5JS6A

Crystal structure of 17beta-hydroxysteroid dehydrogenase 14 t205 variant in complex with nad.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
GTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 268
sequence length 268
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5js6A00
3OSUA 4OAQA 4DIBA 1NPYA 5JC8A 4YVFA 4OO3A 4GQAA 2VWHA 4DMMA 2BMAA 4IDEA 1E6EA 4WK6A 3NUGA 4Q39A 3UUWA 3PYMA 1PJTA 4I9NA 4YRAA 1ZH8A 5BSGA 3ZHYA 2NWQA 3K2EA 3DBHB 3OETA 4BNTA 1R16A 1ZEMA 5BQFA 2E4AA 2GZ3A 3OEWA 4YAJA 2PA3A 1ENPA 2PKQP 3ZWCA 4NJOA 4J1NA 4JX8A 8LDHA 1HE3A 3JD4A 3QP9A 1YJQA 4UUMA 5A5FA 2D59A 2PFGA 2X23A 2CSUA 3RC1A 1AHHA 5GZ6A 3PWKA 3U4HA 4E6PA 3RFVA 4TQGA 3JD0A 4ZN6A 1QR6A 2ZB4A 1N9GA 4XYGA 3ETDA 3HWRA 3W8EA 5IDYA 4Y6PA 2G82A 3VH4A 1ZEJA 3C1TA 3QVOA 4LCJA 3WYCA 4AJJA 4CL3A 1DC5A 3VTFA 3H9EO 5FFFA 3ZU2A 4J3FA 2OGUA 1VM6A 4PVCA 4DLLA 1BRMA 1NTOA 4YT2A 1QRRA 4ZGWA 4GH5A 4UEOA 5FYDA 1A5ZA 4DYVA 1I30A 4LSMA 5JE8A 3ZN2A 4ZQBA 3D7LA 4DMLA 2DFDA 1PJBA 1U3TA 1PJ3A 1B16A 1GAEO 1MUUA 1WAMA 2FOIA 4Y8VA 3UAGA 4MPDA 4Z9XA 5EMHA 2O7SA 1ZJZA 1HE5A 4UREA 1CF2O 4L0QA 1JVSA 1KEVA 5IXYA 3Q2KA 5TS3A 3HG7A 4CMHA 1JTVA 1LDNA 3WGGA 2IYOA 4J7CA 4NZ9A 5DCUA 1E7WA 2NQTA 3GUYA 2C59A 3W8FA 4EUHA 3JQFA 1YH3A 1I32A 3DBHA 3QHAA 2DQ4A 3JQGA 4NK4A 1ORRA 2EV9A 3I52A 2Y1FA 5DCWA 3KETA 4L4SA 1Y5MA 3OJOA 1KVQA 2Y1GA 1H6DA 3OP4A 1HDZA 1V6AA 5A06A 3EZLA 5JDCA 3RAJA 1NFQA 1DSSG 1KOLA 1T26A 3FNHA 1E1NA 4PG7A 4XQCA 5FI3A 1B2LA 2HK8A 4AICA 5ITWA 4I5GA 4RLSA 4W7IA 3JQ8B 3VPHA 4D42A 2FWMX 2GZ1A 1VPDA 1NYTA 1SOWA 1Y6JA 3AM4A 5DF1A 5ER9A 1YBAA 3UH1A 4AJ1A 2DKNA 4D7AA 3L6EA 1WLYA 4I08A 2DBVO 4GVLA 1XDWA 5G0WA 3H5RA 1YE3A 3ONEA 1P33A 2WTBA 3NDIA 1B3BA 1HE2A 3GEGA 3F4BA 2OFPA 1HDRA 4JROA 1JKIA 4P38A 4YCAA 3FF4A 4Q3DA 2JJYA 1KVSA 4HX5A 2WD7B 1HYEA 3BMQB 2JL1A 3Q2IA 4P4LA 2JFHA 3L0DA 3Q0EA 4D3DA 2RBEA 5IDWA 3PIIA 1PQUA 4OMUA 4NBRA 2QZ9A 3PQEA 4XQGA 1NHWA 3UCEA 3DZKA 2AE2A 2EJVA 3D4NA 1CRWG 3W8DA 4GX1A 4IZHA 3BZUA 4R4JA 5A9RA 2GZ2A 2DBZA 1LRLA 4MO2A 5L51A 2VNSA 5L4NA 1ADGA 3QVWA 3JQFC 4FFLA 1HDGO 2C29D 4YDRA 2VYVD 3RD5A 1WWKA 2OHXA 4JNKA 4BO7A 1ONOA 5T5QA 4IJUA 3ETGA 3QWIA 4I5EA 2WJPA 1LQTA 3FD8A 1OFGA 5JDCC 4WNCA 3DHEA 1RM5A 3TWOA 1CQJA 4NU6A 2R00A 5F3RA 3JQ8A 4DIOA 3RCBA 4CMEA 1NR7A 4P22A 1RWBA 2GN6A 2BLLA 4WEQA 3CPSA 3TZQA 3PXXA 3FPCA 4U6SA 4FR5A 4F3YA 1NWCA 4M55A 1UAYA 4CQLB 2C54A 3QWHA 4PRKA 1DAPA 2YYYA 2EP5A 1MB4A 1P45A 2C5EA 4N5LA 1HDCA 2BFPA 3JCZA 3GN1A 2Y0CA 1CQIA 2ZK7A 1GD1O 2H9IA 2FRDA 4HFMA 1U2DA 3ANLA 3A9WA 4IQ8A 4BO3A 3UN1A 5CFZA 2WD7A 3BMQA 1NAHA 3AU8A 3JQ9C 4N5MA 4CMGA 2DC1A 5COQA 1LNQA 1OI7A 1GYQA 2HLPA 1E7QA 2XXJA 1DBVO 5JMPA 3GMSA 3V8BA 4BMSA 3F5SA 4RDHA 3C24A 5I7EA 1N92A 2J3IA 2I67A 4E2YA 1KYQA 1TVEA 3OH8A 4Z3KA 1K3TA 4K6FA 4CM7A 4B8ZA 3NJ8A 3BMNB 2UVDA 3CEAA 2H63A 5IDXA 4IY1A 1BG6A 4OXYA 1NVMB 5TGDA 2X0NA 3TZHA 1Q0LA 2WDZA 2RCYA 4IGEA 2R00C 4EYEA 2PGLA 4RF5A 4D45A 4RPKA 5HRUA 5JC1A 4RPGA 3IDSA 1A7AA 4XGNA 2DUUA 1XG5A 1TT5A 1PR3A 1C1DB 4JCOA 5EN4A 3KUXA 2AEFA 1MC5A 2Q45A 2Q1TA 3T7CA 4CQLA 4CUJA 3EK2A 1IYZA 5LC1A 3TJRA 2X58A 3ZU3A 2C82A 2EEZA 3WWYA 3GDOA 1ZSNA 2BD0A 1HDOA 3RUCA 4AJOA 2BGLA 1LDMA 1LTHR 3U49A 1V9LA 4DL9A 3M1AA 5I9NA 2QZZA 1UUFA 1LC0A 1LA2A 1X7GA 4TKMA 3I9MA 4CR7A 3DZGA 5KVSA 3LC7O 1PQPA 4OIMA 1QORA 4R51A 1LXCA 2Y05A 3KSUA 3UF0A 2E6UX 1NPTO 1MG5A 3UGKA 4YT8A 5CDGA 4Q3BA 2NUAA 1EUDA 4I9UA 1VL6A 4XR4A 1YQDA 3HQ4O 4B3HA 1R0KA 1GUFA 4PVDA 4BQPA 3BMNA 2I9PA 2I6TA 4ND1A 4CQMD 3ANMA 2GGSA 1GEEA 4LGVA 5G4KB 3AU9A 2H1SA 4O1MA 2GD1O 3IMFA 4O63O 3K96A 3A1NA 3NTQA 4DREA 5IFLA 1E1KA 1QYXA 4GWKA 4XD2A 2E82A 4OM8A 1ZZEA 3MTGA 4XGIA 3BTUA 4A7PA 1E3JA 1T2DA 3ADPA 5DDIP 1MXFA 1XGKA 2HUNA 4Z6KA 4RF3A 3OF2A 3NGLA 3WGIA 2BI8A 1U4OA 4IJWA 4IINA 2GRAA 1VSVA 3PDJA 1LRJA 3DMYA 1JWAB 1YL7A 3AM3A 2V6GA 1R4NB 4NFYA 5BSHA 3DDNA 4WE3A 5AXDA 2X7HA 3RUDA 4L74A 4X54A 1YQGA 1CJCA 5G0VA 2VUUA 5TX7A 4PIVA 2PH3A 3NYWA 3IQDB 2X86A 5AXCA 3VH1A 4OJNA 7ADHA 4BNUA 3E82A 3IJRA 2RH4A 3U5TA 1H94A 4ZQEA 2OUIA 4BO4A 2CF6A 2DBRA 1T24A 1KBZA 2I3AA 3HJAA 3DAFA 3QE3A 4XYBA 4K1LA 4YACA 4RVDA 4DQVA 4E5YA 4MVJA 2AQKA 1ULSA 5TNXA 4IDFA 2O50A 5KJ6A 2PTGA 2OBNA 2NU6A 5CAEA 2NVUB 2YQ4A 2OMEA 1V3VA 3I6QA 3OHSX 3DZBA 5G4KA 1R0SA 4B8WA 3WYBA 5I8WA 2A9FA 5CDYA 4NDNE 2EW2A 1H2BA 4KQWA 1Z6ZA 3F4LA 3OJEA 1SOVA 2Y66A 3GOHA 4BV9A 1U8FO 4OSPA 3G49A 2Q2VA 3JQ7B 1DEHA 3K2BA 3GGOA 3HDJA 4TKLA 2NVBA 3DB2A 1NBOA 1GCOA 3RKUA 1E1MA 4YAIA 2Y1OA 3L6OO 3FNFA 3M2TA 4FJ2A 3LQFA 5F5LA 3RJ5A 4WASA 3RQSA 4LN1A 1R4NA 3I4FA 1CYDA 1I5RA 5JCJD 3DZJA 3AY6A 2JD1A 3C1AA 1DIBA 1P1FA 2V6MA 1A4UA 4G2NA 1DJNA 4L75A 1HL3A 4B3IA 4RJTA 3QJ5A 1NFRA 3L6DA 2Z95A 2YHIB 3QQPA 3ZWAA 3JQEA 3DMTA 4BKRA 1P3DA 2FR1A 4JIGA 5A05A 1EVYA 1RM4A 2VHXA 4WCFB 1X15A 1B8UA 3WDSA 4TRNA 3AOGA 4D44A 4BO0A 4IIUA 4YB8A 2DUWA 2NVUA 5JLAA 1E3LA 1YS4A 2G0TA 1QV7A 4HBGA 3F1LA 4JBHA 5ILOA 3CZRA 3G1TA 1S6YA 5J23A 3WLFA 1FDWA 4Y6SA 1G6KA 1IY8A 1UZLA 3EC7A 4FFOA 2ZTUA 3SJUA 1EK5A 1ADCA 4JK3A 3IAHA 2E49A 3F6YA 4GGPA 3JQ7A 1ZK3A 5KJEA 4BKUA 1NVTA 