2P6MA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDMPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p6mA00
3IT2A 2P78A 2P30A 3EZNA 4ODIA 1SK8A 4JOBA 3IT3A 3F2IA 3D6AA 2P79A 1C81A 3PGMA 2P9FA 4D4KA 1DKQA 4E3WA 2H0QA 3K4PA 4EO9A 4QIHA 1CVIA 2ENWA 4ARSA 4PZAA 4D4LA 1K6MA 3BIFA 1XQ9A 1QWOA 1E59A 2F90A 2P6MA 2HHJA 3FDZB 1QHFA 4PGMA 4GPIB 2P9YA 2EOAA 3E9CA 4ARUA 3C7TA 5AJZA 1SKAA 1RIIA 2H4XA 3O0TA 2DWPA 1FZTA 3R7AA 4FDTA 3GP5A 5PGMA 1UJBA 4ARVA 3QPUA 2P6OA 2H52A 4D4JA 1QFXA 1RPAA 3HJGA 5CU7A 4MA4A 3FDZA 3IT1A 1FBTA 3DB1A 2OWDA 4JODA 1T8PA 2PA0A 2ENUA 4PZ9A 5CDHA 4D4MA 1DKPA 5AJVB 3GW8A 1V37A 2HPAA 5CX4A 1DKLA 3NTLA 2WNHA 2I1VB 4TSRA 2P9ZA 3MBKA 5AJYA 1ND6A 1IHPA 3K4QA 2WNIA 1UJCA 5AK0A 3E9EA 3QPVA 3NFYA 5HR5A 3EOZA 2H4ZA 2IKQA 3E9DA 1DKMA 2OWEA 2QNIA 2GFIA 3QPWA 1DKNA 1SK9A 2RFLA 2YN0A 1V7QA 4IJ6A 4FDUA 3F3KA 3FJYA 3KKKA 4GPZA 1BQ3A 2A9JA 3GP3A 1H2FA 1SKBA 4EMBA 2P75A 4HBZA 2P2YA 2EKZA 3DCYA 3OI7A 1C7ZA 1DKOA 2BIFA 1YFKA 1RPTA 2HIAA 2P77A 5HTKA 1H2EA 3MXOA 3D8HA 3IT0A 2A6PA 1E58A 1EBBA 1TIPA 2YN2A 2WU0A 2DWOA 1YJXA 1NT4A 3LNTA 2AXNA 4IJ5A 4JOCA 4AROA 2P2ZA 5AJWA 3ZHCA 2EKBA 3LL4A 1BIFA 1C80A 3D4IA 3LG2A 1BQ4A 1ND5A 5AJXA
chains in the Genus database with same CATH superfamily
3EA4A 1NOKA 3UVEA 4C6HA 2Q3JA 3OJLA 3RC1A 1L7VC 1OROA 1UT6A 1DG9A 3BD8A 2IW3A 3N28A 1AUQA 3R8FA 1JHXA 1G8JA 1U98A 1XWFA 3QHAA 4DT1A 2JFGA 2JZCA 3KXDA 2Z4RA 4DDVA 1CEYA 3K0AA 1K7FB 1RMYA 1TCCA 2QVCA 3IQHX 3K4PA 5KX5B 5LJIA 1Z6GA 2QZPA 4M1MA 3FOEC 1MIOA 3EFBA 1EUYA 2BCGY 1VHWA 3TL6A 4NZMA 1TQ6A 3KJGA 2Y6VA 1UMKA 1MRZA 2AZDA 1EP2B 2HF8A 1UJ5A 2W71A 1YQUA 5C18A 1QHFA 1AXGA 1OYVA 4GI5A 5L7YA 5F7XA 4E12A 2BFPA 1JZTA 4CUZA 3O1IC 3T61A 1ZC3A 4GKKB 3DVSX 2IHTA 3B70A 3PFHA 4Q7EA 1TAUA 1TD9A 4DS3A 2HPVA 3OM9A 3KTAA 2ABWA 1UZLA 4MR9A 4NCHA 2OZEA 5KAMA 4J4TA 3QEBZ 5F2EA 4RPJA 3UAVA 4HB3A 1AURA 4H0FA 3UYKA 2HA7A 2YRFA 3UG6A 1VMEA 3BTOA 4MDFA 3DSRA 3ZDDA 3EFHA 1AQUA 1JG7A 2Q6OA 3BK1A 1RQLA 3F9RA 1X9IA 1RJWA 3K8OE 3LUBA 1Z18A 4NHOA 3CXUA 1T5IA 1AKNA 2G1UA 4LSMA 5FADA 4MRVA 1R6AA 4XCQA 4HWTA 4LRYA 4UTNA 1JKMA 3IB6A 2DQSA 1TEZA 2OLJA 4AO7A 1BVHA 3O8QB 1EE2A 2WNHA 3G5UA 1PEKE 1DAKA 1YMVA 2GBCA 3E0XA 3PLRA 4NPCA 4OBEA 4QGHA 4KN5A 3VU3A 4V0ME 4O4IF 1SXJC 1VA5A 4NMXB 5H0IA 4HEHA 4TUYF 3KOUA 1OBHA 1WABA 3DTVB 4XFKA 4JL5A 1ENYA 5LOVA 2FOLA 4KVZA 4UZFA 3DOHA 1ZW1A 3HO8A 4NP6A 4DQLA 4DOMA 2RAVA 1MRSA 4BLVA 3OA2A 4M0DA 1WV0A 3K53A 4Q4HA 4E30A 5JHGB 1P6XA 3CLSC 4HF7A 1KDVA 4Z4EA 5KZMB 3LCMA 3F96A 2W93A 4NYIQ 1J00A 3KKOA 1R4AA 2PXHA 1BS1A 4YFYA 2OO3A 1Y1SA 4C7XA 2AZ4A 4GO1A 3TK1A 2OV2A 2QJWA 3SYKA 1X74A 2V6FA 2XDWA 1C1HA 1CR4A 1FUIA 1JHZA 3KJXA 3WLIA 1QWSA 5IFKA 2RCYA 3RVKA 3ZXSA 4F8YA 4HZUA 3WS7A 1YHYA 3K5IA 2J07A 3IESA 4WLUA 1CHNA 2QWXA 4ESHA 5L3SA 1I3KA 3FCEA 2FPOA 5L4NA 1N36B 2H5LA 5HF5A 3R2JA 1W44A 5FIUA 4ARBA 4C6RA 1ODSA 4ZCPA 5SY4A 1P17A 2MSDB 3OF2A 1HDEA 1Z82A 3MMXA 3QNUA 1X8XA 1DKOA 3M33A 4IILA 2PUBA 3KLNA 4MKRA 4YECA 1PFUA 4LZPA 4R81A 3ZV3A 2IHBA 4FEYA 4FHZA 5CIWA 1TIBA 3T1VA 4FKZA 3P9ZA 4LC9A 1KY2A 4LZLA 4CGYA 4EG7A 1BGVA 1OQAA 1DAPA 1C0LA 5TB5A 4Y6LA 5IARA 3K0AB 1UL1X 4O8ZA 3UKJA 3IVGA 1FNSA 1ECLA 3DMHA 1MIOB 3R5SA 4AIIA 4X1IA 4RK6A 4AO6A 1ZXLA 1FY2A 4LJKA 3LHIA 2QF7A 5JFTA 3GLGB 3QG5A 4ZGGA 3CR8A 1UJMA 3CNQS 3ISJA 2N47A 2G09A 4L57A 1E69A 4XH9B 3RBXA 1KMCA 5KYKA 3I6IA 5HCIA 4KRFA 4ENVA 4DARA 1Y6QA 4F3NA 3DDZX 4X7MA 2DHCA 2VHWA 4PLZA 3HO6A 4DL9A 5LDHA 2HXYA 2JCYA 3GFRA 4MS3B 4BBZA 4CCYB 2FJ0A 4JUBA 1N1DA 5GONA 4EH1A 3PQ3A 1NMQA 3KXIA 1WQ1R 1QR2A 1VSVA 4BV3A 1FPQA 1FQKA 1Z8DA 4YT5A 2ZIXA 1JFVA 1KK0A 1KHHA 1NVTA 2Q07A 2VTKA 2LNDA 4OHZA 2HDOA 2PSDA 2R62A 4ZK6A 1KJYA 3P2OA 4K6FA 6AT1A 4PYOA 5LQCA 5IT9A 2W4IA 1Q6YA 2P9QA 3EFEA 3QEJA 4HD8A 4QGSA 5IHXA 4NOLA 1NVEA 5IC6A 3PGLA 3BFXA 5EWMA 3HYCA 3MD9A 2XUDA 4J29A 4Z0NA 1JJBA 3IIIA 1A5BB 1Y3AA 2GZSA 5JJLA 1MX5A 1OI2A 4G25A 4W6ZA 5E9JA 1AGRA 4PF1A 4U5XA 5BWOA 2VDWA 3FN4A 3LX8A 5LNK6 3PEVA 4DR1B 7ADHA 4X7RA 1TW2A 2I7CA 2B4QA 2EXXA 3B89A 3AEQB 3ORRA 2H9IA 3EVFA 1NKTA 4KI0A 5AVJA 3V4PB 3O93A 5EWLB 1H6BA 2Y1FA 2CMHA 2QPAA 3B6IA 1C7RA 3MB8A 3PUHA 4XASA 1BU5A 2O57A 2X2FA 2YFQA 4QOEA 4W63A 4RTPA 3RBVA 1LX7A 1OWMA 5AM3A 1EWVA 1U3GA 2QORA 1I2BA 3DBLA 1QVAA 4YP0A 4Q3EA 5A7FA 3H2JA 3A7DA 2ARKA 4A1FA 2VWQA 5SYNA 1Y8QB 4FKBA 1GG5A 4BYGA 4HZUB 4DTIA 1YZTA 4H3KB 5ILQA 3RH0A 5L3SB 2ZJ0A 4F2GA 2OECA 5AM2A 2FG6C 3KJNA 1JBKA 1WXHA 4Q3NA 4NFHA 4F5ZA 4QDJA 3GLIE 2E4ZA 1LW7A 2C95A 1XRNA 2HCRA 2I66A 2PZFA 5P8WA 4M98A 3ZOKA 4ENTA 2GWHA 3EQ7A 3L4BA 1TLLA 4A2QA 1KDTA 4F06A 3RUHA 2K7ZA 3DL7A 4TTJA 4XUGB 5K3FB 1NC3A 5DV9A 2WKPA 3KE8A 1EESA 1EWKA 2CJWA 3GFTA 4X20A 2J67A 1M10A 2W2KA 3DEFA 1G8YA 4Q47A 1BVRA 3TXYA 2AK2A 3R8XA 3PRYA 2UVPA 3ZY6A 4YUAA 2WVAA 1KJIA 1QE5A 2Q4BA 4HYYA 4ND8A 1ZICA 5ELMA 1FFHA 4EUKA 3K7EA 3OZRA 5GADl 5NLLA 1I94B 2XBUA 1S0UA 2NU8B 1QGYA 3VAZA 2VXOA 4QO7A 2VHCA 5CXQA 4ZVRA 2QR3A 3N86A 5K4GA 4DA7A 3VSAA 4WOPA 2WOJA 2B3DA 5KYNA 1D2NA 1G2IA 3ELUA 4LCEA 4DV6B 3KQNA 1K5HA 2GOYA 2PS1A 2QR5A 