2P6MA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDMPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p6mA00
1H2FA 1DKQA 2A6PA 2YN2A 3R7AA 3K4QA 4PZ9A 3O0TA 5AJWA 2BIFA 3NFYA 3OI7A 4PZAA 3K4PA 3FJYA 1SK8A 3MBKA 3E9CA 4GPIB 2DWOA 1E59A 4JOBA 3F3KA 4QIHA 4ARUA 3QPWA 3LNTA 1QFXA 4EO9A 3GP3A 3FDZA 2P2ZA 1E58A 2PA0A 5AK0A 1FZTA 1UJCA 2OWDA 1SK9A 3C7TA 3HJGA 1RIIA 2EKBA 4D4LA 2H52A 3GP5A 1ND5A 5AJVB 5HR5A 1SKAA 4MA4A 1DKLA 4ODIA 2AXNA 2WNHA 1RPTA 2OWEA 1ND6A 2P30A 2P2YA 4AROA 1TIPA 5HTKA 1YJXA 1XQ9A 1SKBA 3E9EA 4HBZA 2I1VB 3NTLA 1UJBA 2WU0A 3LG2A 2HHJA 3IT0A 3QPUA 3MXOA 4D4JA 3D6AA 3QPVA 2P6OA 4D4KA 2P75A 2HPAA 1V7QA 1YFKA 1DKPA 5AJYA 3FDZB 1H2EA 5CX4A 5AJXA 1BIFA 1FBTA 2A9JA 2P78A 1DKOA 1C7ZA 3E9DA 3D4IA 1C80A 4D4MA 3IT2A 3DB1A 4FDTA 5CDHA 2H4ZA 2F90A 1V37A 3IT1A 1C81A 4GPZA 4FDUA 1K6MA 4PGMA 4IJ6A 4JOCA 5CU7A 2GFIA 1QWOA 2H0QA 2P79A 1T8PA 4TSRA 2WNIA 3BIFA 2YN0A 3LL4A 2H4XA 1BQ3A 1EBBA 1DKNA 1QHFA 2ENWA 3DCYA 4E3WA 4IJ5A 1RPAA 2P9YA 4EMBA 2P9FA 4ARVA 2P9ZA 2EKZA 3KKKA 2IKQA 2RFLA 2EOAA 1NT4A 2ENUA 3D8HA 2QNIA 3F2IA 1IHPA 5AJZA 1BQ4A 3IT3A 3PGMA 3EZNA 2DWPA 1DKMA 2HIAA 4JODA 5PGMA 3GW8A 4ARSA 2P77A 3ZHCA 2P6MA 3EOZA 1CVIA
chains in the Genus database with same CATH superfamily
4PN7A 3HSYA 2C7GA 5E4FA 3QKWA 4JT4A 3WLFA 1G5PA 3VOAA 1VFNA 4EJSB 1V47A 4ZIRA 1AKUA 5T4EA 2GPNA 4FX5A 2YW2A 4I66A 4LW8A 4OQDA 3T3DA 1G0OA 3KJFA 2P9HA 2H0RA 3BB1A 4RH1A 3RBXA 4DIMA 2RHJA 3PWKA 2FA9A 1UAGA 2II6A 2R1UA 2C3OA 5KYXA 3HACA 3R5SA 2YZGA 4BXOB 3ZCQA 4FYJA 5K01A 3RANA 3KSUA 1XQ6A 3FI9A 3TCKA 4CLHA 2PEZA 3A31A 4DLWA 2I2FA 1KI6A 1NNUA 2E3JA 2HA2A 5TEWA 1NOIA 1YS9A 4QATA 4JUIA 1VJ0A 3OIGA 3KPYA 3NBAA 3I9LA 1NX6A 2Z2ZA 4FMPA 3CO5A 4QBHA 1URPA 5F3RA 2AXPA 2OOSA 1LQ2A 1VPEA 3QA9A 3KEQA 4Q1CA 3EIQA 5GZ1A 4RTMA 1CUDA 1UOOA 4OATA 1AMOA 4ZKDA 2NUPB 1TRKA 2BGLA 2HOQA 2IZ5A 3AFGA 1AUQA 4ZAWA 3ZG6A 2O5EA 1UWCA 2VLIA 1MPXA 4IIEA 3UAWA 3HJAA 2IVFA 3EB9A 5G1PA 4ZXPA 4Y6GB 5TDHA 5E6SB 1CCWA 1M1NA 5G1OA 5HA5A 3PCXA 3DXXA 1Y3AA 1DU4A 2Z09A 3NNNA 1U1CA 3EXG1 1RRGA 3KAQA 7AT1A 1Y4AE 2ZAYA 5T4BA 4I5FA 4XSVA 1YDHA 3K9BA 5E6RA 3PKZA 3Q2OA 1EVQA 4KYTA 4WCVA 5I9BA 4CT5A 5IKMA 1KGDA 2AI1A 2MSCB 4RC9A 2CYCA 1DC5A 3I1FA 3JQ9A 3K5PA 1NYLA 1FYFA 1OIWA 1Z0IA 4BU0A 2ZROA 1ZCFA 3CEHA 2D5IA 1E5TA 3NDJA 3OUTA 4BTVA 5JSYA 2ODWA 1YOBA 1QTNA 3FWNA 3HGTA 4LYEA 3HN6A 4CEHB 2XYQA 1N7JA 1L3BA 3LQ1A 5CT4A 1IG3A 2IUSA 2QSZA 4HEA1 5CDFE 3JQ9C 2FPKA 4Z1OA 4YJFB 1AQYA 5G0VA 1N34B 3OU6A 1WPQA 2P2GA 2C2KA 1XF1A 4O2AA 4ZV9A 2C7OA 3LGAA 4H17A 4A7PA 4C4PA 3NOQA 3C4JA 2OV8A 5LSAA 4JSRA 3ABSB 1QB7A 2GA9A 2X0RA 4LJAA 1O4WA 2ZYWX 5HRCA 5L4NA 3K1TA 2M6SA 3P5BA 1KO8A 1NW8A 2WV9A 2G4LA 1GFWA 4HRVA 4EMBA 3VKGA 5EGSA 2IYUA 5KTOA 3LWDA 3PSAA 2ODPA 3MA0A 4BMZA 2C7VA 3HM9A 4M46A 1NDQA 4BNTA 4DWJA 3OJOA 2JAUA 2PRIA 3DTNA 3OZSA 5ALEA 4DEYA 3G82C 5FBRB 4ZICA 1P77A 3PL1A 3I04M 3LKDA 4MW7A 4HNHA 3K16A 2PMFA 5E7IA 2Z30A 4DMUB 2JGJA 4Y7CA 4FFPA 2EQBA 1HY3A 2GRAA 3H99A 1F2TA 4HGYA 3OZIA 1Z13A 4I4IA 2JK0A 2LRHA 1U9YA 4X64B 2Z56A 2YRXA 1ODCA 1PR9A 1CRWG 1EESA 1CRLA 3FVQA 2BKLA 2XRMA 4JBGA 4EGAA 5IT4A 3RLFA 2D3WA 2OV4A 1GFSA 5LA6F 1YIDA 4JBWA 4TN5A 4ETWA 5I7EA 2EU8A 2GCGA 3WGNA 3DHEA 3WMGA 3QUQA 3TZ6A 5IDQA 2XCLA 3STTA 1SB8A 1XDGA 3QG5A 4E1AA 3GBPA 2JFFA 2TECE 3NWPA 4FZRA 1XTRA 3DOEA 3T95A 4YCNA 3U9TA 1C14A 1XLWA 1Z25A 3RJZA 2Q2QA 4EF6A 5LB4A 3HK2A 3ZDZB 2H92A 4IXMA 1ZOSA 5LOVB 3DBIA 2XOXA 5AIBA 3PXAA 3HR8A 3RIYA 3R4VA 1CJCA 3HBNA 1RQXA 3A9SA 3KHUA 1JSZA 3GFGA 3OJEA 5JT1A 1B73A 2PSJA 2F4NA 3ANYB 2O20A 3LECA 4AJ9A 1GQYA 2AG6A 3ITNA 4WK2B 4F4CA 1JLKA 1F17A 1WHSB 2QJRA 2Y1DA 2ZIEA 1ZJJA 1PL0A 4QUHA 4Q1FA 1X1AA 4CF6A 4NBSA 2DU8A 2TYSB 1HDGO 3H75A 4W8HA 4E5YA 5BWOA 3LC0A 3JQEA 1PSDA 3VSCA 4KPGA 3K0BA 2PGJA 3KZKA 2DBRA 4IQ4A 3QW4B 1D0SA 4Q47A 5HCUA 4E4TA 2W2LD 2FP3A 3BFVA 2VTBA 4C03A 2EX4A 1RXCA 3L8GA 4NS1A 1E79A 3IR5A 1FSZA 2FPPA 1QO9A 4J03A 4LDNA 4QO7A 3UK6A 3HA2A 4KR2A 4DPKA 1DPFA 5FKJA 3NAZA 5GV7A 4CMGA 1FBTA 1Z62A 2Q8NA 3OC6A 3QGMA 4IMIB 1ZR2A 3LVFO 1HKHA 1Y8QB 3B6JA 3CMCO 4P4SB 3ANSA 3PB3A 4QRHA 2Q3EA 4YLYA 3C5CA 1NDUA 3KUDA 2F55A 3PF8A 1EVEA 3I9FA 1IHYA 3P0FA 4FLEA 5I9NA 1PUIA 3CIFA 3NH9A 1H8ED 2ICAA 4W5RA 3EISA 1PVVA 1G1AA 1JR4A 2R1VA 3KQVA 1CZLA 1ZOIA 3F7MA 4M8LA 3RS7A 3SZMA 3TLAA 2NYAA 1KEVA 1GXSB 1KDOA 2AN1A 3HWX1 1RE0A 5DBEX 4MV4A 3S1AA 2Z2JA 2H8KA 2X41A 2XMBA 3A6FA 1KEUA 3KL4A 4I9GA 2OFXA 2V55B 2UVDA 4YRNA 3HVUA 4OU5A 1N2BA 3DMNA 4C0LA 3FOZA 4QHYA 3QWHA 4R0NA 4RZ3A 4EMSA 1QIEA 2JIPA 3O21A 1DX4A 4R8LA 5CGQB 4DM3A 3VH3A 4F46A 4Z4HA 2DSNA 2IYEA 4GAEA 3LY8A 2EKZA 3Q7IA 4MYRA 4H3SA 2X4IA 3RYIA 5ANRB 4N40A 5K0SA 2GEFA 4JI7B 1NKVA 1RAAA 4TWIA 1K9SA 4GP6A 3V3TA 2ENUA 4MJLA 4CIXA 2Y8EA 3EMKA 2DJIA 3GT3A 3RUAA 3GCXA 4CCAA 1T36A 3KKZA 2JG3A 1OTHA 3AESA 3DKKA 2HCTA 3S6JA 4WLEA 1EVYA 1E6KA 1F8YA 2YYYA 4ITVA 4MVJI 2PT6A 2NGRA 3MMNA 4P98A 1RRKA 1V2HE 2PRJA 3EULA 3RTBA 4H0FA 3ZHSA 2CHEA 2IHVA 1C30B 3LX8A 1TFRA 4K9SA 1LLUA 3MTEA 4MV3A 3VPGA 2ASVA 5K8TA 3OLQA 2W6ID 5DN9A 4C9BA 