4RTQA

Complex of escherichia coli dna adenine methyltransferase (dam) with adohcy and a 5-bp non-canonical site (gttta )
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
270
structure length
246
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSASFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
total genus 86
structure length 246
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtqA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtqA01
2ZBPA 2YXEA 3IHTA 2H11A 5E1MA 2C7QA 2YQZA 4ER0A 3R9XB 4EK9A 2FYTA 3KPWA 3OE5A 3FRIA 2ZBQA 2XYRA 2AN5A 4RV9A 5CVJA 2HTEA 4ATNA 3SM3A 4PGHA 3LDFA 3EVDA 2ZTHA 4Y30A 2XVAA 1SQFA 4PYNA 5HIKA 2B3TA 7MHTA 3IEIA 3PVCA 5GIOE 2HNKA 4PGGA 5HFJA 2QY6A 3NWBA 3RW9A 5D1HA 2VS1A 3P97A 1P39A 5E2BA 1SUSA 4P7FA 3H2BA 4EVIA 4OA5A 4ZTBA 1SUIA 3GRVA 2OB1A 3FPJA 4QPNA 5DX1A 4A6EA 4QDKA 2OZVA 5EMJA 5KS2A 1AQIA 3BWMA 3FUTA 2P3QA 3NVMB 3JWGA 5JR3A 1T43A 1AF7A 2YR0A 4KVZA 2ADMA 5DTRA 2ZIFA 3VYWA 5ICCA 2GPYA 3GRZA 5T67A 5FUBA 1R8YA 3FTCA 1XDUA 2GA9A 2K4MA 3O4FA 1NT2A 1X1CA 4POOA 4F84A 1N7IA 1FBNA 3EMDA 4GOOD 3M70A 3O31A 3IV6A 4GC9A 1NKVA 3LCVB 5EOVA 3LCUA 5DM0A 4C08A 1XVAA 2ZWVA 4HSGA 3RIEA 1NV9A 5F2NA 1INLA 2PXCA 2DPMA 1KYZA 3DP7A 5DXJA 5EHGA 4PYMA 1JQEA 5DTMA 3PTAA 5K09A 1L1EA 2PX8A 4RVDA 4WVLA 1BKYA 4KDRA 3T7RA 3UJAA 3LX6A 2CMGA 5LQCA 2OBFA 1EQAA 2PXXA 3KR1A 3KQPA 3SMQA 5DLYA 1NW6A 3UJBA 2BH2A 1D2GA 2AN4A 2AOUB 1SQGA 2B9EA 3OPNA 4CTJA 2P1DA 1JR4A 2Y1WA 4YV1A 1SVUA 4HC4A 3X0DA 4FSXA 4GOLD 3JWIA 3NW9A 4XUEA 2QE6A 5LSAA 5CIYA 3R24A 2GS9A 2PVCA 2LD4A 1WXWA 1WS6A 1ZGJA 3GDHA 3LGAA 2P7HA 2QRVA 1G8AA 3DMGA 4YUZA 3CJTA 4XUDA 3EVEA 2AOVA 2N47A 2GAFA 3GGDA 1UWVA 3MTIA 5DT2A 2NXCA 3DLCA 2I6GA 1U2ZA 1D2CA 2FK8A 5F2OA 3KU1A 1FP1D 2YXDA 3B3JA 3BWCA 5GWXA 3UJCA 3KKZA 1YZ3A 2AVNA 1KPIA 5KQSA 4E32A 4R6XA 3AY0A 2CMHA 5H02A 2JG3A 3DMFA 2IBSA 2EFJA 4DM3A 2ONYA 4R05A 4RVHA 5HIMA 4LG1A 3A25A 3I64A 1YB2A 2KW5A 4OBXA 1YFLA 5E1OA 1NV8A 2R6ZA 10MHA 1JG4A 1TW2A 3I9FA 3KPVA 3HVHA 3MAGA 4ISCA 1JSZA 4RTOA 5EMLA 2NP6A 5K0NA 1UFKA 4CKEA 4OX9Y 5FTWA 3MTEA 4QPPA 5FCDA 5HILA 5EPEA 5CCXA 1ZQ9A 3DLIA 1NE2A 2DULA 4E31A 5EGSA 4YMHA 3G5LA 3GU3A 3A27A 4M36A 3SX0A 1M6YA 2UYCA 4E2YA 4G56A 2PY6A 1YF3A 3Q7EA 3VC2A 4AZSA 4BLWA 4RTKA 1HNNA 3OFJA 3DXYA 5FWDA 3TQSA 3ANXA 5HIJA 2OO3A 4DF3A 4DZRA 1F3LA 3EEOA 2A14A 3THRA 4E2WA 1VL5A 2H00A 3EGVA 4P58A 1MHTA 4HG2A 4KRGA 2IP2A 4KDCA 1TPYA 4MTLA 5FULA 5GP1A 1MJFA 5D1NA 4BLUA 4DMGA 2EJTA 3K6RA 3UJ7A 3MERA 4IV0A 2I9KA 3P9IA 4C04A 3A26A 2BR4A 2C7PA 1JG2A 1X1BA 3E8SA 4QVGA 1O9GA 2C7RA 4HTFA 5EIWA 2PT6A 3TR6A 1WY7A 2VZ9A 4XUCA 2G1PA 2YX1A 1VLMA 5M5BA 2VDWA 3CGGA 2AN3A 3M6WA 1RJDA 1KYWA 3GXOA 1RI3A 2E5WA 4M37A 3BKWA 4OBWA 5E9WA 4PIPA 5FQOA 1ORIA 2B25A 3FZGA 3KQTA 1XJ5A 3HVIA 1VIDA 4PCLA 4CWAA 5DRYA 5K0FA 3KPYA 2EX4A 3FPHA 3MCTA 2IH5A 2P3OA 2PWYA 5DSXA 1QANA 1N2XA 2ONZA 3C3PA 3EVZA 4E2XA 3B3GA 2OXTA 2FPOA 4C03A 5K0BA 2JHAA 2NNWB 3A7DA 4PYIA 4DCGA 1DUSA 1L3BA 3BXOA 3GRYA 4PWYA 4LWOA 2JJQA 3EVGA 5ICGA 2AVDA 1KPHA 2ESRA 3FPEA 3VC1A 3AXTA 4E30A 3MCZA 4QTTB 3M6VA 5GM2A 3PFGA 1M0EA 2Z6QA 5EKXA 2JH9A 2PBFA 1JTFA 5F2KA 3T7TA 4EKIA 4HGYA 5DX8A 5BXYA 3NDIA 5K0EA 3LPMA 5BW5A 3GO4A 1G60A 4IV8A 3TMAA 3QOWA 1WXXA 1QAQA 4A6DA 9MHTA 1KIAA 5EKUA 4FGZA 3FYDA 4P7JA 5LQAA 2CL5A 5K8VA 5K0JA 4X63A 4KIGA 3TM5A 3UA4A 1SKMA 1IY9A 1DL5A 4AUKA 3E7PA 1ZHFA 1VP3A 4LWPA 3CC8A 3NMUF 5K03A 1HMYA 4X61A 4YUWA 4DCMA 5GINE 1KR5A 1X1DA 2PV0A 4EKGA 2IIPA 3PX3A 3QV2A 4X41A 2BR3A 5CD1A 2C7OA 4X1OA 5CVVA 3G7UA 3OFKA 2VDVE 1XDSA 4CXMA 1KXZA 1X19A 4QDJA 3FRHA 1G8SA 2WK1A 3I53A 2OYRA 3G2OA 3HM2A 2GH1A 3FTDA 1G38A 2ZULA 5C0OE 3CJRA 1JQDA 3HCCA 5E8JA 5T6BA 3OU7A 3B3FA 3DOUA 2AS0A 3HCBA 3OZSA 1VPTA 2HV9A 2PT9A 3HA7A 4EMSA 5BP7A 4DA4A 2IBTA 3PLAE 2UZ4A 3L8DA 1DCTA 2ZZMA 3TPZA 3R6TA 3C3YA 4RTJA 2IDKA 3U81A 3OZRA 5CCBA 3ELWA 2IGTA 3T0IA 3DULA 4KWCA 2QRVB 3G89A 4PNEA 2Y1XA 1RJGA 3PB3A 4PYKA 1RJFA 3FTEA 4MWZA 5E8RA 2JH8A 1ZGAA 3T7SA 1ZKDA 1NW7A 3LSTA 1VE3A 2R3SA 4U7TB 3KQSA 1JSXA 3UZUA 1AQJA 4CKBA 1PRYA 3FPFA 1BC5A 2I62A 4GC5A 2HR1A 3CVOA 5DRTA 2AOXA 2PSSA 1P91A 5G02A 4WXHA 1R00A 3SXJA 4YV2A 3GIWA 2P7IA 3CJQA 1IM8A 1WG8A 3G88A 4BY9E 3UBTA 1G55A 3BGDA 3G2QA 4FSDA 3ORHA 5DWQA 3HNRA 4CKCA 5HEKA 2Z6AA 1R74A 4QTUB 3DXXA 3SSOA 5GM1A 2GB4A 1UIRA 2O57A 3OU2A 2VP3A 1YFJA 4GUAA 4XCXA 1QAMA 4FT4A 1BHJA 3HP7A 3KQQA 5EIFA 3UJ8A 1JQ3A 4E2ZA 3EVFA 1XTPA 3V97A 2IFTA 3BZBA 3R0QA 4X60A 3A4TA 1RI5A 4KW7A 1VQ1A 3OZTA 2JHCA 3A7EA 3P2IA 2QM3A 4RX1A 2P3LA 3C6KA 2HWKA 2BR5A 3KQMA 5IH3A 3TOSA 3LECA 1QYRA 3F4KA 3LDUA 3HEMA 3Q87B 4KIFA 5DM2A 5EHIA 1WZNA 2ZIGA 4IKPA 3EGEA 4YV0A 5FHRA 2BZGA 2IH2A 2B2CA 4OQDA 3G5TA 3OU6A 4PCAA 3LHDA 4BP1A 1Q0SA 4V0QA 2PKWA 4V0RA 2PX5A 5K0CA 3OE4A 1L9KA 3EPPA 2GLUA 3NWEA 1JG1A 5E9QA 5HZMA 1F38A 2ZCJA 1L3CA 5EQJB 3UA3A 5DPMA 4GOMD 3BKXA 4P7GA 4RVFA 4HTFB 5FA5A 4Z2YA 5EVJA 2IPXA 2ZBRA 3C0KA 3G8BA 1R18A 4U7PB 5HOQA 5KQRA 3PX2A 3BUSA 3IYLW 3B89A 3EGIA 4C4AA 1TW3A 1Q0TA 2AOTA 3CKKA 3HCAA 5U4XA 1ZG3A 2PLWA 3GRUA 1I9GA 2YTZA 1VBFA 2OB2A 5LQKA 3KQVA 4RSRA 