4HZGA

Structure of haloalkane dehalogenase dhaa from rhodococcus rhodochrous
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
294
structure length
294
Chain Sequence
EIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 104
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4hzgA00
4W63A 1XZEA 1CQWA 2HA5A 4INZA 2K2QB 5CT8A 4QLOA 1E66A 1W1IA 1QIJA 2FUKA 3EQ8A 1WOMA 3MGAA 4X93A 5HF8A 5T4FA 4WDQA 3RK4A 1DINA 3H1BA 2Y2VA 3BIWA 4PV7A 2EDAA 4Q05A 4OB7A 1MJ5A 3BXPA 1ZGBA 4Y2RA 1BU8A 1N5RA 1XZKA 3A70A 4FLMA 1LPNA 5LKRA 1TIBA 2XI4A 3DL4A 1H2WA 3QVMA 5EIAA 1UK8A 1QFMA 3E0XA 2WUDA 1XFDA 2VTVA 5HK8A 1L7RA 5DYWA 4EY8A 2JGLA 2BAGA 4WJLA 5EFZA 3K2IA 3FSGD 4QEKA 4B9AA 5AI6A 4OD0A 1MNAA 4P93A 3C6ZA 1ZD4A 3NOXA 3AIKA 1DQZA 4AO7A 1BN7A 1ODSA 4H7FA 3C70A 2XUOA 5JZSA 4HTAA 3ZPXA 3ZV7A 3L1HA 2JGKA 5JATA 2Z8XA 3WK5A 7YASA 4J0GA 5IVDA 3QBJA 4UBOA 2HFKA 1U2EA 4UBIA 4KE9A 3BDVA 1DTEA 4MQMA 3IUJA 3O0DA 4XX1A 5H3HA 2GYWA 3IA2A 5AM4A 3D59A 4FDMA 1HKHA 4XVCA 4DYHA 1Z68A 5ALVA 3HEAA 1BEEA 3F98A 5JASA 3STWA 5A7HA 2YYSA 5JD4A 5AIAA 3W05A 1BE0A 2BUCA 4GDMA 1WPRA 1W75A 4FLFA 2WUEA 5CXUA 3UUEA 5E4YA 3STXA 1CUXA 3I6ZA 5I8PA 2R8BA 4KE8A 5IH7A 1XLWA 1A8SA 1CLEA 1SFRA 4QDXA 4Y2VA 2WILA 1E89A 2RI6A 3C8DA 5K3DA 3RLIA 3FLEA 1UKBA 1PJAA 4D9JA 1GPKA 1R9NA 2ZVDA 3C45A 5A71A 3H2JA 4KYVA 5D6OA 1WHTA 3PF8A 4XJVA 4IO0A 5ALMA 3D4LA 5AI8A 1JFRA 4G4GA 3I2IA 4KRXA 4OYYA 3CCBA 4GECA 4NZZA 1E8MA 3DKRA 4C6HA 3WL7A 2VF2A 4DSZA 3CN7A 1BCSA 3WYNA 1CUCA 3BE8A 4BATA 4CCYB 5LP1A 3H19A 5K3EA 3F96A 3R3XA 2QUBA 2RHTA 1XZBA 2OCGA 4KAJA 5AO9A 2JGIA 1CRLA 3R41A 3NWOA 3IIIA 2VSQA 3V1LA 4FOLA 2Z3ZA 1QIEA 5LZ2A 2I78A 1DX4A 4A16A 4UHCA 4Q82A 4JYMA 2JF0A 1ODCA 1UOPA 1XLVA 1IUNA 1X2EA 4BVJA 3WKCA 1JJIA 1QE3A 1THTA 1JT2A 4NMWA 1IZ7A 2XUGA 3D7RA 3KD2A 3G0CA 3JWEA 5T4EA 2BFNA 4L9AA 1XZIA 4X6YA 3WWPA 3FYUB 4WFKA 2AJ8A 1QJ4A 3LLCA 1J06A 2HL6A 3IB3A 1ISPA 3PUHA 3C87A 1A8UA 4FLEA 5LLSA 5T4BA 4X85A 3KWFA 5ALGA 1UK7A 5AI4A 3DS8A 4Q3OA 3I2FA 4HAIA 4C87A 3GROA 3BWXA 2OQIA 3T4UA 4BCCA 4DNOA 1AQLA 1IUOA 5A62A 3V48A 1FFBA 2Y6VA 2C5FA 4X71A 3C8HA 4M0EA 3IDAA 5JAPA 1N5MA 1GGVA 2PM8A 1J07A 1GZ7A 2XLBA 1YA4A 5ESRA 5E2IA 2G5TA 4B80A 2XMBA 3QYJA 1W52X 4UHBA 1UKAA 2GYUA 3ANTA 1TCCA 3L1JA 4EY4A 1E5TA 4LKOA 3IURA 4UBKA 4I19A 5FPQA 4PSUA 3FVTA 4B7ZA 3VISA 3ED1A 1EA5A 3H18A 3BIXA 3R3YA 5AKEA 4KACA 1ZD5A 2PPLA 1PFQA 5AI5A 2RHWA 1THGA 4FKBA 4G5XA 1YR2A 4MXDA 1WHSA 3STUA 1EDEA 4KE6A 2JBWA 1AC5A 5JIBA 4J0CA 5AIBA 5FV4A 4W1RA 3CN9A 2ZYHA 4RNCA 4KAAA 3D2BA 5LIPA 3L1IA 1DQYA 3DOHA 2QOEA 1Q0ZA 4PQEA 4BP9A 1J2EA 4AMYA 5FLKA 5C8XA 2JGJA 5EIEA 5AM5A 4CFSA 1MX1A 1EX9A 5CURA 1WB5A 5AI0A 4WY8A 2WU4A 1WPXA 4ZGBA 3QM1A 3E3AA 3ICWA 4AB1A 3FNBA 1C4XA 1E8DA 5ALJA 3R3VA 3WA7A 5D7BA 2OLEA 3Q8WA 2WU3A 4A23A 3ICVA 1F0PA 2JIDA 4UHHA 4I4CA 5CT6A 1BRTA 4J0DA 1LZLA 5HKBA 4RGYA 2WIJA 3FVRA 1XZAA 2HU7A 1C7IA 1CUIA 1NX9A 2CZQA 3PFBA 1OCEA 2QJRA 4OPMA 4UHDA 1YSCA 2WJ3A 1CUUA 1E8NA 1G4HA 5HF6A 3G9TA 1TK3A 4UHFA 4J7AA 4J0IA 4G4JA 5CT5A 2WJ4A 5KWJA 1QZ3A 1EK1A 4B84A 4EA6A 4FNGA 3B3QA 4X6XA 4NS4A 3HRHA 2RONA 2XUIA 4IQ4A 1X2BA 1QIGA 5ALTA 3RARA 1GT6A 2WHPB 1R9MA 2WQZA 3ZI7A 4BCBA 4BE4A 4X97A 4QA9A 1NU6A 2VJBA 1BROA 2PSEA 1MX9A 3WWCA 5FPPA 4Q3KA 4C4YA 3DD5A 4BAUA 2G4LA 1ORVA 4UBNA 2DSNA 1SOMA 1YA8A 5CH5A 4HXFB 5LKAA 4B81A 2QR5A 4FFVA 3ZWQA 5CH3A 4F60A 3GELA 3HJUA 4N8EA 1XRMA 4WY5A 2QXTA 4ARBA 5DYTA 3VJLA 4KRYA 1QTRA 2WIFA 5D3ZA 5DTIA 1MAAA 3ZLVA 2Y2UA 3PF9A 2WKWA 1FFAA 3BL8A 4XWGA 1LPAB 4OCZA 1KEZA 3KXPA 4BE9A 2PKYX 4Y2YA 4NVRA 4G9EA 4EBBA 4X6UA 1T4MA 3N0TA 1UZAA 4Z49A 2HU5A 3RKSA 5YASA 3QMVA 5DJ5A 3DQZA 1QTIA 3HABA 3F97A 4MYSA 1FFDA 2W6CX 3NUZA 1WB6A 3GZJA 4KEAA 3WK6A 4W9RA 2XUHA 1LPSA 4BRSA 3W2TA 4ETWA 3MVEA 1LPPA 3D5EA 4B9EA 1UKCA 2DR0A 4MWTA 3I1IA 3V1KA 2ROQA 3IUQA 5ALLA 3G0DA 2DHCA 4CIAA 3C43A 2VJAA 1AGYA 4EY6A 3I28A 4V2IA 1H2ZA 3G9UA 5KBYA 1EVQA 2WUGA 5EGNA 3OG9A 4G9GA 5CXXA 2D0DA 3A2NA 4GW3A 1EK2A 3GFFA 4Y2QA 3ILSA 1LGYA 2WIGA 1ACJA 5HFNA 2VAXA 4AN1A 4XIIA 4E14A 1GQRA 2OAGA 1XZHA 5ALUA 2WG1A 2ORYA 1CUVA 5CH8A 1USWA 2VJDA 2PU5A 5JZ9A 5ALXA 1RWQA 2VJCA 2GBCA 1YCDA 3HYSA 2WFLB 2C4HA 5HKAA 2OCKA 2ONCA 2XUKA 2BCEA 2BGNA 1R4ZA 5K3AA 5HFAA 2BGRA 1B6GA 5FDFA 4H7EA 1XRQA 1JKMA 1RP1A 1CUYA 2XQIA 2EEPA 3WK9A 4L3WA 2QS9A 3DNMA 4EB0A 3AJAA 1TKRA 2H1IA 4PW0A 3QITA 4FFWA 4Y2TA 2ACKA 3AILA 3AZOA 4U2GA 4OB6A 5K3CA 3WQHA 1CUHA 2QZPA 1LPBB 4WFIA 1H2YA 2C7BA 4U2DA 2VAVA 3AFIA 4QNNA 2V98A 1QOZA 2PSJA 3AUKA 5SYMA 3WKEA 1GQSA 4WDRA 1CUWA 3OPMA 3ZLTA 1WCYA 1HLGA 2HDWA 1VA5A 3H0CA 3WMRA 3D0KA 1VOTA 4AO6A 3T52A 4HZGA 1UT6A 5ALKA 1QIMA 3I6MA 4MEBA 2RIPA 3IBTA 5LZ9A 1YAJA 4CI9A 4BDSA 2O2IA 3DDUA 4FWBA 2X76A 1QO9A 4J0JA 4A5SA 5JAHA 2ZSIA 3H17A 5LZ5A 1JU4A 2HA7A 3BJRA 5IVKA 2WSLA 3I2GA 5C81A 2RGUA 5AM0A 5ALQA 1QIIA 1KU6A 2EDCA 4F5ZA 1QIDA 3DYVA 2IIVA 1HPLA 2FJ0A 3FYTA 5LYYA 1XROA 3R3WA 1XRRA 1XZCA 2FJPA 2Z8ZA 3M81A 2XUDA 5CTAA 1W76A 3QZUA 5ALYA 3I2JA 5IKXA 4ZWNA 3V1MA 4HXGA 3VVLA 1DWOA 2XMRA 2I03A 4K5QA 4BZZA 4E11A 4JYPA 4X90A 2XMSA 2HFJA 3TEJA 