2R1ZA 4DMHA 1GUAA 4DSOA 1J25A 3QPUA 1G8AA 1M0EA 4QFDA 4CL3A 1R3UA 2G40A 1ZM4A 2O23A 4DCPA 1CG6A 4G3XA 2HK9A 5GJBA 1E7WA 3NV9A 4GP9A 1E94E 3U26A 3BJEA 2EBUA 1B73A 3KVYA 4MV1A 1SOAA 2QGZA 1Z36A 4WX2B 2O5CA 3R7AA 3FNIA 2SICE 1A7JA 2WD7B 2B4YA 1WEKA 3CJTA 5DNWA 3SEFA 3ELWA 5BNFA 5LQSA 4UNQA 1HE3A 2D2VA 3CR3C 1KAOA 3NP7A 4I5GA 5DCWA 5F1KA 1MO5A 5JWRA 2OYRA 1LB1B 2QRLA 2BF4A 1RYBA 1G7SA 1U94A 2WSLA 3EJ6A 4Q00A 4C6TB 1SIBE 1T91A 1QG2A 4ZHQF 3MJTA 3IDSA 4MWOA 4CM8A 3ISTA 4CEIB 1STOA 3K73O 1JHVA 3H1EA 4MS3A 5CAEB 4JGGA 1T5DX 1H85A 1XRRA 3FI9A 1W49A 9GPBA 2Z83A 4W5QA 1IQ0A 1XNGA 2P9ZA 3ACCA 1J70A 3GJTA 2BFAA 3NNSA 1TI7A 2R68A 4DV0B 3P0JA 1CUZA 1C41A 1R50A 2RGDA 3BH6A 2X1MA 4QPJC 1W5TA 5HFAA 1XCJA 2JDID 1L4KA 4GMXA 4GSKA 3LDUA 5DHUA 1PJTA 5LQCA 3CZQA 5KIAA 2V6JA 3RK0A 5A4AA 1SH7A 4DIBA 4H31A 3FPEA 1GILA 2R86A 4JUCA 2ZXFA 4PYMA 1WDLA 1GRRA 2B36A 4UDNA 1QGYA 4DJFC 2XZOA 2C92A 1E3SA 2FQQA 4DS3A 3GUCA 3BRCA 2B1JA 3G5AA 1ZW6A 2P2DA 3DV2A 2R79A 3JD1A 3LWBA 3D7KA 2R6R1 4LZAA 2GD6A 4PGGA 4WIAA 5FJIA 3EG5A 3LD9A 4UKDA 1Q1AA 3AVUA 5JZBA 4P0QB 1M1ZA 5HZKA 2NTNA 2VNSA 2PZAA 2YXDA 3HHEA 4CM9D 1PHRA 2EJCA 2JAPA 3UAVA 1J6UA 2BKUA 2HT6A 4XVUA 4IOLA 2PV0A 1N7HA 4FBLA 5K4GA 4YWJA 3TLAA 3UC9A 2IYUA 1Q7EA 2EKQA 2V74B 3P2EA 4Q18A 1IN6A 4ERNA 5KYKA 5EGSA 1SBIA 1NUSA 3QVKA 4H08A 4NPHA 2W2PA 5CT5A 4DV3B 3V8RA 2NQ2C 3JQFC 1NYTA 2GBCA 5E4YA 1EVJA 4KX5A 2ZWMA 1JV2B 4RFSA 3K9QO 5IKPA 2SCUA 3EFBA 4MAAA 4S04A 3B6ZA 4E5KA 4HBGA 5G0VA 3IAM6 1SPBS 4MJLA 3N0VA 5GVSA 5E1OA 5F9HA 2E4ZA 3IBYA 3LT4A 4R1NA 3GEIA 3T34A 4DQKA 4TRNA 1PVVA 4FEAA 5CTJA 4AX4A 5F2EA 2GEFA 4LN1A 5FR2A 4Q03A 2YXLA 5DM70 5L45A 2GZ2A 3KQPA 3ASUA 3DYBA 4UQOA 2HF9A 4ZVMA 1JYSA 3QKRA 1K08A 3TRDA 1JLLB 3C8DA 4JP1A 2O8FB 2OZLB 3LSYA 2VOEA 2G9ZA 2FFRA 2EBWA 4XWWA 4DA9A 4U5XA 3HADA 1A95A 1A5SB 2W83A 3U4QB 3B9BA 3WO0A 3PHLA 4BO9A 4EL0A 3AXTA 3DG9A 2V7XA 5E6SA 3T4PA 4C5AA 5K45A 4RTNA 1QHSA 4Z9FA 3QE9Y 2QTNA 2Q07A 3FHLA 3EAQA 1X8XA 1V9SA 5K6AC 1G8PA 1XZPA 2E37A 4HH1A 5BN4B 1P7CA 2V6GA 4DRXA 4GX2A 1Y63A 2HK8A 5GIPE 1F8FA 1WLSA 2YRXA 2H5JA 3I9KA 1C8BA 3ENQA 4J75A 4L5YA 1EX7A 4B7UA 4C7KA 4ON9A 1FDIA 1QHEA 2QMHA 1B8OA 2BFFB 3DCJA 3NMUF 4LZPA 3BSSA 3T5GA 3S3TA 3MBKA 2ZTUA 3RADC 4EMUA 4EJSB 2ZB2A 1RI3A 1YZUA 5JHHB 1DV2A 1WZCA 3HR7A 4R6WA 4B82A 4F3CA 4ZYUA 3P9SA 5SY9A 1RQLA 1KEWA 2EJTA 1MP0A 1NW8A 3R24A 5DNVA 2YJ4A 5H81A 3TAXA 1F2TA 4JP8A 3VDRA 4DKJA 3NONA 4MAMA 3GZ4A 2BI8A 5AM1A 1BMTA 1Y37A 5CITA 4KR6A 1W88A 1R0LA 4TSRA 4QJ3A 4CQMD 3CM0A 3HB1A 2VSNA 2YV5A 4UPEA 2HSZA 1T10A 2OZVA 3SMQA 2FWIA 4L1KA 5E7IA 1LC3A 1EFLA 1OOEA 2VDUE 1RQ7A 2J9GA 4HDMB 4BBJA 4JVLA 2AFHA 3F47A 2VWQA 4JLAA 3UC5A 8LDHA 1DLIA 4O2AA 1EEHA 3L7DA 1V1RB 5D85A 3JATB 4O8ZA 1MX9A 5TJHA 3N2EA 1HA3A 1EM8A 4I1VA 3UHPA 2W9XA 3CRQA 4PLZA 2X13A 2FYTA 5C4GB 1YRYE 1VB5A 3SLGA 1LBEA 4JN6B 2PL1A 2O2ZA 5LQKA 2C5BA 3Q5DA 4ECEA 1ABBA 1HFJA 2WJIA 3AVTA 1ZN8A 1MN6A 