2P6MA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDMPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2p6mA00
4MA4A 1K6MA 2HPAA 3QPWA 4D4JA 3MBKA 1DKMA 5AJXA 4EO9A 2AXNA 5CX4A 3FDZB 4PZAA 3QPVA 1E59A 1DKPA 4GPZA 3EOZA 3IT1A 2H52A 1BIFA 2F90A 1EBBA 1NT4A 2ENUA 3LL4A 1IHPA 4ARVA 4PZ9A 4D4LA 2P79A 3LG2A 1XQ9A 3O0TA 5PGMA 2YN2A 3GP3A 5AJWA 2P2YA 1H2EA 3E9EA 1QHFA 3C7TA 5AJYA 2EKZA 4JODA 2A9JA 3FJYA 1CVIA 3DB1A 1DKQA 1YFKA 2OWEA 4PGMA 2H4XA 3EZNA 1RIIA 5HTKA 2ENWA 1QFXA 4ODIA 4IJ6A 2OWDA 1BQ3A 1SKBA 3MXOA 2QNIA 2PA0A 3IT3A 3KKKA 3NTLA 1BQ4A 1UJBA 3D6AA 3R7AA 2HIAA 4D4MA 3LNTA 3IT0A 5AJZA 1V7QA 2P77A 5CU7A 1RPTA 1SK8A 1C80A 4AROA 3K4PA 1DKNA 1E58A 1DKOA 2DWOA 4QIHA 2RFLA 2EKBA 2EOAA 5HR5A 3BIFA 2GFIA 3K4QA 4IJ5A 4TSRA 2P6MA 3F2IA 1RPAA 4JOBA 4EMBA 2WNIA 2I1VB 1FBTA 4ARSA 3IT2A 3OI7A 2BIFA 4ARUA 5CDHA 1DKLA 1SK9A 1C7ZA 3GW8A 2P6OA 4HBZA 5AK0A 2A6PA 2H4ZA 1ND6A 1ND5A 1V37A 2YN0A 3FDZA 1H2FA 2DWPA 1FZTA 4FDTA 2P75A 2WNHA 1SKAA 2H0QA 2P2ZA 4D4KA 3GP5A 4FDUA 2P30A 2P9ZA 3D4IA 3NFYA 3DCYA 3PGMA 4GPIB 3ZHCA 2HHJA 2P78A 1C81A 1YJXA 3E9CA 4JOCA 5AJVB 3F3KA 1T8PA 3QPUA 1TIPA 2P9FA 3HJGA 2WU0A 1UJCA 4E3WA 2P9YA 1QWOA 3E9DA 2IKQA 3D8HA
chains in the Genus database with same CATH superfamily
2XDWA 1QG6A 1MO5A 1W4CA 3GVHA 3W5BA 4CLRA 2W4IA 3ZDZB 5M2QA 2GPYA 4G01B 3TDNA 4LF8B 3SNKA 2WWHA 1VKNA 2V0GA 2EFCB 2W9XA 4EPXA 1KOFA 4UZEA 3SQWA 4CL8A 1RT9A 5G40A 1PFKA 1VE9A 2NU6B 2QTTA 1O08A 2WKWA 3HKDB 1CF9A 4D9GA 4DMHA 1H6CA 3KB1A 3O90A 3Q0EA 1B42A 2ENUA 3S5UA 3UAVA 3K73O 4D8VA 4BO7A 1G21A 1EK1A 4Y0VA 5ESRA 2PANA 3DVSX 3TBFA 1N1GA 3R1IA 1UL1X 5AI8A 1P5RA 2BEWB 4FGKA 5DBHX 5AR1A 1XVTA 1OFTA 4A92A 2A4MA 1JFFA 1IZZA 1XDBA 2GCPA 2WSMA 3GYBA 4BBZA 1I6MA 2FMHA 3HPRA 4B5KA 4BFLA 1IB6A 2GHQA 2CNOA 2E3JA 3O9MA 5KDLA 2O7VA 1ZVVA 1IWOA 1IATA 2QXYA 1KH1A 4LDAA 4NAVA 4V3CA 3WYNA 4JSYA 4BE7B 1V35A 1BOFA 3UXMA 2AF3C 2OAP1 3ESDA 1X7GA 4ALJA 3DLBA 3H4IA 2ENWA 1YS1X 2ZTSA 3CVOA 5FWAA 4J4BA 1V96A 1W46A 1H8ED 1UC5B 4E4TA 3JRXA 4FZVA 2XOKA 4IAOA 4MDEA 4YRAA 3M4YA 2A9KA 5JECA 1O5OA 2RG7A 2VAWA 1T3SA 5IJWA 2PUBA 2QJRA 2J45A 3LQQA 3PQEA 4C78A 5FYDA 3PQ5A 3B6JA 4EITA 1PCXA 3HYTA 4R41A 3SQMA 5JJCA 3AR4A 4FCWA 4MUEA 3GBPA 4Q39A 5BSHA 4JUCA 1T4CB 1SUEA 2GD1O 5T4EA 3FKJA 3D2CA 1CUEA 4JIMA 2FFQA 3A36A 2EARA 3F74A 4NJEB 3CLUC 1AK9A 2ZS9A 1IUPA 2ZBVA 3PJFA 3QVOA 4IMPA 1UZAA 2X7XA 1N1MA 3LYHA 3SCZA 2O3UA 3MT0A 5DFAA 2I8CA 1SR8A 4J7UA 4CM3A 3AHEA 1B3BA 4M1ZA 4NH0A 2VTEA 2FTKE 2A5JA 2YIJA 3O93A 4YBRA 4A6XA 2NZYA 3BDIA 2HTFA 3WGKA 1SM4A 1QDUA 4DIFA 4C03A 3V34A 4PSVA 4YJFA 1EVLA 2NXWA 3FVRA 2ZIFA 1E1NA 2AG6A 4MKXA 1Y9AA 2MIIA 1Z2NX 4P0TA 1DFHA 2GVDC 2A67A 2WJPA 2WT9A 2HT6A 3I34X 3LX8A 1AS2A 2JRLA 3JZMA 5NLLA 5M04A 4MKRA 3PIDA 4J6FA 3GLFE 4LZAA 2VSOA 1NLMA 2OCDA 5L7WA 3QXSA 3HRHA 1EAYA 3SYRA 4N5NA 2VR1A 3WLLA 3K0EA 5LB4A 1VG1A 4GVXA 2NZ8A 3DEFA 3GF4A 1KEVA 3V2UA 2UYHA 4E5MA 1YL7A 2RK4A 3BMNB 3GZNB 4KR9A 2P4EA 1U5AA 4F7WA 2AZXA 1JT2A 3SDBA 1T1EA 2DHQA 1G2OA 1M1NB 1N0WA 3DOFA 3NR2A 4F9EA 2CF6A 4BYMA 4V0LA 4F84A 2X8JA 2ZLBA 3QHPA 2OCYC 1H4QA 4W7IA 1DP4A 2IIVA 1PJ8A 2W2QA 1ZG3A 1KI4A 3L7LA 4BGVA 5KQGA 2ZM5A 2J9ZB 2AF4C 4OV6B 3AI3A 1ZUNA 1RQNA 3E9QA 2V98A 3REQA 5KZMB 1SZCA 2ZAMA 1S9HA 1UINA 4B4UA 2CDCA 2PMDA 2VRCD 2XDQB 5E4JA 3WMFA 3ZTYA 1T5IA 4D97A 1Y6RA 1ZESA 1AKUA 3OA2A 1QGED 2ISCA 3N7UA 1U2ZA 2VJAA 3F8SA 1DXQA 2C4HA 3HNPA 3U3RA 1JG1A 2O57A 3USCS 4CCSA 2IP2A 1S2DA 3QXJA 3E7FA 5CDYA 1ZBDA 3UXEA 4JKYA 4E88A 3U3XA 3WIUA 3HB4X 3E8MA 4K6GA 1GKUB 2X42A 2C5EA 4CV2A 5AVTA 4A5SA 4LZWA 3GOHA 1YBAA 3EJ6A 3B78A 5EKXA 5EESA 4KKXB 1C3VA 3FIJA 1WETA 1G21B 3KOZA 1TVCA 5EMNA 3REGA 1IEXA 2Z6VA 1XDWA 4EP1A 5JD4A 1AMNA 4BU0A 2FOIA 2YQZA 1QV9A 1AF4A 2XIJA 1SUDA 2JVKA 2ZJZA 1LPPA 2CD7A 2VYCA 2AOWA 2ZANA 4MRSA 4P4SA 3W8NA 3EDOA 1VCIA 4ENVA 2XZOA 1K2WA 4DIEA 3IDOA 5EWMA 1GPLA 1NV8A 1Q0RA 2QMYA 2WJIA 3CBQA 3KE8A 3O4RA 1VGRA 4HQKA 1PEKE 3SYNA 1AJEA 3NAZA 1E1YA 2HF9A 1THTA 5CTAA 1PQ4A 3GNTA 4INPA 2ZYDA 5DT2A 1JALA 4M83A 1C3XA 2OBNA 1WUKS 4B0OA 3T1YB 3ME5A 3QF4B 4IIJA 3SC3A 1CV2A 3CZ4A 4NYMR 2YHBA 3AP2A 4HEA6 2POQX 3EVAA 3JY6A 1BJTA 1Y1QA 3PX3A 4IV0A 2Q0HA 3K1YA 1XELA 5AK3A 1LSJA 1Y9ZA 4QUBA 1CIPA 4TUYA 2Y0EA 1BHSA 2NQ8A 4WZAA 1LNZA 4NV0A 4MKGA 4QJ4A 5FI1B 1NI4B 1QAOA 1PGQA 2SKCA 3I5MA 4LGYA 4PTLA 1CY0A 3QY0A 1NBMD 3LDAA 2XKKA 2J5XA 2X0JA 4GWGA 2M98A 1I9GA 3NJ8A 4L9AA 1B3RA 4YVFA 4EYOA 3H8WA 4HLUA 2OBYA 5HGXA 4GOLD 3W5UA 1C3OA 4MUYA 4N5HX 4EKYA 3HUDA 1CZOA 3L6CA 4G89A 4Q9JA 3GLGA 1E6LA 2QDKA 3C4JA 4ARAA 1BE8A 2B8NA 1OU0A 3E8XA 3WISA 4HVAA 1FMFA 5AOBA 1AOXA 3N58A 1ZOOA 3T5CA 1B23P 4G1CA 2Q9BA 4XVRA 5GIOE 1GG8A 3AYXB 4J9UE 1XQWA 2Z83A 4IINA 3ZWKA 4BMPB 1TM2A 4BNVA 1U9JA 4LXYA 2OO5A 3NAQA 5DYIA 1UT5A 3QITA 2FLVA 3SNHA 1GUBA 3T1OA 2HFKA 4ND6A 3LZ6A 5D01A 3QE3A 4PAWA 1XP8A 2R8BA 2P8SA 4BMSA 1N6RA 3CZCA 1FMCA 3MTBA 3COYA 1E4OA 2LNDA 2O05A 1CEQA 1W36B 5KYWB 3ISVA 1SU6A 5A04A 1DX9A 3IOEA 4BC1A 4QEDA 1TK9A 3G5UA 5ICMA 2A57A 4NE9A 2XE7A 3D8BA 3WGZA 4YAIA 1TOAA 5KTNA 4RMIA 