4RTQA

Complex of escherichia coli dna adenine methyltransferase (dam) with adohcy and a 5-bp non-canonical site (gttta )
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
270
structure length
246
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSASFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
total genus 86
structure length 246
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtqA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtqA01
1M6YA 1X1AA 1VIDA 2FPOA 3HA5A 4K6MA 1XTPA 1KYWA 1QANA 1SUSA 3GGDA 5BXYA 5LQAA 4MHTA 3PFHA 1NBIA 4M7RA 1VPTA 4GBED 3FUVA 3C3YA 3PX2A 4CKBA 4YUZA 2NXNA 3BWMA 1P91A 4QPNA 3P2EA 4KIFA 2PT6A 2V7EA 2A14A 4X60A 1BHJA 2AN4A 2FHPA 3B7PA 3HCFA 3MTIA 1X1DA 2G1PA 4E2WA 2QRVB 2PLWA 4C03A 4YMGA 2GB4A 1NW3A 2B25A 3QV2A 4KDRA 1XDZA 4G56A 3EMDA 3EVZA 3KQQA 2BM9A 1G55A 2PVCA 3F4KA 4HC4A 4RTPA 5F2NA 3GRYA 5FUBA 2Q41A 2Y1XA 2P7IA 1UIRA 2AOTB 4R8RA 5FCDA 4DF3A 4MTLA 1IM8A 3QOXA 5ERGB 3B3GA 3ID6C 3P9CA 3I9FA 5EEHA 5LQKA 4QVKA 1RI5A 4AX8A 2ZZNA 4ISCA 3BKWA 5CVVA 1NV9A 2IBTA 1VQ1A 2OPBA 5DX0A 4CTJA 1RI4A 4HGYA 5HIKA 3G5TA 3OE4A 3IHTA 3KPWA 5EOVA 4PCAA 1L3CA 2E5WA 3OU7A 5GWXA 5P8WA 4BLVA 3BWBA 1JG1A 2JH9A 4B17A 3EPPA 3LSTA 2DPMA 4DCMA 4EK9A 5FQOA 4YMHA 5IKMA 3KR1A 3EVBA 3FPHA 5JR3A 1R6AA 5EZSA 3TQSA 1INLA 1SG9A 4AZSA 3BGVA 4M36A 1IXKA 4E33A 3HVJA 3EVGA 3C6MA 4XUCA 3LL7A 3FPGA 3M6VA 2Z6QA 3DLIA 1TW3A 3PB3A 2HTEA 1L9KA 3SVZA 3LKZA 2P35A 4DQ0A 3KHKA 2IH4A 5K0FA 1SKMA 3FUUA 2O07A 3DUWA 3LCUA 4PYKA 5DM1A 5DSXA 4U7PB 5F2KA 4GQBA 3DR5A 4YUWA 4GEKA 3LBFA 5DT2A 4FT4A 3OFJA 1R00A 3CJRA 4MIKA 5DXJA 3HNRA 2EX4A 2EFJA 3P71T 3GJYA 5JUWA 1ZGAA 5EZQA 3FUWA 3UJAA 5CUQA 3M6XA 2F8LA 2QE6A 3CJTA 5F2OA 2HWKA 2IDJA 4MQ4A 5BP7A 1N7IA 1V39A 3IV6A 4PYLA 3DOUA 2PXCA 2IDKA 2PX8A 4ZTBA 3LECA 5K0JA 3KQVA 7MHTA 1X1CA 3K0BA 4PGGA 3GRZA 1B42A 2FK7A 3T7SA 2PGXA 2I7CA 3CC8A 5T6BA 2OY0A 2HNKA 3G7UA 4QPPA 1RI2A 1XVAA 5EG5A 3LDUA 4RX1A 3P9NA 4GOMD 4X1OA 5FA5A 5T64A 2FYTA 1F38A 2QRVA 3HCEA 1JG3A 2ERCA 2OBFA 3KQTA 1DUSA 3MCZA 4KW7A 4QDJA 4E2XA 5GIPE 2K4MA 3PX3A 5K0CA 4R6WA 5EIWA 3FTDA 3O7WA 5GINE 3ELWA 2HV9A 3HA3A 3GRUA 3G2MA 5CIYA 1WY7A 2IP2A 3L8DA 3UFBA 4RTKA 2QYOA 3G89A 2PSSA 1KPHA 1EIZA 3HVIA 4YUXA 1WG8A 3C6KA 5K05A 4BLUA 4KRGA 2GAFA 4CWAA 4FGZA 2IGTA 1VBFA 4F84A 2Z6AA 1VE3A 3UJDA 5HIIA 3HM2A 5HOQA 4IWNA 2NP7A 5EMKA 2OYRA 3TKAA 3BXOA 1U2ZA 2V74B 2AOUB 2AS0A 3KQSA 4YUYA 5M5BA 1JTEA 2B9EA 3FYCA 1O9HA 1Z3CA 3HCBA 4IV0A 1ZKDA 3C3PA 4ER7A 4HH4A 1N2XA 2ZW9A 3MGGA 4MWZA 1XXLA 2ZWAA 4EVIA 3M4XA 1L1EA 1P1BA 2PXXA 5E1BA 5K0LA 1I9GA 1FJXA 2R6ZA 3KPVA 3ER8A 3TRKA 5K0BA 2XVMA 2ADMA 3E8SA 5CVJA 5C1IA 1N7JA 4PWYA 2YTZA 1JTFA 3QOWA 5CVUA 2CKDA 3DMFA 3G2QA 4RTJA 2ZFUA 5DRTA 2PX2A 3NJRA 5LSAA 3CBGA 4FSDA 3DTNA 5FHQA 4C04A 1R8YA 2CMHA 3R9XB 2JJQA 2O06A 3GDHA 4P7KA 1Q0SA 1EJ0A 2XVAA 1JSZA 4YV0A 4JXJA 2AOTA 3B5IA 3HVHA 1KP9A 3A7EA 4L7VA 4PYNA 3AWIA 5DPMA 5HEKA 1JQEA 4P58A 3ER9A 4PCLA 3V8VA 1XCJA 1G8SA 2G71A 3HCAA 3PS9A 4AZTA 2ZCJA 1YUBA 3MB5A 1FBNA 5DRYA 3T0IA 3O4FA 2B3TA 3G88A 3JWJA 3UJCA 2P3LA 4LECA 4XUEA 3I5UA 5E9QA 3SSOA 1T43A 2Z6UA 1WXXA 2NYUA 2P1DA 2YXDA 3VSEA 2YUIA 1NBHA 4A6EA 4DMGA 5K03A 1NT2A 1D2GA 3O31A 4WXHA 2IH5A 4DZRA 1NE2A 3UJ9A 4ATNA 4X41A 10MHA 3CCFA 2VS1A 2QM3A 3DXZA 5EHIA 3S68A 5BW5A 2IIPA 3A4TA 3R3HA 3KR0A 4FSXA 5EC8A 2HR1A 1FP1D 3DXXA 2AOWA 2ZSUA 4OQDA 1I4WA 1SQGA 5K0GA 3NDJA 4POOA 1MHTA 2QY6A 1KXZA 2PX5A 4HTFA 2XYQA 1JQ3A 4P7JA 4RSRA 1H1DA 4C05A 4BP3A 4BP1A 1PRYA 5DM4A 5K0EA 4RVGA 5CCXA 4PINA 2UZ4A 1ORHA 3RODA 3EEOA 2OO3A 4RTSA 1EQAA 1P1CA 1KIAA 4IKPA 2FK8A 1EJ6A 4R8SA 3LGAA 5LQUA 1TW2A 5FQNA 5HFJA 4Y2HA 3GIWA 3KR9A 1EAMA 2AVDA 3P2IA 4PYOA 2UYQA 5T67A 1O54A 5DLYA 1D2HA 1HNNA 3SR4A 1YB2A 2PKWA 5DM0A 3A25A 3Q7EA 3FPJA 4HRAA 4QTTB 2OXTA 4CKEA 1RJGA 3FRIA 1NKVA 3JWIA 4Y30A 3K6RA 5K0NA 2VDVE 3ERCA 1VP3A 2XBMA 3HEMA 1AQJA 3EEYA 3AY0A 1G38A 1KPIA 4HGZA 3UA4A 1NV8A 4DCGA 4YV1A 3FTCA 3BGIA 3RW9A 3IEIA 1XJ5A 3ELYA 1UFKA 2BR5A 2H1RA 3LHDA 3LKDA 1YF3A 5FADA 1Y8CA 4WVLA 3MTEA 5IH3A 3TLJA 4AZVA 3PLAE 1QAOA 2EJUA 3OU6A 2AZTA 4QQNA 4HTFB 4E2YA 3UJ7A 1VP9A 2WA2A 1QAQA 3E7PA 3ORHA 1EG2A 1BOOA 4RYLA 4U7TB 4RTNA 3KPUA 5E1DA 3TM4A 2H00A 3GXOA 4UOEA 3FPEA 3EGIA 5B1SA 2BR3A 3H2BA 4C07A 3OFKA 4OBXA 5E8JA 3ME5A 1TPYA 1FPQA 5FA8A 3REOA 3LCCA 4V0RA 2ZWVA 1AF7A 2GLUA 3PFGA 3AXSA 4PYJA 4ER6A 1ZG3A 2IBSA 2OB1A 3DMGA 4Z2YA 3EMBA 5D1NA 4PGHA 4KDCA 3VC2A 2PBFA 3B3FA 3G8BA 3IYLW 4PIMA 1RJDA 3MAGA 3OZSA 2VDWA 4LWPA 5FHRA 1QYRA 3BWCA 2BM8A 2O05A 1ZHFA 3AXTA 4X63A 5CM2Z 2Y1WA 1FP2A 2FCAA 3P9KA 2UYCA 4F86A 4PNEA 5LR6A 3HCCA 1R8XA 5EVJA 1ZQ9A 3BWYA 1SUIA 2KW5A 3BZBA 1NW5A 4E32A 1G60A 3M6UA 3KQMA 5GM2A 4KVZA 5GP1A 5EMJA 3UZUA 5ICEA 3UJBA 2G70A 4R6XA 2PXAA 5D1HA 5HZMA 3P2KA 3MHTA 5DM2A 2NP6A 1WXWA 2P3OA 3FRHA 4C4AA 5EKXA 4BY9E 2ZVJA 2B78A 4GC5A 3BKXA 2IH2A 3DH0A 4QDKA 3SX0A 3KPYA 1DL5A 3OZTA 3AJDA 1QAMA 5GOZA 3LBYA 5E8RA 3TMAA 1YZ3A 4P7GA 3M33A 3MCTA 4FP9A 1L3IA 3ANXA 1KHHA 2GS9A 4RVHA 3UJ8A 5E9JA 2JHAA 2ONYA 2BH2A 1O9GA 2PWYA 3M6WA 3B3JA 3R0QA 3JWHA 5EMMA 3TKYA 