4HR7A 3SJCA 5AVSA 1HYHA 1ORDA 2FUG6 1NULA 2JAOA 3F78A 3BUSA 4HNAA 2ZIXB 3SNHA 4UHHA 1SELA 1Y81A 3D64A 3PIIA 4R31A 4BX8A 1YB5A 4IUYA 1HOXA 3G8BA 3G8YA 2OYCA 1T0HB 2R3SA 1MRNA 2Y67A 5CCXA 1LPAB 1NWCA 1DWPA 1YO6A 3AY0A 1SVOA 4ZEOA 4US2R 1KI8A 1IB0A 1RWKA 2YWJA 3RC8A 1LY1A 3K9HA 1N78A 1FTWA 2AG6A 1ZISA 3WWDA 5EWMB 4DLVA 3GBSA 1NJFA 3ZE8A 2FEWB 1JG6A 3FPJA 1E8MA 2PUHA 3EFOA 5IJXA 3HPRA 1KR5A 3TOCA 2G82A 5J2TB 4B7AA 1R50A 2JLSA 1T5SA 3N74A 5CG2A 1DJQA 4CQNA 4AQDA 2VDWB 1P19A 1Y7HA 3KYBA 3VZRA 1R5JA 2RG1A 1KI2A 2VBCA 5FHQA 1N6LA 4C20A 2BGMA 3A0UA 3DYBA 5DIFA 4C0KA 4C7KA 1NRJB 1ESEA 3F46A 3CT6A 5HYVA 2RE8A 3QVSA 3G0HA 3K20A 3NALA 2WAYA 4M0KA 5GZ1A 1I7SB 4A2PA 1G3UA 1ENPA 1NMZA 3MTGA 4KNYA 3THWA 4Q9KA 2FZWA 1NYLA 2IHZA 2QD4A 3DKKA 3C6YA 3UYLA 5AKLA 4OM8A 1ZVJA 3K9WA 3JALA 4F96A 2UUBB 4TZTA 1MC4A 1YC5A 2AF4C 2ENUA 4UW9A 1PF7E 1BA2A 4C3OB 1ISIA 4QVIA 4II3A 2PFSA 4LF6B 2N75A 2C3MA 1KKUA 1TO6A 3JD4A 4JXXA 4S2EA 4FT4A 1E2KA 3H6KA 4ZALA 3ZUGA 1JSLA 1UQUA 3G7NA 2GKOA 3LUHA 3ZG6A 5JMWA 1SN7A 2GH1A 3D1VA 4JGBA 3SMQA 3L92A 1PTJA 1XZQA 2ZXUA 1ZGZA 3OQIA 4ZEMA 3O8NA 2I2XB 2Q5OA 4E07A 3I2FA 3I05A 1V3TA 9ABPA 1F9EA 4PSCA 4OGKA 5FOUA 2CLFB 1XQYA 2C92A 4BO9A 4EW1A 5F9FA 2JK1A 4PQFA 3TZLA 5MN6A 4KN8A 1T8UA 4MV6A 3OD5A 5HKLA 4MI3A 5TPZA 2O07A 3BDIA 2XI4A 3KSZO 3N2LA 3ZVKA 3UJCA 5FUWA 2UVPB 1BW9B 2RDMA 4KNVA 4LHSA 4PCVA 1Y8ZA 1P0FA 4TMVA 4B83A 2Q99A 3PNOA 2Z9DA 2R6FA 3UK2A 4MB2A 2WSIA 1QPBA 4M7RA 2R8OA 4YP7A 4OU5A 5A0TA 1Y3IA 3SCZA 4S0ZA 1E99A 3ND7A 1QJCA 3ZE2B 5C9ZA 5JUWA 1YNOA 5CBKA 4GG1A 1R64A 3A3YA 4WI1A 3NBQA 3ZWDA 5AM0A 2DKFA 3TAHA 2XQJA 5H59A 3U4CA 2FZ4A 5CLJA 2D5LA 4RADA 1KGDA 4ZJUA 1DJMA 3A1NA 4H1HA 3VKWA 4CF4A 3E8MA 3ON5A 3NWJA 1DHTA 1RQPA 4ABYA 2IUFA 4PPQA 4FMBB 4F7WA 3E7WA 1MR3F 3NXSA 2Y0EA 4QYIB 4HJRA 2DFKB 5J58A 1WUJS 5JPIA 4E31A 1ZJYA 4D96A 3OX2A 5CYPA 2R47A 5JZVA 2PT7A 1B7GO 3IVRA 4FJ0A 4QODA 3VHXB 5M2QA 3DAFA 4M83A 1I10A 2XZPA 1J39A 4PINA 2ST1A 3R7BA 3SC4A 3UUEA 2XT0A 1F8FA 3NT5A 1P72A 3AKYA 5IAKA 5JO0A 3WNDA 2OV3A 3IKJA 5I9IA 3GEPA 5JDCA 2HRCA 2GLXA 2GO1A 2J45A 4MJ3A 4UOZA 3QEMB 2ZRBA 1Y4ZA 4IHQA 3UH0A 2YXNA 2AN4A 3OQOA 1BCSA 4FMDB 1UK8A 5K51A 4TXHA 2JH8A 2BZ1A 3AUSA 5F3DA 5A0FA 1DI0A 3VU1A 2RI1A 3ZY5A 4F3RA 5TLSA 1DZ3A 4LXUA 1NLFA 3ZHUA 3HUEA 4I5GA 4ZJZA 2DRIA 4WECA 4CKEB 2GDZA 5TSDA 4HFMA 4I55B 1D03A 3SKYA 3T41A 2B20A 2IC5A 3ZR4B 2EOAA 3DZ8A 3A25A 2XSZA 3D5QA 3RTCA 1U2SA 1E7SA 1GO2A 1JDUA 1OXMA 1QORA 2PT5A 2XGOA 4NDNE 1DB3A 2WWHA 3EMVA 5CTJA 2WU4A 3M6MD 1KYVA 5FNZA 3VPFA 2F3RA 1OFGA 3KE9A 5AHOA 4DCMA 2GPWA 4ZWNA 2ZSUA 1H66A 3F97A 2CFRA 2J9ZB 2ZE6A 4IMIB 4B5LA 2UUAB 3Q6IA 3BSSA 3FY4A 5HCNA 5EZYF 3L8GA 2VVTA 3BFJA 3EVBA 5LNK1 3R3VA 4RO0A 3TTTA 1JT9A 2R8ZA 5FEMA 4F6RA 1V8BA 2NNLD 1JBEA 1QIDA 2I4MA 3E15A 4TL6A 3BL5A 3U81A 3WISA 2Y27A 2F48A 2RARA 4LJSA 1XR3A 2G9NA 5T4EA 3A2MA 4TS1A 4L8FA 3KOOA 3LMKA 4MVJI 5HA5A 4JI1B 3C41J 5I7HA 1NNSA 1CC1S 3DA8A 4QO8A 2JJ1A 4OHVA 4BNDA 1JBQA 2PWZA 4GZ5A 4RWZA 1P7YA 3ITNA 3G0DA 3NOOA 1Q1NA 4JYCA 4WK6A 5AJTA 4KQEA 3PEWA 1OH8A 3G2PA 2G63A 3RUAA 2J0EA 3AFOA 3C8HA 1O9GA 3ENZA 1U9IC 3IAS6 3UB4A 4CTNA 3KT8A 1YDEA 2ZXFA 3GYGA 4G0PA 3JRWA 4A0QA 1WW2A 3RFFA 3KSDO 1Q7RA 4BNNA 3V3TA 1DXYA 4J0EA 4KDRA 1NLUA 1IJEA 1SKYB 1TJYA 2I6XA 4YMWA 1WJGA 3LPMA 5JS2A 2OP0A 4G0ZA 2VQ3A 4DM4A 2CMKA 4EBFA 4F5DA 3NRCA 1RBQA 1XE3A 2P35A 4UCWA 1EFKA 1Q12A 1PZGA 1L5HA 3RV3A 2YIDA 3DV0B 4BNKA 4ZCRA 4F4FA 4BLUA 1JPNA 3ZJVA 3FWHA 3U1VA 1DC4A 1E1KA 2Q8PA 2YMLA 3C3DA 1ZFNA 2PAFA 1E1YA 4MUHA 3U7RA 1HRDA 2NX2A 2ONKA 4HN2A 1WP9A 2NOAA 3PPXA 4CQMD 5IVPA 5IKEA 1FYWA 1WR8A 1TL7C 3U1BA 4ENWA 2NTEA 2O05A 1WVGA 3BH6A 4Z7OB 3CA8A 2OM2A 5DN6D 1T0JB 2HEGA 1FXSA 3AY6A 3KRTA 1CUVA 1PSZA 1FXUA 2H2GA 2VZ9A 1DMSA 1WUHS 2CDAA 2Z1MA 3G79A 5EXXA 4BNGA 2ZROA 2WM3A 1UQRA 3VBCA 4L22A 1K27A 1EE9A 3WDSA 4WLOA 5CNKA 1GCUA 1P31A 2ZJ6A 4WEOA 1C9EA 3HZRA 4TL7A 2IBTA 1W76A 1BCSB 4IOJA 3FVQA 3ZWQA 1BE1A 1EK5A 1VXRA 1O03A 3HZOA 4CFYA 4IR7A 3QYAA 2EJVA 3HXMA 3R9KA 4M6WB 3WXBA 3U26A 1J1IA 1AC5A 4M46A 2P30A 3LAWA 1IOVA 1T4GA 4J0FA 1H22A 5CVJA 3EA0A 4BFVA 3OE1A 3LPLA 4PCUA 3WRWA 2ODAA 2CB9A 3P9CA 4Q9DA 1ML4A 2BMWA 2HNBA 4GQBA 1GQYA 3N7AA 5TF4A 3OKPA 3AOEC 1JFLA 3PFKA 5GPBA 3FCAA 4AX4A 4MW7A 2NQ8A 1M7GA 3GELA 1S4QA 1YJAA 1OWLA 2BMJA 5IYZA 4YRDA 1OLSA 5JFGA 1RXWA 4MDHA 5FJJA 4F6RB 1G55A 2NSYA 4U39A 4WIAA 2FG7C 2FWBA 3PXXA 4RMHA 3E18A 4XQCA 4LCBA 4Q7LA 1RIFA 1GAXA 1V0JA 3N87A 3S2IA 1JHOA 1MFPA 1WHSB 1E1LA 2AMFA 4R7ZA 5ALTA 1TB4A 1UJBA 3V7FA 4CIXA 2FZ5A 3N8HA 1RRKA 3QKWA 2NGRA 4G0XA 4UM9D 2W58A 4GSYA 1RP1A 1QIHA 1V1JA 3EYAA 1KH2A 3JQAD 5SY9A 1W29A 2CNWD 4HUTA 1Z5NA 1YZKA 2ZI3A 3MIZA 3N0WA 3TLYA 2WQ6A 4KR6A 2NSLA 1SHJA 1UPXA 3SSMA 2YV4A 3IP8A 3L4EA 4HK4A 3QXXA 2ZLBA 1X0XA 3CH6A 5K8UA 5HUQA 5EUCA 2VJYA 3K1TA 1G9SA 1IHYA 3DBHB 4OXQA 4U3JB 5LBUA 4BASA 4F2WA 4ALMA 5IF9A 1VMDA 3X1JA 4CG1A 1KMNA 4XTCS 2HO4A 3H2ZA 3KQMA 3V9AA 3U2QA 4XWAA 3E22B 4B75A 1GZSA 4Y6PA 1YAHA 4RJJA 4ZQEA 3DV9A 3PJEA 1HX7A 3FWKA 3WYNA 1GZVA 1YRWA 5FORA 5U9CA 2HT6A 