521PA 4IIFA 4G1MB 2FP3A 4B6RA 3T1YB 4MIKA 2ZSJA 1BFKA 3C85A 1EFVB 2Y0CA 4J0GA 4UU1A 3UWSA 2IXEA 1SHUX 1L5SA 1WZIA 2AFHE 3UNXA 1UDCA 2DLNA 2J4DA 1CNEA 2FWPA 2R8EA 3ZQUA 1NIPA 1ZLYA 3FLEA 1HK7A 3ROQA 4GDFA 2PGOA 1U0FA 3AMVA 4S2EA 1XQYA 5BYBA 4FDAA 5TPZD 2HQ1A 2CBXA 4B74A 1JR3D 3VNAA 3B6KA 3Q9NA 4X3CA 1Y81A 4BNGA 4F0JA 5DBEX 5JEDA 1IEXA 3ESDA 4EJFA 3K9FC 1ECPA 2OTCA 2HJRA 4UUBA 4X8MA 5TQ2A 4WCFB 5KNCD 4OIFA 4DGQA 3K9GA 3W2GA 1QVVA 3I8OA 4XIGS 3AR6A 1U2QA 2CGEA 4UAUA 4OUDB 3V8QA 1H8EA 1D4FA 1TO2E 2CHUA 1NPDA 4Z1OA 2JGNA 2JJ1A 3TD2A 3WE7A 3EEOA 4XTRA 2WQ6A 5EWJB 1SBHA 2H51A 4YRQA 3WNZA 4Z53A 1UT5A 2BFNA 2AG5A 3MTIA 2W90A 5TDHA 4A26A 4IDDA 3M2PA 1J4AA 1JAHA 1FRVA 2WUGA 3MAJA 3T3NA 1WY7A 1Z2CA 3VHXA 1ENPA 1NRJB 1SQGA 2G8LA 4AJOA 1JKMA 4HNQA 5GAJA 4ANFA 1E96A 4B6FA 1GN9A 1JKXA 1MPXA 1FLDA 5DI9A 2PMDA 4F9GA 1SO8A 5H8WA 1EK5A 3AL0C 3T7TA 2D1FA 3IDFA 4WACA 5ALKA 3L82B 3W3ZB 4DXDA 3SXJA 2PR2A 3EGWA 4YV7A 3AM1A 2WHXA 1EEXB 3M4XA 1RZVA 3NX4A 3AYZB 4BQIA 2DG2A 1CJMA 4CV1A 1SU7A 3NHKA 1U9IA 3OPYI 3OP4A 1AO0A 3AUJB 4FYPA 2RGRA 1Q19A 2Q1SA 2WZDA 1P31A 4F5ZA 3UN1A 3K20A 1P17A 4H1TA 3H4MA 5LQAA 1LVGA 2P68A 3A6JA 5D8DA 1Z7BA 3NEJA 3OIWA 4P7KA 3KV1A 3HKCA 2XT6A 1E5VA 4JQOA 4KK3A 3EX7C 1B8VA 1K6EA 2G25A 2JFBA 5GWXA 3CRVA 1VBKA 3KYCB 1QANA 3AR3A 3ROPA 3PNSA 4C7MA 3FVWA 4EW6A 4IXTA 2WA2A 2NIPA 4LX0A 3AG6A 3DDWA 3T3IA 2JFPA 3GDOA 2RGCA 3QKWA 2JF0A 2PKCA 3BTUA 5KUTA 3AP2A 1WMAA 3UXEA 5JTUA 4E51A 3DBVO 2XVZA 2JJYA 4JDUA 3DKPA 1TQ6A 4MLPA 1HDEA 4KSBA 4UBMA 1V39A 1GPUA 1FFHA 3F67A 3RT1A 1LPBB 3IKMB 3A8TA 1KF0A 3MUNA 4JOQA 1VI6A 2VNIA 4Q4DA 1Y0BA 3RAPR 3W9YA 3TKYA 2XDYA 3GFSA 2O8VA 4Z0TA 5F23A 1TZMA 3M6LA 3TUIC 5L3SA 2VUUA 3C87A 2BFBA 2I55A 3HL0A 3R1IA 4ONEA 1Z5NA 5KVAA 4XM0A 2JGIA 3LT2A 1E1QA 3EGDB 4KNVA 2ZB8A 4RAQA 5EKXA 2VRCD 1WSAA 1CUUA 4N40A 3MJHA 2C7OA 1RKUA 5EXTA 1NFFA 1J7JA 1WF6A 1EUDA 3ZHXA 1EH5A 1HTBA 1LC0A 2FMFA 2IPLA 3OBIA 1GZ7A 2VP0A 2APJA 3AC0A 4LVCA 2DC1A 1NVBA 4BAGA 1U2PA 3OBBA 5AK6A 3U1TA 2BONA 1Q7RA 2X1VA 1TYEB 1IZ8A 2W58A 4D80A 3ZVMA 4ALNA 3BIJA 4M1QA 1M5TA 3FMPB 1QGUB 4UEWA 1E1MA 5FAKA 1ZK3A 1RD4A 1TVKA 3PQ7A 4HRVA 4OSOA 2EEPA 3CSDA 1VHQA 4IFBA 4J3FA 1QQBA 3KAQA 3A26A 2WT4A 1J20A 1L8XA 4RSRA 4MW9A 4E5DA 5LJIA 2Y1FA 3TD9A 1WXDA 4RGVA 1SXQA 4ZQGA 1XSEA 4YBZA 1UFVA 4TTPA 3RBVA 3KXPA 1IVNA 3NBYC 2R8RA 2XAAA 3K94A 2IHUA 3TI9A 3B2NA 4R6XA 4DLNA 3IQWA 4CEJB 1CUVA 4MUMA 1H8ED 2OORC 2B6HA 4GLLA 3VI3B 4RDCA 1VYTA 1AQIA 3RRMA 2Q4TA 2XCSB 3CUEF 2H4YA 2PSHA 4ZMSA 2YWCA 1J0AA 4W9MC 1FU4A 1KPIA 1NQOA 4OK3A 2FVXA 3KJQA 3BXPA 2GD0A 2HBRA 3IP9A 1II9A 3RW9A 1TEZA 4BAUA 4AZSA 5JZOA 4B84A 1JLSA 1SQFA 3STWA 1HPLA 2ZUCA 2IPOA 1TGYA 1LPAB 2B98A 1P18A 1QHFA 2VLBA 2WJGA 2YNMC 2OK7A 1S4MA 2Z57A 3FNBA 2W2KA 3JQDA 3DEZA 4X3OA 1OLSA 3RVRA 1OYVA 3GRVA 5J58A 1V8OA 4LXHA 4X97A 4PPQA 1N78A 4MW7A 1ZCAA 2ZYSA 1JDBC 4RMJA 1T9GR 5ELXA 2D74A 1PZEA 1CY8A 3BVPA 5KOIA 1N7GA 