4RTQA

Complex of escherichia coli dna adenine methyltransferase (dam) with adohcy and a 5-bp non-canonical site (gttta )
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
270
structure length
246
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSASFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 86
structure length 246
sequence length 270
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtqA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtqA01
5LQAA 3A25A 3EEYA 2ZBQA 4RTLA 3SSMA 2O07A 2O05A 1SUIA 2ZTHA 3OZSA 2YUIA 3BKWA 5CVUA 5DX1A 4DCMA 2C7RA 4CTKA 2YR0A 2ZWVA 1YZ3A 2BR5A 4KDRA 4YUVA 2YVLA 3LPMA 5E1DA 1UWVA 2P40A 4ER7A 4QTTB 4XCXA 9MHTA 1ZGJA 5DX8A 2JHAA 3LCCA 4FR0A 4EKGA 5EKUA 2ZLBA 3QOXA 3UBTA 3HVKA 2AVNA 4HTFB 5DLYA 1Q0SA 5EIWA 4E2ZA 4YV1A 2XYQA 3NVMB 5EOVA 1NW8A 2HNKA 2QY6A 3G5LA 4P7KA 2ZW9A 3VSEA 3DLIA 3SMQA 4C07A 5E1BA 3P2IA 2R6ZA 2JHCA 5HFJA 4KIFA 4RTQA 4X61A 2YTZA 5DTRA 4IWNA 3B3GA 4YMGA 1SKMA 2AR0A 5FQNA 4PCAA 5DSTA 1SUSA 3NJRA 1F3LA 2G70A 2HWKA 3DULA 4PWYA 5CVVA 3EGEA 5U4XA 5ICCA 4A6EA 1VPTA 2OY0A 1NW3A 2PWPA 2UYOA 3G7UA 3M70A 3QOWA 4H0NA 5LQRA 3RW9A 3VC2A 2P7IA 3NW9A 4OA5A 2ZBPA 4HG2A 5GP1A 3FUXA 3RODA 2AOTB 1WXXA 1NT2A 2PY6A 4WVLA 2ZVJA 2XBMA 2I7CA 1EJ6A 3HVJA 4A6DA 3IEIA 2H11A 2CKDA 2OZVA 3S68A 2BR4A 2LD4A 5EEGA 2QRVA 2PXCA 5HEKA 3NTVA 2O0LA 2HV9A 2ZULA 5T67A 3TKAA 1RI4A 2EG5A 2NXCA 4HRAA 5FHQA 4RTPA 2AVDA 2GPYA 1AV6A 1X19A 3OU7A 3PFGA 3R24A 3MGGA 3EVEA 4QQNA 4WXHA 3WSTA 1JG2A 3TLJA 5FCDA 3O7WA 3MHTA 2BH2A 1L3IA 3OU2A 5EC8A 3CKKA 3LHDA 2UYHA 4YMHA 1XDSA 5DM0A 5E8JA 3TQSA 2IIPA 2CMGA 1NW6A 1VQ1A 5K0JA 1RJFA 5JR3A 1QYRA 4CWAA 1X1CA 1L1EA 1X1AA 2PSSA 1JQEA 2PVCA 4RTMA 1O9HA 3D2LA 4BY9E 1YFJA 3AY0A 3EVCA 4MIKA 4YUWA 3HCFA 5DT2A 2AZTA 3KR9A 4X1OA 3KPWA 4ZTBA 1AQIA 3TM4A 5LQUA 1KP9A 1X1DA 4C03A 5F2KA 4YV0A 4LWOA 3HCDA 4KW7A 2ZIFA 2N47A 1VP3A 1N7JA 3FTCA 4C06A 5E2AA 4Y30A 1I1NA 3PT9A 3NWBA 2PBFA 1P1CA 3AXSA 1XXLA 3EVDA 4IV8A 5T6BA 5GWXA 2FPOA 2AN3A 4CTJA 5K01A 1KR5A 3AWIA 1NBHA 5C0OE 3LBYA 5D1NA 1KYZA 2ONZA 3KQOA 3GWZA 1RJDA 3LL7A 2PLWA 5DRTA 3KPUA 2ADMA 5KVAA 3AXTA 2GS9A 2PT6A 3T7RA 5GIPE 1G60A 3NDJA 4RYLA 2ZFUA 2VS1A 3PX3A 5FA5A 3BWBA 1Z3CA 1BKYA 1JG4A 4RV9A 4BLWA 1ZKDA 2CWWA 3SSNA 4DF3A 1VP9A 2B9EA 2QYOA 5LQNA 1KYWA 3ER9A 3BUSA 3TOSA 2G71A 3ELYA 2JG3A 2HR1A 5FHRA 3G5TA 2NXEA 3UJCA 1M6YA 3DTNA 2JHPA 4FT4A 1KIAA 5GINE 4O29A 4ER3A 2BM8A 5HZMA 5CIYA 4HGYA 3KQMA 1RI3A 2IFTA 2ZWAA 5EHGA 3MCTA 3GGDA 1R74A 3M4XA 2A14A 2P8JA 3EGIA 5D1HA 4RSRA 1QANA 1WXWA 3OFJA 5FTWA 4HTFA 1WS6A 4FZVA 5EMKA 3JWHA 1ZG3A 3GRVA 4PGGA 3EGVA 4OX9Y 2VDUE 5GM1A 3P9KA 3HP7A 4GC5A 3OFKA 4PCLA 2UYCA 1MJFA 5P8WA 3FUTA 4OBWA 1DCTA 4FS8A 3EPPA 2NP6A 1G8AA 1R18A 5BP7A 2IDJA 10MHA 3M6UA 5ICFA 1XVAA 3EVAA 3M33A 3E23A 4P7JA 5HIIA 3CGGA 3UA3A 4E2YA 3DMFA 1V39A 4QDJA 4E32A 2OPBA 5E9QA 3K0BA 2AS0A 3DXYA 4RWZA 5LQJA 3C3YA 1AF7A 5CCBA 1ORHA 3G89A 4PIMA 1JTEA 3FPFA 3FRHA 3FUVA 1ZGAA 1VE3A 5DM1A 3CJTA 3T0IA 1XJ5A 3V8VA 1L3CA 2NNWB 3GRYA 4OQEA 5DPMA 4AZWA 5K03A 1G38A 3EVZA 2G8NA 5HILA 1M0EA 3HCCA 5K0GA 2O57A 1JG1A 3M6VA 5DX0A 4ER0A 4ISCA 2OO3A 1QAQA 3DP7A 3EMDA 3UZUA 4P58A 2O06A 3EMBA 1EIZA 5HIJA 3G2PA 2GH1A 5E1MA 3BKXA 5DXJA 4GOLD 5H02A 4RVGA 1R00A 2ZIEA 4RTKA 3EVGA 4EVIA 4RTJA 3P8ZA 3UJ6A 3MCZA 3DXXA 4P7FA 3KR2A 5K05A 5DWQA 3I9FA 5DSXA 3ER8A 1VBFA 2OBFA 1QAOA 3A27A 5HIMA 4BP1A 3LDUA 2ZZKA 1O9GA 3E7PA 3KQVA 3ANXA 5DXAA 5GIOE 2FRXA 2P41A 4R6XA 5KYGA 3ELUA 2XVAA 1FJXA 3FTDA 4GF5A 3HCEA 3OE5A 2EJUA 3UA4A 3RIEA 3EVFA 2AN4A 5EGSA 3MB5A 1F38A 5FADA 4QDKA 3BGVA 3HA5A 3O4FA 1XDZA 2ERCA 3PX2A 4PYMA 4V0RA 1XDUA 1XTPA 3DLCA 3HCAA 5LR6A 4EKIA 4DCGA 2IH2A 5EZQA 5F2NA 5G02A 1U2ZA 3NDIA 3UJAA 2Z6QA 3GRZA 4AZTA 4E33A 5K8VA 2PKWA 3UFBA 2PXAA 4PYJA 5JUWA 3NMUF 3FPEA 3TR6A 3VC1A 3I64A 5EMJA 2IGTA 1I4WA 2ESRA 3FUUA 1NW5A 3TKYA 3B7PA 4QVKA 5KS2A 5FWAA 2AOUB 3I5UA 3KQSA 4GUAA 3GO4A 1D2CA 1P39A 3UJ8A 1MHTA 3LBFA 3Q87B 5CVDA 2I6GA 3BGDA 1BHJA 8MHTA 3DUWA 1FP2A 1Y8CA 2R3SA 3G2MA 3KPJA 4C05A 4AUKA 4CKEA 3R6TA 2PX5A 3REOA 1KPHA 3FRIA 4RVFA 2Z6UA 3OZRA 3I53A 3A7EA 3FYCA 4L7VA 4EQZA 2C7QA 3P9IA 2B2CA 3BXOA 4Y2HA 4QPNA 4Z2YA 1ZQ9A 3Q7EA 1H1DA 3KQTA 4MTLA 4R6WA 3UJ7A 3EEOA 3HVHA 2VDWA 4KWCA 4X41A 3LECA 2C7PA 2G1PA 3ELWA 3PS9A 4PYIA 4NECA 3KQPA 5K09A 2QM3A 3ELDA 2WA1A 3THRA 1JQDA 2OB1A 3HNRA 2BM9A 4XUCA 2PX2A 1WZNA 2GAFA 5T64A 4AZVA 3G88A 1NV9A 3H2BA 2YXEA 1R8YA 2ZIGA 1AQJA 4YUXA 5EEHA 2FK8A 4LG1A 4QPPA 1R8XA 4GOOD 4RTNA 3UJDA 4ER5A 2JH8A 1EG2A 2P1DA 5CD1A 1FP1D 4BP3A 5FUBA 2AOXA 2PXXA 3CCFA 2NYUA 2P3OA 5K0BA 1L9KA 4B17A 3IHTA 1Q0TA 1B42A 4DM3A 4F84A 4AZSA 5KQRA 2B3TA 2PWYA 3BZBA 5EKXA 3SVZA 5K0CA 3HA7A 4M37A 3BGIA 3HCBA 1PRYA 1TPYA 1JSZA 2H00A 3CVOA 1QZZA 3I58A 3OU6A 1WG8A 4KIGA 2DPMA 2IPXA 5ERGB 1BOOA 2OYRA 4LECA 1RI2A 3SX0A 1RJGA 2EJTA 1QAMA 5HIKA 3FUWA 2E5WA 1UIRA 4OQDA 5B1SA 4X60A 4F86A 4C4AA 5DTQA 1P91A 2GB4A 4OA8A 1BC5A 4PYLA 1R6AA 2GLUA 3HTXA 1I9GA 3GRUA 4RTRA 2I9KA 1NBIA 3LCUA 1P1BA 1VLMA 3KPVA 2BR3A 2P3QA 3SR4A 2ZSUA 4M7RA 1SQFA 2OXTA 3G2OA 2ONYA 2UZ4A 