5JS6A

Crystal structure of 17beta-hydroxysteroid dehydrogenase 14 t205 variant in complex with nad.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
b'GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 92
structure length 268
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5js6A00
4E31A 5BNIA 4GBJA 1E6UA 5H81A 1V0JA 2CSUA 4M89A 1R37A 3K30A 3JYQA 4O1MA 3PYXA 4P4LA 2R6JA 1K3TA 2ZYDA 3ANLA 4PVDA 4DLLA 4J9UE 2B5VA 3BMCB 5I8WA 2DPHA 3P2YA 4ZGWA 4AJIA 4IXTA 2P2SA 1PS8A 3KYDA 3RC2A 3DO5A 5AXAA 1PZGA 1H93A 2VWGA 3PIDA 3QVWA 1Z6ZA 1K6IA 3G49A 1XCBA 3ZWAA 4WKGA 2UYYA 3A06A 1PS9A 3L77A 3PLNA 3I6IA 3PJEA 4BNGA 3E9NA 1RWBA 1VKOA 5MDHA 1YJQA 1RPNA 3IOYA 3OFSA 1PGOA 5ES3A 1C0PA 2IEBA 2B0JA 5GZ6A 3EAGA 1GUZA 2HK9A 3RWBA 3ZCXA 3WSVA 3JQAD 1PWXA 4EEZA 5EERA 1W4ZA 1E1MA 4JBHA 1HEUA 1ZO8A 4GPD1 1YBAA 5CAEA 5CPBA 3VKUA 4UUPA 1I5RA 3MWEB 5EQFA 1F12A 1XYGA 2QRLA 4JXKA 2DBZA 1NQOA 3GNSA 3M2TA 3O03A 1K89A 1G6KA 1KBZA 4EUEA 3ENKA 2X6TA 3GEMA 3E18A 1N5DA 3F4BA 3B6ZA 1VJTA 4ND3A 1WMAA 2CDCA 4MKXA 3BZUA 1M67A 1JA9A 2CF5A 2YQ4A 1H9BA 3FR8A 3WBFA 1D7OA 1UXKA 4IDEA 1IHXA 1J4AA 1T25A 4DIOA 5BSFA 1LC3A 3PFFA 3PJFA 4FIZA 5JDIC 1HXHA 3RKUA 3V2GA 4IJKA 3WNQA 1PR9A 1YONA 2GRAA 1MXHA 1BXGA 4ND2A 4J1SA 5LDHA 1NQTA 3JQAB 2VUUA 2X22A 3PWSA 4LK3A 4FFPA 4ZRMA 4PLGA 2O23A 3H3JA 3S2IA 4Q3BA 5DBGA 4EUHA 3L4BC 1UDAA 4NU6A 5IDXA 4K6CA 4R5HA 1MXFA 1ISMA 1K0UA 2A92A 4XKJA 2CFCA 4BNMA 4RLHA 4MINA 4W9NA 3JQBA 3OIGA 5KJCA 2BELA 2Q2WA 3CMMA 2IYPA 3LT4A 2ZTVA 3BMNB 4GX5A 4CM8B 3AM3A 2X0RA 3OSUA 2BD0A 3DHYA 1XGKA 4CLOA 2AHRA 5L7YA 2RH8A 1KOLA 4OOEA 5C5IA 4KWIA 1XU9A 4QTZA 4N7RA 5F3RA 5KVCA 3MTJA 4LVUA 3AJRA 1X0VA 4EYEA 1JVSA 2AW5A 1V3TA 1D4FA 4ALNA 2GR9A 4E13A 3C7CB 1MC4A 3AOEA 3RUEA 3LLVA 3GOHA 5L45A 1F0YA 3UH1A 1RYDA 1KC3A 4AJ4A 1H9AA 2O3JA 3DDNA 4UULA 1YL7A 4CM3A 1YE3A 3JQGA 3ASUA 2VWHA 4U5QA 2GSDA 4OXKA 4W99A 2VHVA 4KQXA 1DLJA 3HDYA 2UV8A 4WOJA 3E1KA 1LDNA 3RC7A 5HRUA 4WCFB 1HDZA 3DBLA 5JC1A 4LN1A 4CR8A 3QVOA 2Q1UA 2XXJA 4YJGA 5KJEA 4BO4A 3NRCA 3HN2A 3RI3A 3EZYA 4MKZA 1QYXA 1ZMTA 3KVOA 2PD3A 3CH6A 4FFMA 1HDOA 3JYNA 4WJZA 4DUPA 3WMWA 1CETA 3ZWWA 3AY6A 3QWIA 1OFGA 3KSZO 3FNHA 2P91A 1O6ZA 2HMTA 4M54A 1T24A 4E12A 1TI7A 3ABIA 4AVYA 1PZHA 4XIYA 1LSSA 3ZU5A 4AJ2A 5ILGA 3ICCA 3IDSA 4O5OA 4TRJA 3D4NA 2P5YA 3UGKA 2BF7A 1D1TA 4GKBA 4GMGA 4BOYA 3JV7A 2R2GA 2YDXA 5CDSA 1SEVA 4Y6RA 4CMEA 5B4VA 1XSEA 1D3AA 3I6QA 4DPLA 1JAXA 2O48X 2DKNA 3FF4A 3GUCA 3ADPA 4TRMA 4BNNA 4Z0PA 3DFUA 3KEQA 1UP6A 2FPGA 2DUUA 1Q2XA 3NJ4A 4OIMA 5JE8A 4E3ZA 1T1SA 3I3OA 4GL4A 1O89A 4BIIA 3E9MA 3DZJA 3WGIA 3EY4A 5COQA 1DIAA 1C3VA 3DB2A 3GVIA 4Z3DA 1P31A 3H9JA 1ZUD1 3Q9NA 5EINA 5I7VA 3Q2IA 3INTA 4I5GA 4UVHA 1LDMA 4S3MA 3R6DA 1GFSA 2Y1GA 3LC2O 1FXSA 1LXCA 2FHSA 2HSDA 4IUYA 1C1XA 1JWBB 1OBFO 4AJPA 3OJ0A 3QW2A 5HTOA 4MIOA 3WIEA 1E3EA 1ZVMA 3AM5A 4WGGA 5ER9A 4RF2A 1GU7A 1DSSG 1PJTA 4OXNA 2VRBA 4CQLA 3PVZA 1X7HA 4WLUA 1KEUA 2Y0EA 2ZQYA 5CPFA 1Y5MA 3OM9A 2WD7A 3DBRB 2JFGA 1NNUA 1KVSA 3GGPA 3S55A 4DLAA 2HAEA 3UAGA 3NTQA 3V1UA 2OGUA 1FDVA 1XQ6A 2W8ZA 2I3AA 1UJMA 2YHUA 2PGJA 4J16A 3WR5A 1E1KA 2QIOA 3I83A 4PLZA 1RJWA 3ST7A 3MOIA 3DBHA 1A9ZA 1BW9A 4D46A 2JD0A 1IL0A 5F1KA 2P5UA 4XWYA 3NYWA 2C7VA 2X9NA 4DBZA 5CDYA 1K6XA 3F5QA 2A94A 2EJWA 3R3SA 1HKUA 1T2FA 1YBMA 4GX2A 3I4FA 3K2BA 3PJDA 3DHEA 4FJ2A 1GR0A 1FF9A 2EHDA 1R6DA 4M87A 4CM7A 5BNFA 4Z9YA 4YAEA 5I8ZA 4D0RA 5L9AA 4IDFA 3FCOA 5F5NA 5JCJD 2IDZA 1YH3A 3F47A 4DQUA 1SZJG 1HE5A 1E77A 5L51A 4MO2A 1Y6JA 5FI3A 2ZB3A 3QVXA 4BNUA 3DFZA 7ADHA 1K5HA 2QQ5A 4PVCA 4Y8VA 2PGDA 2GN4A 4J6FA 4CM4A 2J3JA 4GMFA 3GDOA 3W1VA 1LSOA 3DC2A 1LDGA 2CVZA 2G82A 2Q3EA 3KM0A 3SLKA 1Q0HA 3MJ4A 2NVUB 1U2DA 4IBOA 2Y93A 1W8DA 1ZJYA 4FFLA 4IGFA 5EJ2A 1E7QA 2PLAA 1NFFA 2D3TA 3DZFA 3GLQA 3WG9A 2ZB8A 2C2XA 1XQ1A 2X1HA 2B4TO 4ZQGA 2Y0CA 1WXDA 5G4LA 3BYZA 1NX6A 3KEOA 1DDOA 1JKJA 3TL3A 2AG5A 3OH8A 2BI8A 4IDGA 5K0ZA 3WB9A 4P22A 4J43A 5EIOA 4W6ZA 4IQGA 5TX7A 5B1YA 3RVDA 3I52A 3OP4A 3BTSA 1HE3A 2NU6A 1YQDA 1LRLA 2OP1A 3HFGA 4GVLA 3AOGA 3ETEA 3D0OA 3RJ9A 4WLOA 5C3MA 4FCCA 3FR7A 4ZRNA 1DIGA 1JLLA 3Q11A 1ZCJA 1LDYA 1ULUA 1V6AA 4PG5A 3WQSB 3OBBA 4BKOA 3DOOA 1EQ2A 3F9IA 3UF0A 5EESA 3ZV5A 3FN4A 1P33A 2ZTMA 4BKUA 4BO3A 2GPTA 4URFA 2Q46A 1H6AA 3OEWA 1H6CA 2WEKA 4L75A 2JL1A 2RIRA 1LDBA 3LU1A 2JD2A 4XR9A 4FGWA 1Z74A 4RZIA 1GEEA 5A9RA 3L4BA 4JBIA 1PWZA 3HFSA 2H5LA 2Q45A 4E5PA 1LRJA 3PTZA 3WGHA 5AXDA 4CMHA 1V8BA 1PJ4A 5G4KA 3WQQA 4YT2A 3NX4A 5T6BA 3I4CA 1UXGA 3ZWPA 3DBVO 1BDBA 2I76A 3OF2A 3QJ5A 5DP2A 4YYZA 3FPCA 1WWKA 1H6BA 1ADBA 4CLHA 3E8XA 4YJFA 1I2BA 4OGWA 4IMRA 4W82A 4KMSA 3SX2A 9LDBA 2IYOA 4U7WA 4K26A 1DFIA 1ENZA 2G17A 1QLJA 1QYDA 1P77A 2GNAA 3KO8A 1Y81A 1NVMB 4S1VA 4UEOA 1M2WA 4FDAA 5G0WA 4B79A 1ADFA 2P9CA 3QLJA 4MVJG 1VI2A 3IJPA 4FBGA 2WDZA 3TPCA 4P4NA 3DONA 1AGNA 1C1DB 1LSJA 3I9MA 1AHHA 1B2LA 1VSVA 2QZZA 4ONEA 3F1KA 4E5YA 5H82A 3PQDA 1ZK0A 2Y1EA 5JAZA 2Y66A 4IY1A 4J0FA 1EQUA 5C7LO 4GLOA 3B70A 4GSKA 5A3JA 2BMAA 3K5PA 3BHIA 3U0BA 4UVGA 2O4CA 4DC0A 4EUFA 4B3IA 3O38A 3KBOA 1RM0A 4D43A 3PQEA 