3NDJA 2WA2A 5DX0A 4MQ4A 4C06A 3CCFA 3D2LA 4AZWA 3KHKA 3LBYA 5CVUA 3SR4A 1RJEA 4EQZA 3NTVA 4FP9A 4FZVA 4RTSA 1PJZA 3SSMA 3G2PA 5K0GA 2IH4A 3QOXA 1I1NA 4DKJA 1EAMA 5GOZA 3TRKA 3AWIA 5FADA 3SVZA 5EEHA 1P1CA 5C9ZA 1FPQA 4GF5A 3MHTA 3LBFA 2FK7A 3P2EA 3MB5A 1EJ6A 1QAOA 2XYVA 5DTQA 5EMMA 3DR5A 3ERCA 4YUXA 4RTNA 3P9CA 2ZIEA 5T64A 4GEKA 1D2HA 4GBED 3EEYA 2PXAA 3NVKI 2ZZKA 5LQJA 4QQNA 2FHPA 4E70A 2XBMA 3FTFA 4AX8A 2O05A 1KHHA 3OCJA 1Y8CA 4YUVA 2NXEA 5FHQA 2F8LA 1KP9A 1KPGA 3HTXA 1P1BA 4RTRA 5EEGA 2G72A 3FUWA 1EJ0A 4ER6A 1VP9A 3PT9A 2FCAA 2PJDA 3DMHA 4FS8A 3UJ9A 3THSA 5EZQA 5P8WA 1G6Q1 1RI1A 3GWZA 2G70A 4OQEA 4HGZA 2B78A 1EIZA 3LKZA 3RODA 3DUWA 4BP3A 2CWWA 3CBGA 4PONA 3HCEA 2PGXA 3LCCA 3GCZA 4R8RA 1R8XA 2O06A 3HVJA 3KQYA 5ICFA 5LQRA 1YZHA 3KQOA 4O29A 4PYLA 2WA1A 4UOEA 2H1RA 4R8SA 3SSNA 4YMGA 3BWYA 2UYHA 2NXNA 2ZLBA 2ZSUA 4L7VA 4YUYA 1NBHA 3JWJA 3ID6C 2O0LA 1EG2A 1SG9A 2NYUA 2YXLA 3FPGA 3LDGA 5GIPE 1I4WA 5EZSA 5E2AA 3UWPA 3TM4A 1BOOA 4RTQA 3I5UA 4PYOA 4CTKA 1FJXA 4M38A 3M6XA 4P7KA 5CVEA 2P40A 2I7CA 5DM4A 3TLJA 4QVKA 3B5IA 5E9JA 3G2MA 1V39A 3FUVA 3DXZA 3M6UA 4ER3A 5LR6A 5HIIA 2YUIA 5LQNA 2Z6UA 3P8ZA 5FWAA 3DTNA 3KR9A 3ME5A 3V8VA 2AOUA 3R3HA 4FR0A 3NJRA 3LKDA 1IXKA 8MHTA 3PS9A 1H1DA 4RWZA 5CVDA 2O07A 3EVAA 2FRXA 2VDUE 3MGGA 3KR0A 3ER8A 4DQ0A 2NXJA 2ZFUA 4F85A 1NBIA 3P9NA 1O54A 5JUWA 4OA8A 3M33A 1NW5A 3FYCA 1L3IA 3GRRA 4LECA 1R6AA 2IDJA 2P35A 3E05A 3HA5A 4B17A 2P41A 3P71T 2V74B 4HH4A 2PX2A 2ZW9A 3KPUA 2HMYB 1XCLA 4JXJA 5ERGB 3REOA 3UFBA 5FQNA 3ELUA 2Q41A 4MIKA 3E23A 4QQKA 3AJDA 1M6EX 2YVLA 1XXLA 3KQWA 5K05A 1O9HA 5KYGA 5EC8A 3VSEA 4GQBA 3DH0A 3BGIA 5C1IA 3ELDA 2NP7A 1N7JA 3SGLA 1XCJA 1XDZA 3JWHA 4AZTA 4GOND 1X1AA 4BLVA 3I58A 1QZZA 4RTLA 3FUUA 5ICEA 3HCDA 5DSTA 3KPJA 3KR2A 5EG5A 5CM2Z 5EMKA 5E1BA 5FA8A 4C05A 4MHTA 1FP2A 3LL7A 3MQ2A 4RTMA 3HVKA 4RTPA 2ZVJA 3BGVA 3S68A 3BWBA 5K01A 3BT7A 2OY0A 4E33A 1RI4A 3C6MA 5KVAA 2JHPA 4IWNA 3UJ6A 4ER5A 2ZZNA 3O7WA 5K0LA 3UJDA 2P8JA 2BM9A 3EVBA 2AZTA 4HRAA 4RYLA 5LQUA 1OR8A 3HCFA 4R6WA 4ER7A 3TKAA 2UYQA 1NW8A 4AZVA 3EVCA 3EMBA 4K6MA 4F86A 2AR0A 3AXSA 5MHTA 1B42A 2PX4A 2ORED 1YUBA 2OKCA 3B7PA 5DXAA 2CKDA 3HA3A 2AOTB 3ELYA 4PYQA 4RVGA 2G8NA 5IKMA 1NW3A 4PYJA 4NECA 1AV6A 2EJUA 1Z3CA 2AOWA 1JG3A 2ERCA 5CUQA 3P2KA 3M4XA 1ORHA 3PFHA 1RI2A 3GNLA 5E1DA 3G8AA 3TKYA 2QYOA 3GJYA 4H0NA 5B1SA 5DM1A 2XYQA 2EG5A 1JTEA 4PIMA 4Y2HA 2XVMA 4PINA 3WSTA 2OPBA 2UYOA 2G71A 3K0BA 4FT2A 4C07A 2ZWAA 4M7RA 3TFWA 2PWPA 2BM8A 3FUXA 3ER9A 3P9KA 2V7EA 5BW4A
chains in the Genus database with same CATH superfamily
3SDSA 2YXEA 4I36A 1NVTA 4MDHA 4L2IA 3EA0A 4MLDA 4CEJB 3VOAA 1OXTA 4QAQA 3KXLA 1JX6A 1PTJC 4HZUA 5CITA 1BVHA 3O91A 2HJSA 2O2HA 3NH6A 4K6GA 2AN5A 4KK4A 4DLSA 5A5VA 3H7AA 4CLOA 2WC1A 5KQGA 4QU8A 2DHQA 4L78A 4NICA 4HATA 2EX1A 3MQ4A 4WK2B 2D4AA 2YNMC 3U2QA 1V45E 1GPNA 4H3HB 1QVZA 5GIOE 1Z63A 4PW0A 2P5SA 3A6FA 3P97A 3QWHA 3KWMA 1WULS 2FW9A 4JSRA 2GN0A 1JKIA 3A05A 2XCRB 4C3UA 4MUJA 5DDIP 2X2FA 2O3JA 5EMJA 2L82A 2VNKA 2GFIA 2P3QA 3G8CA 4II3A 2B61A 2BP7B 2WZDA 4CTNA 2QZSA 1BDJA 4M9CA 3UK7A 2ZSAA 5ICCA 4OJKA 3PNOA 3NBXX 1T2EA 4ZU1X 1GG8A 2ZJFA 3ZXSA 5CH5A 5BR1A 3BH6A 2XUHA 1UDAA 3UXEA 2HJHA 1KC3A 2Q0XA 2JD1A 2FFBA 2QK4A 2XTMA 3JAWB 2ZB4A 3BEDA 4Y1GA 3KT0A 5KU1A 2PGJA 5LA6F 2C3UA 3LMKA 5CH3A 1GAQA 1V7PC 2OAEA 4AWBA 1P8AA 2XTAA 3KETA 1MW8X 4G63A 3OESA 4Y6GB 3TR0A 2G5PA 4HMPA 2I2DA 3HI6A 4GD3Q 4RVDA 2PAFA 4XQEA 1R15A 1N9GA 1NDUA 1AQNA 1SCQA 4AUNA 3ESAA 2JGMA 3QU2A 1XB2A 3GUCA 1OWLA 2CLOB 1PNOA 2BFWA 4KO2S 3OM1A 4WNYA 3TG8A 2DQSA 1YZUA 1EK6A 2P1DA 4I2NA 5JHHB 4I8IA 3A4LA 3SFZA 4F4IA 3SC2A 3VPDA 4WCDA 1OGYA 3WDSA 4TT3A 3VA7A 4FFVA 1QUFA 2HA3A 5AVUA 3BB3A 3I32A 4D9BA 4JL5A 1YZVA 1HO3A 2GKSA 4TXHA 5F3WB 1TM1E 2PSFA 3MEQA 1ZX1A 4OLFA 4P93A 3W5IA 5B7QA 2P7HA 5LU8A 2W7TA 5K3AA 1YAJA 4KFCA 1V11A 3Q11A 2IUEA 4NENA 3NANA 2ZJ8A 3LQ1A 2I2FA 3KALA 3Q8WA 3R3WA 2HAEA 2ZS9A 5GWXA 3SQLA 1VGRA 4H17A 2FUCA 4M9SA 5ALRA 5KVQA 3DLPX 2ID8A 4DA6A 1Y3DE 4N3NA 4DZZA 1V1MA 3KSZO 4X20A 4XD2A 4DLKA 1QR6A 2JG3A 5LFAA 3KTFA 2Q4RA 5FA6A 4W5JA 2B1IA 5AVWA 3LQ2A 4C3ZA 3C5VA 1KQOA 4LGYA 2O2JA 2BT4A 4ZXPA 1TU4A 4BX3A 1RYNA 4K86A 1WUJS 4OHMA 4OGFA 2W6MA 4Z9AA 3SDBA 2O8BB 1ETUA 3CF4G 3DZJA 3AQIA 3I2HA 3MRSA 4MLPA 3MTEA 4OLJA 4V0ME 2F1RA 1K68A 1GL6A 1BX1A 4MW6A 5FBZA 3V46A 1ZQ9A 3W4JA 1PT5A 3ZZTA 5BOSA 4MIEA 1N3YA 4HVAA 3O4GA 1JJBA 3M89A 3WOVA 1WMAA 3I9MA 5SY6A 4YJKA 3B2QA 5FWDA 1TK2A 1AIPA 2OO3A 2J3IA 1XNRB 1WSBA 1GUAA 1ONPA 5T7BA 2CLDX 2I8CA 3ESZA 4PX2A 3ZQ4A 4HG2A 1XQ9A 4Q7KA 2VJYA 4UULA 5GP1A 1PV1A 2XUZA 2NZ8A 4NZMA 2YVAA 3TG2A 1PCXA 3MJFA 3OOJA 5JZVA 2BL4A 2VKTA 3B60A 3NPMA 1X1BA 1T9ZA 1O9GA 1U2TA 2N1MA 5TQVA 4LRSB 3KYBA 3P9SA 3LH5A 5BQXA 1CQZA 4UVIA 4HN2A 2QRGA 2BGMA 3IJRA 3TSYA 4AYWA 4YQYA 4HH3C 4Q4JA 4WWHA 4DN6A 4KV9A 3G13A 3OJEA 1GYRA 2JA1A 5BMVB 4BIIA 5JCJA 3V6MA 5LXTA 4LNAA 1EE2A 2DFNA 1JZSA 2FZEA 3ZLJA 3QMWA 2Z5GA 1FNSA 2WF8A 3KPYA 2FPPB 4BO5A 1VCHA 1U7ZA 4GXQA 3WYNA 2A8YA 2LWIA 3PL1A 3WSVA 1PHPA 1UDXA 1PR5A 4H6VA 5TGZA 3D0QA 3AHDA 2PE5A 1O87A 3IXLA 4N0MA 