4ZJUA 4FGSA 4ILKA 4A0SA 4ZICA 5KVQA 5C5IA 4MVJG 4NHEA 2A94A 2CVOA 3BYZA 4BUCA 5KJCA 1O94A 1CDOA 1P44A 1UR5A 3I3OA 3HDHA 1U3VA 1C0LA 1GL3A 5DCYA 2C20A 1J5PA 3RKRA 5IAAA 2C2XA 3EHEA 3S8MA 1VLLA 5IG2A 3WQQA 4MIOA 3IL2A 2NQ8A 4HY3A 2FSSA 2QHXA 1CIVA 4UVHA 4E0BA 1JA9A 3LT0A 4GL4A 2VHYA 1DAOA 3O26A 4JXKA 4WCFA 4CM3A 3FR7A 1F12A 1YOVB 3IKVA 2OXIA 1HLDA 3AUUA 1GZ6A 2D4AA 4PLYA 5JDIA 1AXGA 2CY0A 1ZSYA 3C7AA 2UV8A 1VL0A 5JS6A 5JYDA 3M2PA 3GQVA 1HDXA 2H5LA 2JCYA 1KVUA 4LW8A 4PLPA 2Y0DA 1EFKA 1LLCA 3MCVA 1VRWA 3CXRA 4C7JA 1N7GA 3P7MA 4H7PA 4E5MA 3MOGA 3EYWA 3PGXA 4FCCA 1H0KA 4NU5A 3RIHA 1P1KA 3FNGA 4MVJM 3FN4A 4DQXA 2FP4A 3ZV6A 2Y93A 3RBZA 4MVJP 2NVWA 3Q9NA 2ZQZA 1QLJA 1PTJA 4FC7A 4KZPA 3GLQA 3WNVA 4DC0A 1PL7A 3TL3A 3PFFA 4CLRB 1K2WA 4TSKA 4KP7A 1KETA 5TQVA 3WR5A 1K5HA 3PEFA 2GPTA 2O3TA 4PLHA 2NU8A 1XEAA 1IPEA 1DIGA 4G65A 2Q4BA 3AW9A 1JDJA 2VHWA 1QG6A 3D0OA 1JAXA 4J4BA 4IXTA 3JQDA 1ISJA 1IPFA 1B14A 3FWZA 2P9EA 1VKNA 4CM8B 5DOZA 4NQZA 3OQ6A 3HN7A 2PLAA 1SZJG 4RZHA 4A5OA 2W2LD 4EGFA 2OBYA 5IN4A 1B8PA 1E6UA 3IUPA 1RM3A 5KVCA 2IRWA 4WCFC 1P1HA 2FHSA 3KXDA 3IOYA 1BW9B 3ORFA 1NWHA 1YOVA 2G17A 2AW5A 4YBZA 1DIAA 2NLOA 2CF5A 1LJ8A 4UAGA 2BI7A 4IQGA 4NK5A 2W4QA 3BMOB 3NJ4A 4R54A 1U9JA 4E2ZA 1XCBA 4KTVE 2D5AA 4HXYA 1ZFNA 1U5AA 1VJ0A 3GFGA 4XDZA 2F00A 2W2KB 4R16A 5KJFA 5GZ1A 3DBRA 5TF4A 4NBVA 4GSKA 4PRLA 3S55A 4ALIA 2CUKA 4FPXA 3B6ZA 4UEKA 3MJEA 3HSKA 3TNLA 3IIEA 4AFNA 3P2YA 1XSEA 2XPCA 1BXGA 5L4SA 1ULUA 4QT0A 2CVQA 3C1OA 3IUSA 3JQCA 3JSAA 4CLRA 2AE1A 3PYXA 4FBGA 4GSLA 1F17A 3RROA 3GGPA 2HO5A 3DFZA 2CFCA 4N5NA 4BKPA 3KYCB 5AXAA 1NNUA 3PTZA 2C7GA 1UDCA 2P68A 1D1SA 2X0IA 3NGXA 2IXAA 4J91A 4YR9A 3H9UA 5EESA 3ZWBA 1CEQA 1NQTA 4BQRA 1TEHA 3I9OA 2W8ZA 4J1SA 1DRUA 3JQAD 2FR8A 5JY6A 2X22A 1DC4A 5B4VA 4CM8A 4DBVO 4W99A 4UVEA 2DBQA 2VWPA 3AY7A 4ALKA 5CEEA 1EQUA 1GYRA 3PHLA 1YBMA 3WX0A 3ZWYA 3AJRA 4LK3A 4FQ8A 3UICA 4DGSA 1BW9A 3PLRA 3RUEA 4HFRA 1Y5RA 1BGVA 1GUYA 1IUKA 1HSZA 3VOSA 2PR2A 3FBGA 1QKIA 3DEYX 1H6CA 2J3KA 1V8BA 2HMSA 4P4NA 3WIEA 4K28A 4PGFA 2HAEA 2W2KA 1KERA 1A27A 3MJCA 4B7UA 1PL6A 2PK3A 3H7AA 3NX4A 3ON5A 3ADOA 4JP3A 2ZB7A 4D3FA 1E7RA 1ONNA 1XQ6A 3ZWMA 3ZV5A 3OBBA 4WLEA 3BA1A 4NNJA 4ZQHA 1I24A 3OJLA 4H15A 3SC4A 4BNMA 3P5SA 2ZATA 5H83A 1J0XO 5CDTA 3MWEB 3I9NA 3U3XA 3ZWVA 1Y8RB 3KYCA 2DAPA 4AJEA 3IKTA 3WGQA 1EUCA 1X0XA 3ZDFA 1BXZA 1LRKA 2EKLA 1N1GA 5AOVA 2D3TA 3H5AA 4C7KA 4ZQGA 1KY4A 3PFWO 4GX2A 4L9RA 4YT5A 2FMUA 4QECA 2FPGA 4A2CA 1XU9A 2QIOA 5I7FA 2J5RA 4RVUA 1DHRA 2CDAA 5DBFA 4CM6A 1E5LA 1JKJA 1R37A 3DOOA 1R66A 3JYNA 1D7OA 2F1KA 2Q99A 1U3WA 3BXXA 3N58A 1DJQA 1ENZA 1NFFA 3LU1A 5A03A 4TRMA 3SC6A 3A06A 4RORA 2NSDA 3D3WB 5IZCA 4IM7A 4PG6A 3VZRA 2BHLA 3EAGA 2NM0A 3PRJA 5CP8A 2I3GA 1AGNA 4HNGA 5A9TA 4J9VA 4ID9A 1DLIA 1XQ1A 3QRWA 3FBTA 3OA2A 1B15A 2RAFA 1DRWA 4CL8A 3PHGA 4XRRA 3M1LA 4EEXA 2GYYA 2IE0A 3ONDA 1GEGA 3KEOA 4NFSA 4YEDA 3G79A 4CV1A 3K8ZA 3HFGA 3ST7A 4MIEA 1P9LA 3GEDA 2AMFA 1EUZA 3OJFA 3QLJA 2GASA 1Y8RA 4M89A 4CUKA 3WMWA 3JQAB 2VZ9A 5JNLA 1DFGA 1U8XX 3ZGYA 5K9ZA 2WMDA 3RBXA 2P9GA 3WS7A 5BNTA 2EGGA 3KM0A 4XX0A 1Q1NA 4BB5A 1W8DA 5JBIA 3WG9A 3KBOA 1RJWA 3HFSA 4TZTA 2VRCA 1GYPA 1AN9A 4XIYA 5HS6A 3WBBA 4TRRA 1S7CA 4U0KA 2P91A 5TSDA 2BF7A 4GPD1 1H9AA 4Z9YA 5CDUA 2NU9A 3BAZA 4ZU3A 3ZCXA 4IS3A 4BMNA 2HKIA 3TFQA 4AJ2A 2B36A 5DP2A 5T67A 5IZCC 3UXYA 1HZJA 2GUGA 5IN5A 3EVTA 5BNFA 1XELA 3JQ9A 3PGJA 4MVJF 4EDFA 4J0FA 2O3JA 2GN9A 2WYVA 2ZJ0A 1NR1A 1FDSA 3KO8A 3GY0A 1NP3A 1Q7BA 4IBOA 5DT9A 4GBJA 1Z73A 3BHMA 5IXSA 1UP7A 2VZ0A 4ZA2A 2Y1DA 1XA0A 4FN4A 3DBVO 3E9MA 4XRGA 1ZO8A 3DBLB 3MJVA 2I5PO 4W9NC 1HYGA 4HADA 4QO7A 3NTOA 1D1TA 2YV3A 4HWKA 3RFTA 1ZMTA 3GN2A 2W90A 4GGOA 1MFZA 4IPTA 2J5QA 1EBFA 2C7VA 2IZ0A 1UDBA 3ZI0A 1LQUA 1HYHA 1T2FA 3ABIA 3PDUA 4HV4A 4WOJA 3FSRA 3JTMA 3K92A 1FJHA 2YDXA 4DPLA 4S3MA 1Y9AA 1U3UA 3L4SO 4CJXA 4O5OA 1C0IA 3P2OA 1YKFA 4R1UA 5U9CA 1B8VA 3STHA 3GFBA 3Q6IA 3OEYA 4N18A 1H2HA 3VZSA 4BL5A 4RVFA 5G2OA 3IS3A 4AVYA 4FOSA 4AJIA 3CIFA 2VYND 4ONEA 4PFJA 2ZTVA 4CV2A 3IJPA 1X13A 3KLMX 3W4IA 2PGJA 1Z82A 3PWSA 4M87A 4Y67A 2VT2A 1RM0A 4ND2A 3QY9A 1L1FA 1LSJA 2QRJA 3GF4A 4CLHA 2HU2A 3ROPA 4FB5A 5G0TA 4BHTA 1I01A 4I1IA 1MP0A 4RVSA 4QFCA 3W1VA 4AJ4A 3VPSA 5L45A 2B4TO 1ZNQO 2JAPA 2ZYDA 1HRDA 3DBLA 3GMDA 1F0YA 2VTEA 3MTJA 2IYPA 4RQTA 1PSDA 3QWBA 2DPGA 3WGTA 1H93A 4HUJA 1GADO 1NAIA 2HJSA 5EIOA 2PZKA 1Y7TA 4ZVVA 3PJEA 2JHGA 3SXPA 1IHYA 1Z7EA 5TT0A 1WDLA 4CM9D 4RPJA 1DB3A 4ND4A 3HNPA 3PWZA 1H9BA 1ZK4A 1YB5A 3PHHA 5G4LA 4K6CA 1NHGA 4MJLA 3U4IA 1AUPA 1B26A 5FF9A 3F9IA 2X0JA 4AG3A 2ZTLA 3I5MA 1WMBA 1BTOA 3NT4A 4E5PA 1H6AA 2PD4A 4P4GA 3ZV4A 2Y68A 4INAA 3PVZA 3TSCA 4MINA 4XIJA 3ICPA 2DFVA 3MJ4A 2HCTA 3QSGA 3LYLA 4UUOA 4FJ1A 3HZZA 4DRYA 3KZVA 3R3SA 3F5QA 3DAPA 4ESOA 3BTSA 3KEQA 1LDGA 4PLVA 5MDHA 1CETA 1NXQA 4CMIB 1IHXA 2ZIZA 2YV2A 3VKVA 3WJAA 5EQDA 1KEPA 5I7SA 2LDXA 1ZXLA 3I9LA 1PZHA 1OAAA 6ADHA 1Y81A 2QW8A 2CDBA 3QVTA 5TJ9A 1WDMA 3GK3A 1M66A 3AI1A 3R1IA 4UULA 1ZIDA 5BR7A 3IP1A 4C4OA 5B1YA 1L7EA 2X9VA 4ND5A 5L9AA 2VHVA 4CLOB 1ZXBA 2IEBA 