2Z5GA 2W22A 5ALDA 4TGLA 5ALFA 3FCXA 4L72A 4RPCA 1FFEA 1GXSA 3H2GA 4BC1A 4DGQA 4EUSA 2QVBA 5ALZA 3FAKA 2OAEA 3WYDA 3LP5A 1MX5A 1ZICA 5KREA 4H0CA 3LS2A 4W1QA 5AK5A 1QIKA 3KDAA 3S2ZA 1MTZA 2HM7A 2PU7A 1YASA 3U1TA 4H7HA 1Y7HA 1VLQA 4ITVA 4UFNA 1MN6A 2OG1A 1BEZA 1W4LA 2ZSHA 4FTWA 4N5HX 1IZ8A 1GKKA 5DNVA 4RE5A 2WTNA 3WLAA 4DMFA 2X8BA 1XRPA 1XZFA 1R1DA 3WJ2A 2XUJA 1BN6A 2AXEA 4DTCA 5AOAA 4N8SA 1CV2A 2DQZA 2PSFA 4DIUA 2WFMA 3UMJA 1YS1X 3STTA 5ALWA 5T4HA 4Y2XA 5D3KA 4MJ3A 3O4GA 1ZI6A 2QT9A 1CQZA 3WL6A 3TRDA 3PFCA 2ZJFA 5JAOA 2OQVA 3GBSA 5EI5A 1K4YA 4X91A 5CMLA 4B85A 4BTVA 3WKBA 2HU8A 5IVHA 1CFJA 1ETHA 1O6GA 3FLAA 3ANSA 2JEZA 3UUFA 4BTLA 1VZ2A 4MQLA 5EHNA 2QM0A 1D07A 4BBZA 1JJBA 1MO2A 4PO3X 4MEAA 5DNUA 4CG1A 1CUEA 2HIHA 2WJ6A 5AJHA 3V9AA 1P0IA 3C5WP 4BCDA 4QDUA 2WUFA 1JU3A 3KWJA 5DYYA 2C0PA 1ZIXA 3C6XA 3SX4A 3WJ1A 1CUBA 1XQXA 3WIOA 1QLWA 3OC0A 1LZKA 4UBMA 4CCYA 3MUOA 5CBKA 2VA9A 2X5XA 5HF9A 3YASA 3A2MA 5DNWA 1LNSA 1HQDA 3ESBA 3GUUA 3HSSA 5C8ZA 3F9CA 1AUOA 1AKNA 1QO7A 4BP8A 4UHEA 4C01A 5AM1A 2H9YA 3BF8A 5AKYA 1EINA 4IH9A 1QGED 2QXUA 6YASA 4AX4A 3O4JA 4M0MA 2O2GA 5AKGA 1UOOA 3IULA 3C6YA 2XQKA 3WI7A 5HQ3B 4QWMA 2HA6A 5AK4A 3E1GA 1XZJA 4UFOA 2XLCA 3FYUA 4IHAA 1CR6A 4C88A 1NU8A 1LPMA 1Q0RA 3I1YA 2PVSA 2XMZA 4BAZA 1SCQA 2QKYA 5AKXA 2B20A 1LPOA 3SWWA 3H2IA 4K6HA 2WHPA 4LYEA 2J3QA 3FBWA 4OYLA 4HXEB 1S8OA 2IX9A 2HA0A 2ZJ6A 1CUDA 1F0NA 2V96A 4KE7A 1MPXA 3DYIA 2XMDA 4LXHA 4PSCA 2DQYA 3G0IA 3QPDA 3STVA 4RE6A 4UPDA 2XDWA 4OB8A 1XKTA 3HC7A 4JUIA 4E15A 4ROTA 1QIHA 1K6EA 4AZ0A 1F6WA 3R40A 3HXKA 3KSRA 1C7JA 4H7DA 5FOQA 1MU0A 1ZD3A 2VT7A 3M3DA 1ZI9A 2AJCA 4DMHA 1F8UA 4CG3A 5FRDA 3JYHA 3WZLA 5FKJA 2HA4A 4X3CA 3TJMA 2DHDA 1XQWA 1UOQA 5IVIA 5ALOA 4BYMA 1OILA 3PDCA 5FXMA 1SC9A 4DM7A 2YASA 1XQVA 4LXIA 1CUSA 4PSDA 2V9ZA 2OGTA 1TRHA 2CEKA 3Q0TA 4ZI5A 2XB6A 2XUPA 4FMPA 1G66A 3W9UA 5AM2A 3G9XA 2PL5A 2DHEA 2WLSA 2XQJA 5ALNA 5AKJA 5AOBA 2H7XA 4UUQA 2JGEA 4GI1A 3QH4A 3F8SA 4LYDA 4C4XA 3ESDA 2C0QA 1VZ3A 5JALA 5K3FA 4KAFA 5BV7A 1XZGA 3EIOA 3M83A 1PV1A 4X95A 2BKLA 2NW6A 2DFPA 4H35A 5JD5A 3WKAA 3G8YA 2B61A 1ZI8A 1BCRA 1BS9A 1YAHA 1WM1A 4H7KA 3SK0A 3VDXA 1ZOIA 1J1IA 4B0OA 1R3DA 5ALIA 3PE6A 2XUQA 4ZV7A 3W04A 4G8CA 1UXOA 1DT3A 5LZ7A 5AK3A 5K3BA 2OGSA 2GYVA 2OPHA 5DLPA 3WA6A 2PSHA 2VT6A 2VATA 1EDDA 1ZGCA 3OTQA 1XRLA 1JJFA 2BUAA 4J0KA 1XQYA 1CUFA 4EY7A 1HDEA 1LBTA 3PICA 5AKKA 1EB9A 2DCMA 1L7QA 4Q3LA 1ZJ5A 1EI9A 2E3JA 3ESAA 1OXMA 3HI4A 4OSEA 4HVTA 3DCNA 3WWEA 2XE4A 3W9BA 3LCRA 4BZWA 2PBLA 2CMFA 2XMGA 1I6WA 3O95A 4X94A 1Y7IA 3FOBA 4L0CA 4BDTA 4AZ3A 1JI3A 2PUHA 3H04A 5DWDA 3DOIA 3LIIA 2Y6UA 4J3JA 5AKIA 4CCWA 1N8SA 4C89A 4PF1A 1LBSA 2WM2A 1TCBA 3F67A 4H18A 3BF7A 2WFLA 4FBMA 4MYDA 4Y2PA 5K3FB 2P8SA 3ZLUA 3WK7A 3FWHA 1L7AA 4UBLA 5CW2A 1Q84A 1U4NA 4B6GA 4K2AA 4TPKA 1G42A 4M0FA 2XUFA 5A6VA 2QUAA 1JMYA 4QDOA 2HADA 3S8YA 2C58A 1TCAA 3C5VA 5AHXA 5ALRA 1QFSA 4QZVA 1VKHA 4LHEA 4Y2UA 1IMJA 1Q83A 1IVYA 5CRIA 5LZ8A 2YH2A 3VJMA 4S0XA 2XUAA 3QPCA 5ALSA 2IITA 3TGLA 4GXNA 4P9NA 4JH0A 3WKDA 1FFCA 4G1FA 4DMKA 2QTBA 2PX6A 4J0HA 1U65A 2I3ZA 4F21A 3H2HA 1LLFA 1VJ5A 1CEXA 2AJBA 3DEAA 1XZDA 4P08A 3R0VA 2H7CA 1P0PA 3QPAA 5JAUA 5JYCA 4ARAA 3MUNA 4DMCA 3H2KA 3PI6A 5AICA 4G8BA 2CB9A 4YPVA 4HS9A 1QONA 2OCIA 3O4HA 4K6KA 4H7IA 2G63A 4GEGA 4X00A 1SCIA 4AN0A 3QMWA 4EZIA 3W06A 4C4ZA 4WCVA 2R11A 3G9ZA 5AI9A 2WHQA 3VJKA 5HZGA 3VKFA 4LIPD 5BOVA 4PNZA 5F4ZA 3G0GA 4X92A 2OXEA 4JNCA 4DNPA 3G0BA 1ZIYA 1GPNA 1MT3A 5ISMA 2H7YA 2CBGA 2B9VA 5LZ4A 5J3JA 2GBFA 2WHRA 1UFOA 1VE6A 1XRNA 3ESCA 4YK7A 2HRRA 2QRUA 4AQDA 5C8VA 3AIOA 1U8EA 1VXOA 4Q34A 2GBGA 4BVLA 1YS2X 1EVEA 2GZRA 1H22A 2XMQA 4Y9SA 5JARA 4QLAA 3DLTA 3WL5A 1H23A 2HA2A 4F0JA 4B82A 1DX6A 3DL7A 4P92A 4J03A 4OUKX 4DNFA 3D3NA 4UBJA 4OU4A 1EXWA 5FP0A 2VEOA 1AURA 2UZ0A 3FSGA 3IVMA 2YXPX 2B4KA 2WIDA 1GKLA 4YASA 1ZJ4A 5DTJA 4B0PA 4OU5A 4HRYA 2ES4A 1G5FA 2HRQA 5JD6A 2Z3WA 3CXUA 4U2FA 5KWIA 5BWCA 5I7UA 4KJXA 5AKHA 1A7UA 3PUIA 5EHZA 4BRZA 1RYYA 1K8QA 1ACLA 1KU0A 3U0VA 2J4CA 1K5PA 5CT9A 5ALHA 1EDBA 5AKLA 4DSAA 4EY5A 3DKKA 3EQ7A 1JMKC 4ZV9A 4U2CA 4EHBA 4GBGA 1MNQA 3N2ZB 5A7GA 3HACA 3AIMA 3AZQA 2JEYA 1EHYA 2QMQA 5AOCA 1A8QA 1FJ2A 1M33A 2WFZA 5C7YA 4AXBA 5I9IA 4MWSA 3B5EA 3I2KA 5HF5A 2ZYRA 3G02A 2V97A 2HHAA 1CUZA 1XKLA 2PSDA 3E4DA 5AKZA 5ALEA 1EH5A 5HCUA 3OOSA 5JANA 2CUTA 4G8DA 5JZBA 1VA4A 3M82A 3G7NA 4O08A 5AH0A 3KOOA 3WIBA 5K5EA 4GWLA 2ECFA 5SYNA 3O9MA 2WTMA 2Y1KA 1B41A 3EF3A 5EHXA 2BJHA 1WB4A 1P0MA 4CIBA 1XZLA 2HA3A 4ZXFA 5EHQA 3C6BA 4DNQA 1O6FA 3VVMA 5A2GA 4FBLA 1R88A 4Y2JA 4BAGA 3BDIA 1UWCA 1HL7A 4K6GA 1FSSA 4H77A 4LXGA 4BB0A 3K6KA 1AX9A 3A2LA 3WL8A 2VQ6A 3I2HA 1N1MA 2XT0A 4QWWA 1CIJA 4E46A 2ZYSA 5CT4A 3OURA 3OM8A 1AZWA 3H1AA 3P2MA 2CKMA 4U2BA 4YX9A 5AM3A 1TQHA 2G5PA 3HZOA 2D5LA 4QE3A 3WZMA 1SCKA 4QDZA 2I3DA 4Y2SA 4N5IX 2J4FA 4TVKA 2C5GA 2QJWA 2BUBA 3WWOA 1VXRA 1UK9A 4AMZA 3I6YA 2O7VA 2XQFA 1T2NA 3FYUC 1XZMA 4B83A 2XQGA 4BC0A 1CUJA 5EIHA 1X70A 5ALPA 2OGZA 1R50A 5E4TA 3B12A 1EB8A 4UFPA 1GPLA 2Q0XA 3FCYA 4GLBA 2WIKA 4QDTA 1W6RA 1CUGA 4X7BA 5E4JA 3JW8A 4AO8A 3K9BA 1UK6A 2JGFA 5A7FA 2FX5A 3RM3A 4ZRDA 3WK8A 1DWPA 1K63A 4W1PA 3IUMA 3EQ9A 1A88A 3VXKA 3R3UA 1VE7A 1CVLA 5HQ3A 1YB6A 3FLBA 5BWBA 1ORWA 3X3HA 3NGMA 3D2CA 2LIPA 2J3DA 4BVKA 2ZJ7A 4Y7DA 2GZSA 2OCLA 5JADA 5AK6A 3SC2A 3GA7A 1MAHA 2CJPA 4ZREA 4WFJA 3WWDA 4G4IA 2AJLI 4IH4A 4N8DA 5FUMA 3V1NA 3EBLA 1DU4A 4KR0A 1DWQA 3CCCA 1ZD2P 1XLUA 3O4IA 1IUPA 1AMNA 2AJDA 4JEIA 1ODTC 2ACEA 2JGMA 2ZYIA 4U2EA 1CUAA 1H2XA 5HK9A 3QMMA 4FHZA 3BJMA 3IUNA 1QIFA 3HLKA 3D2AA 3A6ZA 4I3FA 1TAHA 1P0QA 3AZPA 1DT5A 4DLNA 2PUJA 3WK4A 4GHWA 2O7RA 3DJYA 4FNMA 2XMCA 3STYA 4CG2A 4H7JA 2GBIA 4IH1A 1E3QA 3O9VA 2O2HA 4Q1VA 1YB7A 3AINA 4HRXA 1Y37A 1HBJA 3LIPA 5AP9A 1CPYA 2RAUA 2WG2A 3R3ZA 2WG0A 4W1SA