5A0VA 1LSJA 4GEKA 1MT3A 2FEWB 2IY8A 3EGIA 4G8CA 2BIFA 3D4OA 3RNLA 1HSOA 1P1CA 4PYQA 4DVGA 1PQPA 3DFZA 3EVDA 1F4PA 2ADFA 4PIMA 3NV7A 4BV8A 2V65A 4GOXA 2HV9A 3MPOA 5CHEA 1E59A 4HQ0A 4EATA 4UOZA 1T43A 1L7RA 3NP9A 3QFRA 5CR9A 4UUQA 3PCRB 5H02A 1RABA 1ZMRA 4CKCA 3JQAB 1H6AA 1NYLA 3P0HA 5FL7D 5CCDA 4MSUA 1M73E 3O83A 1W9MA 5EJAA 4OQ4A 3L84A 4WXEA 5B3KA 4Z51A 3RANA 1KMHA 3MUEA 1NQTA 4DAOA 3IKTA 4D92A 1XI2A 1RWVA 3SHVA 4CR6A 5IZCA 5EFOA 1FYXA 3FE2A 4EFMA 3L0CA 1LU9A 1QQ7A 3S5JA 6ABPA 3MWYW 1UR5A 2CL0X 3HVIA 3K4HA 4NFSA 3CFYA 4Y0AA 1N2CE 3ZCTA 5JXWA 3B5JA 3DAYA 4LTNA 2I6QA 4H2DA 4R0NA 3C8ZA 1M2NA 2DR2A 2QD2A 1USKA 3GFTA 1DJOA 2I65A 3ESRA 4CI0B 3H2IA 3RODA 3DVLA 1VE5A 4XE5A 2WPDD 3ZLBA 4O0LA 3WGIA 3E6AA 2IXBA 1SY7A 4P5PA 4S1NA 1DOAA 2FX5A 4ZRNA 2W42A 1H2AS 3WFJA 1XTJA 5DB4A 4EW3A 2QPTA 1AMOA 2ZCUA 1VPVA 3ZVRA 4LOKA 1SC4A 1TCBA 1UJBA 1VKOA 4EQ6B 5IVPA 5HM6A 2H1FA 3V1YA 2G3YA 4LE1A 4IEIA 1H42A 1A9RA 1CR2A 5TARA 4G4IA 3OJEA 1UMDA 3CIOA 3AHCA 2BZ1A 2DF8A 4DQUA 5ADVA 4CVNA 5BR7A 3Q85A 1Z28A 3JQ8A 1JYEA 2QRHA 5E9JA 4U9UA 3FFXA 4Q16A 2GEDA 5KYGA 3SM9A 2MR6A 1QC5B 2IEGA 4KXFB 5F78A 3EFOA 2QP9X 1PR9A 1YA8A 2VPZA 2XEXA 3WKBA 1V6CA 5JNUA 4KLRA 5JAIA 3T7AA 3GK3A 2IBMA 3OPYB 5EOVA 2I6UA 2LGJA 2RHMA 3MGBA 4MUNA 1C4XA 3EBPA 3QOFA 4I8DA 4RD2A 4A0GA 3MHPA 5IEBA 2ORYA 1QE3A 4EG8A 5F7OA 2VRWA 4AJJA 4BDSA 2ZIFA 1JJAA 1RWBA 4RACA 4UDYX 3L8CA 1PR6A 1OHHA 1RMTA 1FDRA 1W2GA 3CHYA 2AF3C 4ZJPA 5COBA 4XQ9A 3GNQA 2HHLA 3STVA 3DXZA 1VBNA 4K81B 3IEVA 4H6XA 1J8FA 1KBQA 2A14A 4O3FA 4EJMA 2W8ZA 1UMBA 4UTRA 2VJLA 4QOJA 1YF3A 1ZIXA 2A2ZA 2EZ9A 1IXYA 3F3SA 1RM4A 2CBZA 3F96A 1DTEA 2X6QA 1DEXA 4I81A 4V2IA 5AKYA 4ZALA 4LVOA 2UV8A 5HFNA 3ZDQA 4DDHA 1BWRA 4MZXA 4DB4A 1W0CA 2LRHA 3NFYA 5HNKA 4K46A 2I1QA 5IP5A 3V97A 2W4IA 1OZHA 4MYHA 1OH8A 5FCDA 1RRKA 2VXYA 4LDNA 3VC7A 1YJ5A 4PYJA 1TM3E 4P4SA 2HI0A 2B0CA 2NWQA 3SSOA 1XF1A 5JQWA 1XCGB 1O9GA 5CJ2A 5HS4A 1GGEA 4N01A 1IN1A 4JHXA 5FDFA 2F1RA 3OU7A 1L5HB 2VNAA 1A8PA 3ZWWA 2A0XA 1QVRA 2FFHA 1NAIA 3KOOA 4ZV9A 1SXJA 3WSTA 5JW6A 3BL5A 2Z6UA 3IV6A 4XD2A 5ALDA 2ZRPA 4ZCRA 2NUAB 1F20A 4FWIB 3QK7A 4B0PA 1NXWA 4LJ8A 5K3EA 1CS0B 1MXFA 1P2SA 4S1PA 1FL9A 4PGMA 2UKDA 5TR9A 3T15A 4HUTA 1JHDA 2H1CA 1A9SA 1I9GA 2H07A 4M3NA 4O4IF 4R3NA 1PKXA 5H5JA 3S68A 1HNZB 4OXNA 3S2IA 3AKZA 4NJEB 2GPWA 4UC0A 1EGVB 3WNQA 3FA2A 4FT2A 4BO0A 4C22A 2I8LA 3BBPA 3UG6A 5F5XA 1H3EA 2EL7A 5DP1A 3IBSA 3NBKA 4C4YA 3PEYA 2ZRHA 3P20A 1E6UA 3THYB 4PWYA 3VR2A 4JS0A 5AI5A 4QIHA 4DCGA 4XAQA 1V11A 5EY5B 3IQIX 4MW4A 1A71A 2NZXA 5JSQA 3EH1A 1O95D 2FZKA 2X4LA 2WIGA 1P0IA 3RS4A 1ZQ9A 2QNRA 2H1LA 2HWYA 4RK5A 4B34A 3MINA 2OMKA 5FLEX 2C3YA 3O8RA 3G0OA 2P5YA 2WV9A 2IGBA 3R9XB 2QG4A 2CFTA 4RHUA 3W4JA 4ER7A 1G2PA 4QKQA 2ZYHA 5EMNA 4PO8A 3GLIB 1Y5NA 4L75A 3FH0A 4Q1EA 4D9KA 4MQFB 5KWIA 1E89A 3A2KA 1DKLA 2H6EA 3VC3A 1GQRA 3RLIA 2QMZA 3FCUB 1T9HA 1UDBA 3MYYA 1U1EA 1J9EA 4M1KA 5TPZA 2I03A 5JPCA 