3RUFA 2Z5LA 3WTCA 4YXFA 1NM5A 4ALNA 1ISGA 4FC6A 3Q3CA 2B5VA 2X6TA 3H3JA 4UUNA 2BFOA 3RUAA 3ZWWA 3INGA 5C3MA 1RYDA 3H5NA 1YXMA 4Z3DA 5F1KA 4GX0A 4IJKA 1ONPA 2RHCA 4MVJH 1MGOA 2AXQA 2GO1A 5JYEA 1X1EA 2VWGA 5BSFA 3DONA 1EVZA 4BNYA 3OA0A 4Q3AA 1C1DA 3WQRA 3ITDA 5L7WA 4M8SA 4WLVA 1SEPA 3LZ6A 4BGVA 3ASVA 4RQUA 3O4RA 1PGPA 5AXBA 1U7TA 5HBRA 2CD9A 2AQIA 1O89A 2YJZA 3UOGA 3RBVA 3GHYA 2DU8A 1X1TA 4CMIA 4GMGA 3RC9A 2I65A 4E12A 3GRPA 3VC7A 3QW2A 2BKAA 2XXBA 2Q2QA 2YDYA 2PWZA 4IJVA 4II3A 5CPFA 4RPLA 4TZKA 3FTPA 1FF9A 3GPDG 1JAYA 3BHIA 1AE1A 1DXYA 2Q3EA 2VYVA 4B3JA 2C2YA 4CM4B 4FW8A 4JGBA 1JN0A 5A4DA 3X2EA 5CDSA 1XLTA 4R41A 4RF4A 2OP0A 2G76A 5ENDA 3TQHA 1HKUA 4CMAA 1P1JA 3GH3A 1QYWA 1T2EA 2NTJA 4CLOA 3S2GA 1R4MB 1EK6A 4IS2A 4UVIA 4CLXA 4PLGA 1TI7A 1HWYA 3E9NA 4BGIA 4AJKA 5DULA 4RDIA 3UCFA 4IXWA 5ICMA 2JFGA 4GX5A 1W73A 2HK9A 3C8MA 1EDZA 3E5MA 4ALMA 3RUHA 4BO5A 3I9KA 3CINA 4J4HA 3AI2A 2DTEA 1DLJA 3DTYA 4CUZA 4Z0PA 1B7GO 3ZWOA 2IEDA 2EIHA 2QYSA 3HB5X 1C1XB 3K9QO 3V1TC 1HLPA 2AA3A 2HDHA 4NMHA 2YY7A 3I83A 3R0IA 4PLWA 4LCEA 3TFOA 1E3IA 3QVXA 4CMBA 5HA5A 4KWHA 5EINA 3OFSA 3EUWA 4BNVA 4J2OA 4YQYA 1PGQA 4GMFA 1U1IA 2D2IA 3VDQA 4L73A 3VAZA 1MV8A 4W7HA 5EJ2A 4R5HA 2OO5A 2VWQA 2QRLA 3RASA 3GAFA 4GAEA 2JCVA 3ZW8A 4BNNA 2UUOA 3SX2A 3TPCA 2VN8A 3NDJA 1ZK1A 1QXSA 1M6WA 4UVDA 1RKXA 4XQEA 3B1KA 4I5FA 4CM4A 2EGHA 5JAZA 1I10A 5CEJA 2VQ3A 2JD2A 4R1SA 5JAQA 4CQMB 2SCUA 3VZQA 3F47A 3ENKA 4R68A 2G1UA 3ETEA 4J0EA 3O8QB 1UZNA 2EKPA 3KHUA 1Z75A 3C3XA 3U62A 3CH6A 3GNTA 4B4VA 3VH3A 3JYOA 2W98A 1Z45A 3HHPA 3ZU4A 4YT4A 4CPDA 5L95A 2RHRA 4MVJI 1Q7GA 1P77A 1HE4A 3ENNA 1PS0A 1EVIA 4XB2A 3E8XA 4TROA 5EL0A 4N7RA 1C1XA 4LVUA 3ULKA 4H3VA 4JJFA 4WECA 1KVTA 4CM5A 3VDRA 1GPDG 1KY5A 3KOUA 1TA4A 1A71A 1PU2A 3INTA 4WCDA 4KUHA 4L4XA 3B1JA 4KMSA 3QA9A 2EHDA 3F3SA 3PLNA 3PK0A 4XZ3A 4YYZA 1IE3A 4DIFA 3AUSA 2HMTA 3TN7A 4UVGA 3PQDA 2DVMA 8ADHA 2X8LA 2YHIA 3VHRA 1OZAA 4EZBA 1F14A 2AG8A 5DNAA 4RZIA 4WNIA 2B37A 4WGGA 5B4UA 3H6KA 1DC6A 3H65A 1YQXA 1YBVA 2DM6A 3S2FA 4BO1A 1I33A 3G17A 1YL5A 4CQMA 4QEDA 3GC6A 2ZTMA 5F1PA 3O8QA 1SC6A 1PIWA 2P4HX 4FGWA 4UUPA 2GDZA 1I8TA 4ITUA 3ONFA 3TL2A 1P0CA 1GUZA 1R6DA 1XR3A 5JO0A 2B4QA 3W4JA 3JD3A 3VPXA 4EJ6A 4HNHA 4R9SA 4NJMB 2WM3A 3RU9A 1WVGA 2TMGA 3KRTA 4J2HA 4NPCA 1PJLA 2WD8A 3GZ4A 3AY3A 3HN2A 1N2SA 2BRUA 4D79A 3WOHA 1R12A 4O6VA 1P31A 3NAQA 3Q1LA 5TJHA 3E03A 4YJHB 1E5QA 4BNJA 5FEUA 4BNLA 1PEDA 2AHRA 1R15A 3GGGA 2CMDA 1NASA 5A5EA 2Q4EA 2VOEA 3HB4X 5KKAA 3DZIA 1NQ5A 1WPQA 3GVCA 4URFA 4DTIA 4CMKA 1EVJA 1TB4A 5DBIA 2PKRA 2BFMA 1X14A 5B37A 1OC2A 4I5DA 2P9CA 1M6HA 3TDKA 4IUYA 4OSOA 1PS8A 3E1KA 4A10A 2Z1MA 2D0IA 4XJTA 4LMPA 4RL6A 3GZNB 2GF2A 3Q9UA 3NDRA 5JW6A 1O5IA 4YJFB 1YO6A 3EY4A 3WFIA 3ZWXA 5JAIA 3K30A 3PJDA 5TRTA 1ISMA 3VPFA 4PG5A 3PYLA 2VNAA 2WWRA 4AJNA 5HTOA 1XKQA 4GKVA 4OXNA 3WLEA 1E7YA 1E6WA 2EP7A 3OIGA 3VZPA 1PJ4A 4IQ0A 3S2IA 1MA0A 1EMDA 4Q3CA 4QXMA 2O2YA 4E3ZA 3U09A 2X9GA 1T2AA 2HSDA 2IODA 2EW8A 3RFXA 1DRVA 3PZBA 1I3LA 1LDBA 2YQ5A 3OECA 5T64A 3WSVA 1P0FA 4J4TA 4H16A 1MX3A 2P4QA 3AK4A 4OKIA 1PQWA 2ZJ1A 4WOKA 3FWNA 4R5MA 4YJHA 5FI5A 4WLOA 1GDHA 5JCJA 2UYYA 2XAAA 1ZVMA 4WKGA 3T4XA 4EITA 4QTZA 1EZ4A 4KUGA 3OICA 1J49A 2WE8A 3UCXA 4YPOA 5F1OA 1Y8QB 2FN7A 3SLGA 1ADFA 5U4QA 3ZNQA 5IZ4A 4S1VA 3GVIA 2VCYA 4JJGA 3DWFA 3JQBA 4Q3NA 2HMWA 1UAGA 3DFUA 3H2ZA 3JD1A 3PI7A 4MKXA 1ENOA 1MXHA 1E3WB 3EZYA 5LDGA 4LSWA 4BS9A 3JYPA 1HETA 2QG4A 1FDVA 5BT9A 2ZYAA 2J8ZA 3MEQA 2H6EA 5KNLA 5T6BA 1I2BA 3GZNA 4IGFA 1L7DA 4DA9A 1I36A 1J4AA 2P5UA 2XOXA 1WZIA 3WFJA 3UVEA 5MGBA 4CM1A 5F21A 3BMOA 2ILTA 1P74A 4GKBA 2FR0A 3LLVA 1NQAO 2JAHA 2YUTA 3QV1A 1SBYA 4MVJE 3AOEA 4QQRA 2BGMA 1F8GA 4EUFA 4OKNA 4OXKA 1UXIA 1N8KA 4BNWA 3GVHA 2DT5A 4Y9DA 3DQPA 2AEMA 3K5PA 4BV8A 1G0OA 1SB8A 1U28A 5HS4A 2Y99A 1LBEA 3KTDA 5KJ1A 3JV7A 3MJTA 5IDQA 1E92A 2JHFA 3KSZO 2O3RA 2EG9A 3D4OA 3EVNA 1BVRA 1K6IA 3ZHBA 4GLLA 1Y8QA 4QO8A 3DL2A 5C7OO 1QYCA 1KEWA 3SBOA 4TVBA 3AWDA 4YWJA 3JQBC 1JQBA 1WW8A 4KDFA 2FPIA 3EMKA 3WNQA 5JSFA 2V6BA 1D4FA 2EWMA 1WMAA 2YFHA 2ZCVA 5ILGA 1E3WA 4DYDA 1GR0A 2O4UX 4XB1A 2ZCUA 3FTNA 2Y1CA 3L9WA 1X0VA 4TWRA 1VKOA 4PZCA 2P2SA 1UP4A 4IMPA 3GDGA 3JQGB 4L76A 4GI2A 4BVAA 1YB1A 4R3WA 4U5QA 4Z9FA 3U4CA 3BTOA 1W4ZA 1LDEA 4LISA 1B3RA 5L7TA 2FY8A 4XWYA 5GMOA 1MFPA 3Q11A 5KOIA 1O6ZA 1C0PA 4MIYA 3COSA 5U1PA 3AOEC 4U0JA 5TLSA 1VL8A 4Z0HO 2V65A 1N5DA 3NEPX 2HRZA 4JJIA 1VJ1A 4FD3A 3WGHA 3X2FA 4A73A 1N7HA 5TT1A 3LDHA 4YAEA 3ZH2A 5KVVA 3DZHA 4XYMA 3LK7A 4AJHA 1BWSA 2ZB8A 1KEUA 3K6JA 4J9UE 4W9NA 2QYTA 4J7UA 4DPKA 3CE6A 1SEVA 4BOYA 3CKYA 1IOLA 3O03A 2UDPA 1Y1PA 2Q46A 1I3NA 3VVCA 4GLOA 1A72A 2D8AA 2HK7A 2WSBA 1Y9EA 4M86A 3VH2A 4JBIA 4BO8A 4KOAA 1IZ9A 1YWGO 5K0ZA 2ET6A 2W2LA 1EFLA 4PG4A 4XGKA 5CG2A 4R9RA 4PN3A 3V5NA 1ADBA 3F1KA 4ZRMA 3E9QA 3T4EA 3DOCA 1VSUA 1DHTA 4Q3EA 3ZV3A 1SCUA 3BTVA 1JLLA 3UKOA 5BNIA 1UZMA 1U2GA 4JN6B 3TZKA 2IZZA 3ICCA 3GVXA 4NBTA 4PLZA 2RH8A 3OJ0A 5DOVA 4UEJA 2Y0EA 2AQ8A 2WEKA 1O9BA 1SMKA 1E3SA 3HDQA 1LU9A 3D3WA 5L40A 1T1SA 2GSDA 1KVRA 4YJGB 4TVOA 3FRJA 1LDYA 4DXHA 