chains in the Genus database with same CATH superfamily
2WPDA 5JFTA 4M22A 1PFYA 3TYXA 3K7EA 1CQWA 3BMNA 2I3BA 3L7DA 3OQPA 3AWDA 1XTTA 4PPFA 1X9HA 1QQ7A 1GU1A 3W5VA 1MIOA 3BE4A 1E94E 3GUHA 1MW8X 3RAPR 2Q07A 4QLOA 5FCDA 1AV7A 4IIJF 2PMBA 4IX1A 2IKSA 1HK7A 1Y3BE 3NHMA 2CDAA 2IYFA 1NRXA 1C9YA 4MW6A 3BGOS 4Q66C 4CM9D 2BELA 2FUKA 3EQ8A 3OCXA 1GNRA 4JI8B 5FTKA 1CQXA 1MORA 1Z2DA 3B60A 5FOWA 5KC8A 1CZOA 2J32A 3RK4A 3BB1A 1P7ZA 4DMLA 3H1BA 1QYWA 2OWEA 2QMHA 4N6GA 2CUKA 2Y2VA 1X1BA 4PNHA 4LF4B 1ZMXA 1PWYE 2BEWA 1X7XA 1DO2A 1NAHA 1Z33A 2V7GA 4CPDA 5BVGA 2PFGA 4OB7A 5A6SB 3S44A 3AEKB 3BXPA 5G53C 2XEDA 3HR4A 1RYHA 4ZO8A 1EAMA 3BGSA 3L1UA 3LXUX 1TTPB 4PGMA 1HE3A 3VDMA 4RY0A 2G88A 4LS3A 1LPNA 1N2BA 3REFA 3F6BX 4OJTA 1G6HA 3DL0A 4QT0A 1LSSA 3A9WA 2YXNA 3GNSA 2O2ZA 4L5IA 4OGLA 5EIAA 4LQCA 1JSRA 4BASA 5I7EA 4UHKA 3HB0A 2Z4TA 5GVSA 4YRCA 1AGNA 3ADPA 3E0XA 1XFDA 3CUTA 1US8B 2AA3A 4TS1A 3T1VA 1KDOA 4IY1A 5DYWA 4EY8A 4XTCS 4RW0A 4QTTB 4C04A 2GB4A 3AUFA 2HO4A 3R7LA 4WJLA 1HTTA 1M7HA 2RGNA 3IV9A 4YRLA 4I1YA 4I50A 4NOLA 3X2SA 4BQNA 1J1UA 4IV8A 2VJKA 3QE3A 4B9AA 2BDEA 2W71A 3SXUB 3UMMA 3BSWA 1C3OB 4INJA 5FAXA 3A37A 1D04A 3L8HA 4X66B 1MNAA 4UQOA 4LQLA 1A3CA 4ASUD 2O0MA 4ZIRA 3N8GA 1JWLA 1ZD4A 4J2TA 5DM4A 1A50B 1DQZA 2WDZA 3NAQA 4URZR 2BD0A 4EA9A 1BN7A 4ID9A 3KKPA 1ODSA 4UEKA 1L4EA 3HFGA 3JQ8B 3WLHA 3CZAA 5F7XA 5IKMA 2NWQA 4BRWA 1K75A 3C70A 3UATA 2GZDA 3SC4A 3DDOA 4ZANA 3SD7A 1SVKA 1SBQA 2VG8A 3L1HA 3QPWA 1U5BA 5IDXA 1SWVA 1HE2A 5JATA 1ESNA 2Z8XA 4KFCA 3MRTA 4M0DA 1JEJA 3KZMA 1A04A 1MZVA 3B1WA 3DHWC 1T1RA 4FC7A 4NV3A 1II8A 2AW5A 2P77A 3AOGA 4ZT2A 3JQQA 4Z9XA 5JAMA 7ADHA 2C9OA 5DGTA 1U2EA 4YO7A 4RPGA 4UOZA 1XEXA 3MGGA 4UBIA 1SHZA 3EXG1 3GCWA 3SPXA 2DG2A 4DV7B 1VBKA 3CF4G 3EPPA 3SNHA 2J3EA 4MQMA 3BB4A 4IDHA 3IUJA 1XD2A 1JU9A 2CNLA 3B5IA 2FSVA 2A1TS 3ZGXA 4CI0B 3THOA 3V4VB 2Z1NA 1YQGA 4A7PA 2WSYB 5EG5A 1AGRA 3TS1A 4QYIB 1GPJA 1GWNA 1V1RB 1JSLA 1HKHA 5IM4F 4JU8A 3NEJA 4KU4A 4HGYA 1AN9A 1Z68A 1OKKD 3EOAI 3HEAA 3CX3A 4K6FA 1XF9A 1BEEA 2C9MA 3SMQA 4AKSA 1QG6A 4H31A 2UUAB 4JV5B 3F98A 4ZOLF 1QGDA 2IK8A 3H8JA 5B53A 1UFQA 5AIAA 3ZDQA 5EUQB 2R8ZA 3NEYA 3TLXA 3WXMA 3BWVA 2ORWA 3C14C 4PPNA 1LI5A 2C07A 3VO8A 1IQUA 1RWKA 3JD1A 1W75A 4PINA 4WUVA 3PGKA 1PVDA 1APBA 3JQEA 2JKZA 3IQGX 3T3GA 1J20A 1EJ0A 4PAWA 3NT5A 3SFZA 5TY0A 4PFJA 3GGGA 3ZCXA 1URPA 4CGYA 4TLBA 3GLIE 1OLUA 4XTRA 4EG5A 1FMLA 1Z0FA 4PLPA 1QYVA 5EPUA 1K9VF 4LDPA 5FUWA 3L2OB 5DT2A 4JI3B 1JH9A 1TZJA 2PN1A 4PHGA 2WKPA 2RJOA 3L6CA 3T5PA 3ZDCA 1KARA 1CLEA 1SIUA 3LWBA 3PVZA 2AZXA 1T2VA 3AG6A 4Y2VA 4CV3A 1RZVA 2WILA 3CLUC 1W9HA 2C59A 1DC3A 4KH1A 1DHRA 2P78A 3AUSA 3ECCA 3ES9A 3VR5D 3JU3A 4IXTA 2HWKA 4XYMA 1X0XA 3FLEA 1XDGA 4US2R 1XAHA 1K2WA 1Y9EA 2RBKA 2Q7OE 3R7FA 3LC7O 3SIRA 2EP7A 1GPKA 1R9NA 2O8NA 3CVWA 2XSZA 5ULLA 4Z4EA 2ODTX 1T6NA 1ZK2A 5KTPA 3PL1A 3G59A 1MOPA 2C8LA 3ZCRA 2QIPA 3TAHA 1YNSA 1SCUB 2FLVA 2H9IA 4ZVMA 5TV2A 4YT4A 4AY6A 4V0QA 1JXQA 3QVUA 3L3BA 4D98A 1IBLB 4EI8A 2YBDA 3QU5A 4RLQA 4YCDA 1NXSA 1VRVA 4BWYA 3P0IA 1F7UA 2HWWA 2A7XA 4G4GA 5J5VA 2H8GA 4KRXA 4Q48A 1S2DA 3CCBA 3NTQA 1GYPA 1U0BB 3EMVA 5CAEB 4FMCF 4BB5A 4C7BA 2GM4A 4OBBA 1HFJA 2NU6A 5IAOA 1U9IA 4NZZA 1KK3A 1PL7A 4B47A 3DKRA 3I53A 4W4TA 4S35A 4EYGA 3CNBA 3WL7A 2D00A 3RC7A 5FULA 4AY3A 1GCUA 5K0JA 3VH1A 3HDVA 3G8CA 1ZH2A 1M6WA 3E82A 4JBNA 1ZKDA 1NLMA 3UK7A 5IUNC 1RM0A 3M1YA 2J07A 4IDOA 1IL0A 3GWZA 4D80A 1FNDA 3MTEA 4E5UA 3KPYA 1CUCA 2B8JA 4FGLA 3WXBA 3AL0C 5M2QA 4LC9A 1XVAA 4BFWA 2O0KA 1GZ5A 3WB9A 4B6FA 1MVOA 4IIGA 2R1TB 4JLSA 2FB9A 1E2DA 2YS7A 4MW7A 2AOXA 5KQLA 3R3XA 1E5QA 2HXSA 4XD7A 3GGDA 1UPFA 3RSGA 3TLKA 4DSTA 4ZOQI 1NFRA 1U7PA 2JGIA 3PT9A 1CRLA 4M7WA 1NJGA 1QKKA 2WF9A 4DB2A 3GFBA 4EMSA 1T29A 10MHA 3R9IA 3SHQA 3UFBA 4Q1BA 2YBEA 5IAEA 3HADA 5KOHB 2VSQA 4CKXA 3ERCA 3OQNA 4TXHA 2A0XA 1YBFA 4EG0A 5C5CA 2OORA 3QMPA 1QIEA 3ZHBA 1Y3IA 2X6TA 1MMFB 3KEMA 1J0CA 4H16A 2I78A 3SZUA 1K6IA 5JEEA 1M1YA 4A16A 4FOTA 4CEHB 1JG3A 3I6QA 1TYAE 1J0DA 1I7NA 2GLUA 4MYRA 4LFBB 4OHMA 1YIOA 1MKYA 3AJRA 1ODCA 2IHYA 3AUXA 2OECA 1XTIA 4CVNA 3B7GA 3K6SB 4TUYF 1IUNA 1TF2A 4YT2A 1JJIA 3T41A 3LUKA 4PRZA 2DC1A 4BMCA 4OHFA 1L8LA 2AI3A 2OV2A 3D7RA 4G5RA 1OUMA 1ZW6A 2QD4A 4P3YA 5FI1B 5SICE 4ZJPA 4IVPA 1PNQA 1QH8B 1UWKA 2ADMA 2FF7A 3KDPA 3WWPA 4Y0AA 1CZLA 2ARKA 2CJWB 3EK2A 3QFFA 2I6TA 3FYUB 5AMXA 