4JP2A

Crystal structure of tt0495 protein from thermus thermophilus hb8
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
239
structure length
239
Chain Sequence
MERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
total genus 81
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jp2A00
2FMUA 2GUGA 3HUDA 3C1TA 2B4RO 3F46A 5JAZA 2DVMA 3JYNA 2W2KB 4WASA 3D4NA 4RPLA 5JO9A 3EYWA 2CVZA 4D43A 1KEVA 1WAMA 1D1SA 4Y6PA 3BAZA 2PD6A 1U28A 4MVJF 2UVDA 3DBRB 4DC0A 5IG2A 1CETA 2O3SA 1RKXA 4HNGA 3MTJA 3JD2A 4UUNA 2ZK7A 3UKOA 3GHHA 3DFUA 5FYDA 2CF5A 2PH3A 4BVAA 4YR9A 3NYWA 4MVJA 4MIEA 5EMHA 1RWBA 1BW9B 2OL4A 4PLVA 4QO8A 4R1SA 3UUWA 3QLJA 3HZZA 3L4SO 4XX0A 5IDYA 1K89A 1HDGO 3O8QA 2DKNA 3FCOA 3LF1A 2EV9A 4ZU3A 4RL6A 1ISGA 3TQHA 3IS3A 3Q1LA 2DAPA 3PYLA 2W2LD 3HB4X 1O6ZA 2CY0A 2Q2QA 2QIOA 2J5QA 1BXKA 1Y81A 3GN2A 3P7MA 5CPFA 2OMEA 4Y9DA 1BVRA 4DPMA 1I10A 3JYOA 4IS2A 3D5TA 4XZ3A 3NRCA 2VUUA 3RFXA 1E7WA 1GYRA 3HDHA 1WVGA 2EG9A 1DFIA 3PJDA 1W0CA 3RKRA 2HU2A 5DCYA 4ALIA 3ZU4A 5BQFA 3Q9NA 5IZCA 3GAZA 4RPHA 4RORA 2IEDA 3H2ZA 3E82A 2VWQA 3U9LA 1D8AA 4BNFA 5ENVA 1HXHA 1EE2A 1TB4A 5I9MA 1MLDA 1ORRA 1SMKA 4BOYA 1E3WB 4BO5A 5ADHA 3GZ4A 4RVGA 3IUSA 1Y8QB 4MVJM 5F21A 3BHMA 3DDNA 3GGPA 3G3EA 4CM9A 1CJCA 3ZHYA 3KZVA 2BRUA 5L51A 4CUJA 3CPSA 3E5RA 3EY4A 4C4OA 2JHFA 1J0XO 4CM8A 3PWSA 4YAIA 1AHIA 3COSA 4NJMA 3U5TA 1CYDA 1Q0HA 4HXYA 4R1NA 1H6DA 1M76A 2PZMA 2RBEA 4ZRMA 3E03A 5DT9A 2CNBA 2Y1CA 4PLWA 5T8KC 3ZWXA 1B26A 5B37A 1QG6A 4PRKA 4E5NA 3KEQA 1AUPA 4EI2A 3C7AA 1NFQA 2ZKLA 3WGYA 4A7PA 4I5GA 1UJMA 3TOXA 4TROA 3FTNA 1R66A 1NR7A 2QRJA 4LW8A 1YGYA 4EJ0A 2DUWA 1YQGA 5HS4A 5CEJA 4J3FA 1HSOA 4DGSA 3BMCB 4ESOA 5DN9A 2GR9A 1R37A 1B8UA 1TVEA 3LC7O 2DBQA 3H5RA 1A4IA 3DOOA 5FWNA 5A5FA 1OFGA 4CLOB 3Q6IA 5JMPA 2NSDA 1JWAB 4IJKA 5COBA 3E5MA 2PKQP 1NP3A 1P0FA 3H6KA 2GZ2A 4FJ1A 1QRRA 3B20A 4YJGA 5CG2A 5LCXA 1MG5A 3U4IA 3S55A 2NVBA 5I9NA 3T4XA 2EHDA 4J0EA 3ZW8A 5JDIC 2VWGA 1YONA 1C0KA 2B36A 3S1LA 4BNMA 2X9VA 1GV0A 3GFGA 2PD3A 1MUUA 1P33A 1I5RA 4UAGA 3QA9A 5T67A 