1V48A 1C2YA 1W48A 4A26A 4B3XA 3FCXA 4M49A 4F9EA 3TOVA 4JLUA 4DY4A 1UBJS 1JYFA 1XP8A 4UASA 4NBWA 3U4GA 1LSUA 4BBJA 2PX6A 4OKIA 5K4GA 5FWXA 1BS2A 4NCKA 2UYCA 2JFVA 1SZCA 2XKJE 3KOUA 1TPYA 4ZOLA 4HFMA 3GRPA 1PQPA 2C8VA 2P6PA 3OQMA 3PVZA 4U9HS 1DBRA 4FN4A 1RKQA 4Z53A 4BVJA 3WGIA 4CI0B 1XNGA 4CEIA 1US8B 1FZTA 3NZEA 1JDVA 2IHZA 2YYZA 3RC2A 3ZY2A 3S1SA 1U28A 1IJFA 4B75A 2VNSA 4K6MA 1Z6AA 3HSSA 1MENA 1L3IA 1MNQA 2GEUA 4DRXA 2JEZA 1XNQB 3N53A 3RK1A 2G7ZA 3QK7A 4MPPA 5BN4A 3DFFA 5T6MA 4HCJA 5FHQA 3GHHA 2CNKA 5E1BA 1NN1A 2Q5JA 2GEKA 1YOVA 2ZRKA 3U49A 3T4UA 1JJIA 2ANBA 3QWIA 4XASA 4OO3A 5GMOA 2H1WA 1H0RA 3JAMA 1YVDA 2C4UA 1Q92A 4W1QA 3MAAC 5ALZA 3RGWS 3NHAA 2AH5A 5LC1A 1U28C 2YX1A 4UEWA 3V3KA 3K1ZA 2OILA 2Y92A 1L0BA 2MINB 3D5QA 4HDNB 5KYWB 5MN4A 2W83A 3QJYA 3P2OA 4MVJP 3E7WA 4Y6PA 2ZBRA 1WXGA 5AM1A 1WBBA 3WRYC 5ED0A 2ALJA 1CIVA 2YV2A 4BBAA 3STUA 1KJNA 4H0NA 3IAAA 1FQWA 2VRNA 2DBYA 2J3LA 4HZUA 3B6ZA 3IA2A 4M87A 1R6VA 4O4IB 1CR2A 1DHTA 2AG5A 5DM70 2HRZA 4LHWA 1XCGB 2AA3A 2WZBA 5JU6A 4U6NA 4D80A 2JJQA 1MG5A 4RAOA 1KKMA 2RAFA 5SICE 4EZEA 2IP1A 2VWPA 1F8XA 2FFAA 4LJ5A 2OHFA 2V54A 3MUFA 4BV2A 4TL9A 5YASA 1WA5A 2XHZA 4L2IA 4M1QA 1Y5NA 1E5LA 2EZUA 3IX7A 1UKEA 2FW7A 2NZJA 3ZDXB 4QYTA 3QLEA 2MSEB 2I3AA 2ZBGA 3T41A 1QK3A 4PC1A 4U2GA 4DM7A 4WOPA 3H1TA 1ID8A 4X1KB 3GA0A 2JLBA 2W6JD 1AS2A 3ZI0A 1MO4A 2DWCA 3OICA 2EFJA 4DPLA 3ZBPA 4HGRA 1N8NA 2WWGA 4RH3A 4Q3DA 2C97A 4JOCA 4KR6A 3ZDCA 2AOTB 4ME6A 5CU7A 1IH8A 3UGKA 3CNLA 3QXXA 2ZXFA 4OMFG 4RMJA 2Q62A 3WBJA 4C3VA 1BEEA 1PJ3A 3T0GA 2Q6KA 4Z4QA 4K9MA 3R75A 2WP8J 1F6WA 2NTVA 3ELDA 4HDMB 4L4RA 2IHYA 4D0LB 3BZUA 5CNJA 3F74A 2G4CA 3BXOA 3EH2A 3JVVA 5IVDA 4X65B 4ZT2A 2CV0A 3QENA 5C35A 1HDIA 1MBZA 4YAWA 1T3TA 3ZLBA 1IQPA 2ECOA 5LM3A 4G3XA 4BB6A 5B2FA 4J7XA 2CLIB 1TKBA 3C6XA 1XDDA 3C3YA 3GV0A 1IMJA 2IQ5A 3KV3O 4LY0A 3SXUB 3U2QA 1Q3TA 2CHVA 1BQ4A 1CBUA 1XZDA 1YUMA 3E8MA 3QLUA 5CLIA 3UQZA 3PV0A 3AUFA 5ELXA 3HDYA 2IS1A 1JB9A 4HX2A 3LUCA 3IP1A 5FPYA 1CKEA 3QQ5A 1OLUA 2YOHA 1FFHA 2FTKE 3JQCA 1VB5A 1SUIA 1WKVA 5A5FA 1ACMA 3N1UA 3PE6A 3GLHE 3QH4A 2BI7A 4CG0A 2BEUB 3A4NA 1TZ2A 2FZLA 2XVZA 1TQ6A 4P7KA 4DIKA 4ER7A 2V58A 2VA9A 3QLUC 2Y2UA 1YFLA 1QGOA 5EJ7A 1MC5A 2YXEA 2GM4A 4LI3X 2ZR0A 1DXYA 2A5JA 3RWMB 2R5FA 4D79A 2ANCA 2RBGA 2VK4A 4I1VA 4ZOEA 3DMPA 4BO0A 1RTKA 1V0JA 2PLNA 4X45A 4GVLA 5TY0A 3BD7A 2QUAA 2EATA 2FR1A 3F6YA 3IBTA 2I3DA 3PDWA 3IDSA 1EFUA 3TZLA 2R97A 3GJ7A 4NNJA 1QF9A 2IP2A 5BMOA 2NN3C 2E5LB 3R7FA 2XT9A 1WZNA 3FYUA 1R9JA 3T1VA 3U9SA 2CDCA 1NWCA 1OE0A 1WKBA 2BT4A 3CKMA 3DTVD 3GY0A 1TUGA 3D3WB 4KFRA 4KIFA 2MDTA 1E9AA 3PU6A 2QW1A 3C4VA 4TKVA 5TQ2B 4F4IA 1DJOA 5FOSA 3OCVA 2EKPA 3V1KA 5FYDA 1A9PA 2JFOA 1TO2E 3GRFA 4KYUA 5T8KA 3RIHA 4Q5IA 3UA3A 3O2SB 3ZGYA 1XE3A 3EWNA 3CF6R 5ALJA 1P2DA 3SJZA 2FAXA 2CV2A 5BYAA 3I4FA 3OOYA 4KFUA 4XYMA 2FXIA 3DMDA 1ESCA 2QN8A 3FYUC 3JRNA 4LZZA 4URUR 4WMLA 3R7LA 3EZ7A 3SEQA 2EX1A 3Q7PA 4QL3A 3IQIX 2B3TA 4IUYA 1M54A 3UMBA 4F7DA 2ZS7A 4IZHA 4I5EA 1RBQA 3PRYA 3LYUA 2PBLA 4WV3A 3QF7A 3KSMA 4EBFA 4J1TA 3RHTA 2D1RA 3BD6A 2MSNA 5EZYA 3AUUA 2HMTA 4IAOA 2ZSHA 3MPOA 1TAHA 3FVRA 3NX4A 4RA9B 4E5SA 2EERA 2EKDA 3QU7A 4MROA 1CUZA 1JA0A 3NASA 3MRTA 4XUDA 1NC3A 3AOGA 5CFZA 2AMFA 3G2QA 4O4HB 1V1MA 2B9VA 2CXUA 1Q1AA 3EEQA 3SHFA 2WU3A 3DL7A 2FW9A 4B35A 1TYZA 4W5NA 1NW7A 1RJWA 3CC8A 4FUTA 3S2EA 1JDNA 1EXWA 4S1OA 4PCVA 1BS9A 1FSGA 4XB2A 7YASA 3THXB 2RHMA 4BO4A 3UPUA 4Z2YA 1HWYA 4UAGA 3CF2A 1P3DA 4JZYA 4L4ZA 3NHSA 4XSHA 2G3YA 3LUPA 3N9IA 2XVYA 3P0JA 4RMNA 2VK8A 4AO7A 4ZN6A 2XBLA 2XNHA 4LZNA 4GQBA 1VJ1A 2VAVA 3UUEA 1HDCA 4UNRA 1JDSA 2GFHA 1ODFA 3UW1A 4HVTA 2PY6A 4OM8A 5BMVF 2OR3A 4D8XA 4KFSA 2XT6A 5LZ5A 4LBZA 5CR9A 4CV3A 2DCMA 3VOTA 4YYEA 5JAHA 1ZGBA 2M1ZA 3OWHA 4BQNA 2JCGA 1J0DA 1OILA 1J7KA 1DJLA 5CLJA 5T67A 1WCV1 2H6EA 3A37A 5C5EA 1PZNA 2E9SA 2GLXA 3EUAA 4P1ZA 4JXZA 2QR2A 4AMUA 1Z7BA 5H3CA 1VKNA 4JVMA 5FBHA 1F8FA 1THMA 2J5BA 1XU7A 3CPSA 3LKVA 4IXNA 5EGNA 4F06A 4DGSA 1GVHA 5FBZA 3EGOA 4UU7A 2VP4A 2GPTA 1QIJA 2LDXA 1FEZA 2QYTA 2YV5A 4C07A 3TGLA 3R7AA 2A0XA 1WZCA 1T1IA 1BWSA 5LJIA 4NAVA 2O8BA 2JFYA 4RK4A 2WD8A 3K7EA 5FRDA 1GNTA 4GICA 1FJXA 3TW8A 3VH2A 2M9MA 3O3MB 4UTRA 3CNQS 3ZHRA 1WKCA 2ZJ1A 5FXMA 4UM9B 1I33A 1MAWA 1SWWA 4EW3A 1KP9A 2ZIZA 1X77A 4XIYA 5LZ4A 1E4OA 3LF1A 4MP8A 2R1TA 2CFSA 2B1QA 2CXTA 2PRZA 2RHLA 5KOYA 1RHQA 1KAGA 3PICA 4WESB 1ZWKA 2AN9A 2VJCA 4H3HB 1QE0A 2CLCX 3A04A 3ZGZA 2HU7A 3H5WA 5FIUA 1A82A 2EYQA 4F93B 1W0KA 2POQX 3DLAA 4Z1MD 1XCMA 4IHJF 1B14A 4OKNA 1QQTA 1AA6A 4WE3A 4UCFA 3RFVA 2Z1MA 2OHVA 4OJYA 1BA3A 1DEAA 1R6AA 1S3GA 1ND5A 1XAIA 4C0QC 1RPZA 1FU7A 3QTLA 3HGQA 1EBUA 3DOJA 3P5SA 3QLVC 4B74A 2EG9A 4FMCF 2HRRA 2Q6LA 4JOSA 2KE5A 1FOEB 3G9QA 1UBTS 4JJ6A 4KXYA 3ND8A 4XJXA 3IKTA 4PC2A 1ZGZA 1USVA 2BDUA 5BUSA 4I9FA 1J8MF 4XEUA 4J0IA 2QMHA 3VHLB 4WVLA 3I01A 1WJGA 2YWJA 4QO8A 3FJOA 4IGAA 1H4QA 4OI0A 5CLQA 5TGDA 3NHRA 3L40A 4MRRA 1ORHA 4LS3A 2RKOA 2AKAB 4LY3A 1LPMA 2XV1A 3U81A 1FYDA 1VBKA 1VRVA 5AVZA 1AX9A 1RZ3A 3G8DA 4NOKA 5REQA 5SZJA 4V0ME 2IF2A 4LRSB 