2OP1A 1UH5A 1LLUA 1XHLA 3PQFA 4XKJA 2FZEA 3D1LA 4RLHA 5CHEA 4RF2A 4G81A 2VHZA 2DTXA 3H9GA 3IC5A 3QWAA 4E5NA 3D5QA 3ZNNA 3ZZNA 5F5NA 1HT0A 2J3HA 1O95A 5A3VA 1PWXA 1UDAA 1YB4A 1GCUA 3AFNA 3CUKA 1I0ZA 1MC4A 4GWGA 4R1TA 5AYVA 4F6CA 3BIOA 1BMDA 5JFOA 1R0LA 3E18A 1GY8A 1XIVA 3SLKA 5I7VA 1BXKA 4A03A 4M54A 1PR9A 1F06A 1PJ2A 1DO8A 2D1YA 3JQAA 3KB6A 3G0OA 1FMCA 1T4DA 2B5WA 4XR9A 3TRIA 3TZ6A 1PL8A 3WGYA 2GN4A 2AEJA 3GG2A 2AQHA 4W6ZA 3L4BA 5C37A 5GY7A 5TIIA 2YFQA 4RV9A 2O48X 2Q50A 4R01A 4A27A 4EJ0A 3A14A 1DDOA 4Z0TA 5ER6A 3GDFA 3U9LA 1QSGA 3WYEA 1FK8A 2DLDA 2EKQA 1SNYA 4DLAA 3V1UA 2EJWA 5DZSA 9LDBA 1YRLA 4MVJD 3V2GA 4J6FA 3QVSA 4CR8A 2V7PA 4XQ9A 3NV9A 4YJGA 3WICA 1QP8A 4CR6A 1T2CA 3R3JA 4M1QA 4WLUA 5JXWA 4R69A 4OQYA 5IJZA 2GNAA 4BNFA 1EQ2A 4FFPA 3U0BA 1UXJA 3GT0A 4YAGA 1TT5B 4KDEA 1D8AA 2CVZA 4FDAA 1LSSA 5CEFA 2CNBA 3C7DB 3WTBA 1CWUA 3D5TA 1ZMOA 3LF1A 1KIFA 2TMDA 1H5QA 4PLCA 2BH9A 1K89A 4Y6RA 5H82A 4E21A 1AXEA 4F46A 1ML3A 3DTTA 1M75A 1GPJA 1Z7BA 5JCXA 3K73O 1WP4A 3TF5A 3L9XA 3RC7A 1H6BA 1GZ4A 1D3AA 2R2GA 4IDBA 1FXSA 1PWZA 4DWVA 4XCVA 3I1JA 3GNSA 5JY1A 1NPDA 2NTNA 1X7HA 4KQXA 1A4IA 3D3EA 2VZ8A 2NTVA 1ZSVA 4RVGA 4BO2A 3L07A 1OBFO 3L4BC 1ISHA 2PV7A 1ZBQA 3KV3O 3WSWA 3ROMA 1I2CA 3AM5A 3IP3A 3OQ1A 3ZNPA 3GNQA 4TMFA 4BGUA 4ND3A 1DIHA 4HFJA 3KVOA 3KYDB 5COAA 4OOEA 2PD6A 4IMRA 2NACA 2Z1NA 1SPXA 4TRJA 3ZHXA 2E37A 2WYUA 3ANNA 3CMMA 4IZIA 4MKRA 4R1NA 4JBGA 4BGEA 3I23A 4CMEC 4U7WA 3INRA 3SEFA 4XDYA 1EDOA 4D0SA 3H4VA 3GR6A 2X5OA 4CV0A 4HKTA 4QFDA 5C7IO 1M2WA 1U7HA 1KC1A 3DZFA 4QX6A 1OMOA 3TOXA 3FHLA 4NG5A 1JWBB 2HMUA 4KWIA 3HADA 4O0LA 1X7DA 3GG9A 4IDDA 1YVEI 2PNFA 4RVHA 4RCVA 4YA6A 1GTMA 3VVBA 3ZW9A 2UUPA 3W4KA 5IF3A 1OOEA 2ZQYA 1E7SA 5THKA 3BHJA 3LT4A 4CV3A 4XYLA 3V2HA 2EXXA 5B4TA 4CLDA 2C07A 3RI3A 4CMCA 1K0UA 5L53A 3B1FA 3SVTA 1ZJYA 5K6AA 1RPNA 4FFNA 2ZKLA 4OHUA 4PZEA 1B0AA 3DAGA 1Q7CA 2FPPA 3AUAA 3PHIA 3KYDA 4IDAA 2VUSA 2FZWA 3RSHA 3C7CB 4FSHA 5T57A 4BKQA 1G0NA 4HP8A 2GLXA 1AHIA 4MP6A 4OQZA 1A9ZA 4RPHA 3LSYA 4FIZA 3RVDA 1E3EA 4B4OA 1W0CA 3E48A 4NFHA 5BSEA 4CLEA 3DXFA 3TZCA 1A7KA 2A35A 3WB9A 3G3EA 1Q2XA 1NVGA 1SB9A 4HFNA 5ICSA 1GQ2A 2C5AA 3GRKA 2J3JA 4B4WA 2X5JO 2JCXA 2E48A 2X1HA 4KUEA 2OOSA 4O59O 3OIDA 4IDCA 3P19A 1HSOA 1YGYA 3UHAA 2Y67A 3D4PA 2V6FA 2NNLD 1NQOA 3HE3A 4E2XA 4D46A 5ENVA 2B4RO 2CDCA 2QRKA 3N74A 3LLSA 4ALJA 1BHSA 4U8GA 3GVPA 5I9LA 4F45A 4II2A 4BO6A 7MDHA 3OIFA 4LRTB 4E2WA 4BMVA 3V2UA 1XU7A 1QMGA 3DOJA 5AQ1A 4Q9NA 2IZ1A 2X5KO 3LF2A 2VYNA 3PHJA 5ES3A 1W6UA 2I66A 3JD2A 4XA8A 2ZB3A 1FDUA 4E30A 5K6AC 1E77A 4OL9A 5T8KA 4BO9A 3MOIA 4I8XA 5CG1A 4B7XA 4DPMA 2X0RA 3O38A 4FS3A 5HWSA 2PGDA 2JFFA 2B35A 3FCOA 1T25A 3I4CA 4M49A 4ZHSA 1HXHA 4BNIA 1GV0A 2HMVA 3F46A 3GPIA 2GR9A 4DLBA 1V0JA 4ZD6A 1SO8A 3EW7A 4EW6A 4MDHA 1XWFA 1LC3A 3LC2O 3OMLA 5A3JA 3W6UA 1PJSA 4J43A 4AJPA 1C0KA 1YL6A 4BNXA 3MWDB 5EQFA 1DFIA 1G1AA 1J6UA 4PCVA 4EUEA 4WUVA 1HF3A 4ZQFA 3T7EA 1O8CA 3CSDA 2NADA 5H81A 1QYDA 2PZJA 1DPGA 1LSUA 3NTRA 1DFHA 3WXBA 2O23A 2Q1WA 4JQCA 4CMJA 1LLDA 3NRCA 3GAZA 2OL4A 3KYBA 4BIIA 4YQZA 5JO9A 3H8VA 4W4TA 1YDWA 4CM9A 3FPLA 1CERA 4FOOA 3LVFO 5AVOA 1EE9A 3GUCA 1A9YA 5DP1A 4J90A 4PLTA 1K6JA 3SJ7A 3EGOA 4WLNA 1R4MA 5LCXA 5THQA 5A02A 1E0DA 1UJMA 4WEOA 5HM8A 4AJLA 1JW9B 4KTTE 5C7LO 5A04A 3H9QA 4EJMA 1UXHA 1TT7A 2LDBA 3PJFA 5EPOA 4OH1A 4WLFA 1GQQA 1PGOA 1Z74A 2NV6A 1DOHA 1BDBA 3VTZA 4B7CA 1BDMA 2I99A 2P5YA 3E6AA 5T8KC 2O3QA 4XYEA 2NU7A 4EI2A 1PJQA 2OORA 3A28A 4WJZA 4EEZA 4BB6A 3NKLA 5L3ZA 6LDHA 2HRBA 1KC3A 4YRBA 5LDHA 3WIDA 1EBUA 1VC2A 1LSOA 3LT2A 1LEHA 3ZNOA 2Q2WA 3DHYA 3HUDA 1HTBA 1MLDA 1ISFA 2WE7A 5G0UA 3ZWPA 3HDYA 2O3SA 2X4GA 3FR8A 5G0SA 4XJSA 4NH4A 1C14A 5JPIA 3H3FA 5DBGA 3QIVA 3B20A 3B70A 1UP6A 1GU7A 3TOZA 4LRSB 1RYEA 1PZEA 2UAGA 3CMCO 1YJ8A 2YW9A 2O3UA 3DR3A 4IIVA 1VE9A 3ITKA 4YRDA 5L7YA 4EBFA 1VJTA 5ADHA 1U4SA 2DTDA 1Q0QA 3GEMA 4OOFA 4PLFA 3VKUA 3RJ9A 2Q49A 1Q0HA 2OZPA 4E4YA 5A9SB 5B12A 1U5CA 3JYLA 4J49A 1PZGA 2EF1A 3DMTC 2BGKA 3L77A 3S1LA 2DPHA 1ZUD1 4YTEA 4AL4A 2PD3A 4E33A 2Q1SA 3AFMA 1GV1A 2Y1EA 3MJSA 3AI3A 5TC4A 1EEHA 2B0JA 4GVXA 1HEUA 1LUAA 2GERA 3M6IA 4BNHA 4D3SA 4OGWA 2RIRA 3DO5A 1PS9A 3E5RA 3O9ZA 1T4BA 4BNGA 2A92A 5KTKA 2YHUA 4NBUA 4F6LA 2G5CA 3MZ0A 3H9JA 4QUKA 3BMCB 4B79A 1UXKA 2XF8A 1IL0A 3KSDO 1WNTA 1JU9A 1ZKMA 4N54A 1BVUA 1NX6A 2I76A 2QQ5A 3JQ6A 4PG8A 4K26A 1PGNA 3ZU5A 4D43A 3GHHA 3PIDA 3DBRB 3PZRA 2O2SA 2IDZA 1E1LA 1WZEA 4PZDA 4YAKA 1XYGA 1IZ0A 4L4RA 2PH5A 3RC2A 3U4DA 1M76A 1LLQA 3I9JA 4NBWA 4J1QA 4BKOA 3I6IA 1VI2A 1BXGB 3EDMA 4DBZA 1LX6A 3AUTA 3W6ZA 3S2EA 1HZZA 2GCGA 4ALLA 4RO0A 1YDEA 1ISIA 2VOJA 4FFMA 3PJGA 5DN9A 3WGZA 4DUPA 3VPGA 2CZCA 4MOWA 4NIMA 2ZYGA 1I3KA 1ZW1A 5COBA 4J16A 3V1YA 1PGJA 3WGOA 1PJCA 4K9DA 1F8FA 2PZMA 2YZ7A 5ITVA 2JD0A 2FSVA 5KWEA 2BELA 2EERA 1WDKA 3RUIA 5A9SA 1ARZA 2HJRA 3WQSB 1V3UA 4OYRA 1I3MA 4U6QA 4E5KA 4A26A 4I9HA 3NT2A 4DC1A 4G5HA 3WWZA 4LVCA 1I2ZA 1M67A 1ZCJA 3ROQA 5JMWA 1PZFA 1MG0A 1ID1A 3OQBA 2QX7A 4DVJA 2AG5A 1IULA 2GN8A 1OC4A 3N7UA 4MKZA 4NJMA 5EERA 5GZ3A 4MP3A 3ZHZA 3PP8A 3DC2A 2VRCD 