4Z9AA 2FN3A 2ZBFA 3NHUA 3H9QA 2WSIA 3TX2A 1DIGA 2FK7A 2O8BB 2HL6A 1LWOA 5SZJA 1Z0ZA 5TNXA 3C87A 3RVNA 1RMTA 4OAOA 1RXWA 3EXFB 1JIVA 4FHFA 5I9BA 1SUAA 3PPVA 5K8JB 3DV9A 3WVNA 4CM4B 2D06A 4D42A 1Z7YA 3UMBA 3P4UA 1N57A 3K9LA 1M6VA 2BJVA 2HDNB 2YWJA 1R5BA 3DE5X 5AI4A 3DS8A 4Q3OA 4FXPA 3I2FA 1BS2A 4QIHA 2OHVA 2J4DA 4GMXA 4C87A 3GROA 5A5FA 4U8GA 3BWXA 4RCZA 2P0YA 4WH0A 5AHRA 3T4UA 1K7SN 3JTMA 2B92A 3KXIA 4PYNA 1NUUA 2OVBA 3HS3A 1AQLA 3KR0A 3FTQA 4DJEC 2GJSA 5A62A 3Q7RA 1UC5B 1XDDA 1KZ6A 2ZTUA 2IYNA 3EDMA 4AYXA 4BVAA 2OKGA 1HL3A 2HOQA 2Y6VA 4KDEA 4R84A 3C8HA 4X71A 5TQ2B 4EECA 5HM8A 2BFDA 3IDAA 1JYEA 2CFSA 4G5YA 5JAPA 1FCJA 2WHYA 2VXBA 1ST3A 4HDNB 5E2BA 5L3VA 1GQQA 2XLBA 4JU9A 2XCLA 5EZQA 1IEWA 3T9AA 3JQBA 2HJSA 3P9RA 5KSWB 3PENA 5E2IA 1YDFA 1E9RA 2QQ5A 4TQAA 1KMHB 1MH1A 2Q1YA 1EJ2A 2JI7A 4AZ0B 3KQYA 5ES4B 4KNVA 1NRWA 4WV3A 3ZHVA 1HG1A 3CLUD 4AAYA 3L0IB 2P40A 2BP7B 2D1YA 2IE0A 3PS9A 3DZGA 4R3WA 5H80A 4KDRA 4WL0A 1VGVA 3GRFA 3VOSA 3AKCA 2A9PA 1SULA 3IBFA 4MCJA 3IURA 4K8OA 1XG5A 4I19A 3R9XA 1BH6A 3PQ4A 3G2PA 5FPQA 1OVGA 3KQUA 5GGYA 1NW8A 1LDGA 4I5EA 4YN3A 2J6HA 2YHSA 4KWEA 3WGHA 4DBLC 3AP2A 1GPWB 1WPGA 1BXGA 2OPBA 3N0RA 1YRLA 2D7JA 5BSFA 3LVFO 3OFNA 3T0GA 4DEVA 4BO0A 1QYRA 1HT2E 1T1IA 5C80A 2A4KA 2PPLA 2LPMA 5J2TF 1CSEE 4ALLA 1Q1ZA 2RGXA 3NWJA 5EEHA 4C6TA 4G5XA 4WLNA 4ZAGA 3SHFA 5JZOA 3AETA 2XWBF 5AJYA 5DB4A 3STUA 4HT3B 3LD9A 3U3DA 2QTVA 1QP4A 3QHQA 1Z2CA 2GNAA 1VJTA 1XD2B 4YJ2F 3CPHA 1IRIA 1O5TA 3WIDA 1B0ZA 1CY0A 1KVUA 1M8FA 1ZCBA 4HB0A 4XEHA 5B4UA 1N0VC 3L79A 3C6QA 3DZ8A 1GR1A 5CA0F 1FYVA 2FEKA 2C7QA 3BMQB 1ZMTA 2AB0A 3M3PA 1JI0A 1DELA 2X23A 1T9CA 1J8YF 3ZWNA 1GSHA 3EC7A 1H6BA 1H3EA 3QNUA 3USES 1Z6ZA 3IGFA 2XT9A 4B33A 1DADA 4BP9A 5BW8A 1FVHA 1J2EA 1B26A 2BE9A 2GX6A 1FXWA 2EAUA 3CG0A 1S3IA 1SGWA 3CNHA 3KJZA 2YYZA 4IL5A 5FLKA 4OJKA 1GG9A 5JSKA 1GCAA 2BIFA 2UXDB 4KX3A 3NGXA 4MMYB 4YR7A 4YJHB 1A2KC 1R10A 3O3CA 1VYHA 3LCJA 1EX9A 1GQ2A 3OIGA 4RPHA 3U4DA 1P2GA 5F12A 4DXAA 4Q3DA 3JQ8A 4BQPA 4A6DA 3EIHA 3LL7A 5EJ2A 3TSCA 2ZWMA 2RHJA 3GH1A 2WUVA 4F92B 5AVRA 3DEKA 2QZJA 1Z38A 4AB1A 1ETUA 3AL3A 4WBNA 2YQ4A 2AL7A 4A0QA 1RI1A 1Z37A 2VJYA 4TRJA 4YJFB 4ILKA 3EJWA 5BN5B 4F4FA 2R6HA 2F3TA 2QE7D 3IQEA 5IW8A 4IHKA 3H83A 4KW7A 1D1QA 4F7DA 4L08A 3E53A 1FMCA 2O05A 3BGIA 4S2EA 1H0KA 3WA7A 2QTFA 3O3MB 2UZAA 2OLEA 4XKJA 3FNGA 4DR3B 2DAPA 1PHPA 1IHDA 5ER6A 2XWJI 3ZHXA 1IHPA 2K7ZA 3EXG2 1P29A 3L46A 4G85A 4AJKA 1DCTA 4D5EA 1BWSA 3CMCO 1NN3A 2Q0SA 2JBHA 3KR2A 2WF5A 4FYVA 1N2HA 5DHFA 4J0DA 5E1MA 3RBAA 4FGSA 4C14A 1CF4A 2F1IA 3EZFA 1J0XO 5HKBA 1VPWA 3HCPA 4XSVA 1XZPA 5G02A 3DBHB 1SKYE 5DM70 2H4YA 4DRXB 3FVRA 1PGPA 1DBVO 1XUOA 3FUXA 2C4UA 3SVTA 3B2EA 5KVQA 4GKAA 1CJMA 2QYSA 4I5DA 5CAEA 1MAUA 1C7IA 1Z5WA 1KDVA 3NWEA 2OYSA 1JB1A 2RAVA 5GGXA 1CP3A 1O6CA 5DHPA 4CQNA 1SQ6A 2NZ8A 1WSDA 5JFGA 1G59A 3B1JA 2YOHA 3JZMA 4OHXA 2YZKA 4KQEA 1E7YA 1PQUA 3TIXB 1DPFA 1SXIA 3PPWA 4NPHA 1BQEA 1LA2A 1D6MA 4BVFA 2B8NA 4AKTA 2WJ3A 1OXTA 2BM8A 4MRMB 1C1XB 1NUTA 5EWMB 3K20A 3KHSA 1JS1X 1USUA 3ZQJA 3FKQA 3G9TA 4L3OA 5B64A 3T7RA 3TTVA 5A9SB 1PL6A 1IN1A 3RGGA 3KPWA 2JAHA 2XB2A 4DA7A 4AUMA 1ZIOA 3I3OA 3BXEA 1L6IA 1IE3A 1QZ3A 3AY3A 2NT3A 3AONB 5JH7F 3RUDA 3K5PA 5K4HA 3IDZA 2I1LA 4EA6A 4IR7A 4FNGA 4FYPA 4URXR 4X6XA 4J7UA 5EE3A 2I8CA 2Y76A 3W5SA 2IUTA 4ZPJA 3SY8A 4JB2A 2DY1A 3AHJA 1HSZA 2XB9A 4ZGWA 4QOEA 4GQBA 4F6CA 1P7WA 2J3HA 4WNYA 1TCUA 1RABA 4U7HA 5ALTA 1GT6A 5CA1A 1N34B 3OKCA 4TMWA 1A9SA 1TC2A 3SZRA 2FUEA 2J8ZA 4X97A 2VJNA 2YC4C 1W59A 3N2KB 2ACVA 3E3OA 2VH1A 3VX3A 2QPLA 2PSEA 4WRRA 1U2SA 4M99A 5CYFA 4CCAA 1WY5A 3WWCA 2IEIA 2NZUG 2PS1A 3LRXA 3ZBPA 1IB0A 1AQIA 2GZ1A 1DJMA 2V7EA 1V7QA 5IYZB 3ZWWA 1CNMA 3EWIA 1EXDA 2Z6QA 1XCOA 2PFSA 2B69A 1RWOA 2D0IA 4EA7A 3P0JA 2ZG6A 4UBNA 1IN4A 1PGOA 3FOAA 4PX9A 4HZIA 4J1SA 4V0RA 4B7ZA 1V4NA 2CFRA 3ZWBA 5A0TA 2HRBA 2B25A 2WR8A 5CH5A 2ZITA 1OTHA 3JQ7B 5JI3E 2OZKA 1B8PA 2J0QA 4KQ2A 4I4TF 1WV1A 5G0SA 3F78A 1C3XA 3ZWQA 3HJUA 3MWEA 5B4TA 4GPBA 4QUHA 4TKZA 1E1MA 2QXTA 2VHVA 1N75A 1HZZC 1LJUA 4I9GA 4LTMA 3O3NB 4Q24A 3VRHA 1V9SA 1A5TA 3ZHSA 3B6JA 1ECGA 3VJLA 1ZP6A 3EVAA 2HV9A 3MAGA 5D3ZA 5FR2A 1O94A 2FOXA 2O1SA 2FTKE 3BXGA 3H9UA 3BL8A 3JX9A 1W49A 4GVPA 2R84A 1OWOA 5TDHA 1NBEA 1PS8A 3ZTTA 1KEZA 3NPMA 3KXPA 4BE9A 2RKBA 1VJGA 3A6HA 3TPFA 3AI3A 3FOZA 4A8PA 4GEKA 2VL7A 4Y2YA 1H0SA 3TR0A 4KXQA 5DX1A 2RK6A 3UWPA 1U2DC 1EK6A 1HLDA 2Y27A 2GF0A 2FPKA 3A4NA 3C4JA 4Z49A 3ZYZA 2R48A 9ATCA 4AZVA 3JQCA 3OIFA 4TMYA 1L7MA 3QMVA 4YRGA 2ZJOA 1NVWQ 1E9SA 3DQZA 1V35A 4JDUA 1NY6A 3OQ6A 4B76A 2ZXUA 1GKIA 4EHHA 2CNKA 2IQIA 3M9WA 4H1HA 2P68A 3AW9A 3M49A 3NFRA 3DBVO 3RSQA 4EF5A 2D5IA 2W6CX 3W5JA 3NUZA 1WB6A 1V16B 3IVCA 4G07A 3RRBA 2X0FA 4IOKA 3HYRA 4KEAA 3FRIA 2DBYA 3ZXXA 1OIWA 2H3EA 4ZVNA 5AOVA 3TXAA 4GYJA 4CTMA 4JVOA 4KR6A 4U9UA 1Z5UA 3U1BA 5EZYA 5EVCA 2H29A 2B83A 3LKDA 4WNAA 4FC6A 5EZYF 1SBZA 5JE8A 4AJIA 1NRJB 3HR7A 4BRSA 3IODA 4ETWA 1U3UA 1AKVA 2C0CA 2CJWA 3EEQA 3EZNA 3LDUA 4M53A 1LPPA 4Q39A 5D1NA 4AY4A 1GVNB 1K89A 4P8RA 4B9EA 1J0BA 2M6RA 1ECPA 5BN3A 1INLA 3L4SO 