1I36A 3QWHA 4PG8A 1XDWA 2QW8A 2D5AA 2CVOA 3CKYA 3L9XA 2VT3A 1B14A 1O94A 4XYGA 2X9GA 2GZ1A 4BNZA 1TT5A 1KEWA 4YQYA 1FDWA 3WGQA 3STHA 4XDYA 4D42A 3A28A 4CMKA 1NQ5A 1VJ0A 1HLDA 1L1FA 3KYCB 4DQXA 3FRJA 5IAAA 5K9ZA 1H2HA 1OC4A 2YFQA 4ZN6A 2HMVA 3ZU4A 4K6FA 3UOGA 4XRRA 4KUGA 1N7GA 4F6LA 5L53A 4PLTA 1A4UA 2ZK7A 4RF3A 1GL3A 3K8ZA 4NFSA 2Q4EA 3JQCA 1TT7A 4WLNA 3AFNA 2DPGA 3DOCA 2PKRA 3E03A 3VAZA 1NPYA 2VTEA 1HE2A 4MVJF 5ITWA 2W2LA 4OJNA 4MIEA 3GZNB 1NP3A 1YWGO 1TB4A 2VHYA 3WGYA 3A4VA 4CMIA 5KTKA 4OSPA 3OJFA 3GFGA 4E30A 4OXYA 4I08A 3GG2A 4HUJA 4PG7A 3TJRA 1GPDG 4W7IA 1P44A 2W90A 4YAIA 2E48A 2G0TA 4IGEA 4EI2A 4IDCA 1QYVA 2EF1A 3GPDG 4Y67A 1R0LA 4J91A 3VPGA 1VE9A 1NAHA 4E5MA 3GVHA 4HNHA 3PYMA 5L4NA 2GO1A 5JSFA 2J3HA 5CEJA 2O2YA 2D8AA 4XX0A 2VWPA 1IPEA 1PJ2A 1ENYA 3AOEC 2VYVA 2VZ0A 1MC5A 3KLMX 2JCXA 2J5QA 4M55A 3WLFA 4J1NA 3AI2A 5DOZA 4XD2A 4R41A 3SLGA 5G2OA 3K2EA 5F1PA 1EZ4A 2DAPA 3OECA 4FN4A 1ZJZA 4KQWA 4JROA 3JQ9C 1VSUA 5KKCA 4CLRA 3GNQA 1U4OA 3B20A 1CDOA 1JU9A 2JHFA 4YJHB 5T57A 1ONOA 4OO3A 2PV7A 4HNGA 1P74A 4XJTA 1MUUA 4YAJA 4ROSA 1FJHA 4BB6A 5B12A 1Y9EA 3EVNA 3IIEA 3ULKA 2JAHA 3ICPA 1PGNA 2QG4A 5KOIA 4TVBA 3PHHA 1E3LA 4PLYA 3SC6A 2HDHA 2POQX 1Q7GA 2GYYA 4RCVA 4BGVA 6LDHA 3GRPA 1E6WA 3F5SA 3H2ZA 2RBEA 4MP8A 2HU2A 1EBFA 3DZHA 4AJEA 3F1LA 4R01A 4AFNA 2DU8A 2C82A 4MDHA 4QFDA 4LGVA 2PTGA 2C5AA 1B8VA 2CDAA 2YHIB 2FR8A 2BLLA 3LLSA 2J3KA 2Q99A 4MJLA 2Z1NA 3N58A 4R1TA 4AJKA 1LA2A 1CEQA 5DDIP 1WW8A 4J49A 4BUCA 3D1LA 2R00C 3R3JA 3MJTA 2X0JA 3ROQA 4E32A 4WPGA 4O0LA 5AOVA 1R4MA 3RBZA 4CMJA 4YRBA 3L07A 3T7CA 3FI9A 1GAEO 3IMFA 3RBXA 4DPKA 4EDFA 4DWVA 2WM3A 4R16A 1YS4A 3RSHA 1SMKA 1ZMOA 3W8EA 3AWDA 3TRIA 1P9LA 5AYVA 2HJSA 3O26A 4FJ0A 2Y1CA 3AUAA 2E82A 1Z75A 4FJ1A 1YBVA 3NEPX 2NTJA 1E7SA 1GPJA 3GGOA 4RPHA 4I9NA 4WECA 1R4NB 2VZ8A 1A7AA 3U5TA 3H9EO 4FOOA 1XEAA 3CUKA 5T5QA 5A3VA 1YOVB 2B5WA 3C1TA 1DIBA 5JFOA 3WWYA 2X7HA 3JQ8A 3JD4A 3ZI0A 3HZZA 1E92A 1PL8A 2CVQA 2PY6A 2EG9A 1E1LA 1JVBA 3WGOA 1GZ4A 5KVQA 3L4SO 2BHLA 2HO5A 2WSBA 2C2YA 4MVJM 5KVSA 3OA0A 4BMNA 1PEDA 2UAGA 4XB2A 3ZU3A 4UVIA 5IDWA 3K92A 3P2OA 5IG2A 1PZEA 1YDEA 3ZWBA 7MDHA 3WDSA 3KUXA 1FDSA 4YJGB 3SC4A 5K6AC 4CUZA 4FR5A 1NBOA 3JQ6A 2B83A 1KVTA 1OOEA 4ZQHA 5LCXA 4XGKA 1DJQA 4IIUA 3GFBA 1OC2A 4WUVA 1P1IA 1GZ6A 2W2KA 2WE7A 1IE3A 1RM5A 3OEYA 1CJCA 2BRUA 4P38A 1C0LA 1U8XX 1HT0A 2JFHA 3EHEA 3GG9A 3OHSX 3WMXA 4BQPA 2NWQA 1XIVA 4YRAA 2JCVA 3V2HA 2X86A 3BTVA 1QR6A 4ALKA 5A03A 5CFZA 3QWBA 3H65A 3P19A 1YB5A 1BVUA 1CYDA 2ZYGA 3WYCA 2AMFA 4JJGA 1LSUA 4HKTA 4ALLA 1YJ8A 2V6MA 4BKRA 3OICA 4CL3A 1H0KA 4ALJA 1S7CA 4AICA 4D41A 4EBFA 3UUWA 4A7PA 3ZNOA 4F3YA 1E1NA 1O9BA 3JCZA 3S2FA 2ZYAA 2F1KA 1ZIDA 2C7GA 3I23A 4J2OA 3KYBA 5JO0A 3CXRA 4RPGA 2NTNA 3G1TA 3A9WA 4UEKA 3FPLA 3VPHA 5ER6A 4YQZA 4LCEA 4BNTA 1U5AA 3VZSA 2VRCD 4YEDA 3IUPA 3UCXA 4MVJA 3FTNA 2O2SA 3NT2A 1V35A 3U9LA 1H94A 1Q7CA 3RAJA 1BXZA 5T64A 3VZPA 4WCFC 1U3TA 2OP0A 2JHGA 4J4TA 3LYLA 4GGPA 4J90A 4XQGA 3AM4A 1O5IA 3IKTA 2V7PA 2D5CA 4CQLB 2EKQA 1DB3A 1HL3A 2DT5A 4J3FA 3WYBA 4FW8A 4YT8A 5ICSA 1P1HA 4YCAA 4FSHA 3CMCO 5DT9A 1FMCA 1R12A 4QO7A 2V6GA 3F4LA 3V5NA 5TRTA 4B7CA 5LC1A 3OJEA 1N8KA 1TLTA 2HK8A 5JY6A 3B1KA 4L4RA 1F14A 1PJBA 2FPIA 3QRWA 8ADHA 4JP2A 1PSDA 4BNKA 5TLSA 1LC0A 1EVIA 3BTUA 4NFYA 3W8FA 1BG6A 2CY0A 1F8FA 1GUFA 2V65A 3H3FA 1A71A 1ZK1A 3GF4A 2H6EA 1B3RA 3FWZA 4BO0A 4N5LA 1J5PA 3QY9A 3B1FA 1A9YA 1XHLA 3VVBA 1LU9A 3ZV3A 1UZNA 3ASVA 1VM6A 5CG2A 3H5NA 4XA8A 1EFKA 1HWYA 1DIHA 3ZWCA 1H2BA 1BXKA 3Q0EA 2OBNA 3GMDA 3LT0A 4E2ZA 3Q2KA 4F45A 4HX5A 3PXXA 3U3XA 3VC7A 3BMOA 4DIBA 2EIHA 2CNBA 3OIFA 5G0SA 5TSDA 3DMYA 5CEEA 3O8QA 2Q4BA 1LTHR 1P1RA 1ZNQO 3OQ1A 5CDUA 5A02A 3DR3A 3LC1O 1ISFA 3MOGA 1BMDA 1PU2A 1HDGO 1T4DA 3HN7A 3EW7A 4KZPA 3WFIA 1HE4A 4A0SA 5U9CA 1Q1NA 3JQ9A 1AXEA 2PH5A 4GAEA 4RVUA 1GQQA 1V3VA 1I2CA 3MEQA 3F46A 2JJYA 1JW9B 3A14A 4L9RA 1QLHA 4ZQBA 5DBFA 3PHJA 4NI5A 4DPMA 3ONFA 5BSHA 1C0KA 2GN6A 1IB6A 1WPQA 2PNFA 4MVJP 5G0VA 2OBYA 3SXPA 2W98A 5DF1A 3RBVA 3BA1A 1HYHA 4BS9A 2DTEA 1PL6A 3N74A 2SCUA 4IJWA 2PFGA 3GVXA 2FMUA 3V1TC 4NBRA 4WK6A 4XYMA 1U2GA 5I9NA 1IYZA 5FEUA 1DIRA 1WZEA 1U1IA 3QP9A 4L4SA 4PLCA 4BO2A 4CMBA 1U4SA 4CPDA 3WXBA 4EJ0A 2O3UA 4JN6B 4MVJI 3ZHXA 1K2WA 1I10A 3UN1A 2CD9A 2NQTA 4K1LA 3PP8A 2IE0A 2X8LA 1LNQA 3L9WA 2PZMA 1B0AA 3GVCA 1U7TA 2FSVA 2R00A 2NTVA 4XYLA 4WNCA 4I8XA 2EEZA 3ROMA 5GMOA 3BMCA 3EVTA 3D64A 1VPDA 2X5OA 4LRTB 4YT4A 4EW6A 4II3A 3U4HA 2VN8A 2J8ZA 3DZBA 1O95A 3EZLA 3LF1A 5G4KB 1MLDA 4BGIA 3GVPA 3C7AA 3NAQA 1MFPA 4I9UA 4TMFA 3JQEA 2J3IA 3RFXA 4ALIA 3FNGA 2B35A 3AU8A 4GVXA 3WICA 3WLEA 4JNKA 4KUHA 4RQUA 1X7DA 2Z1MA 2IZZA 4ZU3A 3PGXA 3KLPX 2HQ1A 4U6QA 2JAPA 5GZ3A 4ZHSA 2OXIA 3WGTA 4NBUA 2ET6A 2H63A 3ZNQA 3U09A 3L0DA 5DCYA 2UUPA 3EUWA 4CR6A 2NM0A 2ZQZA 4R1UA 5ICMA 2JFFA 4TRRA 5T8KC 5I7SA 3PHLA 1QMGA 1UUFA 3GN1A 3PHIA 4BO7A 3ADOA 1S6YA 4QFCA 1EVYA 2BFOA 2AQ8A 4QX6A 4J7XA 1WVGA 4YJDA 1LQUA 1I01A 1PGQA 2E49A 4J7CA 4OHUA 3VVCA 1K6JA 4CUKA 4NJMB 2C59A 3TFQA 2QRKA 5EL0A 4IQ8A 1CQIA 4QEDA 3QHAA 1RYEA 5K6AA 2Q2VA 1QORA 