4IDGA 3CZMA 1BSVA 5JDIC 5KCZA 2YV1A 3C85A 2A4KA 1P1RA 1ENYA 2J5KA 3BMCA 3LC1O 2VUTA 1PX0A 1FDTA 4Y98A 2PY6A 4D41A 4BNKA 3H2SA 3GA0A 3PPIA 3ROKA 1QV6A 2O7QA 1V3TA 4E13A 1O0SA 3WMXA 3QWFA 1DIRA 4YJDA 1DC3A 1QYVA 3DHNA 3ASUA 4QSMA 4J1TA 1N1EA 4ROSA 4NR0A 1IB6A 4E32A 2O4CA 2HQ1A 4J7XA 2VT3A 1JKFA 4CODB 5L4LA 2WYWA 2POQX 2B83A 2VRBA 2B69A 3OM9A 2PZLA 3D64A 1YONA 4D0RA 3JYQA 1QLHA 3FNEA 1T1RA 4YJFA 2PKQO 1LI4A 3CTMA 4FFRA 4BNZA 1ZK2A 9LDTA 1JVBA 1P1IA 4L8VA 1SAYA 2Q1UA 3ZWNA 4RGBA 4R3NA 1WXDA 1HDYA 1N9GB 1GZ3A 2X9NA 3LT1A 1GFSA 1V35A 1TXGA 1ZK0A 2IXBA 3A4VA 4LMRA 1E7MA 4P8RA 5I8ZA 4JP2A 1K6XA 2C0CA 5KKCA 4MP8A 3WJ7A 1EE2A 4ZRNA 4WPGA 4DQUA 5A1TA 3FI9A 4W82A 1TLTA 3R6DA 3K31A 3UFXA 4NI5A 3WBFA 4XEHA 5FWNA 5CPBA 3NT5A 2D5CA 5I9MA 2VTDA 3RWBA 4E31A 2BFAA 4JLWA 1KS9A 4B4UA 3G1UA 1GQYA 3RU7A 3UW3A 2R6JA 4FJ0A 5KIAA 2J6IA 1UXGA 1C3VA 2JKVA 3KLPX 5JAMA
chains in the Genus database with same CATH superfamily
3B1ZA 2UVPA 3OSUA 5EI5A 3EB9A 4HEA1 4DIBA 2LTAA 4X3CA 2A5GA 4RZ3A 5DNVA 4C1NA 2VWHA 4P86A 1KGDA 1OXKB 1IH8A 2GBIA 1U2TA 2IXDA 1G16A 2BMAA 4K6MA 4QJ5A 2QPOA 2RG1A 1UJ5A 3PYMA 1X1AA 2VJNA 3ZHYA 2NWQA 3K2EA 3DBHB 1VLQA 1U2PA 3LPMA 2QTVA 4JL8A 2INGX 4RH0A 4KZKA 3QEJA 5TQ2B 1MOSA 2YW2A 4YAJA 2ZBFA 2PKQP 4LPKA 5D87A 1YDGA 3WA6A 1IZYA 3EAQA 1O97D 4JX8A 1D09A 1R0RE 1W4CA 1U7DA 2HQBA 2UZ1A 3DFFA 3NWPA 3QP9A 2BP7A 1A95A 2GSWA 3S6JA 2PFGA 1OBCA 1WPRA 4N03A 1P19A 4UMVA 4LQDA 2PWAA 1FYDA 5HK8A 2BMVA 3U4HA 1IM5A 4HF7A 4RD0A 1MAHA 4E6PA 3RFVA 2ZB4A 1N9GA 1ECJA 3NWJA 1D4ZA 2EX0A 5IDYA 1QIJA 5LPNA 4GICA 3QTLA 2QJTA 3VH4A 1ZEJA 3QVOA 3E5HA 4X91A 3PFHA 3KKZA 4PXYA 1VM6A 4PVCA 5AM3A 1JFTA 5ICFA 5ICEA 1NTOA 4AC9A 4YT2A 3KZXA 2ONZA 2FWAA 1RKUA 2OFXA 1W36B 4URWR 5FYDA 1A5ZA 1NT4A 5DVZA 1Q20A 4LSMA 3ZN2A 1D5CA 2QUZA 2XNDD 3MJFA 4ZV4A 2IEZA 2DFDA 3NIDB 1K3UB 5M7EA 3AETB 2GZAA 3FUCA 4KPFC 1ODLA 1QOZA 4QFBA 3DGFC 1F6DA 1JEQB 1YE5A 2FOIA 1W0JD 2GHRA 2WD9A 1Y8ZA 1IHUA 3H75A 1M8JA 2AJTA 3QNWA 4IF6A 2Z4TA 4MPDA 4RHEA 1F2UA 2FX2A 1CUFA 4QQ8A 1ISPA 2W6MA 3K15A 1Z63A 3UAYA 1TYCA 1RAIA 1HE5A 1OPXA 1CF2O 4I55F 4JCCA 1JVSA 2JKZA 2RFLA 4L0QA 3L7IA 3O73A 1G5HA 2AKEA 1IG0A 2PUWA 2H1LA 2WB4A 5IKXA 2WDPA 1E18A 4JLVA 4C3OB 1P0IA 4PGAA 3QNUA 4J7CA 2HBZA 3DQZA 1Q0RA 4GM4A 3EVDA 2XZTA 1AKMA 4OGGA 5A7HA 3FGNA 3T5MA 4EUHA 3TO5A 3BD6A 2LZ0A 4RK0A 4O4JB 2B8JA 1DRJA 2IX9A 2QQ0A 1VQ1A 3JQGA 3QHAA 1ORRA 5NULA 5D01A 4M2LA 1NZDA 1E94E 2JGJA 1Y5MA 3Q0IA 1DBRA 3LYUA 4HDRB 5MFZA 4AIRA 3FPHA 4RL4A 3UUGA 2WM8A 5JOQA 4IAOA 4K7JA 1HFWA 3I73A 1TYAE 1NFQA 2FW1A 1Q1AA 1VL5A 4XQCA 3E2IA 3RYCA 5DHFA 5LQJA 1ODKA 3IO5A 4I5GA 3JQ8B 5SYNA 3VPHA 2GZ1A 5JANA 1YBAA 5C46F 1FLNA 3E9RA 4DABA 4AJ1A 4EVQA 2DKNA 3U16A 2REQA 3R3HA 1SKQA 1SUFA 1EJ2A 3ZXUB 3FPGA 5IT9A 5CGZA 4YP5A 5SZHB 2WQ7A 4L51A 1P33A 3NDIA 1U0RA 1B3BA 2GKGA 2RHMA 2CBXA 4NCBA 5ITZB 1NU6A 2FPXA 1O2DA 5CU7A 5CVJA 3NWBA 4ESVA 3CFYA 2FI1A 1JKIA 4YCAA 1QIEA 4HB4A 3OX3A 3NFRA 1QRDA 4Q3DA 1Y1TA 3ERCA 4REQA 1OILA 1KVSA 1M8PA 1T0UA 5E2IA 3ROGA 3EIEA 3FLAA 3HVJA 1RAFA 2ETXA 4GR5A 4D3DA 1F2VA 1WUKS 1PT5A 3JSXA 3PIIA 4DCGA 3QVMA 5EJAA 3ZDQA 4OMUA 1USUA 4GZ5A 2QMHA 2AV6A 5GVSA 2QZ9A 3E9YA 3IBFA 1ZVQA 5AW7A 4KXXA 3DZKA 5D3MB 2AE2A 3R9WA 4M8IA 3D4NA 1FP1D 3CX8A 3W8DA 4GX1A 1SQ5A 5IWAB 4NCNA 4LFCB 4R4JA 1ZD4A 2OBBA 2GZ2A 1A5AB 2NUTB 3BSYA 3EEBA 1KRHA 2FEPA 4LUCA 1P75A 3QGMA 3HYRA 1ZISA 2VNSA 5B7GA 5JVDA 3RT1A 1WRBA 1EM8B 2CBGA 2C29D 3RSCA 5EXDA 1SH7A 1LPMA 4KFRA 4IUBS 4YDRA 3RD5A 4BO7A 4RJLA 1D6JA 4OXRA 5HGJA 3QWIA 1LQTA 3FD8A 1OFGA 2G67A 4NC9A 2R96A 4HGRA 5LYJF 3GWGA 5FLEX 3DHEA 1GKIA 4TGLA 1RM5A 1ODIA 2B4YA 3DW3X 5FTNA 4DLYA 4NU6A 3T8YA 4C4AA 3I04M 3D81A 1AUOA 2RGWA 4Q4AA 5J59A 1FB5A 1Z9BA 3JXEA 3ONWA 4QKQA 3NIFB 4LBVA 4WEQA 2RGUA 3TBKA 2VNKA 5BO5A 3TZQA 1M5RA 1MQSA 4UDXX 4ARSA 3SBEA 1G7RA 3R5FA 3M4ZA 3A7DA 5BSTA 4FR5A 4B0OA 4NATA 3OTGA 1T5TA 3EOBI 5AIBA 4RULA 4CQLB 3CHYA 2VK2A 5AW8A 2VSOA 1JLHA 2YYYA 1MB4A 5K0LA 4DG8A 1YHYA 1RMQA 4RKYA 4LNAA 4Q00A 2P0EA 3H19A 6ABPA 4EYQA 3FVRA 4MMXB 1TYZA 4ZCPA 1GD1O 1W5TA 5FPQA 4DNQA 1JIKA 4B2PA 3ANLA 4P3PA 1PVVA 2OHHA 4F8JA 2BPOA 2WD7A 2BCJQ 3AU8A 4U7TB 3WMEA 2ADOA 3OZDA 4JNCA 4CMGA 4LGCA 5KX5A 3PGVA 2QSUA 2VSNA 4B76A 1NMQA 4KAXA 4NPHA 1POXA 2IIPA 5COQA 3NTLA 1LNQA 3DBIA 4GPTA 4DA6A 2JHPA 4PR3A 3V4LA 2GWRA 1UKYA 4LVNA 3F98A 5MHTA 4IIFA 1F8UA 2XXJA 1DBVO 1M1UA 2QX8A 5GM2A 3I8XA 3WL6A 2FOLA 2I29A 3DEKA 1ESZA 2PIAA 2ZIWB 4QYSA 1W5BA 1EUDB 4GQBA 1CU1A 1N92A 1L8QA 1RPZA 1AKEA 1TVEA 2RK6A 4ADSG 1ZGBA 2K6GA 4MWOA 3U31A 1K75A 3LVRE 4CM7A 1K3FA 3NJ8A 2PXXA 2XWPA 4N5HX 1KKUA 3I45A 3CEAA 2H63A 1OX4B 5IDXA 2PM8A 4OXYA 5B36A 3G9ZA 1NVMB 2WRZA 4GRAA 1Q0LA 4MI3A 4IGEA 4EG5A 4LDZA 3QPAA 3S4YA 2ZM5A 1DWQA 5KC8A 4RPKA 1P2FA 3DOEA 5KYYB 1VMKA 2QNIA 2H08A 3T9BA 5JC1A 3BK2A 1WUHS 3GO4A 1A7AA 4XGNA 2GXAA 1G21E 3C6BA 1L3IA 1TT5A 3GQBA 4BZQA 2XWJI 2KMLA 1VCIA 3P9NA 3MLEA 1C1DB 2PJZA 1MRSA 1SM4A 1TQ4A 1MC5A 2CXUA 3KKKA 3KUXA 4CUJA 4UASA 3K0SA 3WZMA 2VP9A 4N3AA 1M6EX 2FZ4A 3PVCA 5LC1A 2RHWA 3TJRA 1UPCA 1XV5A 2X58A 1G8SA 