1NAIA 2ZCUA 3I83A 4J49A 1EVJA 3Q2IA 1GPDG 4J2OA 3E9MA 4MDHA 3WSWA 4OL9A 1B0AA 3JQBA 4XQEA 3FPCA 4B4UA 4Y98A 4E2YA 4BV8A 4E2XA 2GERA 5I7SA 2D8AA 3IUPA 1ULSA 3ZWNA 2CSUA 4DA9A 2WE8A 3AM5A 4TMFA 2X9NA 4AJHA 1FJHA 1LA2A 2DUUA 1GQYA 1LC3A 1YJ8A 2VNAA 3KTDA 1KS9A 3JD3A 1ISHA 5GZ1A 5AVOA 5A04A 4PG7A 3EW7A 1GUYA 2EGGA 3RU7A 5I7FA 5EQFA 3PPIA 4HFMA 5JDIA 3TZCA 4YAEA 1B8VA 4BO2A 2AA3A 2D5CA 3MZ0A 3OP4A 3FBTA 2RAFA 1LQTA 4GAEA 3ZWPA 4R54A 4AFNA 1KIFA 3DZHA 2FY8A 3BZUA 1GDHA 2IYPA 2Y1GA 1ML3A 4BGEA 2XPCA 3AFNA 3L77A 4Z0TA 2A94A 5L53A 1GFSA 1T2AA 5KJEA 1PIWA 1QV7A 3LC1O 4B4OA 2Q4EA 3HWRA 5JYEA 2AQKA 5G0SA 3AY3A 2ZB8A 4O59O 5CP8A 3EC7A 3KVOA 2ZJ1A 2B5VA 4BGUA 5CDUA 1XU9A 3W4IA 3U4CA 4OH1A 1NXQA 1CDOA 4BKUA 4L4XA 3I9LA 5BSFA 4XR4A 3ZHBA 1DXYA 3DBVO 4J1TA 3JQFC 5L40A 4XKJA 4CMGA 1VKOA 2DT5A 1DC5A 3CSDA 3EVNA 4H15A 4FB5A 4UVHA 4OO3A 4J6FA 4ND3A 4I9UA 4CLEA 4QT0A 4E2WA 5I8WA 2GNAA 2V65A 4EZBA 3C24A 3ANMA 5ER9A 2ZTMA 3RAJA 2P2SA 5A9SB 2WMDA 2PFGA 3ZV6A 2EJWA 1ZCJA 1DJNA 3GQVA 4J7CA 3GNTA 2JCVA 2E82A 1L7DA 2DM6A 3W4KA 3B1FA 3GEMA 4JJGA 1VE9A 3AU9A 5IZ4A 3NEPX 4CMKA 1NPDA 4E0BA 1LDMA 2E4AA 3K8ZA 1N8KA 5DP2A 2Y05A 3M1LA 4FFPA 3H5AA 4PFJA 1PQUA 2P5UA 3GZNB 4DRYA 1CWUA 4L9RA 2XXJA 1ENPA 1KEWA 1W73A 3DL2A 4AJLA 1DEHA 5CG1A 2B5WA 4J1SA 4EYEA 3GPIA 3MOGA 1E1LA 5DBFA 4YT4A 3R3SA 4BNTA 3AM4A 1GUZA 2NM0A 2WD7B 4NFHA 5TIIA 4H16A 3GZNA 1I0ZA 2BD0A 1NQOA 3OEWA 3QJ5A 3WFIA 1EBUA 1U7TA 5JW6A 1E6EA 2DC1A 1R0LA 4AL4A 3ETEA 4CR6A 3F4LA 4WLEA 1T2FA 3CTMA 4OKIA 4PIVA 3NTQA 4YWJA 4KOAA 1EK5A 3HADA 1NNUA 5CEFA 4D0SA 4IBOA 3PHIA 4WPGA 3TNLA 4W82A 4BB6A 3DQPA 1ZSVA 3OJ0A 2O2YA 2EERA 1SB8A 2Y1OA 1DIAA 4ALLA 5ILGA 1HSZA 2YY7A 1LSUA 3U3XA 4E32A 2C2XA 3WGZA 1V0JA 1KERA 4JBGA 2EIHA 3QVTA 1EUDA 3RSHA 2J3HA 3A9WA 3OFSA 3ZWVA 4I08A 3PQDA 3TFQA 1TI7A 4I5FA 2OP1A 3GMDA 4D41A 3NJ8A 2JFFA 2O3UA 1RM4A 3GVXA 3WBFA 5KJFA 2PKRA 1Y8RA 2GZ3A 3FF4A 5IF3A 4RQUA 3LT4A 3QY9A 3A14A 5A1TA 1IZ9A 2D1YA 3BTVA 3QWIA 2ZYDA 1YE3A 4ZICA 4Y8VA 4DLAA 3GH3A 5JCJA 2OFPA 3C3XA 4FGSA 1EEHA 