4J1TA 1MGOA 1GV1A 1UR5A 4RQTA 3K6JA 5CHEA 9LDTA 4PCVA 3JQAA 1TT5B 1U9JA 3RJ5A 4RL6A 4DYVA 2D0IA 1DRVA 4QQRA 4CM9D 4BNWA 1UP7A 4BL5A 4CQMD 4DVJA 2X4GA 1PX0A 2EJVA 4OQZA 5JYEA 3FNFA 5JAQA 3C8MA 3OJOA 4NMHA 1C14A 1PJLA 3VH1A 1CERA 4U6SA 5B4UA 4R69A 4OOFA 4DC1A 4NU5A 2EW2A 1UXJA 4FFRA 2WD8A 3BMNA 4CM8A 5TF4A 3Q9UA 3HWRA 1IUKA 4GSLA 4UAGA 5IDYA 3BMQB 3ETDA 1E7WA 1UH5A 3JSAA 3BAZA 3RUCA 1ISIA 3DAGA 1EVJA 4CMIB 5THQA 2NACA 3PFWO 5DP1A 4RVDA 3JTMA 4JGBA 2GASA 2LDBA 1NFRA 3GDGA 3PEFA 1HYEA 1Y8QA 5KIAA 1NAIA 4INAA 5G0UA 1ONPA 3AUTA 4OKIA 4Y6PA 4HWKA 4WEQA 4NBVA 2VYND 4GGOA 4CQMB 5TQVA 3MJSA 4NIMA 4E21A 1NHGA 4IDAA 1JTVA 2NNLD 2AEFA 1YQXA 1UAGA 3EK2A 4IS2A 5A06A 2AG8A 1DHTA 2Y0DA 4LSMA 3GH3A 1LDEA 4FOSA 3C24A 3HB5X 4NBTA 3FD8A 6ADHA 1O8CA 1ZSNA 4JP3A 4WCFA 4CM5A 2GZ2A 3GHHA 1XWFA 1BDMA 1L7DA 2DC1A 3NT4A 3DHNA 3LK7A 4YDRA 3DZGA 5BNTA 2CF6A 4MVJH 3EGOA 5CG1A 5G0TA 3X2FA 2ZB4A 4CLRB 5L7TA 4DIFA 1KYQA 2P68A 3MJVA 3MZ0A 2IXBA 5JW6A 3TNLA 4EJMA 1UDBA 4RDHA 4JJFA 1UZMA 2NVBA 3IP1A 1W0CA 1L7EA 3ONDA 4BMSA 4FC7A 2EXXA 3QWAA 4CM1A 4E33A 3PQFA 2DFDA 4NQZA 1Y7TA 1ARZA 1VC2A 2AQIA 3WIDA 1SAYA 2NSDA 3HADA 5DNAA 5THKA 4MP3A 4H15A 3DMTC 3INGA 4XRGA 3GPIA 4U0JA 2XAAA 2EKPA 1B8UA 3SEFA 4BNFA 3G3EA 1ZK2A 4PLPA 1X7GA 3RKRA 4L8VA 1G1AA 2Y1FA 3H2SA 1YXMA 2PWZA 4XGNA 3UCFA 1EUCA 4JJIA 4KTTE 3FWNA 4B4OA 1KERA 5U4QA 1ZXBA 1HETA 3H9QA 2OORA 4BNJA 3PYLA 4RPKA 4NNJA 4BGUA 3I9OA 1FDTA 1YDWA 3I9NA 3N7UA 3JYPA 1PIWA 3UKOA 5IDQA 3CPSA 3GN2A 1ZW1A 3P7MA 5IZCC 1MX3A 1CF2O 3M1AA 1YB4A 2C0CA 4LW8A 3HUDA 4PLHA 4RGBA 5HWSA 5I7EA 3PDJA 1CRWG 5CDGA 2OMEA 2ZJ1A 2C54A 1Y8RB 3FBTA 4PRKA 3WSWA 2QHXA 3AUSA 5HM8A 2QX7A 3AY3A 1E3WB 1OMOA 3GDFA 2P4QA 2PZLA 3ORFA 1SB9A 1LUAA 2PD6A 2OZPA 2VT2A 3DBRA 1N9GB 1PR3A 1SEPA 4R54A 4FFNA 2VHWA 2PZJA 3LZ6A 4A26A 1UP4A 3W8DA 1WMBA 1E7MA 5AXBA 1ADCA 4CL8A 3CIFA 1MFZA 5L7WA 1HLPA 3H8VA 3R0IA 4BGEA 2PH3A 3HHPA 4GLLA 4NPCA 4YTEA 1HZJA 3LT2A 3D3WA 1Y9AA 3AI3A 3U62A 4AJLA 1DC6A 4PLFA 4Z3KA 4ND1A 3VTFA 1E3IA 3W6ZA 1B7GO 1KEPA 4MIYA 3ZV4A 4B7UA 3JQ7A 1OI7A 1VL0A 2D4AA 4BNIA 3Q6IA 1I0ZA 2GCGA 4BB5A 3EDMA 4EEXA 3FNEA 3IUSA 1NASA 5C37A 4AJHA 1WDKA 4R3WA 2EERA 1ISGA 2BFPA 4JBGA 3ZN2A 2Q2QA 4IDBA 4B7XA 1PL7A 5IN4A 4DTIA 1YVEI 1U3VA 1J0XO 1EE2A 1PQWA 3GNTA 3JD0A 1T2EA 4CV2A 4AG3A 2A35A 1HSZA 1SBYA 2XF8A 1DEHA 3KYDB 2FWMX 2GERA 1I3MA 3VH2A 3W4IA 3EYWA 4J4HA 1DXYA 1IY8A 3OJLA 2DUWA 3PRJA 4NZ9A 1ORRA 3WS7A 4CMGA 1NPDA 1N92A 3TZCA 2FY8A 1KVRA 2Q1SA 3QVTA 5DN9A 4RJTA 1Q7BA 3CE6A 1PJSA 1UAYA 4DXHA 4E2YA 3AU9A 5JCJA 3VOSA 3PLRA 5IN5A 2NADA 4G2NA 1ZEJA 5T8KA 3JQDA 3JQFC 3WJ7A 1LX6A 5A9TA 2JD1A 5JAMA 3GMSA 4XCVA 5COAA 3DTYA 3FBGA 3UFXA 3DAPA 1LLDA 4JK3A 1HF3A 2I65A 3CSDA 3KXDA 3LQFA 3UCEA 1N7HA 4UVEA 1EEHA 3X2EA 1I3KA 2EGGA 3GGGA 2C29D 1ML3A 3HDHA 5EMHA 4A27A 3VH4A 4W4TA 2OHXA 4GI2A 3T4XA 4PRLA 5TT0A 5L4LA 2ZCUA 3L6EA 3VDQA 4B3JA 2G5CA 2HJRA 2OOSA 4XB1A 3VZRA 4W7HA 2ZKLA 3IS3A 4QT0A 1KS9A 2IXAA 1YB1A 3UW3A 1YKFA 2VOJA 3K96A 4Q39A 4WLEA 1GYPA 2PR2A 2QYSA 3GUYA 2JCYA 4IM7A 4NJOA 4HFNA 1P3DA 1BXGB 1LRKA 2P9GA 3RROA 4EGFA 5HA5A 5L3ZA 1ZBQA 2DM6A 1Z82A 3E82A 4BO9A 2AE1A 3FHLA 4Q3DA 1BHSA 1X1EA 1T2DA 2HRBA 5IXYA 1H6DA 3MTGA 5BR7A 3D7LA 1GADO 3ANMA 1PQUA 4ZD6A 3TWOA 3NGLA 3E5MA 4B4UA 1MB4A 4DL9A 1KVUA 2B69A 2BGLA 4NR0A 1I3NA 1IPFA 3Q1LA 4MP6A 2Y67A 5KNLA 3SJUA 1G0OA 1XR3A 2BFAA 3SJ7A 4J2HA 4ND4A 1C1DA 4CLOB 5JYDA 3D5TA 4FD3A 2Z95A 2XPCA 1LLQA 2EWMA 3TQHA 1N1EA 1U28A 2I6TA 5GY7A 4JLWA 2GD1O 1M66A 1E0DA 4E5NA 4PN3A 3H5AA 3QVSA 2Q50A 4AJNA 4RPLA 2GZ3A 2X0NA 2D1YA 2HRZA 2I66A 2IRWA 1P1KA 4MPDA 4UUOA 2Y1DA 3U4DA 3WTCA 1SNYA 1MA0A 4YR9A 4CODB 3Q3CA 1PJQA 3I1JA 5A9SA 4OKNA 3JQGB 2NV6A 5F21A 3G0OA 4FB5A 4II2A 3TDKA 2X5JO 4MOWA 4TSKA 4XR4A 2FRDA 2X0IA 4F6CA 3OA2A 4ILKA 4JIGA 3O4RA 2UDPA 4Q3CA 1TA4A 1WP4A 1SCUA 3JD2A 1T2CA 2FZEA 3DBLB 4R51A 3KYCA 5ENVA 4B4WA 1EUZA 4PG4A 1DAOA 1ID1A 1OAAA 3WWZA 3T4EA 1FDUA 1PQPA 2I3GA 3VPXA 3C1AA 2Y05A 4TRNA 2BI7A 1W6UA 4BO5A 4XYBA 3PHGA 4RVSA 4A2CA 4ZVVA 5FI5A 2ZJ0A 4B4VA 1HTBA 2O7SA 4YXFA 3EC7A 5FF9A 5ENDA 3DMTA 1EVZA 3B1JA 1IZ0A 3BHMA 4BO6A 3COSA 1U8FO 2B4QA 3GZNA 4RV9A 3MWDB 4A10A 5JNLA 1BWSA 3PZRA 1U7HA 2BGMA 5CP8A 3OIDA 4KTVE 2RHCA 4J7UA 3K9QO 3TSCA 5HS4A 1JDJA 2IZ1A 4BO8A 2GUGA 5L95A 3RQSA 3L6DA 4O59O 3RU7A 2XOXA 3P5SA 4E5KA 4G81A 2P4HX 2HLPA 4ZICA 3D4OA 3IAHA 1NM5A 2FP4A 1DFGA 1JKIA 1EE9A 3I9KA 3IC5A 1P45A 1NFQA 2VUTA 5JBIA 2CMDA 3ROPA 4A5OA 1ULSA 3AUUA 5IXSA 3C85A 4OSOA 4GWGA 1BVRA 5IZCA 4PZEA 2YY7A 5FFFA 3NV9A 5JPIA 3ZW9A 4QXMA 2EW8A 3BXXA 3HDJA 4XYEA 1G0NA 2E4AA 4TROA 3RD5A 3UXYA 3E5RA 3U4IA 3ZDFA 1ZSYA 3E48A 1VRWA 2XXBA 2X9VA 8LDHA 5DCWA 4BNLA 5B37A 3C3XA 1W73A 1EFLA 4YJHA 1KVQA 1C1XB 2RH4A 1I33A 1MV8A 4I5EA 1X13A 2ZTLA 2DVMA 3ETGA 1GYRA 4NFHA 1QG6A 4IS3A 3VDRA 4FC6A 1Z7BA 1ZXLA 1HRDA 2X23A 4M1QA 2HMSA 2HCTA 1EUDA 4XDZA 1Y1PA 3ONEA 5AXCA 3GY0A 2WD7B 1C0IA 2VHZA 4WASA 4TQGA 4BV8A 1PGJA 1U5CA 4CMAA 2QRJA 1M76A 4B8WA 1O0SA 1X1TA 4M49A 3WJAA 4NHEA 5A1TA 3DBHB 5AVOA 1BW9B 3TOXA 3V8BA 1QYWA 2YHIA 3KTDA 4FS3A 3D5QA 1GUYA 