1KJZA 5JMWA 4B3IA 3HN2A 2PLAA 3DB1A 5DW3A 4BV8A 3HMQA 2UVDA 3VVBA 1K6XA 4FU0A 1LI7A 2B1IA 3HNRA 2PHZA 1S9HA 3CR7A 4D0SA 4OA5A 4TL9A 2DHCA 4OTZA 4K7JA 2A7QA 3T3OA 4W5QA 2BI8A 5JCOA 1P1BA 1YDEA 2YHIB 1ID8A 3W3ZB 2VJAA 1R9GA 3I01A 3LSYA 3UJCA 1OJLA 4EY6A 1BX0A 1DXOA 4MUIA 1OW3B 4KQGA 1UEJA 4J2HA 4YMTA 1XHFA 3UAWA 5FO0A 1RSZA 1EVQA 4LX8A 5FPTA 2BF7A 1K8RA 1TW2A 4FW8A 5ILOA 2P4SA 1YR8A 2CL7X 3EDCA 1ZUD1 1AV6A 1QH1B 1U0TA 1W87A 3A2NA 3A6FA 1W44A 3B70A 1CS0B 3FPGA 4PANA 3CZQA 5EXTA 1JRLA 2C1XA 3GFFA 3OX2A 3OSUA 3Q87B 4HN4B 5E95A 5B1SA 3K8QA 4MVJI 2VP5A 1PSZA 1SHUX 4GBED 3HXQA 1XPOA 4X8OA 1IJEA 1HYQA 2GM3A 2WIGA 2YOFA 1TK2A 3JSAA 3LBNA 3N2NA 2O14A 2ZT5A 3WB2A 3B1YA 2VAXA 4RF4A 1UBLS 2C2GA 1J22A 2JFGA 3NBUA 2WBLC 1YRAA 3ZW8A 3ROEA 1QHSA 1DC7A 2LWIA 1E58A 2FN7A 4PEVA 4RTRA 3KYCB 1MR3F 3CLSD 1K5HA 4MWEA 1ZH0A 3SXPA 3H1FA 2WG1A 3H6GA 1QLHA 2ORYA 4JOSA 2I1WA 4LDAA 5EHIA 5K8UA 2ZZKA 5KNCA 5LQAA 2EIHA 2JNWA 3I52A 3CMMA 4HS4A 2EF1A 1NN5A 2PU5A 4FFMA 4EVSA 5JZ9A 5DLEA 3T3EA 2HYIC 2GBCA 3S5UA 1L8QA 1U8CB 1QVZA 1RHUA 2ERYA 4UAUA 5REQB 4BMZA 4HDQB 1W46A 3HYSA 4NAVA 5IHXA 2WFLB 4KWCA 3W9SA 1QUFA 2GEKA 4LOJA 4CU2A 4F72A 2EIXA 1SCNE 4C5BA 1PZEA 1XELA 2ONCA 2GAAA 2GCOA 3P2KA 1FP4A 2H00A 2RHMA 3KVYA 2XUKA 4OHRA 4RACA 4IRMA 3VAAA 2UUPA 4CE6A 2BN4A 5H83A 2VP4A 1HSOA 4BV9A 2GMWA 1KS2A 1KY2A 3HRKA 3IAS1 3FPHA 4JP2A 3ISJA 4RX1A 4DR1B 1UBEA 5IAGA 4EPVA 4Z0HO 4CMGA 1B6GA 2I7CA 3OA0A 3R2JA 1M1ZA 1Y42X 3AETB 1MC5A 1NP7A 1H8HD 4HUJA 5IYZF 3GCXA 4KO1S 3W90A 4KXLA 3AEXA 2HK9A 3OVMA 1LY1A 3VZDA 1D1TA 3KOYA 3VHRA 2CCGA 4E4RA 2QRZA 1IDOA 2PKWA 3QVGB 5ESDA 4BN0A 1QB7A 1RWBA 1GDTA 3WK9A 4R2MA 4YDHB 5TMEA 3U7QA 4EO7A 2Q29A 1NQXA 2VDVE 2W6MA 5DU2A 1U28C 3K73O 3C41J 3O1JC 1X1DA 4U5QA 1X77A 1IQRA 1Y48E 4EB0A 2VTBB 3HXMA 1S4QA 4CR8A 4PGHA 2H1IA 4I8XA 1E5DA 4Y2TA 3DWGA 3JD4A 5HBRA 3LW8A 4DARA 3ML1A 1AKQA 1UBTS 2ACKA 5IAJA 3T9DA 4ZCIA 5CD9A 3E2PA 2NXJA 2IDMA 5FWDA 4DUGA 3AZOA 4LGMA 3FZEA 2V74B 4JUAA 1CY6A 1FX0A 2CXNA 1F4VA 4L74A 4UZEA 5DI3B 4MB0A 4QYSA 4OB6A 5K3CA 4QXPA 5M7EA 1CUHA 3LY5A 4NIMA 2QZPA 4WZBB 2WMYA 3LQQA 3UAXA 5CBPA 2C2WA 4KWTA 3EA4A 3GGSA 1E59A 4Z4CA 2Q3FA 3UQZA 1DDIA 1L7BA 5G40A 2R79A 3DCIA 3L1VA 4R8VA 4AULA 3EY4A 1J2JA 1OTXA 1XA4A 3QBEA 3E4CA 3M4XA 3CVYA 1SWWA 4Q0MA 1ZRHA 2DFTA 1ZQ1A 1Z34A 4R7TA 3G2NA 1PF7E 4QNNA 1JAXA 1L4UA 2V98A 4LRUA 1PJTA 4WK0B 2Q3DA 4WBNB 5AUOB 5K8LA 5SYMA 1OH8A 2VDOB 3JATA 1ICEA 3QWBA 2CE7A 1PSDA 1Y9JA 2VYCA 4MK4A 4HR7A 4G0YA 4V0SA 5GM1A 3GLVA 2WU8A 3FFAA 4GP7A 5IZ4A 2GN9A 2C3UA 1YONA 3I9MA 2FZWA 1RHMA 3FWYA 3BULA 1D4OA 1HLGA 2VI5A 4AKGA 2O8FB 1VA5A 2ZRNA 1FW6A 3HRIA 4TWIA 2PX4A 3WMRA 1KQGA 1VOTA 4XI9A 4CXMA 5IT9A 2GSDA 4HYYA 1XXHB 2ABWA 2BY4A 2FDXA 4JUFA 4EGAA 2ATIA 3U7GA 4XGQA 2ZYUX 4ZXPA 3A9TA 2IEBA 2VRCD 4GZ5A 4Q4LA 5ALKA 2WJZB 1PR2A 1YACA 3RT1A 5K2OA 1EFRA 1C0KA 3GT7A 4EUKA 4CI9A 5GADl 1O4VA 3Q9SA 4LY3A 2O2XA 2OFFA 4XB2A 1U8ZA 3WWYA 2EKDA 4FWBA 4EHKA 5BYKA 4NONA 5F3RA 5HNKA 1QO9A 4QM6A 5BWOA 4A26A 1J5EB 4UE2A 4MR9B 1SXJD 1SU6A 2R6ZA 3DG9A 1FTSA 4H15A 4HJRA 3KKLA 2O5RA 4NF2A 4J0JA 4IXDA 1GL7A 4OHPA 2XKBA 4LISA 1TADA 1KYTA 1KZ7B 4EL0A 3JQ7A 1MC4A 2QTNA 3QBTA 5F5XA 3BIJA 4JIMA 5HDBB 1BCRB 1YZHA 5FQNA 3RADC 3TIFA 3MWEB 2BGUA 2YRXA 3TLZA 5HP4A 3MMSA 2DH5A 5ED4A 1NI5A 4QU0A 4UEOA 5IVKA 4YIKA 4X1IA 2EFHB 2C4WA 2MSNA 3I2GA 4M1EA 3ZHZA 3ENVA 1B93A 2E4VA 3OOHA 2IYWA 1CY4A 4MHOA 1E79A 2CXRA 3FTFA 3C3AA 4IGFA 1QIIA 3NM5A 5CA0A 2A1UA 1QIDA 4EYKA 4F5ZA 5E4FA 5F35A 5EJ4A 1GLVA 1HKUA 3L5KA 1MJNA 4M36A 3HP4A 5J47A 4GVLA 3E7WA 2Q1TA 1XROA 5H1YA 4CTOA 3R3WA 5KTKA 3TOVA 1AGXA 3PC4A 1PJ4A 3GW8A 3QW4B 4XVRA 1L4LA 5FWAA 1UEIA 2JDID 4IMIB 2DEUA 3VYWA 4HAXA 4NH4A 4EPYA 1VPTA 1QHGA 1LB1B 3D4OA 1P9WA 1SUSA 3C7DB 3QPBA 2XNJA 4KGZA 4HXGA 4L3VA 5ED0A 1WZIA 3SQMA 2HSGA 3UJAA 5F7ZA 4B6RA 4CDGA 6CHYA 3U56A 2DETA 4XWYA 3VVLA 1F3OA 1JFSA 1DDGA 1FXUA 4QQKA 1QGUA 4K5QA 2AK3A 2SICE 3GT3A 3ZCSA 3VDQA 2W2OA 3DDHA 1X86B 3T9BA 4JYPA 2TMKA 3WGQA 2FMKA 1JQDA 1XJQA 3D8NA 2GDZA 3UTDA 3RWBA 1N3IA 2B98A 1SIWA 2DUJA 1OWNA 3RV4A 1P9OA 3QK7A 1X42A 3WLLA 1J9EA 1HDIA 4OK3A 3TEJA 4KQMA 2Z5GA 5MDHA 1J42A 1K7FB 5AW0A 1IRXA 2FCRA 3B6KA 1GDHA 4CR7A 4HB4A 1H5NA 2G3YA 4TGLA 1VL2A 1JILA 3EVCA 3FDIA 4O1HA 3RREA 1EE2A 3VU9B 3VZRA 3VPHA 4YMVA 2QBYB 1ML4A 1YZNA 5AR1A 1U6KA 1L5YA 4UNRA 3B3GA 4L27A 3ZZMA 3LE8A 5L6MB 3LYHA 1OZGA 2VSYA 3JZDA 3AUYA 3H7AA 4RPCA 2JIQA 1FFEA 1GXSA 4GO1A 1SC3A 5EWJA 4DGQA 5U9CA 4EUSA 3T99A 4H08A 2WWVD 3ED5A 3RE1A 4RVUA 1GG2A 3L06A 3RIYA 1N2OA 1OKKA 1Z6AA 4N7BA 5EKXA 1CY7A 2XE6A 3D64A 3K6JA 4PZUA 4AECA 2AXQA 3KDAA 1SKAA 4MUMA 1O96A 2PU7A 3K8YA 1H05A 3GRZA 3JQFA 3U1TA 4CM9A 2XXAA 1MB4A 1V26A 1GGNA 5H82A 1N2CE 2JJ2D 1DOZA 4U5XA 4B79A 1UPAA 3PV0A 4CMJA 3OZCA 4RFLA 2OG1A 5HJ5A 2YMPA 1FRVA 3NNNA 4RKFA 1L4BA 4GF5A 1UXJA 4FTWA 4MP3A 4TM8A 1A95A 4ZT4A 2IWHA 3ZH2A 2VFAA 4QJ5A 3AEUA 2IRWA 1SZCA 4TYQA 2WTNA 4FJ1A 4II7A 5G3ZA 4A92A 3T5DA 1Q7RA 4DMFA 3E9DA 4JLAA 3KOMA 1UPXA 4P2GA 4AJJA 3ORQA 4I81A 4GAEA 5WRFA 1T8WA 1UWVA 2XUJA 4B6OA 1M6EX 1VL6A 1TA0A 4QARA 