2JFBA 5E2AA 3VKHA 1C0IA 1V9LA 2SICE 2QQFA 1AGXA 4OHUA 5DHTA 2IEGA 1JHQA 1TDJA 1ZGHA 2CNLA 3CC8A 4OD0A 5HE8A 4ZZ2A 1J8FA 4M60A 4BBAA 1WRBA 5DLDA 3E9RA 5JAHA 4IDNA 1BHJA 3AY7A 1LK5A 3V8BA 5JRJA 1PV1A 4IJ6A 3QW2A 4CM8B 3TXAA 2H9AA 4A92A 3NMUF 2C4KA 4M1WA 2RH5A 4JNCA 3QE4A 4EELA 4F93B 1H93A 3BTVA 3UJ3X 4LRWA 2TMKA 2ZE5A 1BKYA 3BH0A 1L5VA 3ICEA 1MBZA 5HF6A 4L0DA 2B61A 2LWIA 2QTMA 1VHQA 2VWPA 4FZJA 3VX3A 1GFSA 2BFFA 2WSBA 3ZGZA 3VPGA 2E4YA 4B3RB 2C99A 4Z4CA 5EHXA 4KLNA 1E9RA 1LFDB 1UPCA 4KX5A 1WCWA 1RWWA 4MVJH 2GAIA 2KLBA 5AJUA 5IDXA 3IJRA 1BMFD 1UINA 2AFHE 3TQIA 3L49A 3VNBA 3ASYA 5BYJA 1NYRA 4M7OA 3MTDA 2NLOA 4C4RA 1OFTA 1ECPA 2OD2A 2QRPA 5KJEA 1QK4A 1VYTA 1LDGA 2P1ZA 2VKTA 3FF4A 5IYZB 1OLSB 4KLAA 6PFKA 1ZINA 2RI0A 2OV6A 1QHIA 3L6RA 2AJDA 4XARA 4P34A 1RC8A 1JNXX 5FOSA 1YR6A 1LSJA 2H0RA 1P6QA 2MIIA 1OD6A 2HLPA 3VHRA 1F06A 1S1MA 1GQSA 2WMNB 1L0BA 1X2EA 1ZWKA 2HU2A 2HHAA 1DX9A 2L0XA 3AONB 2R84A 3HBMA 4Q15A 4TUYA 5DX8A 5JSQA 1QF6A 2HWWA 2XVZA 3QEAZ 2D4HA 4LOKA 4DXAA 3EHDA 3PDCA 3FI0A 3A3PA 1IBSA 4A8PA 1ZUNA 5EJ6A 1A9SA 1QWOA 3WSTA 3AGPA 2XLCA 1FSSA 1G16A 3SP1A 4MV5A 3UKOA 4Y1EA 4PGMA 4LVNA 2Q7DA 3MUNA 1LPSA 3S5JA 2LPMA 1YRAA 5ES3A 1Q0PA 1JQKA 1ZESA 2DFLA 3MAAC 4MUYA 4Q7KA 1ZYUA 3H84A 5DM2A 1XA3A 4B46A 1DPFA 3QVGB 4V0SA 1GL7A 1YZVA 4ZCTA 1TFRA 2H1WA 3ONNA 3ABSB 3ZGYA 1UBEA 2Q1UA 3SEAA 4A5OA 1JYEA 1P6UA 2D8MA 3DL0A 2Q9BA 3NETA 1JPVA 1GLGA 1RQNA 3NBUA 4NCJA 1T1GA 1T29A 3F7OA 3VMFA 3I92A 3NV9A 4ZOLB 1OYWA 2YOGA 4L95C 3WI7A 3LXRA 3LS2A 5JXJA 3U60B 1HI9A 3H16A 3U3RA 2ZWVA 3K09A 1XRQA 1C3EA 4NV0A 4CKYA 1ZD1A 4OX9B 1E9EA 2CLCX 3GH1A 1JHAA 3RIMA 3IAS1 4BP3A 4CJXA 1KEUA 1MVNA 1GRNA 1TVMA 5DCUA 3ROXA 5F7OA 4RHTA 2WF8A 1B14A 2RIPA 2FSIA 3UT5A 4D9MA 4HDCA 5GOZA 1TA0A 2Q1YA 4HGOA 5T41A 1QDLB 4OQMA 5AHRA 3TPZA 3S1SA 4L3WA 2AI3A 2F9LA 3L4JA 2GN4A 2HBQA 1II8A 2HAEA 5KCMA 5JNWA 4KPEC 3IBGA 2C5GA 4M0MA 2EFDB 4FTWA 2COKA 2OCKA 3HMKA 2BFFB 2I55A 4HVLA 4GI1A 3KEFA 3T35A 3WLJA 1TKCA 3VDQA 1JR2A 4H7HA 4YCAA 3WC4A 2O54A 3JWHA 2FPGA 2EKPA 4UTVA 1Z6XA 3D6JA 2EL9A 3TLKA 4W1PA 5CLHA 3D6HA 2IGTA 2WWRA 4XB6B 2FRXA 5HE9A 3CZQA 3LT4A 4DV4B 5F3WB 4EGJA 4BVAA 1AQIA 1XQXA 1TK3A 2EZUA 2QN9A 2E55A 4B6SA 3UNXA 5B3LA 3BF7A 4C7BA 4WCFB 1ZD8A 1XZMA 4MLPA 4LQLA 4W5OA 1KOGA 1W2GA 5FULA 3AIKA 1O6BA 1G5TA 2WMDA 3RBZA 4E2ZA 3K9NA 3AERA 4QDOA 3R3YA 5CBPA 1CJBA 3RVQA 2PL9A 3WVNA 5JR3A 4HWGA 1C7IA 3GG2A 2NO1A 2YUIA 4EG6A 3USZA 1AMOA 5FH9A 5FYDA 1V39A 2AR7A 1DARA 2DY0A 3KB2A 4M87A 5I9SA 1YJQA 3SJAA 3UHAA 3KL4A 2QT0A 5M7EA 3FYDA 3F74A 1SXJA 221PA 2IZ6A 4JLOA 1NW5A 3HVIA 1WF6A 2R60A 3LG2A 3NOXA 3JAWB 3WA6A 5K01A 4YB8A 1DEKA 3J7AC 5IH3A 4C0SA 3GARA 1A76A 3WL8A 3WLMA 3EQZA 1VGQA 1T9KA 3AIMA 3DZGA 4IO0A 1EJ6A 3GVPA 3BFPA 5J40A 5AFSA 2PWPA 4PGGA 4Z1OA 2O7VA 1IVNA 2D3WA 1PJ4A 1TNDA 2ZI5A 2I1WA 1Z0DA 3KJHA 3EY9A 5IP5A 1L1FA 2PE5A 3G0IA 3DCJA 3VZQA 4E1BA 5HNKA 3K15A 4QSMA 2CVFA 4JXZA 1HE5A 4Q0MA 2FVXA 3KSUA 5H5JA 1Q1BA 3KUUA 3OLWA 2FZGA 3AXSA 1Z5UA 1LSOA 4R71A 1QRTA 5JQGB 1JLHA 4DMGA 1OIWA 3JRNA 1IEXA 2YMMA 1XL0A 3IRUA 4P7BA 2WLTA 4YH1A 1MEOA 1V3UA 3NIGB 3FGNA 5E6RA 2QRKA 3NQ41 3P9XA 2V59A 4WLNA 3X1XA 2EDAA 3CPSA 3W8EA 5JW6A 2GYYA 2WKRA 1TECE 2P2DA 3C3BA 4YPFA 2E18A 3E3OA 4IL5A 4CLRB 2W2PA 5A3QA 2GK6A 2QTCA 2HBZA 4H3SA 4XIIA 2WU3A 4JC8A 4JQZA 1KS9A 1TOAA 1E66A 2XNHA 4RZSA 5F5XA 2I4NA 3BK7A 4QDUA 2I34A 2WWTA 3JQ8A 1FNCA 3TL2A 1EVKA 2WIJA 2NMVA 2HX1A 1S2LA 2QT1A 3A6GA 3IKLA 3UJAA 2ZSFA 3JTEA 1RRCA 4L8WB 1N4DA 1I2AA 1P1IA 1S2GA 3SDSA 4GHWA 3SZGA 1YFJA 3M6IA 2BGNA 3OY2A 4PX9A 2A58A 3Q6MA 3QLTA 4ZO6A 2D1RA 3ZEIA 2CVHA 1AT1A 3U7QA 3HYNA 2B4KA 2W2TA 5GZ6A 1FDUA 1ZRMA 2ZT5A 2VUIB 2X7XA 3B7PA 2FHPA 2PH5A 2EC5A 3BN3A 1P1HA 3MM4A 3QUBA 3GIWA 1DIOB 2O3QA 1RMQA 3N7TA 3UB2A 5K2OA 4YPOA 2I7XA 2FJPA 3D6VA 4LSZA 4Z51A 1WB9A 1IHPA 3PLAE 2P2GA 5G4KB 2YJ4A 2OVBA 3STXA 3COWA 4G56A 5LCXA 1GLNA 1KYTA 4LVOA 3E9DA 4UNSA 2YWHA 3AFHA 1PGQA 2YINC 4IGAA 3FTNA 1O4VA 3ZW7A 4AJNA 5DTQA 4F8JA 2IH2A 3SM3A 1GG2A 1N6NA 3KD2A 4XZ3A 5KYVA 4NY1A 5EYPA 1FLAA 1Z83A 4GBED 2QRLA 4ZI7F 2EF0A 3R20A 3B6JA 1IJKA 2FWIA 4N47A 1OC4A 3MJSA 3RR2A 5A3RA 3ESZA 2W2NA 3QXHA 2BHSA 1QV7A 4R2KA 1WZ2A 2R68A 3I01A 4RK7A 2B37A 4WQMA 3PFWO 2UAGA 5D3MB 4LE1A 2NU9B 3RVBA 3ZNPA 3VKGA 2IUYA 2JJ2D 5I6DA 3K6RA 4CMAA 4TT3A 3T1OA 3GG9A 2OPHA 3TIGA 4C7VA 4DWVA 4CTOA 5EIXA 2CNNA 1I01A 2AA3A 2WT8A 1K08A 3CB4A 3PXCX 4R41A 1M2HA 5AVKA 2P65A 3WE7A 4Z7NB 1GRVA 3ZLJA 2Z8YM 4TWJA 3M4XA 4EMBA 2P2LA 1MOZA 4EDFA 3HR7A 3R6GA 4DW8A 1DIHA 3P26A 1NVFA 3DFKA 5IT4A 1BMTA 1NRXA 3DT9A 1Z7GA 4HDNA 5J4VA 3DFUA 2F8TA 1VHTA 1XDGA 2ZB3A 3HHPA 1A8UA 2VXYA 3IHLA 3KXLA 3O1LA 4MS1A 4B4VA 1NY5A 3O91A 2ZIUB 3QKIA 3T7SA 6CHYA 1BG6A 1XO1A 2IHUA 2N3ZA 3N0XA 3T52A 1Q44A 3V8RA 2V6BA 3FF1A 3UWSA 1W0JA 1DFGA 1T34A 2XUKA 2W0MA 4FOOA 1G5PA 3B12A 4RYLA 1MQ8B 4D44A 3HQ4O 4LHWA 4WKNA 4BVEA 1OR8A 1R3DA 4O3FA 1SY7A 2G5TA 2VQFB 2KLHA 2WFLB 5E7JA 4JP3A 4JOBA 1OLXA 5BN3A 4RKFA 5FDFA 4QJBA 5KS2A 3GLFA 3HVJA 5JROA 4XX1A 2AFRA 2BR3A 2CY0A 2ZSEA 5E6RB 3R3JA 4DLRA 