2J5KA 2GN8A 4GQAA 4M86A 4C4OA 3AW9A 2WYVA 3OETA 3I9JA 5KJ1A 5EQDA 1BRMA 5HBRA 3H4VA 1DLIA 2AQHA 3E6AA 3ZU2A 3WYEA 5JAIA 1BGVA 1J49A 3UICA 4E2WA 4N54A 1SOWA 5I9MA 3PWZA 4CV0A 4NK4A 4BKPA 1PTJA 3DL2A 2GDZA 3KHUA 2PA3A 4I9HA 4BHTA 2DTXA 3PZBA 1AUPA 2PZKA 4WE3A 1GYQA 3QQPA 2DFVA 4J1QA 4O63O 4R9SA 4CM4B 2J5RA 4PIVA 4G65A 4K9DA 4BNHA 4Z6KA 3GAZA 3QE3A 1R15A 4PGFA 4YPOA 1R4NA 2HK7A 3DEYX 1LLCA 3JQFA 2V6FA 5JMPA 4D3DA 3KOUA 4E2XA 1YOVA 2NLOA 2BGKA 3MJEA 2DBQA 2YUTA 4C7JA 1ADGA 3WFJA 1Y8QB 2O50A 1GTMA 3QSGA 5JC8A 3WOHA 3NTRA 1FK8A 3ZWMA 4LVCA 4OMUA 4DYDA 2Y1OA 4LMPA 3ZZNA 3KZVA 5JMWA 5JLAA 3HB4X 3OQBA 3G1UA 5HS6A 1NR7A 3DXFA 4IDDA 1KETA 2DQ4A 2Y68A 2TMGA 4GH5A 2HKIA 2FR0A 3BHJA 3NUGA 3KETA 2RCYA 3RFTA 4TZTA 4DRYA 1R16A 3ZWXA 5KJ6A 5L4SA 4IPTA 3PK0A 1JWAB 1GCOA 3LSYA 4EZBA 3RU9A 5IF3A 2FN7A 1F17A 4PG6A 4RF4A 3BIOA 3ZH2A 1LBEA 2BH9A 2GN9A 1PGPA 3M2PA 2G76A 3ZWNA 1M6WA 4AL4A 4HADA 1VJ1A 5F1OA 4TKLA 3TL2A 5IFLA 1SO8A 4XQEA 1VKNA 5DBIA 4D3FA 1ZSVA 4RORA 1UZLA 4YRDA 3RIHA 4DGSA 2IODA 3WTBA 5B4TA 5IJZA 1NPTO 1D1SA 1ENPA 3CINA 5A04A 4OQYA 2VHXA 2JKVA 3AI1A 3GK3A 2NUAA 2I99A 3WX0A 3RASA 4GX1A 1TVEA 4LCJA 3CEAA 1B16A 3C7DB 3GEGA 1DC4A 4YB8A 2O7QA 1NTOA 1VL6A 2VCYA 4YJFB 3ZHYA 4IZHA 4OL9A 2BKAA 3ITKA 3WBBA 4PZDA 4KP7A 3UVEA 3PWKA 1XG5A 4H16A 3PI7A 2VNSA 3VTZA 2HMWA 3IJRA 4HY3A 4YACA 4IIVA 4KOAA 4LRSB 3IQDB 1LQTA 3VH3A 4XQCA 3U4CA 1ZK3A 5JDCC 1HDRA 1T4BA 1XLTA 1B15A 4A73A 1WLYA 4BO1A 5BSGA 2O3TA 4N5MA 3ZHZA 3PPIA 4Q3AA 4D3SA 1X15A 2WWRA 3RUFA 4OYRA 4WLFA 4L76A 1VL8A 2PKQP 2AXQA 5A4DA 4RZHA 1IHYA 4NDNE 4PFJA 4C7KA 2UUOA 2W2LD 1LEHA 4E4YA 1QP8A 1JAYA 4RDIA 1NQAO 4UUMA 2QZ9A 1AXGA 1IOLA 1P0FA 3TN7A 3RUHA 3M1LA 2VQ3A 4RVGA 3GZ4A 2YYYA 3ZWVA 4M8SA 4JCOA 1WNTA 4WNIA 4CM6A 4G5HA 4DMMA 4ZA2A 3RC9A 3G17A 1ENOA 1F06A 2AEJA 4I5FA 4YVFA 3GQVA 4E0BA 1EK5A 2VRCA 1EDZA 1DO8A 2EP5A 3OMLA 2HMUA 1MG5A 2OFPA 1LJ8A 4D0SA 3D4PA 2O4UX 3D3WB 3CZMA 2VYVD 4K28A 1M6HA 1WDLA 3S1LA 1UXHA 4ITUA 4GWKA 4J9VA 1IZ9A 2W4QA 1NVGA 3JQ7B 3VPSA 4MKRA 1GCUA 1JN0A 1Z45A 2I9PA 3QWFA 4A03A 1SOVA 4U8GA 1LI4A 1NYTA 3GHYA 5BT9A 3RC1A 2ILTA 4RO0A 4WLVA 4DREA 5U1PA 1A5ZA 1Q0LA 1SB8A 2VZ9A 3GC6A 3NDIA 4B8ZA 2B4RO 5TS3A 1WAMA 1DPGA 2D2IA 3H6KA 3NKLA 4BVAA 4CMCA 4UUNA 2Q1WA 4RVFA 2E6UX 3HG7A 4OH1A 4Z0TA 4B3HA 3BTOA 4HFRA 1PZFA 4DMLA 1NHWA 5FYDA 1DBVO 3KRTA 4KDFA 3V1YA 4Q3NA 4JX8A 4P4GA 2NU7A 3LT1A 1GV0A 3RUIA 4UEJA 3TZHA 4X54A 1QSGA 3ITDA 2H9IA 2ZIZA 3ZNPA 1BTOA 3ZV6A 4L74A 1KEVA 3H7AA 4RPJA 5ADHA 2YV1A 1YQGA 4CLDA 2O3QA 1DHRA 5TJHA 1CQJA 1EK6A 1ISHA 1M75A 3KV3O 3H9UA 4YWJA 2FPPA 1RM3A 2FR1A 4J0EA 4Z9FA 3KB6A 2E37A 2OL4A 3I9LA 5DOVA 5F5LA 2RHRA 1QV6A 2I67A 3S2EA 4DA9A 3F6YA 4BQRA 2C5EA 2ZB7A 3VZQA 4CJXA 1GDHA 1GZ3A 1R0SA 5KVVA 2IEDA 4J4BA 4HBGA 1YGYA 5JO9A 4DBVO 1OZAA 2CUKA 4KWHA 1B8PA 1T26A 1T1RA 5IZ4A 5JDIA 2VUSA 4KUEA 3TZ6A 4HXYA 5EPOA 1NWCA 1R0KA 4H7PA 4P8RA 1I24A 2EGHA 4XGIA 3HDQA 3IKVA 2D59A 3HQ4O 5TIIA 2YFHA 1I32A 2A4KA 3PDUA 1ZZEA 1WZIA 3WGZA 4CV1A 1QXSA 1U3WA 3W4KA 2AQKA 5DULA 1T2AA 1ISJA 4JQCA 5KCZA 4DQVA 4YA6A 4CV3A 1KIFA 1TXGA 3GRKA 3JYOA 1XA0A 4Y6SA 4QUKA 2G1UA 3L6OO 1ZKMA 1R4MB 4R1SA 1XELA 5GZ1A 4OM8A 1UDCA 5I7FA 4KDEA 2PK3A 1J6UA 1N1GA 4D45A 3NT5A 1R66A 1ONNA 2Z5LA 4TWRA 1HYGA 2Y99A 1A7KA 4U0KA 5I9LA 1XU7A 4Z9XA 4NH4A 3DAFA 4WEOA 3ZWYA 1DAPA 1F8GA 4CR7A 3WQRA 1V3UA 4AJOA 1ZEMA 3ZHBA 5A05A 1P1FA 4LISA 1QYCA 3S8MA 1AE1A 2V6BA 1YL6A 3ZW8A 1MG0A 3JYLA 3HNPA 5TNXA 2CDBA 5JY1A 3JQ8B 3AY7A 3MCVA 1A72A 1Q0QA 4CUJA 1Z7EA 4BNYA 4Y9DA 4Q3EA 4NJMA 3E9QA 1PS0A 2P9EA 5TGDA 4YAGA 2O3RA 5A9SB 4WCDA 2GGSA 1DFHA 3OQ6A 1CIVA 1E3SA 4PLVA 3WGGA 4YT5A 4OAQA 4TZKA 4ID9A 1PJ3A 1IULA 1E3JA 2VNAA 4R68A 3LC7O 2NU8A 4AJ1A 5JCXA 4RVHA 4FQ8A 3PIIA 1KC1A 2OO5A 2O3SA 3DTTA 3DWFA 1UXIA 2YW9A 4UREA 5A5FA 1ZFNA 3NDJA 4IQ0A 2EKLA 3TZKA 5L40A 4WOKA 5BSEA 1I3LA 3QA9A 4IJUA 2RAFA 1YRLA 1B3BA 2YJZA 4IINA 4LMRA 5BQFA 3GEDA 1A27A 1I2ZA 2W2KB 2WTBA 1E6EA 1DRUA 4H3VA 2DBVO 4ZQEA 2VOEA 2YV3A 3BMQA 1P1JA 2NVUA 3IL2A 4IXWA 3HSKA 3INRA 2HUNA 4QO8A 4W9NC 1HDYA 4MVJD 4NK5A 3JQBC 4IMPA 4PLWA 1CWUA 5A5EA 3UHAA 3TFOA 1V9LA 1Z73A 3QV1A 4QECA 5KJFA 4D79A 5TC4A 2B36A 1X0XA 4CLXA 2CZCA 4GX0A 3NJ8A 4Q9NA 5JXWA 5KWEA 2WMDA 1GEGA 3NDRA 3GT0A 4CM9A 5AQ1A 2QYTA 3I5MA 4CQMA 2YV2A 5JDCA 3W4JA 3AFMA 3PJGA 1XKQA 4YBZA 2PGLA 1YL5A 2A9FA 3HJAA 3SVTA 1BSVA 1JQBA 5H83A 5C7IO 2YDYA 1H5QA 3ANNA 2ZTUA 3LDHA 3O9ZA 3ON5A 1EDOA 4EITA 1YO6A 3CZRA 2DTDA 1X14A 2H1SA 2AA3A 5LDGA 5KKAA 1DJNA 3KSUA 2UVDA 3U49A 2VTDA 4F46A 4GKVA 4HP8A 1E7RA 5DZSA 2TMDA 4N18A 4BNVA 2VWQA 4CLEA 4I5DA 3C1OA 2F00A 1HDCA 3VKVA 1RKXA 1D8AA 4ESOA 3DQPA 3T7EA 3ZNNA 1NR1A 2Q1TA 1NVTA 3QIVA 4O6VA 1A4IA 4BNXA 1GQ2A 4NBWA 4R9RA 1DOHA 2EV9A 2VYNA 1AN9A 2WJPA 5TJ9A 1WDMA 2AEMA 5ILOA 5T67A 2NQ8A 4L73A 3CTMA 1E7YA 4FFOA 4Z0HO 3HE3A 4I1IA 5MGBA 3MJCA 5EN4A 1N2SA 3DZIA 1P0CA 3M6IA 1EMDA 1EBUA 1U3UA 4E6PA 4IZIA 3ENNA 1KY5A 3NTOA 3TOZA 3KSDO 1KY4A 5C7OO 1NXQA 1LLUA 2DLDA 4ZJUA 4DLBA 3FSRA 2J6IA 1E5QA 1E5LA 3RCBA 3IP3A 3ROKA 1QKIA 4Y98A 2ZATA 2WYWA 3S2GA 3K31A 4CMEC 4N5NA 