4X62B 1I30A 3GRYA 4NJMA 1ZNYA 4K5QA 1NQUA 3MS2A 1Y37A 4BU1A 1KETA 5ITSA 3QFHA 2LKCA 3ZU6A 5K0FA 2FHSA 4C88A 2PIDA 4TXLA 2MTBA 3QWIA 4L8VA 1VCIA 1NRJB 3UANA 1TMOA 1N6LA 3BFPA 4WEOA 4R1PA 4NOLA 5J2TF 3RTGA 8ADHA 3P4XA 4PG5A 1C8KA 1G5QA 2PO7A 3Q2KA 4ZGBA 4L57A 3QTTA 1GNTA 2NW6A 2WM2A 3I39X 4UXJA 1K92A 2QY9A 4B3DA 2JFXA 4W5QA 1K5GA 1ZM4A 2J3HA 1G8KA 1S0UA 1O5OA 3JARA 3ND7A 3Q0IA 5AD1A 5CDFE 5A0VA 3H1TA 2GPJA 4IDNA 5EYPB 4EQ6B 2GK6A 4DCNA 4BU0A 1SKMA 2R4QA 3PDUA 4IOMA 5LCXA 3X1MA 5ENZA 1A9PA 2Y2UA 3ESYA 1PDVA 3IOMA 2EKLA 1DX4A 2Z4SA 3E9MA 4GZ3A 4M49A 1L4GA 1XEFA 2P4HX 4RCYA 2JLZA 1WP4A 2XB4A 4L6AA 3A1WA 4S2EA 4ZVPA 2PUTA 2R1VB 1NVWQ 3H42B 3DT6A 1HG1A 1J8VA 3M6LA 4IILA 2N9UA 4TLLB 4YECA 4E94A 4PO3X 3ABQB 4S04A 1E2GA 1U80A 3RROA 1JDUA 4I2VA 4BEJA 4PQFA 1PNTA 3O1JC 5CYPA 5FOVA 5LA6B 3EF0A 3KYDA 1ISSA 4MNTA 3VDXA 3VR2D 3WXBA 4P1ZA 5LB2A 4DA4A 2W2KB 4JXXA 4WXPA 2BGKA 3E9EA 2IEDA 1U4OA 3R6TA 4M21A 1G3MA 1I13A 4IRXA 3U81A 1E58A 2H48A 3B9PA 2WE8A 3VHLB 5HM6A 4MV8A 1XN4A 5CBKA 5JOQA 3L0ZA 3S1AA 1MVLA 4PNEA 4RJJA 3MJDA 3GCXA 4LJAA 4PYKA 5HXAA 1GLNA 3RBVA 2HX1A 2Q5QA 3AHFA 3L79A 4LZJA 2J08A 3ZK8A 5JJLA 5E8RA 4EJ6A 3M4JA 2JF0A 3TD9A 1ESEA 3WB9A 3D4BA 1E8MA 3IAEA 1ZN2A 2VZ8A 1ZVJA 1L4BA 3OIYA 5D6OA 3J81A 3OCYA 2I91A 3L0YA 3JD3A 3TXAA 5JNLA 1QFMA 1G20E 3Q8LA 3ONWA 3OZAA 5JNTA 1L1FA 1T1RA 2Q1TA 4FFLA 3L6EA 4R3UC 5BNFA 3WISA 2D1YA 5I47A 3COPA 4CW7A 2M6RA 4HDKA 1ZMRA 5A2QA 3KAQA 3OT1A 4YJ2A 2V1XA 2A0UA 4DV6B 3NAMA 5DWQA 1YBAA 5BW6B 5H0IA 1ZK4A 2I7TA 3FSGD 3U3XA 2AZ4A 4DLLA 3ZYCA 4C6TB 4FUQA 3L7CA 4YWJA 2B9VA 2VP6A 2PD3A 2R96A 4NU6A 5IM4F 1NRWA 4P2GA 4CKXA 1ZIXA 3AFNA 3T94A 2OBMA 2VXCA 2D8AA 3H1AA 3ZLBA 2VDPB 1SCUA 4BXOB 5FO0A 1KMMA 2FQWA 3ZWYA 1G5IA 4C2BA 2VDNB 4NH4A 4D9HA 1J0BA 1AQYA 4KIFA 2BTEA 2XXAA 3SVLA 1WMBA 1E7RA 5D5HA 1PF7E 2R7KA 5K3FA 4A0RA 4P4NA 3LQQA 2AG6A 3PFWO 3FF1A 1OY1A 2IPLA 4I1PA 1WF3A 4A3SA 3C3MA 2D2VA 2NTEA 1J90A 3PPIA 1U1IA 1Y3FE 6LDHA 1S01A 2AFHB 4A0GA 3QH4A 1A4UA 3E3NA 7GPBA 3BKXA 3WLJA 2QD1A 1T1JA 3OAAA 4HTFB 2P68A 721PA 2C4HA 3C0KA 4MV5A 5DYTA 1XNQB 5ALKA 3G2LA 3PX2A 3RG8A 3O84A 1VJTA 1HBJA 1EUCA 5FNVA 4XARA 3AEYA 2UVPB 4LRWA 2OK8A 2PCLA 5C34B 3ESDA 3GEGA 3RDPA 1ZN8A 4C7BA 3NV9A 1NLMA 2KMLA 1P1HA 4ZJYA 3PXCX 5LBUA 3U0VA 3BEOA 3OE7D 4E1VA 1FSGA 1VBFA 2QP3A 3EXFB 3KLPX 5EJ8A 4GKAA 1DCMA 2IP4A 2LTAA 1QS0B 3GB9A 3HYTA 3NDJA 3V6LA 4QT4A 2VJNA 4N3AA 3LSYA 5DH9A 3IV7A 2QTGA 9LDBA 3WNCA 3QIAA 3PI7A 5D3MB 4R16A 1WSWA 3LUBA 2AG0A 2EZUA 2HA6A 3IKLA 1EGAA 3B6KA 5FI1B 1IY2A 1QIJA 1C4KA 1VE1A 2Z2IA 3MUOA 3PYXA 4ND1A 3V2HA 3QJGA 4X1YB 3S29A 1V5GA 2DHDA 3S2GA 3EULA 4W63A 4HT3B 5C9ZA 1Q91A 1SVLA 4BZZA 1H2ZA 5BSKA 4ND6A 2VJDA 3LTEA 2FWIA 2A67A 3BRQA 1ID1A 5EMMA 5LZ7A 4CI0B 5D84A 4OQFA 4LGVA 3TTYA 1GITA 4JN6B 1M1NB 4YS6A 1WUKS 4YT2A 2ZXUA 3TIXB 1KDZA 1HTBA 1JILA 3M49A 4FMBB 1FZQA 3IOCA 2FHPA 2A5YB 2Q4BA 2XIQA 4QQNA 4TSRA 2DFPA 2X0JA 2OQRA 1USVA 4UPDA 2QN7A 4AWXA 2OHOA 1F6WA 2GRAA 4AKSA 4O5OA 1RPJA 4CM6A 1KAGA 4XYMA 2P9HA 2RSLA 1KPGA 2O8CB 4RF3A 2JGDA 3K09A 2CFOA 4MEAA 1I0LA 2PJDA 3WFZA 1CS0B 4M1YA 1X7YA 4CKZA 3THSA 5B1YA 3PC2A 1EZ4A 2FSVC 4ENQA 2AJLI 4OQEA 2I4TA 2EWVA 4CNBA 1VECA 4HLUC 4YLEA 1XKXA 2DH5A 4ENUA 5J2TB 4PX3A 1AOXA 2ZITA 3SN6A 2A6PA 1ZFNA 1C4WA 2XKAA 2O06A 1PZXA 3WLOA 1G291 4IUDS 4O29A 3U4QB 3ZTWA 3BE8A 4QD3A 4QBGB 2FEWB 4FN4A 8OHMA 4Z0PA 1MDBA 4ZI7A 2X2OA 1NBMA 4K8RB 1PSZA 3RK1A 4CM5A 4C29A 4TV9A 1WVGA 1QBGA 2OXRA 4PPYA 1GCAA 4FHEA 4FR2A 4E5SA 4CHGA 1L7EA 3OPQA 2V98A 5DM4A 1I51A 1CY6A 2H59A 2I7CA 4TWBA 5E9JA 3I2JA 3CRRA 3WKDA 3L6UA 4IIHA 5LR6A 4W1SA 1UFRA 1YIOA 4ZQGA 3SIRA 3E7FA 1QHFA 1V0JA 3R3HA 4O2AB 1VHJA 4DT1A 1XVIA 3E9YA 2J9FB 2WIDA 3DOJA 2O07A 3VGPA 3A06A 1DC3A 1HLFA 1WX1A 3ZQKA 4PANA 5CT8A 4ZEMA 4Z7QB 5CGZA 2Z58A 4LZAA 4KVFA 3BDAA 2IIQA 3Q2IA 1PK9A 5A4DA 4PLWA 4UTOA 4HH4A 2PZGA 2HMYB 4MQFA 4NQRA 3LYAA 1H9CA 4ZGGA 2MIIA 2Z0MA 4FHZA 5AKZA 2KB0A 3WGZA 1JLLA 3UV7A 1T4DA 2V59A 4UU8A 1QB7A 3VNVA 4RPIA 2NTNA 2ZB3A 2CVZA 2R6CA 2PS1A 4QOGA 2V7BA 3V4PB 5COQA 2NN3C 1JHOA 2NVWA 4PR0A 4QBTA 3AKYA 1DQZA 4TYMA 3VI3B 3GFTA 4CM9D 1QZZA 3W34A 1LF0A 1UJNA 4R71A 1D4ZA 3RYFB 4URXR 5E1BA 1QQBA 2XBUA 3WWPA 4ASUD 1RZRA 3EBPA 3G6KA 4MQ6A 2XA9A 4IM7A 4MRVA 2JKYA 2Q4TA 2QUBA 3EZ7A 3KSDO 4KGZA 2CNLA 2BRUA 2JJ2A 1BXRA 3UJHA 2EEZA 3H5AA 2VQFB 1Z0IA 1ZOIA 3QVLA 1TEHA 4IFIA 1HM5A 4IIJF 5KREA 1OR8A 2PK3A 3RS3A 4ER7A 4R7TA 1A69A 1ISIA 2J09A 3EVCA 3T3MB 4RMIA 3R7AA 4QDTA 3JALB 1B42A 2XITA 3LP8A 4N5DA 4CIWA 3BE4A 1OBVA 1E1KA 4ZALA 1G3RA 3ELYA 1Z73A 1ZUD1 2H1CA 3SYTA 5K8LA 1US8A 3LT0A 3ENZA 5L4SA 3B5EA 1TVKB 2AOWA 3D8NA 4NE7A 3S1LA 1J0DA 3E53A 1MEEA 3MRVA 4MWSA 4JA0A 1J6UA 2R66A 3STVA 1NYTA 3WLKX 1I6MA 1RLIA 1MP0A 1I3CA 3JATA 3OC0A 4Z54A 2QRLA 2ATXA 4NDAA 5EJMA 2PX0A 2X8AA 4PINA 1NVBA 3V1MA 1MV8A 3S2UA 2OPBA 1V8FA 4ZREA 3NM6B 1UKEA 2B5WA 2IZ5A 3IDZA 3RBAA 5ERXA 4AROA 5D87A 2OWEA 4J49A 4BCDA 2OZKA 4B85A 1QU2A 1WDTA 4RZXA 1RWOA 2QUHA 1LPMA 2YQZA 1Z75A 1DX6A 2APJA 4L3WA 2BKLA 4TKVB 3RHZA 1V5FA 5BRJA 4OYHA 1DDOA 3HJNA 2O7VA 3QMVA 3BSYA 1T4GA 1Y8QA 2HTEA 