3R0QA 4WFJA 2ZCVA 3L7OA 3W0LB 4DCUA 3E8SA 4YPVA 1M34E 2G80A 4FGUA 4HQRA 4Y30A 5AKIA 2SNIE 5ALRA 1KGDA 1L7OA 5IK2A 3QYFA 2OHHA 4QREA 4UU7A 4TTSA 4XD2A 3MMZA 3VVCA 1OKKD 2QIPA 4UEWA 1G5HA 3GGSA 3GFRA 5GJVC 4JVLA 5LCXA 3C3DA 2DHRA 4L2IA 5E6SA 3ROEA 2JAUA 3AHGA 4M1OA 2ECQA 3I2KA 1DPFA 5H81A 1MC4A 1ULTA 4H17A 1UKBA 3QV1A 3A1UA 1QCYA 1LPSA 4N49A 1BDIA 4P4TA 1TDJA 1BMDA 3MTQA 3ORQA 4YDQA 5FPYA 1B4DA 1XXHE 1E6CA 1MA3A 4GD3Q 4HNRA 2NU8A 1NL3A 1IZ7A 2G1UA 2FK7A 4GBGA 2P9JA 1SBNE 1TCAA 1WO8A 3B2QA 4Q18A 1IJEA 4HR7A 5AW0A 3SQNA 4C7JA 1IUKA 4L57A 3BWEA 4MUFA 2PT7A 3NAMA 4P7KA 4RLHA 5B58C 3L0IB 1SOVA 2HXYA 5T8KA 4TXHA 1ODLA 3OF3A 3FWHA 1JJ7A 1VIVA 4TQ9A 1O9GA 1XEWY 2ZJ1A 4X90A 1NLUA 4EUSA 1XQ6A 3SEQA 2R6DA 3S70A 4AKIA 2VJPA 3M6AA 4P4SB 2VP4A 3AERA 4YASA 2GD2A 1OTXA 1D2NA 1HDYA 2ZK7A 3TIVA 5IVIA 4C2TA 1CFJA 3OU6A 1XAHA 1L8AA 2VIIA 2VF8A 2J3HA 3HCBA 3HGTA 2JD1A 2NU9B 2I9KA 2O59A 4TZKA 2B92A 3IR5A 2FSHA 4GP9A 1L5LA 2VSXA 2X8LA 3MCTA 4WV3A 2ZJ5A 1R5OA 3VI3B 5JISA 1PS0A 1MAWA 3KSUA 4DWOA 4EY8A 2W6IA 1M6WA 2J48A 2XB9A 3Q87B 2HLDA 4CF6A 1HTWA 1XVAA 1Z0JA 3WGYA 3AI1A 2C57A 1YIDA 2OD7A 3MHPA 5K8JB 4BWGA 3EVCA 5HDBB 2IDMA 2JH8A 4KMMA 4TUYB 4ENWA 3EIQA 1FDRA 3GROA 1E3LA 3ITNA 5DKFA 2JJYA 4FSDA 4HGOA 4QYXA 3SHTA 3VR5A 3DBVO 2WMDA 3CIFA 2C2ZA 2OVFA 2ZSAA 4AL4A 3IP1A 2C5BA 5I7HA 1MXFA 1MHTA 4BUZA 1PR2A 2YL2A 3G7SA 4Z9YA 4ARSA 3WZLA 2ZJYA 2YV1A 3H1PA 3CEPB 4UU8A 3RJTA 4HB3A 1NUQA 5FJJA 3TLGA 1AKQA 1C3OB 2R7MA 2IGBA 4IJWA 4A26A 3GLGB 3PFGA 2YOFA 4RCZA 5TGDA 1KZHA 2HHCA 1SIWA 1ZOLA 1RKXA 1EDBA 1JEQA 2J09A 1ZCBA 3ICCA 4KO2S 4PYMA 5DGDA 2FX3A 4HUQB 2Q1SA 3SEFA 3C2QA 5EJ9A 2QTMA 1SUWA 4B75A 4L3WA 2R2GA 2JVIA 2Y4OA 5CIQA 4I6EA 2LR0A 1A72A 2C9ZA 4BLSA 2WM3A 5EOVA 4HZUB 3VPXA 4LG1A 4MRMA 2GDJA 2HHJA 3SS7X 3CLHA 2QY9A 4FZJA 4EYEA 5LKAA 2QTGA 5BN5B 4YRCA 2ZAOA 1WW8A 3SMQA 4YCSA 5A3JA 4E3ZA 3O3MB 4X7MA 3VJMA 2IXAA 2QLMA 3CMMA 5AVQA 2P1RA 4LTDA 1TIKA 5JDIC 2KS6A 4R2MA 3IE0A 4GZ3A 4QWMA 3SF0A 5K0CA 4DJDC 1Z5WA 1XYGA 3L0ZA 3INGA 4EQZA 1QJCA 2D1TA 1O5TA 6ADHA 3OICA 2DUJA 1F5NA 2UV8A 2V7PA 1LZKA 3NWOA 4ZC8A 4BTVA 4DIOA 5IUNC 4KMSA 1BE6A 1N2IA 2W8BB 1B26A 1UJ4A 2AXNA 2WG2A 1VPWA 5A5FA 3QLUA 3P94A 5KNDD 3CR3C 4N7MA 2SECE 3V8EA 3LYAA 1WSWA 1W73A 3PITA 5GPBA 2QAIA 2DBZA 2PSEA 1X7XB 2YIDA 4FQ7A 4IQ8A 5E6SB 4OAQA 3LE8A 1XZIA 9GPBA 2DPMA 2IGTA 4MA0A 3SF8A 3ZZTA 1ZN7A 1EEXB 5FPSA 3DTVA 1V3QE 3G68A 3DKRA 3BFXA 5TVGA 3BEOA 3BERA 3C7TA 5IARA 4MARA 5DNVA 2XT0A 2P3QA 4P3OA 1FFYA 1RADA 2ZRIA 2A9JA 1GA4A 1LLQA 3BDVA 2ZI4A 3EB9A 3CT4A 1BDHA 1OW3B 2BTOA 3D3JA 2VP9A 3A05A 1U7XA 3GL9A 3R8CA 3VFDA 3PGKA 4KO3S 1ZN2A 3USZA 4A15A 1HFKA 1CUSA 5CXQA 4JMLA 4OB6A 3Q3GE 3AG5A 3UO8B 1HK7A 2O8NA 3QU5A 4WK2B 2FE1A 4DV1B 4RW0A 3A11A 4BE9A 2H31A 2HJHA 2J85A 2WW8A 3BRWA 3AYZB 2QT0A 5DZSA 3SFZA 2P11A 4HGZA 5A6SB 1CS0B 2JZCA 2ZRFA 5CGQB 4BMYA 2HUNA 3UWPA 5AJZA 1D1PA 4EQ6A 3PKIA 4O4JF 4LV6A 2P9GA 2A33A 2X8WA 1Y9EA 4P2BA 3B1KA 3VDMA 2HQBA 4OEHA 4GHWA 4RDHA 3N2GA 2X77A 2GLTA 4HO1X 4RYLA 5EFOA 1L5HA 3TQQA 4DV5B 3LOPA 1G7CA 4EJSA 1RWBA 4XM0A 3PFFA 5KHOC 1JFVA 1B6GA 4A16A 1JEEA 3C3CA 4FK8A 1RYBA 4QGAA 3JSAA 4TT3A 1M7HA 1SOAA 2H18A 2X9NA 3CV3A 4GVLA 2VYVD 3BIFA 4PG6A 4S0XA 5G3ZA 4LC9A 5KWVA 1PFGA 3GLIA 2AX4A 5JO9A 3IOYA 5BXYA 4BBPA 1V8FA 2RGBA 2QTAA 1GXSA 3HYCA 2JA2A 4TMVA 1JA9A 4H18A 1Z4IA 1O8CA 2DJIA 3AKCA 1T24A 3M5CA 3RSCA 4CV3A 4EPTA 3E03A 2CNKA 3I23A 4B83A 1DRKA 1P45A 1T0UA 1ULBA 4H15A 3EF0A 1A8UA 4H4CA 4A0GA 1NVBA 1M33A 3DNFA 2X9VA 5EGSA 3EPKA 1H85A 1K75A 2K7ZA 5F2NA 4O1IA 2IZ1A 1N6IA 4GEKA 5J2UB 4O02B 3RQSA 4P3XA 3A27A 3RS7A 1WP4A 4E12A 3FBGA 1OA1A 2PL9A 4WECA 1XZQA 1HQKA 2A7QA 2HMSA 2P9ZA 3C8MA 3D4IA 4HLNA 2DGDA 1YCFA 3JTMA 5CFOA 1IY9A 4QRHA 4GKKB 2X6RA 1TKBA 2KYRA 2A0WA 4W5WA 3UJDA 5KWSA 4TRMA 2N47A 1JBEA 4RPLA 1OXUA 2X7JA 3F7TA 1C9YA 2GCOA 2PGNA 2VRBA 2Z56A 3O94A 1GT91 1P8JA 3WOVA 2VAVA 4BAZA 4I4IA 3GJSA 4MEBA 4EVSA 2NO5A 4WCFA 1PL6A 1ICEA 1Y1TA 4E2ZA 1JQLB 3WXBA 1L4UA 1PR3A 1OHHD 3NC4A 4F4IA 5CA1F 3G82C 4X00A 3QK7A 1OAAA 2QNBA 4GMGA 2HSWA 2QY6A 4IGIA 2C2BA 1I4TD 4OSPA 4QUDA 4R2IA 4RE5A 1ZR2A 1ZMOA 2J0EA 1KGSA 2Q3EA 5J59A 5C1OA 4IW3B 4KIWA 3ITEA 2ZVQX 2HHHB 3B53X 5JNSA 3EXHA 4ROTA 3IMFA 3DPIA 3W9SA 3ZZ0A 1EWQA 3PICA 5JH7A 2HRQA 5GP1A 2XR1A 2FWJA 3BMXA 3O26A 1KAQA 2CHUA 4XEHA 2ZKLA 5A62A 2I7VA 3N6VA 2XUAA 3EA5A 1DJPA 3ZVLA 4MO9A 5AVRA 3GLRA 1NR7A 1WZNA 5JLJA 2GCEA 1VIYA 4XKJA 5KHLB 2Y0BA 3R3VA 4CG3A 2G88A 3KTAA 5A4FS 5H0IA 1E2NA 3DTVB 3I62A 3OEED 3DNMA 2AFRA 4I14A 4L9WA 1ZDMA 3FOAA 3KM0A 4DANA 4F3CA 1PEYA 1ZR4A 1D9ZA 4PX3A 3I6ZA 2IK8A 1U0TA 3IEUA 4MUKA 2ZOSA 4B74A 2CBZA 1BD3A 3VHRA 2J3EA 5L3RA 5IN5A 3OQPA 1M0SA 2H08A 2Y1WA 5IX8A 2Y1GA 4PTZA 3SX2A 1QIGA 3PXAA 5ECYA 3BWCA 1GG5A 4EGSA 1LDMA 2XB4A 3ZWXA 4TGLA 2IYRA 2G36A 1L7NA 2XJ4A 2ZZMA 4RHTA 4EFLA 3V1TC 4ZI3A 4KN8A 2CLOB 2V7XA 1ZITA 5E4YA 4BFTA 1T6ZA 3OPNA 4PBTA 4ZPJA 2FFRA 1X13A 3T9CA 5A4AA 2I76A 3OBIA 5ITZA 5LQUA 2GKOA 1RVV1 3K6RA 1P4SA 1MC1A 3EVBA 4GRDA 5G4KB 3JR3A 4EQ6B 1WPQA 2Q3JA 1IYZA 1SK8A 2PFGA 