4XIJA 3PGJA 4BKQA 4EJ6A 5DCUA 2C07A 1HZZA 3VHRA 5J23A 4ZQFA 4TKMA 1DRWA 1VLLA 2NU9A 2PD4A 2GLXA 4AJJA 1TEHA 4QSMA 2OUIA 1DC3A 1QV7A 4HFJA 2I5PO 5TT1A 2X5KO 3LVFO 2NVWA 5JS6A 4FGSA 5FWNA 3A1NA 1I8TA 1HDXA 1SC6A 3GA0A 3R1IA 4UVDA 3BMOB 2PKQO 4XEHA 4XQ9A 4MVJE 3NGXA 3GAFA 1GQYA 3FTPA 4R5MA 4HV4A 4R1NA 3O8QB 3H5RA 2DBRA 4RLSA 3ZGYA 1AHIA 3ZWOA 3EMKA 1Y8RA 1ZH8A 2GF2A 4L4XA 3G79A 2YZ7A 1E3WA 3F3SA 5CDTA 1RM4A 3RFVA 1SPXA 2ZCVA 1NWHA 2FOIA 3W6UA 4TVOA 5COBA 1N9GA 2BFMA 3VPFA 3TF5A 2IZ0A 4RF5A 3V2UA 1HSOA 4ALMA 3TZQA 1ZK4A 2C20A 4NG5A 2YQ5A 4YAKA 1Y5RA 2FZWA 2EP7A 1GD1O 1PJCA 4ND5A 2B37A 4XJSA 3SBOA 3DOJA 5ITVA 5CEFA 1GY8A 4PZCA 2X58A 3RUAA 1B26A 4R3NA 4IJVA 2AE2A 3H9GA 3AK4A 4FPXA 4D7AA 1DC5A 3RUDA 4D44A 4LSWA 2LDXA 1I30A 2Q49A 1QRRA 4R4JA 3GR6A 4L0QA 3JD1A 3LF2A 2WE8A 2WYUA 4HFMA 4BV9A 1MP0A 1JKFA 2FSSA 3DZKA 3JD3A 3D3EA 4XZ3A 4BMVA 3WNVA 3K73O
chains in the Genus database with same CATH superfamily
4N7BA 1A04A 1T0BA 4EFKA 3F49S 5AJHA 4RTSA 1JDVA 1W48A 5IJ0B 4WZZA 2VDPB 4M89A 3K30A 3WOVA 3CB4A 1XCMA 5FNVF 4P4LA 5TQ0A 3WK9A 4PVDA 5KWJA 2C04A 2OD7A 3DE3X 3BMCB 2FMKA 4J9UE 3RSCA 1JDTA 1JHYA 3OSZA 4AJIA 2IHYA 1EP3B 2BBSA 2RAVA 3KYDA 5H68A 3RC2A 1C4WA 2QV7A 3X1YA 4R9NA 2VWGA 3PIDA 2HPVA 1ID8A 1I7PA 4M53A 3MT0A 1BZYA 3G49A 1DINA 4HXEB 4ML3A 1TMKA 3AF2A 3ZWAA 4ZJYA 1PS9A 2ZBPA 2J3LA 3PJEA 5DNCA 2FEPA 1RWBA 1K8RA 3R5XA 5B3KA 4GBMA 1IK4A 4KX3A 1S2NA 4IIJB 3U6KA 3E61A 4L50A 2ZSHA 5AKEA 1JKXA 1R0ZA 1RFLA 1TYDE 3BZBA 1N75A 1YIAA 2LKDA 2PZEA 3HKBA 3IOYA 4AD8A 3RNLA 1B1CA 2VZEA 2DSTA 3N2NA 3QOWA 5ALDA 5GZ6A 4WKOA 3GL9A 1KH3A 1XZHA 2HO4A 3LE8A 4D4JA 4BU1A 2I2DA 5SYAA 3RLIA 2Q6LA 5CM2Z 3WSVA 4BN0A 2F9LA 3JQAD 1O54A 3G89A 4EEZA 1HR0B 1K6EA 1UEJA 2GB4A 1E1MA 1NIJA 2WIAA 3A1SA 4JBHA 5J2UB 4B5LA 1U81A 3FJYA 3VKUA 3USCS 1ZGBA 4F93B 2WINI 1F12A 2GFIA 2FFJA 2EKZA 2QRLA 3LO8A 4UKDA 2FPSA 3CB2A 4A8JB 5JADA 2OZLA 2DBZA 3BICA 2Q7OE 4W63A 2ZWMA 2WPNA 1IJBA 3GNSA 1TKCA 1AV6A 4EUEA 1M34A 3D02A 3VU3A 3F3YA 3MS4A 3TRKA 2YC4C 2XMCA 1P73A 2AK3A 4EKNB 4M1SA 1DMRA 1N5DA 3F4BA 4L6IA 3ZWKA 3B6ZA 1VJTA 4FSXA 4MITA 1DARA 2ZU0C 1SG9A 2MCFA 4MKXA 3BZUA 3EXIB 3L7KA 4ZK2A 1H9BA 1OKKA 3NUQA 4HZUA 3WBFA 2AD1A 1D7OA 4KAJA 4A4DA 4FZJA 3T3OA 1JB9A 3C3CA 1T25A 2JK0A 3CX3A 2IYSA 2XB9A 3F6BX 3FPBA 3TMKA 3EGWA 4X95A 4CKYA 1LC3A 1NJ5A 3FZQA 4DIOA 5C35A 1HXHA 3IQZA 3DL4A 4KGVA 4EPVA 2GRAA 3CVUA 3CKMA 4UQOA 3EDYA 3GPBA 2O2EA 2IYFA 3DYIA 3QBEA 5I7UA 1PWEA 2XE7A 1IOWA 4X1YA 2MR5A 4IUCS 1RKUA 4C22A 3HVIA 4LQDA 3BREA 2GCNA 5LBIA 1TECE 3QE2A 2O23A 4L57A 5AKJA 3KQTA 3IUJA 1Z8NA 2ZJ2A 4RZ3A 4UZSA 4EL5A 1GZUA 4LFCB 4R5HA 1ISMA 2NV2B 1AUOA 2JRCA 1F4PA 2TMKA 3PPYA 5FL7D 1N4AA 1TKAA 2GYUA 3GFTA 3W0LB 3CUUA 3JQBA 4Y9SA 4OMDA 3OIGA 1OTYA 1REQB 2Q2WA 4KMRA 3ROZA 3UC9A 2BKXA 1Z2OX 2X2EA 2ZTVA 2XD4A 3FHTA 5F9HA 4H77A 2Q9AA 2QRUA 2YNMA 1VGVA 2ZYVX 3OSUA 3SM9A 2BD0A 1XZQA 3DHYA 4FGLA 2ZITA 4XAQA 5CNMA 3T1VA 3A7DA 2CWWA 4OOEA 3E9CA 3CX4A 3T1NA 5C5IA 1XU9A 4QTZA 1CUSA 4N7RA 2FH5B 4P3PA 3WMRA 5E3HA 1TZCA 3GFRA 1KRHA 1W94A 1PSWA 5F35A 5TVKA 1V3TA 2GR9A 1QHSA 2ZWAA 3B13B 4UU8A 1JEQA 4HNAB 4AKTA 3KTAB 4FP9A 2CFTA 1G3QA 3A4YA 3KEGA 3LLVA 3OE4A 3RUEA 5L45A 3DOFA 3BDIA 3UH1A 5HGJA 1DAHA 3DDNA 5DGCA 3PXAA 1OV6A 2OB2A 4NABA 2Z4RA 1XVAA 2VWHA 4L6AA 1GDTA 4OXKA 2QN1A 2IWHA 3W9SA 3Q4GA 3HFJA 2XCOA 4ZVSA 2JGDB 4G4GA 4WOJA 1FYEA 3G5AA 3ELDA 2ZI6A 3FOFC 1UJ5A 3MHPA 2K4MA 3B9PA 3MK31 2EZ4A 1HDZA 3DBLA 2OHGA 3QENA 1ND5A 4MYCA 1Y7IA 1II9A 2XXJA 1Z39A 2BTEA 4YJGA 5CYFA 3HN2A 4QQFA 3RI3A 5EIEA 3K8YA 4ZAZA 2GUWA 2C1XA 1ZMTA 2IE8A 3OD5A 3O94A 4FFMA 1JQ3A 5CGQB 3JYNA 3VVMA 3A9UA 3PD1A 4KN9S 3ESCA 3PCXA 1TEXA 3BIXA 4WXPA 5YASA 3WMWA 1J0AA 3VU9B 3O1JC 3UJPA 1YE5A 1O6ZA 2PXCA 2HMTA 3MSCA 4AS1A 4YCJA 3I01A 5IT4A 1T24A 1N1MA 1UDRA 3ABIA 2GAIA 2YYZA 3LLUA 4JP8A 4XIYA 5FR1A 2VL7A 5KYXA 4P54A 1RE1A 1JDSA 3WLPA 4O5OA 4TRJA 4DV3B 2MDTA 3GCGA 2NYAA 3AF4A 4GEKA 5DJ5A 3QVJA 5KHOC 6PFKA 3NC1C 1YTUA 4LS3A 2I3DA 3UAOA 2R2GA 1O9HA 2YDXA 3KWLA 3OE5A 1G16A 4HDMA 4CMEA 2W93A 3WISA 4E03A 4F06A 2J07A 4DUYB 5TR9A 5K05A 5JLJA 1DBQA 2D1RA 2JI4A 4QHSA 3AFGA 2GA9A 2Y2VA 3JQQA 2O48X 5GV8A 4U7HA 2DKNA 3QKIA 3FF4A 4DDKA 3OQOA 1CBUA 1EXNA 1P7YA 5DM0A 4TTVA 4XD7A 1FX0A 3RJTA 1NRJB 4QAJA 2FF5A 2X0DA 3Q7TA 3VR6H 3ZTYA 1X1CA 4FZ3A 4Q7QA 4R71A 1QDLB 4MHTA 2FFQA 3O73A 4GP7A 4UTNA 4FQ5A 1T1SA 4X6LA 1I6KA 4BIIA 1E2PA 1SQ6A 1ZH2A 4PZPA 1EUCB 1B4DA 5CFPA 1RYNA 1U04A 3LQ4A 4DWOA 4QOJA 3WGIA 3EY4A 3LPLA 3PXDA 3ADBA 5LMUB 1X7YB 3DB2A 3QM1A 3HCAA 4HGOA 1G9XA 2YIDA 1P31A 3KCNA 4Z3DA 1JYEA 1XMVA 2CNOA 3FKQA 4EX7A 5JBQA 3Q9NA 1QIEA 1FU4A 1NN0A 1AGYA 2GJSA 3BF7A 3INTA 4KXUA 4S3MA 5JD3A 3EB9A 3RVOA 3V97A 2D6FA 2TECE 1LXCA 3BN3A 5E2IA 2FHSA 3F2IA 3P8ZA 1JWBB 3OJ0A 3GLUA 1A9PA 5LQMA 4YV2A 4R9UC 1HLFA 3WIEA 2GOYA 4GPAA 4CFSA 3DJFA 2J31A 3A36A 1WXEA 3FDZB 1GUAA 2H4JA 1GU7A 4MAFA 1IHPA 4O29A 3UGJA 3W06A 2X0FA 3TTWA 4PS0A 2E87A 2OHVA 4I1SA 1G291 4FFVA 4CIWA 4EL0A 2G7MC 1FMFA 5BVGA 3G7NA 1U9YA 1ZONA 5AI6A 1NNUA 3N1UA 5C31A 2RI6A 2FEXA 3GGPA 3GFSA 3HY3A 