1LV7A 3A9CA 3MT0A 1ZRHA 3IELA 3EDMA 1M6WA 2J5QA 2QTVB 3TDMA 2WQ7A 3WL8A 1Z2EA 5IT5A 5JAPA 5HIKA 1EVLA 3VVMA 1E7YA 5B1IA 3CWCA 2ZKIA 3MRTA 5HFJA 4CQLA 5LMZA 4EG5A 1I10A 3T9FA 2HLHA 2F7SA 4AJHA 4LDJA 3RYIA 2NUBA 2YRXA 3B1JA 3VYTB 2PSHA 2ZAIA 4BRUA 3C3BA 3VPFA 3K53A 4DMMA 4ZCPA 3UGTA 1OX4B 3BE5A 3BWMA 4A4DA 1U0TA 1JEYA 3OJXA 1HWYA 4I5DA 3FZQA 3QBVA 2FZVA 1U5AA 1IWOA 1T9DA 4OOEA 2ADMA 2IPMA 3N05A 3TZQA 4BBZA 4BO3A 2C00A 3VYWA 3GFSA 3G5UA 4X3PA 5JXIA 1AGPA 1OXXK 3FTCA 2C2HA 3JWPA 5BV1A 1KRWA 1ZESA 4UU1A 1YD7A 5FOTA 4R4JA 1KQ3A 1NXXA 1LCIA 1MC5A 4JX9A 2C4VA 3E18A 1NUQA 4WZBE 1JHPA 2VK4A 2A1TR 2PZLA 4GYJA 4D0SA 2HCRA 1BJRE 3QKWA 3R77A 4Q3DA 3RNOA 1M75A 4C7JA 2VXOA 1QHHA 3BD7A 5K4GA 2FZ5A 3EIHA 1LDMA 4HO1X 2FE1A 4MRMA 5AVVA 3LRPA 3FKSA 3WE7A 2EQBA 4HYTA 4RZHA 1K0FA 1LC0A 3S28A 4XVCA 1ULHA 2RKOA 3U9SA 1F2TB 4H77A 5FTNA 1P18A 2I6FA 3QYPA 4PC3A 4BJ5A 4DYHA 1MQ8B 2Y1WA 4QRDA 2ACEA 2VUUA 5AUQA 3ADCA 4C6HA 4FSXA 5A1TA 4RA9B 4QTYA 3EH1A 4CL3A 1Q0PA 5H1YA 2GVNA 3AO0B 4OO3A 3ER9A 4NAUA 4M89A 4FYYA 2ZM6B 1NP3A 2H06A 3NGXA 3UIEA 2LIPA 5FYQA 3CEMA 1H2XA 1P74A 3DMGA 2G3YA 1FNNA 4R9RA 1QIIA 5AK0A 1VJDA 1R6DA 1AM4D 3MNFA 2DBQA 5G40A 1UWVA 1USWA 3QA3E 4I4CA 3EDQA 1G42A 5CG1A 1N2ZA 2B98A 3KOZA 2NVOA 1N32B 3IIMA 3SHWA 1N5KA 3D1LA 2AVNA 1KPIA 1EWRA 3LIPA 4JQYA 4YCBA 1SUCA 3GYGA 3K0CC 5IUNC 1P1FA 2DPLA 3AY0A 1TAHA 3AY7A 4PSUA 1KC1A 2JGLA 1GU7A 4CT4B 2YV2A 1A88A 2E6KA 4QAJA 3KV3O 2HCBA 3GK3A 1T34A 3F73A 5AW9A 2ONYA 4ZHQA 4MO2A 1PUJA 1R8JA 3HL4A 4U3JA 2I3ZA 1J99A 1RQGA 3VYVA 1SVSA 3L4EA 1IQRA 3A25A 3N8HA 2WE7A 3I64A 3K0FA 3ZHRA 1M1UA 5BV8A 1T0BA 4US0R 1JG4A 1U6KA 1I0IA 3HVHA 1YKSA 3WMWA 5KTPA 2VHWA 2ID9A 2EFYA 3MFQA 3HNOA 5CCXA 1J09A 3LUGA 3M2PA 1SZCA 3N8GA 3PP8A 4E31A 1O95A 4Z1OA 2CXHA 4EG0A 5C8VA 2YZ7A 2M6KA 1W0KA 3KUCA 1M2JA 4LV6A 2EIHA 4TSFA 2JBHA 9LDTA 3OFJA 1QRRA 4Q9IA 2PUJA 1BE8A 4GU5A 4UUNA 3IHKA 1UBTS 2FPMA 1XC7A 4P4GA 3VC7A 1ORWA 2PWZA 3TOZA 4D56A 4L4RA 4MTLA 4M1WA 1Z4KA 2ZBGA 5A4MS 3KOOA 4UJ3A 3H9CA 4Z9BA 1CR6A 3TFOA 2C7PA 2BY4A 3DZIA 1L1RA 4I6GA 1V1RA 2VJAA 4ZYXA 3JQ9A 2Y8EA 2Q9BA 1XRSB 1W0JD 4WLNA 3ROXA 1WY7A 3NUGA 1MZVA 1Z4NA 2CXQA 2CXUA 2FPIA 3K32A 4ZIRB 2IYPA 2VDWA 5L45A 4JLVA 1NJ8A 2XTJA 3BMXA 3NXSA 1YZLA 4MV9A 5E9WA 3BDIA 4Q9NA 2W6IA 3BL8A 4W5NA 1KZGB 4HNSA 3KM0A 1ORIA 1OZ0A 1E99A 2IDMA 2J5RA 1SG6A 3KQTA 2QPTA 4IDQA 2OGTA 1CVRA 1D6SA 1X8XA 2OO5A 3B1ZA 3H84A 2OEPA 1PGNA 2PU7A 6Q21A 4LRUA 3UHOA 2EQAA 3RADC 5LZ5A 3JQBC 3BL6A 4M0UA 3GG9A 4Q82A 3ZJVA 2Z30A 2XDAA 5CNMA 4RNDB 2FFRA 3GJQA 2REBA 3F47A 2HMSA 3PUJA 1JG6A 3ZLUA 3OFND 4WZZA 5IVPA 2VPIA 1OAKA 4EA8A 1E60A 3LQRA 1FUYB 2IVFA 4ES6A 1YNOA 1H8ED 3MJHA 4TPKA 3MJEA 5I5EA 1AO3A 4FOTA 1TO2E 3GRKA 3Q6MA 4HWSA 3CKMA 1DEAA 5EJAA 4R1OA 1J8FA 2H1SA 1KQNA 3UUGA 5K0EA 3WQRA 4MV7A 4JUCA 1GT91 1GZVA 5EIBD 4N5NA 4O02B 4F38A 4NYJQ 4CMEC 2WWFA 3BIJA 5EKUA 4ZTZB 2XT6A 2EX0A 2HBQA 2Y2VA 3GEBA 4TRMA 4A23A 3GVIA 4D4LA 4LV5B 4MO9A 3PNPA 3RS2A 4XM1A 3TM5A 2NO9A 4AMYA 4Q1BA 4HEA1 3FRJA 4DSAA 4EKNB 4MQ5A 2QSUA 3SX2A 5CW1A 1P81A 5JFTA 2Y0PA 3CW2A 5J63A 2PWAA 1DJLA 4J2HA 4YT5A 2VHZA 4HX9A 2QMUA 1E1NA 4M8LA 4NI5A 4Y2PA 5HS6A 1GRNA 1Z8FA 1XPRA 1SZDA 4BKUA 2O0HA 1TCCA 4M99A 3VUEA 3X1JA 5CFPA 1CW2B 2HBRA 1EVJA 2IDZA 1XF9A 4GAEA 3N0WA 4MGEA 3EXG1 3UK2A 3W2EA 4B8WA 2PUFA 4PZDA 3WJ7A 4KO4S 2UU9B 2EIXA 2FJPA 2RGUA 3DB2A 2BMVA 4RM2A 5AW5A 1W36B 4GBJA 1L8QA 3BCUA 3T0IA 1FNCA 4CQNA 2QTAA 3DD1A 4L0DA 4UU7A 5BUZA 1DOHA 2OR3A 1AQLA 3COYA 3KDPA 4O2BF 4AYXA 5I45A 3MMZA 1HUQA 4ZMBA 3MW8A 2WJ6A 3DCJA 1E2IA 3DXFA 2X22A 2XB6A 3GMTA 1BCSA 2ZS7A 5FXMA 3WLHA 1S1MA 3FY4A 2QAJA 5JDCC 4ECEA 3FPFA 4DJFC 1F17A 2R25B 3ZJYA 4OM7A 3UT5A 1ACJA 3WMEA 1GRRA 4NDNE 5AHWA 1G7TA 1MKYA 5E7JA 1SCNE 1PL8A 3RGWS 1TC2A 3VR3D 6ABPA 2PJRA 2IYXA 5CT4A 4OXXA 2ZYSA 1GL3A 4NR0A 2GCOB 4K1XA 4FSDA 2Y93A 1PFWA 4MITA 1M5TA 1PZFA 3P45A 2QLMA 4QTUB 3AUYA 1KKUA 3SZ3A 5BSRA 1N25A 1GPJA 4C4SA 1JQ3A 3FYUC 4GECA 4GOXA 1D6JA 4JASB 1DIGA 1HH4A 3SKVA 3AZOA 3ZKWA 1VQ1A 3PEWA 4XPZA 2JLAA 3U4IA 5JFGA 4Q4HA 2RGEA 2OV3A 1THZA 2HSEA 2PGIA 4TUYA 4F3CA 5DGDA 2FLWA 3ULKA 3EWIA 4ZD6A 2BFNA 2DWPA 5C52B 2C9MA 3NM5A 1WZNA 1PT6A 4XW2A 1YJQA 5C46F 2O5CA 1TO1E 2XR1A 3D31A 1VKJA 3GLHE 1Q7GA 5CLJA 1Q0SA 3HJAA 1FDIA 3ILSA 2X5KO 1XZCA 3L05A 3W7VA 4AG6A 2VP9A 3P9ZA 4B46A 4UNNA 4NH0A 4ZGWA 1Z06A 1FU7A 2FP4B 1L5FA 2AFVA 3I6QA 5EVJA 3NBYC 4LY0A 1JA0A 3KZ1E 4I1OA 4AN0A 4OXIA 2B0CA 3IMKA 3NWOA 4ZCQA 1YB4A 3D7MA 3EY9A 2YVQA 1QGZA 2QJOA 2FW0A 3H4MA 3OURA 5FKJA 4BUZA 4D4IA 4N4AA 4NNJA 3VR1A 2WSLA 2HA0A 3UBMA 4DFDA 4U5QA 1WOMA 3Q5EA 1J23A 1OC2A 3IQXA 1PEDA 4LYYA 3RJZA 3VQTA 3VTAA 4CQMB 5EE3A 3Q3VA 5I01A 5LQKA 1I33A 3Q3IA 2C97A 1KZHA 2CV1A 4PSVA 1W4AA 4FQ7A 1I1QB 3IC5A 1UBGA 2O3TA 3CCFA 4KOAA 1JIXA 1IHDA 4L5IA 4UXHA 2HJGA 2C29D 1LDBA 3AILA 1P9OA 1Y3AA 5F73A 2EDAA 5K3SA 3SSMA 5T4HA 5ILGA 5LP6F 2KX7A 3T4XA 4F6CA 2A9VA 1EAMA 3K4PA 4FEGA 4FGSA 5JCXA 3ENWA 5REQB 4C14A 5A5DA 1OI4A 1I7LA 4NS4A 4WUVA 2CLKB 2IYUA 1BEEA 1BQEA 2ID4A 1WE2A 3LBFA 1AK2A 1OTXA 4GX5A 4WIAA 3ZNOA 1MC8A 2ES4A 1QAOA 2YW9A 4XM2A 1CQWA 