2GHTA 1YOVB 3NX4A 3BEDA 3ZN2A 2XUQA 3TE7A 3DW3X 2IOFA 2ERYA 4HX9A 4BS9A 1A9XA 1IN1A 3N2GB 1L5HB 3IUJA 2XHEA 1W9MA 1OXKB 1V5FA 3N76A 3P0RA 2OFPA 4GGPA 1JU4A 2E87A 2CVOA 4JUFA 2WFLA 4N3BA 3UCXA 3KQVA 2V9PA 5FLEX 5JS7A 2V8OA 1NNEA 3Q7RA 3GLIB 7GPBA 4IDAA 2NZXA 5BRNA 3H1GA 1GKYA 3DF9A 3AL2A 3CTMA 4ZO8A 1E7RA 1ZN8A 2V7VA 4JWKA 2DAPA 3SS9X 1CQWA 5C80A 4NCJA 3K9BA 3W6NA 4BO8A 5BVHB 3EPJA 3N5CA 2Q6KA 3JQRA 2C7QA 3F97A 4JEIA 1HDOA 2RK6A 1CDOA 2Z43A 4UOQA 2EG5A 4CQMD 3AKEA 4RDCA 1GGJA 5L7TA 2ID9A 1T29A 1SUPA 1G59A 3K2EA 3TRFA 4RF3A 1NUTA 3WGMA 1M1YE 2DUUA 3C14C 1A97A 3E9ZA 2B1JA 3IODA 4RHUA 3KBOA 4AJNA 3IE2A 1M6YA 1ORRA 4ZYZA 1YRLA 4OPMA 4XUGB 4NHEA 5JQGA 2VSQA 3BKXA 2Q5IA 4O2BF 5A5GA 4NBVA 5K0FA 3BXZA 1F7VA 2BCGY 2QP9X 3UMJA 3PHHA 1CJKC 1TIPA 3WWZA 2BM9A 3A6DA 3GUYA 2Q99A 4RPJA 3KKZA 1E0KA 1RFLA 2QRGA 1G7TA 3W5HA 2VDQB 3D6VA 5TJ9A 3E2IA 3OVMA 4GLBA 4LKOA 1WQ3A 1ZVMA 2CLKB 2O7SA 3FTCA 4XVHA 1B93A 3NIDB 4IVQA 3V55A 4BZZA 3PI6A 2Q2OA 1TX4B 2YMQA 4WXHA 4ZDWA 4JOSA 3OP4A 5DJ5A 2AYZA 4B2PA 4FE7A 3UM9A 2IUFA 1UBGA 1J0XO 5FWXB 4HY3A 1XX6A 2X19A 2XTNA 3BWBA 2FPLA 3E3LA 3F4KA 3KE9A 3LA8A 1IEWA 3EOZA 2PUFA 3EXHB 3EN0A 1RWWA 3Q6NA 3WRVA 1AHIA 5ESXA 5JH7B 1IG0A 5AI5A 2IELA 5JAUA 2W98A 5F7OA 2R9VA 1MEEA 4X1KB 3O4IA 4FC6A 1SQ5A 1T5TA 2XBLA 4CR7A 1QOPB 1TYZA 4R83A 3EY4A 4RD3A 1T5LA 4K86A 1YU6A 3MF4A 3A6FA 1MQ8B 3JR7A 2G0NA 3ETLA 1DQPA 1ZKMA 3KTAB 4KQIA 4LY0A 4Y9DA 1QBGA 3FBWA 3A2KA 4MQMA 2IW1A 1I0IA 3GELA 1MB0A 1LRKA 4DJFC 1GGHA 2Q6IA 2MSNA 2VDUE 1ZJYA 3A0RB 3H6KA 2CXSA 1KAGA 4I3HA 5KINB 2FPIA 5MN4A 4DCPA 2JLYA 4BLQA 2I3ZA 3U6BA 4N54A 3ZDYB 5JW6A 2EIHA 4Q4HB 4RF5A 2CVPA 3EMDA 3BSFA 3T0FA 3M49A 2GAOA 3A9SA 2WLSA 4WUVA 1JPUA 3EVGA 4EDHA 5C7LO 4LF6B 4L95C 1QYIA 1W4AA 3DLPX 3DXFA 3H5NA 3I9KA 4UE3S 1XZDA 3A31A 1W19A 3I58A 5CGZA 3IJ5A 1D1TA 3BJMA 1OT3A 2CEKA 4IHKA 4CTKA 1LBHA 4TWZA 4BVKA 3CY6A 4IQFA 1JTFA 2ZI9A 5EQTA 5F51A 1XRNA 2QP3A 4RH1A 1XVVA 4MP8A 2J3JA 4BWYA 1F51E 1YWGO 5C34B 3VUEA 2Q5CA 4GZMA 3UV7A 2WFLB 4BEVA 1KVTA 2XQVA 1C8LA 1JA1A 1TU0A 3AJRA 3SLGA 2WJ4A 1K7EB 1WJGA 1JVSA 1ZONA 4G0ZA 5K0BA 1KH2A 4ARUA 2R751 3QKRA 4KGXA 4UDNA 4G65A 1T8RA 1D4ZA 2H59A 2PIAA 2X6QA 2WYHA 3BJIC 3HXTA 2R5FA 4NPAA 4P86A 3ZWMA 5BV0A 5KKNB 2H9AA 5JAPA 3HJFA 1MB2A 2PCJA 1JHZA 1VYVA 2YY6A 4EYSA 1GGMA 2GLXA 4P34A 1R6DA 1BVUA 3OQIA 4KR6A 2RAUA 4JQCA 3VYSB 2Q41A 4EW3A 3AMVA 1U9YA 1P2UA 1PYDA 1W30A 5LYJF 1J9EA 4AWBA 1S8AA 1XAIA 2MHCA 3N8NA 4QUJA 1GGFA 3NU1A 3KQLA 2QVZX 5JVDA 3HYRA 4H35A 4UHJA 3HXMA 2GFHA 1P5FA 3K2QA 4QARA 3UKJA 1WNFA 1YZKA 5FBWB 1XVLA 2GRUA 3I9NA 1EI9A 5EHXA 1T6BY 5BWNA 1NC3A 3HEMA 5HF6A 3WRYA 4K6OA 3OPMA 2FPXA 3NT5A 3IMCA 1X7ZB 1ZKDA 2P35A 3H17A 4AF7A 1KBOA 3D0RA 2NZWA 4JKOA 2XDYA 3LJKA 3PQDA 4QFCA 4EKIA 4G1UC 4G97A 4TXMA 5IJ0A 1SVIA 5LR6A 4MCHA 4B6GA 1JR3E 2NUBA 3LVRE 4MR7A 1H5UA 1VL8A 4I50B 2O2HA 4G4IA 2O1EA 2WHQA 1ZCZA 4GXQA 4ZU6X 4AFNA 4NWIA 5ABPA 4IX9A 2H4YA 4F5ZA 1I01A 2G09A 3BK2A 4AF6A 1RKUA 2BR4A 3AZPA 3KHUA 4LI0A 2D5IA 3FLAA 4PSCA 1G3RA 4U2EA 3AIOA 2GEVA 1BMFA 4P93A 1JSRA 4ENPA 2ZUFA 1R27A 4QC2A 3G0HA 1JG4A 4Z0TA 1VCMA 3THSA 4GLFA 4CL0A 4TYQA 2ZYGA 1Z12A 1H66A 3HH8A 3GFBA 2BGTA 1Z08A 3Q5EA 4FHGA 4KXMA 4YRTA 4ZQBA 4J6EA 5DNUA 1AX9A 4AY2A 3DAYA 5F1YA 1SCQA 2R4UA 3JZFA 2YIMA 4PSKA 4PFJA 4KLNA 5FORA 1DCFA 1ACJA 3R5XA 1K3TA 4F4UA 4Y2QA 5FOQA 5A05A 4PTYA 3IUMA 4JLJA 1KRHA 1XMVA 2Y1XA 2PRYA 4MPTA 2RG1A 2WEKA 3L5OA 3LPDA 5AKJA 4XSHA 4C0JA 1D03A 2YRXA 4D79A 3GEMA 4KXNA 3PEWA 3GRUA 1F2UA 1LB1B 4IR7A 5E3HA 2AZMA 2FPIB 4AMZA 4RKFA 1G20B 2RI0A 4IMRA 3EMKA 1NR5A 3LC2O 1XZBA 1V25A 2QL7A 3AEQB 1QIEA 5DTQA 3MAJA 4NP6A 3BXFA 4OXXA 3QMVA 4QQKA 1XL1A 2AI1A 2ATEA 2BHSA 4DCCA 2J0UA 2I3GA 2A5LA 5G0TA 1UFOA 1O9HA 4OYHA 4HN9A 3NKLA 3PT9A 1DKOA 1Z0UA 2Y0CA 3GFOA 3SAJA 2DMRA 3TX2A 3UJ9A 1N0VC 2VQ6A 4ILEA 5E3JA 1QIIA 2PUWA 4AO6A 2JFUA 1K4KA 4R2WA 1Z17A 2EW8A 3GUCA 1NAHA 4ASUA 1W1WA 3ENQA 2C5FA 1O87A 2VAXA 1NYRA 3L0OA 4K46A 2AN4A 1SUIA 4J49A 3UYKA 1Q2XA 4RF4A 5AP9A 2IHYA 3VKGA 2DFLA 5EINA 1QMPA 4I1SA 4HP8A 4BUCA 1E1RD 4PC1A 5C46F 1G8AA 2WR8A 1SXJD 4KYTA 1GFIA 3IPRA 3QKRB 4KDRA 1KR2A 5KJ6A 2H4ZA 3SC2B 4CGZA 1QO0A 1QFJA 3IEVA 2C4NA 1EX9A 1UPXA 3GDWA 4IV8A 4N5IX 3RR2A 4QM7A 5DBGA 4FDTA 4JJEA 1R18A 3E5MA 4WRRA 2VLIA 1NULA 1TMGE 4I9HA 3LTNC 3MWGA 3SHOA 2FY8A 1AA6A 4EOGA 3UTDA 3RC1A 1QTNA 1IN4A 3ZNOA 2ZRCA 1Q91A 1RU3A 2MR5A 3PE4A 3SN6A 3W2EA 3ZDEA 4DSZA 4LHXA 1IL0A 3S2SA 2P65A 3EYWA 3TR0A 4Q9NA 1YI8A 1ZMTA 2WVAA 5JVDB 4KPFC 1DO2A 4JB3A 5LP1A 2WOOA 2ORVA 1IDN1 1A98A 2QA5A 3NOOA 1VRVA 5DBOA 4DT1B 2JGLA 3M6MD 5KNCH 3QNMA 5KX5A 2GRJA 4J0GA 1I3CA 5DN6D 3U31A 3EULA 4FLEA 3UCFA 1U0EA 1HFJA 1AF7A 1WXFA 2DCUA 2I6QA 4OKSA 4JYZA 4BLPA 3VTZA 5I9TA 3TJMA 2Z6AA 4KREA 2ST1A 3HU5A 2C5HA 1XWFA 4INAA 1F48A 1MGPA 4YJ3A 4A03A 1TVMA 1R0CA 1QP4A 1UWCA 3U7IA 721PA 5JEDA 2JIOA 4J1TA 4BGUA 1YS4A 1Q7RA 4MR7B 5HM8A 1M83A 3PQ3A 4GPZA 4MW7A 4DPKA 5JJLA 1GL9B 4UFPA 5BPHA 1R8YA 3LQFA 2AA3A 4QE3A 3BL5A 4TX1A 2IYUA 5KJEA 4AVYA 4IZ6A 4U7WA 1ECJA 1NT4A 3KKEA 1E9SA 2JHCA 