3ZZ1A 4DLAA 5J2TB 3A6PC 3NTQA 1UBGA 2W8ZA 2I3AA 4Q19A 4A15A 2I4IA 3UMGA 4U2BA 2ZSAA 4E94A 2IPOA 2CL6X 1L5HB 4HLNA 1A9ZA 2I3ZA 3W3ZB 4XFDA 5BWBA 4MARA 2WJ6A 4D2IA 3IERA 1ZBDA 2X9NA 2A94A 2YN4A 3URMA 3G6KA 1JLRA 2GN1A 3CU5A 1GKIA 3QVKA 3EWNA 4JA0A 5DFAA 3SQLA 1ORVA 5CBPA 2VRWA 4OQQA 3NOVA 5JT1A 2O0LA 1EH5A 1AQYA 1FF9A 2EHDA 2JKYA 2XGSA 3I53A 4M87A 5BNFA 3M5DA 1ZWLA 4YAEA 1Q12A 2H7YA 2HX1A 3BQMB 1CKEA 3PR1A 4IDFA 3VR5A 1AB6A 2JPDA 4C7MA 5JCJD 1YH3A 3F47A 2IYXA 4IDOA 4KJZA 1SZJG 4KPGA 1POWA 4V39A 4EH1A 1E77A 5CCEA 5HJEA 1BCSA 3AM1A 5ARDA 1W52X 1G1MA 5K7SA 1T5DX 4TN5A 5AW8A 1K5HA 1DCKA 4MUGA 3L8DA 1DQRA 5BNWA 3GXOA 1AKMA 4M1ZA 2GN4A 4J6FA 4LAFA 4I3FA 5EWLB 3RREA 4CM4A 4ZKDA 5B7GA 4Z1MD 1I2MA 3FPKA 5DTRA 4TGLA 3TOVA 1WSWA 2RCNA 2PTHA 3KM0A 4EKEA 2XI4A 1Q0HA 1FUUA 1D2RA 1U2DA 2IOHA 5HW0A 2DY1A 1W8DA 4ENWA 4R1OA 2HHJA 3MS2A 2PLAA 4ZO7A 3IUBA 2D3TA 4KO1S 4KX5A 4NARA 4PSAA 4XFKA 4JELA 4MR9A 4J07A 1Z2DA 3KQQA 1H1LB 5CDHA 4UM9B 1LFDB 2VRNA 3AKCA 3NWEA 4URZR 1TJYA 4ZQGA 2Y0CA 1PEYA 3HHEA 2VG8A 3QFHA 1WXDA 3LQKA 1U11A 1MB0A 4ZEMA 3HACA 5K0ZA 3TRDA 1JHAA 4P22A 4NE7A 4IQGA 3KQMA 1JSZA 1AKWA 2YWCA 4D4HA 4D1YA 1FQOA 5CVVA 2ZRAA 1HE3A 3ETEA 3D0OA 2BUCA 4BUJA 2GZDA 3CT4A 4HSGA 4E51A 1H2FA 1XZAA 1LDYA 1RRMA 4PG5A 1OLSB 1D5WA 5EESA 3K0CC 3KYJB 3SJAA 4QLBA 3IQXA 2XRFA 3EJ6A 2BUBA 3IVRA 4RPIA 1KL7A 3W8RA 1Q3TA 4BKUA 1XVVA 1P0IA 4LG1A 1Z5PA 2Q46A 2XQVA 3UT6A 1AN0A 2WEKA 1U2QA 1EE1A 2XUGA 5BURA 1P80A 4KFUA 3E8MA 4H3HB 5EZYA 1LDBA 2AN4A 3LU1A 3MTEA 2R8YA 3BFXA 1Q1EA 1GEEA 1MRSA 4JYAB 4J6EA 2W2QA 3J7AC 3GEPA 1UIMA 3JWJA 2H5LA 2UVPB 4EO9A 4E5PA 1LRJA 3QLUA 1PP4A 2I2CA 3WGHA 2MIIA 4NSNA 4MQMA 3TX2A 3ZS9A 1UMBB 5HQ3B 4DCOA 5ALVA 1PJ4A 4G5FA 3F78A 3OP1A 5BOVA 2PEZA 2FGJA 3GJTA 3GRAA 1UXGA 4I8DA 4F8JA 3I9V1 2JFVA 2I76A 3QJ5A 2H5EA 5EKSA 2HBQA 4WX2B 1T6XA 1H6BA 1MAWA 2BRUC 2O14A 4JH0A 5AVKA 1F2UB 1RWNA 1I14A 3RJMA 3SX2A 9LDBA 1SHUX 5C5CA 5JISA 3MUFA 3BH7A 3KPWA 1ZS9A 5KKNB 5EE9A 4GECA 1Y6GA 2CXHA 2DUMA 3FVRA 3AVPA 1W5AA 1ADFA 3FNBA 1KMNA 5ALNA 5HKBA 1E2UA 2YOFA 1VI2A 1XRLA 1CR2A 4FBGA 2OZKA 1F5SA 2GDJA 1AGNA 1LSJA 4X92A 2VJOA 4F5DA 4X8OA 4W9MC 1D1QA 4GRAA 5DYYA 2QZZA 4DJFC 4DG5A 5HDQA 4HPWA 3DPUA 1N7JA 3L0IB 2AS0A 2GYWA 2Y1EA 5JAZA 5KTTA 4IY1A 3KQNA 1M1NA 3LOPA 4LDPA 1EQUA 2XE6A 4B43A 2WUWE 2YHBA 3JS5A 3CSSA 4DG9A 5E1OA 4C5CA 3VPCA 4O1HA 4LQCA 3V3TA 3BHIA 5CB4A 3BE4A 3GRVA 4G67A 2FMTA 1XI2A 3J7TA 2O4CA 5E9AA 1C41A 3CPJB 2GBCA 1TL7C 5CNKA 3U4AA 1PYOA 4DC0A 2JFNA 3LZCA 3E3LA 3UTDA 3JAMA 4RVNA 3KBOA 1RM0A 4G86A 4A1FA 2BP7B 4QDUA 5TQ2B 1I3OA 4LXXA 3UJ8A 1GPLA 1UK6A 4UDNA 2XTMA 2NAFA 3AUJB 5BQXA 4PHCA 1KYIA 5D6OA 1WHSA 1XDWA 3VNBA 1Q0TA 5IASA 2D5AA 2WHPB 1FOEB 1DJPA 2VT3A 3RVJA 4MVYA 5L6MB 4XYGA 2XDYA 2GZ1A 2M98A 3F8WA 3HMQA 4RW0A 4BATA 4JT2A 4BNZA 1Q44A 4ANFA 4PTYA 4DIEA 1OREA 2G70A 1IN5A 4XDYA 4D42A 1W93A 4FONA 4JJZA 3RHTA 4CMKA 5ITZA 1RZRD 2OC4A 1UJNA 2EHJA 1TTTA 3AL3A 3B1VA 3DDCA 4R83A 4YALA 1OC4A 4EKIA 2IELA 3ZU4A 4QU9A 4KXNA 5JH7B 5KNDH 4KUGA 1N7GA 1Z8HA 5L53A 4HNTA 5IT9A 3QKSA 4INPA 4KQ2A 4LJAA 4WLNA 1FPMA 1JQAA 3C5EA 3DOCA 3DP7A 2VTEA 1HE2A 2C3PA 4MVJF 3BGDA 3T9CA 3B48A 2OAQ1 4XOIA 5FA8A 1ODLA 5BV8A 5BPHA 3RRXA 4U7GA 4OJNA 1K3FA 3EXG2 4GKKB 1ACMA 1OXUA 1PLKA 4MIEA 4X6XA 1ETHA 3FMIA 4Y9TA 1YWGO 1TB4A 4X00A 3RVKA 4FBMA 1Y6ZA 5KSPA 1IJEA 4BFLA 2BZGA 3LHDA 3H6GA 4TKZA 1C3XA 2D62A 3T34A 1BNCA 2HZ7A 3T8YA 4CEJB 2X3FA 4HUJA 2YNMC 4IHJA 1GPDG 1FU7A 2OM6A 1NBAA 3ZG6A 2AZDA 4AF7A 1T4GA 2DOKA 5EIWA 1AKQA 5DCLA 4IGEA 4M2LA 1P7ZA 4PQRA 1ZD8A 5TS2A 2NUPA 1J7KA 1QYVA 3OWXA 4FWBA 4IDCA 1NJ6A 5CH8A 5HFNA 1VE9A 1NAHA 2D5LA 3PYMA 2HT1A 4E88A 3IJ5A 4EHFA 3V1LA 2J3HA 5CEJA 3OWOA 1I6WA 1CY0A 4TKVA 4XX0A 5DYNA 4DDWA 3OIWA 4Z2YA 4OQPA 2VZ0A 1UK7A 4HDQB 4PCUA 3KLMX 3QE4A 2J5QA 3VR2A 3AI2A 2YYAA 2IIBA 4ND6A 4XD2A 3M6XA 4F4IA 4MKGA 4LWZA 3B38A 3KD3A 5G2OA 3K2EA 2GPJA 4JR0A 4YP1A 1G8KA 1ZJZA 1RU3A 2YZGA 3NVMB 4QPPA 4JROA 1JJVA 5SY4A 3CEHA 1Z33A 2QY9A 1FNDA 4MLPA 4RWEA 1L9KA 5ANRB 2O54A 3NWJA 1T4MA 4CLRA 2RD2A 1U4OA 3B20A 4YJHB 3BXOA 5DHFA 2QGZA 4LJ7A 4FEYA 3QEAZ 3H4MA 4XJTA 3P9SA 1NXSA 1XTBA 3QEMA 2VHJA 4BB6A 5B12A 4C2UA 3ICPA 3EIFA 1PGNA 2QTRA 1E6KA 4ZXPA 3PHHA 1JU3A 1E3LA 4QUIA 2HIGA 5K3OA 4TMVA 1UMDB 4MVXA 3DF7A 2HDHA 3T9BA 1Q7GA 1J9GA 3LYUA 1FJ2A 4DDHA 4ZHQB 3A37A 1T13A 3KT0A 4BGVA 5C8ZA 3TSZA 3ZDZB 1E6WA 2ZT7A 1GILA 2RBEA 3H2ZA 4X62B 1FZQA 1KWGA 1EBFA 3PPXA 4AFNA 4GEGA 2C82A 1WSAA 2WSMA 3A2MA 1OWNA 4O2BB 3M9WA 3AF3A 3ZGNA 2D1FA 2FUEA 3A0UA 4RC9A 2V0GA 1E62A 2J85A 2YTZA 2BOVA 2R3SA 3OT4A 1AC5A 2BLLA 1Y5NA 1QH9A 3LLSA 2FEWB 4B6EA 3KQPA 3JWHA 3SU8A 3FDIA 5A5GA 1M6VB 4OHRA 2OA0A 4WFKA 1NXOA 2AFRA 1WW8A 3DMPA 1RXEA 1C4KA 4J49A 3R8FA 1C9MA 1TADA 1ZITA 3BB4A 2BBTA 2J9FA 1PR0A 4YHBA 4YV1A 3GROA 2F2TA 3E3AA 3MUNA 3ROQA 4O4JB 4WPGA 4R6WA 1VIYA 2ZXUA 4WZ6A 3L05A 5CA1F 4N48A 3ZCQA 1K7CA 1OI2A 3I5XA 1WQ3A 2BDTA 5F52A 1OLUB 4D9NA 3RFCA 1DAFA 5AK5A 4DWVA 5B1DA 2IBTA 4R16A 3F6CA 1X1RA 5KDDA 3EQ9A 1Z2PX 1JFLA 3H84A 1QHXA 2GTPA 4EKGA 3OLZA 3OI7A 3W8EA 4XUCA 3IYLW 4MEBA 