3ROEA 1E3SA 1P31A 2FRDA 3V48A 2FPPA 1JBKA 2HHAA 3KT3A 1HK7A 3QM1A 4N54A 2WLTA 2ZZKA 3A6EA 4P92A 4J7UA 1X1SA 2BI7A 3IMEA 2V4MA 3N0TA 4XA8A 5H70A 4B0PA 3PXBA 4HFNA 1E79D 3LWZA 4ZKDA 5AK6A 1JSRA 3L1JA 1H9AA 2QWXA 1U2RA 4FFRA 4D44A 1SVOA 3BCHA 3OHMA 3UJ9A 2DR2A 4DARA 5G2OA 1B1AA 1DVRA 4ON9A 5JW6A 2JI7A 3TW8B 2W2PA 2M9MA 1IHUA 2ZDGA 4U2CA 2KM1A 4KR7A 3QLUC 1W2HA 3M3PA 2WJHA 3L8GA 2NWQA 3KKPA 4RLFA 1M74A 3DHNA 4P5EA 3B9RA 5H80A 1XZEA 3HJCA 3MBOA 5TEVA 2PH5A 4UC0A 1KU0A 3LOUA 4RF5A 3J7AC 2BMWA 2R2GA 1YZHA 2PS0A 4XOUA 2H1RA 1EHYA 3N7TA 5BSWA 2RG7A 4EQ6A 3SCZA 3TD2A 5JVDF 2JAXA 3DQQA 2ODAA 3L82B 2C3MA 1VA5A 5FOXA 1YR9A 3I2YX 1YNSA 5EZSA 1BOOA 2QSYA 1LK5A 5ALYA 3RTAA 2ZZMA 3ZHUA 3I2GA 2H1IA 3MGKA 5C53B 4DCJA 2AI2A 2ODNA 4FM9A 3GAFA 5JO9A 3PA8A 3LY9A 1K27A 4HXFB 7MDHA 1E61A 1SOWA 1X1TA 1DEOA 2E4UA 3I6YA 1SHTX 4DADA 2QE7D 3LKDA 3NJRA 4FYHA 2NUTB 2JK1A 2QMHA 1FW6A 2A0YA 1YI0A 4IGFA 3L7IA 1FYXA 3L4JA 2ZFUA 3IIJA 1ISJA 3ZDEA 4FEAA 2ZSFA 1A76A 4PZPA 2WILA 3CW8X 4LQ4A 1TYCA 1HLPA 2CJWA 2YWDA 2HK6A 2YDXA 3N7AA 4V03A 3UT0A 3ZWNA 3QSYA 4JXJA 3PT5A 1NVXQ 1YZKA 1N1GA 1GR1A 1RP7A 1E2KA 2YHBA 4M7WA 1CLUA 4IS2A 4OAPA 3JVEA 4O2BB 1VZ2A 3PXAA 3QVKA 1KH3A 3D7NA 4V0OA 2ZSDA 2IE8A 3DZCA 4RA6A 2F4NA 1AKTA 4KTTE 1Z07A 1X1QA 3AW9A 2ANCA 1U0FA 4ML3A 1C3XA 4KTVE 3ANTA 4RS3A 3PWSA 3ZI0A 5L6MB 3J81k 1NZFA 4MYTA 4YFVA 4EJMA 3I92A 2FG6C 1QGED 1RYDA 1Y7PA 2PD6A 2O4CA 5DSTA 4FDLA 2W42A 3SEFA 2Z8YA 3A0RB 1JDTA 1OXBB 1ULZA 3DUFA 4RHEA 2IYFA 2Y0EA 4REQB 3DMDA 4HDNA 4Z4GA 1YBHA 5EJ6A 4ZAYA 1OZHA 1PJQA 2JASA 2QSJA 1QE0A 3D9QX 5F98A 3K5HA 3VM6A 5ANRB 4C6TA 4P36A 2NMVA 4JI2B 5IAJA 2CUKA 1EX1A 1IEWA 1N4DA 4E14A 2R5WA 4XDHA 5EUBA 3TTTA 2UYQA 1J1ZA 4QGSA 3IEPA 3MWYW 2E9SA 3C1AA 4RIIA 1RXUA 4BZWA 4K46A 1ZYUA 4LHSA 4TTSA 1QGAA 2EHJA 3GR6A 3TLYA 1AGNA 4QOSA 4E21A 4IVRA 2WU8A 4RM3A 3ZG6A 4MYDA 4DLNA 1NW3A 1DT5A 1WMEA 1XELA 2O8FB 1NVFA 1GO2A 4JUIA 4MS4B 1VLVA 3U4MA 1RI2A 1YR7A 2RHLA 3G8AA 3PHLA 5KOIA 1DC8A 5KNBH 3IHLA 3OTGA 4JYCA 4Y9RA 2NU6B 4IO1A 2QX4A 5HGXA 1Y1RA 5KTSA 2LP4Y 1NQTA 3R3UA 3TAHA 4LHVA 3TNDA 4BTEA 4BVHA 1V9SA 2QD5A 3GQBB 2VYCA 3LPNA 1V3QE 4F21A 2CUTA 3FPAA 3C4JA 2H3HA 1RQRA 3W8EA 4YCCA 1PKEA 1EMDA 1PQYA 2FX5A 4U2DA 3W4IA 4ZN6A 2R68A 3GUVA 2A4KA 2BD0A 3R9KA 4KZKA 3GD5A 2EW1A 3D5QA 5E1MA 4G65A 2VPXA 3AIIA 5E6RA 1LJ8A 1DGQA 1CZRA 2DR0A 3GCWA 2L42A 2H54A 2LUOA 1V96A 4UMVA 3EXFA 4J4BA 3SD7A 3T7KA 3BXFA 2Z04A 3DFZA 1UAGA 4QYXA 1R9GA 3ZHCA 2P30A 2OHVA 1R0CA 1Z16A 2O2YA 2YFYA 3A3PA 4J1QA 3CZ9A 1YFKA 4GR5A 7MHTA 2OCAA 5FO1A 3X1KA 5LP6B 2OHHA 1GGNA 1PGJA 5DBEX 1BDIA 4YAOA 4BFWA 2PZ8A 1PLLA 1NUTA 1HEYA 3RC3A 1J33A 2FAXA 5CX1B 5KINB 4HMOA 1E2FA 3ANSA 5L7WA 3VJMA 1Q7BA 2YRFA 4UM5A 3COWA 2W0SA 3IIKA 5DLPA 4BC1A 4W82A 4EELA 1AGRA 2BFCB 3OZUA 3B20A 3ETDA 4NCKA 4QPZA 5BYBA 4I4TF 2H85A 2ZIFA 2Y68A 5D86A 3USZA 5DW0A 4AJ4A 1WHSB 4TVBA 7ADHA 1RBYA 1A9ZA 2CB9A 2HK8A 2YC2C 3EHEA 4GOOD 1RRGA 3GFQA 3ZU5A 3AF2A 2EEPA 4WUTA 4EYGA 4YRLA 1TFRA 3L8HA 1ZVKA 4C22A 1K0UA 2OQ2A 1XALA 3D4NA 4HSGA 4DA7A 4PNZA 5ICMA 3FHLA 2IXTA 3U1VA 1XN1A 4DOMA 4KR6A 2B4YA 2YIDA 5JAQA 3CYFA 3LA8A 3T9BA 3DOOA 4S12A 3TI7A 3R76A 4OK6A 1XLWA 1KJNA 2W6QA 1K66A 1C1YA 1Z6PA 4BQPA 2B3DA 1UK6A 2SECE 3GA5A 3ZW9A 3H17A 3LX6A 2CMGA 3EOBI 4MKZA 2WIGA 2X77A 3BD8A 2BH2A 3ZV4A 1KDRA 2W6PA 3MG9A 3DE5X 4Y6OA 4PZ9A 1M6VB 3TBHA 3U4QA 1SM4A 3IP3A 5EXDA 2HHCA 3O21A 3RKSA 4HC4A 3H13A 4B43A 3AVPA 4EHHA 4GOLD 1TL7C 2YJZA 3NR2A 5JVDB 3VNRA 1GQSA 5AK3A 4O1HA 2AHOA 3AL3A 1W8DA 2DHEA 3EJ6A 4BFYA 2PKYX 3U6BA 3KFXA 2GXSA 4Q3EA 4F2GA 2PH3A 3JAMA 1I36A 2B35A 3GDHA 1ZJJA 4L75A 2NQ8A 2QRVA 3QX7A 4WXEA 4YUZA 3QVOA 4ALMA 1E1DA 2ZRMA 4BLRA 1SC1A 2Y1GA 4PAMA 1N2OA 1C2YA 4GX2A 4IIXA 4R0VA 1FP1D 1TC1A 2VHQA 3D8RA 3PQ3A 1P0QA 2PJUA 2ZVDA 3LWBA 2PRZA 1HDOA 4OI1A 2VT3A 1QFYA 3AUAA 2O5RA 3U3OA 2HMUA 4MVJM 1YU9A 1KFKB 1N6HA 1NRXA 2J8ZA 3KX2A 4LF7B 4LJ4A 1WBBA 2WWIA 1BMDA 3JYNA 1ZC3A 4L16A 5ALHA 1N78A 4MGZR 1NYRA 1YRQA 2NM0A 3LDAA 4R68A 1BFUA 2CCKA 3PWTA 3IP1A 4DAOA 4RORA 3LHFA 5E1OA 3BA1A 4ISCA 3I9FA 3G2NA 4OKSA 3GAMA 1JAYA 1K1EA 4RGVA 1IFXA 2FPRA 1MUUA 1QTRA 1HE4A 3IX7A 3JQCA 3MT9A 3SF8A 1IH8A 2R44A 4X7RA 1M8FA 2ZRHA 5IDWA 2OMKA 4Q1VA 1NT4A 2C7GA 1OGIA 3S7TA 5FP0A 1V1JA 1Z5UA 4RTKA 3DXYA 3SFTA 4QLBA 1U5BA 3F8TA 4UAJA 1LZKA 1L8AA 4ITRC 5HPYB 3RYCA 2MU1A 3AFOA 4RFLA 1ZM3A 2H00A 1MHTA 1IEQA 3HH8A 4V02A 4KRGA 1LQUA 1WEKA 2IOFK 2C42A 4HAIA 4KDCA 4OHWA 4KL8S 4WLVA 2CHVA 4L27A 4PHGA 2NV6A 4IQGA 1Q5PA 4BTLA 2H17A 3H2KA 3FLAA 5HQ3B 4UEKA 5IM4A 1GCUA 2VSQA 3A6GA 5JH7A 3F6BX 3K31A 2GA8A 2WWVD 2Q9CA 3R6LA 5JYDA 1FDOA 2WUGA 2AV6A 4TLDA 3B13B 1KARA 4NAVA 3WRVA 1EX9A 3P2OA 4NG5A 4RL4A 1SBZA 1YQEA 4NV1A 2Y4NA 3E4DA 2G9VA 5E3IA 2PYIA 1B2LA 4M6WB 1JJAA 3HM9A 1T8TA 1TJ4A 3OD5A 4WA8A 2QBYB 1NSTA 1Y5NA 3FLEA 2IH5A 1YA6A 1WUYA 2REXB 1O94A 5KOJB 4LOJA 2VDJA 4OK3A 1YDGA 2F67A 3B3GA 5FPTA 4BNDA 5LDHA 1NN1A 4DDKA 4J2OA 3BIWA 1ONOA 2KWIA 4KQWA 3ZV5A 4WECA 5HKAA 1DUSA 2FWJA 3O2QB 4EFNA 1DO0A 3P9QA 4UVEA 1WDMA 3OWXA 5JALA 2QJTA 3EVGA 2I33A 3L77A 5ALEA 4MYCA 3VC1A 5JCOC 2GRJA 