3BT7A 1NE2A 3E8SA 2I62A 3G8AA 1RJEA 4FT2A 3MQ2A 5C9ZA 3P97A 5IH3A 3KPYA 3GIWA 4PIPA 4JXJA 3CBGA 3TRKA 3PTAA 2Y1WA 3IV6A 4POOA 1G8SA 4FSXA 3KQWA 4P7GA 2Y1XA 1IM8A 3ORHA 1SVUA 1D2GA 1RI5A 3LDFA 3T7TA 1YFLA 2CL5A 5CVEA 3CC8A 3SGLA 3X0DA 1JR4A 4G56A 4DQ0A 5DM2A 3FPJA 2BZGA 2AOTA 5C1IA 3HA3A 4PGHA 4RVHA 3B5IA 3E05A 4XUDA 5E9JA 5EZSA 5ICEA 2Z6AA 4RX1A 1FPQA 1SG9A 4GQBA 3FTFA 3P2EA 1YUBA 4PONA 3OZTA 4YV2A 4M36A 4C04A 5FA8A 4E70A 1JQ3A 2JH9A 3BWCA 3DMHA 3UJ9A 3A7DA 4GBED 3MTIA 3R3HA 1X1BA 3BWMA 2AOUA 2HTEA 5K0NA 4GC9A 4MQ4A 4DZRA 3LX6A 5CVJA 2IBSA 1YF3A 2FK7A 3UJBA 2P7HA 4R8RA 2AOVA 3JWIA 1VIDA 2B25A 5EMLA 3U81A 3EVBA 3NWEA 5GM2A 3R9XB 1KPGA 3AJDA 4K6MA 3B3FA 5LSAA 3G2QA 1KHHA 5BW4A 5K0EA 2F8LA 5CUQA 2WK1A 5E8RA 4PYQA 4HSGA 4YUYA 3KU1A 5FULA 5FQOA 4FP9A 2H1RA 5MHTA 2ZBRA 4RTSA 2V7EA 5ICGA 4DA4A 2WA2A 2IP2A 2YXDA 2Q41A 4PYKA 2V74B 2ZZMA 5HOQA 3F4KA 3P71T 3SSOA 1NV8A 4CKCA 1VL5A 4QQKA 3ERCA 3LSTA 3MERA 5DM4A 3PVCA 3LKZA 5KQSA 3VYWA 1L3BA 2P35A 3K6RA 2IH5A 4FGZA 1HNNA 4M38A 5FWDA 4E31A 3QV2A 3FPGA 4YUZA 2ORED 2AN5A 1EQAA 3KQQA 3B89A 3P9CA 2VDVE 1XCLA 3O31A 3JWJA 4HH4A 3KR0A 4V0QA 4KRGA 2DULA 2XYRA 3G8BA 3TFWA 3BWYA 4HGZA 4PNEA 3ID6C 5BW5A 4R8SA 4E30A 3FZGA 4CXMA 1IXKA 4RTOA 1XCJA 2P3LA 3CJQA 3M6WA 2FHPA 5EPEA 5K0LA 1EAMA 3DOUA 4PYOA 4E2XA 3FTEA 1JSXA 4U7TB 3KQYA 5DTMA 2C7OA 5M5BA 3CJRA 1NKVA 3OPNA 7MHTA 4EMSA 1DUSA 4GOMD 2FYTA 5K0FA 2JJQA 2UYQA 4C08A 4E2WA 2HMYB 3SXJA 3LDGA 5EHIA 3SM3A 1PJZA 2NXNA 4IKPA 3HEMA 2PJDA 3PFHA 2PX4A 1TW3A 1IY9A 2QE6A 3LCVB 3THSA 4ER6A 2PV0A 1YZHA 1G6Q1 2YXLA 3KKZA 4UOEA 3GDHA 3MAGA 4IV0A 2IH4A 3A4TA 1EJ0A 3DMGA 2EFJA 3M6XA 5E9WA 2OKCA 1M6EX 3LGAA 4EK9A 1N7IA 5EIFA 4R05A 3B3JA 4RVDA 3ME5A 5EG5A 3TPZA 3MTEA 1WY7A 3TM5A 2QRVB 5IKMA 2EX4A 3C0KA 4ATNA 3HM2A 3IYLW 2PX8A 3OCJA 5E1OA 3GCZA 4OBXA 5EMMA 5F2OA 1KPIA 2PT9A 3HVIA 3UWPA 4QTUB 5EQJB 1SQGA 3R0QA 4LWPA 2IDKA 3DR5A 1JG3A 2VZ9A 4FSDA 2AOWA 3C6MA 3FPHA 4AX8A 4CKBA 4KVZA 3DH0A 4HC4A 4PYNA 2PGXA 5CM2Z 1RI1A 2G72A 3L8DA 5BXYA 2VP3A 2YX1A 5EVJA 1FBNA 3A26A 2K4MA 3GRRA 3GXOA 4KDCA 1OR8A 3V97A 4F85A 3FYDA 3GNLA 2FCAA 3C3PA 1T43A 3JWGA 1ZHFA 4QVGA 2ZCJA 2GA9A 2XVMA 4GOND 1D2HA 3NVKI 1O54A 4MHTA 1JTFA 3P9NA 3PLAE 3OE4A 2ZZNA 2XYVA 3KR1A 1G55A 1KXZA 5LQCA 2YQZA 5CCXA 1N2XA 3LKDA 3TMAA 3P2KA 1UFKA 2KW5A 1YB2A 1TW2A 3DXZA 3GJYA 3KHKA 1HMYA 4X63A 5GOZA 4GEKA 3C6KA 1ORIA 3PB3A 2CMHA 5DRYA 4U7PB 2B78A 3T7SA 4MWZA 5E2BA 2NXJA 1INLA 4PINA 4BLVA 3GU3A 2NP7A 4BLUA 4XUEA 2OB2A 5LQKA 4DMGA 1DL5A 2IBTA 4DKJA 1NW7A
chains in the Genus database with same CATH superfamily
3SQLA 4RTLA 2DBYA 2YIJA 1R0CA 3W34A 5I7SA 3FB4A 2DUNA 5CYFA 1FP4B 1JFFB 3ZCQA 3LLUA 3L5OA 1YL7A 4JUCA 3PZRA 2DETA 1EESA 3SE7A 1PLKA 3FUCA 1N4DA 1YI0A 2XQJA 2R25B 4CTNA 1V16A 3CPSA 1J20A 2X2FA 1CFJA 1T1IA 2Z58A 5KJ1A 4CCAA 2EYQA 3OJEA 1Z47A 4P3XA 4Q3OA 2CJPA 1DDIA 1L7PA 2FG7C 4RUKA 4Z9XA 2HSZA 4FQ5A 3BRCA 1VTKA 2R4QA 3IB6A 4LMPA 2QRNA 3QY9A 4B3TB 2GFIA 2Q1XA 1HFJA 4NBUA 1NYTA 1GPWB 3VSEA 2X5XA 5BQOA 2JHCA 5HFJA 2QAIA 2YJTD 2X4DA 3SWWA 1GYQA 2BFBA 1RCTE 2BJWA 3VMMA 4YMGA 1P5RA 1NOIA 4RK1A 3DKPA 3JRWA 3NUZA 1F3LA 3Q98A 5C3UA 2VFAA 5AKGA 4CCYA 1S7CA 4IOMA 1RJ9A 1VPTA 1N8TA 2QV0A 1NVXQ 2IYTA 2UYOA 3HS3A 5DI3B 3DZIA 1NXXA 4EARA 5HHTA 1FFCA 3FOEC 5JEDA 3W06A 2FRDA 3V1NA 1J2JA 1QH9A 3RIYA 3KS9A 2XJ4A 3AUUA 4MULA 1UPCA 2I67A 2R5WA 5BNFA 4H31A 5K3BA 1FTGA 1DQNA 1GNRA 3ANLA 3PTZA 4IJVA 4UXIA 3ENWA 3TLZA 5JADA 1R16A 5CFZA 3IL2A 5CBKA 3U60B 4X7RA 4EH1A 3R9WA 1PT7A 4BXOA 1N7HA 4X1IB 2GPJA 5K8TA 1GGVA 2JGJA 1YASA 5DHSA 3VPCA 4BX2A 4ERNA 2O2EA 4I3GA 1XN1A 5MN5A 2G07A 3CKKA 3LHDA 4GBGA 3ZHBA 1XVUA 3WISA 4CM7A 1L4UA 1AQUA 1ZI6A 3A06A 1UC4B 1XPOA 2KPOA 1PWHA 3N5KA 4JI4B 3MJRA 3RUPA 4UCFA 4F5EA 1MO5A 1O8CA 3G0DA 1CRPA 2B8TA 3R7LA 1JDSA 2CSUA 4FGJA 4PFSA 4QASA 2QR5A 3UY4A 4Q02A 1YVPA 3I2HA 2QT9A 4GI1A 3C1AA 4K03A 1UBGA 1E2LA 1X7ZB 1XD2B 1KU0A 5BQ5A 3TTVA 2ZJ8A 2R7MA 2A1IA 1SC1A 1ZXLA 4KXNA 1XZLA 4AS1A 2AZXA 3N5CA 1A76A 1OZGA 3IR5A 4JJ4A 5E7IA 2A57A 1G4AE 3OURA 2XCLA 2H5IA 2V7WA 3D6VA 1PG0A 4PPGA 4V0KA 2P75A 3H2YA 5T6BA 5AHKA 5KVSA 5FR2A 2ZT5A 4CM8B 2CBXA 5T57A 1P1FA 3Q72A 1F5NA 4L76A 4F4JA 4MCIA 3EMVA 1MV5A 3CLTC 3LBYA 3QGMA 3LPLA 3Q6IA 4EO7A 4RD3A 4YRJA 2FEKA 2H9IA 4FMCF 1H5QA 1U11A 1GZHB 2LIPA 3FKSD 2H1HA 3BMNA 3OM9A 4OHPA 4RYLA 1Z6QA 1NURA 1VZ3A 3N6RA 3BWBA 4WZ6A 4BLWA 4DZRA 4I1IA 4ZGWA 1LC0A 1BWSA 2OZLA 3JASB 5L6LB 2K87A 2JJMA 4MQ6A 1A77A 1HDRA 2B37A 3ELYA 3TZCA 2C1XA 8ADHA 3BL8A 2HK7A 1WXHA 3H2ZA 5KSPA 3N8HA 1RC1A 3SZLA 4ZDKA 3SC6A 1KZ6A 1HDGO 3KQMA 1RI3A 5EHGA 3JQDA 3RC3A 4OYLA 1ZD4A 2DR0A 2FSVA 5J2UF 4E7OA 2D2IA 2PUHA 1OXMA 1NM5C 1XT6A 4D3ZA 1RYMA 3EAFA 4INAA 5JQGA 2XDAA 3L8GA 3LRXA 4MP3A 2DUMA 4Z7QB 5B7GA 3R3UA 2N0SA 2ANCA 2X23A 2F9FA 3M7IA 5CJ2A 2A92A 1NIPA 3RRNA 4KKXB 2C88A 4HQNA 1FZTA 4HK4A 1W7AA 5HJ7A 2NAPA 3D1VA 1QIJA 7YASA 4G0VA 3LC1O 5A4IS 1YL6A 1W25A 2REBA 3PC7A 3VR6D 4RL4A 1RWWA 2C8LA 4WOPA 2HJ9A 1A71A 3CMCO 5JY1A 2B5VA 3E23A 1Z7BA 3CGGA 4WNIA 1L8OA 3DMFA 2FEXA 1VYVA 2Q62A 2AHOA 1DAGA 2QRKA 3C8MA 2WY2D 2R66A 3AI3A 