1W0JA 4ZOBA 1CHNA 2Z08A 1EHIA 3FLBA 4JUAA 1NIJA 3K2QA 1SELA 1ZSNA 2BD0A 2ZWPA 3RVQA 1JYSA 3OO1A 2GYUA 2X40A 1Y89A 1ABBA 2NQ2C 3TW0A 4E4RA 2H92A 3EA0A 3IVXA 1V9LA 4DMHA 4DL9A 3AW8A 4CIVA 1XVLA 2FSHA 2VP4A 3JAWB 4TL7A 4RXUA 3SQOA 3L7AA 4TKMA 3D4IA 4X8HA 3I9MA 3LPAA 5KUTA 3DZGA 4TXLA 5A2GA 3D6FA 2A57A 3ZE7A 3M0EA 2JBAA 2R8OA 3DL4A 1LXCA 5BR1A 2BFCB 1I1QB 1Z2OX 5EHNA 1NPTO 2EG5A 3UGKA 5CDGA 1O97C 3FPJA 3PITA 4KX5A 2P79A 2M32A 4I9UA 3B52X 5ALZA 4RVCA 4XR4A 1YQDA 1NKTA 4WZAA 2BHRA 2Y0BA 4DC9A 1Y4DE 2G0AA 4MPJA 3TQOA 4OHPA 4IICA 5CAEB 4DRZA 4PVDA 1BYUA 1RAGA 3CX7A 5FUMA 1NDHA 1PW7A 2I6TA 4IIJF 4ER7A 1OH7A 4ND1A 4CQMD 2UXBB 1ATZA 3K2IA 3LRPA 4N0QA 1QU3A 2H1SA 1CRLA 1FTGA 1X77A 1XCMA 2JGLA 2JHAA 5KYXB 3IMFA 2ECOA 4WRRA 1VA4A 1R27A 2E6KA 1EJBA 3NTQA 2BJVA 1YOBA 2H5EA 2O0JA 4GWKA 3HM2A 4XD2A 3NANA 4OM8A 2C3UA 4XGIA 4J0HA 1T2DA 5JAUA 4NABA 1FFYA 4Q01A 2B92A 4HTFB 2C9ZA 1IZ7A 2J9FB 4KXWA 4TYWA 4YCSA 2FAXA 3NGLA 5KS2A 3PUZA 4FR2A 3FHOA 4P5DA 4AS1A 4IJWA 5H3LA 2XT9A 3IR5A 2EKZA 2HYIC 1PD1A 1VSVA 2FA9A 3ZXYA 4MW0A 5E7QA 4F84A 4MQEA 1GKKA 1MO2A 3PKZA 4MUNA 3ZX4A 3CH4B 4IILA 4C0BA 5G0VA 1U90A 3I5XA 1DL5A 2BEUB 4PQGA 4PIVA 1F6BA 4A36A 3FDZB 4NXMB 1YF3A 3DNFA 3VH1A 4FFDA 4M98A 4F97A 3ZJVA 5GOZA 2Z9CA 3E82A 4L15A 4RDCA 6YASA 3IJRA 1BHJA 1N25A 4ZOQI 1H94A 3WP0A 2OUIA 1X1BA 1FTSA 2X2EA 2JJ1D 4L8WB 1Y37A 4TXMA 4UCFA 5IC6A 5JTTA 4LF8B 4LF9B 3F6CA 3DAFA 3DXYA 1BWPA 1L4MA 1MOZA 3LPNA 2YOHA 2EKDA 4RANA 4BEVA 1PJAA 3ZH9B 4DQVA 4MVJA 2AQKA 1CQZA 5TNXA 1KR5A 1N3LA 2O50A 4RD3A 1DI0A 1ESNA 4LXTA 2NP7A 2OBNA 3QFTA 4BC0A 2YXLA 3RYHB 1XX6A 1SN7A 4O2AA 1KMMA 3TINA 1V3VA 2R66A 5IANA 2H2AA 4GLFA 5FWXB 1FE8A 1SWWA 2BGWA 1CRPA 3DC7A 2A9FA 4M9ZA 1JHQA 4BU0A 4NDNE 16PKA 2IHZA 4M46A 3AKDA 3F4LA 3CB2A 3PXUA 3RRZA 2AMYA 3OJEA 1JIQA 2BFDA 1IAVA 3AR8A 4EG7A 1U8FO 4HGZA 2ZU6A 3KQSA 4KEAA 5DM1A 3RSFA 4OSPA 3RB8A 4RLQA 2VFAA 1QS0B 2BGIA 2NVBA 3L7JA 1NVBA 2O1XA 5IJ9A 3UTCA 3CXUA 4YAIA 2A1TS 1RYMA 3RKUA 1UBCA 2JS7A 2GBLA 5AHWA 1ISSA 3M2TA 3THSA 4FJ2A 4MUYA 3RQSA 1X7WB 1QAQA 3VJKA 2YFYA 2Z5VA 2AWNA 1CYDA 4GM0A 3VR5H 3BPSA 2VT7A 3IPAA 5CFRA 1N3BA 3AY6A 1FUKA 2WNIA 4G8DA 2A58A 2XIQA 1P1FA 4MLPA 1A4UA 3NOQA 7YASA 1QU2A 1HL3A 1N5OX 2DFNA 3EHDA 3RIMA 3ED1A 5T6MA 4HS4A 2Q3BA 3CEPB 3PUXA 4J76A 3HU2A 3L6DA 1R4AA 3QQPA 1M1YE 4PZLA 1R6VA 4A6XA 1MEOA 1L4BA 1QTIA 3DMTA 3I6ZA 4I1OA 4QUAA 5IK2A 4AZ0A 1BDHA 4FFSA 4WBSA 3TNDA 3QXXA 5H9WA 4EECA 1J00A 5A05A 1EVYA 1ZR4A 1G66A 2XWQA 1XLTC 1RM4A 2ZUTA 4EFNA 2CZGA 1NI4B 3ZX5A 3HJUA 3T5AA 4QRDA 2OAEA 5HBGA 4TRNA 4DR3B 2GYWA 4LKOA 4DMCA 3PICA 3MINA 3MJRA 5JJKA 3WBKA 1NN1A 4OK5A 2NVUA 2HK6A 1J2YA 3CN7A 5JLAA 1J8MF 2IYQA 2YYSA 1E3LA 3CEJA 3U48A 4NV1A 1VBFA 2DUMA 3CRMA 3F1LA 4HBGA 2XKBA 1MV5A 3FPBA 1S6YA 1TCVA 2DXIA 4NX2A 1IQ0A 1G3IA 1H5NA 2WF5A 1P2GA 5GV8A 2Q6LA 3WYAA 4YBRA 3QBVA 1L7BA 2OE2A 3IAHA 3GBSA 4GGPA 2WMOB 3JQ7A 1BC5A 5AM1A 1M9NA 4BJ3A 5LB2A 1NDUA 1V5FA 1LZKA 3FVWA 3PCXA 4LOLA 5KJEA 3VVMA 3E23A 5BYBA 4X1KA 3KD3A 2GBLC 5EZYB 5EE5B 3IEXA 1V8FA 2ZITA 4US0R 4DA7A 2JW5A 4MVJG 5C5IA 3Q9SA 1G7CA 5L7TA 2P8JA 3TLCA 1GQRA 1O94A 1P44A 3DXXA 3HDHA 1U3VA 1S2OA 2PSHA 4RK1A 1J0BA 1WKVA 2H4JA 1KQFA 1RZRD 4XUDA 4AY3A 3I0ZA 2PGXA 5DCYA 1RHRA 2KQUA 3R0QA 1J5PA 2OYRA 2QRZA 3ZGVA 4UM9B 5I7OA 3AF0A 4FGLA 1EXMA 3SY8A 1A82A 5JWHA 3VZDA 4K6HA 2NQ8A 4NYJR 5FULA 3LXUX 2VPZA 2IYZA 3FF1A 3C5HA 3KKLA 4HY3A 4LRYA 1SUSA 2B61A 4UVHA 4EA6A 3A9RA 5F51A 2YWHA 2P5TB 3AH8A 4E0BA 3KPVA 4KLZA 1WL8A 2ZZNA 3KETA 2VC2B 2OQRA 5ALKA 4JXKA 3FR7A 1OCEA 2C0PA 1F12A 3R3ZA 3OCZA 4BVLA 1W0KD 1YOVB 2O2XA 1HLDA 2C9OA 3ZR4B 3AUUA 3IE0A 4PLYA 5AMXA 2GH1A 5JYDA 1RWWA 1ZSYA 2UV8A 4TWZA 4DADA 5JS6A 5DN6A 4A92A 1Y1QA 1VG9B 1C4XA 1Z56C 3B38A 3GQVA 3V4ZA 4BWGA 2SHKA 1HDXA 1M54A 2H5LA 3DFMA 2IWHA 3QFSA 1KVUA 2J0SA 5BQ3A 2CYAA 1M2OB 2IP4A 1TADA 2I4MA 4X97A 1WETA 2IOYA 3WIVA 5DE3A 2JJ2D 5F5XA 1SKAA 5K0GA 3EYWA 4FCCA 4NU5A 3T3PB 3UWDA 1C4OA 1PSWA 1F2DA 2HJHA 3F8SA 3MAJA 4GL2A 4DQXA 2H52A 1NVFA 4MUFA 3ZI7A 3QEKA 4FYMA 2ROQA 4ISCA 1H8EA 3Q9NA 4TTAA 1A9QA 3BRSA 3CLSD 4LY9A 3RHFA 1PL7A 3HO1A 2XUAA 2ZRMA 1FPMA 1K2WA 1TM7E 2AFIB 2F9FA 3AFGA 3AONB 5F9MA 4BLWA 3N2LA 3SVZA 3EUAA 3UJ7A 4YYEA 3KL2A 4BB0A 3JWPA 5ADUS 3WR5A 1K5HA 4TL9A 1LV7A 2NU8A 2WZBA 1XEAA 1IPEA 4G65A 3LCJA 4UEQA 3AW9A 1ZD2P 1O94C 1TMYA 4I3FA 4KI7A 3H8JA 2HIMA 3NH6A 5GOTA 2VHWA 4G1VA 3ZEAA 1U0NA 2YJ3A 1BKYA 1CXZA 2ZB2A 1A97A 4OQ4A 3ILXA 4J4BA 4UW9A 4JJ4A 3U80A 4F56A 1PG2A 3JQDA 1ISJA 2QENA 1B14A 1RBQA 2PO5A 4X45A 1Z6XA 2CVPA 4CM8B 2XE6A 3BWXA 4BVEA 1KP9A 4G9BA 3ZS9A 2WAMA 2PLAA 1SZJG 4AS2A 3U9SA 3H5TA 3HDGA 1R5NA 1SU7A 1DDIA 2XVXA 4EPYA 3OQIB 4DCJA 4JBNA 4EY3A 4NF2A 1QC5B 3KXDA 3WZ2A 2XTZA 1BW9B 3DL7A 3D7SA 3HKBA 3KEFA 2IS4A 3NIWA 1E9AA 4YBZA 2EZ8A 2NLOA 3FCYA 1JDUA 4M1SA 1QVWA 4BLQA 3LLUA 1HE1C 4NK5A 1R6AA 3BMOB 4R54A 3UMGA 1KJ9A 1WXWA 5DCLA 1XCBA 4KTVE 2V0NA 4ME6A 4RY8A 4DM4A 2D5AA 3TIXB 2GTIA 3OBIA 5K4AA 3GFGA 3B12A 1Y6GA 2F00A 1QFYA 1VIYA 5KJFA 5CHYA 3ZUPA 1L1EA 5B55A 3CPEA 4FQ7A 1E2DA 1JEYB 5C1OA 1M5UA 4HO1X 5P8WA 1F38A 