3CNEA 2O8FB 2QRGA 3P2YA 5DB4A 4BGDA 2GD1O 3F6CA 4NZZA 4UVDA 4BC0A 3VOBA 4CKCB 1WBBA 1NJ1A 2IXDA 3C24A 2Q3MA 4HUQA 2DUNA 1NASA 2FWAA 2XYQA 4Y2TA 1G8AA 4Y6GB 3CV3A 4R2HA 1DQRA 3FLMA 3P71T 3ZZUA 3DKVA 1E3SA 2B8TA 3E05A 5JZ9A 4CW7A 1IJFA 2ZM6B 2EEZA 4OP2A 2C2BA 3P9PA 4PNZA 1PFWA 3NHZA 5EIHA 1RHQA 4C4ZA 4ZHQB 3W5AA 2RK3A 4G41A 4OQDA 3RYFA 3D4BA 1JFSA 1T35A 3BICA 4D4JA 2J6IA 4X1YA 1OZGA 4OLFA 4ZOQI 2I6FA 4OL0A 3LO8A 1E4YA 3AUFA 4TXLA 2HXSA 3GJ3A 3L0YA 3HRKA 1I0ZA 2VDUE 1GG9A 2PH3A 1PL0A 2VJKA 3LFTA 4MS4B 1TAQA 1V8OA 3DBRA 4QFCA 4BLWA 1K1EA 4HH1A 3SHFA 3WWZA 2A35A 3EJWA 4DYDA 5HJ2A 5JHHB 1JTEA 2BMVA 5ILGA 2EIHA 2H06A 2IYNA 1D4ZA 4L78A 4XAQA 3NDJA 1LNQA 1E6WA 2Q2QA 3L0SA 3Q1KA 1P9WA 4TN1A 2XNDD 3QM1A 3W6PA 1F17A 1DC3A 1MU0A 4NQRA 2VH2A 2ZZKA 3AJDA 2X8JA 1LLUA 2O2CA 3CTMA 3T7AA 1IHDA 3NHLA 1JQ3A 1NBAA 2XMZA 3ONVA 4EF5A 2OFWA 3W9SA 3D4LA 5AIAA 3ZCXA 4ER6A 4JBWA 1G9XA 4BRWA 4OJQA 1GNVA 1O7JA 1QHSA 4TTSA 2X2PA 2DHRA 1DAIA 3AT1A 1Z36A 5AI5A 4HDNB 4RFLA 3QWHA 3VR4A 1QAMA 1TKBA 2B92A 4AXXA 1G19A 4MS1B 4E94A 1D2AA 4RVCA 5F2NA 1E3IA 1ZIYA 2I0FA 4XVRA 1N7JA 2AUMA 4ZT4A 3LKDA 4BL5A 1EX6A 3I72A 3B20A 4V03A 3GLHA 1YR7A 3TRIA 3VC3A 4AY4A 2IH5A 1GT91 4GOJA 1KEVA 1ZOPA 3VC2A 2AYXA 1RJ9B 3GMIA 4RHFA 5SZJA 3O90A 2X8AA 3WZLA 2RHHA 1X15A 4JOSA 4M22A 5GVSA 1NVDA 1VBNA 3IQZA 2PTHA 4QDXA 4Z5XA 5D2CA 1KHTA 3ER9A 3D2LA 1OLXB 5BN3B 3SC3A 2Q8QA 4TWRA 4Q7JB 4MRPA 1HY3A 2ATIA 4FHGA 5EZYA 2VRCA 3R3WA 4BZPA 5JXWA 2JAPA 3L6UA 3LPCA 1FUKA 3HE3A 3OOJA 1ABBA 1ILWA 1LRKA 6NULA 2VJOA 5ALOA 4YMLA 1R0ZA 3EXFA 1G5HA 3I6BA 4NJOA 3OHMA 3OJEA 4LRTB 4PLWA 3D4IA 5KTOA 5BSGA 4DN6A 2CB0A 9LDBA 4ZO9A 5C7OO 4GE3A 4CF3A 1FVHA 4PHCA 4OSOA 1NZJA 3BWEA 1Z08A 3GPDG 4IDDA 4NARA 4XW2A 5L3RA 4R2IA 4URWR 3RK1A 1DNPA 3R77A 4EKGA 4Q1VA 1U9CA 3ZWCA 1LPOA 1CT9A 4U7DA 3GQBB 4TMTA 4DMFA 2FUEA 2GHIA 5CURA 4FX5A 3M3HA 5KWJA 3RYFB 1IQ0A 2G9QA 4PQRA 5M34A 3MWLA 2I7DA 5EZ6B 5LDDC 3KBOA 7REQB 1OA1A 2MINA 1PQ4A 4HEA6 2HGZA 1U3VA 5HKOA 3MF4A 5ITVA 3EVZA 4EJSB 1HEYA 1ZVVA 1OJLA 1NYQA 2DBRA 4E0BA 1QZXA 1Q2XA 2FGJA 4HVCA 2J7KA 4GBGA 4CODB 2FXVA 4E5VA 5AHXA 2ZB7A 1VJCA 3TQOA 1TUEA 2ZWMA 3WOVA 3WDMA 4YMSA 3AEXA 2CXOA 4C3UA 1MTZA 4BU0A 3RRBA 2ID9A 1VYHA 3FMPB 3MWKA 4KQGA 4RHYA 1U2ZA 3I30X 3RV4A 4ECEA 3BHNA 5IS2A 3BQNB 1KY4A 1EI9A 2X8JB 3ISTA 1EJBA 5C8YF 5K5EA 3VDRA 1Z0IA 1T1RA 3FTQA 2GN8A 1KYXA 1ZA1A 2XAAA 4ATNA 4JI3B 2ECPA 1D2CA 3MBOA 2AOWA 2LCFA 4TPKA 3PKIA 4HCJA 4CV1A 1RYEA 2C0PA 1VIAA 2OD9A 1GVNB 4BVHA 2RC6A 1GSHA 4HG2A 3CLUD 3N6RA 4KIUA 3ZLUA 4LKOA 1ZWLA 4A16A 4ARZA 2IW1A 1PWHA 5DBGA 3V1NA 3FWNA 4XXHA 4KREA 1TPYA 4P6VF 1XTVA 2J5BA 4GMXA 1XWIA 3L7MA 2VSYA 4NV1A 2JJ1D 4EPXA 1M72A 1OLUB 1D1PA 5AW7A 3S2UA 5BP7A 1M75A 3GLSA 3KVRA 4K0RA 1XNRB 1P2GA 2D2IA 4KH1A 1Z4JA 2QRMA 1Z62A 3FGPA 3HDVA 1RAHA 1UBOS 4H60A 1QK3A 5G0TA 1ZMRA 3TTUA 1XXLA 3RS4A 1P8AA 1CYDA 1T9GR 1AKRA 2DM6A 2IYVA 2HSJA 2WLSA 3OZUA 4GPAA 3U1TA 1L8OA 2NO5A 1JG2A 1H65A 1ZD3A 2WUDA 1YRQA 3L8CA 3Q3GE 4H3VA 1WP4A 4MVJG 4QOGA 4YJFA 5T7BA 4F84A 4M38A 1X1CA 3HP7A 4I1VA 4NBLA 1DO8A 4OAOA 1DRWA 2YWDA 3LLCA 2AG8A 3DOJA 1IXZA 2YQ5A 1IVYA 2ZT7A 4G63A 4KSCA 2F67A 4Q48A 3P0HA 1EZZA 3A4TA 4RM2A 2DETA 2X0FA 1HUQA 5EMKA 2OCAA 4EP1A 5CLGA 4J0HA 2D74A 3EIHA 2WTBA 3CCBA 1A8PA 3H0EA 3VPAA 5G1OA 3IP3A 3ZCPA 4AZ0A 1BMQA 1J2RA 1EWTA 3O7MA 4B8WA 1EM6A 1YE8A 5BWMA 3TVYA 5FPKA 4AI6A 1QIMA 5REQA 2PX5A 4FYMA 4M9RA 2ISSD 1H23A 2QZ9A 2HIMA 3PSHA 3BFKA 4BIIA 5JWOA 4OHPA 3N2GA 1TTPB 4KRYA 3DEZA 3QX3A 1BGXT 2JBAB 3EG9A 4B6EA 3BRQA 3N5KA 2FEAA 2MINB 2DXIA 1FLDA 3ICPA 1U9IA 3JZIA 1ZSYA 1FK8A 4PEVA 4XA8A 1VFPA 2WJGA 2ZG6A 3RC3A 4FFRA 1WU7A 2UV8A 5MN4A 2GZDA 1UXJA 3GGJA 4NDZA 1J1UA 4FDAA 3RHTA 2FX3A 2R7MA 3BHMA 3CONA 5AVYA 2I4LA 5HIMA 4LZZA 4ZCQA 3GZJA 5LYYA 3OQNA 3EOBI 3B6MA 4JQCA 1KJNA 2J4CA 5LYJB 4Q9IA 2FMUA 3HBLA 2APJA 1O5IA 2PVPA 3RTGA 1FDVA 1MIHA 4EKEA 1SVWA 3UXMA 2JLBA 4CI9A 1KO7A 5C7YA 4KC0A 1TZKA 2AH5A 3QWIA 4MGHA 3WMEA 3WGUA 4J43A 4WEQA 3WWPA 2AK3A 5AOBA 2X4GA 2VK1A 1M6YA 1QX3A 1VDZA 4QYSA 3CZMA 4LOHA 4YI5A 5BN5B 1JALA 5F9HA 1FMTA 1NBWB 3KBBA 4H3HB 3IDFA 4Q39A 4BEJA 4UUNA 2O1WA 1Y3BE 3HJGA 1OZHA 4O4LB 1UMDB 2O1EA 3X1YA 3L07A 4IEEA 4LXHA 4GF5A 4L4YA 3TIVA 2UKDA 4BNWA 3ZDYB 4Z0PA 1GPDG 5BR7A 1LI7A 2H5JA 2IUSA 2QEQA 1JDBC 3CLRD 2AXEA 4YXWD 4HPWA 1X7WA 5EIEA 1FYDA 1U4NA 1E7MA 3E3NA 2AD1A 3IEIA 3QH4A 4WESA 3LM8A 2I3GA 2D00A 3NJ4A 3R6WA 4KI7A 4RD3A 5C46F 3H5IA 1U8AA 5DBFA 3VYRB 4IWYA 3SMVA 2PXAA 4F1WA 2CLMB 3Q85A 3VKFA 5IM4F 1JIXA 5FUVA 1RC1A 1DELA 1EMDA 4Z3OA 3G7SA 2J09A 2F1JA 3CNBA 1H2AS 3IUYA 1V16A 3TUJC 4EFMA 3WJ2A 1USVA 1UDXA 4MAFA 1I1NA 1JU9A 1PZNA 1SBHA 2YMPA 2PLWA 3B1ZA 3LGXA 4F92B 1SEPA 1RE0A 4S1OA 5BV7A 3TGPA 5EIAA 4ACBA 3LPAA 3AOEA 1ATIA 4BZXA 5BSVA 2VRWA 3HN2A 2WZCA 1NONA 3T4UA 2QYOA 2C1EA 3KAPA 2DTXA 2BI8A 2EKDA 4HFJA 5G41A 3REQA 1E4EB 4I50A 4DBVO 1CNEA 4EW2A 2IL1A 1Z38A 4XWKA 3GAFA 4YRPA 1T4CA 1PS8A 4NK5A 1QH9A 4M2LA 3VYTB 3ROQA 3R7SA 1NKSA 5DI3A 5E7IA 3LCVB 5AK4A 5AKIA 3ETHA 2BJVA 3GT4A 1Q1EA 2OKGA 3TR5A 5CLQA 3WGJA 4AZWA 