4BGVA 2PRSA 4YIHA 4FCTA 1RD4A 4LQDA 1WTCA 1VLZA 2VF8A 2J85A 3CH7A 2RSLA 3TLCA 1YZLA 2Z57A 3N6RA 4A9AA 1JYFA 3TFQA 3W1VA 4YBRA 5BN1A 2JLZA 4O5AA 3BGDA 4LDNA 1V8PA 2V65A 1F2TA 4KVZA 1IATA 5DBEX 3P9CA 2VHTA 3OTOB 1Y7PA 2WFMA 2X86A 2CBXA 4QOJA 3STTA 2N42A 5T4HA 4IGKA 4TWBA 2B99A 3AFHA 4A8TA 1ISRA 1QCYA 3ZK8A 2DQ4A 2I6XA 4QO8A 5FEMA 1D2MA 5DI9A 3I1FA 4L9SA 1RI5A 2EZ8A 4UTVA 1GQOA 2QTTA 3L8CA 2P9BA 2Q3CA 1ZK4A 1ENZA 1N7GA 2QN6A 4DCTA 3OE5A 3PEFA 4D8XA 4BFZA 2WQ7A 1TX4B 4QHSA 1GUYA 1Y8AA 1BGXT 5JCPA 1EP1B 2AMJA 1VM6A 3QTLA 2R66A 4QC2A 5DMXA 2C61A 4KXMA 4FK8A 4LJLA 4J9UE 2G83A 2WVAA 3ZUPA 1K5DA 4NBUA 3H3JA 3TTWA 1N8KA 4AD8A 4FR5A 4URVR 3B78A 3QOYA 4PM4A 1QV9A 1HQYE 1NUQA 3ASZA 3L77A 5ENZA 3UJNA 4AT1A 2O19A 1GYQA 1QYCA 3PNOA 1I5EA 2CEAA 3GLKA 1C0LA 1KP3A 3GBSA 3IIKA 4XM2A 3WHPA 1DBPA 2O2EA 5J2TA 3X44A 5H70A 4CM8B 3RWOA 1BJRE 2X0RA 1XL0A 2ZB4A 1ESEA 3MWGA 1LF0A 3LX8A 4PQFA 5CMLA 3MOIA 5M3BA 3WKBA 2YNMA 3IBSA 4B85A 1Z13A 4R3NA 1Z8NA 2EU8A 1CFJA 3WGZA 1KR5A 2GPAA 3LQ1A 3G6KA 3KVVA 3M5CA 1U9JA 1L4HA 3RODA 3E05A 4F6LA 4FQ8A 5FBZA 1LFAA 4BTLA 2EBUA 1JG7A 4HQRA 5JPCA 4MUHA 3OOEA 4PTLA 1SKMA 2V7PA 2G1UA 4MOWA 2PV0A 2X5NA 4KLNA 1G2PA 3GU3A 5CNMA 2VPQA 3OMLA 4BBZA 4ECEA 4PO3X 5CBPB 3KYCA 2AYZA 3RSCA 3TXXA 4R7GA 5GTDA 2CVPA 5IEJA 1VSQA 1ZH6A 3BBLA 2WVHA 3BA1A 2NLOA 3UYKA 3PD7A 1P33A 1XF1A 4Q18A 2A4MA 2BV3A 4FYJA 4MI3A 4WACA 2HIHA 4CG1A 1J09A 1W0JD 3AKEA 3WLPA 4DHWA 2VZLA 1P0IA 2H9AA 4WK2B 4Q00A 3IQZA 2EEZA 2X1MA 4K6CA 4L51A 3PYXA 3L40A 3GUCA 5K4AA 5REQA 1KSFX 3V4SA 4EI9A 2PANA 5F9FA 6Q21A 1Z4IA 4MVJE 5K3SA 5KC9A 4J1NA 2QEQA 3AUJB 2WEKA 2Q5OA 1G8PA 2QRVB 3R7DA 3ZV6A 1D9XA 5TF0A 4D43A 2OBBA 5BVHB 1JU3A 2NSDA 1XTRA 3WIUA 3WYCA 3UY4A 1PJ3A 1NJ1A 1XWWA 2CLLB 1EVJA 5D2CA 1I7SB 5FUXA 4GM1A 2JCGA 2I8AA 3PQCA 2ZSJA 2ZJ0A 3OPXA 2BDTA 4JENA 3ZI4A 2W00A 5PGMA 4Q4CA 5G2OA 1AQNA 5K6RA 1HT3A 1FU7A 3KQMA 2IHUA 4WHMA 3AMVA 4JQZA 2ALJA 3VYUB 4DWJA 1Z4PX 3E81A 3P9ZA 2RGWA 3QUTA 1ZL2A 4PLVA 1XXHA 3PEYA 1DKLA 1SCDA 3CF0A 3PEVA 1Z8HA 1FDVA 1A77A 1Q19A 1VPDA 1XQXA 1OI2A 4MKRA 5CVVA 5A0FA 1GAJA 4DLTA 5I48A 1X13A 2W2KA 2DFVA 4A6EA 2MSEB 3AB7A 1IU9A 2NSHA 3PIIA 3Q88A 3FWKA 4UBMA 3TZ6A 5HQ3A 1ZHOA 3I45A 2P5YA 3U2QA 3MUOA 2X5XA 5FNVF 4MICA 3SJ7A 4DRZA 3RHFA 3YASA 3FDXA 4O4IA 3R0XA 3BDAA 1K68A 1LNSA 1XKXA 3LDFA 1IJKA 3E3LA 1QOPB 3ABQB 4NENB 4NXMB 3ESBA 4GL2A 1L4NA 3GUUA 4EZBA 4OLHA 3I92A 5HEKA 1O6BA 3T12A 1T0IA 4QBKA 4WZBA 3ZWOA 3ZWXA 1LK0A 3KPVA 3ZIUA 5KNBH 1I0LA 3FKJA 2FE4A 1I2ZA 1YH3A 3ADKA 3H65A 3JAKA 4UKDA 3VKUA 4ZHQF 3EW7A 4V0MA 1KSHA 1WW2A 1FYWA 4UHEA 1ILWA 1NQTA 4E2FA 4Z7OB 4ZYTA 4NICA 4WFQA 4BFLA 1ZOOA 4D9NA 4HX5A 4LY6A 3BF8A 5CHEA 3X1WA 4AZSA 5J2UF 1FYDA 4IH9A 3O21A 2B0CA 4G5QA 3EE6A 3OQMA 1LF5A 2PH5A 5CNJA 1MRZA 3OE4A 4V02A 1AO3A 3RUAA 4DRYA 4EF4A 4OK5A 3A9RA 1K6JA 3HL0A 3VTAA 2V7VA 2IYZA 2FEAA 4BLOA 3IULA 2O8CB 3D3WA 2J6BA 4KN8A 3DE4X 4P31A 2CJFA 4RORA 1W47A 3ZGYA 3PVCA 1WS6A 2BF4A 1M8JA 5HQ3B 1WXFA 3ZTYA 4ID3A 4YP5A 3ZI0A 1XZJA 1FFYA 5A4FS 3FYUA 3LYUA 4GOLD 3L7MA 4EMUA 4QJ3A 5A0VA 1T36A 1CR6A 5FPSA 4C88A 4ZGGA 1NL3A 1FE8A 1U80A 2PRZA 5GY7A 5E3HA 4O1IA 4CDRA 1Q0RA 1KBQA 4KKXB 2XCTB 1G9XA 4ML3A 4KQWA 4PX3A 3VKWA 4RMGA 3O91A 4HNRA 4MW1A 2DLNA 4B74A 2V6JA 3G2LA 4D96A 1Z82A 5IVPA 2QBYA 3PP8A 3SWWA 4TV8A 4BVBA 3KJFA 1JSCA 1Q6YA 3I6BA 3ZWMA 4YV0A 1OOEA 1AK1A 1GRVA 3EIUA 1C3LA 4R1LA 4MDHA 2IZOA 2EC5A 3HCOA 2IX9A 4ZVRA 3TDKA 1PSWA 1RLTA 3IOEA 4IINA 1DIOB 1G8MA 1NPTO 5HGXA 3RD5A 2XGGA 3ZZ1A 1F0NA 4GX5A 5KWSA 3RJ9A 1YZGA 2QL7A 1CX9B 4CT5A 3OWOA 4X1IB 4ICIA 2VOJA 3WLKX 4H27A 2GN2A 1E9BA 4REOA 5KDDA 1Q3HA 4LVNA 2VDJA 1ZH4A 1T91A 3IJ5A 4R1TA 3VNQA 2G4VA 4DJ5X 3AEQA 2A1UB 5EJ7A 5DXFA 2DR2A 2IXGA 1TYCA 1ZN9A 4Y2HA 5MGNA 4R68A 3WHIA 2GWRA 3HBMA 4AUEA 1LWNA 1IDN1 4R1NA 2VWHA 5FOTA 3TLAA 1LQ2A 4J07A 3QPDA 4A36A 3STVA 2C7OA 3UA4A 1M0SA 3WLJA 2GPTA 1EM8B 4UPDA 2RBGA 1R64A 4FEYA 3FFXA 2FP3A 3PFIA 4RJIA 4BUZA 4DJJA 1KP9A 4JUIA 4E15A 4ROTA 4LF9B 2J9RA 1FXSA 2I0FA 1BMFA 1U0NA 1HDCA 1K6EA 2IOFA 4RY2A 4YV1A 4AZ0A 5FI0B 4M8KA 4OL0A 2FY8A 3FGOA 1QC5B 5FOQA 2JLBA 2JEOA 1U3FA 3OT4A 4KN5A 3DGEC 3M3DA 1E0DA 4XOUA 1PDWA 2COKA 2L18A 1XRJA 2V0CA 1PFUA 2AHOA 4PPQA 1XR3A 3E27A 2WD9A 2P2YA 3OI7A 3M1IA 4KZPA 4MQ6A 5M29A 4BNKA 3QF4A 2GS9A 1PDVA 4I4IA 5SY4A 5C31A 4C0QC 5DTEA 1RAAA 3DV2A 3WZLA 3NDPA 2IU6A 2JGDA 3VNUA 3RK1A 4IXNA 1TTTA 4OHUA 2DHDA 3NOOA 4DPKA 4A0GA 5JSFA 3EEOA 3UV6A 1V7PC 1X7HA 3Q11A 1W19A 3EXEA 1VRWA 3GOHA 1TJ4A 4NBWA 2FN9A 5ALOA 2NUPA 4Y30A 2H11A 3BEDA 3WIVA 4CLRA 4FOSA 1BGWA 2IW3A 2SECE 3NKVA 4ZEOA 1Z63A 3TD2A 3Q8KA 3GG9A 1OILA 1Y3HA 3PDCA 2W70A 1E1DA 1KYZA 4MWGA 4OK6A 4DM7A 2IXEA 2VK2A 3DFFA 1XQVA 3LPNA 3K0AB 1P2SA 3FUVA 1B7GO 4B3TB 3L0PA 5HCIA 3MJVA 2HBRA 2V9ZA 4INOA 1QS0A 3ZU6A 4B6SA 4GOJA 4RAQA 1PD1A 2OGTA 1KJIA 1YV9A 1V25A 1L2TA 3U19A 3EHEA 1VG0B 5CYOA 3PHIA 3QVWA 4P98A 4MHTA 4JCOA 3VZCA 1XQ6A 2CD9A 1MD9A 4A2PA 4JJ4A 4E5NA 1ZRSA 5BRJA 3EVDA 2XB6A 4NZPA 3TQIA 3GRRA 2HDOA 4UU8A 2PS3A 4MROA 4ZRNA 1LSOA 4XYBA 1OA1A 4YPFA 4QBIA 4ETMA 1KMQA 4YUYA 4YAGA 1JHQA 