3KPJA 4EKGA 3KQWA 1VL5A 5LQNA 4GOND 2IFTA 3E05A 4M37A 4DM3A 4PIPA 4EQZA 5K09A 2ZZMA 4RTQA 1KR5A 1WS6A 3FPFA 5EQJB 4EMSA 4AUKA 3D2LA 3OZRA 4XUDA 3BUSA 5FWDA 4FZVA 3LX6A 3E23A 3CGGA 4DKJA 2EJTA 3KQYA 3CJQA 1BC5A 4RTMA 3LPMA 3B89A 4RVFA 2H11A 2LD4A 3TPZA 3GNLA 4PYIA 5H02A 3UWPA 3RIEA 5DSTA 2GH1A 3EVEA 5DX1A 3HVKA 3G5LA 5DX8A 5DTRA 5ICCA 3FUTA 4R05A 4CKCA 3DXYA 1AQIA 1XDSA 3TR6A 4E31A 2ORED 1X19A 1I1NA 1RJFA 4LG1A 2EG5A 2N47A 4IV8A 5EGSA 3PTAA 5KS2A 3M70A 3NTVA 2JG3A 5KQRA 3JWGA 1M6EX 3P9IA 2P7HA 2VP3A 3SM3A 2XYRA 4YUVA 3BT7A 3GRVA 3NDIA 5E2BA 3PVCA 2AOVA 3GRRA 3SXJA 3SSNA 2P8JA 4GC9A 2VZ9A 3SGLA 5GIOE 2NXJA 3R24A 4C08A 2GA9A 3THRA 2YVLA 5G02A 2YXEA 5K01A 3KR2A 3P8ZA 5HIJA 3NMUF 3EVCA 1UWVA 3KQPA 4H0NA 1YZHA 4RV9A 2NXEA 2I9KA 4OBWA 2ZIEA 2AN5A 2FRXA 2ZULA 4QQKA 2C7OA 2P41A 2AOUA 2R3SA 3U81A 1JR4A 2O0LA 3OU2A 2NXCA 4GOLD 2WA1A 1NW6A 1JG2A 2ZIGA 4OA8A 3A7DA 2ZZKA 5KQSA 3R6TA 5MHTA 3BGDA 2YQZA 3I58A 4M38A 4PONA 3MQ2A 1SQFA 2ZIFA 1XDUA 1X1BA 2ZBRA 3EVAA 2YXLA 3NW9A 3NWBA 5ICFA 5EMLA 4ER5A 2OZVA 3NVMB 4RTLA 5C9ZA 2YX1A 3TM5A 4RWZA 3DULA 5KVAA 3FTEA 1NW8A 3PT9A 1NW7A 5EPEA 3HP7A 3SSMA 3DP7A 3G2PA 4E2ZA 1MJFA 2DULA 3KU1A 1YFLA 3G8AA 4PYQA 4C06A 4OQEA 3DMHA 5CVDA 5ICGA 1JG4A 4ER0A 2PV0A 3GWZA 4QTUB 5EEGA 2HMYB 1F3LA 1KYZA 3EVDA 3UBTA 2ZLBA 2BR4A 3A27A 5C0OE 5CVEA 1L3BA 3THSA 4F85A 8MHTA 2G72A 3CKKA 4OX9Y 1AV6A 3T7TA 2CWWA 4E70A 4HSGA 1ORIA 2CMGA 4QVGA 1HMYA 3C0KA 1RJEA 2ZBQA 4XCXA 5HILA 4RTOA 1P39A 3FTFA 4KWCA 3EVFA 5LQRA 3KQOA 1R74A 3GU3A 3UJ6A 9MHTA 3OCJA 2ONZA 2UYOA 1SVUA 1PJZA 4OA5A 3HA7A 5LQCA 4YV2A 2OKCA 1VLMA 3LDGA 2BZGA 5EHGA 4FR0A 5DXAA 2GPYA 5E2AA 1ZGJA 2VDUE 3EGEA 3I64A 1WZNA 3OPNA 4GOOD 3UA3A 1XCLA 3HCDA 4RVDA 1RI3A 4DA4A 4BLWA 2AOXA 1KPGA 2I62A 1DCTA 1D2CA 5K8VA 4KIGA 2UYHA 2JHCA 3VYWA 4LWOA 5E1MA 1M0EA 2JH8A 2C7RA 4V0QA 5FULA 4O29A 3SMQA 5CCBA 5DTMA 5DTQA 3Q87B 5GM1A 3G2OA 5U4XA 3EGVA 3GCZA 5E1OA 5HIMA 3DLCA 5E9WA 1JQDA 2I6GA 2OB2A 4PYMA 5EIFA 5EKUA 3HTXA 1QZZA 3NWEA 5FTWA 1IY9A 1YFJA 3VC1A 4X61A 4FT2A 2P40A 1Q0TA 2PWPA 2ZBPA 3FYDA 3GO4A 4E30A 2O57A 2CL5A 3V97A 3ELDA 3WSTA 4HG2A 4CTKA 2AR0A 2AN3A 1G6Q1 2AVNA 3CVOA 3X0DA 2WK1A 3TOSA 2PJDA 3KKZA 5FWAA 1R18A 2ESRA 4FS8A 2PT9A 2P3QA 2YR0A 4CXMA 3A26A 3ELUA 3OE5A 3LDFA 3MERA 2ZTHA 4AZWA 4P7FA 5CD1A 4GF5A 3FUXA 4A6DA 3I53A 3FZGA 5BW4A 2PX4A 3T7RA 3LCVB 2G8NA 2B2CA 4GUAA 4EKIA 2PY6A 1BKYA 4NECA 2IPXA 2C7QA 2NNWB 1RI1A 3P97A 1G8AA 1OR8A 3TFWA 2JHPA 5LQJA 3NVKI 2XYVA 5DWQA 4ER3A 5KYGA 4RTRA 1JSXA 2C7PA
chains in the Genus database with same CATH superfamily
4X93A 4S1NA 4MVWA 1X2BA 4PXYA 3RSLA 4QDTA 5MDHA 4TYMA 1I51A 1T9GS 2YS7A 1KAEA 3M4ZA 3NC1C 4NIMA 3UC5A 4BE7B 4ERNA 4MHTA 3AJ9A 4RMIA 3WP0A 1I36A 3B82A 4PRLA 1RCFA 2NO6A 2V0CA 3CX3A 3GJ4A 3IPXA 1U7ZA 2BFNA 1U3CA 4RACA 5D5PA 1ZS9A 3CM0A 1QQAA 2CB0A 1VHTA 5JYEA 2OA0A 5C1OA 3HL4A 1R5OA 3OP4A 1NW3A 5T57A 2PUFA 4IH9A 4HUQA 2BHLA 4BN5A 1IZ8A 4XYBA 3PFCA 4KEAA 4R0VA 2BM9A 3CRZA 5BN1A 2V7PA 4R8RA 1UIRA 5F51A 5D2CA 3TTSA 4OK3A 3DLPX 5EIAA 3QBDA 1KJWA 3B3GA 5BXQC 2D5AA 3MCVA 1VL0A 2D13A 3LGSA 4BTVA 1GU0A 1V3VA 4AX8A 2HT1A 2EEPA 3CG4A 4I99A 2XR1A 4OMCA 2C2OA 4Q5IA 1PVOA 3BQNB 4LFBB 2ZAYA 3KTOA 2PH5A 1KJNA 1Z83A 3CWCA 3V8RA 5GWXA 1MEEA 4CIVA 1BWPA 3M5DA 3AY6A 3ODGA 4YRQA 1ZFNA 1INLA 4BOYA 4WWHA 3WVNA 5B58C 4X24A 4FFVA 4CL8A 2Z6QA 1V43A 2GZDA 1LDBA 2I8LA 4GYJA 1TW3A 2RI0A 1ZD5A 4HJRA 3IUYA 2J6CA 3RTCA 1MV8A 4ZRDA 2VJNA 3LKZA 3K53A 3RLIA 3U6BA 1JGTA 4NPAA 4ZJZA 2AR7A 4NCBA 5CXUA 4M0MA 3WRYA 3TH5A 2OT3B 2FE4A 3BFJA 1KMHB 1XROA 4HZUA 3DR5A 4KPUB 1PFGA 2D06A 4E21A 1EM8B 3PIRA 4DJTA 4WFIA 2H16A 3I0ZA 4CM6A 4NJMA 5DLDA 3PRKE 4JITA 2WTUA 1FUYB 2KYRA 1AQYA 3EJ6A 3RGWS 3VX4A 3W2GA 4PYLA 3RJMA 4OH1A 1QH1A 2SCUA 1ZM9A 1UBNA 3BJIC 3CB4A 3LECA 2IDZA 4Y0NA 3SQMA 2PWZA 4J2HA 1L7EA 3KFLA 4CM5A 4YRZA 4ZT6A 4XI9A 3IBFA 1NP3A 4QPPA 2PZJA 1UJ5A 4HD8A 2C2HA 4GOMD 5H9WA 2OBFA 3F1KA 1JW9B 5JJKA 3AZOA 1GLNA 2X8WA 4C0WA 1PK9A 4BNDB 1E3LA 4N41A 5LCXA 4EW6A 4DR3B 1NDUA 3HHEA 2OQ2A 2WNIA 4JA2A 3QLUC 3EGDA 4P53A 2WP0A 3HR8A 1O58A 3WGTA 4G81A 1J7JA 2LKCA 5L7WA 2PANA 3G9QA 1Z2DA 4NAHA 2Y6VA 4IOLA 3DV2A 2HA4A 5HQ3B 3F90A 1M2HA 3IAXA 4YJ2F 4G0XA 2WU3A 3KUDA 5IF9A 2ZKLA 3PJGA 3OCVA 1XXHE 4RAQA 1MJNA 2NU7B 2VWHA 4BBJA 4DE5A 5BVGA 1XTKA 2A8YA 3U1VA 5HBGA 3RVMA 2XZLA 2PH1A 3S29A 2B4YA 4MR8B 2GO7A 4EHJA 2AGVA 1YB4A 2ZDGA 4L8VA 4PXAA 2GR9A 2A9KA 3STXA 3QA3E 1ZN9A 2TECE 1SXHA 3BH6A 1Z2PX 3C1UA 1ZGBA 3KZVA 3WKDA 4EO4A 3EIOA 4IRMA 2X19A 3KNZA 4DR2B 5JAMA 1L4GA 1BGVA 1Q7BA 16PKA 5MN6A 3FBTA 4MR9A 2N0SA 3B1WA 4CEIA 1SHKA 1O94C 2IYLD 3S8EA 4Q3EA 1WPQA 2GF9A 2ADMA 2F3PA 2VRCD 4R54A 5BUQA 1GCUA 2AN1A 2YTZA 3QHQA 1V6AA 1FPMA 2ECFA 2G06A 2FPSA 2LTAA 1BWQA 4M7PA 5JAOA 4W1SA 3TVDA 1M33A 3QXJA 4YK7A 1B1CA 5AICA 3GJ5A 1CJVC 4MRPA 4UDXX 1GKUB 5ITVA 5EJ9A 4JXJA 1E9SA 2H57A 2P6PA 1EINA 4L7VA 3ZGZA 4HNRA 1QWOA 5I5GA 3K31A 2W2LA 3DBRB 1L5OA 2GOYA 2OUIA 2PCLA 2WM8A 2ONCA 5B3LA 4TRMA 2A7XA 4H7HA 1A9PA 4HJXA 1TEXA 4L5CA 5JALA 1TF7A 3G88A 2OHOA 5THXA 2V5AA 1D03A 5EPOA 2GYUA 3E0XA 2RHDA 1DSSG 