2WLTA 3NJ4A 2IUYA 3R44A 2CL7X 2QLFA 3NRBA 4IGFA 5TB5A 3ZI4A 4DQLA 1KEEA 1UPUA 4LRTB 2G6TA 3PDIA 1DUSA 1GTRA 1FSPA 2KM1A 2QT1A 2WTBA 3IHKA 4OGWA 4ESOA 4ZVMA 5K3AA 1C0EA 3BS4A 1CUIA 4HDKA 1PV4A 1IHYA 2O07A 3F6RA 3MSXA 3V33A 5I5EA 1RXWA 2KE5A 1CIJA 3ADKA 3EH1A 4ZCSA 1AUVA 4B0PA 4CYMA 4PM4A 4IOJA 1CVIA 3KJNA 4UNSA 1FX0A 5BWCA 5ITSA 3U61B 3JYHA 4WN9A 3UKDA 3VPCA 3H83A 2VZEA 1DAKA 3VAAA 4C4OA 1WDMA 2AV6A 3HB7A 1XZLA 4UBMA 1ZUD1 3LBHA 1UC4B 2PH3A 5CLHA 3RTDA 4EEKA 1NAIA 3PWSA 5EQJB 1MKYA 1PZHA 1PZGA 2FPUA 2IXBA 2PA0A 2QNIA 3ACDA 1K9SA 4GOKA 4KL8S 1VG8A 1F2UB 5AXCA 2FRDC 2C95A 5K3OA 2VP5A 1RNLA 3LHIA 1N0UA 5K3BA 5JMTA 3H1BA 3R3WA 1ML4A 4IV5A 4MLDA 3AGQA 3P32A 4K87A 1UXKA 1K8RA 1CJSA 1VECA 4GPEA 4IJMA 4B2LA 4YFVA 3OIVA 5ILQA 2J0UB 2GXSA 2PU5A 2A88A 3JASA 3D1JA 1ABFA 3NIWA 3BD8A 4U63A 2WI8A 2E4YA 5HF8A 1VC2A 1GZVA 4DSUA 2W42A 4OGLA 4BP1A 4CEJA 4MUNA 4RS3A 3A32A 3WLPA 3W2FA 4CM6A 2KX7A 2YY5A 4RIGA 1D3AA 1IIRA 2C3MA 2ZCJA 5FOTA 1QH8A 1R0ZA 3B9QA 2B0JA 4YDSA 2HCBA 3DMTC 4ZOLF 4QX6A 4D41A 1EDEA 3WNVA 3D3EA 3EC1A 1P29A 3B9RA 3CA8A 2QVGA 2B7LA 3OLZA 4WA8A 1N36B 1G60A 1H3NA 1W29A 2UUOA 3H2IA 4RD1A 4V0RA 1H1TA 1GPDG 1JXQA 2CKMA 2E5LB 3STVA 1X14A 1A9TA 2Z1MA 4M88A 2IZOA 3PNMA 2PKEA 3L8FA 1Q5PA 4GECA 4LJLA 1IM5A 3CJRA 2WNHA 3IJPA 3LBAA 3LBFA 4OGFA 1ZH0A 3L1IA 2LCQA 1VCNA 2XJ9A 1XRQA 4RGVA 1OLOA 4LC1A 1XNGA 4P08A 4E5VA 4EY6A 3V7WA 2C96A 1XXLA 2R47A 3QLTA 2D59A 3QVXA 3W6ZA 3DC2A 3FWKA 4Q3DA 1R4ZA 2MSLA 5ELLA 4QXAA 1VTKA 1H4VB 1ZINA 2O2GA 3DHEA 3MYRA 3PS9A 4QU0A 2E6KA 4WY5A 5DMXA 5IU6A 4R8LA 4XIJA 4DVGA 3LIIA 5LIRA 4B3TB 1L5MA 1F2TB 2RCYA 2P9YA 4P6VF 3WVNA 2WWVD 5KX5B 4LJ4A 4LWQA 3RAJA 3PVZA 5J40A 4NAUA 3LUBA 5FEMA 1G2PA 3PD0A 2Z8ZA 4UC0A 1IPHA 1EHCA 3WWOA 4XDGA 4ADSG 1AM4D 1XD9A 2OLJA 4YJ3B 4DWVA 5HZKA 4C6RA 5MFPA 1OJLA 4P53A 3ZJTA 1YVPA 2XB2A 1O0SA 2X0IA 4KG7A 3RRBA 2EV9A 5BNFA 4DDHA 1Y6QA 1PV2A 4UVHA 2G4CA 2JS7A 2HFJA 1PJQA 3WI7A 1WB6A 3ICEA 4X63A 3L02A 3ACCA 4D9JA 3KPUA 3ZD6A 1VDMA 1R8XA 2I66A 4MVWA 4QVKA 3BJZA 5TPZD 1GUYA 5KREA 4J29A 5KYUB 1XK6A 2OB2A 2WSYB 3NUQA 5AJWA 1QE0A 1RQPA 4K9QA 2P8JA 2O7NA 3KWFA 1HTTA 2VKQA 3FNQA 4N7JA 3CZ9A 1G64A 4GKAA 3UAZA 5F21A 3TSZA 2IPXA 2RKOA 3TSOA 1MR3F 4EHKA 5JXGA 2J30A 5U9CA 2OAQ1 4CCWA 4DEXA 1KK2A 4Y2HA 1KFCB 2R96A 1RQ7A 3ZCTA 3QM1A 3T9BA 4BNLA 1H1LB 1MPTA 2CDBA 2HF7A 1FX0B 1H8EA 4WN9B 1U3FA 1FMLA 1L4LA 4BNUA 3N8DA 1BQ3A 3AESA 4HEQA 1NW8A 3ABRB 2YKGA 5ALPA 3ZD9A 4O4HB 2PWBA 2WIGA 3SDSA 1ZK2A 4GX5A 1P2VA 1RYHA 3QU7A 1UOEA 2OG2A 2UZIR 4I08A 3ELUA 3JQAA 1SVWA 3PNOA 4I5FA 1I7DA 1J24A 4CFYA 4E1BA 4LHEA 2OE2A 3K32A 1IC6A 3Q9LA 1IY0A 1P9OA 2DSTA 2FWMX 2V6BA 3CUKA 3W8DA 3WHIA 3M1LA 4AD8A 3OE7A 4ZPXA 1HDZA 4P33A 1YSCA 5EZYB 3HK2A 4QIHA 2GLUA 2VJBA 3EUFA 5G41A 3JRNA 3LP8A 2X1VA 4K1XA 4NOKA 2BFFA 1OLXB 1KE2A 3KSMA 3MD0A 1PNQA 3VDXA 5CB4F 3JASB 4LZLA 5HJEA 4XH9B 5ICSA 1IQRA 1SQSA 4K0RA 5CW2A 5B3AA 3D5TA 1BGVA 2OCKA 2WPNA 4TS9A 2QGZA 2JI7A 4WH0A 1H0RA 5B3LA 1QRTA 4E13A 1V11A 1JPNA 1LTKA 3GFSA 3MD9A 1MAAA 5FPQA 1TQHA 1D2RA 3CRQA 5CNJA 2F17A 3T5BA 3VHQA 1P2DA 4CM4A 3AM3A 2PYIA 3CONA 1GZ4A 2G8NA 3L4SO 5KWJA 3KYDA 4BXOB 1QZZA 1OB2A 4JYBA 4A8HA 5K8IA 1VE3A 2ODQA 4L16A 4LRQA 4UNPA 2XKBA 4RZ2A 1W0KD 3C8ZA 5TS2A 5KTPA 4XARA 5HXAA 1Y3IA 4V0ME 4Y1GA 1IU9A 1DTWA 1YBMA 1CQPA 1FZTA 2HU2A 3WIEA 4EVQA 1DQZA 1I4EB 1MFPA 3JYOA 1GQSA 3E0XA 1N2ZA 3LS2A 4B80A 2CWWA 4C43A 2ZTHA 1YU9A 3UMMA 1GM5A 2NT3A 3NGXA 4V0OA 3VNVA 2VH1A 3HDGA 4B44A 2QQ0A 1U1IA 3OA0A 4O1MA 4E21A 2EZ9A 4KE9A 1XMOB 2XKJE 3TMKA 4JOCA 5JPDA 1WPXA 1DCKA 1WB4A 5D1NA 1DEAA 1T8PA 3AHFA 4H16A 1W34A 2J33A 4M3NA 1PQPA 2IYSA 3HJGA 4Q1FA 5G53C 2IYFA 2JF0A 4XLTA 4R71A 2G1PA 2QLBA 1FEZA 1P31A 1OWMA 1TF5A 1DBRA 3IEXA 1M1ZA 3IHLA 3L46A 1JYSA 1ADBA 4UE2A 5FULA 1Q3TA 3RT9A 1RQXA 4X6YA 1J23A 3CH6A 5ILOA 3QWHA 5E3IA 4GXNA 3RUDA 3AVUA 4R9UC 4C22A 2V5UA 3PPIA 4TTAA 4W99A 1FQJA 3TM4A 2JHGA 2W2KA 3HJNA 4MI3A 3J7AC 4Q12A 1XTJA 4YWJA 2SBTA 4YN3A 3ETJA 2XOEA 1T3ZA 4V02A 3W7BA 3V8PA 3LX4A 3DXXA 2F90A 2A1UB 2OFWA 1W6RA 3M6UA 4EW2A 3VSEA 3IP5A 1T1SA 3B48A 3UTCA 5J4KA 5C1BA 4IKPA 3SM9A 3H42B 3UJHA 3B6EA 4C88A 3P9YA 3OCYA 4ZZ3A 1EM6A 1MO4A 3QX8A 4X64B 3GP3A 4YJKA 4PQRA 2GPTA 4AKEA 2DTDA 4WXMA 5AUQA 1N5RA 5EC8A 2FW0A 1PL0A 2GBLC 3IP6A 4O8CA 1OBHA 4MH0R 3UWKA 1SQGA 5L4LA 2GAAA 4H59A 3ZJ5A 4N3NA 2DPLA 1LKZA 4RPIA 3PF9A 3JD2A 1POXA 4NE7A 3LFHA 3YASA 4EJ0A 4B3HA 2W2PA 5CHEA 3ZU4A 4HTFA 4GMFA 4ND8B 1V16B 4JT2A 2ZSJA 3ND5A 5TT1A 1GN8A 1XFAA 1AUXA 4XWTA 1SD2A 5DYTA 2D0OB 3AFHA 5G0WA 2QI9F 2O48X 5JAZA 4PLTA 1EESA 1GQOA 3JQAB 2CE2X 1W0JA 1LF5A 3UMSA 2CYCA 4CQLA 2O1XA 4U5QA 4FN4A 1IAQA 1NM5C 2B1GA 1NXVA 4X7PA 2B2CA 5J5CA 4HVLA 3DZGA 3F3SA 5C7YA 3ZGZA 2IXFA 2YJ3A 1YA6A 2QN1A 4RIIA 1YZ3A 1QP8A 3K5PA 1WMFA 5E1OA 5L45A 5KTTA 4IJ5A 1T9DA 2BFFB 5C0OE 3QI2A 5ICEA 1RPZA 2G07A 1EWKA 4CWAA 2CB0A 4OP2A 5DDIP 1LPOA 4AP5A 1Y6JA 1O4WA 1VB3A 2FG7C 1V11B 3V3KA 3JS5A 2QYTA 3NEJA 4JROA 4RBNA 2UZ1A 3G3EA 1SRQA 4I19A 2C54A 3KYDB 1Y1SA 1F5SA 1V37A 4CT4B 4WEOA 5EWLB 3QZUA 1NMEA 2C82A 2P3LA 