3CX7A 5LYJA 5AM2A 5FH9A 1ZM7A 2PL5A 2AUTA 3NIWA 1DFHA 1SA0B 4LC1A 2R1UA 2WLSA 4MRPA 2X1VA 4RGQA 4UUMA 4OQFA 4WASA 4YRRA 3E15A 3L7AA 3KOXA 3I9NA 5G41A 4GD3Q 4RIEA 3HFRA 2J3MA 2H7XA 4UUQA 1BGVA 3SGLA 5ITZB 3JVVA 2OV3A 3HCBA 1C4OA 2CMDA 4KRGA 3QH4A 4EB6B 7MHTA 1EBFA 3C3JA 1SBIA 2FEOA 1WMDA 2VDWB 3ESDA 4U7WA 4WESA 2WZQA 2G25A 3HV0A 4OQPA 4DIBA 2PJUA 5J2UB 3Q0IA 4HQNA 1NXWA 3EIOA 1YB1A 3QUQA 4FFBB 2BKLA 2CD7A 2NW6A 2ZI6A 3O93A 1SIBE 4JP5A 3UMVA 1R8SA 3OT1A 3EEYA 2WWIA 2DKNA 2YCLA 4GKVA 1G6KA 2RH5A 3UA3A 1BCSB 3RC3A 5C2JB 4CMIB 3PFHA 3KO8A 4B73A 3AW8A 1ABBA 1NP3A 2B61A 3K9NA 4ZCSA 1HLFA 1KFCB 1TO6A 2ZSKA 1YAHA 2CZCA 4HK4A 5KINB 1HA3A 3QEJA 1J99A 4H7KA 4HDCA 5EQDA 1NBME 1JIJA 5EYPB 5FQOA 3RT9A 3D0OA 3CUUA 3AU8A 3SK0A 4DCMA 2Q45A 3RIXA 4DMRA 2VSNA 4J3FA 1OI4A 5KJ6A 4G81A 1O95C 1U2PA 1ZOIA 3WBKA 4BFVA 3ETNA 3FZGA 2QM7A 1L5GB 1I5RA 5D84A 2O2DA 3GNLA 4LCEA 1S2OA 2CLDX 1OZFA 3MBOA 3OCCA 4CFYA 4OI4A 4ZV7A 3W04A 3DEZA 2CLCX 4C4SA 2I33A 2PWBA 1T15A 2WNHA 3CZ9A 1TA9A 2PJDA 1RLOA 1Y8QB 4IDCA 2PUVA 4RKEA 4YT5A 4JJEA 4LMAA 4FUQA 2VPYA 3DMRA 4WOKA 4E5VA 4KQKA 2WB2A 3MTAA 4QXOA 3KUUA 2ZI4A 3IRUA 3DBLA 2OB1A 2W2KB 3DO6A 2C5BA 1FJXA 3VYRB 1EP2B 3DUWA 1DUSA 3MRXA 1M66A 2V6FA 2Y4NA 2W83A 2PZKA 2VNJA 3VAZA 4KN9S 2PJZA 3HXLA 2XB8A 1Z2NX 3KKOA 3WRVA 1ZGCA 1RM4A 1D8AA 2XB4A 4RDHA 3S99A 3GT4A 2JFVA 4Q15A 4YHBA 1GA6A 1WUYA 1KDZA 2BUAA 1FPQA 3PRJA 1XQYA 1CUFA 4EI2A 4EY7A 3NW9A 3Q6IA 2A30A 4HRVA 4JYAB 5FD8A 1LBTA 1RP7A 3N5CA 3FMFA 3ZCUA 4X20A 5KYVA 4WZBE 2C5LA 3PXGA 4RTOA 1EB9A 3KTAA 4DC0A 3WGKA 4CKCB 1GZHB 1L7QA 2JARA 3EN0A 3HGTA 1H9AA 2JK0A 1ZJ5A 1V37A 1EI9A 2FVYA 3LSTA 5U4QA 2VH5R 3NH6A 3ESAA 1G3UA 4BQFA 4ND1A 1UINA 1U3GA 5ECWA 4AG3A 2ILTA 5L95A 4OSEA 4OJNA 3IUPA 3AHIA 2WAOA 3DCNA 3ZOKA 3DOOA 3IVRA 5ILGA 6AT1A 1XTPA 1U28A 4BZWA 3PNPA 4K9DA 2XMGA 2V8OA 3EEFA 1EDZA 1I6WA 1MFPA 3QW2A 4FX5A 1SKQA 4ZQIA 3RTGA 4E5SA 5BMVA 1YZTA 1Y7IA 2VHJA 3ET5A 3KBBA 4L0CA 1JXOA 4BDTA 2FJUA 4L2IA 3ICOA 3IIMA 1NQVA 1JI3A 3N0WA 4XARA 1TEXA 2IOHA 5A3RA 5KPDA 1S5PA 4TZ0A 3O4VA 2PUHA 4DTIA 4EG1A 1FB5A 2B4TO 5IYZA 4US1R 1OROA 2Q3EA 4PIMA 5D6NA 3TQRA 1QGYA 2EBHX 3C3BA 3EGDB 1RLJA 1WU7A 4G5FA 1WVIA 5EKTA 1KO8A 4D99A 1NLZA 5CB4F 5IASA 1FQJA 2AKAB 5JDIC 3H5TA 3UBMA 3LA8A 3ET4A 3L43A 3PA6A 4EABA 2C88A 1TCBA 2ZUCA 4WY2A 2IH4A 5C32A 3BF7A 2AGVA 3E8XA 4GOKA 4RCVA 1KVQA 3UJDA 2FKAA 4P7FA 4Y2PA 2R8XA 4BN4A 2RH9B 3CKKA 2P2CA 2P4EA 2CKDA 2P8SA 5BYBA 2VSXA 1W0KD 2PUTA 3HQ4O 3K9CA 2AWNA 3LJKA 4TTSA 4Z0PA 2MYNA 1C7FA 1Q84A 3CLRC 2G72A 3GB9A 3KFVA 4HN9A 3G1WA 3IV7A 1R8JA 4OBEA 5GOZA 5IBQA 4AYTA 2IYRA 4YRBA 4K2AA 1R0CA 1S01A 3M6WA 4TPKA 1FDWA 1MOSA 3I39X 2G0TA 2XUFA 3ER6A 2G1AA 5KYNA 6NULA 3S8YA 1KIAA 1JN0A 4BNVA 4PN7A 1S9DA 1WE2A 2NX2A 2YYAA 4H1TA 4B3XA 5B1YA 1UJCA 4HH1A 1W7AA 3LLMA 2DX7A 5FL3A 3U7RA 1Y81A 3A9UA 4LNAA 3VR5H 3TCKA 3DEHA 1WG8A 5EQFA 2DH6A 1Q3TA 1CFZA 1ZN2A 4L4SA 3I5AA 5ERGB 4DIOA 4EHAA 3OZRA 5CFNA 1Y1RA 2A92A 1QM5A 3BKXA 4LHEA 1POXA 3ZVMA 1THMA 4X63A 1OFTA 1YDWA 4WXYB 1H2FA 2WICA 1RFGE 4XA8A 2ASVA 3SIWA 3SOPA 1KBOA 2YH2A 3BH0A 4W5RA 3OJLA 2VSOA 1RYZA 2A5FA 1AD2A 1BKSB 2XUAA 5DHQA 1W93A 2NUTB 2PKXA 4IUBS 4LJAA 5FHRA 2V7QA 1P80A 5KQRA 2MYPA 1KYWA 2HV8A 4M1MA 5JD3A 3LNCA 1RIFA 3B1XA 4XB1A 2WWRA 1RJDA 3UAZA 1XCBA 3TGLA 4RGBA 1S1CA 5B6IA 4MKHA 3BE6A 3V3KA 4ZHQB 2Q6TA 3L49A 3PNMA 4CN9A 3CE6A 4JYBA 3B8EA 3ELWA 4PVCA 4X6LA 2KQUA 1V11B 1SVOA 4NARA 1MOQA 1ZGJA 5FT9A 3VZPA 3WTBA 4WINA 4M9CA 1QC5A 5TEVA 3WDSA 5EZYB 5CU7A 5FEUA 3SBOA 4FFSA 2QMEA 3DAFA 1RC1A 2ZUWA 4E5YA 3WYFA 5IG2A 3PFKA 3E5RA 3DYBA 3PR3A 1T36B 3QKIA 4FZ3A 1P2VA 1O03A 1R2QA 4FN5A 3JS5A 4JZYA 1H8HA 4PAGA 1Q3KA 3S28A 3I62A 2ZI3A 3KJXA 2C77A 4ZMSA 1Z5PA 3DDZX 3WGGA 1IM2A 3PQ6A 1CEYA 3UCFA 1HTWA 1I0ZA 1YNOA 4YC7A 3CKMA 2H7CA 3G79A 1ZJZA 5FO1A 1P0PA 3IT3A 3SSNA 3BT7A 4MUAA 3DVAA 3NHYA 5KVVA 3Q6MA 3MUNA 2X4GA 2X13A 3H2KA 4PLZA 4RLHA 2WJAA 3L5OA 4F2GA 3OH8A 4AJ1A 5A6SA 1RVV1 2Y67A 3RTAA 4MINA 3TQTA 4MJXA 1B76A 4HS9A 3MB5A 3WNZA 2YHIA 5H9WA 1QONA 2AOTA 1WLSA 2FETA 1KZ4A 4UUNA 4F93B 4QT4A 4LUCA 1VIDA 4PXSA 3I6IA 2IYEA 4X00A 4KQFA 3GJXC 3IMGA 4FZ5A 4MQUA 2JKYA 3ORSA 3P45A 1CC1S 3DF9A 1HXHA 2XTJA 1NGSA 4TQGA 4C4ZA 2I2AA 1E3TA 3D4PA 3ORFA 5D01A 2IIQA 2YRFA 1A4UA 4RVDA 5AI9A 3KYDB 4HNTA 3DGFC 4FGZA 5C35A 1MRNA 5HYVA 2AXNA 4TS3A 4L4YA 3VKFA 1U1GA 2NTYC 3NTUA 4MR8B 2IP1A 4PNZA 3HJFA 3OQOA 3GC6A 4CEIA 1Z4LA 3FRJA 4NZMA 4OKIA 3G0GA 4KXNA 3BM5A 2GLXA 2OXEA 4QPDA 5F9MA 1JNXX 1TC1A 3CJRA 5HRUA 3G0BA 3L0OA 2Q0QA 5COAA 1QAQA 4ENSA 4QL3A 4M37A 1GPNA 3JR7A 5H7XA 4ABTA 5DX0A 1T0JB 2PH1A 4XH9B 5ISMA 3OD5A 3QFHA 1Z26A 1R7RA 1XAGA 4REMA 1OXXK 1M8GA 4DY4A 2V4ZA 2H7YA 5AJWA 3E70C 1KI6A 4BLVA 2ZBUA 2ZRHA 3W5AA 1QRAA 4M55A 4YYEA 1S2GA 1E0KA 4NFLA 2X5JO 5J3JA 2V5AA 3HCCA 2GBFA 1M2HA 1ZISA 2WHRA 4BOYA 5COBA 5KPJA 3ZGZA 2CLSA 1V41E 4LYGA 1NKSA 3OCWA 4ASUA 1DIBA 3MRVA 2Z2IA 4IUYA 1D7AA 3KEGA 4QGBA 2HRRA 1KI8A 1O57A 3OT1B 5I8ZA 2J31A 5I5GA 4ERNA 3ODPA 1DAGA 1H5UA 2NYUA 3GCZA 3W8EA 4CMIA 5ARBA 1AKUA 1GTRA 3FMVA 4G5HA 4BVLA 2HJ9A 1VE3A 1ISHA 