1V4NA 3TRIA 2DLNA 2WVJA 1P9LA 3D43A 3AL0C 2A14A 1KR2A 3B36A 1LPSA 3PQ2A 4AUNA 4H7FA 1NU6A 4FJ1A 1YBVA 2YWRA 4RD0A 4FS8A 1GPJA 2DJ5A 2IOFK 2NTJA 3GGOA 4RPHA 3M83A 4WECA 5CXSA 3I32A 4AO7A 1LQ2A 2Z4TA 4UE6A 5WRFA 1XEAA 2V54A 1EB8A 4PV7A 2B5WA 3N2YA 1D0IA 1R6VA 1W35A 3L0OA 5GM2A 2AYYA 2WAOA 4U2GA 1RQ7A 1MVLA 3HZZA 4XOUA 1OXSC 5KYVA 4TV8A 4X24A 2GK3A 3X44A 3GQBB 4AY5A 1K5PA 3KJHA 1U3FA 2IHKA 4Z4IA 4KR6A 4IXMA 3M6LA 3O92A 1PFKA 4X1KB 2NSJA 1PW5A 2Q9CA 3H9CA 4G9BA 5LZ7A 2BHLA 3FIJA 4LDQA 4FYMA 4QGSA 5IWAB 2VPQA 3RGGA 4ENUA 5KVSA 3BGVA 1N0HA 1UFKA 3N2GB 3NIWA 4KO8A 3KPVA 4NYMQ 2FWRA 3QK7A 5IDWA 2O59A 2NPIA 2Z8YM 1Y0BA 1F3LA 2J9YB 3PE4A 1M8FA 1EJ0A 4O1IA 5JCPA 4YJ2A 2W2XA 2AWOA 4B40A 7MDHA 4Z9BA 3KUXA 3H1EA 3SC4A 1YR7A 1XX6A 5K6AC 5JXIA 2H4FA 3UBMA 5HX7A 4TKUB 4B84A 2ERCA 1THTA 1GGVA 2GS9A 3LD9A 1ZD2P 4ZV9A 4CG1A 4QKQA 2B83A 2WVHA 5HMLA 3TJZA 1KVTA 2XKKA 5LCXA 1P2UA 4HXFB 3LHFA 2GK4A 2D2FA 1SXJA 1OA1A 4YP5A 5D5HA 4WUVA 4JV5B 3U3RA 1GT91 2DJIA 2H7XA 3BERA 1RM5A 1SA0B 4M0CA 3GDHA 1CJCA 1T9DA 2WTMA 3C5HA 1HT3A 1D9ZA 4I9GA 4PFSA 4NCAA 4RM3A 4P38A 4HDSA 1C0LA 1U8XX 1HT0A 2JFHA 3OHSX 2C78A 3GG9A 3R5FA 2NWQA 3T35A 3TS1A 5FPHA 1WG8A 2IYUA 4EY6A 5M7EA 3KUUA 2UYOA 4NAUA 3RSGA 1QR6A 3Q87B 3HM2A 4PYIA 4XM2A 3GEBA 4G56A 3QWBA 1KDRA 3UGQA 1YB5A 2WSSD 3DOUA 3R0XA 2AMFA 1E0SA 1BJKA 3OF3A 2PE5A 2MYTA 1LSUA 3H42B 4KXYA 3EDQA 4ALLA 5K2OA 1EK0A 5KAMA 2IIPA 1F20A 1BS2A 1YJ5A 2Z43A 3C6YA 1L3BA 5FA5A 1EUYA 2UZ4A 2XMGA 3TOSA 4HPXB 2C7OA 3CLSC 1G59A 4AICA 4N3GA 1G3UA 2AIRA 3A1WA 4XVHA 1IXZA 3E2IA 1O9BA 3JCZA 3U9SA 1MO5A 2F1KA 3KYBA 1WSBA 3BGOS 4WKPA 1Z6AA 4RPGA 1PL0A 3E70C 3UMMA 1GCGA 3BWMA 4AXXA 3SNHA 5AUPB 4HQRA 4I36A 1FS5A 1MJGM 2H1OA 1UCFA 4YEDA 1SCDA 1XTIA 4EOGA 3EAFA 1EYZA 1ZJWA 1OFIA 2ZRIA 3BRCA 3PXUA 2ZIWB 3FTNA 4G9EA 2JFYA 3T7KA 3U4QB 1BQ3A 2R7AA 3A3PA 3U9LA 2PIDA 3IT2A 2OV4A 2H31A 3KE9A 1NF2A 2BLNA 2HEGA 3RAJA 3H2HA 1B93A 5IX8A 5A7GA 4CCYA 4MA4A 2UYQA 3LYLA 2DULA 4GGPA 3U80A 1NVVQ 1FRZA 2VPZA 3KJXA 1M2OA 1VLHA 1DUVG 1JZTA 1KKMA 4XCXA 3IKTA 2D5CA 3LY9A 2EKQA 1HL3A 1SKBA 1YULA 2FEAA 2LV8A 1IWBB 4GL2A 2QSJA 4CF4A 4HDKB 3V9AA 3WYBA 4KQIA 5ESRA 5FNVB 2QNRA 1FIUA 4N12A 2VTBB 1L2TA 1Z2NX 4FSHA 2VHEA 3SEAA 1NMEA 1SCKA 2LR0A 3F3MA 3GDWA 4XUDA 3DEHA 2V6GA 3V5NA 2Q6KA 3R3HA 1YJBA 1CEXA 4GR9A 2XNDA 3IQIX 2HJVA 2VQSA 4B7CA 1UFRA 5IJ9A 1N8KA 1D2GA 1TLTA 4MYTA 4FINA 1OA0A 1A2OA 4J0IA 3X1WA 1KTVA 1PSDA 1YJXA 1WU7A 2WU1A 3GLHE 3GLKA 1BG6A 2CY0A 1AGPA 3LIPA 4L5BA 5GQSA 3H3FA 1J42A 3WGNA 2MTBA 5FLXA 1YFLA 2DERA 4N5LA 1J5PA 3U0VA 3HR8A 3JWEA 5K99A 4YUXA 1LU9A 1OU0A 4IG9A 4Q1DA 5J3JA 1Z18A 5JNUA 4IGKA 1CUJA 5ISMA 3E22B 1H2BA 4FZVA 2AVNA 2BMDA 3CUWA 4O33A 4C07A 1R9JA 3S28A 4Q5IA 2HWXA 1YC5A 3JRWA 1D4AA 3SZGA 2HQRA 4GC5A 5FR2A 4PSCA 3VC7A 3VC3A 3R40A 2D0OB 3BT7A 4LECA 1CE8B 5EKUA 4DIBA 2CN1A 2DQSA 1J5XA 4YCLA 3RH0A 3OIFA 5G0SA 2QL5A 1GLNA 3QBDA 3NEYA 4MTCA 2VJKA 3U7HB 5EWMB 3RAEC 1OFTA 4YONB 4QYIB 4GXQA 2DFNA 5CDUA 3G9ZA 4RV5A 1NLMA 2NXNA 1KH2A 3H0CA 4LNUA 1ISFA 5DLPA 3FDFA 1BMDA 1PU2A 3B1XA 5BQPA 2DG2A 1HDGO 2VBIA 5IYZA 2BBWA 2BISA 3LVBA 1MC8A 1FTGA 1Q74A 2X7JA 1YRWA 1YBFA 3ZVMA 3L7CA 3VHXB 3TAUA 2OHFA 1V3VA 1FYWA 2DMRA 3I5YA 2HD4A 1PT8A 1RC0A 4FHZA 4M1MA 4OYYA 2JVIA 4DPMA 5BSHA 1JIVA 3ONFA 2PCJA 3KHTA 5JG7A 2QMHA 2VHCA 3WLAA 4CNBA 3L02A 4KW7A 2M1XA 5LA6F 2C4NA 4GLBA 4Q00A 3PU6A 1HYHA 4BS9A 2QVXX 2DTEA 1FQWA 4GE0A 4OK5A 2SCUA 1ECCA 5CTJA 1G63A 4Z4GA 1YU6A 3V1TC 4XYMA 1UMCA 2BDUA 3ELWA 4BQFA 4WNAB 2IPLA 3S99A 4W8GA 3SDSA 4OTZA 4H7HA 2YN0A 3AEZA 4O5AA 4MQUA 3SICE 1NUAA 3PUYA 2FX3A 3E27A 2HDWA 1L8AA 2O52A 5GVSA 1N33B 3BD8A 3U2QA 4L4SA 5DLQC 3EGDA 3LV8A 3L6CA 1CQPA 4KBYA 2HMYB 3AEXA 2GTHA 3AKZA 1RAFA 2CD9A 3EIXA 2NQTA 3L0BA 4PAWA 4DNXA 1C7JA 5A3QA 2JH3A 4K1LA 1U0BB 4F71A 3OPQA 1G4UR 2AN1A 4GOLD 4L0DA 4RMGA 3L9WA 3OKPA 3QE9Y 3GI1A 1IQPA 1BD3A 1TJNA 2KHZA 2W2VA 2XD9A 3FNRA 2VCHA 3IH5A 4WNCA 3CEPB 4KZKA 3BMCA 2YZMA 4R2WA 1EAYA 3CR7A 3WGLA 3EVTA 2POCA 1VPDA 2CYBA 2ILVA 4YY3B 2X6RA 4II3A 1ISPA 3MTAA 1LTKA 2VFAA 3SD7A 3U4HA 1Z5GA 4EG4A 3TR5A 3DZBA 4JIMA 4NV1A 3V2IA 3CCBA 3EZLA 3NWPA 5G4KB 3W3AD 3VV2A 1LCIA 1UFOA 4HQ6A 1NYRA 3STWA 1LNZA 4ZCSA 1Q6ZA 2FA9A 2HN9A 2YWFA 4Z2AA 1F4VA 4IIJA 4I9UA 2R4TA 3B78A 1TRKA 3BRSA 3WICA 1EUQA 3NASA 5SYNA 4C6RA 2ZRMA 3EEBA 2QSUA 2Q0HA 3A9TA 3D7MA 4C7BA 1T9GR 1U3GA 3DHVA 4JBYA 4XJXA 2G1KA 2ONKA 4ZHSA 3VDNB 3Q3HA 2EGUA 1RDFA 5BRAA 1L6RA 2H63A 2ZE6A 5J2UA 2IY8A 4XWAA 3PFHA 2ZRPA 1WPXA 1KAMA 3W6PA 4A8JA 1IN6A 1N3IA 4LOAA 2NM0A 1F1JA 4X91A 4R1UA 1R8JA 3ZE7A 2CHUA 1L3CA 1ZKDA 2B78A 2DPLA 2J9GA 5EI5A 1QMGA 1RR6A 4NICA 3PHIA 1DDIA 2P40A 1GGHA 4QFCA 2RKWA 1IBSA 4UNSA 5DTEA 2AQ8A 2IUSA 2C7PA 3LPAA 2HR1A 1QHYA 5G1OA 3EXIA 3RTCA 1I01A 1PGQA 1SY7A 3DVSX 5GV7A 3AZQA 5IP5A 5E4YA 4EVSA 5BV0A 4LC0A 3TFQA 4KR7A 1M2NA 5EL0A 2QZJA 2XNCA 3EQZA 3L6BA 5KWSA 4CPDA 1IWPB 4GT1A 2Q2VA 1GTSA 2PGOA 4MEJA 3SI7A 1Z7YA 2PHZA 1UR5A 1JH8A 4L1KA 1OX4B 5CHEA 2Z30A 5DE3A 5F51A 3UJ3X 2XBMA 1TYEB 3IBGA 1IMOA 3HJRA 1TT5B 1U9JA 4UM9D 3UO8B 4RL6A 1Y33E 3H2YA 1ZAKA 