2FSVA 2W2LD 4WESA 4IUBS 3R0XA 1W76A 5IXYA 3GWGA 4TRRA 3CR7A 4BL5A 3MILA 2W90A 1DTWB 3P2JA 2O54A 1OX6A 3D5QA 1D2GA 1JLLB 5DW0A 3NTXA 5ANRB 2ARKA 5TMEA 1G3QA 3CNOA 1G1AA 5LQJA 2KPOA 1E2DA 4R9RA 1U0FA 2PUJA 4HL6A 1W52X 2QSYA 1P0MA 4Y2XA 3TD9A 1FP6A 4I8DA 4MR9A 1T3HA 3L7CA 4FS8A 2CCKA 4LFBB 3QKTA 2XA1A 4WLFA 1DI0A 3C7CB 3MRTA 4O4IA 3WDSA 2Q4EA 2BMAA 4OJTA 4B34A 3HUTA 2ODTX 3OESA 5IWAB 3X44A 1AQYA 1VLHA 1SB9A 2YMPA 1L8LA 1Z36A 3C48A 2QW1A 4GRIA 4ZEMA 1HLDA 3QPWA 1TO2E 2R8XA 3OJOA 5BNWA 1OXMA 2B4TO 4HF7A 1IHUA 2H5LA 3RV3A 1DBSA 4BLUA 1I3KA 1PWZA 3VKHA 2OCXA 1EXDA 1AB5A 4QGHA 2MMGA 9LDTA 3QNUA 4W5OA 4GOXA 4G26A 3IUSA 1ODJA 3OQMA 2FSUA 3BKWA 3SX0A 2QTLA 3TOVA 1KO4A 1C4KA 4E5UA 4J07A 5B4TA 1CEEA 2FW8A 1FTWA 1LRJA 4FR5A 4PN7A 3QFSA 2XA2A 4YP0A 1Q83A 1P18A 3HACA 4RVNA 4F2DA 4YV2A 3DMRA 3TGPA 4RY8A 4MAFA 1ZVJA 3IFSA 4YV0A 1ZI6A 2OXCA 2VA8A 2DOKA 2GPAA 3EARA 3GQVA 3HU2A 2CFOA 3AETA 3KHTA 3W5JA 4ZZ1A 4B6QA 4AU1A 3VO2A 4EWLA 3B1JA 4MWEA 1OT5A 1RR6A 2AMJA 2DG2A 2PD3A 3K9HA 1AQIA 2QTVA 3FTPA 3W2GA 4B8WA 3KWMA 3ZWOA 2PXHA 1N6LA 1PVVA 4Q4DA 1DXOA 3D7LA 1FVXA 1N78A 1A9OA 3PU6A 4KGZA 1NQTA 5ILGA 4AICA 4CKXA 2X22A 3VR4D 5LQDA 1OXSC 1ZZEA 4UPEA 4B85A 1G291 5IWCA 4E11A 4EFDA 4EG7A 2I7DA 2RHGB 4LNHA 3FN4A 1HDGO 5JHHB 1U3CA 1TXGA 3HWX1 2QAGB 2ON6A 1VSVA 2HK9A 3CISA 3C45A 4XD7D 3HVJA 2VK8A 3CH7A 4GKVA 2FQWA 4FYPA 2WY2D 2J7KA 5ALHA 3M4NA 1CRZA 1MT0A 1K7YA 1RTKA 1TQ4A 1U8UA 4EY7A 2XRZA 4I1YA 1NF9A 2O2IA 3LO5A 2QUAA 3BE5A 4HNSA 2E2WA 2HF8A 3H99A 4FFNA 2IY9A 1E2EA 1DWPA 1Q77A 1Q0UA 2Q9UA 3VKWA 4FT4A 2QRHA 4ENQA 3CUVA 1RXSA 1F0KA 5K99A 4Q3BA 5CIWA 3BAFA 5B2ZA 2XNHA 3L4JA 1JIXA 3GGGA 3U19A 3QKSA 1YFLA 3U4DA 1GADO 4F38A 1ODSA 1HDIA 5FUWA 1UBNA 3BE6A 1MX3A 3DT6A 4PG8A 4OI2A 3AR3A 4AMVA 5IJ9B 4FD2A 1HE8B 4PQFA 3UENA 5A0VA 3VISA 1G6OA 2RCNA 2UZ1B 5AUPB 5CYPA 1P33A 4WZBE 2NTEA 1JHRA 1U4NA 1FDTA 1KTIA 8AT1A 4O5AA 2IUSA 3NTRA 1T6XA 4BWFB 3LUHA 1RZRD 5I4IA 3DE2X 4KYIB 5FOVA 1XPUA 5LOVA 4MRAA 3CINA 2WNSA 3LT5A 3QX3A 3TZHA 4Q1BA 4ACAA 3AV3A 1OGJA 1DC3A 6PFKA 1WDKA 5SZHB 3AT1A 3LQYA 4ZGGA 2OPHA 5BR4A 2HJGA 2ODNA 3ROFA 5IHXA 2ASVA 2ZJ0A 2QE7D 3URMA 5C32A 4DDUA 1C7JA 2FN7A 5FIUA 2ZIVB 2Q28A 2O19A 4XWYA 1WUJS 4MQ5A 2A5FA 3TLYA 4FMCF 2BY4A 1EDZA 4IZIA 4RK5A 4BMDA 3R5FA 4HKTA 1SPXA 1N1EA 3EAQA 3KFXA 1J00A 3AF5A 1WCIA 4LY3A 1V9SA 4UDXX 3VZBA 1KO8A 1W5BA 4J8PA 2BKEA 4LUCA 5D7NA 3U0VA 1IZ0A 3NIFB 3KXDA 5LL6P 4QFDA 2F9FA 4HJRA 1VPTA 1DQRA 3C15C 4F4CA 1CG6A 1Q12A 3HMQA 4C05A 5JZVA 1P1FA 4I8XA 2P91A 3MYYA 3R3HA 2QYSA 4IRXA 5FOWA 1P80A 1X42A 3GCWA 1VCHA 4DMRA 3S81A 5LMCA 3KZXA 5I47A 3COVA 1R74A 4ZCQA 4M7OA 2HV9A 2A3NA 3ZV4A 2XITA 3HEBA 1LC3A 2QX6A 1JZQA 3TLXA 2ZIEA 4C0QC 4ZYTA 3WL3A 4WNCA 3KCNA 1WXGA 4QD3A 2VF2A 2G5GX 4G0NA 2XY4A 3AETB 3JZAA 3ZY4A 4IQ0A 2VJDA 3WHLA 2JJQA 2DKOA 4PWYA 3S5JA 2HOQA 3U7JA 2H2DA 4HB0A 3S3TA 3V2IA 3VJRA 4XR9A 1D04A 3VGPA 4C6TA 4MVJM 4PPYA 4E2WA 2ACKA 4MCJA 4E09A 1J8FA 3WK9A 1W96A 4OQYA 1KC1A 2AEFA 4QNMA 2IUEA 2Z8YA 3ERCA 4B17A 4E1VA 2XUFA 3OKAA 2OKGA 4XYBA 3L49A 4GKJB 4CDNA 4R5HA 5LWHA 1LBTA 2Q2WA 3R76A 3KDSE 4WXRA 3B51X 5FTLA 4PF1A 2BEVA 5DISB 4YV7A 4N0PA 4HC4A 4FLMA 4EW1A 4X65B 3MS2A 2PQ2A 1TUGA 3D2BA 4ZRMA 4OM7A 1OE0A 3FE2A 1S2NA 2EW1A 4CVNA 2DQ4A 3QJYA 3BB3A 1HV8A 3HXLA 1N6KA 2VYVA 3JU3A 5EJGA 4AJOA 3NWPA 1KF0A 1QQ7A 4IO0A 4V2IA 4X62B 4BGEA 4OLAA 3IE1A 2XADA 1UOPA 2EYUA 2VWHA 4M6WA 4MQ6A 3SR4A 3SHQA 3VR6A 3WWPA 4US2R 1KY3A 1S8OA 3CEMA 1UC9A 1A82A 1CUVA 1KJ9A 3MIZA 4QDKA 1HSZA 1I94B 2EX4A 2MSEB 4J03A 4KIGA 4ENSA 1PS8A 3QKSB 1R5NA 5EZ5A 4AZWA 3U56A 3ILYA 1YBVA 4E1AA 4ZQIA 4DM4A 2WYUA 1EFKA 1NMYA 1SIBE 1QVAA 3BCUA 1RKBA 3HBNA 1VJGA 1E9RA 3FVVA 3PHBE 4M9QA 3RV4A 1UF9A 1V3TA 4AKGA 3STXA 2ZW9A 3NM5A 3QVGA 4D43A 4Y67A 1EXWA 3JYPA 1Q95A 4BFZA 1B0ZA 4P3PA 2JGJA 1NVDA 2A9RA 2G71A 4JLPA 5A7GA 3HXQA 3C3BA 3HRIA 1NJ1A 3QPDA 5BVGA 3NBZC 1VA4A 1RAAA 2O2XA 4E2FA 2ZM6B 1FCJA 4LDQA 2ZZNA 1X8JA 3OX3A 2Y6UA 4C0WA 2BFOA 2H1WA 5KVAA 2BSQA 3OZSA 2AJDA 2A0FA 2W58A 4M9RA 1G17A 5A3SA 1CR6A 3ABZA 1AXRA 3O2NA 4HLUC 4IQ4A 2RHLA 2DBQA 3OIYA 4MAMA 3VBCA 4CM5A 4XQCA 3RODA 4Q4CA 5BSWA 3KJHA 4AMYA 3BE4A 1CR1A 1GQRA 4GGOA 2GT1A 3O38A 1KDPA 1JEDA 4TSKA 1RJFA 2LXNA 2EL9A 1QF9A 1FPQA 3NANA 4R1MA 3OJEA 3UFXA 4C0HA 4BMZA 1RHUA 3C6KA 3NYQA 3LP5A 2BGUA 1E66A 3BCRA 3R09A 5KOJA 4S05A 4JB8A 2VK4A 3I53A 4RADA 1MH9A 2AOTA 3FYDA 1GHTA 3HBLA 3CS3A 4I4CA 3HVKA 4EX7A 5B1IA 1X9IA 3HJAA 5K8UA 2H4FA 4Z3KA 3FTEA 3V8MA 3HO6A 2DP4E 3DZIA 3EEFA 1FUIA 5BQXA 2LDBA 1E1CB 1PHRA 1S9DA 2OZVA 3HJHA 4BV9A 4EABA 4EEZA 5JTUA 3LL4A 3TSWA 3P97A 1IHPA 3O2QB 7YASA 3X1JA 3AP3A 5E9QA 1EFPA 3EQ9A 5ALYA 4OXQA 4YGYA 4NDAA 1KK0A 2VFAA 3OEEA 4TWJA 4UE6A 3V4PB 3X1MA 3ETGA 2DWQA 2RI1A 2QN9A 4I5EA 1SCNE 4PC2A 3A4LA 1OH8A 2IXDA 1FJXA 5EXTA 4ZJPA 1SFRA 5GOZA 3ZLBA 4D4HA 3REFA 5BR1A 3WWDA 3FUUA 2UVPA 4QSMA 1RABA 4GM4A 3AW9A 4INJA 2FE4A 2RBEA 2ZXUA 2QPTA 2J9FA 3E4DA 4S1OA 3ROZA 1SXIA 2BFDA 2O9JA 2VDPB 2YYAA 4X20B 3WLAA 1DDOA 3U80A 3E2PA 3FCEA 4RNDB 4BLRA 4MGEA 5KDDA 2DXIA 5F3RA 5BN3A 