3CVJA 5KQMA 1KFBB 1XTTA 2VUHB 3RJ5A 3WL4A 1JS1X 2R96A 1JIUA 3TG8A 2EHJA 4BO3A 4HH4A 2DQKA 1XROA 3K5HA 4O4JB 2Y76A 5J23A 5JCOA 3E3NA 2GKSA 2ETVA 3EC1A 2YY7A 1A7AA 1L8QA 3A7EA 5DF1A 1E9BA 3C3MA 4QNNA 1U0LA 3DOUA 4IOKA 3NKVA 2P4SA 3QBJA 3QXGA 1KJJA 4N18A 1N3YA 1UBTS 3H75A 3GPCA 4UVDA 4V0OA 1ST3A 3NKFA 4XWGA 5JVDA 3QE0A 3DZCA 1Z38A 3EPRA 2NX2A 4H6WA 2VEDA 1W88B 3ASYA 3VDNB 2JEYA 1K8RA 1NE2A 3QWFA 4L6CA 1GUZA 5E4FA 5F2KA 1FU7A 4DMFA 4EY4A 3VH2A 1VL5A 4EHFA 4BUZA 4AULA 4IDCA 4LAFA 4DJAA 4EAQA 2V7VA 4Q15A 1RM0A 2ZANA 4U2DA 5EWLA 3F46A 4LE2A 4PLVA 1BGVA 4B81A 1X1EA 4XB6B 2R9VA 1EVLA 5CB0A 1VKRA 2HIMA 4MUJA 4KFCA 4PLWA 5E7JA 4TGLA 4EDHA 1PTKA 4IG9A 2X0JA 5GONA 5AHXA 3LGSA 2ZVJA 3M8KA 2NOAA 3L9WA 1DAOA 2D13A 3VJKA 2PPLA 4GHWA 1CHNA 4B3JA 1GZ5A 1NOJA 2B8WA 3EOBI 3VZSA 5DIFA 4BX0A 4JP5A 2XUFA 3ZPXA 3HU3A 3UM9A 3RRZA 3T1QA 1Z3CA 2B94A 4KXMA 1QP0A 2G1JA 2NLOA 3FCSB 1PFGA 2X0IA 2I7CA 2VH2A 2ASEA 5IJZA 4YRTA 1Z18A 3GLFE 2P2NA 1U8YA 4NMMA 1OLOA 1THTA 1BEUB 1HETA 1J2UA 2V1UA 2UZ3A 2NN3C 3CZAA 4U7GA 3C3YA 3OZAA 4ZVQA 1VTKA 2GCOB 2OZLA 1YZ3A 2W8BB 2X6RA 1PJ3A 3R3SA 4RENA 1P2FA 4NTZA 5ECDA 4BRWA 5AFSA 2FETA 4AZ0A 3VTFA 1Z5OA 2FZ5A 2PVPA 3PG5A 4K6KA 4ARUA 1VLLA 1SXHA 3PKZA 2BLLA 5AJYA 3UYLA 5C8YB 5KQSA 2Y6UA 1KQOA 4UOQA 4G23A 2IBTA 4N41A 1DNPA 5T5QA 5IXSA 3A58B 4IFTA 3BK1A 3QNUA 1NI5A 2XWBF 4KTTE 3D6VA 4WXPA 4CV0A 2V8BA 3K05A 2H2DA 3F5DA 4LBYA 1TKAA 1YS1X 3KWMA 3DO8A 2V5VA 1XLWA 4QGGA 2FWRA 5FUMA 2PRSA 1JU9A 3DMRA 1HYBA 3NJRA 4CUJA 5B3JC 2QVXX 4RYLA 3ZWXA 4DMLA 2J5KA 3IA7A 4HTFB 4ZOBA 1NXTA 3RSHA 5K9ZA 4BNDB 1GUDA 4Z2YA 1E63A 3ECCA 3IPAA 3AF0A 4IFEA 2FOIA 3IVMA 1OGIA 4U63A 3WL8A 2BTQB 1SZPA 1YR6A 4W9RA 2V7EA 2HCJB 3ANNA 1GRNA 4OQMA 1GN8A 1BHQ1 2F7SA 2H92A 2YINC 5IVIA 3RJZA 4CR8A 2C59A 3E9ZA 3LAWA 5KDDA 2ATXA 3AETA 3LC2O 3ZDYB 3ZHUA 2JEOA 2PD3A 4G6ZA 2HT1A 3IUJA 1E18A 2ESRA 1SIWA 1FPQA 3MELA 4J4BA 4BQSA 2IH4A 2VHYA 1KI9A 4Y1RA 4FR0A 2I34A 2UVPA 4KQEA 5G41A 1N4AA 3I3SR 3S2YA 1DIAA 1NJ2A 5A2GA 2AG8A 1ZI8A 3NOVA 4IDGA 1E2JA 2BFDA 3X1YA 5AD1A 2VXOA 2H85A 2W6ID 3QPVA 5JLJA 1WB9A 1XDSA 2ATIA 2ONCA 3TJZA 4HS9A 4KMSA 4GYKA 3TRKA 4YLGA 2ZBFA 2Y67A 2KM1A 1OI4A 3EZ2A 4JVMA 3WSVA 2CSXA 1K8YB 4PG8A 1KFJB 1V4VA 2WE7A 5CVUA 1OV6A 1FDOA 4JH0A 4Z7JA 2XUAA 4WZBA 2BHRA 4B7ZA 1Y3FE 4U3JB 5K0ZA 4I6EA 4XDZA 2PX4A 5K3FA 1FNMA 3CXRA 4CHTA 4LKRA 4G5XA 3K5PA 1NDUA 4OA5A 3THWB 1E6CA 5F2OA 1E3QA 2DPLA 3FOEC 2D7DA 3ZBUA 1VE7A 3ZNOA 2F2TA 2AVDA 3AEYA 4EKNB 2BFOA 4DSUA 1JE0A 1NP6A 1ZNQO 2MJLA 5LB4A 1MW8X 2GPTA 4MGKR 1W4RA 3HN2A 5AJUA 4UJ3A 4BO4A 4GPEA 1ND5A 1ZOIA 1SKUA 3DDCA 3HUDA 2V7QD 5G0UA 5HIKA 2JG3A 3ICCA 2VDLB 3VTKA 4HXFB 4KQCA 3ETNA 1QYXA 2GN8A 3AEUB 3MTJA 4PFSA 2Q7DA 4G0UA 3LECA 1G7RA 1WNFA 1RLTA 1G4AE 1SOVA 4HLNA 4PQEA 3U49A 6CHYA 2ONYA 3F73A 4BKUA 2OQ2A 1B23P 1RAEA 5REQB 1QTIA 2ZT6A 3F74A 1M2GA 4GBMA 4HYQA 1GKUB 4Q7JB 4W5HA 1EE9A 4Y1RB 5AUOB 5I4CA 5KINB 3DFKA 