4CG2A 4RIIA 4CM9D 3UT5B 2Q5CA 3DT6A 1RRCA 5JVDF 1GPUA 3OJWA 3BJEA 5F23A 4LJKA 4YQFA 5JNVA 1PX0A 3TW0A 4P5PA 3GUUA 1ZAYA 5JAQA 1WW3A 3PENA 3OJOA 4WBNB 2UYGA 3HCOA 2PSDA 5B4UA 1MZPA 3AETA 4R69A 3NRJA 4HDNB 4LHXA 4BCCA 3Q7IA 4NU5A 1REQA 5AJYA 4X90A 3TR6A 4YIKA 2JGMA 5HYVA 4FLMA 2ZIFA 3ET5A 3BG5A 3FPJA 3IURA 1BYUA 1S2MA 1S1MA 3Q8MA 2COUA 3Q9UA 2N3ZA 2Q28A 3LM8A 4TLCA 2F1RA 4GWLA 1YHNA 5IDYA 5J59A 2CJXA 5SZIA 3SS9X 2WJJA 3TDMA 5IUJC 3CRQA 1RBQA 3G7SA 2R6AA 4CTNA 1U1DA 1PR1A 5E2AA 3BCRA 2Z8XA 4ABTA 4LYHA 3KWMA 3T4UA 1N3YA 3JTMA 2Q3CA 1VBKA 3MTQA 1F3OA 1R8QA 1W0KD 2LDBA 1NFRA 3KTAA 1WDTA 3OAAD 1Y8QA 2HWKA 3EG9B 4K9RA 3ODPA 2X13A 1ONPA 1OGIA 1I0LA 3OEEA 3R5KA 5G0UA 5ICGA 5LJLA 1Q1BA 2FX2A 4HWKA 4WEQA 4Y6PA 5HJ2A 1JHXA 1LPNA 4GGOA 3K1AB 1F0PA 5TQVA 1Q0UA 1XYYA 1O97D 3DEJA 3EH2A 4E21A 3DO8A 2NNLD 2WJZB 2MU1A 1ULAA 1UAGA 4UM5A 1UJBA 2Y0DA 2J3DA 2R8RA 2VEOA 4LSMA 1G5QA 1LDEA 2JGDA 3T7DA 3OUTA 2ZU6A 3AHGA 3IAM1 1O8CA 4LTDA 2Z5FA 4J3NA 1TUBB 4JP3A 4CM5A 3EXEA 5FADA 3C98A 3EIUA 1T9CA 2RHJA 3IULA 1L7DA 2WYHA 4H4DA 4KYUA 1IDN1 3TZBA 1P61B 4BMYA 3BSSA 1USGA 3LK7A 1E1RD 1OFVA 4YDRA 3GLFB 1LBHA 3AIOA 3B7PA 3RF7A 1NJSA 3R6LA 3QYAA 4YLEA 3ZCVA 4TMYA 5LZ5A 2HU7A 3VU9A 4B33A 2IXBA 1JYSA 3ZZUA 3HJGA 4B4KA 1E1CB 1UDBA 3MMZA 2VSOA 4RDHA 1U2PA 1YJCA 2VTKA 1KTIA 2I2WA 4JJKA 4KK3A 2VPWA 1STOA 2O9JA 3S2UA 1ZH6A 2EXXA 4HL6A 1HYQA 3QWAA 4CM1A 3DEAA 4DR2B 3LK6A 3PQFA 3C74A 4NQZA 4EMBA 3DDUA 2IOFA 3H5TA 4COKA 3FB4A 3WIDA 2F43A 4NULA 1L7OA 1SAYA 3WRVA 3UUEA 3HP4A 5E9WA 2P90A 4RD3A 1N5RA 1OGJA 2RFLA 3TQRA 1QUEA 1U1GA 3RRFA 1FTWA 4KE9A 1BHQ1 1PX2A 2XAAA 2XHZA 2QMYA 5DXAA 4RKYA 5IM4F 2GMWA 1T43A 4WDRA 4IR7A 2MSKA 5KMGA 8MHTA 2FSGA 2VYFA 4JGGA 1JZSA 1OY1A 2G1JA 4N1AA 3AMVA 3KOXA 4KI0A 5LZ4A 4L8VA 1VJCA 5JU6A 1G1AA 2Y1FA 4O02B 1E5TA 2WKPA 2EYUA 1E96A 1EUCA 2NZ8A 4JJIA 4XGNA 3FTDA 3SZ3A 1RC8A 1YJAA 1IQ0A 1UBRS 4ZAXA 5F78A 2WKRA 1GGEA 1RMQA 4XIGS 2NU9B 1NM5C 4BJ5A 4M38A 3S1AB 1TEZA 4TM7A 2AF4C 1COZA 3LW8A 3FSJX 2WUFA 4NNJA 2AN5A 2E5WA 3LBNA 3I9NA 1Q21A 3T54A 3JYPA 3UKOA 4E15A 5IDQA 3GLFE 3DFKA 3RVMA 2FVYA 4JC0A 4RZSA 5IZCC 3RKSA 3K6SB 1CF2O 3BULA 5I7EA 2OCDA 2G1AA 1O03A 2OBLA 3OZ7A 3LDUA 4I4TF 1CRWG 4HBZA 1JPVA 4OAPA 1CZLA 3FBTA 1VXRA 1VE1A 1MA3A 5HGXA 2C7QA 1R50A 1GITA 3AUSA 1U8AA 4HN2A 4YRLA 3IT0A 1XEWY 1PWYE 5B3JA 4D81A 4DVGA 3QEOA 3JTEA 2PZLA 4PZZA 5KMGB 2XT6A 4EVRA 3DFFA 3OPVA 1SB9A 3KP1A 3PNPA 4M1EA 2VT2A 5KTNA 1T0JB 3OTOB 3WHLA 1N9GB 1XB2A 2JB9A 2PZJA 1G5HA 2QJFA 2ZUCA 3IBFA 1OD6A 2PZ8A 1E7MA 1ATZA 1SIUA 4CF3A 3WRYC 5J2TA 3S40A 2D54A 1YFZA 3IHLA 3FM9A 2CKDA 2ZP1A 5L7WA 4DR7B 3R0IA 1ZNZA 1L5HA 4GLLA 3AHDA 2IYLD 4NPCA 3MGCA 2F64A 3N2IA 1HZJA 2O5EA 1LVUA 2C57A 2IZ7A 1FLVA 1Y9AA 2ACVA 2OHJA 5EXEA 4QBTA 4D9KA 4V02A 4Y30A 1JZQA 5EYPB 4PLFA 3VYVA 1U4NA 4Z3KA 1KZ9A 1V8OA 1VA4A 1F0NA 1N2BA 4G5XA 3VTFA 3WK4A 4BQNA 2IBSA 1B7GO 1KEPA 3KTFA 3ZV4A 5ABPA 5L8VA 1NT4A 3JQ7A 1OI7A 2WMYA 2YC2C 3MXTA 2I29A 4HYYA 3DE4X 4DR3B 4PBSA 4UXHA 3Q6IA 5CLIA 5AO9A 3LKDA 1GIAA 4FMCF 5EMLA 2GBLC 3EW9A 3M6AA 1ZI6A 1T8RA 3FNEA 4MS4B 2G5PA 3C3KA 5HQTA 3E35A 4RNCA 4B87A 3GT7A 4G0VA 5DWDA 2VK2A 2X7XA 3OX1A 3TLCA 1ISGA 2BFPA 4JBGA 3ZN2A 3H1AA 1Z63A 4TUYF 1PL7A 5HZKA 4DTIA 5IULC 1YVEI 2OCAA 4B0OA 3JRNA 4C3UA 2JJ2A 4E14A 5EWLA 1U3VA 1U3DA 4BX0A 1J0XO 3SZMA 1PQWA 3JD0A 1T2EA 4CV2A 3FKSA 3K0FA 5E4TA 4I46A 2I6QA 2HT6A 1I3MA 3SR3A 3VH2A 3W4IA 2CK3D 1LWNA 1DXYA 3OJLA 5JS1A 4P3XA 3BWXA 3Q3EA 5FV4A 4CMGA 4UQPA 4HT3B 3AF0A 3R3XA 1H1LA 1NPDA 1XRPA 1ZD5A 1D8TA 3TZCA 3BD9A 3DBOB 4RTQA 2D5BA 2Q1SA 2YVAA 3QVTA 3ZCSA 2J9XB 4ZCRA 1NBMD 4ZYZA 3TB4A 3CE6A 1UAYA 2WK1A 4DXHA 4AECA 4E2YA 2XB2A 4KKXB 4QPZA 3ONNA 1U99A 3KFXA 3Q9SA 4KPUB 4IOLA 5EJFA 3TQTA 3K71B 2Z6UA 5IN5A 3FZYA 2L18A 1HBJA 2WWVD 2YRFA 3WJ7A 1KZ4A 1LX6A 1YZQA 2G83A 3BBLA 5AUQA 5A9TA 3FCEA 3TCNA 4GXRA 1WUYA 5LUAA 3I2YX 3LY8A 2VJQA 3DTYA 3N3BC 3L7YA 4NU0A 5EE0A 3FBGA 4KODA 4ZQCB 2WMNB 5HBGA 4D8YA 5T6MA 1LLDA 4JK3A 3WA7A 3CSDA 4FLEA 4KWEA 2YXNA 4OJTA 1DKMA 1OLSA 1T0IA 1TF5A 2HXYA 5IAKA 3GGGA 3GA7A 3HDHA 5EIFA 3GZTB 2FUG1 3OCVA 3WP1B 4A27A 4EFMA 2IUYA 4MUJA 1ODCA 3NHKA 3FOAA 3QYFA 5TT0A 4FGZA 4YRPA 2ISCA 1KJIA 2QXTA 621PA 3L6EA 3FJ1A 1SKQA 4L85A 1I4WA 1RLIA 3LX4A 5CFRA 3LHSA 5FORA 5JZOA 1PV2A 1PT9A 1CUEA 2ZKLA 4Y2HA 2REBA 4IAOA 1AY0A 2P9JA 1EDEA 1W581 3G68A 2VOJA 2JA2A 2JIRA 2Z3VA 2IHTA 2PR2A 3CRNA 2UVPA 2QTTA 3EE6A 3IQFA 4IM7A 2XZPA 4HFNA 1E8MA 3R44A 4L5JA 1BXGB 4NJOA 2FFRA 4OHPA 4K8OA 1UMBA 5HA5A 5L3ZA 4X1IB 2DM6A 4TLAA 1Z82A 4A6XA 4F8EA 2PKXA 1KF0A 2AE1A 4IIDA 4R8SA 4UU7A 5AI5A 2UUAB 1EWVA 3FHLA 1BHSA 1X1EA 1H6DA 2QTHA 3HYNA 3MTGA 2B8NA 3IE1A 1CXZA 2PO5A 2I0FA 1F2UA 3ZK7A 3ANMA 5AHRA 1PQUA 2JLXA 2GVDC 3LHIA 3HJTA 3RS2A 1Z4JA 3DDWA 3EZGA 3JATB 1E3TA 4DL9A 1QP4A 1G21B 4QU5A 5A2QA 2QW1A 1KAHA 1RKQA 4ZI5A 4B6GA 1YFJA 2BGLA 3HU2A 5CM9C 3C48A 4YN3A 3VRHA 3BJMA 2CYCA 2UZIR 3SZLA 3PLAE 4I4IA 2EKBA 1TQ8A 1SZPA 1SVUA 3EDRA 1Q19A 1J22A 3HJFA 4ND4A 1DMSA 5ICEA 4ICIA 5CG1A 3JASB 5F77A 5J40A 2GXAA 4BRWA 1ZIOA 1DZIA 2HHCA 1OBVA 2EWMA 3NAMA 3OY2A