3VR6A 3HI4A 2COUA 4CMIA 4US1R 4RDHA 5AVJA 4A6EA 5BY2A 3VA7A 1Q17A 3FNRA 2H17A 2OWDA 1HE8B 4OK5A 5K4HA 4PR3A 3W5JA 2RFLA 5KB3A 1IMJA 2XAUA 3QELB 4HDSA 4X41A 3E5NA 3Q7TA 1OB5A 4V1CA 2JK0A 8ATCA 1H3FA 2R6DA 4IHAA 1JE0A 4KQ9A 4Y6PA 5KYYB 1P9RA 2R7AA 2XDQB 5EXTA 5BSGA 2COEA 1V41E 4F6CA 1MHTA 5ILOA 1OIWA 2GLXA 2C2KA 3EY4A 2PX5A 2R5WA 4HTFA 1V5EA 3WY9A 5CB4A 4GVLA 1H1DA 4RVOA 1UFOA 2R1VB 4XDZA 5KKNB 1WQ3A 3AK4A 5K3SA 5D3MA 4R0MA 5LQUA 2CSXA 1YB1A 1FYWA 1GP2A 2E87A 5U9CA 4II7A 2AVDA 3IBCA 1UZLA 2V9PA 1AMOA 1T3SA 2B20A 3GNQA 2FFRA 5J5VA 4ESVA 2J32A 2UZAA 5AKJA 5FF9A 1CCWA 2CEKA 5CJJA 3DVRX 4UC0A 2VDVE 1D04A 4J0FA 1L4BA 3U3MA 5F98A 3THXA 3ZV4A 3UA4A 2NUAB 1DC8A 2OFWA 3WYAA 1UXKA 1RQLA 2BY4A 2HJGA 4W5OA 3NHLA 3RW9A 2C00A 3COJA 1GTRA 5ER9A 1ZCJA 1XJ5A 2GF2A 3IEIA 2CV1A 4AKGA 5CTJA 4JUFA 5A7HA 4BTLA 1QAOA 1TTHA 3EGXB 5GY7A 4QQNA 3LO8A 4ARSA 3EZ7A 1J9ZA 2JZNA 5JZBA 1DV1A 3HKCA 1BHQ1 1Z5ZA 2D7JA 4D97A 3I9V6 2J6HA 3DB2A 3H2BA 3D6JA 1FOEB 5AJHA 4BPRA 4ZKDA 1EFPB 3HPRA 1GCOA 1UC8A 4PC1A 4A27A 1QH8B 3L8EA 1JDZA 1SBIA 1XJWA 3OJOA 4ZCQA 3LCCA 1AF7A 1PFYA 3AXSA 3QGMA 4FYMA 4MKFA 1W1IA 4XM2A 3HKDB 3U4GA 3PQ7A 5A03A 3K0SA 4EJ6A 1FMTA 1KJIA 2ZSKA 4R5HA 3RK0A 1E2MA 2I6XA 3P26A 1N8NA 5AHRA 4G0PA 1Q7CA 2VDWA 4BNLA 1YMQA 1LH0A 4I8DA 3ZWDA 2YFQA 3SC3A 4TLBA 2AEFA 1ECCA 2DQYA 1TVEA 3MBIA 1Y1QA 1Q0LA 1M6VB 3ZN2A 4GSKA 3TW4A 4WERA 1SA0B 2W2MA 2GFQA 5LR6A 3BIOA 3HWWA 1I6MA 1I7PA 4WECA 4YI5A 1ZUWA 1ZGGA 4JJ8A 3ZBTA 3ZD6A 3WLFA 2HO4A 3K0HA 3L6BA 2NLOA 1UXIA 4KE6A 1KNXA 1IRIA 1KY4A 3D4NA 5GOTA 4JSTA 2RGYA 4UATA 2AL7A 2NIPA 2VATA 2XMRA 3CTMA 1N6LA 3IX7A 2X0IA 3NT5A 4ILKA 2ZRPA 4R84A 3AM1A 1XRLA 3W8FA 5EKXA 3IA2A 4EYKA 4GZMA 4UXJA 1C5KA 4WNCA 3KPYA 3ZQJA 1AMUA 1O0BA 1PO7A 5GJWC 3V8QA 4UAJA 5C3UA 1MBZA 1S4QA 3LBYA 4PZ9A 3NKVA 4I50A 3PU6A 1ZLYA 1B2LA 2IITA 4F97A 4KQFA 1G8FA 4OQPA 2WT4A 2Z4TA 3DPIA 5BPHA 4K6GA 4ZHSA 1I4TD 5E7MA 2I78A 2DT5A 4YTEA 3LQ2A 1RBMA 2EJVA 3AEQA 3N3AC 2UV8A 3OFNA 1ND5A 3BMQA 1DBRA 1VSTA 1Y9DA 2GJSA 4HQKA 3TD2A 4ZYUA 4LF4B 3OT4A 3E05A 2ZTLA 5ALFA 4EY4A 4Z4EA 2YMPA 1CX9B 3RS2A 3HDYA 3DO8A 1C0EA 2ZB3A 4I1YA 3OZRA 3CLTD 4TLMB 2NQTA 2BKLA 1JHQA 2D1QA 5FYDA 3T52A 4BX2A 5EN4A 2QRZA 3GJRA 3ZGVA 4CLRA 4H3VA 2XRZA 2W90A 1JR3D 2GN2A 3PXUA 4YECA 1FW6A 2QUAA 4I1SA 3ZNOA 3OY2A 1AM4D 2XOKD 4G36A 3BD6A 2FOXA 1C8LA 2O8NA 1V16A 4YGXB 3C6QA 3A1UA 1GV0A 1DXQA 4GBMA 2BTQA 2P77A 3G5LA 3LQ4A 3FUTA 3L0SA 4HGQA 4R98A 1JT9A 5B30A 1R37A 4EGSA 2XUAA 4ZAFA 3MWEA 3E9MA 4I1OA 4OQXA 4YASA 2YHIB 4O8CA 3JWGA 3ABZA 3KL2A 3H9UA 4W7HA 3TBFA 4CQMD 1NAIA 4ZC8A 1ZK1A 5BOSA 2CT8A 2H4HA 4BCDA 5C8YB 2WWTA 3AEUA 3AR5A 4MV4A 3K6SB 1YV9A 2LDBA 1U0EA 1B8UA 2WQZA 1WMFA 3DNMA 4GXQA 3L6RA 2YZNA 1XTZA 3LUBA 1QFJA 3F8WA 4MVJE 4FD2A 2QMEA 2HU2A 3AYXB 4GGOA 3PQ2A 2C4UA 2QN6A 3P8ZA 3K2IA 2IODA 3TIIA 4DYHA 1UWVA 2C2XA 3KSRA 3N07A 1RT9A 1Z37A 5KMGB 1R2QA 2HJSA 2C95A 4K88A 3W6PA 1BO6A 2W6PA 1K5DA 2H0AA 2NAFA 4RZQA 4NARA 3HBFA 4Z0PA 1A72A 2O0LA 5GJBA 3IUBA 4LYJA 3SYLA 1TOAA 4PG4A 4WXMA 2W4QA 4XJSA 3B7WA 4JXXA 2DH6A 2H48A 4ZWNA 3VO2A 4EPXA 3ELBA 3DTTA 3SBOA 1M75A 2JLQA 2YWEA 3BRQA 1Z5GA 4ND2A 3TR5A 2Z4SA 5AIAA 3LC1O 4YNBA 1IB0A 4G2NA 2WZBA 5BP7A 5JNVA 1P80A 4FB5A 2FHSA 1Z0KA 2OZVA 3NVMB 4KH1A 4M8LA 5B57C 4X7BA 3GEEA 2GZ2A 5TXGA 4DIEA 2I34A 1H1TA 2WPDA 1MJFA 1K0FA 1FFXB 2QOEA 4XCVA 2BEUA 3MCWA 1X3LA 3ILSA 1KU6A 2XNJA 2NYVA 2JAWA 1MX1A 2BEJA 3CR7A 3JARB 1O94D 1I7NA 3H6HA 3R0IA 3D9QX 3B9PA 4KXVA 3UM9A 1VG8A 4FIDA 4R4JA 3LL4A 4OATA 5C18A 4QVGA 2G83A 1PNOA 3GUZA 1V2HE 1FNBA 5HM8A 2C31A 3P27A 5IABA 1NDQA 2FPMA 5JSUA 3EQ6A 4ZU6X 3KQOA 3THXB 2AFIE 4YQEA 2GHTA 3OKPA 3D6NB 3EARA 4KQMA 5ALNA 3LPLA 1JDPA 1FP4A 3LDGA 4DA8A 2ACVA 4LV6A 1JMKC 4LJ4A 1SHTX 1R0WA 2H54A 1EFCA 1Y6RA 2GPYA 2AH5A 2WV9A 5E2AA 3SEFA 4E5SA 1WMAA 5EZYA 3ECSA 4LTNA 1D0SA 2PA3A 3BWXA 3NHUA 3S7ZA 5KDDA 3RROA 4NZNA 2Z3WA 5A04A 4M53A 4EY3A 1SHZA 1Z82A 2FWRA 2QX6A 2D1RA 4WCFB 3A6JA 2H51A 4OYHA 2IS4A 5C4IA 1Q2XA 1DBQA 1P7VA 3DSRA 1M2JA 4YFYA 2CEAA 3NV9A 5EI5A 3DZHA 4TTVA 2XV1A 1XEXB 4CUKA 4D0NA 1NW4A 2HFKA 3JYQA 3WGOA 5E9WA 1XN1A 1YIDA 2V7XA 4GPAA 3HI6A 4HXFB 4PYMA 4UU8A 3IDOA 4K81B 2VJPA 3UG6A 2YN2A 4KXMA 3H3JA 1V4BA 3ZDFA 2BLNA 4WE3A 5J40A 4D56A 2BFMA 3HNOA 2ZBPA 2PWPA 3A11A 3SYKA 1T3LA 3SZLA 1R0CA 2IYVA 1G9TA 4IP0A 2AN3A 1V6CA 3WKEA 1NVWQ 2DERA 3PC2A 1ZI6A 1X7YA 5A5VA 2QVXX 4M8NE 4MJLA 3IIMA 4RKEA 2FRDC 2R66A 5FOVA 2ESRA 2AYXA 1F5SA 4BO9A 1Z73A 2IYPA 5AMXA 1BMDA 1UBGA 1X38A 3F49S 3I34X 3DPUA 3AFNA 3MJSA 2EZUA 3OX3A 1CUFA 4JC4A 4GX5A 4A6DA 3IVRA 2HXYA 3MTDA 2ZE7A 1DVRA 3C7CB 3MWFA 3O83A 4JJIA 4MLCA 5AT1A 1WP4A 4B6EA 3JAMA 2IE8A 2G8NA 3HRKA 4PO9A 3NTLA 4I1PA 1JPNA 3W04A 5DN6A 1Y3DE 1QBGA 2CL6X 2GZ1A 2RIRA 3B36A 1DAGA 2VDLB 2V7BA 3KE8A 3NALA 5DI9A 5T8KC 1PJSA 4GR5A 3KV3O 5DWQA 1WBDA 2HIHA 1CD5A 1QOZA 2P27A 5TR9A 3TZEA 2CZCA 1M6YA 1PJQA 3M6AA 4FMBB 3PUWA 2XZOA 3GLHE 2FPOA 4KUGA 4YONB 2ZM5A 5DHQA 1AIPA 3FAKA 4C14A 1ZDMA 1B0PA 2RKWA 5KBYA 3X44A 1A2KC 1P0FA 1SBCA 1X7DA 4RJTA 3QBTA 1C50A 1C30B 2ID9A 3LUJA 4ZO9A 2IWHA 5FL7A 4BNZA 4MJXA 2Q9UA 3BGWA 