5LIPA 1FJXA 2C2WA 5L7YA 1KERA 3R7BA 2IE8A 5JZ9A 1ZXLA 3F3KA 3VKFA 2M1XA 4FFLA 1WO8A 4N3AA 4Q9DA 1GZ3A 2QT0A 1KJZA 3TE7A 1XIVA 5CNIA 2RBKA 1MH1A 4YAUA 4N8DA 3WLIA 1CB0A 1HQYE 2WP0A 4HATA 1R4MA 2XTZA 3NQ41 3T0GA 4QLBA 2NTVA 1PQUA 3AUTA 1PEDA 4LZOA 2Q4DA 1EMDA 3B38A 4PX3A 4CRWB 1Y9DA 1JPVA 2DJ5A 4WBNA 1C4OA 2W11A 5AUNB 3FZNA 3H5RA 1KJNA 2PQMA 1OF1A 2ISCA 5JBNA 1U02A 1W2WB 1N6IA 1YMQA 3DVAA 3LZ6A 2ZJYA 4FX2A 4PTLA 1RM5A 3OSUA 2KMLA 1BG6A 2CC2A 4BRUA 4GSLA 1XXLA 4DV6B 2C0QA 2X9LA 1R5BA 1YK0A 2IDZA 1C7FA 1YFZA 2ZK7A 2P91A 4D1YA 2BZ0A 3H3FA 2C88A 1QTRA 3PJEA 1F9AA 1NQUA 3CWZA 3QHAA 4NYIR 3O94A 3A1EA 1DTWB 2V6IA 4YCMA 5C4IA 1AQUA 1Z2NX 1PZMA 1UK9A 2IVFA 5D3QA 2NNWB 3PNLA 3PVSA 3JWPA 2CCKA 3KFLA 1C5KA 3WLNA 4AKSA 1GD1O 2C07A 1A8HA 5JCJD 4CF3A 3O8CA 4KG7A 3DONA 3PNKA 2VC2B 1OU0A 4YXFA 1SWVA 2KBEA 1GU0A 1U0NA 1RQRA 3CX7A 3RHZA 2YN2A 1LDBA 3AI3A 1SD2A 2PKXA 4J0EA 1V16B 3WJ1A 3WYBA 4QJBA 4DR6B 4EAAA 4IMIB 2JGDB 3FR8A 4ZQEA 4BB5A 4B2YA 1RFLA 4R1MA 5F2NA 3UJNA 1T35A 1G21A 4I9UA 3S1SA 2WSIA 4D43A 4DV1B 4AQ7A 3RT9A 3R6TA 4BBPA 4KLNA 4DM7A 4DR2B 1YL7A 3PR2B 4NOJA 4QTXA 3ZE1B 3K1YA 3U62A 4GC5A 1YZQA 1LBTA 1MUUA 5GM2A 3WLRA 4NBVA 4DJ5X 2EQAA 5I47A 1JT2A 4DMUB 4YMIA 2C7BA 3LVFO 3ETCA 2ORWA 3M9WA 3GLIE 4NS4A 5BQOA 4GP7A 1VP3A 1M0TA 3HCDA 2D54A 4GVXA 2H1WA 4BMDA 4MCJA 1Y1SA 4U2CA 1OLUB 3K35A 3PNPA 4IKOA 4RGQA 1MAHA 1BJKA 3DKKA 3FKSA 3RYIA 2QM0A 4IG4A 3SN6A 5G02A 2C9MA 2VTKA 2ZP1A 3OO0A 4OK5A 4B3BA 2C9ZA 1I3OA 4NEQA 1K9VF 1J56A 1N6LA 1DAFA 1UQTA 1T8UA 5IJAA 5IS2A 2QP4A 5EPEA 5IAKA 2FFQA 1ODIA 4US0R 3KFVA 1Z2EA 4OJKA 2Z43A 1MB0A 1JIQA 1P1RA 3B1YA 1OROA 3QE4A 2GAJA 4QDOA 2Q6IA 3UMRA 4C6HA 3MQFA 4BEBA 4D6PA 3ZHVA 1E2UA 5JALA 4Q3NA 1LA2A 4QQFA 1J0CA 1TPZA 4MVYA 5L3VA 4QM7A 4K03A 5L3QB 2WB2A 1GEGA 2CUNA 3GZJA 2HMWA 3HEBA 4JX8A 3Q3IA 1EUZA 4O8CA 5THQA 2OKGA 4FZ5A 2NPFA 2FAXA 3KG2A 1EK2A 3UUWA 4Y0VA 3VHXB 2IYWA 2C04A 2IYTA 4TKZA 2PMEA 3RFCA 1IY2A 1O96B 4TT3A 4EY6A 2G06A 3OI7A 1KC3A 1WU8A 5ES3A 2AX4A 2GEJA 2Y93A 1HQDA 1U8TA 2H7CA 1R3DA 1SUSA 4L4ZA 4JJKA 4C5CA 4YGYA 2VBGA 4JP3A 5I5EA 4JJ8A 3SR4A 3RAEC 3F1KA 1AB6A 4WK4B 1N3BA 1YS7A 3T9CA 4N5MA 1WV0A 1H2YA 3D6TB 3R75A 4JLMA 3KQUA 2D1YA 3LC0A 3BGDA 4FONA 4XM1A 3W5JA 2PZEA 1ZESA 2X8BA 1IXKA 2YFHA 4YWHA 5KYUB 4XRGA 1PJCA 1AA9A 1XD8A 1IOWA 3ABRB 5EZQA 3BHJA 4E31A 1CQPA 3ZV3A 3BORA 1FEZA 3UO8B 4MQFA 1KVSA 3AGPA 4IHJA 3GLSA 1QSGA 4P3YA 1OWNA 3AR2A 4Y2UA 3BWYA 1KSGA 3AVXA 4GLFA 3ZIAA 2DPHA 3JQBC 4TUYA 4EFKA 2H5IA 4M8LA 1B0UA 3VAZA 2HNBA 3SU8A 5BMVB 4IMRA 4Z8YA 1E8MA 5ITWA 4QDKA 3AQIA 3SCZA 5KYYB 3U3ZA 1N7JA 1SUBA 2Y8EA 3AB7A 2C5GA 3BG5A 3FWZA 4FK8A 2QQFA 4R84A 5DGDA 2XYHA 2NU8B 3W2TA 4HNHA 3ZHBA 4UNPA 1Q16A 4P2GA 4ER3A 4TSFD 1KY2A 3UQYS 4PLPA 3R3VA 4XZ3A 3BMCB 3CNQS 1R0ZA 1XRMA 2PX0A 2V5UA 3AEKB 3CXUA 4O33A 1GL3A 2X5KO 2PUDA 1GPKA 4LRUA 2RH5A 3HB9A 3OCVA 5B37A 2EF0A 2Q1XA 3IHTA 2Q5CA 5EEHA 2V7TA 2JARA 1INLA 3NAZA 