4UUNA 1ZN2A 4M1QA 3AO0B 1JTEA 4HPJB 2YWXA 3HV2A 4X1YA 1R2QA 2Q9UA 4MLCA 4ZHQF 5HRAA 5JFOA 3A04A 4HUJA 4GLJA 1E9RA 1J2TA 5I4CA 3QQPA 3CG4A 4NH0A 1CG6A 1UT8A 2PCJA 4Y6SA 3RHTA 4IGEA 2HBYA 3G0GA 4ZJUA 4CKZA 4OO3A 4YO8A 1ZNYA 2YIMA 3F98A 4EA7A 5EFZA 3FFAA 1M33A 5ITVA 1M6WA 1S9DA 4D9FA 1GSOA 1FFWA 4EVIA 3UAYA 3BA1A 4B79A 3G9XA 2Z9DA 5DSXA 2GN2A 3FN4A 3LQ4A 3N2YA 1R0XA 3BH0A 2OBFA 3PUVA 4RA9A 4I50A 3NJ4A 4TQUS 1NX9A 3E7PA 5GIOE 3D81A 3TLGA 3ESBA 3ESCA 2P41A 2Q3LA 3FZEA 4P35A 2IHUA 3L8YA 4UHHA 3TDNA 5IXSA 5KTOA 3DLBA 1YZTA 3K09A 3WDLA 1BDJA 1MQAA 3GNQA 1E58A 1F0KA 3OVMA 4MV8A 2VYVA 1EU1A 5TNXA 4AZ0A 3GEMA 3LRTA 4JLBA 2GN1A 4NBRA 3SF0A 2PMKA 2W22A 3DLCA 3N6XA 5ED0A 1UXGA 4OQNA 5AW5A 3C5CA 5JTTA 5LZ2A 3AVXA 4GMXA 2ZRQA 1OHHA 3DQPA 2JJ1D 3GRZA 4OUKX 4E33A 2F62A 3IAEA 2SKCA 1KFCB 1JAIA 2V7QD 3PHLA 2J6BA 3M82A 2CLDX 3ZV4A 3IUNA 3OWXA 2Q5QA 1Z4KA 4GEGA 4N8SA 4B40A 1I13A 4RDXA 5IYZF 3AR7A 3CXUA 3A4MA 4HXYA 5LBTA 4YMVA 3FG9A 2FF7A 3I2IA 4UNIA 1DRUA 1M72A 2ILVA 4WA8A 4EG3A 5HWSA 2PTGA 3LHSA 4LYHA 5L3QB 5HPYB 3O8OA 3RJMA 1VJGA 2EBUA 2XZLA 3D3JA 2G6BA 4YCDA 1L5MA 4G1EB 1U02A 3PUYA 3JRXA 4KWCA 3V2IA 3ST7A 1G0NA 1JR3A 1Q77A 5D00A 3ELDA 3EVNA 4L5YA 1JHZA 1UF9A 1P1KA 2C3YA 2ISSD 4O4HA 2PX2A 1NQXA 4Q7JB 4WFIA 4XUCA 3H75A 5FD8A 4U00A 4AMBA 2BMEA 2Y9PB 3A2MA 3EHDA 3T7KA 1K06A 1C9KA 1V37A 1AQJA 1LGYA 4P86A 4OBEA 1NBEA 1EEHA 2M6LA 3PX7A 3AKZA 5DHAA 3VGJA 4HAWA 1YDEA 5LNK1 4YAJA 1LVGA 4ZVLA 2UVPB 4PQFA 1K6JA 1TKBA 2J4CA 3EF0A 2Z95A 1CQWA 3JAWA 4OJNA 3EY4A 2WIGA 3MFQA 5DP2A 4YJGA 1BD3A 1ZJYA 1Y42X 2OHHA 2PRYA 2QRLA 1FFHA 5D7NA 2YIDA 3FFXA 2MR6A 1M7BA 4HZUB 1SHLA 5DEOA 1WQ4A 2ZITA 2LV8A 1GKIA 2YY7A 2Z1NA 3HUEA 4B46A 4BQIA 1P2DA 4UU7A 3GD7A 1USUA 1Z8DA 4M9ZA 5AW3A 4DV4B 4ZQHA 3ICQB 2IGBA 1PEDA 4QBIA 4U2KA 4ZT5A 3VTAA 3FCSB 2C1EA 5HIKA 2Y76A 2DU8A 5ECYA 3AY6A 1MZPA 2ZJ2A 2YJ5A 3T3EA 4E13A 2PD6A 1KI1A 2EZ9A 2YZGA 1LBIA 1R6AA 3OZVA 4E94A 3CCCA 2I8AA 4QUKA 3PC2A 4BNVA 3FYUA 3QVXA 4EG1A 4BO9A 4CF4A 3D5TA 1IOZA 4AMGA 1N5IA 2QLNA 1NATA 1S2LA 4H4DA 5JZVA 1NE2A 4AJKA 2I62A 4QZVA 1I4TD 2JIZA 2R1TB 4RBNA 2BHSA 1X2EA 2GK7A 3PFNA 3RRZA 2KI5A 1PWXA 2W0MA 1V5GA 2BMVA 1YA4A 2DFLA 3NHPA 4L8WB 3LDFA 4U5XA 1TC1A 4J6FA 3IP1A 4YJFA 3JZAA 4RKFA 1Y8QB 1EH5A 2GD2A 3K73O 4DCSA 2WHPB 3KTDA 3SQMA 1L5OA 1IUNA 1LBTA 5EZSA 2Z2YA 5BV7A 1A5TA 1ONBA 4KN6A 1GILA 1FFSA 1OX4B 1FPQA 1RKBA 1ADYA 4KLCA 3EWAA 4N0DA 2D1QA 1YUBA 4EJ2A 5BURA 4AKHA 1MCZA 5JMPA 1W0CA 4XVQA 4TMXA 3ZE0B 4WY8A 2L18A 821PA 3M4NA 3ECSA 3A7DA 3DDNA 4Q1AA 4KZPA 2NT3A 3B6IA 2J9XB 3JATA 4KIJA 2CJWA 4YRSA 3D0KA 4EDFA 4RY9A 4JXKA 2OQ2A 4NMXB 2EBFX 4BE4A 1VOTA 4JGBA 4OL0A 2AI3A 3GJ6A 1WMSA 4J4TA 5HQJA 3UWSA 1CBUA 1U1FA 5IJ9B 1WP4A 2C4NA 3WBFA 5J5CA 3AR5A 3WKBA 2V6GA 5AKLA 1ECBA 2CNBA 4CUZA 3DBRB 2GSWA 4HJXA 2GARA 2Z04A 4R2WA 4BUCA 4QQ8A 4V0OA 3IAHA 1T5BA 1RABA 4F4HA 3OTHA 3KB6A 4HI0E 4HSGA 3GLGE 4B35A 1XK6A 2BJVA 4V0MA 1CE8A 2IOFA 2QUZA 2I6XA 1KI6B 3L8FA 4N3CA 2R5NA 1P4GA 1XQWA 3ENVA 5G1NA 1U4NA 3L82B 2V8OA 3BBLA 3IE1A 2Q0QA 1AQYA 1R6BX 3EDRA 1PFUA 1KJNA 2Y0EA 3I5AA 3L2OB 4PAWA 3MINA 3KELA 3V1KA 4BMNA 3K0AA 2WJJA 2OFXA 4EB3A 1RRGA 2AGVA 4OGWA 4D92A 2PGOA 4FYHA 1W2HA 3GPBA 4JY7A 5AVYA 5FWDA 3WYNA 3FPGA 2XUKA 5HE9A 1E1CB 3QJ5A 3L1IA 3KQQA 4QGHA 5LMUB 2O8CB 1FX1A 3Q3JB 2JKZA 1T9BA 1P3Y1 5DHQA 5EUMA 3JQ8B 4LRQA 4WKCA 4E5YA 4KJZA 3AHEA 1V5WA 1CQZA 1CYDA 2AFHE 3Q9SA 4TMTA 3VPAA 4F2WA 1V6AA 3O92A 2JFVA 3QKIA 4PFJA 5F78A 5IKEA 1PEAA 4IX9A 1FCJA 3DOUA 5TPWA 5DBFA 1DARA 3TAXA 4B7XA 4YRAA 1DXQA 3KQYA 3QFHA 4TKVB 4LWQA 3PJGA 1DUSA 3H5OA 2ODWA 2L2QA 2LVBA 5FOTA 2HMYB 4FYKA 5CEEA 4FONA 3MRVA 3GEPA 1VL2A 4TTIA 5AXDA 3T4PA 5KPJA 1IEVA 3EB9A 4ZOLA 4PSCA 1N9ZA 4BPRA 3T5PA 3THSA 3AUYA 5KC9A 4IDOA 2BGJA 5FEMA 4PC1A 3H1BA 2OGWA 2VF4X 1YD7A 2QD2A 4ZICA 1DV1A 3JQGA 2OHOA 1HE5A 3TJMA 3FPAA 1CUGA 4TLMB 3IELA 2FR1A 2V7TA 1XQXA 3UATA 4F21A 5GADl 3FCOA 4F97A 1G9XA 1SXJC 3CIFA 3WGTA 3JV7A 1TVCA 1R4MA 1CR2A 3HJCA 3GEIA 4YQZA 1OC2A 4QBHA 3VKVA 1SXQA 2O5EA 1BAPA 3CRNA 1H1LB 1C0PA 3DV9A 3JQ6A 3TW8B 3VBEA 2QRVB 3ZHCA 1L4BA 3C0KA 3BULA 3B7GA 3DEYX 3VVCA 4F93B 5IKMA 4WV3A 5E1OA 1JBQA 4S24A 1KY2A 3EQ6A 3NTQA 3ZR4B 1KPIA 2ZJBA 2ZUDA 1WUIS 4OSEA 5GV8A 1E6UA 5I9LA 5FOXA 2DXIA 5JASA 1V25A 4K1XA 4Q93A 2FEWB 2HFKA 1KSJA 2VZ9A 3Q8KA 2GAIA 2GXSA 4FSDA 2J0VA 5DK6A 2Q7DA 3RR2A 4EAAA 8LDHA 5AUNB 4RSGA 4E3ZA 3Q6MA 1EVQA 3DH0A 4HC4A 4DIBA 3NO4A 5BN5A 2Q0SA 3DMRA 1OR8A 1K6MA 4DMFA 1FBTA 3IOYA 4X8MA 2FWPA 3MOSA 2HJWA 4TSKA 1T43A 5D87A 3BMCA 4F2HA 1JQ5A 2HCRA 2J9FA 4FMBB 4Y9SA 2ZCJA 1Y37A 5BSHA 1GIAA 2H2DA 4LE1A 1K63A 1ML3A 5BNWA 3PLAE 1WVGA 2R1UA 1ZW6A 3JX9A 3S2IA 3OTOB 3EPKA 3GY0A 3VTKA 3JD4A 5KTNA 4JK3A 3Q11A 3V8NA 4WCFA 5BW6B 4KFSA 2AMLA 3RS2A 1LNQA 1OW3B 1WB4A 4HVTA 3DZHA 1CIJA 2HBQA 4F1KA 1UMBB 3T7SA 2CN1A 3UOWA 1VLHA 1TAUA 3NGXA 4HZIA 3NHLA 2OP0A 4BAUA 2VP9A 4ZEWA 4H7JA 3MOIA 5J5VA 1LPPA 521PA 4A92A 1OIWA 1ZVKA 4Q24A 3WE7A 1VFPA 2CK3A 4PZUA 4BEVA 3N07A 4BMYA 1CQXA 3AFHA 5F4ZA 2Z08A 3WLAA 4NESA 1Z34A 3WMFA 5C5CA 1L2TA 2O6LA 5EP4A 1JBEA 3O38A 4TQAA 4YRMA 4W63A 2ZTHA 