3THWB 2Q6TA 2WWRA 3L79A 1J6UA 5CNIA 2JFZA 1T5HX 1RPJA 1ZM3A 2QV7A 2VHCA 3ED1A 1R4ZA 1LW6E 4K6CA 4IIJF 1Y6QA 3PDJA 4JYZA 2RHBA 4G97A 2QZ9A 1YRAA 4ZO8A 3N8DA 1ADFA 1U4NA 4QEZA 1AMNA 3H2YA 1VZ3A 2LUOA 1Z6PA 3HGMA 4TQAA 5B3JA 2ZAGA 3PQCA 5F64A 3TN7A 3IJPA 5BWNA 1JH8A 2IBMA 4M1YA 5KWEA 3N2LA 4IJ6A 1UAAA 4CMHA 1NVGA 4X44A 1NVAA 2G8LA 1OXMA 4DDWA 1B1AA 3DTYA 4YUYA 3F73A 1LCIA 3FUWA 1N3YA 1EHCA 3GLSA 1RLMA 1CS0A 1AU9A 3UAZA 1SEVA 3DE4X 3MAGA 4KQFA 4D6YA 2XCTB 2VJPA 5EWJB 2B82A 3JARB 1JKMA 1UBRS 3L6OO 1UPXA 4RVOA 3U1TA 5K45A 4Z9FA 4J3FA 5KKAA 1M1XB 1E94E 2B78A 3I28A 2Y1XA 3L8MA 3WVNA 4YDQA 3TG2A 3CUEF 5KSZA 1BOFA 2QRPA 4YJ3B 2AX4A 3K9GA 1ZD5A 4BQPA 4ZCMA 4FBMA 3OE1A 4IIGA 1MQSA 3SK0A 2HMSA 4HX9A 2J32A 1WXDA 4QPJC 3ZZTA 2QAGB 5IZCC 1FPMA 3PUHA 2ZWPA 3QE3A 2FJPA 2XCRB 2PA3A 4KI7A 4A2CA 2HPVA 1QBKC 3IMCA 4JLKA 4KMSA 4B85A 1RYYA 2A0FA 3GVIA 3ZI7A 4PX3A 4PN3A 1CRZA 2VHJA 1A4IA 2V59A 2ZK7A 3L77A 4I55A 5ARCA 2WQ7A 4IIUA 2ZSJA 4NENA 3VKUA 3GARA 1H2ZA 3NM6B 3TB4A 1H9AA 4D46A 2PJUA 3H9GA 2YTZA 4X8MA 1PS9A 1AHIA 1ZINA 1NI3A 3MILA 4I50B 1UBEA 1PV4A 4OHFA 4AY2A 4JI1B 1K4MA 2YIVX 4BVKA 3R9XA 2QMEA 4WZAE 2AYZA 5AK0A 1NVDA 3JQDA 1F6DA 1V9LA 3CLUC 3LGXA 4RGVA 4XQGA 3EXHC 1NXQA 5DK6A 4BJ1A 4YCCA 1CY8A 2W6QA 4AG5A 3R76A 1GAJA 1TGYA 1ZP6A 1Z4OA 1FE8A 1FA9A 2B1RA 3KSBC 1TTPB 1L7QA 4G84A 1M8KA 4OP2A 3F98A 4J43A 4PYOA 4GLOA 3RNLA 5F1KA 3IAXA 3CISA 5G41A 2IYNA 1YVUA 2FLVA 1E1YA 1HTBA 1PNOA 1SC6A 2V4MA 2JLZA 1W36B 1QP7A 3ICVA 5D3KA 2O7RA 3OQOA 1WD5A 2FZVA 5AM0A 1X74A 4XTRA 4YP6A 3EPLA 1MOSA 5DBFA 3BJIC 2G06A 5B2ZA 5KKNB 5L45A 3U4QA 5EUBA 4CM4B 2QBYA 3V48A 2PEYA 3WLRA 1PJRA 4OK3A 4U5QA 2BGKA 1A72A 2VRBA 1OFHA 2XUOA 2J67A 2I8LA 3GI1A 4YBZA 3DQZA 4X6YA 4A8JA 1E7SA 2AZDA 2X1MA 2V7VA 3H4VA 4DUPA 4ZCIA 3DO8A 1OC2A 4MLCA 5J1SB 1V3UA 3ZYCA 1GGEA 4WKOA 2V7BA 4OY3A 4DL9A 2PO5A 1DUSA 2AQKA 4C4TA 3NANA 4ZVKA 4L76A 4DV0B 1ACJA 1W25A 3QFSA 5KVAA 3MSXA 3D6VA 3TK1A 4R98A 3N70A 1N1GA 2X15A 1DAHA 3BAFA 2F3RA 3EF3A 1AGNA 2P4EA 2XHEA 3K6JA 2IF0A 4M38A 3EMBA 2JKVA 4TTIA 3DZGA 3L8FA 1G7SA 2XECA 1OZHA 2CLMB 2DM6A 1YZGA 3NBUA 3RU3A 3CZ5A 1L4BA 3OX2A 1L5YA 3RHFA 1E99A 3WKEA 4E5DA 3JVIA 4W5HA 2WZCA 3B3GA 3K73O 1NW9B 2D1FA 1SUWA 3DDCA 2PPVA 3CW8X 3EDYA 1TO1E 2HM7A 2WYUA 1M2OA 3KXDA 3R09A 4IDNA 4DNPA 4URXR 3B7WA 3Q7TA 4UTVA 4LQ4A 1H94A 3C6ZA 4XZ3A 1JU3A 2PV7A 4BGVA 2WYIA 1QCZA 1FYWA 4KO1S 4XWYA 5FWYA 1BXGA 1B3RA 4JROA 3HXPA 2BH2A 1VBMA 4ECEA 5MFZA 1W75A 4JL8A 4INJA 4CQMD 4RKEA 4BV3A 2HR1A 1F4PA 5LQSA 1DI0A 1AQNA 1E98A 1WXQA 1YCHA 2WWHA 4R8SA 4C76A 4K0RA 5A3QA 4XIGS 4EZBA 1JAIA 1V8ZA 4AJKA 2DPXA 2B4TO 5GONB 2GARA 3ZJ5A 2YN4A 4G5RA 2VJAA 5ULLA 1OI7A 3OFNA 3LX4A 1VMIA 1ISRA 1W34A 2XEXA 3IUPA 5B64A 1VCHA 4LGCA 4LEIA 5JS2A 5IJ9A 2B34A 2ZJYA 2JIZA 1EK6A 2XRYA 3NYQA 2YDXA 4EKYA 1JQ5A 2OZVA 4V2UA 3UHFA 4RZSA 4KBGA 2XIJA 4NVRA 3RU7A 1MX5A 4UW9A 3ETHA 3PEEA 2NU9B 3RFTA 3GJ5A 1WZUA 2WWXA 1J0CA 1S96A 1VBNA 1GT91 1MRNA 1UFOA 3A4YA 3KOXA 4O25A 3UMGA 1K8QA 1XA4A 5KSWB 4DB2A 1MX3A 3BEOA 3SFVA 1V5IA 1TM5E 4QBKA 4TT8A 3K0SA 2OV2A 3D9QX 3EY4A 3ZD7A 3HY4A 3FFTA 4WBXC 4WXYB 5DXFA 2F8TA 3S44A 2NXJA 1Z9BA 3SKVA 1AC5A 2B4KA 3EZYA 1OH6A 1I3MA 2RK4A 4LJ7A 4EY6A 3M6VA 2WYWA 2W2PA 4DJTA 1B8OA 2QL6A 3IQGX 4LSGA 3F1KA 5HF6A 3PNLA 3WSWA 4BP1A 2FF7A 2I76A 1C7EA 5KVSA 1NVKA 5FWDA 1CQJB 3FDFA 2AJBA 4ZYYA 2D5CA 3FR7A 3C6BA 1A98A 1DKLA 1ZKMA 2J59A 2XTNA 3K30A 1T9BA 1U4SA 4FFBA 4YS6A 4LV6A 4IMRA 5CXQA 1M1ZA 4BKQA 1FUIA 1SCNE 1VG0B 2JDID 3TMYA 1U3CA 3IVRA 4O1HA 1YR1A 2HPHA 3UJ3X 1I1HA 4RHEA 5CT9A 3V6LA 5D3MA 1TT5A 3PCTA 2B0CA 1K9VF 2DPLA 4K3VA 3IAUA 5IH3A 1C7QA 3JQPA 1R6XA 2HWYA 3SEAA 4ZK2A 1W30A 5BSWA 3UW3A 1XFDA 4ZVNA 1X13A 1V5EA 2ZG6A 3L0BA 1O9GA 4HEJA 1WG8A 3C6QA 1L4KA 3UUFA 2Q5IA 3JQGB 3FTQA 3EMVA 3KZNA 4HR7A 4JH0A 1D0VA 3BKWA 1RNLA 3KQYA 3U6KA 4I99A 4ARIA 1Z8DA 1RWBA 2B92A 2VT6A 4KXFB 4PV7A 2O3JA 4GMHA 2XBUA 4BWFB 1YAHA 2J5RA 3GN2A 4ZEOA 4C4XA 5KX5B 1QB8A 2GK4A 3FKQA 1CJKC 2OQ2A 4LBYA 1QE3A 2IZOA 2VZ9A 1KYZA 121PA 1IXRC 5FADA 1RZVA 5C52B 4RVCA 4R1MA 5F1YA 4ZVUA 2VHWA 4F2PA 1FIUA 3ONDA 1A7KA 3FSGA 3ILSA 1XD9A 1JTEA 4ECAA 3HEBA 3KB2A 1CB7A 4J76A 2ZBDA 2PMEA 2ZBUA 4Z0PA 5KSPA 2JCVA 3K6SA 1E2PA 4YJGA 2Y6UA 1TVKA 3K0HA 4ZVTA 3KJGA 2XA2A 3D7LA 2PT5A 1DCTA 3AVVA 3GVXA 2E4WA 1AZSC 4L95C 4G1CA 2FPGB 4WH0A 1W0JA 2HU8A 3P4YA 4NXMB 1T0BA 2I6UA 2AE2A 1XDZA 2RI1A 3KWMA 4GPTA 4I1UA 4U1RA 5GTDA 4RJIA 3VZDA 4K9KA 2IKQA 2HK8A 3PQ6A 2YHAA 5LQMA 3AB8A 3NGLA 2J4DA 5FUWA 2Q8QA 3BG5A 3NRBA 1YUBA 3D8HA 1GAEO 1MA3A 1YJ5A 3PC7A 4P33A 2Z8YA 3KSRA 2ZJ6A 4HAXA 4AG3A 5LYJF 5A4KA 2AD1A 1RQ2A 1XZJA 1K3FA 2DKOA 2AUTA 4AZ3A 3DXYA 1MB4A 1U9JA 3NV9A 4IFIA 3H13A 1V11A 1B3BA 1ULZA 1L5QA 3OPVA 4MWBA 1YI0A 4ZT6A 3WLIA 3ZW9A 1UKYA 1VHDA 4YALA 3SQOA 1UMBB 3WRWA 5J43A 3P2MA 2EW2A 3I73A 3LWZA 4G85A 4RIEA 1Q7BA 1OWPA 4RSGA 2GHRA 1JVSA 2A4MA 1FCJA 4TLDA 1EKXA 4BB9A 4UM8B 3DEZA 2WTNA 4NE7A 5H5JA 3X1KA 1YDEA 1GD1O 2QXYA 2WE8A 4M1OA 3OQ6A 4MQFB 3GDFA 4ZWNA 3R8CA 4DBZA 3L1HA 2FUEA 4ENQA 1JJ7A 1NVUQ 4EKGA 1KNQA 1HT0A 