1GRRA 2ALJA 3M7IA 4IIHA 3U37A 3JW8A 4NPCA 5BUZA 2Y2UA 1G21E 2BEVB 3BJRA 4RH0A 2ZATA 1G0NA 1M67A 3BRQA 3SJUA 4BNZA 2C9OA 2VP3A 1UC8A 3DYIA 3FG9A 2ODAA 4H7IA 4R1QA 3UBMA 3ZHYA 4R54A 2BDUA 3LFUA 4YI3A 4YRDA 4X1OA 5DPMA 4TN5A 5JG7A 3LW8A 1FYVA 2GHRA 3NNNA 4TKZA 1KMHA 2A0XA 3OJWA 4X8LA 5KSPA 1JQBA 1WUHS 4ZV9A 4C4SA 4QRDA 2NSLA 1JZSA 2SICE 1RBYA 5T57A 4JJKA 5TSDA 2Y4NA 3DBLA 1FBTA 3CRW1 3I1YA 4X92A 4R7GA 4A5OA 1AH2A 4I3GA 4YHHB 3NNDA 1IY1A 4M6WB 3H5AA 2PCLA 3GG9A 5CVJA 2JJ2D 2W0MA 4ZMRA 1MOQA 3NVKI 3A1FA 1K89A 1U8TA 4PINA 1D9XA 1SWWA 1UKYA 1J56A 3W8FA 3FMIA 4CQMA 4BZWA 3E7WA 4JBIA 1Z4OA 4TKUA 5DYWA 2IHVA 2YN0A 3B6IA 2XCLA 1L6IA 3PQCA 4GW3A 1TZ2A 1H2FA 4H1VA 4KC0A 4OM8A 4PO9A 1HMYA 1RVDA 1GYRA 1YA4A 2GH1A 2O3TA 3RG8A 5DM2A 4A6EA 1HETA 5JNTA 5KYYB 3RYCA 3F6BX 2CF5A 3D7MA 1ZIDA 3Q7TA 5B1DA 3L41A 2FGJA 4FBGA 3QVGB 2OT3B 2CFRA 5E1DA 3GP5A 3K6KA 3KT0A 3SI7A 4DQ0A 2AD5A 2XBUA 2IHKA 4UTRA 4Z0NA 1DBWA 2HA3A 4KXYA 4WIAA 3RIYA 4Z4CA 3AHDA 3SFVA 2Y9PB 4G23A 4IKEA 1E0DA 4AMBA 2BP7B 4H0NA 2P5SA 2I1LA 2HL6A 1F8FA 2Y1OA 3M5WA 2N9UA 1QHXA 4A0FA 4PZUA 4OLHA 4HWOA 4JD5A 3ZU5A 4B87A 1HT2E 4D98A 2NP7A 1UPBA 1KBQA 3ZGXA 1YQXA 2IYVA 3V4VB 1BXZA 2ZUTA 2PXAA 2C8JA 2NVBA 4NS4A 6ABPA 2V7BA 4Q9DA 1DKMA 3H8VA 3PUYA 3EZYA 1A76A 3KV3O 5AW5A 3TW8B 4UOEA 5ED4A 5FO0A 1TA9A 2HC9A 5KOJB 1ECCA 4M1MA 2AOTB 1LU9A 5D85A 1XJWA 1MJNA 1FTYA 2GF9A 5AM1A 3FGZA 1RKQA 3D81A 1SUFA 2H2HA 1ULUA 4J4TA 4WINA 3F71A 2CHVA 1Z0DA 2WJGA 4CMKA 2IEAA 3DJFA 3QLEA 4ISCA 4JQOA 4IX1A 4G8JA 2QRZA 5AK6A 1GILA 1JU3A 2IIPA 4D8WA 5A5VA 2GETA 1EFPB 3V8VA 5J4HA 2F3QA 2DBVO 2WB4A 2QN3A 3WLIA 2FW9A 1ZIXA 3E7PA 4D99A 1IUOA 1YULA 3CX4A 1G6KA 1FFAA 1NJ8A 2X8BA 1OC2A 3K09A 3LU1A 1SN7A 2Z6QA 5KJ1A 2UVPB 2NMVA 2UZAA 2FGKA 3DMGA 3QLUC 4Z8XA 1SC6A 4B6EA 4OQQA 5BQOA 3GFGA 2RBGA 3IR6A 3F1KA 4JBYA 1G7SA 4XFJA 4ZJUA 1YI0A 1ORHA 4CODB 1QCCA 5A4MS 4KXQA 5CD9A 1A8QA 2ZBRA 2H1VA 1YE3A 1KNQA 1JHUA 2QQ5A 4J16A 4Z8YA 3BPSA 4BLWA 3LT4A 4GE3A 2ECOA 3MJHA 4I55F 5C8ZA 3GDOA 3OTQA 1JAYA 1BD4A 1NYQA 4ZRNA 2IYXA 2G08A 4X54A 1DJOA 3GFQA 2RGUA 4O4LA 1DV1A 2B9VA 1JILA 2V58A 3KFVA 1L1RA 5AK4A 3KK0A 2P9HA 1BS9A 4XJVA 1W4ZA 4JP2A 1USIA 3ZGOA 1Y8QB 4IDGA 1KMHB 1SXHA 4JUDX 3T06B 4C29A 4JR2A 1C9JA 2R7KA 3BWVA 1ULAA 4N6NA 3R75A 2C99A 1WZUA 2H1HA 2XNDD 3C43A 3IP3A 4QJIA 1PFQA 3RKUA 2JGDB 4EHHA 5JBQA 5CA1A 3QUAA 2RKBA 4MPJA 2I6FA 3V1YA 4DV0B 4MS4A 4EBBA 3I9JA 2D06A 3PNPA 4GKBA 4OHUA 1V3UA 1TB4A 1SY7A 4CLXA 4TYYA 1XJQA 2G4VA 4OXRA 4CQMB 4CN8A 4TKUB 1HE1C 1PQUA 1WY7A 1N34B 1H9CA 4X97A 4WZAE 1KKLA 5AVXA 3V4ZA 2HZBA 3PVCA 1WZ2A 1T5BA 3Q4GA 2NZUG 4EJSC 2WHRA 3DFUA 3MWDA 3VJLA 3SQXA 4ARIA 4DVJA 1Z6TA 2I3DA 4JWTA 3U2QA 4F8YA 5TIIA 4EG0A 1W88A 1NFRA 1VFNA 2AN1A 3Q41A 1DWOA 4D82A 3J80A 1DCMA 1UPCA 3PDCA 1K66A 3G85A 3I8SA 3A9CA 1CSEE 1C2TA 2YC4C 5AQEA 3OO1A 1LZLA 3ZH9B 4C7KA 4HWGA 5JZMA 3SOZA 1CQXA 3GLGE 2AWOA 1F8XA 1KC3A 2FDXA 3JYLA 1KFBB 4LWZA 3QOXA 3QWBA 4FBLA 5IRCD 1JNYA 2UUPA 2CLFB 2JLQA 3D6TB 4EI7A 4IVRA 3SSNA 3TD2A 1E2UA 3WDLA 4YUWA 4CKYA 1EHYA 2WUWE 1VFPA 2TMDA 4XWOA 3QUQA 5DTIA 2V5VA 3GN2A 2Q1YA 4ZO6A 4US0R 1Q1ZA 5AQ1A 3NEPX 1OQAA 4BO4A 1FFWA 2AKEA 5I7SA 2NVOA 5JFGA 2E4WA 1HZZA 2DFKB 5AJUA 4TL7A 3T3EA 2ZBUA 1RWNA 5CB4A 4O4JB 4WQMA 2HTEA 5KC9A 3KU4A 4DMMA 3BZUA 1E2QA 3JPWA 4XDYA 5IFLA 1VE5A 3LG2A 4K03A 2NUAA 1XALA 1N2EA 1JAXA 1JHMA 3TBKA 1SOWA 4YY3B 3LY5A 2Q46A 1YZYA 1O03A 4U7GA 2SKDA 2YHIA 3IPYA 4OJKA 1MCZA 1NMQA 1R64A 3DA8A 4WCFC 1J2TA 5CX1A 3KC2A 3IQIX 4PHCA 5AIAA 5FDFA 3Q7EA 2OP1A 4DFDA 1ST2A 5BN1A 1DIGA 1P7CA 1T43A 1CRPA 5IM5A 3U48A 3QOYA 2XX3A 3DQPA 3Q85A 5GINE 4D25A 3KX2A 5TQ2A 3NTUA 2AB0A 3T12A 2QN2A 4OKIA 4UEKA 3UK2A 4LRWA 2NPIA 2CFSA 2PRZA 2C59A 3EXHC 2OV3A 3NAGA 4YRIA 1XTPA 3IAXA 1U8CB 1V8BA 3I0NA 3U4GA 2IL1A 4I1VA 3HZRA 3D7KA 4Z7JA 5EUCA 4NESA 2E1RA 2YV3A 3ANLA 5JWOA 4RPCA 4Z0HO 1RXYA 3OQ1A 4G36A 1P9NA 3MJCA 1UZLA 4ITUA 3U4QA 2YUIA 5F9FA 1WUYA 4MW6A 1T4DA 4IUYA 3LYUA 1LWOA 1P4AA 2D2XA 2G28A 2PX6A 2Q8NA 1WD7A 2XCOA 1RE1A 1GZ3A 1RKVA 1XWIA 2NO1A 3KT6A 4FGWA 4MHOA 1K2VN 4DIUA 5HOEA 4DB4A 1V5GA 3QTLA 4BMXA 1HNWB 1T4GA 4ENUA 1AE1A 4J3NA 1J8MF 5CURA 1IMJA 5AM0A 1T4MA 2P6MA 4YIKA 1S89A 5DNCA 4EMBA 1GITA 1FDSA 3WLKX 3R6DA 3DBRA 2WYIA 2FLKA 1O6GA 2P68A 1R0KA 3QVWA 4G1BA 1SCJA 2E21A 4BKOA 5K8VA 5LWQA 2C0CA 4TPKA 4Z49A 3QKUA 3RVSA 1XNRB 3RKRA 3IAS1 5CA1B 1PEDA 1EP1B 1XCBA 1VQ1A 2D7JA 4HLDA 1PJSA 2GAJA 2ID7A 2JLCA 3FLBA 1DC6A 2PTGA 4MW4A 2QYHA 3PFIA 1XNJA 1A3CA 1EPUA 4P22A 4WLVA 2DUWA 4KKVA 5ECGC 2ERXA 5GGXA 2ZR8A 1REQA 2ZRAA 4TSFD 1PDVA 3RHTA 4C0SA 1R3UA 2B94A 2PT5A 1JLRA 2G17A 4PRZA 1OX4B 1M2KA 2Y99A 4NBLA 2Q9CA 3IUBA 1O94A 4LVOA 3Q5DA 4B7CA 1T26A 2OYSA 4HH1A 2FPMA 3C6XA 3IIEA 3BILA 3ZCVA 2Y71A 4IUDS 4ZICA 3U7FB 2NU7B 2NZJA 5KNBA 1W5FA 2J6CA 3WL7A 4ZO7A 1ILEA 2V7TA 4OFWA 4G2NA 1OASA 1UJ6A 1G19A 1VGQA 2IKQA 4N0MA 5DHRA 3W34A 4DV7B 5CFLA 5IMSA 4NATA 1F1JA 1H69A 1TJ4A 2FZLA 3PFKA 4GG1A 4JYPA 4M46A 4BV2A 4EKEA 3F6CA 2AR9A 5FHRA 3B3FA 3T7JA 3I2HA 4OQEA 4D9CA 5CVDA 4OF4A 5LB2A 3T5MA 1A9QA 1EVEA 