2A3RA 1V1RA 4D9EA 3HDTA 3BEOA 3RYCB 1DT3A 2CL6X 1OF1A 2H57A 5B6JA 2PMFA 1IWBB 1PGJA 2B4AA 1JPUA 3O9MA 3TTYA 2RONA 5GGYA 3ILXA 3CNEA 4ER7A 4QTTB 9MHTA 3KX2A 2ECOA 5DX8A 4AJLA 2JAOA 4WZBA 4EF4A 4HDKA 1ZEMA 5FH9A 3PE3A 1NQUA 3L3BA 5IC5A 1NRJB 2V7XA 4DCOA 4E2ZA 5EIWA 1YR1A 3S2ZA 1FP7A 4NCKA 4RFSB 2BW0A 4BS9A 2X0NA 4L75A 3C6XA 5HCNA 2GBGA 1POXA 3GLHE 2OV1A 1DX9A 2WUVA 2YS6A 4BX9A 1QBKC 3RS8A 3ICPA 1P4JA 3WDMA 1KP3A 1EX1A 5K3FA 4YRBA 1EVKA 4KIFA 5AW8A 1DXYA 1E2HA 1I24A 1YL5A 2A9PA 2UUOA 5DNDA 3RSLA 2LTAA 3GZ4A 1LS6A 4S1OA 2HXGA 2C9MA 1QFXA 3RVRA 1BMFA 4WLUA 1NVWQ 2CJXA 3G7UA 3RPEA 3UEOA 1JZTA 1PL8A 2JANA 3AFMA 4GM0A 1W29A 1ECJA 1JQBA 4H0NA 3AOGA 3OJWA 4XUGB 1Z26A 1WOMA 3PQ5A 1T9ZA 1IHDA 2P77A 2PTHA 3GBPA 1Q0PA 3H4TA 2TSYB 3QPUA 5F1YA 3TFOA 4WBNB 2Q0HA 2NU9A 4TT3A 3OJOA 3IQWA 4WVLA 1W48A 4OLAA 1T4CB 1LQUA 2ORWA 4PTZA 3AONB 3IEIA 1UJBA 1NRWA 4MGIR 4MTCA 2X4LA 4Q3LA 4UAVA 1VJCA 1OFTA 5KYXB 2HV9A 2DLCX 3O2SB 2Z1DA 3UCEA 4NE2A 2RHRA 4RK5A 5LYJA 4RFVA 3RSZA 1P29A 5KINB 1KRXA 1N5LA 3T9EA 4RGVA 1HEIA 2ZCVA 1UXJA 3E7FA 4PZAA 3GLHA 1EK1A 1WMAA 1Y1KE 2ODTX 4LI0A 5D01A 4Y2TA 3NASA 5EHXA 1ZSNA 3NTRA 1VQ1A 4OYRA 2VDJA 2Y27A 3ZUPA 3TQCA 1M6VA 1X1CA 1L1EA 3ZY5A 4CDGA 1SQ5A 2PVCA 4FE3A 4OMDA 4URVR 1TMKA 5FYQA 2IK8A 3MNFA 4TS1A 1YDFA 1TB4A 1Z6GA 4UNQA 2WDPA 1ZKMA 4QLBA 5KNCA 4LY0A 1KP9A 3EUAA 2PGIA 5JD3A 2HRCA 4YV0A 1H2YA 1E4EA 1E7SA 2ACKA 1BG6A 4LWOA 4YACA 3AHJA 1EZ4A 5K0TA 1GU0A 3SNKA 3H2SA 4Y30A 2ZTUA 3TTXA 3NWBA 4WCVA 1WX1A 4OCZA 5CRIA 4LRSB 1MENA 2A5FA 4X1KB 2QVBA 4A0RA 3ZHUA 1XXLA 4C2TA 2J5XA 1J8VA 4Q9JA 4LZOA 2HYDA 3T1QA 2FRDC 4A03A 2AK3A 5J23A 4D25A 3PP8A 4GR4A 1CUWA 4RE6A 5A1TA 1HV8A 3NHBA 2IYEA 4K05A 1TQ4A 1QO0A 4X84A 1EXVA 2OWDA 1T2CA 1E96A 3ITEA 2V0NA 2E4UA 1EIWA 3LZ6A 1K7SN 4DF3A 1V7ZA 1SQ0A 2VH2A 5EQFA 4BGVA 5CMLA 1PI3A 4HGOA 1ZM3A 1PG2A 2IHYA 1G5FA 1NI4B 2AWOA 4N0QA 3VC7A 2FZWA 2AMYA 4DE5A 1Z0SA 2VNHA 3BAFA 1JIJA 1XXHE 3PDIB 3ZE6A 1X7WB 3KKPA 1Q7RA 3ZKWA 3A28A 4FR5A 1RBYA 2VUSA 2WU3A 4CFYA 1WXWA 3BQMB 4MIEA 4PHHA 4BLTA 2EWWA 2W6CX 1U4OA 4COOA 2C78A 1I2BA 1XTBA 2P9YA 1COZA 1M10A 1N9GB 1OIXA 1SVSA 4C6TA 4FM9A 3OMXA 1PDWA 3KT0A 5AK0A 1JEAA 2UYCA 5TF0A 2HQ1A 1LDGA 1N1EA 3N2GA 4Y0AA 5FWXB 3EPPA 3HG7A 3K6SB 2ZSEA 1KMCA 2B69A 2WJ4A 2YFHA 4K1LA 5JQWA 1OH6A 1Y1PA 1AUPA 1CXZA 1LSSA 2CNWA 2QAGA 2R86A 2Y4OA 2ZJ1A 3DT8A 4EUNA 4KNVA 3HXOA 2ZOSA 3QNUA 5LM3A 3PHBE 2NO5A 4DTCA 4P08A 4MITA 5CCBA 3UAWA 4FZ3A 5H9WA 1ZGAA 5CM9C 5KHOC 3U09A 1KY5A 3DCYA 2ZUTA 5ANRB 1XXHA 1PFWA 4JBNA 5HILA 1T9DA 3UPTA 5T4EA 5CHYA 4A0SA 1Q6YA 1E9DA 1E3MA 2JB9A 2ZSBA 3E27A 3M6VA 4ER0A 5E2IA 1NRXA 2VQSA 1BGXT 1TU3A 2B8WA 2OO3A 3AKYA 1M2OB 3IPRA 5EP3A 3W6UA 2OGTA 5LN1A 3AU8A 1IRXA 2W6JD 3O8QB 2GH1A 3ZHVA 4LJYA 2A0WA 4GZMA 4KQ6A 3DBHA 3KHUA 4PBSA 4EGSA 2ERXA 2IPMA 2YNMD 4A2WA 4ZYYA 3IPCA 1H4TA 1U9ZA 2D59A 3TBKA 4RORA 3TZLA 3WJ7A 2FSVC 1ATZA 1WUJS 3ER8A 2PKYX 1IBKB 4TKZA 2C4VA 4L74A 1J1ZA 1XZPA 4TMZA 5K2MA 3S40A 4N5NA 3THYB 4OHBA 4BO4A 2VP2A 3NOQA 1D4ZA 2RI1A 2EKQA 1ODLA 5ERXA 3ND5A 2QY9A 4XIJA 4G5FA 3RC7A 1UK8A 2H7CA 1T0IA 1F38A 2AKYA 3D54D 1NY5A 3IPAA 3PL1A 1ZLYA 4G24A 4G5HA 3M4ZA 3O4FA 3UT5A 4EGQA 1XDZA 5DNCA 5L8VA 2H2WA 3NPMA 2QTBA 1VKOA 5HOEA 2WHEA 1T10A 1LD3A 4F7DA 5JAZA 5EZQA 4N5LA 4EKEA 1EEXB 1KK0A 4PF1A 2PKWA 4I1UA 4HFNA 4N47A 5EERA 1ECPA 2PR7A 4WEOA 1LWOA 2DJIA 4WLNA 3TRIA 4YUZA 5I45A 1ZRMA 2NMVA 2I71A 1IL0A 4HEA1 1N6NA 4R1UA 1LDMA 5JXWA 5BN3B 1E0DA 1WU8A 3WX0A 5A06A 3VKHA 3GJSA 5CVDA 3SIXA 3BGDA 1J5PA 3BK1A 4U2FA 4LXYA 5SY4A 4C7OB 4IILA 8MHTA 1G1MA 2GJ9A 1J0BA 2FAXA 3DXFA 4M9CA 4AUKA 1SR8A 1UJ6A 1MAHA 1Y5MA 1JZQA 1VJDA 2NSYA 1I0ZA 3ILYA 4L7VA 1V26A 3DTVA 4UDNA 4QXAA 1PR5A 3NANA 1NVUQ 3V34A 3DEJA 1K8QA 2YV3A 1KORA 2BFCA 4F6LA 3THWB 2QT0A 2VHWA 2BGUA 1JFLA 2RBKA 2ZTVA 1MOZA 3N28A 4UD6A 1GU1A 1W19A 4NNJA 2FOIA 2HREA 5BR4A 2CC2A 1FS4A 4M87A 4Q1BA 1N0HA 4BRWA 5C32A 3KQUA 4JMPA 4QC2A 3TB6A 4CHGA 1EG2A 2P1DA 3IJEB 4EMTA 3RH0A 5A5VA 1GGNA 3BTOA 1KAOA 1WABA 4JSRA 5TQ2A 1L7AA 2QW0X 1PVVA 3O03A 4TRJA 2XMGA 3UGTA 1U81A 3QLVA 4TKUB 4RIIA 3KAQA 3NX4A 4L8GA 5CB0A 4QVIA 1DELA 3N39C 3I9V6 5KQMA 3CW8X 2B2XA 2QQGA 1QU2A 3GT4A 5JCJA 3HC7A 4QNRA 5AHXA 3TO5A 3M2TA 621PA 1JLRA 1QS0A 2HMAA 3FUWA 1W4AA 4OQDA 3ROKA 2WF9A 1N3YA 2ZIVB 2G9RA 1D07A 1R10A 3G7SA 4FEAA 3SK0A 1A82A 2YXNA 3ICOA 1A8IA 1PZXA 5B53A 4K7JA 1I9GA 4XGKA 3VI4B 2GR9A 3U3DA 4R98A 2R7KA 4LX8A 2CGEA 4X8LA 5FPPA 4QOSA 3ZQJA 1DKUA 1C3EA 1NMYA 2WB2A 7GPBA 2ZI3A 2B4TO 3DE6X 5DHRA 2BCGY 1NHWA 3A6ZA 3B85A 5HCUA 3G2OA 1M1ZA 3IS3A 2HMTA 4OHXA 3SHOA 4R1LA 1R12A 3OAAA 3F4LA 1RP1A 1SD1A 2QRHA 3NBUA 4NJOA 4Y9RA 4EOGA 1SEPA 2DTXA 3AB7A 3VH1A 2ZS8A 4DC9A 1WNTA 1Y6ZA 4TN1A 4CUKA 3O26A 3KC2A 4URUR 2QV7A 1UZAA 3TL3A 2CE7A 2V03A 3H17A 4ZO6A 5L4NA 3OE1A 5EA2A 2OM6A 2XSZA 4RIEA 1LNZA 1E3EA 1XD8A 2XUOA 3SZ3A 5KNBD 5LZ5A 1LSJA 1FYDA 1UOOA 1X9IA 2ID9A 4ND8B 1YFLA 3SGLA 4QYIA 3N59A 4G8JA 1W4ZA 2G63A 2BEVB 4TMYA 5LBIA 3JYOA 4UD2A 3R7AA 2E5FA 4C1BA 2HO4A 1VBMA 3QKRB 4X7BA 1ONSA 4XD7D 3UWKA 3UW3A 1NTRA 2JGFA 1SG9A 1N36B 2ABWA 4EFKA 1XA0A 4H77A 1FE8A 