5IJ0B 5LN1A 1Y6RA 4Q4DA 2WTUA 1GSOA 2GZRA 2G9UA 2GERA 1DBIA 4NS1A 4RM2A 1EFPA 4XGNA 2OYRA 4WXPA 1BWPA 1H22A 4DFDA 1GNPA 2PX0A 3LY8A 1T4CB 2ZIXB 3OCUA 4II3A 4Y9SA 4ZCRA 2Z2KA 2D0OB 3NWBA 4CT4B 4EO9A 3IERA 3K6RA 4RTQA 1Y33E 3KQKA 1QQAA 3JALB 1PWHA 1O2DA 2X42A 5AJZA 3L84A 3OCYA 2GRUA 2QVYX 3I01M 5HFJA 2HA2A 3QKRB 4CLHA 5KJCA 4TXNA 1R9JA 1B0PA 3T5CA 1DX6A 4IVNA 1NVVQ 5JZVA 3ZVLA 4BFXA 2DPYA 1L5KA 1E7SA 3E7XA 4ND6A 2GHIA 2OCPA 3D3NA 4UBJA 3GX1A 3PUXA 4OU4A 5A05A 1AF7A 2XMPA 4J16C 2B82A 4DA4A 1X7DA 1NDQA 1IY0A 1VECA 1QANA 3DMPA 2H8KA 4RIFA 3VPSA 1GKLA 4DA0A 1RJEA 4YYZA 5JH7A 1ZJ4A 4IHQA 3E7DA 1PNVA 1P1JA 3S81A 4N6NA 2QGNA 2UXBB 2R2GA 1S7CA 3BICA 3C39A 3L7BA 5AXCA 4BJ5A 4F06A 5CDFE 4L02A 4A2CA 3GCGA 5KYUB 1V48A 3VC1A 2MHCA 2P2GA 1A27A 2YV2A 3VPBA 2X4IA 3R3JA 1PLLA 1X94A 2DKFA 4RXUA 4D9FA 3W6OA 5IHPA 4F4UA 5BWCA 4ER6A 2WTAA 3ONFA 2YIMA 4FMDF 1RI4A 2RK4A 1A7UA 1L3IA 5J2UA 4RF2A 5BQPA 1E0JA 2CL6X 2Q5LA 4R8RA 4XIFA 5EXSA 4N5MA 1ACLA 1SEPA 1KU0A 2JRLA 3DE1X 1C9MA 1NW5A 1VLVA 3E5HA 1TUEA 4MHSA 5KX5F 2RI0A 3QFCA 1R0BA 5JWOA 1BE1A 2BFCB 4RULA 2ZBGA 5AKLA 3DBRB 1G8KA 3SYMA 1UJ6A 3A25A 4N3AA 3ZWKA 5T41A 1GTZA 4C5AA 5CVJA 1JDTA 4D97A 4ZI7B 3K9FC 1VIMA 3JD0A 4EUFA 1Y8CA 4WNCA 4NHEA 4IOLA 4EHBA 1OGIA 2ZBRA 4I9UA 4D8YA 1XKQA 1P2UA 2HBYA 3AM4A 3L92A 3V6LA 3N2ZB 2PX8A 4UVGA 1ZJYA 3NATA 4KLAA 3OEHA 2Q5FA 4C4OA 4XCXA 3DFMA 1CRWG 2O5CA 1OTYA 1YJAA 1UBFA 2QMQA 3G2HA 5AOCA 1A8QA 1KJQA 1FBNA 2VJPA 3GP3A 3QI7A 3I5MA 4XR4A 3LRPA 2JC3A 4R40A 5MFPA 4QTYA 1I9GA 5CLGA 2PMKA 4AXBA 3EGDA 2W8BA 2YZ2A 3B5EA 4MWSA 3FVQA 5D85A 1CERA 5I9IA 3PCTA 1BSVA 3G02A 3R5HA 4JNKA 3UJ3X 1UJBA 2NUAB 3C3CA 1G4AE 2FQ1A 2PT7A 3C6KA 5A4KA 3RVRA 1A72A 1V9CA 3KK0A 2F43A 4MIOA 4UNPA 2X8JA 3T7AA 3ZDYB 1KXJA 4Q03A 1W5TA 2QXYA 2A14A 5KYWA 2F8LA 3WBJA 2CUTA 4PIPA 5DNAA 3SI7A 3UGKA 4E6EA 3CPJB 4QNRA 5FORA 4WBNF 3ZE6A 5GJWC 4UASA 4LWPA 1I14A 1J7KA 3U7IA 1K08A 1F48A 1BE8A 2AX4A 3QP9A 4DMMA 1W85A 1YJ5A 1Q1BA 3KAPA 4YT8A 5I3CA 3WJ7A 2RJNA 4PICA 1PR3A 1UJ5A 3G1UA 4RSGA 5EJ6A 5GWXA 4YPOA 1W8DA 3CZCA 1JFLA 4CMKA 3UKJA 4YCMA 1KO1A 2FGJA 4X20B 1WBDA 5JECA 4DA9A 2EGHA 2QROA 3EF3A 1JTEA 2BJHA 3IT2A 3LHDA 1LV8A 2BSXA 1WB4A 3GPLA 3FCOA 2HYDA 1RLIA 4NEHB 4XAQA 1YJCA 4CIBA 4CEJB 2VP0A 4JWKA 1VPLA 4GICA 5EHQA 1M2VB 3C6BA 1QF9A 1GHTA 1JEAA 4LBWA 4XE5A 1M1YB 4JLKA 5T6BA 4CEHA 4BNGA 2OHIA 5A2GA 1G7CA 3N2YA 4L8WB 4FBLA 3T7SA 5BWNA 3UUGA 3R5SA 1DJQA 1LTKA 2QE7A 4HMQA 4Y2JA 3SSMA 1KK2A 4C0JA 1I3CA 4RVSA 2XIJA 4DIMA 3C4QA 1BW9B 3NEAA 3PNKA 4B43A 5I5EA 1PVOA 1UJNA 1HL7A 1KH1A 2V03A 3CBQA 3CRVA 1DO8A 3PG5A 4JJKA 2QW0X 5E9WA 3VU9A 2PGJA 4I7EA 3I61A 3VC2A 4LXGA 2E2WA 5JNSA 4FEEA 5ECDA 3KHUA 5K0SA 1N2EA 1DXHA 1QHIA 3A2LA 2G1JA 3H5RA 1GUZA 3KZXA 3NHLA 1M6NA 3NHRA 5IZCC 3IQIX 3I2HA 1LBIA 3OAAD 3R5JA 4QWWA 1CULC 4RK5A 2AZDA 5I4BA 3F3SA 1VE5A 3H9JA 3Q9NA 3DXYA 4L8LA 2B8WA 4MS4A 3FBTA 1FYXA 4K3VA 1ND6A 1SR8A 2O4UX 1KPGA 2QMZA 3OM8A 3IPAA 2GXAA 1U7WA 1U5CA 1AKWA 2F1OA 2WP8J 4TSFA 4X60A 1SVIA 4FZVA 3UNXA 1ZX1A 5FB3A 3SZMA 3C3XA 3IBYA 5EKUA 3C3WA 1NHGA 1OT5A 1TQHA 4XLLA 2YDYA 2I8LA 4QU9A 4PNEA 2HLDD 5HSGA 1DKRA 1IMOA 1SCKA 2OZVA 4M9RA 1DFIA 4Y2SA 2AFHB 5LJIA 5ARCA 2NIPA 2DQSA 1C3VA 3UN1A 3ZG6A 5IS2A 3IEVA 2J4FA 4AS1A 1KAOA 1GUBA 2MYUA 2C5GA 2QJWA 3V4OA 1O9HA 2BUBA 2WIAA 2MR5A 5CXSA 3WWOA 3GEBA 1T10A 1JG2A 3U62A 4BGEA 1B8NA 1K4MA 4N40A 2Q50A 3NHBA 3WLIA 2JRCA 3I6YA 4B1FA 3BK2A 2XQFA 3KZNA 4CM5A 4B83A 4LCJA 4RJJA 4BC0A 1CUJA 4QPCA 5KU7A 1LTQA 1N7HA 2MU1A 4C0HA 3A4VA 4HRAA 3X0DA 2QTZA 1Z12A 4D9HA 1KRXA 5LUBA 4JCCA 3KVNA 5EJAA 2ATCA 5E4TA 1GTJ1 2F17A 1UDAA 4Y1RB 4HDKA 3GLGB 1W2HA 4I8IA 2Q0XA 2IVFA 4ZVTA 2F4VB 4WOCA 3RRFA 2WM3A 2IHVA 4P32A 1SD5A 2B3DA 2H1VA 2N46A 1D9ZA 4EF6A 3CNEA 1P19A 4DLYA 3IAFA 2J9YB 5EJ9A 2VH2A 2ZM5A 3NBKA 2F3PA 3ZE8A 1BTOA 2G80A 1JNYA 3EVFA 2XT6A 1UDXA 5A7FA 2Y3IA 4KBGA 3IPXA 2Z1MA 1QQ5A 5CTJA 2XKAA 4W1PA 2JD0A 1N5LA 3PC3A 4DWVA 1A9XA 2REBA 4CL3A 1Q57A 1OBVA 1UEXC 3PVSA 3ZU3A 4YRIA 1G20B 1H94A 2PUGA 5FA5A 3R3UA 2Z56A 3PEEA 2OT3B 1CVLA 1JR3D 1YR9A 3KOUA 3SQXA 4QTZA 2CNWD 2GA8A 5EKDA 2BFFB 5BWBA 4Q7LA 1WHSB 4EI7A 5C8YB 3EOZA 5FUBA 5KCMA 4C6TB 5KJEA 2ZTMA 4BKOA 2C5HA 2LIPA 3U3XA 3LX6A 3MMXA 1OC4A 2PZFA 2XF2A 1I2DA 1Q11A 1R0LA 5FADA 4TKVB 1YS6A 1ECJA 3AR3A 3NHJA 4ZCLA 4KLRA 5FX2A 2G0AA 4Y7DA 3QE2A 3BJZA 1GKUB 1NE7A 1KEPA 3NTOA 4U8HA 3HDYA 2CBZA 5JADA 3IKLA 4NQRA 3QUCA 3GA7A 4WAUA 1CJCA 1ULAA 1RXIA 1FNNA 1L7OA 3MTJA 3NHSA 2CHVA 4E22A 4TZKA 2EX0A 1IBCA 2Q62A 2QD2A 2X8WA 3Q72A 2AEJA 5FI5A 2AJLI 3JXEA 2DWCA 4P4TA 3DMNA 1KAQA 4N8DA 1DBRA 1RXCA 1GL9B 1PGQA 1U2QA 1U94A 3V1NA 2EGUA 7MDHA 5IF9A 1RI2A 3Q41A 4FHCA 4G5SA 4JXJA 5I7OA 1TUGA 3TLYA 5HJ7A 3CCCA 1XLUA 5TXGA 3O4IA 5IFKA 4UVDA 3UT6A 1IUPA 5DE3A 3G8AA 3VX4A 4E4YA 2PL1A 1MJGM 2F1JA 3E58A 1NVMB 3LWZA 1NIJA 1WP4A 3G68A 3QY0A 5CEJA 4MP6A 3TSAA 4MVXA 2GKSA 3BREA 1YVDA 2BW0A 3ORRA 3BC1A 1A5ZA 4O33A 2HAEA 3FFTA 4FHGA 1ZA2A 4WLUA 4NBRA 5EVJA 2AE1A 1E77A 2TYSB 4KQ1A 4A2WA 3UC5A 1KH3A 2B5VA 4JEHA 5THQA 3UUWA 4LK2A 2BVNA 2GUWA 4IF6A 1DS6A 3TUZC 1TAHA