4DLYA 1JHUA 3CB2A 2I2WA 3WLQA 3T15A 2ZJAA 3K2QA 3EF1A 1VBFA 1D4OA 1YGYA 3QVOA 2ON6A 3VKFA 3RSCA 3RSLA 1CZRA 1SKQA 3OKPA 4B9AA 4CU2A 3U7EB 2XNJA 1WCXA 2HQRA 4GXQA 1CFJA 1OWMA 4W9NA 5IRCD 3DAFA 3DHYA 2X6TA 3ZS9A 5KB3A 1Z2PX 1QZXA 2R8ZA 1FP6A 4XRGA 2PMCA 4EPXA 1C3OA 5DN6D 4KPYA 5E38A 1KI9A 2F64A 1SZPA 1QHXA 1H6DA 1KMHA 3HB7A 4UFPA 1AM4D 2X76A 2W2VA 4DXHA 2NYUA 5C32A 2UKDA 1GT6A 3ACDA 5I7RA 4GPEA 5HJ7A 5KOHA 3TCNA 3ZNOA 4QPCA 2BFBB 3RSFA 5DTQA 1V6AA 2AJCA 4WXEA 3G2NA 3A11A 4XCQA 1SKBA 3AVPA 4GI5A 5F7ZA 1M2VB 1TQ8A 3O4FA 2YXLA 5ADVA 2PLRA 5DO9A 5DHPA 5DEOA 1QRSA 2PL9A 2NVUA 3DL0A 4PHGA 4DCNA 5BV0A 3GRKA 3Q40A 1RXIA 4HTFB 1GAQA 2X3YA 1UK7A 5C3UA 3P9PA 4EVIA 5JVDF 1GUDA 1T4BA 1KA9H 2OENG 1XZPA 1XXLA 1YRLA 2KHZA 4EHKA 1THGA 4ANFA 3PR1A 2J46A 1KIMA 4JEMA 2RHDA 4FOLA 5EJIA 1PV1A 2C4KA 2W8ZA 2OO3A 2ZB2A 3P0IA 4FYKA 1RVV1 3MT8A 2WINI 3GZJA 2FU5C 3RFUA 2LD4A 3FETA 2R8OA 2NXWA 2A7QA 1CXZA 4JJFA 1JZTA 2ZE5A 3HL0A 4D0GA 3LT4A 3JVDA 5JWRA 4B3FX 3D4LA 3ZLUA 4FM9A 1N7HA 2Q8PA 4IV5A 5B4UA 4I9UA 3WRXA 4RX1A 4EYQA 5ES4B 1KWKA 5T7BA 4KUHA 1HTWA 1NR5A 1GZVA 3OPQA 5BN3A 2Q5QA 1I8TA 1N1EA 2GN0A 1YQUA 1I6KA 3NTXA 4BVBA 1JI0A 1NQVA 2QL7A 3GDHA 3O1JC 5FTKA 1XRSB 3E15A 3SSMA 1JV2B 3HRHA 2I4MA 4TXLA 1TC1A 1E2FA 2WIAA 1ZUHA 2YBDA 4J0EA 2JGRA 2VPQA 2NSYA 5AW0A 1JEYB 3K94A 1KZ6A 5ABPA 2PAFA 5EJ8A 1E9CA 3T3HA 4UQLA 4L73A 1QH1A 3RVKA 4BVAA 1MXFA 2IX9A 3GR6A 1XXHB 5CNKA 3ZCTA 2NMVA 4N8EA 1UDBA 2VSXA 5H82A 2AZMA 1T3HA 5TVGA 1A7UA 3WYCA 2CMGA 3QYPA 3FUCA 5D86A 1B23P 3UJBA 1M83A 1TM3E 3ZR4B 1I9CA 1Z47A 2AOXA 4ZCQA 1LA2A 1E7RA 1HFEL 5HYVA 4MR9A 1J4AA 3AB7A 3TOCA 4OQNA 4ZZ0A 4F97A 4GI7A 5I51A 5E3HA 2IL1A 1NPTO 4RHXA 3HCOA 3ER6A 3VR0A 4I46A 1FTWA 4NNPA 2ZVQX 1OZFA 1V6SA 3PJFA 1LGYA 4J1SA 4QPPA 3W05A 3M5PA 1C5KA 1IAQA 3LPLA 2PD3A 3EAGA 2P5SA 3K9NA 1ZK0A 3E82A 2J9FB 3GFPA 3JPYA 3OHMA 4FYVA 5D6NA 3IVXA 3RRBA 5BR7A 3G9UA 1N78A 1Z0UA 4D9MA 2ZYVX 3MG9A 4P58A 3TEMA 2QM3A 3I0ZA 1JEOA 1P2VA 1PGNA 1TTQB 2ADFA 3LHIA 5HQJA 4A0HA 4C3UA 2B6HA 3RD5A 3GUUA 1YRYE 1BU5A 2G76A 3FPGA 3KDSE 1X3SA 3IESA 4PS1A 5KJCA 4RABA 5KTTA 4V0NA 3CM0A 4QGFA 1PTKA 2R5WA 3AP1A 5DLDA 5J58A 3EEYA 3BCRA 2A9QA 3SI7A 3S8EA 2QTVB 4BP8A 2ZSUA 1KJIA 4M53A 3UAOA 5JSZB 1A8PA 2AYXA 3KKLA 5AM5A 1DTWA 4OIMA 4RK6A 1OAOA 1T2NA 3LVRE 3OLZA 2WSIA 4CCWA 1BJTA 4EELA 4C2TA 2I4NA 4OSOA 5CA1F 1BXKA 1NSFA 4H7JA 4QFBA 5DWVA 4C4RA 1QVRA 3HLYA 1O2DA 1WP9A 2FDXA 3GUYA 2ZZNA 3IEMA 3R0XA 1A2BA 1UEXC 1OI2A 4AIIA 2FMTA 1SUDA 2I71A 3LQ4A 3GXBA 3WIDA 3OUZA 1OAOC 2FZKA 4ARAA 1NW5A 1RHMA 2O5CA 3IXLA 2Y9MB 2PS1A 3D7KA 4L6CA 5EIWA 2AFRA 2B7CA 4JB2A 2EKLA 4DMMA 2KJQA 3ANMA 4UCXA 2KI5A 2JGLA 2Y1WA 2DUWA 4WTOA 3QE4A 3REQB 1BDBA 3M0EA 2GH1A 5JALA 3LQQA 1PW7A 1ZA1A 2GJAA 1Y4ZA 2GAOA 5CH5A 3RSHA 2G5PA 4PICA 3T1NA 4AKHA 2Q27A 1CRPA 3LD9A 3GLTA 1PWZA 2GEJA 4E14A 1IOZA 3QEAZ 3FFXA 2PKRA 1XQYA 1KH2A 4BQRA 2FN8A 2CXQA 1N2HA 1XEXB 3OPYI 4BO7A 1PZGA 1GSIA 1XZGA 1AKVA 2GF9A 2JGIA 2NZVG 2PZMA 4L74A 1QH0A 4MPDA 4RK0A 5LZ8A 5GWXA 4BX9A 1VZ2A 1M6HA 5EXEA 4MHOA 1SBIA 2FSIA 3WBBA 3LPAA 3CX8A 1EMDA 3I58A 1R4NA 1UPTA 4JJ4A 4MEJA 4XX0A 3TOZA 1FYXA 1GPBA 2JAWA 1N4AA 1YZFA 4RSHA 2Q9BA 1XKXA 2J6CA 3KZOA 2DFTA 3CLTC 1WVMA 4YT8A 3TRDA 3TI7A 1A8QA 4WERA 3LZCA 3S55A 1G60A 4MQLA 1B0PA 5KC8A 3OM9A 2OD7A 3A6LA 4RD0A 3GLIB 2YJTD 1XVUA 1X0XA 2AR9A 2VP3A 4FIZA 2YHIB 2J4CA 4U2BA 4DE5A 1R4MB 2P2DA 1G8SA 1Q0UA 4XD7A 4Z4FA 1K27A 1O87A 3HYNA 1MO3A 1P0PA 3DGFC 4REQB 5IN5A 1L5KA 3S40A 2PYIA 2HMYB 1GUAA 1HA3A 2VDNB 2XA1A 3Q0EA 4R54A 3OE4A 4UREA 4CIDA 3ZDBA 2VDUE 1EP2B 1ZNXA 4FOSA 3T94A 4EDHA 3PSHA 3KZCA 4KIGA 4RIIA 3EG9A 1H2AS 1EGVB 1NULA 3H2IA 5PNTA 4AO6A 1MJFA 3WS7A 2AC4A 3CCBA 3LSTA 1MHTA 2AJ8A 4MARA 1R18A 5DTMA 1O9BA 4EPRA 1YNSA 1E5XA 5AKEA 3U44B 1JECA 1NNI1 2Q5OA 5LUAA 3A8TA 4BJHB 2MTBA 2HLDD 2BTOA 4ZAFA 4IKPA 4YP7A 4IIDA 4TVKA 3SNHA 3TZQA 2HT1A 3BMCA 3KU1A 3ZNPA 3WNZA 1SUEA 1NBMD 2Q21A 1XN1A 1NUTA 1B42A 1UJ4A 2O0HA 2D0OB 3EMDA 1SBYA 4IXWA 2QLLA 4AY6A 1AUPA 3O7MA 3NOOA 2AZXA 2QRNA 4E94A 4INAA 3W90A 1NN5A 1E8MA 1SXHA 5KQMA 5CHYA 3ZQJA 1QBGA 3KU4A 2O0KA 5FORA 4XOIA 2FZWA 2ZWVA 3PXBA 5KQRA 1VL1A 3QEMB 5HKKD 3UAGA 1XQWA 2H2WA 4ZOBA 4KB5A 1IBRA 3F6EX 3CUYA 4AN1A 2OVFA 4LNHA 3AOEA 3VJRA 3TEFA 2NUTA 2CJWB 4JDPA 1G7CA 4JN6B 4OQYA 3D3KA 1FS5A 4BQIA 4U8HA 1OI4A 3GRVA 1LQTA 3U60B 1VE7A 2BBOA 3HBFA 2C82A 4JWTA 4Y0NA 5LN1A 2X9NA 2L19A 1CW2B 1P4RA 3C4QA 4PR3A 1JQLB 1D5CA 4TXHA 3VMFA 1PT7A 3AOEC 4RL4A 1BX3A 4L4XA 4E6PA 3A1CA 1V7QA 1TKAA 5JSFA 3N05A 1P7YA 3MTIA 3AHIA 3DHWC 1GZSA 2YVKA 3IP7A 5L40A 4P36A 3CZ4A 2F00A 1GA1A 1KH3A 1WNFA 2WV7A 4KGZA 2Z4SA 1J1ZA 2UUOA 1A50B 1EDOA 3IV7A 2PKXA 3AUSA 3R6WA 1P29A 5H7XA 4LRWA 3KEFA 2NUAB 1D2NA 3ESAA 1CS4C 3VNBA 1AIPA 4CKEB 3Q11A 1MVOA 4M2LA 3D0RA 3MJCA 2CWDA 4GSYA 3U31A 5AXCA 3NTOA 3STYA 5GIOE 3F3YA 4N5HX 3HDJA 4K40A 1QHEA 2PUBA 4QGBA 2GVDC 5TS2A 3MWDA 3HKBA 1I2BA 1KAEA 2ERCA 2UVPA 1T6NA 2GKSA 5JS8A 1CLUA 4RLHA 3FDXA 3H8SA 2W4QA 1IIBA 4INOA 3VR5H 4YHBA 1JGTA 3W9SA 3W2TA 1I32A 3M4YA 3QVTA 1ZISA 4X8LA 2XJ4A 1W8DA 