4MHTA 2C2BA 4QTTB 1M0EA 4OHUA 5F64A 3GV0A 1U0BB 3OIGA 5BXYA 1XEXB 5GJCA 1UPXA 1NF9A 3AEUA 2XOKD 4BNUA 6ADHA 5KNDH 1MQSA 4FFSA 1KI7A 3KG2A 2V7TA 2ZSKA 3NRJA 3RIGA 4MEBA 3UTCA 4CBVA 3IESA 3C6BA 3P2YA 4MVJE 4QICA 4MI1A 3T99A 2QTVA 5ALSA 1PZMA 3OBBA 4L5CA 3N3BC 3DE1X 3W05A 1Q19A 2V6BA 1X80B 3P94A 2VLBA 3I4FA 5JASA 5JZBA 3PNQA 1L7DA 1JECA 1QIMA 2QUAA 3UA4A 2V7VA 2Z43A 4OREX 1IY9A 1T1SA 4Y2JA 2HDWA 1XQ6A 2FSUA 2GESA 4KQGA 4R1NA 1AGYA 3PUXA 5BVGB 2YICA 1HURA 3L40A 3MYRA 3N70A 3O47A 2QGFA 4XR9A 4A91A 1JQLB 3T8YA 5F7XA 5KIAA 3NC0C 4X61A 2A9RA 5EJ2A 4ERNA 3LY5A 3ZU2A 4A1OA 1SOAA 2C9DA 3DMNA 4KPUA 4B3JA 4I4TB 5KB3A 3EEFA 2TMDA 4JBNA 1GNRA 3PRYA 1QONA 1CY4A 2XNHA 1ZGGA 4GM1A 3N59A 3RUDA 3T1OA 1T9CA 3E0QA 2HHJA 2VDRB 2BGTA 1Z0DA 4I66A 2A9OA 1JN0A 5IF3A 2VWGA 3V00A 3W6UA 3FHJA 1SD5A 5HGJA 4DVGA 1TLFA 4EJ2A 1E5QA 1H85A 1OFTA 3EF1A 4FYXA 2ZR7A 1EYZA 1G1AA 1L7QA 1F2UA 4J0CA 1L7NA 1K63A 2XGSA 3P0EA 2Q49A 3DDOA 3IAM1 2DPHA 4JP2A 3PB3A 4AQDA 1XR3A 5KSYA 1IUNA 1AN9A 4MYHA 4C0AC 5KMGB 3K1ZA 2REOA 3LSTA 4M9ZA 2W2OA 5TS2A 2GPSA 1UBEA 2RAPA 4FVTA 2WJGA 2XNKA 2VZEA 1CJVC 2NYAA 3H2GA 1FFCA 2IXEA 4RA9A 3ZCRA 4BFCA 1JALA 2WJZB 4KX3A 1Z4IA 1J9GA 3IA2A 3K72B 3ANNA 4QU0A 1WG8A 3G88A 1PVOA 1L7MA 1QIDA 3P0HA 1AKVA 2OZLA 2WUEA 5ALMA 5AW4A 2PGAA 2ZIAA 2OAGA 2WU3A 1Z13A 4LN1A 3MSCA 2R6HA 2R1ZA 4RPGA 5GM1A 2X41A 2RHBA 1FFHA 1F1BA 1RAIA 1H4SA 1YFJA 4LMBA 1O6BA 2BUAA 2JLXA 3DWEX 3A4YA 3DWGA 4KUHA 1PG2A 3AGPA 4FCTA 3R1IA 1Q7EA 4W5TA 1LPPA 1YZYA 2F43A 3WQBA 5FX2A 2V03A 1QHIA 1WR8A 5J5CA 1VXOA 3DEAA 1NW4A 3T5CA 3HLYA 1YVEI 3VU1A 4PHFA 2VDLB 1BYIA 4ZRDA 3RBZA 2OCBA 3TOSA 4YR7A 4Z9FA 4DDVA 2YHIB 2QRUA 4KQHA 3NG1A 3UJPA 3EGEA 1QGUB 5JAOA 2K2WA 3MIIA 5IASA 1FQKA 5FPQA 2YN0A 4O5AA 1FQOA 4ZOCA 4MB0A 5CDTA 4HGRA 2BFFB 1WSAA 3DC2A 2PX5A 1VRWA 2XF8A 4PLVA 5MN6A 3EUAA 1LPOA 2VPTA 3O94A 2HV8A 4HQFA 3UWKA 1EP1B 4EPTA 2QLTA 1U9IA 2V7UA 2IHZA 1RHMA 3K6KA 4O4JF 1CUZA 3B89A 5U4XA 3CY6A 2X13A 4IIDA 3UCXA 5C8DA 4JMLA 3JXEA 2QUKA 2I71A 3FAKA 3HCWA 1LJLA 3I6ZA 1V8BA 2P90A 3KLMX 5AI9A 5ALZA 3TQIA 3OTOB 3K0EA 3BGOS 4BASA 2CV0A 4CLRB 5TVGA 3UGQA 3TVTA 4DABA 1X7DA 3H5OA 3K70D 2ZDQA 4IG9A 2G5CA 1DBSA 2C5FA 1SMKA 4IIJA 5DLDA 1G5RA 3F5FA 4ZVLA 2NX2A 4YB8A 4AKIA 2FWAA 3GOHA 2WHQA 3EFOB 1DMRA 5LD2B 4QGGA 2FUEA 4D92A 2W98A 1MO4A 1I14A 2ENUA 3VNQA 2V8OA 2ZYAA 2BFEA 2WF6A 4GF5A 2X0EA 4G0OA 4D74A 3SLGA 5CFOA 4XWYA 1N5OX 1KE2A 1L6IA 2H65A 1OGJA 4RTNA 5ALIA 1HTTA 2QN9A 5L3RA 4JEIA 1U7DA 4MMXB 3UKDA 3ZHZA 1PYGA 3F7NA 3PQ2A 5BSEA 1T5SA 3LRTA 1QGOA 4K1LA 3FTFA 4O3FA 4R2JA 2G0TA 3K0SA 1FUUA 1DIRA 1G20B 1QLWA 1VLHA 2HSZA 3A9WA 3H4TA 3MLBA 3OCJA 2QOEA 4U7DA 3L4SO 3LBAA 4A2PA 1GQYA 3DZ8A 3HTXA 1EFTA 3UKOA 1SXJE 2J9RA 1W1WA 1P4AA 1SVWA 5EWMB 4BO2A 3E0XA 4ERXA 5JJBA 3QMMA 4QQ8A 3PTZA 4N12A 5KAMA 2XMZA 2HA4A 1L5ZA 4R9NA 4ZU6X 2SCUA 3VKFA 1A97A 4CYMA 3TSCA 2XQVA 4EUSA 1LUAA 3FFTA 3JCZA 3KUUA 3CBGA 3L1IA 5E4JA 4HDCA 1DOZA 4DG8A 3WTBA 2BRUC 3HCEA 1TUIA 3BMCA 3KOUA 3R5TA 4R8RA 4RZSA 2ID7A 4UNSA 3VR2A 3WLPA 4AC9A 4UCXA 2L69A 1Q7CA 5A4JA 1EP9A 4AJPA 1CJCA 2G9NA 2PEYA 3BWYA 4PGMA 2ZREA 2ZRAA 5HF5A 3WK4A 4CIVA 1C9KA 4Z4CA 3A70A 4TS4A 1D7OA 4YUYA 2WPDD 3FCSB 1YCHA 4L8WB 4XYEA 4E51A 2YXLA 3D6JA 4CEIA 2NOAA 4MICA 3W6PA 4UM8B 1QMPA 3IXQA 1Z4OA 2BUBA 4INOA 4Q9HA 1JHRA 2VG8A 1T0IA 5DEIA 4ADSG 4M38A 4HGNA 3BC1A 2WAMA 4UBJA 4URVR 3KTAB 5CVEA 1W85B 4CV1A 3SF0A 2QG6A 4M46A 4HKTA 4RMNA 2XMRA 2YUIA 4Q9JA 2Z6UA 4WTOA 4N7RA 1ZOOA 3PC8C 1XUOA 3BJMA 1GL9B 5JO0A 5BN1A 1H1DA 2YFKA 3AINA 1Q12A 3KC2A 4OVKA 5LNK6 3JQPA 2VDUE 2GPNA 4JLOA 1N2CE 1D07A 2ZR9A 2ZVQX 3ANLA 1NBIA 3GRRA 4DV5B 2XVZA 4MS3B 2RGWA 1ISHA 1W5FA 3HYLA 3FSGA 5HSGA 3H11A 1W29A 4Z8XA 1E4YA 3MTDA 5ERGB 1XCLA 5H9VA 4BVEA 4Z7OB 1UXGA 1M2VA 2ATCA 4BNJA 4C3VA 3FGZA 2BMEA 3OQOA 4I81A 1CNEA 1WBDA 3REFA 3HL0A 4EJSC 4MARA 2XAAA 3J80A 4KFRA 1WY5A 4LWZA 4JH0A 3FN4A 2GZ3A 4ZEVA 3A6PC 3EPRA 4K9PA 5FTLA 3BGIA 2JGIA 3KYCA 2WJYA 1NPYA 4K2HA 2MR5A 4R83A 1GTZA 3P4UA 4RVSA 4GOND 1GXSB 3L7MA 4MWGA 2QTWB 2R5NA 4IINA 1NOJA 1YKGA 8LDHA 4F4FA 3Q7SA 3VHQA 4F56A 4DWWA 5K01A 1C7ZA 1MEJA 5F76A 2OGZA 2PG3A 5GJWC 1J2JA 4ALIA 5LM3A 2V3VA 4FB5A 9ATCA 4N3CA 3BHMA 3D8UA 4RD4A 5DV9A 1CK4A 1A7JA 2P77A 3UWDA 2BM9A 4XLLA 2HLPA 2I6QA 1TZMA 5AW6A 1VPEA 1WXEA 4YJFA 4CM8B 4HJRA 3JQAD 3OQBA 1A27A 2GM4A 5HZKA 3AOEA 2ZAOA 2XRFA 3HCOA 1YIAA 1GA1A 3NEAA 4FXPA 4BNZA 4BO7A 2RKWA 1CKEA 2E4ZA 3OE7A 3UHFA 3W7BA 1KYTA 3HA3A 4MOWA 1F6BA 5EIAA 4YRJA 4HUJA 1KI6B 3KKQA 4P4LA 3WFIA 4ZO7A 3QENA 5ELMA 2JGEA 5F7JA 4LHEA 5CH8A 1ORHA 3ICCA 2VP5A 4MVJH 4ECAA 4JLUA 1R4NA 1YDEA 2QRMA 2XB2A 4RHFA 5L4LA 3OA2A 2Y9MB 1E2UA 4Y6LA 2JIOA 3AUJB 1Y5LA 1KJQA 1CDEA 2CDAA 5AI0A 4QUIA 3UV3A 2CD9A 4IIEA 5DLEA 4EGCB 4YASA 4M7RA 1IXSB 1GVNB 1OI2A 2G6BA 4O4JB 1GG2A 1ZZGA 4RH0A 4MW7A 5HTKA 3WL6A 2YYZA 1USUA 1G3QA 2B4KA 3PV0A 3JYLA 5DGHA 1EGMB 4BFLA 2H11A 3KFLA 2R7AA 4QDOA 2GCIA 4Q9KA 5E3JA 3WWDA 3ZE2B 4E5DA 5B7NA 1AA9A 1Q95A 2GN6A 2Q3DA 3CH6A 3E4CA 4TV8B 4R2KA 1IK6A 1Y7TA 1X7HA 2XYRA 2ZBQA 5EJFA 4PEVA 3LUDA 5I48A 2EARA 2JI6A 3EIFA 1SIUA 2DT5A 3DDUA 