1PUXA 3C43A 1XSEA 3PVSA 3L7IA 3CNHA 1GZ6A 3JQCA 3N2GB 1DT3A 1PNOA 1A97A 4FC7A 1GN9A 2HMSA 4OXIA 1KETA 4Y2UA 1Z6TA 1KERA 5C7IO 3THXA 1NP7A 2H29A 3RO7A 2X9GA 1U1DA 1H4VB 2QX8A 5HQ3A 1C4WA 3L7KA 4QKQA 1DCKA 1PFGA 1YRLA 1CR1A 2FRVA 3E27A 1N7IA 4J4HA 4JUIA 5EQDA 3BXXA 5FWDA 1SQGA 4FFBA 1C9KA 5E4TA 2Y76A 3MINA 5AJWA 2CJYA 1AJEA 2OYSA 3RANA 2K6GA 1DTSA 3RSHA 3P9YA 3ROGA 2QTVB 1LD3A 1K8RA 4RTJA 2Q5QA 1GEEA 3EZNA 2QW0X 4MULA 5L4SA 2VUTA 2ZIVB 1NI5A 3M1YA 1BDBA 2E1RA 5FOVA 1N9ZA 4Q6WA 2J3HA 2O2JA 3R0JA 4HEA1 4NULA 4Q4CA 3CRZA 1J8QA 2Z43A 4A10A 5KNBA 3WIBA 1X6VA 3D02A 2I71A 1E94E 3GK3A 3HABA 1SOUA 1CUAA 4KHPB 2K2WA 1FA9A 5I7WA 4FEEA 1G6OA 2CMDA 4DJAA 1UDRA 4JNKA 1W5AA 2B3TA 5G0SA 1ESZA 3UMMA 2R25B 5EFZA 3R9XB 1WG8A 5A4MS 1YQDA 1RXVA 5EKTA 5LFAA 1X7WB 3IBTA 3TD6A 4PSVA 3U7IA 4C7MA 3UMBA 2JA2A 2Q21A 2YRWA 4WESB 4N0EA 2DR2A 2H4WA 4D3XA 1O94D 3LVFO 4KWTA 4RC9A 4AZ3A 5ITWA 3D3QA 2GCOB 1UT8A 4RZHA 2MSKA 3JYLA 1U63A 5U4QA 4D42A 2FAXA 1L1EA 1UEIA 1XQVA 1EDZA 4N6OA 4QTUB 1ZU4A 4Z9FA 4XKJA 1HLPA 4BKOA 1SWWA 1WM1A 3CRRA 1ZVQA 3A6LA 3J7TA 4AP6A 2BGWA 1K75A 2FW6A 4P7FA 4IQFA 1GQRA 3JASB 1UM9B 2CSUA 2Q0SA 2QY6A 4BP9A 1ORIA 4JYZA 5L7TA 3RVNA 1TJ3A 4LK2A 3KUCA 2V1UA 4MV4A 4UBLA 3REQB 4ZOLF 4AECA 1D2GA 1JN0A 4I50B 5AKGA 2I2CA 1UMCB 4NMLA 4YUWA 5CFMA 3L04A 4S1PA 1VHLA 4V0OA 4HY3A 3VZBA 4EYGA 2LKDA 1T4CB 4PO1A 4O5AA 3IPCA 1UDAA 3OEHD 4J3NA 5I4BA 3LTNC 4YASA 1Z0UA 1M74A 4X84A 5CP8A 3IH5A 2GJ8A 2AX3A 2FPRA 2R8XA 3AETA 3QPWA 4JL8A 4IIHA 4MWBA 2GPYA 4RCVA 1Q0UA 4US1R 1VLHA 4PG5A 1XYYA 5E0KB 3I5YA 2IK8A 4TROA 4ACAA 5HFAA 2O9JA 5ESRA 5ITSA 3WAJA 4WH0A 3I09A 4BX0A 3NYWA 2PY6A 1V9SA 1WB5A 5C32A 5K3SA 3AF3A 4GI2A 4CEJB 2KWIA 3I2HA 4EABA 1QTQA 2HRRA 3U4QA 1P2BA 1EWRA 3KHKA 4KIJA 4JP8A 3UTDA 5B7PA 1CF2O 4D9JA 4YONB 3TZEA 1W2WB 1DAEA 4AWBA 4MLZA 2QTZA 1J22A 1L5OA 2YOHA 1C7FA 3DYIA 3GB9A 1EXVA 1BFKA 3EZ6A 1G2PA 2FPUA 5IJ0B 2BIFA 3FUCA 2NP6A 2ZRHA 2FW1A 3ED5A 3JQGA 3M81A 2AHOA 1FDIA 4WAUA 3RROA 5CG1A 1PLJA 2GX6A 2SKCA 3ZBTA 1BD3A 1WCYA 4KRXA 4F3KA 5LP1A 3BL6A 3LZ6A 1M1NB 1VGRA 1LZKA 3SHWA 5KNDD 4HLQB 4MW1A 3DZBA 3QF4A 4NH4A 3L6OO 3SXPA 2W2XA 5AI8A 1IM8A 1VKNA 3CZRA 1L4BA 4UATA 2QS9A 3AZQA 3B3QA 2HC9A 4UJ5A 5GGXA 4QJ3A 2HJSA 4HEQA 4AJEA 1B8PA 2OMKA 2V3VA 3VH2A 4U00A 3ZHOA 4LYJA 4O63O 1PR4A 5E3HA 1NX6A 1FQJA 5CYOA 3D8UA 5TE9A 4ANFA 1U0HC 4CKXA 4EX7A 3CKMA 4O4HF 3PJRA 5MHTA 4UBIA 2O8CA 3AVQA 3GJQA 4KWIA 1JNYA 4C6TB 1JIJA 3GLFE 2OXCA 3VTZA 4M0PA 3W6UA 2EBUA 4NBKA 5DO9A 4AZ3B 4DZTA 4BNXA 5EUBA 3SZRA 3LCRA 2FP4A 4QHSA 1SG0A 2FMIA 1VIMA 1XZDA 3D9QX 3KKMA 4WV3A 3G9ZA 4EW6A 4ZI7A 2WC1A 1HV8A 1BHO1 4GOND 3TFWA 5HIKA 4NG5A 5C1DA 4L8VA 1R0CA 3ICCA 4L4UA 1WZIA 2J5QA 5IASA 5JQGF 2R0QC 2HT1A 1F4LA 4FUTA 3UW1A 5GINE 5ALJA 1WKBA 2PBFA 2Y4NA 3EOAI 4DRXA 1J2EA 3CQ9A 3D6MA 3HVHA 4HUJA 1Q57A 3IXMA 4HDRA 5F12A 2P8JA 3SE0A 3U37A 2WG1A 4FVTA 4PZUA 2BP7A 3H17A 1UQTA 5MGBA 3PE4A 4KK3A 4MPJA 3RIGA 1ORWA 2O5EA 2R1TB 3J81k 1GTG1 4EI7A 2B1JA 2QRNA 2OORC 3RRXA 4JI7B 2JFXA 3A2LA 2DTDA 3MWFA 4PTYA 5AW6A 1K98A 5D6OA 2I03A 1ZMOA 3HA7A 4LJLA 5K7SA 1OH7A 2F1KA 4OM7A 1FZQA 2YY7A 1JQDA 5EESA 4J0CA 2CFTA 4KQWA 4REOA 2VSFA 1FP1D 2UXDB 4D4IA 2VS1A 3QY9A 4L2IA 1DAMA 5EJ8A 5TT0A 2HA2A 5C5IA 3U4QB 3EC2A 4RTRA 3HWSA 2VAMA 4RTSA 3QA9A 4OP1A 1LPBB 3BJIC 8MHTA 2H59A 1W88A 4A6PA 1FP7A 4FJ2A 3N53A 1DTWA 2VYQA 1SIOA 3G3EA 3TD2A 5BXQC 5BMVF 3ZTTA 1ZAKA 1KFEB 1CFJA 1R6BX 1PK9A 4H15A 4KU4A 1Y1RA 2XMSA 4WCVA 1TUIA 2XTZA 4JXJA 4YJ2F 1W1UA 1RLMA 1XKLA 1Z2CA 4YHBA 4D9BA 4JROA 4UFNA 5AXDA 2CLKB 4I1UA 4EEKA 2I2DA 1M7BA 4CV2A 5DT2A 2GZ2A 1V35A 1EE1A 4B82A 5IF3A 5JQWA 3DL2A 3ZVRA 4AVYA 3LUAA 4AF6A 3D31A 1XZNA 3ABQB 3ZWYA 2GF9A 3DLHA 4BBPA 2QAGB 4XJTA 2P9TA 4ZP1A 1XVUA 5HS6A 5IVHA 1T3ZA 2P2YA 1N5OX 2D5IA 3N8KA 4OP3A 4AJ9A 1N33B 2PMKA 2C9DA 3GLHE 4E03A 4NVRA 2BSQA 1QH1B 2HIAA 4DYVA 4WLFA 4EY5A 2ZRCA 3G5TA 3CLTC 2DC1A 1SU6A 4O2AF 5AW1A 3VTAA 1L5SA 2PUGA 1E58A 4A0RA 4EUSA 4ZVVA 3AG5A 3T0GA 3Q7SA 2IXEA 3IILA 1MC1A 3G23A 1P60A 1GAQA 3M9WA 4NC9A 2RGYA 5KSYA 1XCBA 1FBNA 2PJDA 5A9SA 2G9ZA 2WRZA 2VQSA 2W98A 4BVKA 4U7GA 1UDBA 3MOSA 3UCFA 4RPLA 4Z1MD 2CL6X 2QV7A 3AG6A 4RMJA 2W6PA 2ZW9A 1Z47A 2QNBA 5ALUA 5ICGA 1HO3A 1J0XO 3FPBA 3B6ZA 3F9IA 4CN8A 2F1IA 3PQFA 3Q1LA 5DYYA 1NG1A 3ZW9A 1X1EA 4EO9A 2HCJB 4NTZA 3QYPA 1NU8A 3SXUA 3OA0A 2M98A 2NZXA 1C0KA 3TX2A 2CLLB 3AVVA 5JO9A 3KQHA 3BXFA 2C4MA 1AU9A 3AXTA 5AIBA 3ELWA 3ZHTA 4RU1A 1XXHA 1P2UA 3H75A 2ZQZA 3AR2A 4KYUA 3ZDEA 3ZCSA 2ISCA 2L2QA 4NYMQ 1LSSA 1U8UA 3BCHA 2OYRA 3WICA 1QNLA 5KYUB 1Y5IA 2QXUA 4IZIA 2QU8A 3L1UA 3IELA 3ITEA 3NGXA 4F4JA 3QWAA 1C8KA 3H4TA 3S8YA 3OAAA 4LRUA 2VYND 1MD9A 1XGKA 3VYWA 4CTMA 2H9YA 3HDYA 3THRA 5I8WA 3HFGA 3LHSA 4G8BA 3F4BA 2E9SA 2DPHA 1EJ2A 3F6SA 5KI6A 5AM4A 3UMGA 3ZWVA 2AF3C 5IH7A 4G36A 2A88A 1KVQA 2VYCA 2ZP1A 4Q37A 4UTOA 3JQRA 1XLUA 2WP0A 3LGAA 5CDHA 1ENOA 5FL7A 4EFKA 4EFDA 5LR6A 5IULC 2PM8A 2ZIEA 3EWSA 1KU6A 4MKGA 4BO3A 1W88B 4GNKA 3KOMA 1KJWA 1KMQA 3PJDA 1FVFA 2AMJA 2VR1A 4UU1A 4ZVPA 3RVSA 3IUQA 4E5YA 3W6OA 1CVRA 1NXTA 