3PC2A 4HRAA 3SHOA 1LXCA 4JMPA 3G1WA 1NL3A 4U7JA 4HYYA 1FXSA 4Y2XA 1T6BY 1IOVA 3H6GA 5FAXA 3WHLA 4ZVVA 2G0AA 5K1ZA 1BFKA 3EIXA 4UJ3A 1YJ8A 4RTQA 2J45A 1HL3A 3HV0A 4OOEA 4EX6A 2OLKA 1GNSA 4ES6A 3GD7A 2V9ZA 3DHNA 4C21A 5E3IA 4C0KA 2GKGA 5KIAA 5SYMA 1E1RD 3H97A 5TGTA 4RFSB 4A2PA 1BDMA 1D03A 2ZUEA 2JHFA 1V5FA 3B13B 4WK0B 1P2SA 3A1EA 4FKZA 4W1SA 2NACA 3SS8A 2QX8A 2JAPA 4RLFA 4X8OA 4ON9A 3THYB 2FKAA 1IWOA 4PQRA 2ST1A 3J7TA 3MQFA 3RK0A 3E9CA 3N2YA 3VR5A 1J8DA 2BAGA 2XUKA 3RQSA 3W6UA 5IBCA 2ZTSA 2PN1A 2QLMA 5JUWA 3M2PA 1SUPA 1S1CA 1NUHA 4E33A 3PD0A 3G7UA 3SZLA 1BCSA 1FMTA 2XGGA 3MCUA 3UFBA 3H19A 2I1QA 4Q1AA 2X0EA 3V7WA 1GG8A 1WB6A 1LBSA 3AF2A 4NEQA 2DPMA 4UNQA 4CL3A 4NNOA 3GG2A 4R83A 1V6CA 1JHZA 3H04A 4HDKB 4UD6A 4UUQA 4GYYA 1QQ7A 4P54A 1VLLA 1S9DA 2OPHA 1DC4A 1DS6A 5LCXA 3MJHA 1WXHA 1ZVMA 3WHIA 3WAKA 1LH0A 5LA6A 5DI3A 3VC3A 5THXA 2CXXA 1YK0A 5DCWA 5GONF 3H83A 3RVQA 1R8XA 4MYDA 4YACA 4YBRA 4DJJA 1NJFA 2NO7A 2H3HA 3Q8WA 1JKFA 2GUWA 2OAQ1 1VL8A 2XKKA 4G01B 1C8VB 1XLVA 1KMQA 4LXQA 3JQ7A 4MMXB 5HTKA 3SZ3A 1Y6RA 4PHFA 1QPBA 4ZI5A 2C5LA 4DMGA 3STVA 5CVTA 5AIAA 5JS7A 1WULS 3C7DB 4HDCA 5ARBA 3U3KA 5BNFA 4GRDA 4DUZB 3IMGA 3W77A 2VR1A 2D5AA 1CJTC 3RSZA 4F3TA 2D1TA 4CTOA 5LMCA 1CY2A 1V8FA 2RIPA 4MVWA 4QOFA 4QX6A 4CEJB 4BPBA 1KY2A 1QO0A 3AJAA 3HPQA 2ILTA 3N2KB 4NU0A 2JFHA 3A9UA 3DE6X 2XUDA 2QRUA 3E2MA 5J2TA 4EYSA 4LJKA 1NI5A 4P3XA 1MC1A 3CN7A 3D0QA 4KXNA 3ZHTA 2A0WA 1TEZA 2E4YA 4JY7A 3D4PA 3N5KA 3KPWA 3SN6A 1GAXA 2GN8A 2OTCA 1HYEA 2DQKA 5CDUA 2Q2WA 1Z2OX 3X1DA 3LH5A 1N2GA 3K0FA 1VMAA 1E4EB 1EE1A 4GNRA 4DMLA 1AO3A 1G5HA 1DFIA 5ERYA 3H5NA 4UPDA 2FNAA 4NAUA 2XWPA 5HFNA 5LKAA 2QM8A 1B4DA 2ZUTA 3ZV3A 1NE2A 4AY5A 4B82A 3OM8A 4W8GA 4YB8A 4X54A 3W8NA 3ONVA 2IHBA 1QGAA 2VNHA 1C0EA 1TUIA 3IMEA 3R9WA 2P11A 3TYXA 4RCYA 2O8DA 2WVHA 1XO1A 4Q93A 1RZRD 4N5DA 4CE6A 3M6AA 2VSNA 4KTTE 1KE2A 1G4AE 3LK6A 2EX0A 5BP7A 3WI7A 3OZGA 2PMKA 4ARVA 1PFKA 2P9ZA 1VLHA 1KF0A 2R6FA 1O96A 3I2HA 3I2FA 2VK1A 3OZFA 4K05A 1PU2A 4A27A 1Y82A 1H65A 5IC5A 5EHZA 5J2UA 4QASA 1G0NA 3SLGA 3VZPA 1LDMA 1VYUA 1H0HA 1XCOA 4LZAA 3IOEA 4NK4A 2J9XB 1LBHA 1CR6A 3VX3A 1N6KA 3ZD9A 3ZGNA 1XZEA 1XPOA 2D7DA 1OGJA 4GPAA 1HTTA 4JS0A 2KMLA 3IT3A 4M1SA 4AO8A 4BHTA 4CLRB 4PQFA 2AZTA 2BHLA 3CUKA 5EQFA 2HRCA 3OLXA 5HIAA 3B52X 4ESVA 1UJ5A 1CERA 5CB4B 1U31A 2BM1A 1B76A 4H18A 2G9VA 3LCCA 1O0CA 5JXHA 3OP4A 4V0SA 5FPHA 2VF2A 1I7QB 3OT5A 4MKRA 5T3YA 1IHOA 1J5XA 3L4BA 3LP8A 4XVHA 3MYRA 2F8SA 1A77A 3AR5A 4BP3A 5IHXA 1QHHB 4YMSA 5HIMA 1N9GB 1Z0SA 3EK2A 3H2HA 1M6VA 4BUJA 3U3DA 1DOZA 3QXCA 1I14A 2J87A 3CYFA 3QOXA 1K7FB 3CUSA 4ILKA 1NQOA 3ZHZA 2P2LA 5B6JA 4HAZA 3X3HA 4DN6A 1OWLA 2AF4C 1VKJA 3IMFA 2IOQA 3I3SR 4UOZA 1E89A 1JG7A 4HG2A 4ZI7A 5B3KA 3T12A 1I0LA 5KYYB 1Q6YA 5IJWA 3TW6A 3LPMA 1QUEA 2OHHA 2PCLA 1QR2A 2W8BB 1M2NA 3II6X 3OE7D 4QPNA 4FNAA 2ZJBA 3N2GB 2Q9AA 2X58A 5C0OE 4D6PA 2WYOA 1XTSA 3ROMA 2W4IA 2C59A 3HC7A 4HH3C 1SB9A 3LU1A 1J0BA 1QG4A 1P5FA 4CDGA 1PR1A 1Y1QA 3E2PA 1QYIA 3KIPA 1MGPA 2C9DA 2VHEA 1SCUB 3EGIA 3PITA 4PBSA 4WX2B 3TB6A 3TF5A 1AS3A 1B6SA 2OXFA 4KWIA 3EZXA 2ZB4A 1FRQA 2H3EA 3F6PA 1DZ3A 2CUNA 3ONFA 3M6XA 2YMPA 4YNBA 2XGOA 1P1CA 1Q22A 4PO8A 3U7QA 2A94A 3ZY4A 2BEWA 1R37A 2RIRA 2XTZA 4H59A 4RQUA 3DOUA 1XVTA 3JWHA 3MBOA 4FNGA 3ML1A 5JH7A 3B70A 3R5XA 2B35A 3NP9A 1E1LA 4KEAA 5HFAA 2ZI9A 1DWOA 1FFXA 2DLNA 2LNDA 3GB9A 2GZAA 4KQKA 4XWWA 1MD9A 1R5NA 3AW8A 1WOYA 3HUDA 4GYKA 1RQRA 3CJRA 2P75A 3QKSB 4IWNA 2EBFX 3OFJA 1YO6A 1IXZA 4G1MB 2I6XA 4BEWA 3KT3A 1PDOA 2WWYA 3W4IA 1TF7A 4JEUA 4TRNA 4LDJA 1NE7A 1JHMA 3D3QA 3WDKA 4Y2PA 2A9PA 2XTAA 3S7ZA 4CG2A 4JX9A 5C8VA 4R71A 3PNVA 2BH9A 2CB0A 2EFDB 4ZC1A 4FLFA 4AX4A 5K6TA 4J0CA 4PX9A 2FJ0A 3BN3A 4K1LA 4NK5A 2DE0X 2XGMA 3DB1A 2OVBA 1J20A 4NEGA 4MGHA 4E08A 4CQLB 5DYIA 1PJ8A 2Q5CA 4WNYA 4LFBB 3INRA 1DG3A 1LVHA 3GPBA 1EIZA 3OKFA 2VL7A 3ER9A 5K8VA 3VPCA 3ET4A 3GJYA 5DHQA 3CLTD 5F2OA 1J09A 4R01A 3RRYA 4A2QA 4BFZA 5LZ2A 4F1WA 2I1LA 4CF4A 4M7WA 3H5LA 2YN0A 3PG5A 4AJ4A 4F6RA 4B3IA 1Q7CA 1H5QA 1Y81A 3CW9A 1TEHA 3D0OA 3T5DA 5K09A 2WSLA 4MQ6A 1A5SB 3H3JA 5AJTA 1DBSA 1UBLS 2DSTA 4R1QA 4KPUB 4V02A 1T91A 1F2VA 2FYTA 3GLVA 4QVKA 2V3VA 2X0KA 3PC8C 2PUAA 3CT4A 4TZ6A 4N3GA 3N0XA 4EHNA 2AFIA 2ZCUA 1QV9A 3KT0A 3L4SO 4JJKA 3RHSA 3ZWQA 2QVLA 2YVLA 3V42A 3NEJA 3GJZA 3W5DA 1IL0A 2O7SA 4M1MA 5LP6F 1OX5A 3RIXA 2CXNA 3U62A 2VDKB 4EGFA 1QHIA 4ACAA 4AQYB 3SIWA 3WXMA 2WE7A 3QX9A 4WK6A 2WPDA 4XLZA 1N5JA 3VGJA 1YTUA 5JJLA 5DJ5A 1UXKA 1QGYA 1XTIA 3CV3A 3GAAA 2IOYA 1WSBA 3H9BA 3O95A 1ZOOA 4JQZA 4QRDA 5F73A 1Y1SA 5KYUA 2FDRA 4LC1A 3C3EA 3RTDA 3AF3A 2V5AA 3FF1A 4DDMA 4C1NA 1ZI8A 2QN7A 3EIUA 4OXNA 2OUIA 5LU9A 2RHHA 1ECBA 1R27A 3ITDA 4Y2SA 1E1NA 4PAQA 1RYFA 1XTKA 1SHKA 2VF7A 1Q2XA 2UAGA 4RK1A 5EHGA 5ERXA 4CM5A 1AA9A 1VL6A 3ELWA 4BJ3A 3TQFA 3GP3A 2XUAA 3FROA 3DMHA 4TL6A 2NU8A 1R15A 4DLBA 1YZVA 1IJBA 3H2KA 2B0JA 2X2EA 1TQ2A 2O1WA 4HQKA 5EP4A 2QGFA 5A5EA 1QE5A 2Z5GA 4YV1A 4DWOA 2EFYA 1RWOA 3RJ5A 1GGKA 1T6ZA 3CXUA 2JLUA 4MVJH 4IO1A 3R3WA 1Y37A 1AH2A 1RFLA 5HQTA 2A3RA 3V1UA 