2V7EA 4ZP1A 4B79A 1AQUA 4V1CI 1A5SB 1DRUA 1E0JA 1WDKA 5KYKA 1P4SA 1GAEO 1PT8A 3B2NA 4H16A 4RORA 4TL6A 3VC2A 4AM8A 4TMTA 1IE3A 1U1IA 1XPRA 2ZJFA 3OTGA 5J4YA 2VYFA 2E5LB 4KAFA 2IIQA 1G3IA 3O0DA 2XB4A 4K6HA 3Q40A 5FUBA 4IICA 2H9AA 3Q0TA 1M72A 1PF7E 2HU7A 4OAOA 4XZ3A 2WWHA 3KEGA 3NO4A 4MVJG 5LZ7A 2EWWA 3GAFA 1J2EA 1FIUA 2VAWA 4J16C 1DJMA 4DW8A 1ATIA 2X5NA 3D8BA 4WX2B 5DCYA 2D5IA 3DOOA 1SXIA 4HB0A 1VQ1A 1HYQA 3IULA 2DAPA 3H4VA 1G20A 4HT3B 3AVYA 3W3ZB 5HG0A 1L3CA 5FP0A 1KY3A 3JQ7B 5KKCA 4B17A 1HF3A 2B1IA 1E94E 1F6WA 1ZICA 3EPPA 3Q6IA 1O97C 2PX3A 5EP4A 3T15A 4EK9A 2ZB8A 1NNI1 1W96A 1YE5A 1YE3A 3AONB 1XQ6A 2ZXEA 1SG9A 1X6VA 5ALGA 2GCOB 4UM8B 2LW7A 4DKXA 4D98A 2EFHB 2WTXA 3GH3A 3L8FA 1HSOA 5IH7A 2I6TA 1SNYA 2QSZA 2QE7D 2OHVA 3O95A 1H2FA 3KHTA 1WB9A 4AN1A 4JUDX 1GG2A 2A9JA 3U1TA 4CKZA 2F4VB 1YL7A 2I4NA 3LDAA 1V1MB 5IT0A 2IXEA 3OKAA 1XTQA 4P80A 4R3NA 4UUQA 1KDYA 4TKZA 3W1WA 3ESQA 1CYEA 1L1QA 3AP3A 4UVIA 3R0ZA 4UZFA 4EFLA 2FH5B 3VNRA 2EEZA 4NZYA 1HRDA 1XCMA 4K2AA 2MINA 1SUAA 2UYGA 1PZHA 4Z8YA 4WLNA 5CPFA 2A7QA 5F2OA 3MJCA 5IKXA 1P1FA 1UKCA 3PPIA 1D7AA 3IVCA 4QG7A 1CY1A 3VU3A 3LXMA 1PR5A 2YJTD 4JMPA 1KBOA 3I2YX 4OUKX 4DR5B 4G67A 3JASA 2RGAA 4PGGA 4P2GA 1ADGA 3L0OA 1NY5A 3KG2A 4MUEA 4Q34A 3VKUA 2HBQA 1SZCA 4MUFA 4PG5A 3NZEA 2FYTA 1M8GA 3PKZA 5FA5A 2ERCA 2RKOA 4I36A 3IB3A 5GIPE 1K3FA 2I4MA 2JEZA 1XVUA 5TF4A 3VPCA 2QVZX 2VHWA 3DDHA 4XOUA 5I3CA 4U7JA 3URKA 3ABOB 3K0AA 1G16A 3HJTA 4Z4CA 1JB1A 3L0IB 2IP2A 4IQGA 3U3DA 1AB5A 3UFBA 2CDBA 2QYOA 4FVTA 2VF8A 2NUTA 3U4CA 3BSSA 2C8JA 2X2FA 5JATA 4EWLA 2JIOA 2JGAA 2HDHA 4GICA 3SHVA 3FWNA 3L02A 2IOQA 3LX8A 1RPAA 4IIVA 3B6KA 1CVIA 3E8XA 5EMKA 5TQ0B 4D9GA 4J90A 1Q1NA 1MABB 3STTA 1NVTA 2MWMA 2Y66A 3HUEA 2B2NA 3KQSA 1G18A 4HN4B 3M2PA 3KVYA 4FGKA 4MARA 4QLAA 1FNDA 3VZPA 1I94B 3GP8A 5JJLA 2XTAA 1YOBA 1E1LA 4EA8A 2EQ5A 1YB5A 5JI3E 1K6JA 5ALRA 4D6PA 4Z9YA 3Q1KA 3PXEA 1UBRS 4YRSA 2WWVD 2Q1YA 5CB4F 3JSXA 2R6ZA 3OF3A 2C9OA 5FTNA 5AKXA 1F06A 3K7EA 3IVAA 1U5AA 1VSQA 3WLAA 1CZHA 4ZOQI 5JANA 4RS3A 4MV6A 1L5NA 2A84A 3KEOA 3DTNA 5AVOA 4EJSA 2WQ6A 3R9XB 1FC0A 1P2GA 1GVHA 3AL3A 4X95A 2G3YA 1N6PA 1TYCA 1WW8A 3FR7A 4B80A 4BFCA 1A9XB 1CS4C 2E5FA 2EKLA 2XVAA 4PCVA 3JALA 4Q3CA 4LQCA 5DN6D 3KD3A 3K71B 1JEDA 4QDXA 1L4NA 1AUPA 1VE6A 3RUFA 4CVNA 4NWIA 4Q01A 1EI9A 1EWVA 2H59A 3B9QA 4CQMA 2M6KA 4YR9A 5GJCA 4MQFB 2TS1A 4X84A 4DZTA 4CEIB 2FPRA 1SD5A 3MRTA 2Z6UA 4H17A 4E5KA 1W35A 1EM8A 3BL5A 3AR6A 3I2JA 1KQFA 2XNSA 1WM1A 3MB8A 3WIBA 4QU5A 1QR6A 1NBHA 4OQQA 4G0ZA 2YHSA 1S3GA 2CXNA 2YVQA 5K03A 1E2UA 3GRFA 2R8OA 3JRWA 4YEDA 5J63A 3V7YA 1NVBA 3R5HA 4OM8A 1C8BA 3UJ9A 1QHYA 5CT8A 4KXQA 1XLTC 3IV9A 3OFND 5EHIA 2YNMA 1DEOA 1X9HA 1BKSB 4KI7A 5C4GB 4W6QA 3G1WA 3A9SA 4BB6A 3C8HA 3JQ7A 2PBZA 4I4IA 3NIBA 2DX7A 3U7FB 5K4GA 4J0GA 3RKSA 1U9IA 4ZK6A 4BP1A 1PRYA 2P5SA 5DBGA 1F3OA 1QP8A 5TT1A 1CIJA 2R84A 4R1OA 1WV1A 2G5TA 3KYCA 1CY7A 1QIFA 1V7QA 2F9FA 2V7WA 4JDPA 1QGUB 1L5YA 4X7MA 1DFHA 3WWEA 3A4NA 2BGRA 2GNOA 3Q10A 4OI2A 1AU9A 3QIAA 1C3VA 4HEJA 3UHPA 5HYVA 1V8ZA 1HDCA 1Q92A 4GGMX 4EG5A 4J0CA 3FRIA 3H7AA 3OCZA 3K6RA 1XEFA 4N39A 1V7PC 3FSRA 1AQJA 4MVYA 2PBRA 2EJBA 4LQDA 1X1SA 4XD7A 4XFJA 5TX7A 2BGMA 4Z99A 1Z5VA 4Y1FA 1NGSA 3FLEA 3QEMA 1NV8A 5EHZA 4YROA 3FTCA 4C76A 3PXCX 1R0SA 2A4MA 1CFJA 1G7RA 4BNWA 2J4CA 4AZVA 1R5BA 2AG5A 5DE3A 1GG8A 1Y1LA 4PSDA 3R9KA 1L5HA 4MOWA 1LI7A 4E2YA 3LYLA 2XCRB 3QOYA 1VP9A 3H87A 3MSXA 2V6IA 4BWFB 2CHEA 4CHTA 2QMZA 5IAKA 4YMIA 1IQPA 5B1SA 1HY3A 5EZ6B 5BSKA 3AR3A 2ZJ2A 4U7DA 1F9AA 2JKVA 4L9AA 5HGJA 4EBFA 2HRQA 1K3UB 1S2DA 2H3HA 5C34B 1LC3A 3CR3C 4NBVA 1HE4A 1TDJA 3VTAA 1MJGA 4U9IS 2OB1A 4E22A 3OY7A 4M0PA 4GWLA 1U0NA 3DAYA 4FHZA 2M9MA 3WL7A 1CB0A 1T34A 5JPIA 4G0WA 4GMKA 2BFAA 2DBVO 2PRZA 4FCTA 4Q24A 1WUHS 1N2EA 2Y0EA 1LBSA 1O4WA 2NYRA 4XGIA 3MUEA 3I2HA 5CK5A 3RE1A 4MAMA 4X63A 4BVAA 3LG2A 1V6SA 1PV2A 1FP2A 3NQ41 4RHEA 3DMNA 3UATA 3T41A 1KWKA 3QVMA 2J0VA 2ZXFA 3H8JA 3K9GA 1F7UA 1IOLA 1MG5A 4PLFA 3WJ1A 3P9XA 4A4DA 2X4DA 1A0OA 2MSEB 1F8XA 2YNMC 1NI5A 2QN2A 3I01M 3L06A 5AKEA 5GP1A 2DR2A 2CHGA 4Q4CA 1ECJA 2KX7A 3BWVA 4IUBS 1NLMA 4JT8A 2DWCA 3P1JA 1K86A 4NEQA 1I8TA 1W5FA 1BE1A 2IYFA 2P3OA 4UVGA 2K6GA 4TXLA 4A0SA 3FZQA 4CG0A 2B78A 3LRXA 4HDMB 4YC7A 2IH2A 5BNWA 2NZJA 1XTVA 3BEDA 2X14A 3HRHA 3I23A 1JEAA 3QITA 3JALB 4UBJA 3S2YA 1JRLA 5THQA 4GPIB 3QHAA 2WT9A 4ZC1A 1YZ3A 5CFMA 5FFNA 1Z2AA 2OORA 5ES3A 1FRNA 4KFSA 3TXYA 3TE7A 5KJCA 4MNTA 2JCYA 4F11A 2VJCA 2BH2A 2DH5A 2J3KA 5I7WA 5F3WB 1XZNA 2X15A 2EWVA 3E9QA 3GZNA 4EQ6B 5MF6A 3U4QB 3TKYA 2QR3A 3KQWA 2EXXA 3KX2A 4FR5A 4YGYA 1Q57A 2JGDA 4Y9RA 1T8PA 3EZ2A 1EFKA 4IYRA 2FP3A 2QZPA 3VR6D 5CG1A 1IXYA 1WETA 4TSFA 3PNYA 2C4KA 3SFZA 1TZJA 3DEFA 4F3KA 2NUAA 3ZJVA 1N0IA 2ZGVA 4XX0B 3RRMA 3PE6A 3ZZNA 4EUFA 4WOKA 4IINA 1PL0A 4KYVA 1EFRD 3V3KA 3H5TA 1C3JA 1F2TB 2BBOA 2QRMA 3BXXA 4B84A 5DEOA 3R5TA 5DKFA 5I7SA 5GVRA 4QEKA 4G0MA 3ZHTA 1LSJA 2PUJA 3PXAA 3NBFA 1H4VB 3PFKA 3VOAA 4L4UA 2VJAA 3GELA 3N2KA 1K27A 5ITZA 3BT7A 3ADPA 2EOAA 2ZVPX 3LBHA 3MVEA 4NP6A 4WKBA 4DT1A 5PNTA 2NVWA 4QEDA 2PS1A 3LT4A 4LTMA 4ZAYA 