1GG9A 2TMKA 4RS4A 3F4LA 1P5HA 3HCDA 1KQPA 3TZEA 5BSVA 2I2XB 1DAOA 3D8UA 1ZGGA 2QM0A 5DK6A 4BQRA 3NMUF 3ZHRA 2Z5VA 3GMIA 4RA9B 3KEQA 4AUEA 2AW3A 1U98A 1POWA 2RAFA 3R3YA 3PUVA 4RORA 4YRSA 5CB4B 1Z8HA 2CDRA 3A1VA 1EM8A 4Z3DA 4BTLA 2EEZA 1Y0BA 1L4MA 3KXKA 1G63A 1BYIA 1DO8A 2PWZA 2NUAB 4P32A 4A27A 5TQ0B 3P20A 2HO5A 2XSZA 2DUMA 3FIUA 4GE0A 2WT4A 1M5RA 5J1TB 1P9WA 2AZTA 1YIOA 1KYYA 2I34A 4ZHQA 1GAWA 3PEVA 5AVZA 1A95A 1EUDB 4R84A 5CX1B 1Y3BE 3ANSA 1E7WA 2X2OA 3CF4A 4Q3LA 3EZLA 1ZCAA 3ELWA 4QYTA 4RVCA 5DWDA 1L1QA 1LBIA 2N0SA 3AI2A 5IANA 1HYQA 2P90A 1XRMA 4BBJA 4BX9A 2C00A 3RRJA 3IKVA 3NTLA 2Q5LA 3OM0A 2I22A 3T4UA 4ARBA 4C7XA 1EWTA 4CM7A 3NDIA 4BYGA 3K70C 1K88A 3M9WA 4H7JA 5D1HA 5TGZA 4YMHA 4RTQA 5EJ4A 4PRLA 1DQYA 2ZRPA 2PX0A 3I4CA 3O8QA 4IEEA 1G3IA 3P2IA 4J2TA 1V2GA 4R6WA 4U4AA 5ELXA 1DINA 2GVZC 1YONA 4CF5A 1UPAA 2GJ8A 4CRWB 4QU9A 1W2GA 3UG6A 2A14A 1UFVA 4YLYA 3V4OA 3TBHA 2VHEA 4O2BB 5BQ3A 4KR7A 2DQSA 1TAQA 1L3BA 1P75A 1DL5A 3N2ZB 2BN4A 3IOMA 4U8HA 2CV1A 1TMYA 2N42A 1B1AA 3MGGA 2GN2A 1VPEA 4R51A 5JBIA 1CJCA 3IBCA 4OK6A 2D7DA 1MB3A 1KZGB 10MHA 1ZL0A 2ZPTX 4LYJA 4BKMA 1RE0A 5AW6A 1L4NA 3T7IA 1Z6ZA 1SXJB 3FGNA 3WLHA 7REQB 1TCUA 1Q7BA 3EVNA 4XRRA 3ML1A 3PG5A 2PJUA 3Q9SA 1ECBA 5DGTA 3AF6A 3NYRA 1GPH1 3H2JA 1YHYA 3G0BA 4MKFA 3RYFA 2CJFA 3EG9B 3IB6A 4L5CA 1II0A 1X1AA 4JP8A 4MRPA 4O2AA 4WOJA 1L5VA 3T3PB 1V6SA 3UGTA 1JJFA 2V65A 5KOHA 5J23A 3SQLA 1GQYA 1UBOS 2ZEJA 3E9MA 4RHFA 4FDUA 4KPUA 4UVGA 2H3HA 4W7HA 3TH5A 3EZ9A 4NHOA 3ADCA 1REQB 3PL1A 4L9SA 4MYCA 4EUFA 2PIDA 4PG7A 4NY1A 3ZHCA 4YO8A 3I5AA 3RS8A 3GLIE 1IHDA 4P9NA 2IV3A 1C81A 1E3DA 1P9LA 3DE0X 5LN1A 2GJSA 4BMCA 3MK31 2QLJA 4NNOA 4P7JA 4FOOA 4U5XA 2XLCA 3I1FA 2EERA 3PR3A 4MHTA 2X1LA 3JQGB 2ZULA 4DLTA 4LQ4A 1RFGE 2EAUA 4L0MA 3TS1A 2ANBA 4HB2A 2O2DA 4J1QA 4F8JA 3RWMB 3HQ4O 5EJ5A 1CYEA 1X80A 1UPTA 3G8AA 5ALVA 1UMKA 3JQEA 2LIVA 1PR6A 1JHVA 2YWDA 5AJXA 5ICGA 2R0QC 1HG0A 4YH1A 1V3VA 3DZCA 3HA3A 2JGIA 3GNQA 1ATZA 5EL0A 1ZD3A 4DIMA 3DS8A 1S02A 1BXKA 1WSDA 5CVVA 1AKYA 2WB2A 2XAUA 3CU5A 2LUOA 2JG3A 2JFFA 4K6MA 4B4DA 1THGA 3TQSA 4IRMA 3RC9A 3UYLA 2BZ0A 4Q37A 4LQLA 2K4MA 3PDUA 3PKJA 1XDUA 3ASZA 1KSFX 1E2PA 4KOEC 3E5HA 1CZRA 1UBSB 3DO5A 3KD3A 4TWBA 3NHFA 2OBFA 2WFAA 4LCJA 1XMSA 4MJXA 3VOSA 3EXIA 5LQCA 2MSWA 1FU8A 3EIHA 1P5ZB 4EARA 4AY3A 1UBFA 4LMRA 2RHHA 3WRYC 4UNIA 1VL6A 3N1UA 4JY7A 4MIYA 2X0FA 3DEYX 4IIBA 3WXMA 4D1YA 4FFPA 1TNDA 5FWXA 1I36A 2PO7A 2EFYA 3NM4A 3FD8A 2WQZA 3A4VA 2XMCA 5IKXA 4DG8A 3BWYA 1Z4MA 2EFDB 4PYNA 4YYZA 3ETDA 4M53A 5HKBA 4DLRA 1LRLA 3GG2A 2QS9A 1J2JA 5HIMA 1EGMB 2XWSA 1EB9A 1Y4SA 3EXFA 4XOIA 3CKLA 4RV5A 3KJXA 3H5RA 4FI3F 5DWQA 1DAPA 1M34A 3CZ5A 3IX7A 4CDRA 5DNEA 4ECAA 5EJ8A 3NHBA 1PK7A 3RAFC 2ZVPX 1WZEA 4ER0A 2QX9A 4J2HA 3OJLA 4Y3UA 2WV9A 3MEQA 2HXGA 4G8BA 4YAWA 3MJEA 1CVLA 5LYJB 4CIYA 3VR3D 5LKRA 1DOHA 2Q5FA 2EGHA 2GBIA 4ZOQI 5HCIA 2W6JD 2N1BA 4CMAA 2XMBA 1II8A 2WJ6A 1ZCFA 2WIFA 1CB0A 1SBHA 1Z13A 2XRYA 4HS4A 1OTHA 1XXHA 1C3LA 3QH4A 4KSBA 5AHRA 4B6FA 4KTVE 3IELA 1WY5A 1GDTA 1LF0A 3DJYA 4E5DA 1B76A 3O8OA 4IDPA 1JPJA 1LBQA 1TKRA 1Y42X 3GJXC 3G5MA 1KQGA 1OILA 3BSSA 3ZNQA 2RBKA 3IQZA 3DEZA 4QXPA 4KR0A 3IB3A 3L40A 4L0CA 5FV4A 3LQ2A 2ECFA 2QYOA 1H8HD 2X0DA 4B76A 1PLKA 2XUJA 3GPLA 2AHRA 4OHKA 3KZCA 3OZDA 4MUGA 2JHFA 4UQLA 2WQ6A 6REQA 2GX6A 3UZUA 1JTEA 4NEGA 3DMDA 4ZIRA 1GWNA 4BGIA 4KVFA 3M8KA 3DAHA 3FYCA 1E9EA 4LOJA 5EA2A 1BS1A 1SBQA 2QP4A 4TTQA 5E6UB 3RYFB 3DTTA 1ICIA 2VHWA 1Y81A 1ZOPA 3UPUA 3KYBA 2XVZA 1AKWA 2R97A 2WOJA 4BMOB 5JFOA 1A7JA 3G0DA 1FY2A 3OQ6A 4XIIA 5JCJD 1E9DA 1T8YA 1PP4A 1RHKA 3NBQA 4KPUB 3H5WA 1QTRA 1Z0AA 1GRNA 2UVQA 3IAFA 4B9AA 2WKSA 5KO2A 4L22A 2X1HA 4V24A 4B9EA 1SRRA 3KZVA 1R12A 4LYAA 4I0WB 4MDHA 1YJXA 1EX1A 3LHDA 4MS1B 1G4UR 4WBXC 4LHYA 2P9FA 2NP6A 1L5YA 1RM0A 2B36A 1Q7GA 4I2NA 2E48A 5AJHA 4I9FA 1FA9A 5BSMA 2EEPA 4F5DA 1CR0A 1K1EA 4ZVNA 3R7SA 3WGTA 5L40A 1NU8A 1E0JA 1NIPA 1SZJG 4R0NA 1RM3A 1V0JA 2V96A 5T64A 5C3MA 3NM6B 3LK7A 3OM1A 1R6BX 2ISQA 2B8WA 1NLZA 1E64A 2BMJA 2FKAA 2O6LA 1BO6A 3VMMA 4D3DA 4QZVA 3GI1A 5CFNA 4Z51A 3ODPA 3VZCA 3HM2A 4LYHA 4M0MA 4PZPA 5U4XA 5CBPA 2B99A 1ZICA 1FS6A 2EFGA 1RXCA 5EIBC 3AY0A 3TD6A 1GUFA 5EPOA 1Y9DA 2O3SA 3EQ8A 3N2YA 3CRNA 5DV9A 5FADA 4PZYA 2R5NA 4E08A 1WHSA 4DKXA 3GGDA 4NCNA 2D2EA 3H2YA 4GSKA 3RYHA 3PLAE 1L7AA 2X3UA 4GDFA 2C9MA 2HD4A 2K5UA 2YV2A 1KS2A 2CHFA 3AU9A 1MDBA 3BSYA 5CYGA 3EXIB 2FLWA 4C4TA 2EBWA 2ZS8A 3QEBZ 2H2WA 1SC4A 5C8YF 4ND7A 2H65A 3MWEA 2RMKA 4RXMA 5LYYA 3T94A 2BDTA 1OOEA 3D6FA 5JSHA 4DR1B 4ZOLA 3GA0A 3ZHVA 3LGXA 1QRUA 2H4XA 1U0NA 2UVDA 5B5SA 5FHQA 3RANA 2IEZA 2J9RA 5A2QA 1JT9A 3HS3A 1QPGA 3HVRA 4HAYA 2PPVA 4J1TC 2UKDA 3CEHA 3IQXA 1VOTA 3LVQE 3WMXA 3IDAA 3ZVMA 3TKAA 4BNWA 1SHTX 4UBNA 2R62A 2VYNA 1JH9A 1OYOA 3N86A 3ESZA 3V8NA 5H1YA 3CGWA 1M76A 3J7TA 5T4FA 4C14A 4DGQA 5L4NA 3DOJA 3EXFB 1DKUA 1TLLA 4WKGA 5I3CA 4UHHA 3AR5A 3V7NA 3EVZA 5JD5A 2VNAA 2I67A 3ST7A 3DBOB 3QYPA 3QJ5A 5TMDA 1QV7A 2VHYA 4ITRC 5BV7A 3OTOB 4AY4A 4E46A 1WOMA 4MX8A 2Q9AA 1MRZA 4M9SA 1MDFA 4NR0A 1ABEA 3KQTA 3C24A 