2YZKA 1K6JA 4G5QA 1IVSA 1Q12A 2YV4A 3UV7A 2GXAA 5CYPA 1CE8A 4TV9F 3D8NA 4G26A 3PGJA 3RWBA 1E9SA 5JWOA 3UGJA 2ZBQA 2I55A 3E2IA 4EEKA 2HWWA 1FLNA 2VDMB 1TIPA 4RSRA 4Z4IA 3W1EA 3RPEA 4YAIA 1J24A 1W2GA 2J3EA 4WASA 3R4CA 1FDUA 4QBTA 4OUKX 1DRUA 1Z5WA 5FHRA 4BLRA 4XWKA 1W6UA 5JI3E 4CM3A 4QODA 4XKJA 4O4JB 4RKYA 2F3QA 2QPTA 2W2MA 3E3AA 4G0OA 2DR3A 4JL6A 4RZQA 3L43A 4X1OA 4BATA 4B5KA 1GEGA 5LQCA 3PHHA 1BDIA 1ZI6A 1VHQA 2WKSA 4EQ6A 4L5YA 4GBJA 1V35A 1R0KA 1XHEA 4K9PA 4C6RA 5KSOA 5A7FA 1YDWA 2Q4BA 4BDSA 1Q15A 1DIOB 1DOAA 4MVJA 4P2GA 2RH8A 2ZM6B 1DAEA 2NTNA 1U8TA 1KJYA 1OJ7A 5C8YF 3QJ5A 3SXJA 1L1RA 3WLEA 3TLYA 4I4TA 1BN7A 1II8B 3HU3A 1XD8A 2SBTA 2OB2A 4WL0A 3EEIA 5EE1A 1Z5NA 4X6LA 5JNWA 4KAFA 4F4HA 1EPUA 4Z7QB 3D2CA 1WU8A 5JXJA 6NULA 4KN6A 1D8AA 1BHO1 3PQDA 4GVXA 3SC2A 3SIXA 4B4KA 2ZTUA 1J8QA 1IONA 1JR3D 5B37A 1D4FA 1W35A 3NT5A 1XCPA 2H2DA 2BSAA 3B3QA 2V7QD 4JBYA 2LKCA 1Y0BA 2WT4A 4IDCA 3T9FA 3WWEA 4JJAA 1PR5A 1L5HA 1QTIA 2D06A 2L69A 1NW3A 4HYEA 4R1UA 3FVTA 3ICQB 3IDFA 4JYMA 4OL9A 3PDIB 5CM9C 3W9BA 2P9YA 3N7AA 1WXIA 3INGA 4A1FA 2C00A 4IFBA 1XK7A 3CBQA 3ZQUA 5ITWA 2GXUA 1I7NA 2XEDA 3NATA 2OFPA 1KY4A 5EIFA 4EFLA 1ABEA 1DIRA 3RC8A 1QOQB 3B7PA 4FT2A 1OUMA 4HQFA 5E0OA 2BHSA 1FLVA 4D9IA 3G6WA 5BWBA 3GJ6A 3SIPA 1NQ5A 1KEEB 1N6NA 2I34A 3KVRA 1NONA 1PR3A 1IULA 1JLRA 4JB3A 4UUNA 4FWTA 5DTIA 2J85A 2WYHA 4RU1A 4KH1A 1MMFB 4M55A 4QNMA 1UWVA 3ISJA 1RP1A 3JAKB 4LDRA 2SKCA 4IIFA 2CFOA 1SVKA 4A0QA 4DQXA 1L1FA 5BMVA 2QI9C 3TL2A 1SCJA 4HVAA 3SZUA 3GPLA 2XQJA 4QDOA 4C29A 4LQLA 3T9BA 2FQYA 2FZGA 5KTSA 2WQZA 1H85A 2CFCA 4X95A 1EAMA 3TD2A 3HA5A 3ZJYA 4ZDKA 1RZUA 5HIIA 2IYRA 4HH0A 3BRQA 5JE8A 5BYKA 5IAGA 3MFQA 2I9PA 2VUSA 1NI4B 2DGDA 1JIKA 1X70A 2K4MA 1BEZA 1Z7EA 4PNHA 4IH4A 4Y1RB 2ZUWA 3BL6A 1FZQA 1KO4A 3FPSA 1G17A 3RS5A 2A1TR 4M9RA 1LLDA 4R7TA 2I9KA 2XVAA 5J9FA 3Q85A 5FUMA 5KTPA 4Z3OA 1SCIA 2VTEA 2YINC 4XDZA 2J41A 1P33A 1Z2DA 2QW8A 2XE4A 2WIFA 3CX6A 3DBVO 3KPJA 3HKCB 2X7HA 4O2BA 4CQMA 1N2ZA 4F84A 2OAP1 3UXEA 1WSDA 4H35A 3F7TA 3C1OA 4HF7A 4AUEA 2Z3VA 5KU1A 4ND1A 4P35A 2BHNA 2AHRA 4K28A 4H1TA 3NWOA 4Q4DA 3JQ8A 5C1OA 1J8VA 1JXQA 1FVXA 1UXOA 1XYYA 2CJXA 3E3OA 2Y1GA 2NAFA 1BGXT 3AFOA 1QV6A 3IT0A 4EB6A 1CHNA 2CDAA 4YMIA 2ZRAA 1GQSA 4J1NA 1Z7GA 3IQZA 4LMBA 1I24A 4WCFA 2PZAA 1CUCA 1WY7A 1BWQA 3ROXA 2JFPA 4DMHA 1BMFD 2VZEA 3K72B 2VBFA 3PJRA 4G8BA 6REQA 4G0QA 4Q34A 4YMGA 3TSOA 1MT3A 1QKKA 4Q1VA 2VH5R 4AJEA 3RE1A 1H69A 3AY6A 3D4IA 1HDXA 2B5WA 2OFWA 1NBOA 2WTBA 2X8JA 4R6XA 3VVCA 5IXSA 5C34B 1M34E 13PKA 2OBMA 4RS4A 3OJXA 4WCFC 7REQB 2MSLA 4QKQA 1WMSA 3VU9A 3WBFA 4EJSA 3KCQA 2WJZB 4S1NA 3OQIB 3B5EA 3GT7A 4HQNA 2E4XA 4W5QA 2QM0A 1YJBA 2GVZC 5AESA 3C97A 4MV1A 4O8ZA 3H9CA 3TH5A 1ATIA 5SYNA 4BBPA 4I2NA 1OYVA 4B7ZA 5EMMA 4BXOA 4JNCA 4JBIA 3X2FA 2ZXEA 3AR3A 1IVNA 4O2AB 4X92A 4XXHA 4D56A 4BWYA 2LVBA 2W2TA 1N3LA 1TQDA 2A35A 3TLGA 2AWNA 4HNTA 3IPRA 3BFXA 4DR2B 3TLEA 2GS9A 5BWMA 1W85B 1MTZA 3T06B 4AMBA 4C2UA 4YCDA 1OB5A 3MLBA 2H08A 4J4BA 1ISMA 4DGQA 2BSXA 1RWVA 1TD1A 3DOHA 1N5IA 3DT6A 3JQFC 1P60A 2QP4A 2QSJA 3LS2A 2BM8A 3A3OA 4D99A 3F5QA 1SUAA 4R9RA 3L7MA 2D0PB 1L4EA 5K6AA 1JEEA 2NUPA 1CVIA 1T0JB 2IUEA 4QYMA 4BQQA 1KVUA 4PNEA 4XVUA 3DHVA 2X1HA 4K88A 3KZXA 5CYOA 3OMWA 1Q11A 2O57A 1MT0A 4LBVA 4B2PA 1NX9A 5GZ6A 5EHXA 2IU4A 3G79A 4P0TA 4Z9YA 4BNWA 2PNJA 3TLKA 5TX7A 1IY2A 3B6EA 4P32A 4XAQA 5K6AC 2AOUA 5FUXA 3VR6D 3LP5A 3WGLA 1M2HA 5L6MB 2R8XA 3M4JA 1XT6A 3T1YB 4TWRA 2GN1A 3ETGA 1LLCA 3M81A 5EAIA 4S3MA 3OZBA 1YCFA 4HFNA 4BNDB 1IYZA 3HRIA 4E1VA 1YFJA 1P5RA 2W2OA 5MN6A 5P21A 4BNYA 2UZ4A 4F8YA 1BO6A 3S5UA 5AVSA 1P61B 3HYTA 3GMSA 1P1BA 2F8LA 2GEBA 2BY4A 2UUPA 4PRKA 3RASA 1U8UA 2KYRA 4CEHA 3QITA 3MC1A 2OLJA 5F1PA 1IQRA 1SVWA 4YJFA 3UK0A 1DO0A 2FSVA 1XHFA 2AQHA 3T99A 3TNYA 1C9YA 4E32A 2XUPA 1R5BA 3EG5A 2OXCA 1K4YA 3QV1A 1FW8A 2LCQA 5KTNA 1L8AA 3ICWA 4YJ2B 4HYTA 1JG2A 2B1GA 5I3CA 1EXDA 2FVYA 3UWDA 3HMQA 1N33B 1WBJB 3AJ9A 3WG9A 1QTRA 3LCRA 1DIHA 2QKYA 2FMKA 5EPEA 2IBTA 1KK1A 3AFMA 1QCDA 1LJ8A 2AEEA 2BJHA 2PMWB 3HB9A 3N0VA 4TMTA 1P74A 4KDFA 4XH9B 5JV5A 4OB6A 1YQDA 1ZW1A 2GPAA 3IQHX 3JQAD 2JI6A 2G9NA 2FSVC 1PJZA 2XMCA 2ACWA 3WL8A 4DV1B 2G0NA 2Q1UA 2LCIA 3I53A 1SBCA 4HWSA 3V4SA 2IEGA 3O90A 1ZMOA 2Z6UA 4EVQA 4MB6A 3P1JA 5AHWA 1U3GA 4V0RA 1EWQA 1HKUA 2TMKA 3HYRA 3B82A 2LKDA 3PYLA 1U7UA 1FF9A 3OQBA 4WOCA 4LWPA 4YEDA 2O1EA 3KEGA 4URYR 3UTDA 5B7GA 3LC7O 4KPEC 2XQKA 1ABFA 3AJ8A 2YYAA 2F8MA 4YI3A 5TF4A 3FNRA 4FDUA 1NY5A 2HV9A 4IUCS 4CKCB 1YD7A 2PTHA 3COJA 3EGDB 4MUXA 1KR2A 1UPCA 3NRJA 2A1UB 3AVTA 3DC2A 5I7AA 4IVNA 2WILA 3LYLA 3NVKI 2HU5A 2QRZA 1I4EB 1LLFA 5K2OA 5J4YA 4KI0A 3LTNC 4LCEA 4GOND 1HT2E 2W2QA 4YJHB 2G1JA 2D1SA 4Q4AA 5CEFA 1P18A 3W8FA 1NUQA 5LOVA 1SVLA 3H8VA 3JQQA 2ARKA 1P4JA 3SYMA 3GLHB 4AW9A 3NC4A 1E92A 2WJIA 3NAGA 4DR6B 2QA5A 4OHPA 2R44A 3ORSA 1OBCA 4ZYXA 1I80A 3HDQA 1XGKA 4JUDX 4URFA 3CCCA 1QNFA 4ENUA 1KZHA 1YZLA 4P38A 4FX2A 4L27A 4JFAA 4Y6LA 1POXA 5PGMA 4YRMA 4W5OA 4JC5A 5AVTA 3I5XA 1T4MA 1L5LA 1V4VA 1P6XA 1E61A 3AESB 4GU5A 3W3AH 3WY9A 2YC4C 