1OC2A 2CDCA 3TWOA 2O50A 5HA5A 3DBLB 4CV2A 1L1FA 3UOGA 1A71A 2P9CA 4II2A 5KJ6A 2ZB7A 3JQAB 2Q99A 1H9AA 1R4MB 4U6QA 1GAEO 4WLNA 1HLDA 1OAAA 3WIEA 3ABIA 3GHYA 4LRSB 4OYRA 4ZJUA 5B4TA 1BXGB 1QP8A 4K1LA 2ZQZA 3JQAD 5DDIP 1RJWA 1V9LA 3BMNB 1D1TA 3UFXA 3WYEA 4YRAA 4AJJA 3PHGA 2X86A 2YDXA 3I4CA 4N54A 4R68A 3SJ7A 2C0CA 3RFTA 2GN8A 3IIEA 4GWGA 1YBMA 4XDZA 3TOZA 1VL8A 5TNXA 3PJFA 3IDSA 1VSVA 3DBHA 1XIVA 1IZ0A 1IB6A 5A9TA 2BELA 1MC4A 3FWZA 4IJUA 2QZ9A 3M2PA 4FGWA 4GMFA 3G0OA 4NR0A 4JK3A 4TRRA 1I2ZA 4XJTA 2B35A 4WCFA 5B12A 1U8FO 8LDHA 4DVJA 4Y6RA 3M2TA 1M6WA 3B1KA 4WCFB 4CM7A 3CH6A 4GMGA 1V6AA 4L0QA 5EN4A 3WQSB 2UYYA 3BMCA 3ADOA 1Y7TA 4BNNA 4HUJA 4DIBA 4L73A 1MP0A 4Z3KA 4GLOA 1YB5A 2EKLA 2VHXA 4FFMA 2QW8A 4D46A 4DMMA 5LDHA 5C5IA 2G5CA 4P38A 4OGWA 1IE3A 4JBIA 4HY3A 4Q39A 3SBOA 2PR2A 4WJZA 2HAEA 3AUTA 1VI2A 3JSAA 4RLHA 4E12A 2ZTUA 4LK3A 3OSUA 4YQZA 4CV1A 2O7SA 3IL2A 3DZBA 4QXMA 2E48A 5L4LA 5CDTA 1QV6A 1HYEA 6LDHA 4RVSA 1HE5A 4FC7A 4D3FA 1Z82A 3LZ6A 4G65A 1NR1A 1ADGA 3QRWA 1PR3A 3KB6A 4D7AA 4ALMA 3OIGA 2IXAA 4CM4B 4KUHA 2X5JO 2D4AA 1UP7A 5ITWA 3TFOA 1WZIA 2C5EA 1VRWA 2CDBA 3ETGA 2J5RA 2WJPA 3K30A 2DLDA 3GK3A 2BFMA 4FOOA 4OOEA 3VOSA 1SC6A 4CMJA 1YL7A 2PA3A 3P2YA 3PHLA 5LC1A 2C5AA 4XYMA 4NJMB 3SJUA 1PJQA 2JKVA 1DHTA 2NU9A 3B70A 5IN4A 1X15A 4J91A 4Q3NA 3A4VA 3O38A 4I5EA 4U7WA 1TLTA 3MWEB 5AXCA 2VOJA 3NDJA 1I8TA 4GSKA 3ZNPA 2AG8A 4KMSA 4G5HA 4BO0A 3QVOA 3F3SA 1EMDA 4FC6A 5H82A 1HRDA 4EJ6A 4BNVA 3KXDA 2QZZA 2PK3A 1VL6A 2PZLA 5JSFA 2RIRA 4MP6A 4GVLA 2YFHA 1CQIA 2QG4A 5AXDA 2IXBA 1FF9A 5IAAA 5ES3A 3O4RA 2R00C 3DOCA 1QORA 1TT7A 3ULKA 1GTMA 4C7JA 4YT2A 5K9ZA 2VRCD 3EUWA 4Y67A 2V6MA 5JAQA 1N1EA 2YW9A 3GVHA 1F17A 1NQAO 3G49A 3JQ8B 3QV1A 4FFRA 2PLAA 5CPBA 4WGGA 4PVDA 1YDWA 2DTEA 3K31A 1IULA 4M49A 3S2IA 1ZH8A 2Z1MA 3GF4A 3WGGA 4IGFA 4DQVA 3C85A 3I6QA 5GMOA 2I65A 3JYPA 3I5MA 1GUFA 5TLSA 2WM3A 4ONEA 3H2SA 1ZXBA 4RZHA 5F1PA 3VTZA 3CXRA 1U4SA 3FD8A 2C2YA 5GZ6A 3K96A 4DIOA 1ZEJA 2WEKA 4R69A 5KVQA 4BNLA 3IJRA 3CE6A 1WXDA 1M75A 4YJFB 3QIVA 1I3MA 1MA0A 