4H4CA 4UUQA 3RD5A 3W9SA 5KC8A 4AN1A 3NIBA 4BVJA 1SQFA 5EIHA 2Z1NA 4OJTA 1N1DA 1NNEA 1M8GA 3AETA 2W2QA 2QY6A 3PK0A 1JPVA 3FDJA 5GONB 5REQA 4CTMA 1SUSA 1ZJZA 3NOXA 1TKCA 3R23A 2V7PA 1IM5A 1MRSA 2DH6A 2OB1A 3JSAA 3B9BA 3QUAA 4J7AA 1CSEE 1L5OA 3S81A 2HRQA 1SCIA 3BERA 5DOZA 5MGNA 1OZFA 5CA1F 2X5XA 1MO2A 2G09A 4KVZA 2C5EA 1LLUA 3TIIA 1DOAA 3PCTA 3OWOA 4U6SA 2OORC 1JKJB 3CRQA 3PRKE 2VHYA 5FUBA 2GA9A 3EXHA 2O6HA 3OF5A 3DQPA 4P38A 4GC9A 5H7XA 2GZ2A 4KQ9A 2HLNA 1HFKA 1Q7RA 3HBLA 3Q9UA 4MEJA 4Y9DA 1YZGA 4IXNA 4UTNA 4XJTA 5AW3A 5A9TA 2PN1A 3RIEA 1O95C 1XTJA 3PDIA 5F2NA 1XMQB 4OHCA 4EHIA 2PCJA 2WJ4A 3FPLA 3PRJA 4OOFA 3LNTA 4YACA 5JRZA 3GLFA 2I0FA 3L8ZA 3AI1A 2I4OA 4D8UA 3JZMA 4B4KA 3C6QA 1BVYF 2ZAYA 4KKVA 3IKMB 1VI5A 2PXXA 5A0TA 2RJOA 3BH0A 3C3WA 3S70A 2ECPA 3C4VA 3JD1A 4PAQA 1BO6A 1MX5A 2A94A 3EGXA 2O7NA 2QXUA 1E77A 3TZHA 4OIMA 1GTRA 1L8XA 2FWMX 2GBLC 2PKXA 4RLQA 4EWLA 2BMFA 1GRQA 3LXMA 1FFSA 4I6JA 1DC6A 4ABTA 5FBVB 3ZY6A 4DIBA 4PICA 4ZAGA 4HF7A 4IHJB 2J9XB 2ARKA 2X0NA 3NCHA 1GILA 3QVSA 4L15A 4LDNA 5L3QA 3WGLA 3Q1KA 1EG7A 1BSVA 1ZSVA 2HXYA 2OO5C 2RONA 1LWOA 4XRRA 1PEYA 3TOXA 5F2OA 4CM9A 3IBSA 3BH7A 4HNRA 2GBCA 3NTUA 4GGMX 4WK0B 1C2TA 4FDUA 3HBAA 4YXWD 3TUIC 4ASUA 1E3WA 3HABA 2IPOA 3CZ5A 3SEZA 4MV3A 3BMNB 1RTTA 4FFPA 4OQXA 5B4VA 3DAYA 4W6QA 3DYVA 2EFJA 2WYIA 1HT3A 4KE6A 4MMYB 3WIEA 4QUHA 3R4VA 2X40A 4GYWA 4FK8A 4BP8A 7REQA 2RCNA 4ZAZA 3T12A 3W5VA 4UM7A 5AVQA 1RYFA 3GNTA 1E1CB 3QY9A 1S3GA 4B84A 1M0TA 3ECSA 4I3GA 1V16B 4N0PA 2UXDB 2C99A 2ACVA 2P2NA 3FVQA 2Y1FA 4N0EA 1KO1A 3E61A 3QVUA 1WTCA 1QDEA 2NZWA 4RELA 3CRMA 1UFKA 4B4UA 4NV3A 2YWRA 3I45A 3ROGA 5KJEA 3VV2A 2G80A 3X44A 5KHAA 2UZ3A 2E85A 1ZJ6A 3BJZA 3LX5A 2JVIA 1R8SA 5I9SA 5C1DA 1M6YA 1IBCA 1LRLA 5AUPB 4N82A 3UB3A 1CETA 5J5AA 5TMDA 4V38A 5DHUA 4DCTA 4G0VA 1ZAKA 3W1WA 3TQSA 3W6NA 1ACMA 1IONA 1LC3A 3GT4A 4FNMA 4X7BA 1JH9A 4TRRA 4LCEA 5AXBA 1VL5A 5IMBA 4E2WA 3B8EA 3LW7A 2X8LA 5D1NA 3C5CA 3GLGA 3M4YA 1X15A 4DMGA 1W7AA 3HKEB 3DE7X 4EB6B 4H7DA 5K6RA 2IV7A 2B6HA 4KV7A 3D64A 2RK4A 3E3OA 2J6IA 4WZBB 4YRPA 3R75A 4ZVQA 4D9IA 4LNHA 3C3AA 2A1IA 1KVRA 2ZRNA 1SC4A 2HXGA 1FBTA 5JANA 2X1LA 1RI3A 3KVRA 2O8FA 1MXHA 3BHIA 4PCLA 2C2OA 2B1JA 3I8SA 4WVFA 3LS2A 3TLXA 4G5YA 3RPEA 4J0IA 1RXIA 2P3OA 5BSFA 4U0JA 5JAHA 1IATA 3OJLA 2ZQYA 3N3AC 3RRXA 3HV2A 2NU6A 4F9FA 2OXTA 1UEIA 2FPOA 3IEXA 3JW8A 2Z5LA 4FYWA 3SJBA 4QUBA 3ACCA 1Z4QA 1GSIA 2QVZX 3CCCA 3HKCB 2W70A 3UWSA 3RNLA 4YAUA 2H0AA 4TYYA 3BXOA 5LC1A 3O9ZA 5JRJA 1BYUA 1IHOA 5TJHA 3MINA 2WIAA 3CN7A 3DBLB 1FP7A 2IY7A 3TLKA 1MB3A 1JTFA 4GP7A 3EB9A 2YQ5A 3IPXA 4L8LA 5SYAA 1Z5GA 2F3SA 3C98A 1OLSB 2HJVA 4WESA 2BIFA 3K96A 4YREA 1KH1A 5C3UA 1EFUA 3LI2A 3OZVA 5H81A 3LQ4A 2QTNA 3ZWKA 1A98A 4WY5A 4OHYA 3SP1A 5CB8A 2ZROA 2EWWA 3PHCA 9MHTA 3C39A 1W93A 5LQAA 1OFUX 3N2GB 4A10A 2FUG1 1X9IA 3LW8A 5EJ5A 1YS7A 2CL5A 4I9GA 4IHAA 4PXYA 4WXMA 1T0HB 3QPUA 4CUKA 3ICQB 1GRVA 3IJ5A 4XSVA 3M1LA 4D6PA 4M9XA 5ECDA 1OSNA 1CCWA 2D7JA 1TCVA 1NOIA 1DG3A 2BCJQ 3HJRA 2B2XA 3IQGX 4WXRA 1JT2A 1J42A 2AXEA 1X7XB 1DAOA 3K94A 5CA1B 3H16A 1E4EB 5TMPA 2GJ4A 5CVVA 2BFCA 1LF5A 3WA7A 3GZJA 2NZXA 2FZLA 3BFKA 1XLUA 3FOWA 2CXOA 2D2XA 2AUMA 4F5ZA 5B57C 4A0SA 3OT4A 4M1MA 3E81A 3THOA 4QJBA 4V1CA 1WPXA 1ONNA 2GH1A 3NKFA 4QTZA 4X90A 3GI1A 4A8PA 4YRSA 2OV4A 3GRPA 4H1WA 3D8BA 3COJA 4PU0A 2H1VA 3IR7A 4FDTA 2Q6OA 3IULA 3PLAE 1A8QA 3SJCA 2FZCA 3TSZA 1QKIA 2FMKA 1A2KC 2OGUA 5ICSA 2SKDA 3HUUA 3U6KA 2QLNA 3DULA 1U04A 1NUPA 3G89A 3QKSB 3RRNA 2WSIA 4IMPA 5G3YA 4HRYA 5A04A 1EM8B 3L9WA 1NR1A 3WBKA 1BMFD 3CLVA 4D3DA 5FTJA 1JHZA 3S44A 1VE3A 3B6IA 2ZK7A 3KQSA 4KYTA 3SHTA 1LU9A 5HQTA 3RS4A 4K0KB 4H7FA 3L2OB 2D06A 3EJWA 4PIVA 5CLGA 5FEMA 3SXJA 4JI3B 3BREA 4YHHB 1E66A 2ZWIA 2YS6A 2HADA 1BGWA 1UJ2A 1I3NA 1Z7WA 4GI2A 1E69A 2QROA 1W88B 1Z62A 4G1BA 2ZYHA 3F8SA 3O0TA 3Q1LA 4IOLA 3VDNB 2FRDC 5DGTA 1Y4UA 4ACBA 5EJ4A 3L7JA 4MV0A 2CE2X 3KUXA 3NTQA 2ENWA 4GUAA 4XQ9A 5TQ2B 1CZLA 4BCCA 1N3LA 5JEEA 5KX5F 5LVAA 2VUSA 1ND6A 3V97A 2IHVA 4F9GA 1C3VA 1YQXA 2R8ZA 2R7NA 3ITNA 2RH8A 1CULC 2JHCA 3K9BA 1XMXA 3P2IA 1N0IA 3HUEA 1U7OA 3QF4B 1OBOA 3TIGA 1KMIY 3Q3JB 2B7BA 4Q4DA 3MIZA 4CV2A 3AERA 1I3MA 2CDBA 2FSFA 3H9JA 1T6XA 5IZCA 1R64A 1UMBB 2BZGA 2ZJ4A 3AR3A 4UAVA 1DIHA 3VSBA 3PDHA 5J2UF 1ZI9A 2RHGB 1KFCB 3SHVA 2NU7A 3BBPA 1W0JA 2WM9B 2O20A 3OE4A 3U3DA 4F6RB 4ZRNA 4Y8VA 4RDCA 5KYWA 2NUPA 1F38A 3IE1A 2JCYA 1TMGE 1E1MA 2VEDA 4NU5A 1CF9A 4FJ2A 4MKRA 1FLDA 1TM3E 2QENA 3PLRA 4HOYA 4C20A 3AUXA 3V5NA 3PKJA 4L4UA 3W04A 4BOYA 1YK1A 1TW3A 4KE7A 4MQMA 1T9GS 3U26A 3VDMA 2G63A 4FHGA 2G36A 4RJ2A 4RZIA 2SKCA 1QIFA 3D6TB 5EWLA 3V1LA 2GM9A 4DYDA 2C5GA 5BR7A 4A0HA 3OFNA 1WKBA 2FEKA 3O8BA 2AKAB 2FKAA 4MVJD 1ZL2A 3GEEA 3BZUA 1DNPA 1H8EA 2GXUA 2ZCUA 3L92A 4FP9A 4BNNA 1C8VB 3OZFA 4FFBB 4NLLA 4P5DA 3OI7A 4I0WB 3EFEA 2VAPA 3EPKA 1HL7A 4ZVOA 3GZ4A 4F3TA 2VPQA 3F1KA 2GDJA 5FTKA 3DVQX 1I2AA 1HOXA 3G9QA 3HMQA 3F3KA 5LLSA 1K7CA 2CYBA 2H9AA 1D0VA 2HCTA 3WDMA 1GZ3A 2CZQA 4BKRA 4B83A 4LRYA 1LW7A 2LIVA 1TVEA 4HN9A 3ZXXA 3DV2A 1MLDA 2NT3A 3HUFA 2O8EB 4HLQB 3BSFA 4BFSA 4NXNB 4WT7A 4B8YA 