1GL7A 3GEDA 3U3RA 3THXA 1LW7A 1NMEA 2GTIA 1Z8FA 2IYSA 3DE7X 4OQPA 5HEKA 3HKEB 1YS2X 4KQHA 1T2CA 1E5QA 2C8JA 3R40A 4AK9A 4X93A 1ULAA 1P80A 3UOWA 3Q6MA 5G0TA 4HUJA 4CBVA 5FOUA 1KP3A 1HMYA 2Q2VA 2VG8A 4GMDA 5CD9A 5LKRA 4JU8A 5TXGA 4JBNA 1M5RA 3EFHA 4YK7A 2JJYA 3JWIA 3OURA 4MICA 3TBFA 3ZD8A 4OB8A 4AJ1A 2F59A 3IQWA 3ZWDA 1QNLA 1YE5A 2C2GA 2GRUA 4MA5A 5DISB 4OU4A 3MTJA 1Y8QA 4PLCA 4U0KA 1XTTA 2QRKA 4NTZA 4P4SA 4K8RB 5LBUA 4CF7A 5IBPA 2QRLA 1U63A 1IZ8A 1M1UA 5K0EA 1SD5A 5A3SA 2BGNA 2HMVA 3FWHA 3GGJA 3BILA 5FJIA 5UKDA 4DRXB 4YUWA 4IVQA 4KAJA 2I4RA 3TTVA 1CJSA 3WLJA 1TGVA 2XOKD 1GXSA 1NVEA 4ZI2A 4ALMA 3G2MA 3FPLA 4QJ4A 3VYVA 1DELA 3F9CA 4HWTA 2ZPUA 5TV2A 4JCCA 2QVXX 1ZM7A 2O14A 4LE1A 4PG7A 5HDQA 1QAQA 1GPAA 3ROKA 3IUSA 4AWAA 2GWHA 2IIQA 4AP6A 4F91B 4B6RA 1GZ7A 1TM2A 1LRKA 4CMJA 3PQEA 1VC2A 1Z83A 2FX3A 3BORA 3G2JA 3LK7A 2WWFA 3CCFA 1GTG1 1N9KA 2ZS9A 2ZT7A 4BLWA 1J99A 2JGMA 4AXBA 1E3TA 3BTUA 1EAYA 1N6OA 3IPLA 3OTIA 4FHFA 5DP1A 5JDCC 3LHFA 5FFMA 1XJCA 4ZT5A 1G291 3QZUA 4I81A 1C1XA 3SXPA 1QPZA 4JENA 3SX2A 3G8BA 4NSNA 4KVZA 3GOHA 5GADl 4WXHA 2QDXA 4YMWA 2JVJA 1KO7A 3F7OA 3LY9A 1JYSA 3Q8XB 4WBNF 1YACA 4B6GA 4DUYB 3FPKA 1XDBA 4ISBA 2VDQB 1AKMA 4QU0A 3UC5A 4OA5A 3CG4A 1BQEA 1VRWA 3GOQA 4NY1A 4I3FA 2R2AA 4E5KA 2W48A 4FHCA 4ZZIA 4A1OA 3DCNA 1B93A 3OQHA 1CEQA 4YN3A 2PVSA 3AI1A 4C4SA 3VYTB 2VYVA 1I6MA 3FYDA 4FZ3A 1S2LA 2O3SA 3IEIA 4MI9A 4CNBA 2BDEA 4M1TA 4DA4A 1WUYA 1D1TA 2GMWA 2O7NA 1US8A 5JD6A 1OXXK 4MOWA 4TMWA 4BFUA 4AJOA 2RFLA 1JTVA 4RKRA 4CHTA 1YE3A 1HFJA 4F5WA 3RSQA 1GSHA 4RACA 2V65A 1LBIA 5KQSA 2PRKA 3I76A 4LXGA 1FUUA 3HDGA 4OLJA 1E3JA 1MZVA 3K6RA 5E6UB 3NH6A 4JT8A 4Q4HB 2WC1A 4A0RA 5JTUA 3G85A 1NGSA 1HGXA 2RGGA 3AB3A 3TQQA 4ENVA 4B4DA 3GZNB 4NCXA 1JQBA 2GO1A 2XDQB 3UMVA 3A6DA 4GGOA 4IDGA 1K68A 1MO6A 2QN6A 4G67A 1PG2A 3TSYA 2UZ3A 3RTCA 3PQ3A 1MRSA 2W0SA 5AJWA 4C6SA 4N76A 4HDNA 5KYWA 1R50A 3V8BA 5C4IA 1T9DA 4NR0A 4NABA 2PZLA 2EBUA 2O2JA 4IBOA 4OQLA 3U48A 1U8AA 4EY3A 1Q0QA 3EN0A 3OWOA 4C88A 3PIIA 3QTBA 2GUGA 1TLFA 4BE9A 4QU8A 1E2UA 2VC2B 1W59A 5FF9A 5KOIA 1N75A 1X8LA 5BRJA 5JADA 3L6RA 5EJMA 3KOZA 3KJQA 1LX7A 5LYJA 1G4HA 4FYWA 3OMXA 2H5IA 5LQKA 4B45A 3ORYA 3KUCA 2O2YA 4TROA 3W5VA 3WO0A 1NBWB 2A84A 4HDRB 4XWGA 2GD0A 3J7AC 2Q1TA 3OKAA 3FTFA 1Z4PX 1TC2A 3LMKA 5IC6A 2ZJ8A 1H1TA 1GCGA 1C9MA 3H1AA 3TWOA 1LPNA 5IXYA 2J0SA 1ORWA 3N8GA 1ZBQA 4GBED 5SYAA 3GP5A 4UFNA 2PPLA 5A2QA 4KZPA 2PZFA 3P27A 1TOAA 2Y67A 5BQFA 2PLWA 1VE5A 4R3UC 1PBNA 1TAQA 2BFWA 4ZZ2A 3OFVA 2VATA 4E2WA 4WKBA 4D9HA 2QY6A 4NE2A 3MXTA 5DV9A 2DQZA 2HF8A 4W1PA 1X7GA 4FMDB 1LTKA 1PUJA 2AOTA 5FH9A 1Z4MA 2A86A 2VZ0A 4HXEB 3V7FA 4UE2A 4X7PA 4UHKA 1I7LA 2ZAIA 1STOA 1U5CA 2BI4A 3JD3A 4HDMA 4JASB 2WBLC 3FH0A 3IPYA 4KQ1A 4UBNA 3WKDA 4RULA 2ZUFA 4N7JA 4QBIA 2X4GA 3IJEB 1Z2EA 1SHZA 1Z5ZA 2D2VA 2CXPA 3NONA 4OYHA 3N0RA 4PSUA 3T7CA 4TZ0A 3HY3A 2E4AA 1HO3A 4ZU3A 1H2YA 1QZUA 4KVGA 2Y0EA 4BC0A 3H9QA 4DAEA 2Q0SA 3SSAA 1Y6GA 3SLRA 5DU2A 3SXUA 5IXJA 1XV5A 1SVOA 2O7QA 1O3YA 1NV9A 1KZGB 1Z75A 3E9ZA 3G5UA 2OGTA 1P7CA 3L5OA 4L8WB 4PZLA 4J29A 4AKEA 4DA7A 2Z8YM 3ESZA 4UM7A 3MWJA 4IIXA 4ED9A 5F2EA 1P2GA 1L4HA 1G8FA 1LF5A 1G20E 2CC2A 3KJNA 2G77B 3KSZO 4JI8B 5KYVA 2C5GA 2ZBVA 5EXDA 3KJXA 2YY5A 3Q5EA 1BRTA 4Y6OA 1JYEA 3ERCA 3VFDA 2CSXA 1I36A 5DOVA 3WK8A 4AY4A 4FGSA 3DQQA 5JVDA 3BWDD 2BC9A 3AR8A 5ALVA 3RREA 1VE6A 2YY6A 3RU2A 1EM8A 5FDFA 1KI7A 1WO8A 4LISA 3C16C 3TNDA 5IWCA 5B58C 2FG7C 4OFWA 5KTRA 3G23A 2J6HA 5CLHA 4EBBA 1EP9A 4XQEA 3UWMA 1QVAA 4PYLA 1XRNA 4RF5A 4O4JF 4YO7A 1QG2A 5TIIA 5I8ZA 4LF6B 4D82A 4DY6A 3D3WA 2YXPX 4UOQA 5E7QA 1O9HA 1XMJA 2PIDA 5TQ2A 3UUWA 3RC7A 3KSDO 1OZAA 1NXXA 2DRIA 4NRDA 3OCZA 4QOJA 4D25A 3PXDA 4O4LF 4RYLA 1BS1A 5KNDH 3RT9A 1S2IA 4FYHA 1YA6A 4Q01A 2J3KA 4N9QA 5FNVB 4YYZA 3KFVA 4ND3A 1SG0A 3OI7A 4WZAB 1DWQA 2AKEA 4PAMA 2DFKB 5EJGA 3LBIA 4YQZA 4MUMA 1YT5A 4LOIA 3B1VA 2VT7A 1AQIA 1UDXA 2EL7A 3L41A 4G86A 4MYTA 3GDGA 2OZPA 3C8UA 3H5IA 2FRDC 2FSUA 3KLOA 3WK7A 3BHMA 4RA9A 3TDMA 3I5UA 2VRWA 4GR9A 4Z51A 2QLBA 1KZ4A 4KRYA 3LCVB 4YCAA 3RODA 3KR9A 2ZB7A 2XMPA 3LSYA 3OZAA 2R96A 3T5BA 3Q8KA 4H7EA 1NP7A 4MR8A 4AKIA 2G25A 4UC0A 1G21E 5C1DA 4FTWA 5AW4A 1PS0A 1W9HA 4HXYA 3E61A 2A0KA 3NHLA 2VXYA 4KO8A 1U3FA 3TW4A 1T9KA 3AFNA 3BQ9A 4OYRA 3TUIC 5KNDA 1Z56C 4ATNA 2OL4A 1XZNA 4NPAA 4LECA 3W5IA 4IGKA 5LR6A 4HWKA 4JGIA 2XMQA 1RPTA 4DIEA 4Y1GA 5LU8A 3UC9A 3KJZA 1RAGA 1G2IA 1WD7A 2X8WA 2L17A 2BMJA 2QY9A 3M9XA 3HUEA 4ZJZA 4OYLA 1UJBA 5JR3A 1PT5A 4UDOA 5BY2A 1RS0A 4BOYA 3MNFA 5HMLA 1CUIA 1JAZA 1JQEA 2D4HA 2YUIA 4JJZA 1AQLA 3AVYA 2C2WA 2ZU0C 3GD5A 3T4EA 4R31A 1KFCB 4RCZA 4Y9RA 3BL8A 3F47A 2C5AA 4N6NA 5GOZA 2VWHA 3KD2A 1VYTA 1KI3A 2OORA 1ZDMA 2ZRPA 3HNRA 1EWKA 2BSQA 1GU7A 1K6XA 1O58A 2BD0A 2DZDA 5FOQA 2RGNA 1TJ5A 5KOJB 1PVDA 2HBYA 1VP9A 2IUFA 4L4UA 4BO9A 4L16A 4O3FA 5D3ZA 1YVPA 1F7UA 5THQA 1RCFA 1RMYA 4D4MA 1P72A 1A9RA 1NF2A 2BGUA 2HAEA 1P0MA 1BMDA 2X1LA 3PEUA 4HQ0A 2JAXA 4Y7DA 3R74A 1RLIA 4KR7A 3W5AA 3LUFA 4GM1A 2MYUA 4LQCA 3UK1A 2OORC 3WMXA 4IL5A 1W52X 3CY6A 2CUKA 4M99A 4TMFA 