3IIEA 3TNLA 3QU9A 4DWJA 3QPDA 3P2YA 4YO7A 2RC6A 3P96A 1QH1A 4M7PA 3KFVA 1Z28A 1ULUA 1XWWA 2I7VA 3BGDA 4QDXA 3MQFA 4QT0A 3R74A 4RTKA 2BE9A 3IUSA 1SVOA 3JQCA 1G8HA 2R3SA 2XQVA 4IIYA 2R6DA 2HO5A 5A4KA 2NXEA 2PJRA 1E8DA 4BFYA 2HHAA 3KYCB 4IQFA 5AXAA 4HDMB 4AECA 3AR2A 4CCYB 3M6AA 3UY4A 2C7GA 3UC9A 5CB6A 4EVSA 4J91A 3L6RA 1A04A 1CEQA 2QMOA 2QJRA 1TEHA 4ZFNA 4ZO6A 2RI6A 3DDZX 1V7ZA 4B73A 4LRQA 1ZM4A 2W8ZA 3EBLA 4CF5A 4J1SA 1DRUA 5JY6A 4KBFA 3Q5DA 4E4TA 1YVPA 2IV7A 1DKRA 2QTRA 3GRYA 3ZK7A 1V5IA 3PF8A 2DBQA 4LQ4A 3IERA 3H1AA 4UVEA 4ALKA 5CEEA 4S04A 1SCDA 2QQFA 2XBUA 3BJZA 1YBMA 3RFCA 3SZLA 3BK7A 1ZI6A 2GJ8A 5DT2A 3I1IA 3RTGA 5HZGA 3D6HA 1X80A 1N77A 2Q21A 4G0MA 1CUCA 3MQ4A 3PLRA 5K0TA 3FKQA 3LFTA 3W6OA 1N32B 2DSNA 3VO1A 2EJTA 3LY7A 3ADCA 1B6TA 1IUKA 1GUYA 1NUUA 1FFWA 3OF5A 1L1QA 2R87A 1R9NA 2XMSA 2PR2A 1VYUA 4GMDA 1XAJA 1ILWA 2HMSA 5DH9A 2ZJ3A 2F64A 3KT6A 4ZU1X 4K28A 4Q66C 2HAEA 1KEZA 3NM4A 1ZAKA 1LFAA 1XP5A 1B0ZA 3NHZA 3R8XA 2JI7A 4B7UA 1OZ0A 3Q9LA 1PL6A 2ZVDA 4B74A 1KI6B 3NX4A 1GTSA 2GD0A 4PYQA 1BROA 5M2QA 1LWOA 4KR9A 4ZO4A 2JH9A 3C41J 4QJ4A 3ZV5A 1CFJA 3SD7A 1XVIA 1ULTA 4WLEA 3WYNA 1OWPA 3BA1A 5AW3A 1D2AA 1JLKA 5I9BA 4ZQHA 3SC4A 4DNFA 2Z30A 2RHJA 1QHHA 1UKCA 3M1IA 1DS6A 3P5SA 3PUHA 4K9PA 4L4ZA 4QGBA 4RWEA 1L7NA 5JXGA 2SNIE 3MWEB 2IEAA 3QE4A 4ZVTA 1NLYA 4AF8A 4JVNA 3NHUA 4B35A 2ZOSA 4G07A 2DERA 4A9AA 4HPJB 2R7NA 4R8MA 4KXLA 3WGLA 3QIAA 2ZGVA 4X1OA 1VCHA 4C7KA 4ZQGA 1KY4A 4GX2A 1JIIA 1EVKA 2HFJA 1Y6QA 3WLPA 2FMUA 3LBIA 3SICE 4DY4A 4YP0A 4EG4A 3IP7A 1Y48E 1W35A 2Q9CA 4ZAZA 1PVDA 3HB9A 2J9YB 3ZKWB 1QZXA 1RRFA 3BD9A 1NN5A 2IPMA 3B8EA 5FOSA 2WJVA 3A9UA 3EQZA 4L9WA 2W6ZA 4KYUA 4C29A 2JLQA 1R5BA 1R37A 3JYNA 1R66A 5CA1F 3COWA 1QGED 3T9CA 5KU1A 1OGYA 3N58A 621PA 2YS7A 2NU9B 2Y6VA 1NN0A 3LU1A 2FW6A 5A03A 3JYHA 3UMMA 3FCSB 4Q7KA 3SC6A 2OWEA 2ZULA 3A06A 3I1YA 2H4WA 2HXSA 2NSDA 2QX4A 1V8PA 3D3WB 3HEBA 3HKCA 3KAKA 1WIWA 4PG6A 3U37A 4PNPA 4WBNF 4AY6A 1H3NA 3PRJA 1CVRA 2I3GA 5AVJA 1LS1A 5DM70 4GR4A 4JQZA 3SMQA 2V7UA 4ID9A 2DFTA 3IBGA 1DLIA 3GCWA 1WQ4A 1ONBA 3FBTA 1B15A 4EGJA 1PFQA 3F6SA 1SZCA 2ZM6B 1ULAA 1YS9A 1QOQB 2H7XA 1AO0A 2IE0A 1L5SA 5LBUA 2IPNA 1G3MA 1WZCA 2ATXA 4NFSA 1SVSA 3G79A 1R7RA 2D2VA 3HFGA 5GONB 5BRAA 5TV2A 5AW4A 4MIEA 4AWBA 3K9GA 1MMFB 1OAKA 1RZVA 5E6SA 2B34A 2DJ5A 3G8CA 1L5HB 1ZL0A 3PNVA 1EUZA 3L6CA 1G8YA 1CD5A 2XYRA 4IR7A 5TQ2A 4UTVA 5JNLA 1DFGA 4DG5A 4EI9A 4DLWA 3BCHA 1BXRB 5HP4A 5A5VA 1JQJC 3U5ZB 4QUDA 4Z8XA 3RV4A 3ZCPA 3DLBA 1OKKD 1FQWA 4JELA 2J6HA 2P9GA 1G18A 5BOSB 5DLQC 3RREA 4B2LA 3L93A 3F3MA 5A5GA 3BIXA 4TL6A 4F5DA 3VJMA 4QG7A 5MN5A 4BB5A 2H4HA 3H0EA 5JBIA 3D3QA 3H9CA 1EVQA 1GGMA 1RJWA 3HFSA 4PGGA 4B6EA 3OD5A 5MF6A 4HDCA 1AB5A 4JKYA 3RSZA 1GYPA 4NBLA 4U39A 1SCKA 1SVKA 4TRRA 1AX9A 1OT5A 2O2HA 1SCIA 1S7CA 2Q28A 1Z47A 2XUZA 1EWKA 3DPIA 2VDPB 3L7MA 4MR7B 2P91A 1VMAA 4QDKA 4UBOA 5TSDA 3MSCA 3OPYA 2JGEA 1PO7A 4CVNA 5F52A 3ZCXA 4IS3A 1XTQA 2HHLA 5HDQA 3F2VA 4HLNA 5CDFE 2P6PA 5ELXA 4AJ2A 3P32A 1YZTA 2B36A 2RGAA 2VDWB 4ZDJA 2YFKA 2W5UA 2YIMA 2DMRA 1HZJA 2FGKA 1XMQB 2WFLA 3LV8A 2EBWA 4R1QA 5DYWA 1KP3A 4MHOA 2NZ2A 4UKDA 3N8GA 5CFOA 2R0QC 4HZUA 1PT9A 2O3JA 2WYVA 1LF5A 1NR1A 5C32A 2XMGA 4RTLA 3A6EA 5ALHA 3UJ9A 3KO8A 5JNSA 1ZGZA 1K7FB 4Y0NA 2IEIA 2PA0A 2O2EA 1GA4A 3FY4A 2ZAIA 2Y1DA 4XRGA 3LL4A 1XNJA 4W9NC 5A0VA 2ZYSA 4JXJA 1WMSA 3W06A 4QO7A 4WK0B 3A37A 3NTOA 5T4HA 1YJBA 3OZBA 3WGKA 1UANA 3GN2A 4ZAGA 4HGOA 5H4GA 4DIKA 3H1PA 1QB8A 2DHCA 4ARZB 2QA5A 3QE9Y 3O4FA 5J58A 2IZ0A 3RRBA 1UDBA 1HLGA 2OENG 5I5GA 3ZI0A 1GQSA 3HDVA 1U8TA 4OXXA 1A8HA 3KTFA 4UUAA 4HV4A 1QVVA 1XA4A 3FSRA 3I72A 3Q7RA 5JYCA 4D26A 3HVIA 5DXJA 2I2XB 4KE7A 1KAEA 2ZRIA 2B7CA 2AB0A 3D4LA 3G7NA 2N75A 4NG4A 3DMGA 3O91A 3S1AA 1QPGA 2Z3WA 2P2LA 4CJXA 5BT8A 1O6GA 3NOOA 3EGXB 4R1UA 4X41A 4MS3B 4NDZA 3TQCA 1RYBA 1FVHA 2ZRBA 1YZHA 1H2FA 4K9KA 3PX2A 3QJGA 4WH0A 1V4NA 2ZI5A 3KSMA 3N53A 3TNJA 8OHMA 3MN1A 4ZT6A 1DXQA 1RYHA 1RJFA 1YUBA 1HFJA 4F9EA 5JPDA 3KT8A 2CZQA 4AJIA 3EGDB 2VYND 3ZVRA 5ITZA 3W1WA 3LBYA 3W04A 3OCJA 3LP6A 2COUA 2JJQA 2GESA 3IJPA 3ZQUA 3GLFA 3CX4A 4H17A 5LYYA 3W4IA 2HV9A 3PWSA 4GW3A 4XB6B 2WJIA 3EG5A 3E0XA 1QQBA 4LJ8A 1RM0A 4PO9A 4LZLA 4S1WA 4PHHA 2HU2A 1YB2A 1ZLXA 5G0TA 5JBNA 1Y6ZA 1UKVY 1ZOOA 4BRZA 2JK1A 1YR7A 4RVSA 1IBKB 5DHUA 3W1VA 1CZRA 5I6DA 4AJ4A 1AH2A 2C31A 4O4HF 2G25A 1A69A 2A0KA 4LDNA 3H5VA 1XTUA 3LUHA 1KK1A 2WLSA 1E4EB 2WWXA 3CGGA 3KQYA 4LYAA 3T7DA 3RRMA 4MI1A 3HP4A 2R6HA 4FYKA 2D62A 1USKA 1OREA 3ZV7A 3TAXA 3L7CA 2B2XA 3WGTA 3QLVA 3V8QA 2OK7A 4PYKA 5ALRA 5EIOA 1Y7TA 4EF5A 3GX1A 3PJEA 4EKYA 3IQWA 3JPYA 1IHYA 2FPLA 4X94A 4CM9D 3W5CA 4ND4A 4F2PA 1WB5A 1FNSA 3PWZA 4C01A 1JDPA 2BCGY 3VR2A 3LK6A 4YRPA 1LK7A 4ETNA 5IJ0B 3P2JA 1HEIA 4QXRA 3RVKA 3RS4A 4M22A 4X5OA 2M1XA 1ZIXA 1WY5A 1ID8A 1E5DA 3WE7A 2ZIXB 3ICQB 1JF8A 3HCBA 3F9IA 5BN5B 2ZTLA 3I5MA 1PQ4A 1BTOA 2ISSD 4ZKDA 1TTPB 3B1YA 4P4GA 3ZV4A 4BMXA 4IF4A 4INAA 3PVZA 4PCLA 3V46A 2G1KA 4MINA 3ICPA 2DFVA 2ECPA 1KMCA 2ZLBA 4K9QA 3EDRA 5M3BA 1RWKA 1U0EA 3TPFA 1YTLA 3Q40A 3VU8A 3NC0C 2PX6A 4E2FA 1CY6A 