4I19A 4LHYA 4M9SA 2XA2A 4QVGA 2IV3A 3EAQA 1JEYB 2D7DA 2AC2A 2GZMA 3C3PA 2ZBPA 2LCQA 4EGFA 6REQA 4RPIA 4PRYA 2IS2A 5D3ZA 3A9TA 1Y80A 4HI0E 1QG2A 1T2VA 2GN2A 1JDSA 5KOJA 1QO0A 1T5BA 2P62A 1CR2A 2PSJA 3PXEA 4IFBA 5BSTA 3IPRA 1USUA 3KB1A 3WK5A 1IAVA 1L1RA 3DLAA 3OU7A 1VE5A 2WTAA 3GFVA 1U81A 3CXRA 3NTOA 3ZWMA 5HJ7A 1OSNA 5KMGA 3K1ZA 1XG5A 1YH3A 1A96A 4XLZA 5C81A 1TM4E 2GFQA 4RK5A 1TUBA 4N76A 2A59A 3L1IA 3NM6B 1WEKA 3O2JA 5AVWA 3ZHXA 1AY0A 4M9CA 4CU5A 5A5VA 2XKKA 4Q3CA 1BS2A 1U7ZA 2NT3A 2NT4A 4S12A 3TLGA 4C21A 1E1CA 2YL2A 3TZKA 4QXQA 5AVOA 2JGEA 4FFWA 1L6IA 1O95C 1NL3A 4L07A 1VRWA 3OPMA 4FKMA 4HMPA 3WRYC 1I51A 1S89A 3RHZA 1YFKA 1RPTA 1UAAA 1G4HA 3B5JA 4TT8A 2H3EA 5AW3A 3H2KA 4CLXA 5BR1A 4UCFA 1I1HA 3Q7TA 5ULLA 1SFRA 1Z0ZA 3D7SA 1NSFA 3L01A 1M0SA 1MA0A 2GLTA 3CUKA 3E0QA 3MJVA 2A5LA 3HU1A 3K1JA 2BHLA 4RF3A 4RSMA 4FLEA 4N12A 1X42A 1XRRA 3P5SA 2TS1A 5FNVB 2H1HA 2P2ZA 4LRSB 3JTMA 4PYQA 5G1NA 3LL4A 5C8YA 3ZE0B 5DGHA 2R7NA 3P4YA 1Z5ZA 2OA0A 3TYXA 1E7YA 1WMBA 2HU5A 4Y2GA 1UFRA 4E7PA 4U0JA 2XQVA 3DXYA 4EI2A 1SCIA 3K5PA 3DLTA 1OOEA 2H07A 1HE8B 1X3SA 2BGTA 2IYAA 3OZSA 4KNWA 2YJGA 2KJQA 4OH7A 4MJXA 1Q7EA 3W8NA 4F56A 4EEZA 2JASA 1XRLA 3KU1A 4DBLC 3NUZA 1M6NA 4GM1A 3NNDA 1SQ6A 1WLSA 2ICAA 5KTYA 3GVHA 4ALKA 4KOAA 3TM5A 1UKCA 1Q11A 1XPUA 2FPSA 5CHEA 3W2FA 1HNNA 1SRRA 4AN0A 3AQ4A 2NIPA 1TVCA 3PFNA 2QA5A 3Q2OA 4DPMA 4EPWA 4ND1A 5BORA 3HJUA 3I34X 4OJYA 4PGFA 2D0OB 4YJ3A 4MI1A 1NQAO 5JFOA 1R9GA 1F14A 5C37A 1GT6A 5BWCA 2JLCA 2HZBA 4QUGA 3CVVA 3ETGA 2AB0A 2CDNA 2GK3A 4ARIA 1H0KA 1COZA 2BBOA 1C3XA 2A4KA 2O52A 1SNYA 1UK7A 2C3PA 4C76A 3LJKA 1VB5A 1OAAA 2GHTA 3H1PA 4H77A 3QFRA 4PZLA 5EEGA 4DLKA 3P0JA 3RIYA 2VPXA 3A2NA 1WEHA 1BROA 1NW6A 2X0IA 1VRCA 2C97A 2ACKA 3LRXA 1LKZA 3SLRA 3GRVA 5JJKA 2G9VA 3WV5A 2ZRNA 3C7KA 4D41A 2JKZA 1UBHS 4KUGA 2Z30A 3AJAA 4MKFA 1J9ZA 4PICA 1RJEA 1OKKA 3ZX5A 1ULZA 2FOIA 3FHLA 3AVXA 1YFLA 2JD0A 2OGWA 1YDWA 4B84A 1RQ7A 5F78A 3M82A 1LTKA 2AQIA 4MAMA 3WSVA 2OCYC 3Q7IA 3HCFA 4KQHA 4HNQA 1KDOA 1T2FA 2EIXA 1VI2A 2I8LA 3FG9A 2D1TA 1U5BB 3STVA 3CF6R 4DLWA 3ZK8A 1TUBB 4XRGA 4RENA 4JJ4A 3LT0A 4NXMB 4F3YA 2AOUA 1W581 1KO4A 2P3SA 2HL6A 2LR0A 2Z3VA 3TLGB 2EFGA 2OLEA 2GFIA 2SCUA 1IY9A 3TIIA 1F7UA 3NJRA 4J0IA 5E8RA 5EHGA 3OEEA 3D1JA 4RACA 1GYQA 5E4FA 4RF2A 1ZHHA 2NACA 1CY0A 3O8OA 1W5SA 4HTFB 4IIGA 4KFSA 3NU1A 5DGTA 5EE1A 5FPSA 2OHJA 1XA0A 1KZHA 3ZD8A 4DAOA 2YIJA 4DNPA 3ESAA 1Z2EA 4G1FA 4LZNA 4R40A 4ZODA 3F3KA 2IOQA 3QMWA 2FVYA 1MAAA 2HUPA 4B2YA 3LYLA 3ZTYA 4EI9A 2BGJA 1V48A 3TAXA 3TSOA 4IDPA 2W6IA 1CDEA 4R9VA 2BEUB 1DJNA 5IW8A 3IOMA 4P0TA 3K9FC 2AZTA 4IICA 4MWDA 5KDDA 3CT4A 4JBNA 1NLMA 2Q5FA 5BOSA 2DBQA 4PXYA 2OXRA 4AQ7A 3TQSA 1RI3A 3PQCA 2PG3A 1Y3HA 3KSRA 4M8NE 2CGEA 5IUNC 4B6QA 1MX1A 2RHRA 3BK2A 4EQ6A 1QC5A 3FZQA 5LQAA 4B7XA 3AB7A 3TZCA 1NBHA 3ABOB 3Q8WA 4J9UE 1XZPA 2Q5LA 4G5GA 1OT3A 1CERA 2YJ5A 1GPKA 1R2QA 4U2GA 1WDTA 1AKUA 3IOYA 2XCOA 5KQLA 1M6VA 3S1AB 5THXA 5H80A 1BCRA 1T5DX 3R4CA 3B1XA 4HDKA 4JSTA 4PC7A 4X65B 2HJGA 3CUWA 3M8KA 4KJXA 2XEXA 3PGA1 4UUPA 3FAZA 2V7XA 5LZ7A 1GJRA 4QHYA 1KOLA 2JHGA 1R0RE 2P9CA 4Z8YA 4CRWB 3PYMA 1YBAA 3EZYA 1POXA 4X64B 2JPDA 4BC1A 1M0EA 3BGVA 1E4OA 1ZK2A 1C2TA 3ONEA 4C2TA 3HKEA 1AUOA 4FXOA 3HCCA 4GPIB 4IYJA 2C5HA 3IP1A 3TQTA 2BH2A 3OIUA 5LYJF 4NCXA 2X6TA 3VR5D 2IHNA 1E1QA 2AOXA 2BGKA 1IIRA 3T3GA 3QKRA 1TVKB 1Q74A 1XJWA 2WUWE 3Q3VA 3H65A 2HV9A 2UYOA 3OJWA 2FN3A 4G2NA 3CEAA 1EVJA 1L5QA 4OXKA 2GERA 5D7BA 2F4NA 2I4IA 4NICA 4P3KA 4E5MA 3R6DA 2NYRA 4CFSA 3OIDA 4PZYA 1WKCA 4ZT5A 3A31A 3EDRA 5A2GA 3RTDA 1ZUIA 4WNCA 2C03A 4P2GA 1X7HA 2CLOB 2HA0A 3E7FA 4MEBA 2GPBA 3VNQA 4MYHA 3WLOA 4G0OA 1J8YF 3INGA 2Y1CA 1SHUX 2HK9A 1EWYA 1KMHA 4UEOA 1M8PA 3ZHVA 2XMGA 2UDPA 3ABIA 4KQXA 3LUPA 4BB5A 4HYEA 1KO1A 2UYHA 2DHEA 2P0AA 4NL4H 5EIFA 5J2UF 1WXQA 2WHEA 5CM9C 1GGVA 4XSHA 1BXZA 2F64A 1K66A 1HFWA 1YZLA 2I3BA 3PFGA 4WZZA 3QU7A 3ZWNA 5B64A 4RTNA 2BFOA 2IKQA 2JEZA 1T3TA 2JS7A 2ZE8A 5FOQA 4KPYA 1U7WA 2EQAA 3KB6A 2ZWPA 3AUKA 5IPFA 3A9WA 3CMCO 1Z28A 4LWOA 3WWCA 4BZWA 4D3FA 3PHJA 5CA0A 3VRHA 2XW6A 5JAZA 4CIAA 4LXXA 4PE5B 3EXIA 2I76A 3NNSA 4K9KA 1J0AA 2NUPA 2G4CA 2NO9A 2R4TA 4LVCA 4L16A 4M21A 4EMUA 2JVJA 2WINI 3A1UA 1E7QA 5IU6A 4GGOA 2Q5CA 4JCOA 5D5PA 4ID9A 5JCXA 4KODA 1Q92A 3WL4A 1OFHA 1IULA 1QC5B 2RGNC 4QD3A 3DC7A 4G1CA 4RBNA 4Z49A 1QYRA 4QHTA 2B78A 1GZ5A 3OQVA 4LMBA 4D3ZA 4FUQA 5JJBA 4OF4A 1V6SA 2I91A 1J0EA 2EKZA 1IFXA 1GUAA 2YASA 3VNRA 4BKMA 1J2TA 1M6VB 4Z4IA 1EJ0A 1Z29A 2JI8A 2OO5C 1BCRB 1HTBA 1U2DC 2CLIB 3W3AD 4DWJA 4FT2A 4V39A 2VBIA 1CZOA 2J3KA 3SQMA 1MJGA 2PQ0A 3WP1B 1PWEA 2PXCA 3EW7A 2VUSA 1P1CA 4R6WA 4P80A 4PWZA 2PWBA 1E2GA 1ETUA 5JTTA 1MPTA 3AR4A 2O8EB 1CDDA 1YU9A 1TYDE 4AKEA 1HMYA 1NN3A 2JHPA 2GXAA 1CEEA 1KI6A 1R8YA 1B2LA 3ANNA 3RASA 2DWQA 4KO4S 2EFYA 2HY7A 4A7PA 4OQLA 1EHIA 5ITZA 1MHPA 1YU6A 5DF1A 3M6LA 1JJ7A 3MEQA 2OUIA 4IH4A 4GP7A 2RGAA 2NUTA 3ROMA 1QONA 3O4JA 2BZ0A 2CT8A 2VNKA 1KFKB 1E3EA 1YB2A 4JCCA 3DEKA 3HZHA 4YWHA 3OX4A 4UPDA 4EGQA 1Z7EA 4IMRA 4MVJP 4U8HA 4EA8A 3DHWC 1XT6A 2WW8A 