2HDWA 1KYTA 1PD1A 2RGNC 4B76A 1IEVA 3ZE9A 1RLJA 4MDEA 4JLSA 3UO8B 2WNIA 4ZCLA 5JNRA 3AVUA 3CVYA 1GPNA 3DXFA 4PCLA 4ERXA 2DOKA 5ENZA 2IDJA 3IIKA 4MB2A 5CK4A 1W4LA 2EF0A 2G80A 3PQ5A 1KERA 4C3ZA 5EKTA 5HK9A 4WESA 1NBME 2CK3A 2JFGA 2PK3A 3MM4A 4K6OA 4FFRA 3ZCUA 1E2NA 5K03A 4QM6A 2EGHA 3G49A 2WHYA 2C2ZA 2Z2KA 1ISPA 5A0FA 3RROA 2HJSA 3E9RA 3UKOA 3AG6A 3R5KA 3WIOA 1T8WA 1Z5GA 4J4HA 1ZMTA 2ERYA 2JIOA 2Z9DA 3JRXA 2EJWA 4Y9TA 2O5VA 1E1CB 1YH3A 1BE8A 1L4LA 3DW1X 1AQJA 4UTXA 2ISQA 4QM7A 1E1QA 2P62A 2W71A 4BEBA 2DF8A 2EWWA 1GCAA 3TQCA 3VPAA 2RGBA 4LRUA 3RGGA 2P91A 3K2BA 3BMQB 3FPFA 4QEKA 4YHHB 2GZRA 3C8MA 3IPCA 2B69A 1QWSA 2QR5A 2MJLA 4I6GA 3JASB 2XNCA 4RVUA 1BHSA 2RE8A 1KPHA 1GYRA 1J5PA 1M8FA 4CUJA 4HQLA 1Q77A 1S7CA 2HSEA 1E8DA 2Q07A 2R84A 1AQ6A 2VPPA 2NPIA 2EEPA 3GFTA 4KJXA 4NENB 1Y4DE 5JCJD 1HURA 4R1TA 2WI8A 3HZRA 4BLOA 5JZBA 2O07A 1U2DA 4DKXA 3NNSA 4IVPA 4OFZA 5DM2A 5JATA 1D2HA 4MI1A 3USES 4F6CA 3DBHA 1I2CA 4CMCA 4B3BA 3K5WA 4IX9A 521PA 1GKIA 3Q2IA 1P9RA 1DE0A 3VYWA 3TVDA 4EG3A 2WKPA 4ZJUA 4XDHA 3A6GA 5AVVA 1ZZGA 2YIJA 2EJUA 1YJQA 5BVGA 8AT1A 3DR5A 5COBA 1HG0A 4WEOA 2OWEA 2HWUA 3VAAA 1HORA 4YCSA 4CDMA 2DQYA 4TLMB 3T0FA 1G5QA 3DMFA 4A03A 2GTHA 4BNMA 3MTDA 4ENRA 5EPUA 2VUIB 2Z2XA 4BZXA 4KIUA 3T8YA 3VU0A 3RW9A 2V7UA 2J31A 2AXEA 4PRLA 1S1MA 1AZLA 1R8JA 1OXSC 2O0MA 3IBCA 2QBYB 4JJ8A 4UOEA 2QWXA 2HSDA 2OHGA 3HFGA 5EWJA 3RKRA 1VIDA 2C5FA 3K8YA 2C4NA 3JARA 4JU9A 3AKYA 4Z3DA 5K8CA 1HEYA 3CG0A 1XMSA 1SPBS 4A8JB 4XI9A 3VOSA 2J0QA 3C3CA 3P2YA 5EQTA 1Q74A 5DHSA 3KE9A 3L1KA 1QU3A 5JEEA 2B2CA 1E69A 4YJ3A 4EVSA 1C9DB 1MAUA 3E9DA 1WABA 5I4CA 4PQYA 2P40A 2Q29A 1YA4A 5G3ZA 2BP7A 1LS1A 3NVMB 1GZHB 1OU0A 3T3EA 2DB3A 4HMOA 3ILYA 3A1WA 1MX1A 5IW8A 3T0IA 1M72A 3RVDA 4ZMRA 5H3LA 2C5SA 1OPRA 2NG1A 1GILA 3OUUA 4I6EA 4W5JA 4BBZA 1E3WA 5JQGF 1ECPA 2VP9A 4D9JA 4UXJA 2FEWB 4HGOA 3G9TA 2X4LA 4FR5A 4M37A 4ZQEA 2BF7A 1EINA 1GR1A 1Y8CA 1C3EA 4RVSA 1ESNA 4WZBE 1GUYA 2NVOA 3O74A 4N49A 2QAGC 1WWKA 5TGZA 4I50A 4S0ZA 1G2OA 1FDTA 3CZPA 3IA7A 4AUMA 3N3BC 3M9LA 3MZ0A 4XARA 3S2IA 3ZEIA 2WVGA 3PFBA 4ZQBA 1E6UA 3PFHA 4P53A 5EWLB 3AUJB 3IO3A 3ASUA 1S7GA 1Z45A 1VLVA 2I2XB 1BN6A 1DRVA 1YHNA 1Y3BE 4OK6A 1W1WA 3V1YA 3C74A 4WADA 4Q9DA 1ZCZA 4KCGA 4Z8XA 3SHVA 1KI8A 4NHEA 4B3HA 3USZA 5A1TA 1NP6A 2IE0A 1CVRA 4KXMA 1XJ5A 1JEQA 1KARA 1WXEA 5DCUA 1W2HA 3FMIA 1PAUA 2IDKA 3JAWA 4U2FA 3G59A 4UATA 1LSSA 3MD0A 1TJ4A 3M6WA 2Y0CA 2ATVA 3B2EA 3L7CA 1SU7A 3QUBA 3WP0A 4B3RB 2O8CA 3P9KA 2M98A 5F9MA 2VYND 2QN9A 4L8LA 3GX1A 5IJ9B 1WLYA 3PNMA 1E2BA 3A0RB 4PRYA 4JKYA 2Q1XA 1LBTA 3IAS1 4P6VF 4D7AA 2O2ZA 5AKYA 3LQRA 1W36C 4Q3AA 1N1DA 2QJWA 4JUFA 3SHTA 4OHBA 4COKA 5AKIA 1YVEI 3ON5A 4KSBA 3ADBA 3U7RA 1XJQA 3VO2A 5J4HA 5D5QA 4F3NA 4MV7A 4NHOA 1GNPA 3FMOB 1P0FA 1PTJA 1T10A 1S2DA 3WFJA 5SY9A 4R1OA 3TO5A 1QLWA 1XLTA 2HX1A 2ZQYA 5D2CA 4YRJA 4ESEA 3UANA 1XAJA 4C30A 2GPWA 2O8FB 3BWVA 5WRFA 3E1KA 4LDQA 3OPYA 2QDKA 2HHHB 3UXMA 3ETDA 3NUGA 1JIVA 3DCIA 5LL6P 3PXUA 2NM0A 3PF9A 3CNEA 4C5AA 2NSLA 2P3SA 1KDPA 1PLLA 1PTJC 2YWHA 2CVPA 1U0TA 1XQXA 4UBIA 1XLTC 5CNMA 2NYRA 4CZ2A 2HT6A 3GLFB 1O94A 3IQXA 1SURA 3LUAA 2FV8A 2P9CA 3MWKA 3L6EA 1JWBB 1DL5A 2VNKA 4FFBB 3UN1A 3VPXA 2FHPA 1E2QA 3ZJ4A 3IE2A 5K8IA 1NYRA 1HQDA 3ND9A 1F0NA 3QKUA 3OOJA 1T9AA 4QARA 3I5YA 1UCFA 3AILA 1GUBA 1IBMB 1KK2A 2WKRA 3QF4B 3RO7A 4C7OB 1FFBA 1P62B 2BFPA 2FVXA 4G37A 3UVEA 1JHRA 3F3SA 4OUDB 4WOBA 5AHOA 1O0SA 1WDTA 3ZZ0A 1BOOA 1QMGA 3C3XA 4GKAA 1AVTA 2QN3A 1CR4A 3AEQB 3I2KA 1SVIA 5GONA 1GARA 1XP5A 2WY2D 5FPKA 2H2HA 1W2WB 3A6PC 2PXHA 1Z0DA 2DHDA 1CJUC 3D59A 1Q16A 1MOPA 3ZW7A 1FNDA 2C04A 4ND2A 4NFLA 1QYDA 5H8WA 4F45A 1Y5IA 3G0HA 1E63A 1AG9A 1OA0A 2CBZA 2VJQA 4CG3A 2PSSA 3UMCA 1T9ZA 2X0IA 1DKRA 6ADHA 4WPGA 4CQNA 4CWAA 4JYAB 8ABPA 1IOLA 4MLZA 2WAYA 4BVGA 3R5JA 1K4KA 6PFKA 3AETB 3A6HA 2W42A 2WOOA 4RPCA 5KU7A 3OJFA 4GZMA 2PX2A 4E2FA 2AI2A 1GLNA 2LE0A 5EIBD 4OIFA 1QQAA 1NW4A 2G1AA 3EDRA 4MS3B 1EK2A 2WTEA 4M22A 2RH5A 2R7KA 5EFZA 5F4ZA 3CEPB 3VTFA 3WHPA 2R6DA 1WUTA 3L82B 3EEFA 2N42A 1W46A 2VPZA 3CNOA 3IC5A 4IEIA 1Q44A 3EYWA 3QE2A 4GMXA 2ZRNA 1R6UA 1K2WA 2FF5A 3IEUA 2EDAA 4Q6WA 5DTJA 1EX7A 5C18A 3ADCA 2BONA 5KNLA 2QIOA 4L50A 3LT0A 4B6FA 1XTUA 5BUCA 2VUUA 5JW6A 1AB5A 3K5IA 1UDAA 2FG6C 1NUAA 1A5TA 3KK0A 3TUJC 1F4LA 4ERNA 4DJAA 1VJTA 4H08A 1JHAA 2G5CA 3SKXA 1S8NA 4AZ3B 4GMKA 4AMZA 3GNTA 4ARBA 2CWWA 1V11B 3M6UA 3QX7A 2PUFA 2R7LA 4A91A 4P4LA 4HDAA 2XUJA 2IRWA 5SZKB 4U5XA 2O2SA 2HCBA 4OI2A 3EUFA 3T7EA 2HIGA 2X9GA 1FRFS 2Z04A 4WLOA 1JDTA 2HDOA 3G8YA 1K88A 4TWAA 5IT9A 1S4QA 1X8KA 1LVUA 5G02A 3NU1A 2BTQA 4ZOQI 3JQGA 1NJ1A 1PP4A 2K6GA 3K0EA 3R7SA 1JR3A 2FPSA 4OSEA 2JS7A 4EFDA 5CA0F 4S35A 4V3CA 2V7QA 3HA7A 3ZWCA 1E64A 3FLBA 3B48A 4ID3A 5K3CA 3TDNA 1QDUA 1YHYA 4RANA 3NTQA 4QAJA 4COOA 4ZEMA 1XHLA 3JATB 5CFOA 5KX5A 2IS4A 4QFDA 1WMEA 3T9AA 4LMAA 3E7XA 3L7IA 3TKYA 2Q1SA 3FUUA 1QO7A 3CMMA 3ZPXA 4UHDA 4C5BA 3VM6A 2GPSA 2Z4RA 2PZEA 1KOJA 2PX3A 4UULA 5K51A 4BKPA 4S1VA 2HA4A 4ENTA 2BPOA 3I9OA 4MRSA 1GHTA 3KDPA 2X8BA 1QHGA 5BSEA 1KMHB 3E5MA <