4GXTA 3VZCA 3ASUA 4QVIA 4RHCA 1DC5A 1NQWA 1XKLA 4URUR 2ZUBA 3QELB 1G5HA 1KP9A 2P4QA 2QAGA 2YZNA 4LXXA 4C1NA 3HN2A 3ZWDA 3LV8A 3A6ZA 5EN4A 3WADA 4NMXB 3DHWC 3CPHA 2F59A 5D5QA 5P8WA 1G6Q1 1RKXA 3GWZA 1M6HA 4X97A 3TO5A 1XEXA 3HRHA 5CEFA 4PXAA 4DPLA 2B4QA 4L1KA 4KQMA 3LU1A 4BFVA 1S7GA 4BQSA 1UDRA 3KQHA 2WNHA 1GNPA 5COAA 3C41J 1W49A 2R8BA 3G0OA 3LCMA 4EYKA 4HAWA 1R16A 5F21A 2Q3FA 2WYOA 4UARA 4L6CA 1QZUA 1VL8A 2O3UA 2ACWA 2Y4OA 5LQRA 5DMXA 3TQFA 1ZMTA 4IXMA 2WKQA 1TEZA 4I50A 4EZEA 5JYBA 2F8MA 5FBLB 4JOQA 2BC9A 2ZSUA 5JV5A 1M8JA 2ASEA 1SG9A 2NYUA 2WOJA 2JA2A 4DHWA 1RLMA 4OPMA 4KXYA 4O6VA 4RTQA 3GLHB 4CTKA 4BNXA 1B0UA 1XTRA 2GAJA 3OECA 4JLJA 2AFIA 2H2DA 1F60A 2I1LA 3LOQA 1FXWF 1NF2A 4V0MA 4C2AA 4TXMA 5B30A 3OIWA 5HKBA 2EYQA 2X1HA 3ME5A 1YACA 1YHYA 4Y2VA 3PHGA 1CT9A 5BVHB 4AY2A 2XQFA 1AMNA 4TKZA 4JT4A 5CFNA 2GJSA 1XOIA 3RVLA 5A7HA 3TGPA 4YO8A 3VDQA 4DV1B 5H8WA 1E5TA 4JLMA 4J7CA 1JFRA 4PQEA 2NXJA 2O9JA 4F71A 1S3SA 1J97A 4M60A 4CMCA 4UCWA 3SC3A 3WYDA 4FE7A 1OLXB 2YJ6A 3IP6A 4HUQA 3VU9A 3ZLTA 2DFVA 5JRDS 1TF2A 3EY4A 2X7JA 2GFQA 3UFBA 3OFVA 3VZDA 2XBMA 4M0KA 5E0KB 4RKYA 4QXAA 4KFTA 2BFBB 2Q4EA 3U7QB 4BLSA 5HKOA 3E23A 4QQKA 3O2JA 1C0IA 4G0XA 5ALOA 2GEVA 2OQIA 5KYGA 5AM1A 1XEWX 4JJIA 4Q19A 4AW9A 4NOKA 4YRRA 1FFXA 5KC9A 5HNKA 7AT1A 5A06A 1B8PA 3MJRA 4X24A 1O57A 1W4BA 2D5AA 1E3TA 2RFLA 2VHUA 4N9WA 5D01A 4BNHA 2POCA 1IZ9A 3OLXA 1AS3A 3AP1A 3ST7A 4JD5A 3GAAA 1NBOA 3KPJA 4IKOA 5CJJA 3OE1A 4IKEA 3KCQA 3R7WA 2AI3A 2QD2A 1P2VA 2ZRFA 4ZC1A 3TCNA 3UAGA 1QV9A 1Y3IA 2FEMA 2QL6A 4MAFA 4EB0A 1N34B 4PPNA 3A4MA 2ZIZA 4RK0A 4EHFA 4F6LA 4BKOA 1PIWA 3UJ6A 2ZZNA 4H7EA 1VDMA 5MDHA 1Z17A 5AIAA 1E6WA 3CH7A 3IT0A 4G09A 4FS3A 4ZO8A 2YY6A 4YAWA 1LSOA 1QTNA 1NN5A 2GEUA 1UCFA 2JJ8A 3FVWA 3MOIA 1Y3CE 4PFKA 5LQUA 1NW8A 4D4HA 2VF8A 1OT3A 3W2FA 1CJMA 1Z2DA 4IQFA 2AE2A 1V43A 5F9HA 2ORED 1DZ3A 4R1TA 4XVRA 2CL7X 2E48A 4GP6A 1RWMA 1JZTA 3GT7A 1UWKA 1UINA 1WTAA 1V6CA 2VRCD 3EAQA 3NBKA 5ETJA 2G8NA 4H4DA 3WHKA 2VP2A 4WJLA 2D5LA 5IJZA 1LVHA 1QB8A 1DE0A 1STOA 3AWDA 3PU6A 4IRUB 2GASA 4UXIA 4C0SA 4DPMA 1H4QA 4G0ZA 4X8HA 5E1DA 3TKYA 3JAKB 3Q7PA 1EFDN 2BFFA 1S9HA 5JNVA 3MD0A 1Y7IA 5CDFA 1JJIA 3FNIA 3IAM6 1SKQA 4DV2B 1KI3A 2G9UA 4CI9A 2FZWA 3LKBA 3CLSC 4F3YA 4AP9A 4DC0A 4TTJA 2WPNA 2J5XA 1MXFA 1FTGA 1ZGCA 4HYQA 4OQZA 3RVSA 2I78A 5FUXA 5GJVC 5AOVA 3E22A 3HBFA 1Z7BA 3WS7A 5HZMA 2ZYWX 1Y5MA 3VZQA 2ZBPA 5CDGA 2ZIXA 5C5EA 3CPEA 3UUWA 4S24A 3R0VA 1Z18A 5P21A 3RFXA 1IJKA 1U5CA 2H92A 1V3UA 3BAZA 3SM9A 4L07A 1Z08A 4KBYA 1Y81A 1E79A 3E8XA 4KE9A 1C7EA 1ZH6A 1MJNA 3LDFA 5CFQA 3NAGA 3K16A 2QX6A 4L6IA 3UF0A 2PSJA 4L22A 3WHPA 2GHIA 5C4MA 2DQZA 1GFIA 3IEIA 3AESB 4AP5A 3A6KA 1SU6A 2FFHA 1XD9A 4RCVA 3TEJA 1UBLS 2I67A 2PLNA 5D1HA 1OH8A 3ESCA 1ISPA 4G41A 2H2IA 3NC1C 5CPFA 4NZZA 2MSWA 3NM4A 4JEHA 3SOZA 3N07A 1RYBA 5DX1A 2IUFA 4B7XA 1TNDA 3N87A 2JAOA 4BMSA 2IU6A 4U9HS 3FNQA 1JEOA 2NV2B 1L4LA 4R9VA 1T43A 5TPWB 1ZR4A 1T2CA 1DQYA 2F1IA 2ZKLA 5A5FA 1VI6A 4QXOA 3J7TA 3M82A 4ZZIA 2PRKA 1VG1A 3A1SA 5ALUA 1XD2A 1X1CA 3H3XA 3O4FA 4YBZA 1UJCA 1W75A 1ILWA 3S2EA 1YQQA 1YZQA 3ZE6A 3L4KA 3ROKA 5EWMA 2A58A 3CZMA 4G9EA 2H1OA 2OGSA 1JAHA 3CG4A 3PIDA 1S89A 4GRDA 2VNSA 1CQXA 2P9BA 1ZVVA 1EXDA 5FD8A 1EDDA 1U2GC 1QFSA 3DP7A 4CJXA 5I4KA 4DUYB 1IDOA 1Z0JA 3RBXA 4W5WA 1HFJA 5GMOA 1L1EA 2QE7A 4EEXA 3LO5A 3HLTA 4XDYA 1Y1QA 2FW8A 3IPLA 3AFIA 5E6UA 1ZN7A 2OMEA 5DJ5A 4B74A 5JMTA 1PGOA 1OV4A 1TU3A 3FETA 4N6NA 3HJFA 5FUYA 5EXTA 4GH5A 2P9YA 1ZOPA 4G8BA 2Q4DA 4E5KA 2A86A 5BWMA 1XNGA 4DR5B 2PUEA 3PUIA 1IUKA 3IQFA 1JQJC 1BHSA 4I5IA 2XQIA 3GGPA 3OHSX 4A03A 2OHXA 5IT9A 1GUDA 5EJGA 4JUFA 4JV5B 2E4XA 2ZJ7A 3OJFA 1CBUA 3LY8A 1XMJA 3ZHVA 2O8VA 5HRUA 4BPBA 1QH1A 1YH3A 2RGDA 3KTAA 2I22A 4XUDA 3DCIA 4OSEA 2Y67A 3EVEA 2CEKA 1XTQA 2I2XB 2HIHA 1O94C 3H3JA 5TQJA 4A0QA 2O1SA 3DLCA 1DAEA 1OI7A 2COEA 2A9FA 2WU0A 2CB0A 2WKSA 1SCJA 1XQWA 2XQJA 3C1TA 3KU1A 5SYNA 1H05A 1PHRA 4LSGA 1G66A 2Q3MA 3ETHA 1K2WA 2BEJA 5DNDA 5G1PA 5BV0A 3QWAA 2QTTA 4YJ3A 5J5VA 4OJNA 5K6AA 1PLKA 1U2SA 5HG0A 1K4MA 1E5DA 2CJPA 3CR3C 3GG2A 1RW4A 5ENDA 5BOVA 5KNCH 4HQLA 1RC0A 1HT2E 1W4CA 3B2EA 2I2WA 1NJ5A 5M2QA 4JWKA 4C5AA 5J1SB 4LOLA 1JMYA 1Q0QA 2FVXA 4MJ3A 4ZVTA 1B00A 1EWYA 1XCBA 2WMYA 4MVJF 3DEYX 4FWBA 2XA2A 4OBXA 5DGIA 1ST3A 3UC9A 1XQ1A 3WL4A 5K0ZA 10MHA 1UUFA 4QOHA 5EMLA 2VK2A 2BGGA 3IHWA 3DS8A 1PVVA 1XZQA 4EMUA 3CVUA 1PV4A 4DA0A 5DOVA 1SB9A 3B5JA 1J0CA 1LDNA 4X44A 4DEVA 3VBCA 4ZI2A 1NA5A 2IZ1A 2F4VB 1H1LB 2FUNB 1NE2A 2H4FA 2RHWA 5JAMA 2IXFA 3P2MA 1E9AA 1BTOA 1N0WA 1XTUA 4POAA 2IWRA 4AN4A 2C8JA 4YMHA 1T9AA 5DBIA 2YY5A 1WMDA 2XMDA 2Y77A 1HNNA 1Y9DA 3F7OA 3ZWVA 2DKNA 1E2BA 5HIJA 3N8DA 1F3LA 1T2AA 4FPXA 1A8PA 2C61A 1GPDG 2YBEA 3ZDAA 2CVHA 5B1HA 3BB1A 5DCUA 1C30B 2HCFA 3TECE 3OQPA 3EQZA 4CQJA 4HUTA 3U4CA 2B1QA 4JKOA 4N40A 4B5KA 3SNHA 4CM8A 3SU8A 1TQ2A 1E5VA 2ZUDA 4D1YA 2D0DA 3V1YA 2O2GA 4V0NA 3USCS 4FDAA 1TT7A 5B3LA 4DCUA 4XUCA 4MUEA 2ZR0A 1RQ2A 4UBLA 4CFZA 4FLFA 4HV4A 1HPLA 1KVSA 1RJDA 3KYIB 1AKQA 3SR0A 1JWLA 2HK7A 2XI4A 4NCXA 1Y7LA 1Z7YA 2B92A 3CLUC 4DANA 4DW8A 3LT2A 2XAUA 2CXPA