3HBNA 2H1VA 3E53A 3EXFA 4FW9A 1EINA 5D6NA 1ZNXA 1YHNA 4F3TA 1SD2A 1PK9A 1X80A 4OU4A 2AXEA 2ZBEA 3FHLA 3NXKA 1PLLA 5CEFA 1E2JA 5G53C 5H8WA 5DEIA 2YV5A 1HDZA 2G4VA 4LTDA 4R8RA 3RQSA 1R50A 4PX9A 4QBGB 3RJ5A 2A0FA 3EVBA 5DLEA 3V8PA 4PHTA 3LQFA 2PQ6A 3V3TA 1FYXA 3LUAA 3IALA 3K0EA 4K9LA 1UMKA 1W0KD 3F4BA 4D9NA 2XNDA 5BW4A 3S5JA 1LRJA 4HAUA 3WG9A 4X8OA 5IX8A 4W1QA 2ID8A 1EHYA 2DWOA 4A8JA 3FX2A 1WVIA 3TIVA 2B4YA 5EZYF 5L7YA 4OYHA 3QKTA 3E22B 5E95A 4A27A 5HZGA 1PKEA 3P5BA 5FPSA 1PV1A 1REQB 3JSAA 2K7ZA 5TQJA 5KTPA 1B76A 4YEDA 3MWYW 3ZU4A 1GPBA 2HIGA 3K1YA 2FSUA 1VBNA 4I4LA 3WQHA 2ZJ0A 3BTVA 3F6SA 3HPQA 3PCTA 5EPOA 3RSCA 4E31A 3I61A 4KAXA 1JP7A 4E4TA 2AN5A 3RVOA 1NJSA 1FFXB 4M88A 5B2ZA 5G0TA 3O31A 4AO7A 3CEPB 1M3SA 1X8KA 4BO3A 6ADHA 5DLQC 2P2DA 4Q39A 4AICA 1OLSA 3ND8A 4ZYVA 4TUYB 4PNEA 4KJXA 4L4ZA 1P2BA 4U2CA 2DH5A 1C30A 1Z0KA 4Q4JB 3BWXA 2VRCA 3I52A 5COQA 1TKAA 3H2GA 1XIVA 4YCSA 4FN5A 5JNUA 4MRMA 1E7WA 2OP1A 4ZCPA 4EZBA 4W8OA 1ODTC 2V7BA 4BMXA 2DCUA 4I4TF 4JVOA 3N74A 1ENZA 2DSTA 1OBVA 4NV1A 2QIPA 4UDXX 3RJZA 1JA0A 2HU5A 3HZRA 2D0PB 2O6HA 2H7XA 2I5PO 3FI0A 3L1UA 3LC7O 4ZVOA 3SXJA 3WAKA 4TT8A 5BSEA 2AK2A 1Z13A 4BGEA 1ES9A 1HH4A 5A9SA 1TW3A 1PS8A 5C81A 2J48A 3LNCA 3W1VA 4UOEA 5KQLA 1CS0A 4KWHA 4N3NA 4C5AA 2OBNA 5AK3A 1XEXB 2AR7A 3AF6A 1IJBA 3M6XA 2X0FA 2QTLA 2OEPA 3EDMA 1UM8A 3IODA 1S2IA 1PX0A 1VL0A 1DKMA 1GQYA 1NUTA 2QTAA 2XW6A 2YMMA 3G1WA 4G5XA 5AQEA 1N77A 3RD5A 4A6PA 4M7OA 3HXPA 4UE6A 2A9RA 2CBZA 3MTEA 4PZEA 1V7QA 2FUKA 4KDFA 1UMCB 1TOAA 1XF9A 3A4VA 4NYIQ 1GUAA 1YRHA 3GLKA 4NY1A 4YFYA 1IM5A 2C82A 3ZLUA 3ZVNA 2CDAA 1BU8A 4ABYA 3DC2A 3IQDB 3E9ZA 2Q99A 1N32B 1AJEA 2X3YA 3H5RA 3P9QA 4HWTA 3V8MA 1C8LA 5K4AA 5IG2A 2REXB 5IFLA 3W9UA 3L18A 4F5DA 3OIGA 4CKBA 1AA9A 1EAYA 3P0FA 3PNMA 4JLSA 4ACBA 5HKLA 4EA8A 2P6OA 4EO4A 3RFCA 3A26A 2K4MA 3DZCA 3K9LA 5IULC 4AG6A 5JNSA 3TDMA 3KWFA 3N0RA 1TCBA 1MOSA 2AYZA 3QEMB 3HKBB 3WZ2A 2F3SA 1LDBA 5K8IA 4KE8A 4MKGA 3K30A 4F9TA 3QRWA 1PTKA 5CVTA 1V8DA 1SBIA 2XYVA 1H9BA 1BH6A 1KXZA 2BP7B 4J90A 4M53A 5DH9A 4EPWA 5TVGA 4TLEA 2X1HA 1C9JA 1YB2A 1AGNA 2JAUA 4BYMA 2CF6A 4R8VA 4L5JA 3CFYA 1TM1E 1QRUA 4TXHA 1KMQA 5HJEA 3ILSA 2H3EA 5IVPA 4AG5A 1XL1A 3A9WA 1DBPA 1AF4A 3NRCA 3EWNA 4ME6A 2OQIA 4R54A 5SZHB 1JDNA 2Z2KA 3FCCA 4KQHA 5AM5A 1UEIA 1KO1A 2PMBA 3PQ6A 1QHHB 5CJPA 3ABIA 3L9WA 4UBKA 3GIDA 1RXSA 2F1RA 2YCLA 1XAJA 4UAUA 3FR7A 1T6NA 2I8CA 3SDSA 2GF9A 3DNFA 3FAKA 3PENA 4FGUA 4CFSA 1W1WA 3DVRX 3F2IA 2DEUA 1M76A 2A88A 3E18A 5DX1A 2X3UA 1Q91A 5DK4A 3EPHA 2DM6A 4LFBB 1HL7A 3NXSA 3LK6A 2YHAA 3IDAA 5L53A 3T5AA 1V5FA 4S1NA 2WT8A 2WWIA 2CFIA 2ECPA 2Q3BA 4YX9A 5EKUA 2QTFA 2MMCA 1G5RA 3ZY6A 3U4QB 3HVKA 3SR0A 1U3GA 4NLLA 4MUBA 2BSAA 5LA6F 2X4GA 2ZYRA 3QWHA 1GZ4A 1YK1A 4J7UA 2DWQA 2J3JA 4PN7A 1II8B 1RHKA 4F3CA 4IUBS 5BRJA 1K1EA 5A5GA 5JD6A 3DLIA 2C84A 3EH1A 1RWBA 9LDBA 4XVHA 3VDQA 1T5TA 4X61A 2C4HA 2FPIA 5CPBA 4I99A 3O4IA 5IAAA 5TMDA 5BRNA 3JYLA 1U8YA 4JGGA 4WCFC 5U4XA 4PWYA 5ICCA 4RAOA 2GYUA 3PICA 4AJOA 2C5SA 2PWPA 3W5AA 3H1TA 1AK1A 4NJMA 5ETJA 3DPIA 1KAEA 4XVRA 1XEWX 3ZGXA 1WPQA 4TUYF 3TTTA 4H7DA 3OUZA 5DISB 3GLUA 1LLUA 3FUXA 4FFBA 2JBWA 3WQSB 2AOTB 3FKJA 4ZRNA 3HK2A 1XQ9A 5JSZB 4LJRA 4L50A 1WM1A 1TA0A 1UDCA 2IE0A 5A0FA 1JZSA 2PSFA 2SCUB 3MSXA 1EFLA 3TLEA 3KYDA 2PRZA 3NTVA 4IIFA 4LHEA 2HA7A 2EG5A 1M34E 5FTJA 1ZY2A 2PZAA 3CTPA 5TDHA 1M5RA 2IZ0A 3WGYA 3IFSA 4JI8B 2NV6A 1UK7A 1Z28A 4P4UA 3O3CA 4JN6B 3REQB 5K5EA 1QGYA 4J7XA 1KI3A 3KB1A 3I62A 3U4CA 1DOHA 2QE7D 3AY3A 2BTQA 1GRNA 1YJAA 3BMQB 3G2NA 4L0MA 1CUZA 1HQYE 3LX4A 2Z30A 4A9AA 2BF4A 3FDZA 3S2FA 4B83A 1V48A 4RCVA 2IYOA 1JQEA 1SOWA 5CG2A 4BJHB 1ORRA 2QOEA 4Q1CA 3EVCA 4UQPA 5C35A 4UUAA 3W4KA 2O50A 3QBJA 4PR0A 4BFWA 4EZIA 4MH0R 2CXPA 4PAOA 3DWIA 5HYVA 4HAOA 3FVVA 3WWCA 4B6OA 4LBVA 2XLCA 2C3UA 4IDNA 4S1TA 4EP1A 5KNDH 2AUMA 4AY6A 3HADA 1IWOA 3QXHA 3KE9A 1XTZA 2NWQA 3EQ9A 4R81A 4DXAA 4EMUA 4ZGBA 2ECKA 4GKKB 2O1WA 1N8SA 2YZ2A 2QPOA 2I99A 1ULTA 4KVAA 4D79A 2JRCA 2WJAA 2B82A 4YJKA 4I5EA 2BBOA 5CNIA 3LYHA 1SXGA 3SYMA 5GONB 4I0WB 3V4ZA 1CUVA 1R4NA 2FPOA 4IDHA 4Q3BA 5FKJA 4BCDA 4C3ZA 3DT6A 4PZ0A 2EZTA 3PFIA 2P9CA 3ISTA 4IGKA 4S12A 3W2TA 1V35A 5KOYA 4ZCMA 5UKDA 1E8MA 3N0WA 1FY2A 1ZIOA 3GP3A 4O4IF 5FJJA 5CA0A 1GXSA 3LI2A 4JI6B 4ARAA 4ZJZA 3IUQA 3AM4A 3RTEA 4U0KA 2GS9A 2PUCA 2LNDA 5CYOA 4ZEXA 4MR8B 1B0ZA 2CUZA 5TV2A 3VC3A 4QBFA 3MMPA 3R0VA 4XIFA 3U4MA 3ZWWA 3U9SA 2CHGA 2FSHA 4I1VA 3U31A 1UANA 4GIBA 2PUVA 1CY8A 5CXQA 4UMFA 3UPUA 1HRKA 3C7AA 4NQRA 3PLNA 4JQYA 2NNLD 1DX4A 4WLVA 2AYYA 2ZB3A 1AQ6A 3VDRA 4DWOA 3I1IA 4GGPA 5HZMA 4ZARA 2XMZA 2H4YA 2GX6A 3UXMA 4ZVSA 3UGQA 5B7QA 1EVZA 2AG6A 3E9EA 3GGDA 2IY9A 2X0KA 2Y66A 1T1SA 3L93A 4M0FA 2C31A 4Q82A 4EFNA 4RSRA 1E1QA 3ED5A 3HVRA 2VBGA 4O3FA 1T36B 3K94A 3DWGA 1R0RE 4HTFA 1RHRA 1GV1A 2XMDA 1E8NA 3F5FA 1P1HA 1BN7A 3WK8A 4B73A 3QEAZ 4JODA 2Y0CA 3FIJA 3GDWA 4DQXA 5KVCA 2VRNA 4YRTA 3PSAA 5KJEA 1XRQA 4PCLA 1IY0A 4L5CA 4Q4LA 2F3UA 1O0SA 4U2EA 4LSMA 5A2GA 1ZBQA 4C0BA 3ZNOA 1N8NA 4G4IA 4P8RA 1IXYA 3D2BA 2XMRA 4F8EA 1XNGA 1A04A 4Y9UA 4HDMA 5EE1A 5F51A 2IXGA 3TGWA 