4B83A 5L6MB 3SZRA 4E1AA 4C0HA 4B7CA 3DBHA 5C5DA 2FN3A 5IVDA 2E4ZA 4M9UA 1GQQA 1EVKA 2IUTA 2RKBA 4JC0A 4YJ2B 3QSYA 2GVDC 4WQMA 4KK4A 5AXDA 1K63A 1V7ZA 3BQ9A 4PGFA 4OF4A 3IEKA 5KTKA 4PSVA 1B0AA 2JDID 3A1EA 1RR6A 4LCJA 4FGUA 3DEAA 5BVHB 5KNDH 1XOIA 1JLLA 3BC1A 1VPEA 5L7YA 2IHKA 2FSVA 2GCNA 1E8DA 3PFWO 5HKBA 3EPJA 2C7OA 1U81A 5D84A 1U0LA 5B2FA 5EIEA 4YA6A 1BX3A 4K1LA 1IXRC 1K06A 1KZ6A 4AYWA 4BX8A 3TK1A 5E4FA 2QAIA 2RJNA 1LA2A 3PUYA 4OA8A 3VYVA 3KOMA 3C4JA 4DAEA 3ZYZA 4Z4HA 1XI2A 2J0QA 1C8VB 4KQHA 1FE8A 4NJEB 3S5UA 1E61A 4A5SA 1QUEA 3LTEA 4DQLA 4QWWA 3ETJA 1OI7A 1G5QA 3AJRA 4MEBA 4NSNA 5KVAA 2R79A 4W63A 4MGIR 5TF0A 4K9MA 3BAZA 1PR1A 5B58T 4PYQA 1M0SA 2HHCA 2Q45A 2R6R1 5ABPA 3GV0A 3GWZA 3R7FA 1WHTB 1AKTA 2BR4A 4Q82A 4F9TA 2GUGA 3ZLJA 3TL6A 3BAFA 4ZVKA 1C9EA 3OIVA 5DM70 3VKHA 3VMMA 4TQ9A 4UTNA 3FMGA 1JXQA 3LT2A 1JFVA 2Z2XA 3B13B 4Z7JA 2O5VA 1QQ5A 3IR6A 3OJFA 4C01A 2QRUA 3IT3A 5KYUA 4XRGA 2MU1A 2CBXA 1B3RA 1Q0QA 5CFPA 3RVKA 1OAOA 2RK6A 4OA5A 5TMBA 4DPKA 5LMCA 2F67A 1W1UA 1XRMA 3NDBB 4LW8A 2BFFB 1TA4A 4DV1B 2QN7A 3KB2A 3PE3A 2FW0A 2ZR8A 4S24A 4RFSA 3UA3A 5J3JA 3GEPA 3L0PA 2DFPA 2AOXA 2X41A 3P0HA 1E6WA 5F52A 2C92A 4NBNA 1O6ZA 2ZPUA 4KIGA 3Q8KA 2DHQA 1NRWA 3NPMA 4ZHQF 3VYWA 1QZTA 1G9XA 5H68A 3U62A 5AO9A 1SXJD 2HRBA 3GLHA 2O8FA 5DTMA 1MORA 2NZYA 2O6LA 4X7PA 1J0AA 3RS0A 5HIMA 4BX9A 5C1BA 1AZWA 1SRRA 2PAFA 5AM0A 2QL5A 4Z3KA 1U0HC 1NMEA 5I4KA 7MDHA 4LF8B 1E0KA 4E30A 2CFIA 5H82A 4KR6A 4IHQA 4HZIA 5T5QA 1WDLA 5BWBA 3CRNA 2WG2A 2OORC 2XE8A 4WKOA 4YCCA 3B1XA 4M55A 3CLSC 3TOSA 5CA1F 4U7HA 3CF6R 2XKKA 4OHPA 3ZG6A 1U8XX 5IVIA 2DP4E 4L3OA 5LWHA 1DFIA 1PR2A 3PJEA 2YR0A 3V4LA 1VBNA 3VZRA 1LCIA 1N6IA 3I9NA 2W0MA 3ZWYA 5LXTB 3G5AA 3LDFA 4QFMA 1YGPA 3E9CA 4RJLA 4DIDA 2J3LA 4B6OA 1RXVA 3ESZA 1OVGA 2F3SA 4R69A 1Z2EA 4TSFD 5EJAA 1K5HA 4M9SA 3EWIA 4FYWA 4G0NA 5HF6A 3T9EA 2DU8A 2EF0A 2F3QA 5HGXA 2GEFA 2UXBB 4IDBA 1IHDA 3KT6A 2EU8A 2OL4A 5JARA 3IR7A 1YNOA 4LMBA 4E0BA 5BRAA 1WUIS 5F78A 1YHZA 2FEWB 5P21A 2H4JA 5IULC 2J67A 1SGWA 5HF8A 1ZMOA 3KDPA 4DC1A 4PFJA 4LF6B 4RU1A 3MS4A 2X4IA 4OYYA 1ISMA 1O6GA 4W5JA 4AULA 1QANA 1M2GA 3OD1A 5WRFA 1NBIA 2ZJBA 4GBED 4HMOA 3QF4A 1ZD9A 2NXNA 4XVUA 3HP1A 5KOJB 2Q4RA 4BO0A 2QD5A 3ADCA 2C54A 2WNHA 3BXZA 1JPJA 2Q9AA 4PO3X 3IAS6 2EKZA 3HCFA 4E2WA 1X1DA 5DT9A 1IK6A 3AHGA 4BVKA 2JFPA 1OB2A 3I6YA 1OU0A 4UD2A 1QLJA 5B4UA 1OGJA 2V59A 1C1HA 3OM8A 3QY0A 4JFRA 4K7JA 4HQFA 4IIUA 1KQNA 3AUXA 4D8VA 1M7GA 3QM1A 4CMCA 2XVYA 4GNKA 5IAAA 4FGLA 2VDQB 1JFFB 1EPUA 3DOIA 3OZEA 2WFLA 1PSZA 4G85A 4IIJF 4OY3A 2Y8EA 3C74A 3DQQA 4G5SA 3UK6A 1WCIA 2JI4A 4ZDIA 1M76A 4IS3A 4O02B 3ZVKA 2I3ZA 1JJBA 4CGYA 2AEEA 2GCEA 3FOEC 4C88A 1XD2B 3QIVA 2X23A 3KPWA 3VH1A 1XTJA 3GF4A 3MJ4A 2XBUA 1KI7A 3KTDA 5TIIA 4A82A 2P30A 2BTOA 2XUGA 2QPAA 2OXIA 2WMOB 4WLVA 2VA9A 3RAGA 2QRHA 2QTLA 2NT3A 4Y9UA 3FDJA 4DCUA 3QA9A 3CW9A 3W5SA 1QVWA 3EVGA 4F2GA 1YHYA 1UPCA 2C4VA 1RPZA 4FOLA 1ZJZA 3DLIA 1H2ZA 4PZZA 4D9JA 4MR9B 2JGMA 3ZDRA 4DIUA 3FMOB 1PZFA 2BELA 4TLEA 3UKJA 4RSHA 1DHTA 2HI0A 1J00A 1D4OA 1UXOA 1KZYC 2QPLA 3G0CA 1S8FA 4QNMA 2GK7A 3ZXSA 1NXTA 3D7MA 2DC1A 3DUWA 1BEZA 2F00A 2DFDA 3E3AA 1XKLA 4A2CA 3ZDCA 3NXKA 2H3EA 1ZH8A 3IVXA 4YB8A 5BSRA 1G63A 3Q0IA 3C8MA 1B8PA 3SF0A 2ZI5A 1WZIA 3E81A 1OBCA 4CQJA 3UPUA 4BQPA 5TJ9A 3GJYA 4TN1A 5FJIA 4RV5A 1X7ZB 1QMGA 2QTBA 2ZP1A 4I5GA 4WFJA 3E5RA 3LNCA 2A5GA 3CJTA 5AHKA 2JGFA 4DTIA 4ZMSA 3A3KA 1N7IA 1HLFA 2V6FA 1RMYA 1RRMA 1P7ZA 2IDKA 2PXCA 2RK3A 2WTBA 2ZUVA 3FCCA 3QV1A 4RE6A 1QO9A 1Z08A 4W1PA 5K0JA 3EIWA 1GYQA 4UQOA 3RPEA 1ZD4A 1RTKA 4ZAVA 4CFYA 2FE1A 2M2IA 3KZCA 4GEGA 4HX5A 2IX3A 2I5PO 4O4LA 3RBZA 2FEPA 4LKOA 3IEVA 1LBTA 4L6IA 3TQFA 3R5KA 5AW9A 3VKVA 2F2TA 3NBQA 4DS3A 4JYCA 4JKOA 1Y80A 3MJHA 1KEPA 4RX1A 4H7PA 1KYXA 3DFIA 1OWOA 2QRPA 4DQXA 3MCZA 4TL9A 3CINA 4Z1MA 4KW7A 1MB2A 2ADOA 1J9GA 3EXEB 1CR1A 3NYIA 1XA4A 4RKRA 2FLKA 4Y0VA 2HSDA 2BUCA 2PKYX 2WWXA 1Y5MA 2FGJA 3F6SA 3G2MA 1II9A 1JQAA 1RWBA 4KE8A 1U5BB 4KSYA 4PZDA 5DTIA 4O5OA 3VKWA 2WF6A 3OHMA 4QIHA 1E9BA 3AEYA 1U3TA 1YJCA 3CX4A 3EF1A 4HOYA 5FUVA 3NDPA 3R7DA 3HYCA 4JB8A 4YT4A 1Y9ZA 1JHUA 2GKSA 3BHMA 1GPKA 4WV3A 2OYRA 1IH8A 5C51B 2IEBA 2JGKA 3O93A 4Y6GB 1UOEA 1HT0A 2W48A 2A9OA 5KHOC 4BLTA 2B7BA 2F9MA 2CXTA 5A9SB 4ICIA 5M5BA 4INZA 3RK4A 3E35A 3N8NA 4EA7A 3R6DA 1P1RA 1RQGA 1WVGA 3LP5A 1U94A 1QVAA 2LV8A 4Q1CA 3TSWA 1GO2A 4C3ZA 1RAHA 2O8CB 2BMVA 4JK3A 1PJAA 3RRJA 3M81A 2W6ZA 1M2WA 3JW8A 3WA6A 2AC2A 3IDZA 2E1RA 3IUQA 3IODA 1ODLA 5T8KA 1PG2A 1QV9A 1L5GB 3KZOA 3W2HA 6YASA 3ER8A 1A76A 2GASA 2IPAB 3RS4A 2YS6A 4R8VA 2QVLA 4UUAA 5M2QA 3DMFA 3O26A 2ZFUA 3IXMA 3S70A 5TARA 1U2SA 3CBGA 5SZIA 1QH1B 2SCUB 2XBLA 4QYTA 3BMNA 1NBAA 1RC8A 1N2HA 1EFRA 1QIMA 4ECEA 3TD6A 1EP1B 1GRVA 2HAEA 4MV3A 1PLKA 4LYYA 1WUTA 1Y48E 2A88A 1JSZA 5DZSA 4WASA 2AOTA 5BQPA 4U0KA 1B7GO 3TF5A 1CF4A 3COYA 4KN9S 3C1OA 1O97D 4PPQA 4Q4LA 1RMQA 4QYIA 1JZQA 1XCJA 2HEGA 1DDIA 1OX5A 1PDVA 3OLZA 3RCBA 3ZPXA 3H6GA 4JI7B 4TWRA 4LN1A 1FNSA 4NR0A 5D6OA 1BRTA 3QEMB 3VR2A 2ZAGA 4Q7QA 2V5UA 1PWXA 5ARDA 1IXSB 2NYUA 3MPUA 5KQGA 1MGOA 1ODKA 2WZDA 