1SR8A 4JIMA 1KYZA 2QTWB 3FOBA 4WOBA 3GMSA 1NJSA 3NVAA 1JAIA 1AM4D 3U48A 2KPOA 3KQWA 2X1HA 2PSEA 4JB8A 1FEZA 2YY5A 3ND9A 4JL6A 1DOZA 1ZX1A 1P9RA 2GPJA 2QTAA 1Q19A 4UVHA 3SBXA 3SQOA 1NUPA 2C4NA 3HC7A 2J33A 5I51A 5A4JA 3EB9A 1D9XA 3DTVD 2H52A 3Q0EA 3KYIB 5EHIA 1L5MA 1Q77A 1YQQA 5BR4A 1B6GA 1DFHA 2C54A 2VWGA 3E23A 2R1ZA 5CA1B 5DDIP 4ESVA 1NW9B 1WOYA 2E4UA 3OCYA 4W5TA 1GNPA 5AOVA 3S55A 3Q0TA 1A88A 2NTVA 4CM5A 4KXLA 5CA0B 4DR2B 3QTLA 5BWLA 3G0CA 1D9ZA 1GWNA 2PFKA 3EXIB 3BA1A 4GR9A 3K71B 5KYYB 2Y66A 4IINA 1TZJA 2NUPB 3BWDD 2OXIA 3HS3A 3ID6C 3IUNA 2JANA 3NYIA 1U94A 1JR6A 2EQ5A 5JXGA 3PHIA 5ESDA 3E48A 2ZYAA 1RZRD 3UJ7A 3HACA 4DJJA 5JH7A 2J5KA 4Q12A 4IZHA 1O57A 3IHTA 1NLYA 4QUAA 5JNVA 3II6X 2V7EA 4GLOA 4Q01A 1XTUA 1PWXA 4GM0A 1VJ5A 1UZNA 3GAZA 2EFCB 5DGXA 3R5KA 3MCTA 3RHSA 2J48A 3D3EA 3HLKA 1XMPA 2AEFA 2PZJA 2XB8A 1L7RA 4O4HA 3GOHA 1OPRA 3ILVA 2P4SA 3PE3A 3HN6A 1S7CA 4O3MA 1ATZA 3W06A 3EUFA 5BR8B 4RD0A 4D46A 4ZOBA 4LVUA 2W6OA 1T1EA 4D0SA 1Z8HA 1ORRA 5CJJA 3U7FB 3NTRA 3PBKA 2WWIA 3RLFA 1UCFA 1Z2NX 2C7RA 2EX1A 4I3FA 5AVVA 2H63A 3KZOA 4MSUA 1KKMA 5DNDA 3V3KA 3FYTA 4M88A 4C4AA 5TNXA 4UTPA 3C6KA 1RDFA 1G59A 4MVJA 4RVFA 1NYTA 3JPYA 1BWRA 1WHTA 3KP1A 1OGYA 4RKQA 5ITZB 3B13B 4KN6A 1E3TA 2CXUA 1J42A 3EF3A 3FMIA 3LCUA 3GWGA 3NT4A 1ADGA 3MSXA 4BO8A 4N7BA 1H2YA 2BGRA 3B2QA 4GPTA 4UCQA 3I9LA 3U6BA 4RVDA 3WMGA 2FQ1A 3RYHA 3WYFA 5K0SA 5TQ0A 2J7PA 2XXAA 4GSLA 1NAHA 1AA9A 2QVXX 3JY6A 3IOBA 4LOJA 3MJEA 3FCUB 3TDKA 4DRZA 4U1RA 2BLNA 3JQDA 4QOIA 2XCIA 4R3UC 3ZZMA 4DDKA 2WJWA 2ZTVA 1N25A 1ZCAA 3R76A 4W5NA 3P20A 3R0ZA 4JJKA 4XD7D 5IKPA 1WCV1 5H1YA 4U2KA 3NIBA 4LDPA 4LXIA 3ZQKA 5C8VA 1N5RA 1Z37A 2PEZA 3MWEB 4N49A 4RA9A 5JRDS 1OU4A 1YQGA 1N9GA 2QMEA 1V5IA 1AGPA 4H0NA 3A8TA 2FE4A 1PX0A 3ECSA 5JECA 2F90A 4E1AA 2VNSA 3NT2A 4YAIA 2VT6A 1JG1A 1S2NA 1B26A 2PJZA 4PLGA 4BB6A 4RETA 3PS9A 4FNGA 1FYXA 1XXHE 3L6CA 1OB2A 2PKWA 4MQEB 5G3ZA 3PXUA 4A2CA 1UPAA 2PK3A 1MW9X 3FNIA 3HWX1 2OMEA 2C8KA 1CUWA 3BGDA 1UEXC 4L5JA 3T9EA 5JAPA 4EG1A 2RHMA 4RD2A 3ICOA 1RPAA 3T38A 4AXBA 3TEMA 5E3IA 3DB1A 2D4AA 1U2EA 3V55A 1DV1A 2O8VA 1PQYA 1MEEA 3PQ2A 3U3OA 5MDHA 4FLMA 3J81A 3WLSA 5JH7B 5D84A 2VHJA 3G9UA 3Q5EA 3X44A 2VFAA 5B2FA 1ZA2A 3AVTA 1NV8A 1VSQA 3ZPXA 1D4FA 2NTJA 5IVIA 3RTAA 1M8FA 1ZR4A 3AILA 4WA8A 3SKXA 4MR8A 1PL8A 3EWIA 3ZVLA 5DKFA 1KEZA 3HDGA 4KXFB 3F0TA 1KZ7B 2JGRA 3JQ9C 2A1UA 3CRW1 4LYFA 4AY6A 1UBFA 2O2SA 4FFLA 3DCNA 1NN1A 4TTVA 2GA9A 2PUWA 1RM4A 3UV7A 4O4JF 2ES4A 1F48A 2XJ4A 3SX0A 3D7RA 1L7QA 3EAGA 1TXGA 2GUGA 2AKAB 3FRJA 4G6ZA 1QUEA 1V5FA 2HWYA 3CUTA 3UM9A 4DSOA 2HFKA 2ZIAA 2X3FA 2ZJ4A 3GAMA 3RWMB 2ZBVA 3ZD6A 4GFDA 3CBGA 5K6RA 3UA4A 1IZ9A 1WUIS 2VATA 1QGZA 1E3WA 4EY8A 3E53A 4LEIA 1CRWG 4PFQA 2HHLA 4IKOA 4FQ8A 4DIBA 2AJLI 4D82A 2O3RA 2ZSJA 3AHHA 1MFZA 5TV2A 3A6DA 5BSEA 2EP7A 3PCRB 1P1BA 1P4JA 3EIFA 5KYTA 4ENUA 1Q0QA 2A9JA 2IUUA 1MC5A 2FSHA 2X42A 3UFXB 1K63A 1NF8A 3FBGA 3BD9A 3E03A 4Q3BA 2FNAA 3HWWA 3VU9A 1X7ZA 2JAWA 3AL2A 1KTVA 1K7EB 2GVNA 3G82C 1WXGA 4PFKA 4R2MA 5DTRA 1KS2A 2J6BA 4FGWA 1RYNA 1OXKB 2FWPA 2RH8A 4IQ0A 3NJ8A 4JJIA 4L8YA 4U6NA 1SBQA 3GFOA 1YA8A 3O9MA 4TRJA 1EEXB 1CK4A 5H70A 4H7IA 3WLQA 4AG6A 5EQFA 1VG1A 1H85A 2X4LA 2OORA 4E70A 1VMIA 4YRMA 1OX6A 5D6NA 3A1VA 4JBHA 3OETA 2QRJA 4Q9JA 5FO0A 3H1TA 5KSPA 2H7YA 4EUFA 5EJ5A 1WPGA 2PZEA 3KR0A 2QRZA 3TM4A 3V7NA 4RDIA 1ZJZA 1NUTA 3AM5A 1U8ZA 2ZS9A 1ISGA 3MT8A 2DYKA 2PVCA 2ZKLA 4OBXA 5CM8B 1IM5A 2ZEJA 4DQVA 4HX9A 3GPIA 2EZ4A 4B2IA 2V65A 1MCZA 1IJBA 3T5CA 2II6A 3BCUA 5LP6F 1N5JA 3I2JA 1YRBA 1U7TA 5DP2A 3C0KA 2NYVA 5BPHA 1NHGA 1HETA 1SXIA 2WF7A 1EUZA 1HR0B 1JPJA 3LC0A 4K6CA 1CVIA 1I6KA 1DEHA 3UEOA 2C5AA 3GJ0A 4NE2A 2DULA 2P5YA 4X91A 3L1JA 1L7NA 4KAFA 4Q5IA 3I9V6 1BC5A 1OZAA 1JG3A 3RSCA 4B44A 1YVDA 1DZIA 1RVDA 2YWGA 2PKRA 4DSNA 2WP8J 1NTOA 3CE6A 3EXHC 3P94A 1QGED 2CDRA 1PHRA 4FW8A 3JYQA 4QL3A 3A32A 2G0AA 5JV5A 5CVDA 1JQBA 2Y0BA 1A2KC 4ZC1A 3ENKA 1NE7A 2P6OA 1YZGA 5AHKA 1N6OA 2XE7A 3ONWA 1PGOA 4FGJA 4WASA 5IN5A 4IDGA 3OU6A 4MYDA 1GNTA 2BKVA 4QAJA 3R7LA 2JG3A 2G0NA 1G5IA 1W6UA 4KFRA 4D6PA 2YDYA 2CVPA 2WR8A 3GAAA 3OAAD 4L0MA 1HM5A 4Z9AA 4D45A 4MKZA 2ZJ7A 3P9SA 1HZZC 4RK4A 2B1GA 4KGDA 3QLEA 5C8ZA 3DDHA 4QNRA 3NC0C 1U4OA 3WMFA 1NQ5A 5HKAA 1ZD9A 5IWAB 2IXFA 2W6ZA 4LTDA 1RLIA 3KETA 1ESMA 4EKDA 5KNBH 3IEKA 4F72A 2XWJI 3WNBA 1NDQA 3R0QA 5ICSA 3EIEA 4MQUA 1XDSA 2M6SA 2EL7A 1A9OA 3NKVA 1W4CA 4AWAA 2BI4A 4JT8A 5C80A 3SWWA 3F6PA 3OZWA 1R9JA 4LJAA 4ZGBA 5LIRA 2JAQA 1SOWA 3WGOA 2O19A 5E9AA 4WOKA 1N9KA 1XDWA 4V2IA 2CL0X 5EJGA 3MRTA 4YMVA 1MOSA 1RCTE 4IQ4A 3VU9B 1QO0D 1X7ZB 4A0SA 1SZPA 3LY7A 1P4AA 2ZPAA 4OQNA 5T4HA 2W90A 1Y1PA 2GPAA 1VFNA 5BNTA 1ODKA 2C1XA 5B1SA 1ISMA 1WMFA 2BEWA 5DYIA 2VHYA 4BKRA 1W36C 1MV5A 2MR5A 1FVOA 2HK7A 4MRMA 4AKGA 3L9WA 2D0DA 2JGNA 2MSCB 4GPZA 4NZNA 1UP7A 2ZRJA 3PYXA 4PVDA 4MUIA 1P9LA 4GUAA 3C45A 1C4OA 2NN3C 3LQRA 1RHJA 3HGTA 3B36A 2DX7A 3BHJA 1UJ6A 3K31A 2QUKA 2WD8A 3GJSA 4YFVA 4CQJA 2WFAA 2AIRA 4ZXFA 4BWFB 5H9VA 4LY6A 2EX0A 4ZK2A 2GASA 3DWGA 7YASA 4P36A 4ZOEA 1E3LA 1TZ2A 1JHMA 