2RAVA 2EG9A 1SHZA 3E61A 3PE4A 4TLLB 2PUTA 4XI9A 3CY6A 2QSJA 5B1SA 3MAAC 4D02A 5HXAA 4DR7B 3STYA 4L7QA 2Y0PA 5IKEA 2AEFA 5AW5A 4NAUA 3ILSA 2P2GA 3KS9A 1WSWA 3A4IA 3IQEA 3TDKA 2NZWA 3DAGA 1ZHHA 2XA1A 2OCYC 2ZBEA 2X8JA 4XX0A 4FE7A 3DL2A 2FXVA 1J0DA 1R9MA 1XXHA 2LUOA 2PYZA 1T5LA 3P27A 4PR0A 3RC3A 3WZ2A 4C29A 4DRXB 5B30A 1CZKA 4DC1A 1WETA 2XLBA 2AOWA 4P3KA 4OK6A 1XEAA 3Q7PA 2EFJA 1A8SA 3UJDA 3WIUA 2A92A 1ODJA 2JPDA 2ROQA 1U8FO 3Q15C 1XCPA 2IU4A 3KDSE 3JQ9A 1JJVA 5CDTA 1LV8A 3TEFA 1WWKA 3E84A 1QRTA 4FHFA 3A9CA 4ZC1A 1DCFA 4H77A 2FFJA 5F21A 4DLUA 2B8JA 2JRLA 4YR7A 4XWKA 5JAMA 1XA0A 5J1SB 3U4HA 5BR8B 3AWDA 1M34E 4AMUA 2CUZA 3F3YA 2GESA 2JJ2A 5CVDA 8ADHA 1R0XA 2WFMA 4MV3A 1RAIA 4JI8B 3M3PA 2Y66A 3TLEA 3L6UA 4A36A 3UMBA 1X38A 2HC9A 1QAOA 4Q4LA 2ODQA 3UGJA 2RH8A 4RDHA 1QLHA 3CVOA 3ZDEA 3Q9SA 4DSNA 3GLTA 3PEWA 3SJCA 1OBVA 2D62A 3EDYA 3NLLA 2IPNA 1P9NA 1NLMA 2FR0A 1JJIA 2JW5A 2NO5A 1JR3E 3NBQA 3GJ3A 3Q6IA 2IU0A 3C3JA 4BLWA 3LP8A 4MVJI 5AK0A 2FPRA 2RHJA 5CBPB 2X76A 3L7MA 1YAHA 2NTEA 3GQBB 4L0MA 1ZZGA 1U8AA 2ZVQX 1GAQA 2V7QA 4H0CA 1L5WA 3SP1A 3SQMA 2F3TA 3RTDA 1CR6A 2XWJI 3OCXA 3WKCA 1JEQB 1YL6A 1KEPA 2J4FA 2FK7A 1RQ2A 3ORYA 2VXBA 2WAXA 2EEZA 1XD9A 4NU5A 3AFIA 3UK0A 2BOVA 3NBMA 2I4MA 3OOWA 1I4TD 3H2SA 1DBVO 1KGSA 1QHXA 4K86A 3RLFA 2H9YA 2ZKIA 5B1IA 5DNDA 2IFTA 2D0PB 3ZI0A 3OECA 1TCVA 5B7QA 4CKZA 4QU5A 1N5RA 2E55A 2WSSD 4YAOA 3IERA 2CT8A 2F3UA 2EJBA 1FFSA 3TSCA 2Q50A 4DLWA 3Q0TA 4QBHA 3WIEA 2QX4A 3UANA 1HZJA 3RFUA 1MJNA 3PR3A 2P62A 2QMQA 1XCOA 4Y18A 4Q4JB 3VR5D 3IBGA 4HL6A 3RF7A 1NM5A 3JTEA 5BN5A 1ZU4A 5HPYB 5LYJB 4WZAE 5TMDA 5DHQA 1QS0B 4PIVA 1PYOA 3BE6A 4M49A 3ZLVA 4C6SA 4JYZA 2H00A 4Z0NA 3Q8MA 1L4HA 3DM5A 2CXUA 2RBEA 4M0LA 1UINA 5C5CA 2CV0A 4KV7A 1N8SA 1TE2A 2X4DA 1Z0ZA 3EFHA 4GPBA 4MWEA 4OAOA 5ERXA 1M6YA 3ZCVA 1XZBA 4BV2A 2C94A 3I0MA 4EDFA 1BJRE 3AXSA 2Q5EA 1Z2DA 3RAGA 1M76A 4GOJA 3UGQA 1ULHA 2FW6A 2Z2XA 3EZ7A 2CNWA 4LHWA 4QQKA 4F60A 3LCRA 4FLEA 4MQEB 3S2ZA 3N3AC 2Z1DA 4Q34A 1O0CA 4GPD1 5DBHX 3MCTA 3KK0A 3NRCA 5C7OO 2X58A 2BFCB 2Q0HA 3JQEA 1ZHOA 4GP6A 4KSYA 1OTXA 4EKEA 4TN5A 2X14A 4B4DA 4WNIA 4QGHA 5EVJA 1P61B 4D3FA 5A2QA 2C78A 3TNDA 1K5HA 4A5OA 1P81A 1WL8A 2JGMA 1N2ZA 4DHWA 2I4TA 3KQTA 4KWEA 4X20B 1M1YB 1RAAA 1U7HA 4NK4A 5K3BA 1UOQA 4YRIA 4RK0A 2OFPA 1KI6A 3DBOB 3PP8A 1XMVA 3MUFA 4X66B 4TV9F 4LHSA 2PY6A 3WFIA 1YQWA 1E2DA 5JCXA 1VKNA 4LZJA 1UC4B 3WLMA 3CLSD 3DBLB 4IHJF 3MWKA 3V2HA 3ACDA 4BC1A 2ZU6A 2GLUA 1FXUA 1RRVA 2E85A 3NRJA 1FYFA 1TD1A 2FMTA 5C46F 3M6AA 3SXUB 1NBMD 2WAOA 5EEGA 4XLTA 3W7VA 1NQWA 4B44A 3N5CA 2RGYA 2JGAA 2A0WA 1S02A 4JKOA 1C29B 2ZBDA 5U9CA 3CGGA 2V59A 1TA0A 1B6RA 3WBKA 3C3AA 4M1ZA 5AM3A 4KO1S 5FWAA 1TAUA 1G5FA 2FPXA 1Z6QA 4UM9D 5JBQA 2R66A 1UIRA 1YQTA 3DHNA 3M6WA 4I55A 4QHTA 4UM8B 4D9NA 2ZVPX 3WHLA 5K0EA 5LU9A 2JFVA 2Z0MA 3L8MA 4Q3LA 3SC3A 3N05A 4YMVA 1WXFA 1DJQA 2BE7A 4JJFA 3SC2B 3D7LA 4WERA 3NT4A 2VAXA 3UYKA 4D41A 