3FXAA 4PSAA 4UTOA 2Z8YM 2ODEA 2PQ0A 3QG1A 2XDAA 2VS1A 3S68A 2I54A 1RHRA 3EZ9A 3R3HA 3WL4A 2R2GA 1A8SA 1E0DA 2C5LA 4JB3A 2ZR7A 4IXDA 4KMOA 4OQDA 1VB3A 4ESEA 2CXSA 4K0KB 2PN1A 1AK9A 1AHPA 1KY2A 4M1SA 2Q2WA 4JVNA 4RUKA 3PUVA 1DXOA 3I6IA 3LCJA 2WYOA 3NYWA 3RYFA 4RVGA 5TQ2A 2FGKA 3OQMA 1PSDA 3ZWMA 3EEOA 3ZVNA 3BE8A 4RTSA 1P1CA 1WX1A 2IOFK 4RFLA 2JJYA 2L42A 3U48A 5JROA 3A6ZA 1ORVA 1U2DA 1VI6A 4ZOEA 2BSAA 4BGDA 5TVGA 5JPCA 5KEIA 1Z4MA 1UP7A 4LC9A 4JI1B 4B8ZA 1AMNA 4CEJB 3ONWA 4J1NA 4IR7A 2CNWD 4B6JA 1SKBA 3EDQA 4YAWA 4DMFA 5IC4A 5EWLB 5LP6A 5K0NA 1VP3A 2YJ4A 2ZUFA 2JB9A 3COWA 1KPIA 1SZPA 2AQKA 2JI8A 2ZYGA 4MMXB 4QATA 1U2QA 5ALYA 1NIJA 1C3XA 2WIJA 3PLRA 4UAGA 1U4NA 2EJWA 4ZOLF 1CUAA 2BM1A 4BDTA 2ZRAA 3DDWA 3LIIA 3N2EA 3WHLA 4D0RA 3BCSA 3DBLB 1Y7IA 1Q5PA 3DS8A 3DD1A 3L49A 1UC5B 3MTEA 4R1SA 4YACA 4NVRA 1Y63A 1NQUA 4XKJA 4G1MB 5KU7A 2WA2A 2CHFA 2DTEA 5TT0A 1VJTA 4QJBA 5EY5B 2F1IA 5JZOA 4P83A 4AMYA 2F7SA 5E8JA 1OOEA 5FA8A 4BATA 4NLLA 1DTWB 3W4JA 4JOCA 2P67A 4NOMA 3VNUA 3CRW1 1RJWA 4JHLA 4ER6A 3N76A 4ASUA 2RGNC 2OC9A 2QYHA 3L7LA 2L17A 3EZGA 1D1TA 4FW9A 3E9YA 5ALWA 1PR9A 3BVPA 3EHEA 3QH4A 4X7RA 1NF9A 4M0UA 1SU7A 2C20A 3NS7A 1N6OA 2CF5A 2Q6TA 3C5EA 2NO9A 1R12A 2WG0A 4ARAA 4A91A 1WULS 4QARA 4DCVA 3LP8A 4HDAA 5DV9A 1TUIA 4F6RA 1ZJWA 4DIOA 4TWBA 2IPLA 5DU2A 2UYCA 1ULHA 3SR3A 4PNEA 4YS6A 4ZO8A 4DPMA 1ZUD1 1KH2A 5FTLA 1OROA 1Z0SA 2ZB4A 3N8IA 3ED5A 4BKOA 5IXJA 4DC0A 1SUIA 2F17A 3PIIA 2QTVB 1BROA 1QZXA 4U8GA 4PX5A 5F3DA 5JLAA 1U4SA 1ZA1A 3RSZA 4BEJA 3PGA1 5HUHA 2BJVA 4RD4A 4ND8A 2F1HA 1XXHB 1GL3A 1SCIA 4KXUA 3T7JA 1U0BB 1U0FA 4D02A 1CY4A 2EKBA 4E3ZA 3K6JA 1Q6YA 3N05A 5I9LA 1DDOA 4FDUA 4FGJA 4YRLA 1ZOIA 2PJUA 3DMDA 3QVGA 1M1YA 5EQTA 1G8YA 1P5ZB 3MCTA 3TEJA 1R0ZA 3RR2A 4YRNA 4JGBA 3VYRB 4RSGA 4ZRMA 1NVEA 3VO8A 3VC7A 3B3JA 1JE1A 5CT6A 4NRDA 1FDTA 2VCYA 4HNAA 1RP7A 1YZNA 4BNTA 4DY6A 2GYYA 3F8SA 1O77A 4M37A 4NI5A 4Y9TA 1AN0A 4AJ9A 2BWJA 5J2UB 2HPVA 1J6UA 5EQJB 3HBAA 4BQNA 4EJ2A 1PNRA 2FKNA 1T3ZA 1UOPA 4TMYA 3E23A 3PQ3A 3W5CA 1A7AA 1Q0HA 1ZH2A 4JQYA 1EIWA 1IJBA 3H9CA 3OMXA 4F9EA 2R6HA 1XYGA 4JKYA 1KMNA 1X8LA 4ZQGA 1JQ5A 3WA7A 3OTQA 1ZAKA 2C2YA 3SXUA 1QS0B 2JA2A 1A3CA 2HL6A 5I9MA 3T9DA 4E31A 2ORED 2BMEA 2YIVX 4MUNA 2W42A 2XNKA 3O8QB 4K5QA 4QGGA 4MPPA 4FGWA 3M70A 5F3RA 3K70B 1C8KA 1GDHA 2VJOA 1M6EX 2OK7A 1VYUA 3GJSA 2DFTA 3J7TA 1XD2A 5E2BA 1JLMA 4Q3OA 1HDOA 4U9HS 5CTAA 4KR9A 5BR7A 4XFKA 4M49A 4FGSA 5G0WA 4G97A 3X1WA 3F67A 1F14A 4Q1DA 4TUYF 1KEEB 3A1DA 5JQGB 4X3CA 4LSMA 4TKUA 5CMLA 4M1WA 2PXHA 3D8RA 3F78A 4MCAA 1CHDA 1SHLA 2VH5R 2JGIA 4N0PA 4P3XA 4XM1A 5GAJA 2RJ3A 5ELMA 4BGUA 5CDYA 3CVVA 2I2CA 3TL2A 2G1KA 2P5TB 1JF8A 3O8OB 3OG9A 1KDVA 4F4UA 1Z16A 3VPAA 4BGVA 4BB5A 4JUIA 2D7DA 3OU2A 3PUJA 2NXCA 2D00A 2OBYA 1H2BA 1TYDE 3B6EA 4PAOA 1BQEA 1ONOA 1Y4SA 4RK6A 1YRYE 5KWJA 3W2EA 4Q9NA 5CHYA 4DIKA 2Y1LA 2P62A 5AW0A 3X3HA 1IOZA 3AIKA 1BVRA 4NBSA 2ZZKA 4RVUA 4F5EA 4TRJA 4QU9A 2YQZA 3CT6A 1SQFA 1EVLA 2A9FA 5ICFA 2WU1A 3IOMA 4C4YA 3A1SA 1L5SA 2RBEA 4UHHA 5LB2A 1F1BA 2ZJ5A 3UT5A 2VPTA 3UWDA 2QTWB 2WYHA 5EPEA 1C29B 1ULUA 1WDWB 4HH3C 3H42B 1KBQA 2ZT5A 3WLTA 4TM7A 3OEWA 3RVQA 4P0QB 2OVFA 4BLSA 3DFUA 3FGNA 3N2ZB 1XAIA 4Y18A 4EVSA 3MWGA 1U63A 1J23A 4GLJA 4JBYA 2NU8B 4UUMA 4LZNA 5ULLA 5BN5B 4MP8A 5SZJA 3UMYA 3OOYA 4QGFA 4PG8A 2PUVA 1RZRD 3SNHA 2WOOA 2IHVA 3AF5A 2VTVA 4U5QA 1MZVA 3VR0A 1ZO8A 5LXTA 4MI6A 1UFVA 4KWCA 4HX2A 4K28A 1YR2A 3CNLA 5JSKA 1YDFA 2ONZA 3WLPA 4UTVA 2D0DA 5B3AA 3EXIB 4XOIA 2XCIA 5G4LA 4GT1A 1VLMA 3VC3A 4ZAXA 4F6RB 4DL9A 1U9CA 2IIVA 2VQFB 1MIOA 1UOQA 4TV8B 1AHNA 3OPNA 4YWJA 2W2VA 1CZUA 5HE9A 2HJRA 5EYPB 1NFQA 4IDOA 4CM9A 1HL3A 4N3AA 2IZ1A 4O2BA 1NQVA 5ALPA 1DCTA 2UYHA 1BRMA 3JVIA 1R6VA 4HEHA 4FYKA 4A2QA 4ND5A 5EYPA 4BO8A 2I6UA 3EWSA 5E1MA 1RWPA 5JASA 3CEJA 3IKJA 4BVHA 4D81A 4C5CA 4PW0A 1VB5A 2AG1A 1TT7A 4GM1A 4C0JA 3NUZA 3AI1A 2WKPA 4AP5A 3CONA 2B4QA 4BBZA 2V7TA 3PT5A 2IF0A 2FQXA 4JR0A 4L57A 4US2R 3BMNB 4FONA 4QQFA 2ZSBA 1SQSA 1XHFA 2F1OA 2WT8A 4LXQA 1YZGA 3FBWA 3RRNA 4CTKA 2P3SA 2FZLA 4EVRA 2YRXA 4UU0A 2CBZA 5DNDA 5EGNA 5ERYA 2GARA 3S2SA 1XZFA 2WK1A 3L8ZA 5A7FA 4Y2SA 2MSCB 1KGDA 1DRKA 1SCJA 1L4KA 4OJNA 2GAIA 4R1NA 1IJEA 4YMVA 1HRKA 3E3OA 3WIDA 2ZBGA 3R0JA 5BUCA 3DFKA 4P7FA 3AGQA 1PT7A 4M99A 3AU9A 3CLHA 4GUDA 1LW7A 4IH1A 3G2HA 1XD9A 5KJ6A 3M6FA 3GB9A 4NECA 3ZDEA 4CLHA 1ZNQO 1CQIB 2NNWB 2VAVA 3D81A 5K8LA 1N1DA 3KU4A 1GT6A 3WFJA 1T1RA 2D2IA 2QL7A 4B3BA 5DNCA 5FFMA 5KX5A 4M54A 4QG3A 2YYZA 3GGDA 4Z4IA 1FS5A 1RU3A 1Z6TA 2GO1A 3N2NA 3CA8A 1EH5A 3BTSA 3CO5A 2HJWA 4QGAA 3AM5A 4IZOA 1KORA 1CJMA 3BF7A 3W9BA 1R27A 1SBYA 3VBEA 4YPOA 2C5EA 4WL0A 2AN4A 2D1YA 2YBEA 5CJPA 4I4TF 2PGLA 2E3JA 3T1YB 1AJEA 2ET6A 4LBWA 3N7UA 4KXXA 3PFNA 4PCUA 4XTRA 2QSYA 1E2GA 4GS5A 5JJBA 2AR9A 1A69A 4UM5A 3ANSA 5IRCD 1F4LA 3EMDA 3K94A 2OQRA 3QJ5A 2JLVA 3IP1A 2VDMB 3K0FA 3KB6A 4S1PA 1QF9A 1O89A 3LX4A 5CHEA 1XRQA 3DCYA 4Q7LA 5ENVA 5AUQA 6GPBA 1UKAA 3ILHA 4EGCB 3TG8A 2C3MA 1RI5A 2RGUA 4R1MA 1W0JD 4YRCA 1NV9A 1MD9A 1G8HA 5HIKA 3SOZA 4O25A 4IIBA 3ZU5A 5P8WA 2VJDA 3H1BA 1SXGA 3JQ8B 4L0DA 2BZ0A 