3EVAA 4IDFA 3E1SA 4GECA 2BKAA 3O4RA 5JPCA 2G0AA 1X1QA 2QTWB 3IKJA 3KT8A 5CH5A 4BLRA 1CULC 3DXYA 5LD2C 2OOSA 3C3YA 3O1HB 3M5PA 1E20A 3B1ZA 1M5UA 4NNOA 3C6YA 2P4HX 2SECE 2VHQA 3FUVA 4BNDA 2PAAA 2QD3A 1XTRA 1PR6A 3GJTA 4I3FA 4JR2A 1EGHA 3GRYA 3QVUA 3T1OA 5EYPB 1T9HA 4F92B 4FEYA 4LHZA 1YI1A 1IBLB 2PBRA 5B1DA 1IZYA 1LQ2A 2X1MA 4FDVA 1W2GA 1ZVQA 1M1YE 3WGLA 1HE4A 1JN0A 1IBCA 2AI1A 2JEZA 1U8UA 4RQAA 4V0NA 4FE4A 3ZKAA 5IJ0B 3X1JA 1V71A 1E3SA 5AI6A 2WU4A 2H8GA 5IBPA 3WV4A 4CW7A 4EG8A 4CLRB 4JYBA 3ISVA 1JPVA 3FTNA 1KZ1A 3BCSA 1IRIA 4ZCRA 5IABA 1OBOA 5KJ6A 4TWJA 3AV0B 2QQ0A 3ELBA 1TCVA 1B3BA 3H11A 4WY2A 3E7DA 2IU3A 2QYSA 4DMMA 4EHJA 3U4QA 1Y0BA 3JVEA 3MWJA 3K8QA 4FUQA 1MOQA 1MJ5A 4B3GA 2FWBA 3I45A 1D3AA 1IBSA 4WXMA 3L7BA 5LDGA 2WZBA 4MZDA 4WD3A 5B58C 4DB2A 4KC0A 4XX0A 5AK5A 2BZ1A 4BKPA 4IGFA 3VH3A 3SKYA 1GTG1 2GBPA 3ZZMA 1H4VB 3QVTA 5J59A 1ECCA 4Y6QA 2FWRA 2PSDA 1Q22A 1MB2A 1NT4A 2D2FA 3QUCA 3HJBA 3KJFA 4XRRA 3TCNA 4CKXA 2Z6QA 1C3OB 4LAFA 2PA0A 1GRCA 1E77A 1QRAA 5K8VA 4EY4A 1EUZA 3QWBA 5DZSA 4TYQA 2GYVA 1BVHA 3W7BA 1T4GA 2XTMA 1JLHA 5LJLA 3UPDA 4DVGA 7MDHA 3PA6A 4BX3A 1WY5A 1D2CA 3EPJA 2QPTA 5HX7A 4JS0A 3CUWA 1EDZA 2J5RA 5J47A 5IJXA 1NMQA 1N3BA 2VT7A 3G2MA 3V4VB 2GM4A 1QX3A 4IIEA 3HDJA 2O8BB 1XA4A 2BEJA 3KUDA 3TQFA 3UK0A 1U90A 4D3SA 2Z6UA 4RLFA 1E61A 4K2AA 1T91A 2CVOA 2HLDD 4TTPA 1NJ1A 5ABPA 2TECE 5J1SB 4WUVA 2C83A 1FFEA 1GFSA 1EB8A 1TUGA 4YMLA 3H9QA 5F9HA 2JIDA 4N4AA 3WRYA 4EELA 4G1VA 3LH5A 1SXJB 4MPPA 2OB1A 3UGKA 1A88A 2BM9A 4UBNA 1J90A 1S8NA 4BNHA 4MLPA 4P38A 5D2CA 2D54A 2Z2JA 4O02B 1IQRA 3T3NA 1XPRA 4NS4A 4KSBA 4UASA 2BBTA 1W96A 3NJ8A 3M89A 4YMSA 4Z4HA 1UOQA 4QPPA 4R4JA 1QQAA 5T4FA 1EVJA 1SKQA 1ZIDA 3D4BA 3HVUA 3PT5A 4DTIA 5FUBA 2AOXA 3OE7A 3LOQA 4CMBA 1QIGA 4HL6A 3NB0A 1XMVA 2Z3VA 2QTTA 4EPYA 1XP5A 2OTCA 2P4SA 4MPTA 5G1PA 3Q8MA 2FZKA 1BQ4A 2ODBA 3D5EA 2VPPA 3FFTA 1XZNA 5ALTA 4RFLA 5HCIA 1HZJA 1TPYA 3TVTA 3QOFA 2OYRA 1JALA 3SS7X 3HSSA 2V0GA 4WGFA 3VOSA 1NSYA 1A9PA 5B7PA 1KDOA 5B1SA 1NF3A 3F6RA 3PXXA 4NEHB 1E94E 2ZRKA 2NVOA 4ED9A 3TRDA 4XEUA 5K6RA 4MNTA 1GG8A 4PYLA 1L8AA 1WKCA 4UMDA 5EE3A 3GXBA 3AJAA 1EX7A 3LCUA 3NNSA 4RVCA 1VLMA 2O8NA 3DBOB 3Q1KA 4NZ9A 4MDYA 1U63A 3REFA 3Q0EA 4K5QA 2GQ0A 3OIFA 4XIYA 5DTJA 2UZ4A 1KDPA 1A27A 1PWEA 1XJQA 3EJ6A 1HX7A 2J3IA 4CV2A 3N2IA 3WBJA 3KFLA 4FT2A 4L2IA 4CG1A 2XODA 2F90A 2PQ0A 1VLLA 4E3WA 2BGMA 3GGSA 1CHNA 3F7TA 4DYVA 3PEYA 2OK7A 1BMDA 1G8SA 1FNCA 3N7TA 1OXKB 3F6EX 4IHJA 3OZXA 2ZGVA 4JC0A 2CL5A 3SIWA 3AFGA 2XXBA 1ZOSA 3IT3A 4KR9A 1T29A 1M8JA 1TF5A 2PKCA 3D7SA 5FL7A 2OG1A 2Z4RA 4DGSA 1KQGA 3B13B 4Y2XA 4O2BB 5ICEA 3BSSA 4IS2A 3W2FA 1VHQA 1E69A 3C1UA 3WS7A 4MHOA 1ID1A 3QLVC 1U7PA 2IEAA 3MD0A 3ONDA 4WA7A 4AKSA 4J0QA 1RRFA 5AYVA 4XDYA 2I7TA 3RU7A 4BLPA 3R3VA 4GBED 1FW8A 4D3FA 1EGAA 2PU7A 1B6TA 3EFHA 4ZVUA 1CU1A 1ZQ1A 5IAJA 5AKZA 1OAKA 3KYBA 4LVCA 3MUOA 1GP2A 5A62A 5EXTA 1RSZA 2AQIA 3HFSA 3QHQA 3WRVA 2C9BA 1JH8A 5SYMA 1AHHA 4EJMA 3F46A 3PPYA 4EX7A 4B2LA 1XAIA 3WAGA 4XYEA 3K70C 5FB3A 2Q49A 4Q7EA 3COZA 1I2MA 3DM9B 4K6MA 2ZATA 1Q17A 3OHPA 4FNAA 4TWIA 1PS0A 5E6UB 5JJ5A 1EVYA 2VSQA 4NZNA 3TJRA 2VNJA 1GFWA 4MAMA 2CDCA 4DARA 2REOA 4BN5A 2GTIA 1UBCA 3ROMA 3HGTA 3AUKA 2JFBA 1CVIA 4MQFB 2R6DA 3ZHQA 3K15A 5AVRA 2QRPA 1Z68A 2AJ8A 2VDRB 4YRRA 4EPTA 2YXDA 2ZEJA 1DO2A 4CQMD 1OB2A 5F3DA 3NG1A 3LVFO 5IBCA 3IAUA 3GR6A 3LO8A 3PHCA 1GCOA 1NV8A 5EZ5A 3SSOA 2QMYA 1IDN1 3LSTA 1CP2A 3ODGA 2X5KO 4ROTA 1HL3A 1RC0A 3CNLA 4DIKA 4ENQA 3S7TA 3SDZA 1VSQA 4OFZA 4IV5A 1T34A 4YHBA 5J2TA 1HNNA 2FZ5A 1Z29A 1YS1X 2GPBA 4KOAA 4LIPD 4F3NA 4B6SA 1SVNA 4E09A 1I7SB 1R6DA 1NRIA 2IIVA 1YRQA 4KYIB 4KZKA 4MS4A 4RZQA 1XZCA 4MJXA 3WIEA 1Z4LA 3DEIA 4JITA 1KH1A 4NPCA 2VEOA 2YQ4A 5FFNA 1A4IA 3MTBA 3U80A 4CQLB 3ID6C 3ZGYA 2IZ6A 1ULSA 4E30A 5IZCA 3LT5A 3EZFA 1ESZA 4YAFA 4EBFA 2ORYA 4RIFA 5EPEA 4B44A 2VJPA 2OBLA 1M54A 1VJ0A 2X1LA 3KKOA 1TTQB 4RPIA 2IS1A 2Z8YM 3I23A 4QYMA 2YYAA 3C1OA 4J0KA 4IYJA 3WTBA 1NFFA 2NUPA 4GI5A 1SB9A 5CB4A 1ZW1A 1PJZA 2BFBB 1DPFA 2RAFA 3JALB 4N7JA 4QRIA 1BFUA 5A4JA 1UZUA 2SNIE 2PX4A 1XZQA 3H5LA 4MKZA 1IY9A 4F6CA 3ZLBA 5B57C 2R7LA 1R5BA 1KIFA 2HBZA 2PT5A 4P32A 3DPUA 3IDOA 4ZRDA 1ZYUA 4BNGA 1RJ9B 5JLJA 3E7XA 5JE8A 4OQMA 4AZ3A 5CDYA 4A8JC 5GJBA 1FK8A 3T61A 2RGAA 3PF8A 3ZH9B 5F9FA 2Q5LA 4JL5A 1DRJA 3FHTA 3UH1A 1YBVA 3IO5A 5HM6A 4Y1GA 3BJEA 1V3QE 1F2TA 3E58A 5HF5A 1ZA1A 4QREA 2VO1A 3TE6A 2E21A 1TUIA 3A0UA 1IE3A 1SA0A 3OH8A 3A4YA 4O0LA 3TM5A 3KSZO 5DO9A 5AESA 2FQXA 4G0MA 2AN1A 2VR1A 2ZM5A 3H19A 3UHOA 4RDHA 4WNAA 1LY1A 4H1WA 1PHRA 5B7NA 3HVIA 1AS0A 4UUOA 1TAHA 4PSUA 3QUBA 3RFFA 4OHKA 3C3AA 3S5UA 1XVTA 1N2JA 3QFFA 1NF2A 1W1IA 1FJHA 1O4VA 4RMJA 3WK4A 2PGXA 3BH6A 2G72A 1JAZA 3L8DA 5EINA 1F51E 1RQ2A 2CNLA 2VT6A 3EZ2A 2FEOA 3GXOA 4FOPA 5PNTA 3VSDA 2Q4DA 4AU1A 3G6WA 3KUXA 4ML3A 5G1OA 1KJZA 1RRMA 2PAFA 1ODCA 4PLFA 4QVGA 4MR9A 3UAOA 2QRMA 5HFNA 4ZT4A 3OE4A 5SYNA 4DM7A 3ZIAA 2IP4A 1SVKA 3U4IA 4M83A 1QCCA 1SULA 4FQ8A 4Y1EA 2AJLI 4XB6B 4GLFA 4LBYA 4P3YA 2YHIA 2VQEB 3Q10A 4FFRA 2IYFA 4LXTA 4R9NA 1XTKA 1FUIA 1X13A 4MWZA 1Y7HA 3P2MA 2C54A 2QJOA 