4JI4B 2VUSA 4PCUA 4D56A 2G63A 1DWUA 2XQJA 3UJPA 4JBXA 1US8A 4UJ5A 1MTOA 2GVZC 4R4JA 4L08A 5AH0A 3JAMA 4Z9AA 4BFYA 2WJZB 4GWKA 1VYUA 1XLTA 4F9EA 2D5LA 1IQPA 4G5FA 2H8KA 2CKDA 2PGXA 2HB6A 5BVHA 2E82A 4QBIA 4II7A 2IYZA 3C97A 4PE5B 3TLKA 2QN1A 3G23A 3HUFA 2GB4A 4GAEA 4R7TA 5FPKA 3BCSA 3UV6A 3WL3A 2YL2A 3L92A 2CXTA 3DMHA 4QPZA 3SDZA 2A30A 3D7NA 3LX8A 5A7GA 4L6AA 4YR9A 1E7RA 1IJKA 2V98A 5JCPA 4M88A 4Z3OA 1I51A 3FPAA 3AW9A 1MRSA 2ZW9A 3JSXA 5HIIA 4IKEA 2WYOA 2XWQA 3FFTA 1VG9B 421PA 2LIPA 3CZ5A 5AVRA 4CT5A 3M2TA 2G0AA 2YZMA 5JSHA 2QLBA 1Y4AE 3OETA 1L4NA 1Z8DA 2IHTA 2Q21A 3HLYA 3TNFA 2IH2A 3DV9A 2X3UA 4YTEA 1BXGA 1F48A 1L5OA 4NZPA 3PHCA 4WTOA 1GUFA 3X3HA 4Y0NA 1Z0AA 4KXQA 5KDLA 1PYGA 1SVSA 3DZJA 1FP2A 3JYPA 4TL6A 5REQA 1AU9A 1GZ6A 4UUNA 3CR7A 1XQ1A 3W7AA 1MC1A 4C9BA 5I7HA 4URZR 1QS0A 3GHHA 4XARA 5BRJA 1LWOA 1FYVA 1Q1GA 3W34A 1KS2A 2YS7A 2E1PA 3E9DA 3HL4A 4ZVOA 1ENYA 2VPQA 3Q98A 3WGKA 3L7LA 3D3NA 4DV4B 1DC3A 2ZJ6A 3MF4A 5IJWA 5LUAA 4EGJA 2VI5A 3KETA 4D0GA 3U7EB 4F4IA 5C8ZA 1G21E 3JZFA 4OHXA 4TT3D 3RVSA 2X23A 3PXDA 1U7DA 3HKDA 1NP7A 2VP3A 3M5CA 4BY9E 2HHAA 1O95C 3TGLA 2P6OA 2PUGA 2O1EA 4FSHA 3I5XA 3OC0A 4Q9LA 3TOXA 4ZZ0A 2CD7A 2DH5A 3EFEA 3H5LA 4JB3A 5H68A 3EVEA 3ME5A 4IWYA 3N3BC 5C2JB 3OG9A 1UXJA 2CXQA 2JNWA 5FA5A 3DBLA 2PUAA 3JU3A 2D5IA 3VUFA 2PU7A 4F93B 1ZLXA 3KEGA 1J0BA 5EKUA 1GTL1 1KSHA 3D3WA 1ES9A 1TTQB 1LTQA 1PD0A 3OQJA 3OX3A 1KI6B 1T3LA 3EA5A 4CT0A 3DKVA 4P1ZA 2QPLA 4UARA 3WBBA 1JHUA 4ENWA 2F67A 1DIGA 1IIRA 1UBFA 2RKOA 2M6RA 4REQB 1EK1A 3OP1A 4CYMA 2IQ5A 2B9EA 3NTUA 3OUTA 3PNYA 4ENVA 1VCMA 3BD7A 1T3HA 2OXEA 3COWA 5GJWC 3VSEA 1IMJA 2QPAA 5AM0A 2GPSA 2IZ5A 4HAUA 3WLAA 1P6UA 1IOLA 2NO4A 2XB8A 4DR3B 1ZMOA 2XCLA 1DKNA 1E7QA 2X5NA 3F9CA 2BFDB 1V1MA 1Z33A 3INTA 4KMMA 4LCJA 4MUKA 1PNRA 1P2TA 2B2XA 1JHPA 3HRKA 1MAAA 2CLKB 3NM4A 3EXIB 2PT9A 5E6RB 3C98A 4WD3A 5E3IA 3LGAA 2OAGA 3BWVA 1EFRA 2ODBA 1NMSA 1BQ3A 4RLQA 1D7OA 1DEAA 4GMHA 3D1LA 4Z9YA 3RYFA 2J3HA 2GN4A 4CF5A 1S3GA 4KXVA 4EF5A 2CV1A 1YXMA 1RPJA 3A6DA 3ACBA 3VPAA 4ZGWA 1B0PA 1AURA 2FW9A 1N92A 3TR0A 4M0CA 3SIWA 5GONB 3E48A 3LY8A 2W0SA 1YZNA 1RBYA 2TECE 3FWKA 2PGAA 4HFMA 4EK9A 4CIXA 2PLNA 1P72A 4YRGA 3CG4A 5DHRA 4V38A 2R84A 3O38A 3OQVA 3QVGA 3R0ZA 2PEYA 1ZGZA 1I7PA 1BN6A 1NNLA 4LHYA 1FOEB 1UWLA 1KQPA 2P77A 2ZTLA 3C48A 3IOEA 4BMNA 2JLUA 1UXKA 5GTDA 3R5FA 4K6GA 4UBOA 2CJXA 3U60B 1NF3A 2E5WA 1E3WB 4G8BA 4NWIA 1FDSA 1IEQA 1VJ5A 1XHEA 4OJTA 4YI3A 2FE4A 3M34A 2VXCA 3QWIA 3U17A 2CLIB 4MQMA 5ISMA 3I2KA 1YI1A 2X4IA 2XMQA 4Y2YA 1DUSA 3ICQB 1KHHA 4NJMA 1E1KA 1KDZA 1N6RA 3QFFA 1LK7A 2EJWA 3DT9A 3JRWA 1PR2A 4F7WA 3GWZA 1Q95A 3TECE 1JILA 4I66A 5CGQB 3D6MA 2WNHA 1PHPA 2XB9A 1G98A 4FMCB 4GOOD 4O29A 3T3OA 3ZD7A 2Q4EA 4PZCA 1U28A 3MFQA 1Y3AA 4WLFA 5HRUA 3IAAA 3NIWA 4D6XA 3UWDA 4AJPA 3A9RA 1EM8B 2BRUA 3T52A 2DMRA 2ZT5A 5DBIA 3R7DA 2ZUTA 4AP5A 2FSPA 3H05A 4CMIA 1NC3A 3D0OA 4OXQA 7REQA 5KNCA 3ZJUA 5IH3A 