2ALJA 3CURA 5JC8A 1Q1EA 2P8SA 5JR3A 2D5CA 4X66B 5EZSA 1N5OX 3KKOA 5AXAA 4RDCA 5LP1A 4B3GA 4J0JA 4V24A 3IESA 3LFHA 1UP4A 1RQNA 2WPNA 3PD1A 1NJ5A 1AA6A 3I5XA 3AUAA 4PV7A 5JH7F 2CV2A 1P4RA 2KMLA 4TVSA 2B2XA 2V1XA 3BH7A 2H2FA 1CNFA 3ZUGA 1TM3E 2GTIA 2XUKA 3PVSA 4TPKA 2AFIB 2W0SA 3KO8A 4PFSA 1GN8A 1U8ZA 4Y98A 4MDEA 4WLFA 1W94A 1YRQA 1ARZA 1SCQA 1NLZA 2VDRB 3UQYS 4HEA1 2GILA 1OLSA 4ZEMA 4GQBA 2GPBA 4YUWA 4GEKA 3LBFA 4IHJA 4DEVA 1NMYA 5L3RA 4A16A 2P9ZA 5EERA 3LC2O 1JN0A 4GYKA 2NQ2C 2XLBA 2IKQA 1CZLA 1E7YA 1YCFA 1TUGA 4O6VA 4O2BB 3V2UA 3L6OO 1NU6A 3GLIA 2O8EA 1Q1BA 4O4HA 3WHKA 3IV6A 5FOWA 2NUPB 4H6XA 4RHYA 1I1HA 1O6BA 2BYTA 3ZU6A 3EPKA 3KQVA 3M6LA 3WAGA 3GA0A 1IBLB 2JAHA 4JLOA 3U9TA 4HI0E 3ROEA 3AMVA 2FN8A 2LIPA 4JT2A 4H3KB 4YLGA 5I8WA 1DELA 1K2WA 1XSEA 2I7CA 4WKCA 4OLJA 1NLFA 4G4SO 5A5EA 2KWIA 1RI2A 2VSYA 3AX6A 4XR9A 2Z56A 4C0KA 1W7AA 1LK0A 3OFSA 4BWYA 1F38A 3NORA 4IKEA 4E2XA 1QU3A 3TR0A 4N4AA 4COOA 1CDOA 1E2LA 4N3BA 4EHIA 4J8PA 1GRRA 1X87A 2HF8A 4FN4A 1C0PA 1ITZA 1P9OA 2P2GA 3BMOB 1EDZA 2J6IA 2VQDA 3ELWA 1SIOA 3ENZA 1ZK3A 3ZY5A 5CIYA 1T1IA 3EGCA 4CQLA 2A35A 5BWCA 2QNIA 3F5SA 3UANA 3H2KA 4UKDA 3UAWA 2NG1A 4XPZA 1L7QA 2RE8A 1XMPA 3C6KA 2NTVA 3PJRA 2ZRHA 3HG7A 1JFSA 1EXDA 1AZLA 2PUWA 4N3GA 5EIOA 4CDMA 1M1YB 2R6AA 2WYUA 1DWQA 1XQYA 1KH1A 3R09A 4L74A 5LOVF 3H5NA 2Y1KA 1Z7YA 2I76A 3FVVA 1Q0UA 1CQZA 2YFHA 4PZ0A 3RTBA 3TKAA 2LE0A 2VF4X 3KLOA 4URYR 5FUXA 3T54A 2KHZA 3HADA 3V4SA 3HXOA 1ZRNA 5JS8A 2J4FA 1C2TA 1NONA 1MQ8B 3OZFA 3E18A 4LWQA 5IJXA 2NPOA 4QTXA 4IV0A 3GDWA 1CJCA 1O3YA 4ZOAA 5D51S 4MJ3A 5FO1A 4E07A 5C3MA 3IIIA 1NE7A 4G0QA 4OLBA 4EEZA 1RQ7A 3KS9A 3MELA 4NBKA 4Q3DA 4B3HA 3M4XA 4HDRB 4Q4JB 2HXGA 3AIOA 4QE3A 1EWQA 3GQVA 1FJXA 2CL0X 3KPVA 3UMSA 4BO6A 5JQWA 5IW8A 1H5QA 3ZWAA 5IAJA 4WESA 1I5RA 7GPBA 2B7CA 4F3RA 3U17A 3DHYA 5E7IA 1C9KA 4QULA 4D9IA 1V1MA 2WJ3A 3OE1A 4EGFA 5I47A 3COVA 1E2NA 1H6DA 2Q9BA 2G6BA 2G7MC 2QVGA 2LIVA 5JIBA 2QK4A 3HLTA 4IGKA 5AVVA 1DAHA 1ZPDA 2LKDA 1NRJB 2NSYA 2ZI4A 4G89A 1T35A 1TCUA 3T0FA 1VGVA 4OU4A 3RQIA 4NOLA 2GNPA 3CNEA 1KP9A 4DJFC 4ESHA 1P61B 3S1SA 4AKIA 3H5AA 4HWKA 1ZLXA 2IYNA 1FFGA 4MV9A 4PCLA 4TXMA 4X1KA 4ZARA 1JLSA 3K72B 4UPEA 2P2SA 5DRYA 3S2UA 3BS4A 4BYMA 2E55A 4CLOB 4D5EA 1EQ2A 4BRZA 3MWDB 2XMBA 1MFPA 4B5KA 1YR7A 2QD4A 3FDZA 3ZLUA 3FH0A 2GMWA 4P4LA 1NUUA 1Z0UA 4JEHA 3G79A 2NPIA 3K9BA 3BE5A 3TQIA 4DZRA 1TADA 2QYTA 4MW9A 3ZOZA 3F3YA 3CCFA 3Q4GA 4I19A 5FJJA 3F98A 5DHFA 1FFWA 4DN6A 1D7OA 4C2TA 4LOKA 4D3ZA 3ZBPA 4POOA 3TTTA 4ZAZA 4AMZA 5AM2A 4RJIA 4BP9A 1R66A 5IDVA 4BP3A 3FSEA 2OOSA 2UZ4A 4PO8A 1G2IA 2Q2NA 1EJ6A 4O2BF 1TUBA 2AG8A 1FXUA 1SCKA 2R8RA 5FPTA 3I45A 3P2IA 3JZAA 1KETA 3ADOA 3FCXA 1S9HA 3HLKA 4X90A 5C81A 2CXRA 4P4GA 4BEWA 5BN3A 5IEBA 2OXTA 5JBNA 2O0KA 1YIAA 4IDEA 4OKSA 3HSKA 5FWXA 4E5DA 1XRPA 4B82A 1Y4ZA 3V7UA 2R68A 2F8SA 1T25A 4RA9A 4MEAA 4AS3A 1Z0JA 3C3MA 5FWXB 1ATZA 2QTVA 1UK7A 2INGX 4H7IA 3VU8A 4HVAA 3L1KA 3PDUA 3DDUA 4UBOA 1RBQA 2FFBA 2JAOA 4JYPA 1I2MA 4LHVA 2GPWA 4LCEA 1VGRA 5IN5A 2AZTA 2QGNA 2VNIA 4OHCA 1JVBA 4BECA 5EIBD 2YV2A 3SS8A 5HZMA 3PC8A 1MXHA 4I6EA 4UOEA 3GXOA 3OCCA 4IFTA 1MCZA 3OTWA 2XJ4A 3ZNPA 3BCRA 3WKCA 4AMUA 1HFKA 4CQLB 3F6CA 2VYVA 1AK2A 2HJVA 4P4TA 5KNBD 2AMYA 2H2IA 3K9QO 3DZBA 5ESRA 3DC7A 4OJKA 2GT1A 4BWGA 1W6RA 1PFWA 1NBOA 2B1QA 4MP3A 5FT9A 3BG5A 4LXHA 2Y9PB 3PHJA 1LPAB 2DGDA 4LE2A 3NANA 1XYVA 1XKQA 4I3HA 4A03A 1NIPA 1RJDA 1GAWA 1PQYA 3EXFB 3H1FA 3OMWA 3QWIA 4W9NC 1KSJA 3U7RA 1JKFA 5ISMA 2G77B 2VJYA 1QB8A 4PC3A 4J0HA 4MS3B 1ZH0A 2RMKA 4IXNA 4U7FA 1XE3A 2WUEA 4UFNA 3B1VA 5CM2Z 1WABA 1W36C 4PRYA 1Y6ZA 4F3YA 4EX7A 2CY0A 4DLSA 1JEYB 1E2KA 1NYTA 4P08A 3GVXA 3QVKA 1N5MA 1YJQA 3KBBA 4W5QA 1JQKA 4I9FA 1SCBA 4HDKB 4GXTA 1MENA 1RXUA 1OZFA 1KKUA 2GERA 4NZZA 2XA1A 4XVQA 5FIUA 3VPDA 1ABEA 3LHKA 1N3BA 3NH6A 4RDIA 5HHTA 4KV9A 3RAJA 3ANYB 3NEJA 3PUXA 4TV9A 5EIHA 4DDWA 5KPDA 1W5BA 4BY9E 1GPH1 4ID9A 4WZBE 2XODA 3KXIA 5BSWA 4NABA 1S1CA 4OQYA 4FW8A 5U4QA 2C57A 4RGYA 2C5GA 1L1FA 4BNDA 5DHAA 2BFEB 5KTOA 5H83A 3CGWA 2HK7A 1KZ7B 2WWIA 4QEZA 3FPBA 2VHEA 3W05A 2DWUA 1UANA 2JH3A 1WNFA 1WCIB 2PGNA 4LRSB 2WYVA 5IKOA 1EK0A 3AZPA 5LD2C 2HDOA 2JJ1D 4IY1A 1WD5A 1RZVA 1N2BA 5EMMA 4IOJA 1IN4A 1SB8A 1CZKA 1T0HB 4WBSA 2VRBA 3FDZB 4PHTA 3MK31 1DIBA 1H0KA 2YV4A 1F4VA 4RD6A 1V5WA 2VDPB 5BOVA 3W4IA 4ZGWA 5DJ5A 3O2SB 5E7QA 4OXXA 1NOIA 1T8SA 2EJTA 2R8ZA 2VF7A 3BH0A 4IFBA 2QP4A 2ZJOA 3IUPA 4XQCA 4DRXA 5JJCA 2YN0A 3IFSA 1K5PA 4PYIA 4FMCB 4BJ1A 3O8CA 1G1MA 1KI9A 3SR0A 1L4MA 3HP4A 3MWYW 4L27A 3FNQA 1GZ3A 3NKLA 2DQKA 4ZV9A 4RULA 3RAFC 4MPDA 1FLAA 3TR6A 1XNHA 3RSOA 1QF6A 4KE7A 3QWAA 4CV0A 5FPSA 1OI2A 4N0DA 4RK7A 3LVBA 4HGPA 2FP4A 4O4HF 2XQIA 5HBRA 1TT5B 2FMKA 1VIMA 5F1PA 5CCEA 2X7JA 3L6UA 3OD5A 1WV0A 1D2EA 1F0NA 1QSGA 5SZHB 1P73A 4URXR 2NXJA 5LUBA 1L1RA 1Y5RA 2IELA 1GTJ1 4LC0A 4BVEA 1GUBA 1U4OA 5LQMA 2UUPA 1ZVQA 1UM9B 3VM6A 1SUPA 5H3LA 4P98A 3DJFA 1Y0BA 5K2OA 4UEWA 1KJQA 1PNQA 1T9GR 2RHMA 2CYCA 3TVYA 4DLAA 2Q1WA 2QMYA 3T9BA 4BGIA 4BQIA 4II3A 5BN5A 1K89A 1X9IA 3DV9A 3V3TA 1I14A 1G7CA 2C03A 2O7NA 2R00A 2XT6A 4EGAA 1A50B 