4C0HA 2A6PA 4MUNA 3HBFA 4PNHA 4HAZA 4PRKA 3IC5A 2ZIZA 3FCUB 4XUEA 3GPDG 1DL5A 1JI0A 5GZ3A 3BMNB 4WFQA 1DU4A 1LDNA 5KJCA 4BFCA 5JAPA 4Z3OA 1K97A 4IO1A 3T3GA 4MS3A 2VAPA 2E7ZA 2P8SA 1IFXA 1PNTA 3QX9A 1L8LA 1P73A 5I9SA 4P82A 2QW8A 2F8SA 3KV1A 3PDJA 2Z4TA 3S1AA 2VAXA 2WIBA 5J3JA 4BQRA 3PA8A 4LHVA 2KM1A 4ZQFA 4AIRA 3VMFA 4G8CA 3HRHA 5EJ7A 3N2ZB 4JWTA 4RA6B 5DLYA 2QL5A 3D6FA 2IODA 2HDOA 1T15A 4A82A 1J9EA 5ALOA 1YFKA 3PWTA 3G5LA 4CEIA 3ZE7A 2HOQA 4CR8A 3HWWA 2Y05A 1OSNA 3T9CA 3AVYA 4PXSA 2VH5R 3EWSA 1CY6A 1DIRA 1R0BA 3B1FA 1YZUA 1GG2A 3K72B 1JG6A 2YTZA 4R2IA 3WMXA 1O89A 4C7MA 3PNOA 3U39A 2JAXA 4R1MA 4Z7NB 3K4PA 2XZOA 2BFMA 2FGKA 2SICE 3F0TA 3PUJA 4PBTA 3CGWA 3GCWA 2WU8A 1UWCA 3L1KA 1J33A 2CXSA 1LS1A 1UXOA 2TS1A 3E5HA 3M70A 1UADA 4ZA2A 1J2UA 4ZAXA 4F3KA 2IS2A 3S70A 2DAPA 2VIIA 1QPZA 2Q28A 3R5HA 2XUAA 2FUG1 4OA5A 1V1JA 5BPFA 2WWRA 5BSRA 3NEYA 4GRAA 3HO1A 4NCJA 2O1EA 2O2XA 2MWMA 2PRIA 1N0VC 4L4RA 4TQGA 2XBMA 1U7HA 4FNOA 5IAEA 4DG5A 3KETA 1K2VN 2HZBA 4W9NA 1HO3A 2IDZA 1G2OA 1UDAA 2FNAA 2WVGA 4HRAA 4PLVA 1CQPA 3VZQA 4D4KA 1HQCA 3SQDA 4A2CA 5IKPA 3D02A 2P90A 3O7WA 4MVCA 5ADHA 3IBCA 5ESRA 1U3WA 3C87A 4H0FA 4BNMA 1S2NA 1JWAB 1NBME 3M83A 3W9YA 2P27A 1MTOA 4Y6RA 1OHHD 3I9JA 4I50B 4U7WA 5DHFA 3EIEA 5SV2A 5LP1A 1CC1S 3GUYA 4G81A 3UF0A 2AX3A 4O6VA 3V1YA 4DG8A 3TQIA 5G2OA 4X1OA 3RK0A 4OXYA 4F1JA 2OLEA 4GX2A 4UQLA 2LW7A 4MS1A 3VR4H 4AZ0B 3RC9A 4GPD1 4BLSA 1T6ZA 4MJ7A 4WKNA 4C06A 4DWVA 2A35A 3P20A 4JYAB 1YRAA 5I6DA 2PBFA 3DDHA 4J07A 1CIPA 1Z5VA 4Q4DA 3C3BA 5CT6A 1CDZA 1AOXA 1BVRA 2EW2A 3EVDA 3W9BA 3ZHSA 1JQAA 1SUWA 2GERA 3IV7A 2I54A 2RFLA 1Z7YA 2NOAA 3BFPA 3HR8A 3JVVA 1OJ7A 1DXOA 2V5AA 3EJWA 3VNRA 3D4OA 3G82C 4JENA 3DAHA 3EIFA 5I4KA 2VTEA 1JR3D 5DOVA 1BA2A 3LL7A 1HQDA 1NLZA 5DRTA 5JDIA 1YE5A 2FB9A 4K0RA 3ZD8A 3UMJA 3KEMA 5JROA 3JQAA 4N9WA 1NBMA 4RV9A 4MUIA 1CIVA 1H2ZA 1J25A 5A4DA 2GZ2A 3QLTA 4KGDA 3EYAA 4YMIA 2JPDA 4NTZA 3RAGA 3BHNA 1GGHA 1YH3A 2IEIA 3WBBA 3O8OB 2CZCA 2IYZA 2VXBA 1D1QA 2D8AA 4YPFA 1CF9A 5HUQA 1ESEA 4CMAA 2NZVG 4ER3A 1ZC3A 5H3LA 4IIBA 5K0SA 3MJEA 4YWJA 1UWLA 4O4HB 4JASB 4EYQA 4K8OA 1KOFA 3I30X 3KOMA 2AD5A 3UMGA 4C6SA 3AJRA 4BCCA 3V1TC 5D1HA 1N1MA 1EI9A 1NVTA 1MABB 2RIPA 3GLSA 2XKJE 4D3XA 3V80A 2Q1YA 3U56A 4F8YA 4DLYA 3H2HA 5I8ZA 3M5DA 4YAUA 2PUJA 2CVZA 2VJYA 1W8DA 3JAWB 1X8LA 1ACLA 2BKUA 2P3SA 2ST1A 3DGEC 4O1MA 2ZI9A 2G83A 2IXTA 1G8AA 3TL2A 1TVKA 4ZYXA 2CHVA 3HMQA 2VWGA 4PWZA 4D6XA 1MW8X 10MHA 3IXQA 4KK3A 1W76A 1YDGA 1SC4A 2VK8A 3JZMA 4PTYA 4IINA 3NM4A 2OESA 4E32A 5A4MS 5E9QA 2P62A 3H1PA 1MVLA 3ZYZA 4RV4A 2JIZD 4QD3A 1G0OA 1JU3A 1D1TA 3R09A 1WW2A 3V33A 1A9ZA 1G38A 1E9AA 5JQGF 1KI4A 1K7YA 4Q9LA 3RV4A 1TZ2A 4G37A 1EZZA 1ULZA 3NGLA 4FYMA 3E1KA 3HB7A 4KLAA 4XYMA 3EWIA 2B98A 3RC2A 4OFXA 4EHBA 3B3AA 1OI3A 1YKGA 1QIMA 2OA0A 1HWYA 2PU5A 5FI5A 3GV0A 3KZCA 4RTKA 3QVJA 4PFQA 3UJ6A 3ZDQA 3I9FA 2JW5A 1FSZA 1U8EA 1AA6A 1OBHA 1GFIA 4NDZA 4AUNA 3PNYA 3H87A 3DD1A 3P0HA 4IIGA 3DQZA 5DBEX 3BRWA 2VK1A 5EXSA 1KWGA 1ZIXA 3IPLA 3WL3A 4EA9A 2V8BA 3HCEA 4URFA 4F7WA 4YJFB 1NXTA 3FPKA 3KZVA 4M1EA 2QORA 4OSPA 3WQBA 3GLQA 4DJ5X 5KOHA 1ZMBA 3HA5A 4V0RA 3AI2A 1GQOA 3QHAA 5FLXA 3KLBA 4G86A 4MW0A 5AUQA 4RLHA 3DL4A 4EL0A 4PG6A 1BJRE 4XASA 3SEZA 4PYJA 3BMXA 2DH6A 1M2HA 2E87A 3NFRA 1I3NA 3FUUA 3HDGA 1NW5A 5FWAA 3JATB 3I5UA 2G3YA 3V2UA 3KQSA 3OHSX 4OHRA 4M1MA 4TWBA 5AT1A 1UKAA 4DL9A 1KFKB 3Q7SA 4F6RA 5JNVA 4I50F 4NV3A 4Y6LA 4BNNA 4OM8A 3F8TA 3WL4A 1WNFA 3BXPA 2A5YB 4DLTA 4Y1FA 1BMQA 2DQYA 2UYGA 1Y7TA 3QPBA 1P72A 2WR8A 4ZI5A 4CL8A 5KEIA 1I8TA 2QIOA 2VTBB 1DKRA 3PDUA 1MAUA 3RT1A 5B3JA 2MMGA 1IBRA 1VB3A 3VKWA 3EX7C 3D0RA 4U9HS 4DZZA 3ZWKA 1R5NA 2Q1WA 3PD7A 5CGZA 4AMZA 3I83A 1TLLA 1YHZA 2TMDA 4TXLA 2DLDA 1LC3A 1SC6A 3FI9A 1RXEA 4ND3A 1QDEA 1DJMA 1G8GA 2WHRA 2XH8A 3D64A 3RASA 5JWRA 1E2QA 4ZZ1A 2GEDA 2VC2B 3G88A 2R8BA 3KEFA 4MA0A 1XTQA 2G8LA 2ZIGA 5TR9A 3K0AB 4JJAA 4NE9A 1CZOA 4LYFA 5B2FA 4OXQA 3NBAA 1WCV1 4CEHB 4AK9A 4I81A 1ZAYA 4LKRA 2ZAYA 4YP0A 4Q6WA 3RQIA 5HGJA 2C98A 2XIJA 3L1JA 3N2KB 1GLGA 2VQFB 2SKEA 2CB0A 1J8DA 2CSXA 3GDGA 2B3TA 2HMSA 3AUFA 2ZCUA 4JUIA 2IV7A 5HKAA 1PRYA 3PKZA 3QM1A 5LP6A 2WMDA 3BICA 4TMWA 1JHRA 4LECA 3D6NB 1DXHA 3MMZA 5TPWB 3WHLA 1KTIA 5D51S 2V7VA 2VTVA 2ZXFA 2QGZA 5FPYA 3K7EA 3GLGB 1CZHA 4BMDA 4UU1A 4LZLA 4FD2A 3NR2A 1P91A 1PUXA 3OJXA 3PPWA 5CX1B 2R62A 1OPXA 3M81A 3GRUA 2O3JA 2ZROA 4QFMA 2VTKA 1NQTA 2PFKA 4ZOLB 5ILGA 2K5UA 3AHFA 3E9NA 1MGOA 1JX6A 4KPYA 1F17A 1UL1X 4ZVTA 1QKJA 1SCNE 5AVWA 1U7ZA 3JQGB 3WRYC 2B6HA 4I8XA 1YQEA 2AMJA 1FDIA 2HADA 4QKQA 2BEWB 3SG0A 3WGKA 2G08A 4NE7A 5CT8A 3LP5A 2XNJA 4CLOA 2J5QA 3U5ZB 5DN6A 4OQPA 2X3FA 3WFIA 3HZZA 2D4HA 1DIOB 1JDTA 1E8DA 1IM8A 5FR1A 1GEGA 5ALIA 2O5RA 3RROA 4DIMA 5F98A 3CC8A 2CLMB 2R1VA 3QZUA 1JLMA 1YACA 1M66A 1GG9A 3C74A 3IE0A 1T8UA 2L17A 3MBKA 1ZMOA 4HN4B 4RVHA 4ZVMA 3E05A 4KOEC 4D02A 2ZXUA 3RSQA 4X62B 4DR4B 1UDRA 2VSNA 3NYIA 3DDWA 4I5FA 3GFVA 4PONA 1HSZA 2MJLA 3R3WA 1DMSA 4QA9A 3W04A 4AYWA 4YQFA 3PNPA 3W5HA 2R1ZA 4IKOA 4JBHA 1U2PA 3MT0A 4PX2A 1D7AA 1B8PA 2DFKB 2J87A 5E3IA 3VZRA 4FC7A 4H6XA 1V11B 