4L8YA 3ZHOA 2C61A 1EK6A 3BFKA 5GONF 3LHFA 4XPIA 2JAHA 1V7CA 2VUHB 5LSAA 2AOXA 4Q1EA 2C3YA 5FP0A 2DY0A 221PA 3D3NA 4KQEA 3SZLA 3EZFA 4JVMA 5AW2A 3M4JA 1W5SA 4IFTA 3O8OB 4BN4A 4HT3B 2JZNA 1EVQA 2QF7A 2X15A 1RSZA 4FP9A 4YP6A 2QD2A 1NBAA 3GXOA 1XVIA 1ESNA 2X5KO 3FUXA 3M3DA 3VDRA 4KHZA 4V1CA 4COOA 3H7IA 2HSGA 2Q49A 1E3JA 3HVHA 4RWEA 1L7MA 2BUBA 4R40A 6REQB 1KSGA 1UAGA 4GZ5A 4FHZA 3P19A 4W9NC 3WNDA 3AB3A 2QTRA 4FDAA 3UUGA 1QX4A 4NECA 1UMCB 1VL1A 2B5VA 1RYYA 3M1IA 4X94A 3E23A 5DW3A 5LXTF 1WXQA 3TM5A 3ZHTA 2FXVA 1TUEA 2PK3A 1P1KA 2ATIA 5J43A 4X3OA 1JDUA 1B8NA 4V0QA 4ZFNA 5JS2A 1PHPA 1NFFA 1TT7A 2ERCA 1K97A 4D0LB 2BGKA 1KDOA 2Q27A 5EXSA 1QK3A 3LZDA 5H80A 2A1TS 5BMOA 3C5EA 5IF9A 1TYAE 1C7RA 5CR9A 3PRJA 3LPNA 4D4JA 3K71B 2GF2A 2NG1A 3DQZA 3SOPA 4LTMA 1V8DA 3D31A 3UICA 3GAZA 2AEEA 2QVXX 3V5NA 3BIWA 3MCVA 1VMEA 4B48A 3KV1A 4P54A 3W1VA 1JBQA 1G16A 1AQLA 3ZXUB 4TVBA 3R9XA 1DSSG 2AQIA 5CBPB 1WIWA 1S7GA 1KJZA 3L0CA 3OY2A 3KD2A 4FYKA 2WFMA 2PMEA 5IC5A 4OMDA 1VIAA 4NU5A 1WHSB 1R66A 4WY2A 5ADWA 1EQUA 2H9YA 1B0AA 3I45A 3RYHB 1AKVA 2A92A 1QHGA 1U9IC 5KU1A 1WBDA 1GA1A 2P0AA 3GJTA 1QLJA 4ZVVA 3D6JA 3AUYA 5ENDA 5ALXA 1Z4NA 1G5QA 3R3SA 5I51A 3MZ0A 2ANCA 3MWEB 4XX0B 1EX7A 1YMUA 5AXDA 3VR4A 4ZOLB 8GPBA 2AQKA 4MNTA 3DAPA 4JI8B 1QXSA 3N2LA 2VQEB 2H7CA 2XYGA 4IYJA 4MQEB 4DCNA 2OD2A 1TK2A 3PC6A 4Q19A 1CT9A 4MLPA 3ZIAD 1V26A 1FJHA 4OLBA 3KNZA 4LZZA 2X41A 4JSRA 2HU8A 2F8MA 2NN3C 3MJFA 4MGKR 2PS9A 1EG2A 1CEXA 1GLGA 4WLNA 5LQNA 1JQ3A 1QRAA 2D1QA 3D4OA 5HPYB 1G98A 2DCMA 4OMUA 2VDJA 4FQ8A 3ZW9A 3VJKA 2GCNA 1Y98A 1DIRA 1QHIA 2IODA 5I7EA 1O95D 2XCQA 4WKBA 3P2OA 4CM9D 5KQSA 1NATA 1SVNA 2VPPA 4CT0A 5D3MA 1ZUHA 2YNMD 4GNKA 3LUCA 3NDRA 2VUIB 3AVOA 4CN9A 5CBKA 1FP4B 1ZXLA 1ZD1A 2KBFA 4CQNA 3LHSA 4FUQA 3LX5A 3WO0A 3DL2A 5AMXA 3UJ6A 4XPIB 4IEFB 3EUAA 1YB2A 2ONYA 1AQNA 3HJRA 2PBRA 5CVUA 4K8OA 1YVEI 3L7AA 1QMGA 2I6UA 1F6WA 2FEXA 2WU1A 3FWYA 1HLGA 3I9V6 3NOQA 4QUEA 1XRPA 1KY2A 4ZO4A 3RSFA 2G9RA 1M10A 1V43A 1W48A 3C39A 4DTCA 3PLRA 4PVDA 2A9PA 4K9LA 3PNYA 4TL8A 3K6JA 2XUGA 4RDIA 3TN7A 3ZDCA 3P4XA 5FBRB 1J09A 3HCEA 5IBQA 5IAOA 1QGZA 1UKEA 3PDWA 3E82A 5I7AA 1NXTA 1SAYA 2E4ZA 1GPKA 1I1NA 5CT9A 3MQFA 1ZFNA 3FSRA 4TMKA 3EK2A 3U3JA 1W85B 3RT1A 3H0EA 1QC5A 1KHHA 2ZT6A 3ZDRA 2FSSA 2JKZA 2XWBF 2YRFA 5K5EA 1U5BB 3FCAA 3OPYA 2XE4A 2BEKA 2NT4A 1WQ1R 1CE8A 3QOFA 1N2XA 3PPXA 3A70A 1JVBA 1L5FA 5DI3B 2CGEA 2DHCA 1N75A 3DCNA 5FTMA 2Z8XA 5F4ZA 2OKCA 1Y33E 2JFWA 2KHZA 3PEFA 3VU0A 3ND8A 2QR5A 2XB8A 3FR7A 4ALIA 1OUMA 4XM2A 3UMBA 3NC1C 3Q9UA 4R7ZA 4UNRA 3RE1A 4EFNA 1DMRA 2EKDA 2XYPA 1GT6A 4KAFA 4C5AA 1IBSA 4MRVA 5DHFA 1TZKA 5CA0F 3OEHA 3BGWA 4O0LA 1DB3A 2GSWA 3HZOA 4YRQA 2ZIWB 3STTA 1C1DA 3EDYA 1E3EA 2JLXA 3UUEA 4XOUA 4YB8A 5JSFA 3ITKA 4ETWA 4N3GA 1C30B 3ANXA 1C1HA 4L5BA 2JFOA 4UM7A 1NQ5A 2BHNA 4DLUA 3RSSA 1USVA 4CMEA 1J7JA 4FINA 1D6MA 3BCHA 2EDCA 1RXUA 1NW7A 4PPFA 3S4YA 3ELDA 4PLZA 2NUTA 1P1IA 5A9SA 3R7NA 2V45A 521PA 5JRDS 2PX3A 1YVUA 3UB4A 2BT4A 1HGXA 3M3PA 1TVEA 3F7MA 1JH8A 4HYQA 3VC7A 1D2AA 4EBFA 3ZNNA 1E8MA 1NURA 2R79A 3LWZA 2AFIB 3HCPA 5KAPA 4WNAA 2F3UA 2RHMA 3PYLA 4MUHA 4O63O 5C8DA 2NYUA 1L7BA 1NF3A 1YQWA 2AJBA 4PEVA 3ILSA 1U3UA 3DFKA 1BXGA 4UKDA 4X24A 4DXAA 4NH4A 1PVDA 2H4WA 4IVPA 4NDNE 3RSGA 4IHJA 3NEYA 4GMKA 1QOQB 2NVWA 1H6DA 4XZ3A 3RVBA 1IK4A 3DTNA 2PGLA 2O8EB 4L8LA 1K8YB 1X15A 5FD8A 3LKBA 5TGTA 3PYXA 3RVNA 3JQCA 2Z2KA 3T7KA 1Q16A 1Y6ZA 2M2IA 4BRUA 4P0QB 2EKQA 1LLFA 1ESMA 1MJGA 3EAGA 4M76B 2PZ8A 3ON5A 1KQNA 3HR7A 5JI2E 4DREA 1JF8A 4YMLA 3QTBA 3PV0A 5DXAA 2IEBA 5DYGA 1CFZA 2WKPA 1GVHA 1JHOA 2QZ4A 3O47A 1T2CA 3ZWWA 2M1ZA 5IDYA 1L2TA 3AOGA 1NLYA 2G70A 3CLUD 4CIAA 5D3MB 4DNOA 1U3WA 5JPIA 4WBNF 3LT0A 2AYYA 4G0PA 3CEAA 3I2YX 4ZCTA 2WF7A 1Y7TA 2B34A 1MTOA 4GP7A 4HUJA 2AKAB 1XA0A 2IHZA 1QIFA 2IU6A 5CDHA 2GCGA 1T10A 4E33A 3AO0B 3FHJA 5BMVA 3QPAA 3RSHA 3ZGLA 2JJ1D 3MW8A 4G67A 1UDWA 3G89A 4NI5A 1ZJ5A 3PRHA 1QCZA 1P91A 2XXJA 4RL6A 3N2KB 4KLZA 4QUIA 1BA3A 4U7FA 2LV8A 1EG7A 1Q84A 1KY5A 1QQAA 3JQ6A 4DUGD 3O6VA 1IXKA 3K1ZA 3KXLA 3MAGA 5A3QA 3VTKA 4XGRA 1ZM2A 4B7AA 3PE3A 4UHDA 2R1TA 3C8UA 2F1KA 4LA4A 3R7DA 4IXDA 3QQ5A 1WMEA 2NO4A 2YWGA 1XNHA 1KO1A 4LXIA 4BQFA 3OIFA 5FRDA 4ID3A 4OVKA 4U7DA 2JFBA 4DF3A 4QXRA 1TCBA 1KO5A 4S2UA 3HEAA 4F5YA 1CRWG 5LDDC 2Q2VA 3ZZMA 2VBGA 2J3IA 4Y2YA 4BQEA 1QC5B 1JQDA 2FMUA 4G5OA 5LMUB 1E79D 3QU9A 2IBSA 1CY6A 1PNOA 3HG7A 4HXYA 1J22A 1U5CA 2CV0A 1CE8B 1L4FA 4HS9A 1QKJA 4P5PA 4OHXA 4NZYA 3D02A 4KQMA 3HLYA 6LDHA 1OXBB 2D0IA 3U7QB 4GI5A 4NV1A 3ECSA 4D9FA 4Q02A 4JYAB 4JQZA 4OHOA 5IAAA 5CB6A 2EWWA 3WK8A 2Q1TA 3ICVA 3ZDFA 1A2KC 2YVLA 2FSVC 1E99A 1E59A 1IN7A 4MYRA 3ZWPA 3KYCA 1ZU4A 1Z5PA 1D5WA 2BMEA 2W48A 2QWXA 1AZSC 3F7NA 1ZSYA 2JIZA 4Q9AA 3EDQA 4QFBA 1XC7A 2Z5LA 3VU3A 1XMJA 4RJTA 5AVYA 5JALA 1MFZA 2MYUA 1KJ8A 2PBFA 2NGRA 1XN1A 2B1QA 4HDAA 3P9IA 4PO8A 4UVIA 1ECLA 4CW7A 2Z3ZA 4LS3A 3PFBA 1C1DB 1PAUA 1F6DA 1LPBB 3KJGA 4KB5A 3IBGA 3D59A 3II6X 2FNAA 3IQGX 1W59A 2NV6A 1K98A 2XRFA 3M1YA 4QJBA 3UUFA 2JFHA 2GPJA 2IP4A 2EKZA 2WWTA 3BZWA 2NUTB