2OVFA 4CMHA 4E33A 2WD7B 3T9BA 4UNNA 2NAFA 2HM7A 1KRXA 3QEKA 4BQNA 3E5HA 2H31A 4H9GA 4N5MA 1EFUA 2I5PO 1SXQA 4C78A 1T1IA 4NMHA 2BFBA 2VPZA 5SV2A 3OZVA 4K03A 2YWXA 5LQKA 4DUPA 2B0JA 2D0IA 5FR1A 1W4RA 4NCKA 1C80A 1U0OC 2FPIA 1SKQA 3K0FA 1GKKA 3QBDA 4P32A 3PD0A 3G89A 1MXFA 2UYYA 1LBHA 2FZVA 3IT2A 4BUJA 4Z4GA 1YI0A 2L19A 2QSZA 3FYUB 3K8QA 3MS2A 4ZU1X 5TF0A 5CB4B 1ADJA 1K6EA 2W42A 2ZUEA 1PW5A 2HRDA 2C8LA 5DNAA 2PGJA 3UQZA 3AR7A 4JJ7A 5D87A 5T8KC 1G5QA 4ICIA 1XL1A 2XZLA 4JVNA 3MPUA 4TL8A 3UHFA 4UARA 4EMTA 1CKEA 1J23A 2VH1A 5DYWA 3U49A 2JI9A 1E59A 4HWRA 4LS3A 1G41A 2EWWA 2IS4A 2RB5A 3TIFA 1PR2A 3W2GA 3FJOA 3SZMA 2CFCA 3RFCA 1XHEA 3BMXA 3HVKA 3SC2A 5JALA 2SHKA 2F2TA 4XR9A 1O4WA 1O95A 4D02A 4PAMA 4KQ6A 4AJLA 1JGTA 4IHAA 4TVKA 2DQKA 5EIOA 4RTKA 1GTL1 2PZMA 2ZR7A 3WWEA 1RKQA 1P2TA 4DLUA 1YMQA 3UJPA 2HO5A 3KK0A 4C87A 1EYZA 1G5FA 3FVRA 3CH4B 3LOQA 2SBTA 4C4XA 3PUYA 3EPKA 1XPRA 3PK0A 2QM7A 2YX1A 4H7JA 5F4BA 4MWSA 4DMCA 1UDCA 1QFSA 4L72A 3WK7A 3VVLA 1B8NA 1ECFA 2H1CA 3W5IA 3L93A 5IAGA 3F7NA 4XRRA 5K0NA 2PAAA 1LB1B 5KINB 4IXWA 1N2ZA 2NM0A 3LBIA 4YLGA 1R4ZA 3DLPX 3FRHA 3LXMA 5CT6A 5TJ9A 3ZIUA 3GD5A 2GILA 4XOIA 5JZOA 5CNIA 3C3KA 2G07A 1R0YA 4COKA 3BGIA 2E0IA 3SHTA 4X7PA 1KDZA 1ZCBA 1ZMBA 4V1CB 5KSZA 5GIPE 2YZKA 4FOLA 3P97A 3HM2A 2N1BA 2IPNA 2YWBA 1HYBA 1GLVA 2X40A 5BSFA 3UUWA 1GSOA 1OVGA 1KAMA 2VG8A 2X14A 2DF8A 4KR7A 2BM9A 3EGOA 1YS1X 1NUSA 3AUAA 1RADA 3IDQA 5ENZA 1HWYA 4IFTA 2CZCA 4YGXB 4DVJA 4IM7A 2IZ7A 4JENA 3WXMA 3D8NA 2AZXA 2YMQA 5CVCA 3BZWA 1TADA 3FLAA 2Q29A 3DOCA 1A82A 4LISA 4A36A 3E1GA 1RAAA 1DEAA 1R9NA 3TB4A 4A2WA 1SIBE 3NO4A 4EZBA 4OFWA 3W6NA 4BN4A 5HJ5A 4MW9A 1KZ6A 5ALGA 4J0QA 3HTXA 4UUOA 1CVLA 1EUCA 3M5DA 3MJDA 5H81A 4CMIA 1CX9B 3K0FB 4K9PA 1ISHA 1LI4A 2CWDA 3ETCA 4TMZA 4ZT6A 1XU9A 4TV9A 7GPBA 3QBVA 1QG4A 2W6ID 3OPQA 4GBMA 3PDIB 3FZGA 3D8HA 3WTBA 1VI6A 4KUEA 4LGVA 1PR1A 1DAGA 2CEKA 3JSAA 4H18A 2H3HA 3JATA 3KAQA 4KIWA 5F7ZA 3VISA 2M6LA 4OHBA 4LSWA 1J5EB 1Y33E 2ZRPA 3H5WA 4ENSA 2H2IA 3NVDA 2J9XB 2Q49A 4MDEA 4HGRA 5KVSA 2EERA 2QDKA 1WZNA 2WBLC 4ONEA 1TKRA 4L76A 3A06A 3VR6D 1U0BB 1ND5A 2I2AA 2IYPA 1QH8B 3KFVA 4DNQA 3BWYA 3NYQA 1T1JA 4A1OA 4CV0A 2ORVA 2F55A 1HT1E 1JJFA 1G21A 1I4EB 3SC2B 2MYPA 2LZ0A 3F90A 3NTQA 1QYIA 4QRDA 3URKA 1KAHA 5TGDA 3ZYZA 5KC9A 4Y6QA 3LBYA 1BSVA 1OHHD 1JT2A 2XMDA 4NCIA 1LQ2A 2F6RA 2FA9A 5KTPA 1JMYA 2QV0A 1B0ZA 3DR3A 4KLZA 4MLDA 2KBEA 1QZTA 2FX2A 3Q40A 2F8SA 1WUKS 3B8HA 2HCFA 3WLEA 3JVVA 2H2DA 1J2UA 2ADMA 2J3JA 4LZOA 1H3EA 1PBTA 2PLAA 3FPCA 1JEJA 4WBXC 1ZPDA 2J3MA 1CJMA 1KRWA 4O8CA 3BJZA 3UT0A 1RRMA 1U8CB 1OFUX 5U1PA 1HK7A 1UZUA 5FPTA 4YMHA 2B7BA 1XLVA 3GRYA 1HG1A 2CF5A 2GM5A 4XCVA 1RABA 4IOKA 3A9CA 3L7BA 3ZHQA 2Y2UA 1QGUA 1T3SA 3K30A 1G64A 3CHYA 2ATEA 4B4KA 1QCDA 4P35A 3UO8B 3FKSA 1GXSA 8ABPA 4KQ9A 4EBBA 3QV2A 1YVPA 1JEQA 4Q3OA 3NHSA 1JJVA 4RVUA 3ZZ0A 1H1LB 2O5VA 1V7PC 1DXHA 4UEJA 4HJXA 3R7DA 1HDCA 8LDHA 3M6FA 4Y30A 1EXDA 2WD9A 3JQQA 1E79D 3OY7A 2CF6A 1XK7A 4BLRA 1VC2A 1U31A 3W1WA 3WYCA 2VTBA 3L8EA 3UENA 3QFSA 5INTA 3LF1A 1AUPA 1FTYA 3LQFA 2FPPB 3LK6A 4LJ7A 4LUCA 1NF9A 1CUYA 2RGEA 1WIWA 2JFQA 2ZTUA 3A9RA 4HDSB 4OHXA 1KZ9A 3U0VA 1EKXA 5DWDA 3RNLA 3I1YA 3SM9A 4ZDKA 1L2TA 2PA3A 1P61B 2JLZA 1PYDA 3T4EA 2O7NA 3FHCB 3GU3A 4MRSA 1FQOA 4TKUA 3WLAA 1ECGA 1KAGA 2EATA 3D0RA 3HNRA 2DR0A 3QFFA 5GMOA 3WGKA 2ZANA 5KJFA 3G7UA 5FBHA 3TLEA 1M34A 2OQVA 3UHPA 1IDN1 3G0OA 4PGHA 1VMAA 3REFA 5HX7A 3ACBA 2Q4EA 2FWJA 3O5AA 2BD0A 4ZU3A 1FSGA 5LVAA 4MWCA 1I5OA 4U7WA 2HJRA 1JA1A 1RRVA 1CY2A 3LUCA 1HDRA 2NSDA 3O31A 4FDUA 1FP6A 2SKDA 3R40A 4EKNB 3TFOA 2M9MA 3LSTA 4GYKA 2WIBA 2Y93A 3FFXA 2FEOA 3DEIA 1V2HE 1FS5A 2HREA 2Q1WA 2WAMA 2AG5A 3L8ZA 4KMOA 3UZUA 2VJLA 4NG4A 4B3XA 2JLVA 2QMHA 4MV9A 2ZU6A 2IEIA 2AW3A 4WPGA 4JJ6A 4DSZA 3HLYA 5JSZB 1FFYA 1P7WA 3QMPA 4TM7A 2WILA 4KR2A 2VDMB 1Q2UA 3DVLA 5KU7A 4RGYA 3I2IA 1QS0A 1NI4B 3BBPA 3EVNA 2IHKA 3H0CA 4J1TC 1TJ5A 3W5HA 2AEEA 3IP7A 4N5HX 3C98A 1Q0TA 5TGZA 4J07A 1NFQA 3LNTA 5T4BA 1A0OA 3HJRA 4JI8B 1QGAA 1QB8A 1KF0A 1N6HA 3DP9A 5TMEA 4B33A 4LFBB 3O6VA 1WVMA 1CQWA 4WY2A 2I2BA 3ROTA 2QMQA 5SY6A 1Y9ZA 2JB9A 1B2RA 4MP6A 4B76A 2WPNA 2B5WA 3O4VA 5LB4A 3H2YA 3LQ1A 4Q4LA 2EWVA 2L17A 2W8BB 3EXEA 3EZ7A 4F2PA 3BX1A 3MYRA 2Q4OA 1LFAA 1WTCA 2OTCA 4JX8A 2CFSA 4NXNB 1K06A 3KR1A 3QLVC 2GK7A 4KR0A 3AV3A 1QGUB 2IV7A 5B1EA 1FLVA 1RZ3A 3FSRA 4OA8A 4K26A 3OKFA 3DWEX 4UBJA 2O2IA 1VLJA 2GDJA 3K2EA 4Z0TA 2V96A 3GEIA 4ALLA 1SG6A 3I04A 1RYBA 1TQ8A 1KVTA 3S2SA 2IYWA 3PF9A 1GUFA 2RGNA 3HNOA 1TM3E 4IVQA 4FZRA 1K0UA 4KXQA 5K45A 4GMDA 5JAQA 4BTVA 1FZTA 2OE2A 1A9QA 4YJGB 3AKCA 5CJ2A 1QBKC 3EH2A 3HY4A 4M8LA 4P5EA 1QAOA 1LV7A 2NPOA 1JMVA 3PB3A 1XQWA 3PJGA 1IY2A 2X4DA 1U2DA 3HCWA 3LKBA 4Y9TA 3CW2A 1XTJA 2V58A 4EB6B 4F9FA 3FROA 4XR4A 3ETJA 3LDFA 1KDPA 4GX0A 5FBQB 1WPXA 2BSAA 3DQPA 3FCSB 2GJKA 4JEUA 4RA6A 4F2DA 1LBIA 2AG1A 2WKWA 4RIEA 5E8JA 1B42A 1G60A 2FLVA 3DJFA 3T5TA 4J0JA 3GWZA 3IVMA 3K6SA 4L6AA 4K5QA 2XCQA 4LE2A 2IY7A 1CUCA 4IRUB 3RSFA 1JU3A 3ZS8A 4JYBA 3LWDA 1JVSA 4I2VA 4PIMA 1P4GA 2H85A <