1RBQA 3B7WA 3GT0A 1Z25A 1PL7A 2FK7A 2O2HA 3BMCB 5CU7A 2LCQA 4TKLA 2P7HA 1LBHA 1N2HA 3CVYA 2AOVA 2JEOA 2HWWA 2MTBA 1PR3A 3GJ7A 2XY4A 3PFFA 3HEAA 5FBRB 5KOJA 1DNPA 4LX0A 2I22A 4MQUA 1BVUA 4GW3A 1KPGA 3DBVO 4GGOA 5HMLA 5KTSA 3KWLA 3DF7A 1KHHA 4WCFB 3IA7A 1KOGA 3RKUA 3NFYA 5EE0A 4LZAA 3N2LA 5AW9A 1SC9A 1PBNA 3LBNA 4C6HA 2QMQA 4KR6A 4L6AA 3CEHA 3NHKA 3F1KA 5BSKA 4PGAA 3ZWVA 5H9VA 4F4CA 2AFIE 4BVEA 4DN6A 1GKYA 3V7UA 4BFXA 3SVLA 1IHOA 2ZUFA 4JXXA 2BIFA 1RBZA 4JP2A 5TS3A 5JJKA 4NAUA 1C7FA 4B7ZA 1T8RA 5MFZA 1JIVA 2IQIA 1FF9A 1WR8A 3SU8A 4E07A 2VCEA 1BWRA 1F5SA 1V1RB 2VJNA 2AW5A 1OTYA 3OQOA 1DLIA 4HFRA 3ONFA 5AOBA 3TLAA 2IY8A 1CRQA 1JE0A 1TE2A 4HH4A 4BO5A 4DDTA 1YA6A 1TUEA 2JLUA 3H5IA 1O96A 4JT4A 1CJCA 1X92A 2DKOA 4NPHA 3R5TA 1BMFD 4RKYA 1XCJA 4S3MA 4ZV9A 4CM6A 5JC8A 3LQQA 1J4AA 4E2XA 1MDFA 4U7TB 1TFRA 2BHTA 4B9EA 4NI5A 1A4XA 1SVOA 4PSAA 1XKTA 1G2QA 1OBFO 1EJBA 5TF4A 1E3WA 2PUBA 5AJVB 5EKDA 1V2GA 2ODEA 4Y67A 4TT3D 1B6RA 1NP6A 2X8JB 5K3FB 4M86A 3UUGA 5ALWA 3BHMA 1GZUA 2AFIA 2PJDA 4HLQB 2C8KA 4O4JB 5IJWA 4L1KA 2R6FA 2VYNA 1Z88A 1YZHA 1QHNA 2C2OA 4DSZA 3THXA 2P2ZA 1G20A 3WLIA 2YINC 3K1AB 4MVJI 1T2FA 1YNSA 1V9CA 1AMOA 1Q1AA 1YVRA 2HMUA 4FIDA 3KVOA 3IEVA 4U7FA 4UQOA 2GZDA 2Q50A 1XL0A 3NS7A 3K1ZA 4G89A 4XGRA 2XBUA 4KXQA 4XPIB 5JVDB 4EHAA 5DP1A 3GN2A 2NU9B 4XR4A 4DDUA 1Z36A 1JVSA 1N7IA 1TF2A 1I0IA 2XZPA 3OLCX 2VCHA 4YJ2B 3OLXA 4BKQA 3EODA 1U6IA 3TYXA 2B1RA 2P9EA 3AIMA 3HJGA 3ME5A 2OHFA 1MPXA 1WY7A 4JP3A 1EX6A 2GK4A 1O3YA 1H2AS 3WLSA 7REQA 1KK2A 1GNQA 2XOKA 5EMMA 3RAPR 4IZHA 1OWNA 1XTUA 4L16A 3RTCA 1NPDA 2PFGA 4DLAA 4DBLC 1QWOA 2GCOA 3D8SA 4D82A 4ZOLF 1NVDA 4RY2A 3GLHB 2QN7A 1J0CA 2IDKA 4JCOA 2P2CA 3C1TA 4MB0A 4PR3A 1NUSA 1VL1A 1MG5A 1M6VB 4QJ5A 2WEKA 3BREA 4IHQA 3I0MA 5EVJA 1II9A 4E7PA 2H54A 2EBHX 1ARZA 3O0DA 2FOLA 2HEIA 1C4XA 3C39A 3L0SA 2QP9X 3NLLA 3ZYCA 2VJLA 2GA9A 4TL9A 1WQ1R 1D4FA 5L4LA 1E4EB 4NYMQ 1R0SA 2J08A 5F7JA 1QO0D 4TS3A 5AH0A 3RIMA 2C03A 3TMAA 4P9NA 3P2KA 4BE7B 4EF5A 5KWVA 1CRWG 1QHIA 2WYUA 4OQFA 4II7A 4JYCA 3ZPXA 1OAAA 2GCEA 2OENG 2NGRA 3C6KA 1RVDA 4BN0A 2ZYVX 5SY6A 1U1EA 1MX5A 4ZP1A 2IPAB 3U4DA 1WEHA 4XLLA 4BTEA 2H4JA 3FLMA 4C88A 5LD2B 3KZNA 5ALJA 3JTMA 2OB2A 5TC4A 3USCS 2GFQA 4MMZB 3QELA 2MSKA 1HBJA 3L02A 1U2QA 1BXZA 5CIQA 1V8FA 2GN6A 4HNSA 4J2OA 1NQAO 1TK2A 3C6ZA 1MO2A 1MB3A 2ZAGA 1DDGA 1KMMA 3TF5A 1WSBA 5I47A 3MFYA 4HYQA 4J7AA 4DNOA 1LSOA 2A0XA 5ELMA 1JTVA 1NOJA 1UAYA 2BR5A 3F78A 1IOWA 1P0MA 3SHWA 3TEMA 4YUVA 4BB0A 5E1DA 5A9TA 3U1BA 4GH5A 4WLEA 2DQZA 2J4DA 4UUQA 3R8XA 1W36D 2V96A 4FR0A 4NU5A 2CNWD 1DWPA 3G8YA 3IQFA 3LXXA 4HVCA 2IVFA 2Q4RA 3MBIA 4WESA 1L5FA 2AVNA 4A1OA 1SBTA 2NSDA 4D6PA 1PJ4A 2ATXA 3HHEA 3JU3A 2HNKA 2QY6A 1YZFA 4HYTA 4RANA 4C6TB 3ZXIA 2RCNA 4OLFA 4DSAA 3Q5DA 3SMQA 1RWKA 4C07A 2CYBA 1RADA 1JEYA 4JB2A 2FKAA 1W85A 2NVUA 3WRXC 2AD1A 5T5QA 1TPZA 4Z5XA 4EKYA 4JBWA 1PZNA 3VPDA 1GO2A 3ZD9A 4J94A 4D4HA 3DULA 3LW7A 4F1WA 1D1PA 2RK3A 2PPVA 3LS2A 3R7SA 1C2YA 2D1YA 3OBIA 2AEFA 1KSFX 2CBGA 3MJCA 5DHUA 3WA7A 3NH6A 2PV7A 2X14A 4LYJA 3MWEB 4UJ3A 4LQ4A 3QVOA 2VP4A 2R6AA 3NCTA 4FHDA 2OKGA 1QTRA 2VNKA 2BFAA 1O94C 5JSQA 1ZJ5A 3EISA 3MTQA 1XXHB 2C0CA 2I7CA 3BWVA 4LJ4A 5FO0A 3E81A 3ZWXA 2CKDA 4ZAYA 4CN9A 3WJ2A 1XJ0A 4OHOA 4D44A 5HEKA 5FLKA 4RSMA 2GRUA 3AR6A 1NG9A 1ZO8A 4F9GA 2YV1A 2JLVA 3ORFA 1A2BA 3PJEA 3UJHA 3WNVA 3OT1A 1IZ8A 3MEQA 3UKOA 2FUCA 5EC8A 2Q1UA 2JGKA 4MVJA 2ZE6A 3CZAA 4NABA 1F12A 4UCQA 2NPIA 4RK0A 5H3HA 4X3OA 1POWA 3TSWA 2VDKB 3E1GA 2NADA 3FKQA 3HO8A 4DYHA 4OQZA 5M3BA 1WXDA 5C5DA 3LLVA 1A1SA 1ZRNA 1DBVO 2B3DA 3ETGA 1WSWA 4G4GA 3JD1A 3KDAA 5IAGA 5G3ZA 3UM9A 4DGQA 4ZJPA 1SQSA 3AOEA 3VA7A 4HVLA 4C03A 1R15A 4YYEA 4Q3DA 5KYUA 3LA6A 2GM5A 1D5CA 3FHCB 3UT5B 5BN4A 1MN6A 3J80A 1Z39A 1Q84A 2OK8A 4OEHA 4ZCIA 4KI0A 4BQFA 3U48A 4C3UA 1W94A 1EP2B 5HJ5A 1H66A 1NVEA 4IXNA 4XWTA 4BZZA 4E4YA 5LYJF 1TDJA 1GT91 3DTVD 5I7VA 4MVJM 3MRXA 4AF6A 4MV5A 1N5DA 1T8WA 1HG0A 1CZRA 4F72A 1X8JA 2W6MA 2ZU0C 3GWZA 2B83A 3HP4A 3YASA 4DPLA 3CBQA 1PO7A 4AWXA 3DOJA 4TXMA 4XOIA 3T38A 1TYAE 2WT4A 3DDOA 2PT6A 4J4HA 3T7JA 4IXTA 1BDBA 2NU7A 2PZGA 3GI1A 4W9NC 3T9DA 2QROA 1SKUA 3UOAB 1QE0A 4CMIB 3TOZA 2PZEA 2GJKA 4R7ZA 4LOKA 3VX4A 1VP9A 1X2BA 3NATA 1E3TA 1KYWA 2VHCA 3LKBA 2JGRA 2CXTA 3DGFC 3C4JA 4YCMA 3VH4A 1HG1A 1JKJA 1L7VC 2G71A 3SBOA 1IXZA 2HR1A 5FHRA 4OXRA 4UPVA 2I4OA 3ZGOA 2BFCB 2HRZA 1VI2A 2HPZA 2Q6OA 4LWZA 3SD7A 2WZDA 3FHOA 3W6PA 1D6JA 1P2UA 2PNJA 5ER6A 3B6EA 3ZS8A 5AVXA 4RE5A 2JFWA 5DTIA 1XR3A 5EMKA 3WC4A 3ZVMA 4GKBA 3UO8B 1UJ4A 1WMFA 5LZ7A 5JCJD 4AM8A 2YZKA 3HU3A 1A8HA 1TLTA 1TUBA 2ECFA 2XNHA 1D2RA 4HT3B 1MJFA 1QKKA 4H4EA 5TQ2B 1TKCA 4ES6A 5BP7A 2PUFA 2PZFA 3DB2A 3ET4A 3LUJA 2IDJA 5L95A 5CFRA 1QV6A 3DYVA 2GZSA 4NMMA 4R68A 3ZWBA 3K70D 3OPXA 1B43A 2P0AA 3QBVA 2ZSKA 4P93A 4M46A 3VO1A 3G5MA 3TVYA 1H3FA 2NIPA 3LUHA 4I4IA 2GZMA 3OAAD 3W7VA 1B1CA 1FDSA 4OTZA 5JDIC 4RU1A 4XTRA 2ZUEA 1O5OA 1ZN8A 3CPJB 2ZIXB 4IUYA 1ISSA 3ZUGA 1VDMA 4PC2A 1CJMA 2CVQA 1PIWA 2G8NA 3L7OA 1SHJA 2JZCA 1KIMA 1P75A 2P5UA 1ADJA 2XSZD 3KOOA 3LT1A 1JG1A 1U3FA 1YB1A 5EHNA 2OFFA 3ZHOA