3F5QA 4MW5A 3OHPA 4YI5A 5K3CA 4RGYA 2O1WA 1K08A 4PLVA 5MDHA 3IOBA 5K3AA 1CETA 3WGUA 1NXQA 2ZRKA 1RLJA 1E2NA 3RS0A 1U0SY 2FWIA 2ZIZA 3LFUA 3VKVA 2ADFA 2VLBA 4RPIA 2OCLA 2Q0XA 1QGOA 3VPBA 2LDXA 1ZXLA 1P7PA 3OWXA 1XPUA 4CKWA 3NWEA 1Y81A 1DZIA 2CDBA 4NV0A 3DOFA 2OAGA 1L4EA 1C7ZA 5K01A 5A3QA 5KTPA 4BQOA 3VR5D 1ZIDA 3KLBA 1SOMA 1XT6A 1LCIA 2HZBA 4U2KA 4LDRA 3OSZA 4QDTA 4HWRA 4V02A 4ZVLA 3T7KA 1L7EA 3ETCA 3I2FA 3TR0A 4OHCA 4BJ5A 1KTIA 1OKKA 4Q1FA 1GHTA 3QLVC 5B3JA 2W2OA 1V1JA 3H0CA 2ZJ5A 3QKIA 3AEKA 1OXMA 4YXFA 1NM5A 4ALNA 2ZZMA 3THOA 1XVVA 3CUTA 4OG2A 1Z0DA 2IXGA 2XADA 2XSZA 3Q3CA 1YD7A 1OX4A 4OKSA 4ZTBA 3RUAA 4AMBA 3ZWWA 3INGA 1EX7A 1JHAA 3EIHA 1NJ1A 3N8KA 1YU6A 4N4AA 4GX0A 1YIOA 2RHCA 5FOTA 1GZSA 4MUBA 5KYYA 3L46A 4DSTA 1MGOA 4OUDA 4MQ4A 4L8YA 2D7CA 4WW0A 3CZCA 5EXEA 1M83A 4JWTA 3DONA 1G5QA 2F1JA 4BNYA 3KJEA 3ZEIA 3VGPA 4A1FA 5FWYA 2IDMA 2JGKA 3A9CA 4LV6A 1ZG3A 2FMHA 2UZAA 2ZUCA 1C1DA 1NJGA 4C0SA 2HXYA 1ZUHA 2HA0A 5EOVA 4EVRA 2XQKA 4TZ6A 3MB5A 2IPXA 2PUFA 4LSZA 4LHSA 1A2QA 1HQYE 1RXIA 5HBRA 5KQPA 2YJZA 1U7WA 3LKVA 4WJKB 4EHBA 3KXKA 4IDNA 1JAZA 4YMSA 4PY2A 3UW1A 3N0RA 9ABPA 3LHDA 4CMIA 5GPBA 3T3EA 4GMGA 4IFBA 4ABYA 1GR1A 3D7NA 2R25B 3A6PC 4TXNA 3QW2A 1Y3DE 3K6RA 5LL6P 2YDYA 1HA3A 2O2JA 1T0JB 2WABA 3EDOA 3FTPA 3KUCA 3OLYA 4RPLA 4D4IA 1I51A 1P0PA 4WAUA 3RM3A 2ZI3A 1EFHA 2OD9A 2VYVA 1KDRA 4M4SA 3SZGA 4UOZA 5CDSA 1U94A 3X2EA 4R41A 4J0QA 2OZVA 4QGFA 1XJ0A 3BAFA 2JDIA 1B43A 3RTAA 1JAHA 4FGKA 3G23A 4WOPA 3G0DA 4JUIA 9GPBA 3DCIA 3OQHA 5E2BA 5B3JC 3GRZA 1GZDA 1QYWA 2NTJA 4QZVA 3WI7A 1KNQA 2YV4A 1P60A 2HCJB 5JADA 1NM5C 4KK3A 5AJXA 1WO8A 4DNXA 1YC5A 2KJQA 3FMPB 4IXWA 1IN8A 1DQRA 1Z5ZA 1LF0A 2JFGA 3DWGA 4GMXA 3WDMA 3C8MA 4BDTA 2HPVA 5KYXA 3W7BA 2R8BA 4I4TF 4P32A 4BO5A 3M3HA 1NVEA 2AR7A 3G6KA 4C6TA 2C2WA 1WVIA 3DTYA 1DU4A 3X1DA 4U2DA 4CUZA 3L3BA 4ZI7A 1B7GO 2IEDA 4HDSA 4KXVA 2EIHA 2EJCA 3IIIA 2PBZA 4HDKB 4ILEA 3T6KA 4C0JA 5SZIA 5F35A 2HDHA 1CCWA 4NMHA 4PLWA 3HBLA 1GZ7A 1TD1A 1IATA 3MRVA 3DLIA 3QVXA 1V1RA 1RLUA 3IEUA 4N3NA 3ROEA 1ZA1A 3BJRA 3DDWA 5D5HA 3T52A 2XNCA 3NAZA 5K45A 2Z09A 1EFVA 4ODIA 1P4HA 2HEIA 3ELWA 4PQYA 2Z9DA 2F8SA 6Q21A 3H1EA 3VDQA 2JARA 1S3FA 3EWIA 1YNOA 3IAS1 4BFSA 4DT1A 1UBKS 2RGNA 2CSXA 2X2OA 1J8VA 3WWDA 4X8OA 3RJZA 1JXMA 5E1OA 3HFRA 3VR3D 4ACBA 1XAHA 2VN8A 1GCIA 1ZK1A 2IQIA 3DD5A 4AQYB 3JWIA 2I3DA 2RJ3A 5CM8B 3WYDA 4FE4A 2CVFA 1OXBB 1OV4A 1UJ2A 4KIGA 1Y3HA 3D6JA 2QN6A 1G8AA 3B1KA 4KLRA 2D1QA 4LOHA 4C07A 4IFEA 5JAZA 3G8BA 4MV4A 3V8EA 5CLQA 1I10A 2VQ3A 1RRVA 4HAWA 4GZ3A 3U61B 3FYUB 4CQMB 3M5DA 3VZQA 2P75A 4I4NA 3TTTA 1CK4A 1Q17A 4R68A 4RK6A 1T8UA 3ETEA 4J0EA 5BXYA 4MQ5A 2YRWA 5EIFA 4LTDA 4B3CA 1XWIA 4TPKA 4KMOA 1TOAA 1Z75A 4LJYA 1G20B 2IVZA 3GELA 3U62A 3BC1A 5TGTA 4YAOA 4Z99A 2DWQA 3ZU4A 3HHPA 1YVUA 1OE0A 2PEYA 3BWCA 3U60B 4OP3A 1Q7GA 1HE4A 3ENNA 1PS0A 1TAGA 3MWYW 1GKLA 4QYMA 4S1PA 3T5TA 5JROA 5IVKA 3SQLA 2B1JA 2JAOA 2D2XA 4TMXA 1QH9A 1ZHHA 2XGGA 1C1XA 2BBWA 5D1NA 4MRRA 3ULKA 1QS0A 3FIJA 1PFVA 4YAUA 2B3TA 3QW4B 4FLMA 2EX1A 2GCNA 1GPDG 2QNRA 1N5LA 1TC2A 2M6SA 4F2GA 1KWKA 3QBJA 1T0HB 1X7WA 2VJDA 2XRYA 2JFBA 4MGEA 2EFJA 1F9AA 2I4TA 4W7SA 2FF7A 3VC1A 2RGNC 4MCHA 3WKBA 3QA9A 3UJNA 3T9DA 1JHPA 4YYZA 5TQ0B 2C8LA 4EZEA 1IE3A 3N6VA 3ZYCA 1CP2A 3MUFA 3Q41A 4MUJA 4X92A 4DUGA 4EG8A 4QYIA 5BSKA 1T1JA 2XR1A 1O08A 4BC1A 2OWDA 1OZAA 1F14A 2HWWA 3CLTD 1EJ0A 1CLEA 1SBTA 2Q8NA 3HBAA 4WNIA 5E6RA 2XYQA 4WGGA 4BE4A 1MAVA 1Z83A 3NIGB 3H1GA 2KYRA 5B4UA 3V8RA 1BMFD 2WSIA 1YBVA 2DM6A 1WOYA 3K0FB 4QATA 5CCEA 4YUVA 5F33A 2NT3A 2Z8ZA 5H4HA 2WFZA 2D00A 3C3MA 2Y1KA 2BEJA 2ZTMA 4OHVA 4GRDA 2WWVD 4HNUA 1YVDA 3REQA 3CZAA 3THXB 1PIWA 1Z35A 3K8OE 4DFDA 3WA7A 2VRWA 4KN6A 1UQTA 4LZNA 2GDZA 4ITUA 2VCHA 2YHBA 1KSJA 3A4YA 2O9JA 3IMCA 1P0CA 1R6DA 4HQRA 3RAGA 4YDQA 4KW7A 4DJDC 1KFCB 3K9FC 4QRIA 2HT1A 4R9SA 4NJMB 4IHKA 4NPCA 4OKIA 4XWOA 2D0PB 2PWBA 1PJLA 4Y9SA 2AUNA 4LWZA 5LJLA 2JFUA 4D79A 3T7TA 4YONB 3WKCA 4JVOA 4RADA 4HX9A 5BP7A 4YJHB 5HIMA 4GOJA 4BNJA 5FEUA 5K3BA 4BNLA 3O82A 1C8VB 5FEMA 3GGGA 2HSZA 4NP6A 5EZYA 1I7LA 4JD5A 3ZZMA 3BKXA 2Q4EA 1ZD8A 4WJLA 5A5EA 3KR9A 2NUBA 2D0OB 4CEIB 4GM1A 5KKAA 1NYRA 3BXOA 2PN1A 3EEFA 4NE7A 4TMYA 1WPQA 4O1HA 7AT1A 3WNCA 3OIYA 4BEBA 5I7AA 4V0RA 3KR2A 3SNHA 2C7PA 3BF8A 5B37A 1XZCA 4G84A 4IUYA 3JAMA 3PFCA 4BVHA 4ZT3A 1PS8A 2ERXA 3CIOA 1XRLA 3QUAA 4A10A 4AK9A 2D0IA 4GVPA 2V9PA 3GH1A 3O8RA 2QKYA 2AN5A 1RHQA 3AHEA 1BE1A 1P2TA 4XWGA 5HDBB 2HA7A 3KOXA 5JW6A 1HG1A 1YO6A 1KH1A 1PWHA 4GHWA 2ZJ6A 4YRMA 2E4VA 2X15A 5IBCA 3HLKA 4UPEA 4HB2A 3RIGA 3NHSA 5GONF 2DR2A 1E7YA 1E6WA 1WQ1R 3OIGA 3N5KA 4MZDA 4U6NA 1QK4A 5G3YA 5LXTB 5JVDF 2CC2A 1MA0A 3G0BA 3HO6A 3GJ7A 4WZAE 3CU5A 4D3XA 4A8PA 3HXLA 2X9GA 1T2AA 3KXPA 1QONA 5EKTA 2W2TA 1K7SN 3N87A 3RFXA 1ZIYA 4AF7A 2Z43A 5ESWA 5KDOA 1G7TA 1KFBB 2WVGA 3PZBA 1FFDA 3I01A 3OZRA 4NZNA 1LDBA 5FUYA 5T64A 3WSVA 1ORWA 3REOA 3PXAA 5JAOA 2XZOA 4H16A 4HAXA 5SYMA 1PQWA 2WF7A 1CUAA 4WLOA 4JVMA 1Z17A 4EITA 1ZVMA 5FBRB 1KXJA 1Q2UA 3G5TA 1P5RA 1NRXA 4J29A 5F1OA 1N6RA 2FN7A 1UK8A 4XUEA 4YHBA 2PKEA 3LX5A