5JH7B 1ZK1A 1MNQA 4EUEA 1C2YA 2CUTA 4FI3F 5AOVA 1PIWA 4P32A 1KPHA 5FWXB 1FFGA 3OEEA 1X7XA 2J9FB 4KAXA 5U4XA 3VH4A 3VISA 3ROFA 2HHCA 4B6SA 2GQ0A 4TM7A 4YPVA 4ENQA 1N6OA 4HUJA 5EHGA 3H0CA 2GA9A 4PAMA 1GQOA 4QYMA 1MX5A 1ZKMA 2AEJA 2CXPA 4FNOA 2ZRBA 3I6ZA 1X19A 1N5IA 1S1CA 2BM9A 1MFZA 2VJDA 4KHZA 5EHNA 1E9DA 1MVOA 4KIJA 1ANKA 3CRW1 1OBHA 3G2NA 3T7KA 4DYVA 3F7OA 4QASA 3OCJA 3M5DA 5L95A 3D8UA 1E2MA 3R2JA 4M0DA 5EE5B 3SBXA 2LPMA 3FKJA 4GUAA 4X45A 3L4BA 1NVUQ 4P4SB 2F1KA 1N2CA 3OCCA 1T9AA 3ESZA 1JR4A 1AGYA 1ENOA 1KPGA 1G5PA 2EBFX 3E1SA 5ALNA 1S8AA 5F1PA 4DZZA 1UAAA 5JJIA 3ZJVA 5IDXA 1WW2A 2HMVA 2IL1A 1KBOA 3IUSA 3P4UA 2CJFA 3E2IA 2WM3A 3PUVA 2V9ZA 3LQKA 4GRAA 1N9GA 1SHTX 4KXLA 5BSUA 4MUYA 1BU5A 4OXIA 2J0UB 1LK0A 4V0QA 2QQ0A 3FD8A 4OYYA 2OL4A 3FDZA 1C4WA 4I4TB 4WL0A 3EZ9A 4GBJA 1TYDE 4FGKA 1BEEA 1CSEE 4M38A 4Y9RA 4F2GA 2POCA 4ROTA 4HJXA 3LP6A 3W1EA 3DB2A 3ZW7A 1YZKA 5DXAA 3SJBA 2Q6VA 1XNRB 4DADA 1BOFA 4ZREA 1RJDA 3GRZA 2PGDA 3I0ZA 4PO3X 3W9SA 4S0ZA 3V1TC 5BV1A 1JG4A 4UD2A 5AOAA 2OGWA 1T0PA 4XJVA 3NHWA 3TNLA 5U1PA 1PW5A 1M9NA 4TTRA 3MMPA 1XTRA 2Y0EA 3N87A 2XV1A 4AJ1A 1JF8A 1ZM2A 4QOGA 4F9TA 1WDTA 3O91A 3AEQA 4P5DA 4RF3A 1QWOA 1W6UA 3PCXA 4MXDA 2W6MA 5JJCA 3VH3A 3AP1A 2ZU0C 4F7DA 1WUKS 1QFYA 1ESNA 1UAYA 4BQEA 1RADA 4FZVA 1OFIA 3ENWA 4YC7A 2YVAA 2OHJA 3GVHA 3RJ9A 4Z4FA 2UXDB 4HVCA 4AIIA 2P78A 2TRSB 4X6YA 3AL3A 3MIZA 4CKEA 5EZYF 1X1CA 4EZIA 5EIOA 2C7PA 1GY8A 2HQSA 1CF2O 1XZMA 2VHQA 3HO8A 3LS2A 4MR7A 4IX1A 4E70A 2BEUA 2O8EB 3LWNA 5CIWA 4EB0A 3UBTA 1FX0B 2NZ2A 2QD5A 4U7DA 5G1OA 3FFBA 2Q99A 4E46A 1U0SY 2GAOA 3G9ZA 4FE4A 3K5WA 1TRKA 3I04A 4I50B 3JASA 4Y6SA 5SYMA 3U3JA 1ARZA 2B8EA 3BWEA 3CINA 4AZ3A 2DYKA 4KRYA 3VSCA 2AMYA 2GZHA 2CLDX 2OBNA 1Y34E 4KXXA 4LJAA 1I94B 2O5EA 3KEQA 3OZXA 1CEYA 5DKFA 1U65A 2WVAA 2VDRB 4NS1A 4NULA 3ITKA 2YIDA 2JD2A 1QQ5A 4RSHA 4Y2TA 2ZEJA 2EX0A 4Q93A 3BQMB 1S7GA 3MD0A 4Z0PA 3S28A 4KWIA 3Q88A 4MR9B 2QVYX 1D9XA 3WGHA 2J9ZB 2OAEA 4UASA 1E4EA 1L5FA 1PEYA 4UEKA 1OREA 3OT5A 4LF6B 2YTZA 2YXEA 1TJPB 2ECFA 2O2DA 2ZUDA 2AT1A 3MJSA 3QQPA 4M7PA 5LVAA 5IM4F 1WVIA 2GBLC 3ZOZA 3FVTA 4GGOA 1Y9JA 3NVMB 3UPTA 4DCMA 1HLPA 1ZCFA 3HJBA 5JFGA 4X1YB 1EX1A 3A1WA 3R4CA 4DG5A 1ZUNB 2PJUA 5JH7F 4E14A 4EYSA 1DBIA 3EXAA 5BPFA 2DLDA 2HPZA 1POXA 4G65A 1SVLA 5GP1A 3G8CA 3NOOA 3IAXA 1DI0A 4M1YA 3KSAC 1YBVA 3FPFA 3I2IA 5HGXA 4PVDA 3BGSA 3R5KA 5I4BA 3KYBA 1QOQB 4QL3A 1E4VA 2CL7X 1UP6A 1NUTA 2J5QA 2FH5B 1Z6GA 1OSNA 2P2SA 4KBFA 3CMMA 2VZLA 3ABZA 2WOOA 5L6LB 3LI2A 2W2TA 4HCJA 4O2AF 2PPVA 5EG5A 2AZ4A 5P21A 4C7XA 1N8KA 1NN5A 1E6KA 1NUUA 2IPAB 3KNZA 3I6MA 4E5SA 3GT0A 3IB6A 3FVQA 1RP1A 3JXEA 1QYWA 2E49A 4PYKA 4ZAVA 1XMQB 3M1YA 3V9PA 3NW9A 1VG8A 2PT5A 3AEZA 2L19A 4DAEA 1G21B 1U3FA 4DREA 3BT7A 4BFCA 1B15A 2CB0A 1MJ5A 2ZBRA 4OSPA 1DIBA 1JXQA 2O57A 4GM1A 2CNKA 1KJIA 2PL9A 1M66A 2IUSA 1ZRNA 4O1HA 5ADUS 3T1NA 1G9XA 2HJVA 4YJ3B 4K9RA 2MT9A 5FBWB 4OV6B 5EXXA 3GOHA