5I3ZA 4FWTA 2FEAA 1H0HA 4FTWA 2ZS8A 7REQA 1OJ7A 3QBJA 3P0EA 2Q7DA 1FX0A 2ZIGA 4BVGA 4X1IA 1U7OA 2WJ4A 1J8FA 2O0JA 3VSBA 4FFWA 1UJBA 3U40A 4F4FA 1T2DA 1QQ7A 1QTIA 1OXXK 2VF5X 3FFAA 3R6TA 3G8YA 4FMCF 4IIGA 3K70D 2Z98A 3DTVA 3O84A 4UU7A 1SC1A 2IOYA 5F35A 4I6GA 4X65B 1X1BA 1MEOA 1JHYA 4DJJA 3RS3A 4ZYWA 2XTNA 2ZBVA 5C9ZA 1YVRA 4I5EA 4RF2A 4G4JA 3GFGA 1OGIA 3B51X 4AAYA 5KMGA 1EXVA 5GPBA 3JQGA 2ZIWB 4FKMA 1MW9X 1SC9A 1T8WA 2XMCA 4P8RA 2OV8A 2DF8A 2H9IA 3H13A 4QGBA 5CW2A 3MT8A 5CM8B 5HMMA 1JG4A 2VOEA 4ALKA 2FUCA 2BCGY 1Z6GA 1QE3A 2GWRA 3HWSA 4DIBA 4F12A 4XB2A 1OX4A 3RRXA 2Y1FA 3IILA 1L8OA 1ORIA 1SC3A 2AXQA 3OCUA 2XHZA 5IFKA 3WIOA 1USKA 3OBIA 1GSOA 3HGMA 2B6NA 4PLPA 3WYEA 1GTVA 3HN2A 3SLKA 4GI7A 4Y2RA 4FMDF 4KXLA 1SVUA 3OPQA 3PCTA 4A0GA 2X0RA 4M1ZA 4US0R 5BMVB 2P9FA 5HJ5A 4ERXA 1T1SA 2HCBA 2V3WA 3E9RA 3WO0A 3ZHXA 5CEFA 2UU9B 3O8DA 2WZCA 1UKVY 4WZBB 4PLVA 4CI9A 4GOOD 4HUTA 621PA 2OM6A 4RVDA 1OT3A 4KAAA 2F62A 2FV8A 3ZWWA 3HV0A 2VNAA 1H66A 4K8OA 5A5FA 2IZ0A 1DCMA 1J90A 1WE2A 2KSQA 3PD7A 1ELOA 1CK4A 4GO1A 4CKWA 3FCYA 4YAUA 2QRJA 3PKJA 3ZKAA 3LUDA 4IZHA 2JH8A 4DC9A 2VPXA 3BFKA 3VAYA 1V71A 2C59A 3EGVA 4RL4A 1ZC4A 2AV6A 5KOHA 4CGZA 2OB2A 3L7IA 3F96A 4I46A 1KRHA 4V0MA 3U0BA 2PKCA 3U26A 2QQEA 3Q5EA 1E1YA 3D0KA 3HXTA 2O57A 3U09A 4W8OA 2WAOA 2JI7A 3WL5A 3DAHA 2HU5A 3IBTA 3OOWA 4OO3A 1S2IA 2GJ9A 4V02A 1D2RA 1DRWA 1OY1A 3KKZA 3SBXA 4DEYA 1ST3A 2OZPA 2RARA 4AWXA 1K8YB 3T7EA 1VJGA 4GXRA 2PT9A 1QQ6A 3LV8A 4WACA 4BV2A 3OE5A 1RM3A 4MV8A 3UHFA 3JZIA 5MFPA 2J46A 2OV2A 4XDGA 4GF5A 3R3VA 2GBFA 3BK2A 1WR8A 4TZKA 3ZTYA 4NOJA 5BW4A 3PUIA 1TJ3A 1IN1A 4BMYA 3TQRA 4MLZA 1Z0ZA 1AHIA 1DX6A 3ML1A 4NFSA 5ECWA 4CRWB 2IPXA 1CU1A 1CS0A 1PT5A 2SECE 3DNPA 3EQ8A 3GCWA 4L5AA 4LXXA 1HLGA 1QGZA 4X85A 5T4HA 3SX4A 4FCWA 3NUQA 4P38A 4CM4A 4A0QA 1WHSA 1IBCA 1XKTA 2G76A 1RWWA 4P3YA 5ADHA 3WL3A 2C9MA 3K5PA 5JQGF 4LTDA 3FHOA 2IV2X 2WRZA 4MKIA 6REQA 1P2BA 3AY3A 4M22A 3K4PA 4IIEA 2WY2D 4QZVA 4UHKA 4O2LA 3FF1A 5BXYA 5AI0A 3IQEA 4JLBA 4FFBB 4YBZA 3JU3A 1TCCA 1O0CA 4UM7A 3WLRA 2XSZD 4CMEC 5J47A 4Y2XA 4EF6A 2XRFA 3AILA 3IMEA 3IJ5A 4N7MA 2Q07A 1B8NA 2JFGA 5D7NA 1D6NA 4AQ7A 2A94A 4KFCA 1EYZA 3AKYA 2ZJ4A 4YMGA 1L4YA 4WOBA 1OAOC 1T5TA 3D7RA 4NE7A 2WF5A 3GOHA 1G19A 4W8HA 2AKYA 1G55A 5HKKA 1DAPA 4D9FA 1X86B 2NZ8A 1L7RA 1TCAA 1E69A 2P7IA 4MUYA 4RZ3A 4BRSA 1LJUA 2JAPA 1RQPA 4GXNA 3ISJA 3QOXA 5CAEA 1IC6A 1D1PA 4R8LA 5JRDS 1B15A 1D07A 5EEHA 3C8DA 1PL7A 3K2BA 1VG9B 1BVHA 1E32A 5DCUA 5G1PA 2FR0A 3NR2A 1JWLA 1QCYA 1XVLA 2IBTA 4EB3A 1EKXA 1G66A 1JSRA 2VO1A 2HO5A 3TLEA 1RI4A 1XEWX 2ORWA 4YLYA 2C1EA 5IJAA 4XX1A 4ZIRA 4LDJA 1SG0A 2Z1DA 3JQFA 1FDOA 1H5UA 3C16C 3D64A 3DFFA 3QE3A 4P54A 4X6LA 4BV8A 1HDRA 1UJCA 1POXA 2PPVA 1C0IA 1VKJA 2CLEB 3IQIX 5FQOA 3UWOA 2OZKA 1SFRA 2MSWA 1NOJA 1MIHA 3I3SR 1PGPA 3C8ZA 3D4LA 1R6BX 4NYIR 1VYTA 1VPWA 2J0SA 5L7TA 3HZZA 3D3WA 3PV0A 2GVNA 4JJ4A 4JVSB 2JJ2A 4XD2A 1AOXA 2BL4A 3FY4A 2A1TS 3BE6A 3FPKA 4P5DA 1ECFA 5EIXA 4FEEA 3QVGB 3F4BA 5TSDA 4U2DA 3CE6A 4NBTA 1ABFA 3FYSA 3GUVA 5ELLA 1A2OA 3HJAA 1PVDA 1RAEA 3FJYA 3RUEA 5FLEX 4KITB 3CX7A 2J3HA 4WD3A 3P2OA 4YMTA 3KQUA 1U2GC 1ZU5A 3L40A 1SUDA 1JQLB 1P3JA 3CFYA 3M8KA 4G5GA 4OXKA 2AZ4A 3GZJA 3IHKA 4FOPA 4H1HA 4DT1B 4EO9A 4S0ZA 1X80B 3P9SA 4K9PA 4OHUA 3FUWA 2G5PA 1YS2X 1M2KA 3LFUA 1NMQA 2DBQA 4AP9A 1TYAE 4UHEA 2XT9A 1FTWA 4KSCA 3GAAA 1AKQA 1HDXA 3JRNA 1PUXA 1NYLA 4I0WB 3VU1A 2M1ZA 2GGSA 4HYEA 2EQBA 3E58A 3SLRA 1QIGA 4Z0NA 1AHHA 2GD2A 4D74A 5JCOA 3K9NA 5HUJA 4HAYA 2QSUA 2ORIA 3CC8A 3DZDA 5FBQB 4B6FA 4BAUA 3BL8A 4DOMA 1LPNA 1L8LA 1V8BA 2GHIA 3H5OA 4B4KA 1N0HA 3MHPA 4CT4B 3QP9A 4DQKA 2FN4A 2YY7A 4NU0A 3TSAA 2NZ2A 4TXHA 1KEKA 5BORA 1AUXA 1UBMS 2WIGA 1YJ5A 3P9QA 4MGHA 1K7CA 1NA5A 2J30A 4MK4A 4P6VF 5BV0A 1OWLA 2H4ZA 3UUEA 2WFAA 1XHLA 3BA1A 5AM1A 1PP4A 7ABPA 1EESA 3LC7O 2AFVA 3CF0A 4FM9A 4I50F 3GX1A 1EIZA 1I3LA 1LRKA 1HOTA 3F3KA 3RJ9A 1S2LA 5KIAA 1XTTA 2M6LA 2YOGA 2Z6AA 1DKNA 2VSFA 3A70A 4F2WA 3HXPA 4LMRA 4RAOA 1TJ5A 2J7PA 4YRDA 5J2UF 4UOZA 2PWAA 3IUSA 3NHZA 3G6KA 3Q3JB 4L07A 4LIPD 4NNPA 2VEOA 5FV4A 2ZJ6A 3RV4A 5A2GA 2YHBA 3HCBA 3KD2A 3F6YA 3OJ0A 5B1HA 5J9FA 4LRUA 3ICQB 4IGIA 1N2XA 1AS3A 1KQGA 1NC1A 4JEMA 3HEBA 1II8B 3PZRA 4A0HA 4OD0A 2HZ7A 1SQ6A 3BB1A 1P4AA 2OGSA 4LJKA 1T0JB 3H1TA 3IEPA 3T5CA 4CEJA 1ZQ1A 1XLUA 3ZD9A 5HSGA 1CVLA 1P5JA 1U8CB 1XRSB 3ECCA 3TFQA 1TNDA 1U2DC 1AT1A 1YQUA 3S28A 4R9SA 1YT5A 2VTBB 1AGYA 4QM6A 1USIA 2IYYA 3JAKA 2CXHA 4J9VA 3U9SA 4AY5A 1DQRA 1J9EA 2IOHA 5CDFE 1W85B 1ZM7A 3G9XA 4LNHA 4AKEA 2GXQA 1I7LA 1LXCA 2JIQA 3A1TA 3FGZA 3Q8WA 1S01A 1Z8DA 4N54A 4IJQA 2RGNA 4NCKA 2EG9A 3D0OA 3IVMA 5ALLA 5JCOC 5AW7A 4N5HX 4FIZA 4B32A 4GSLA 1K7FB 2ZSDA 3IQXA 2ZIAA 4LV8B 5TRTA 5E9QA 4QXMA 2NV2B 1P7YA 1DBWA 1ZEJA 3ZHUA 4FSHA 2P1DA 1Z28A 1KY5A 5T3UA 4FDTA 2YUIA 3DPSA 3HY3A 3ETLA 4RELA 5BO5A 4WXHA 4KUEA 3HYNA 2PWBA 3DE2X 2O8EB 4K9OA 3T3IA 1VHLA 3F74A 4MRMA 4CIAA 2IIPA 1A9QA 4Z9FA 3O4HA 1SR8A 2GEDA 3T4EA 4N7BA 5C32A 3FBGA 4YP0A 4ACAA 4F2HA 4WZAB 3RC8A 2EFDB 3LYUA 5HA5A 2IS1A 2OQIA 3GPLA 3T7AA 4C05A 3PGMA 4KAXA 4Y2VA 1IPEA 4HFJA 3N7AA