2CMDA 2P4QA 1PS0A 4MVJE 4BB5A 3HSKA 1AXGA 1UDBA 4DREA 3UCXA 4DBZA 1ONNA 1VPDA 4BO8A 1I30A 3ZW9A 2GDZA 2PGLA 3LT2A 3JYLA 1SCUA 3RUHA 2ILTA 2NVUB 4MIYA 3T7EA 2Z1NA 3PQEA 1C0IA 1T2EA 1ISMA 2PH5A 4E21A 1DSSG 4FCCA 4CV0A 1E5LA 1EDZA 4XGNA 3M1AA 1XELA 3T4EA 4BNKA 1B16A 3KLPX 1PZEA 1R12A 1J6UA 2ZB4A 5JY1A 3HG7A 2BFAA 2VHYA 2A35A 4CQMB 4CQLA 1KEUA 4Q3CA 4R16A 4BNHA 3KYBA 4YRBA 2XOXA 2VUTA 2DPGA 1LI4A 2VT3A 4PG4A 2X0RA 1PS8A 4E33A 1BSVA 1DC3A 3FR7A 3CEAA 2P9GA 3TDKA 1HWYA 3VZQA 1KY4A 2O48X 7ADHA 4C7KA 5HTOA 1UXIA 4QEDA 4I9HA 3P2OA 5DCUA 1NHWA 3W8DA 1GU7A 1R4NB 1RM0A 3UW3A 3I6IA 3BMOA 4XYLA 4R41A 2JL1A 3I4FA 3M6IA 3D4OA 1JKFA 1IHYA 3VKVA 4DXHA 9LDBA 4AICA 4J4HA 4RV9A 5L95A 1E77A 3ZU3A 2YV2A 2AQHA 4RLSA 2R6JA 3GA0A 4J90A 5G4LA 3LLSA 5KVVA 4GBJA 3E6AA 2D2IA 3JV7A 4ROSA 1PGQA 2C82A 2O3JA 4BO3A 1ENOA 2AQ8A 3EHEA 4JBHA 4YB8A 4TKLA 4UEOA 1KC1A 1WMBA 2Q2WA 4RPKA 3VAZA 2EW2A 4OXNA 4Q3DA 3WTCA 1Y5MA 2NACA 1PJ4A 2HRZA 1B2LA 1BHSA 3BMNA 3OQBA 4W9NA 1YH3A 3PQFA 3OBBA 1M66A 5U4QA 4IJWA 5G2OA 3SX2A 3TZHA 1R4MA 1XA0A 2EP7A 4B4WA 4CMEA 4PG6A 1EQ2A 2W2KA 4A10A 4AJ1A 3D64A 4XDYA 1X7GA 1I24A 3S2EA 2XAAA 3I9NA 3MCVA 2HMWA 3RASA 4PZEA 3WX0A 5C37A 1TT5B 4KTVE 1JA9A 2DQ4A 3HN7A 3WNQA 3TPCA 1YL6A 1VL0A 1X7DA 3MWDB 3PZBA 2BHLA 4UVEA 5A3VA 4CQMA 1B14A 3ORFA 4I1IA 2VQ3A 2EXXA 2G82A 3NJ4A 4MP8A 4XQ9A 5KIAA 1U3WA 5F3RA 2E6UX 1NVGA 3EGOA 2O7QA 4TRJA 4K6FA 3FPLA 3UVEA 1VM6A 1PWZA 3NT4A 3QWFA 3KSZO 2Y0CA 3IKTA 1VKNA 4JGBA 4CR8A 2YV3A 1ONOA 5BR7A 3GGGA 2C7VA 1UDAA 3INTA 2X9GA 4YAKA 5BT9A 4FBGA 1DHRA 3OIDA 1LU9A 2X5OA 3K9QO 3R0IA 2POQX 2OORA 4M89A 5CFZA 1F12A 1Q2XA 3FHLA 1PS9A 3ZNNA 3JQAA 2QRLA 4EUHA 2VRBA 5A5EA 2UUOA 5FI5A 1EQUA 1NQ5A 3NUGA 4LRTB 4CM5A 3DMTA 4WNCA 4Z3DA 4U6SA 3T7CA 3GUYA 1ZUD1 4NU5A 1PQPA 4OXYA 3RC1A 1OC4A 2B69A 3QE3A 3D3EA 1EDOA 4TSKA 2HJRA 4YJDA 1SB9A 4YXFA 1C1XB 4M86A 2AEMA 1BVUA 3PLRA 4XQGA 2IEBA 3Q3CA 4TRNA 1A7KA 1JVBA 3I9OA 3TSCA 2Q3EA 1DO8A 2GYYA 3I52A 2GGSA 4YT5A 1DBVO 1E7SA 2FZWA 1HE2A 3DHEA 1R6DA 5TSDA 4TZTA 2J3KA 4B8ZA 3MEQA 4I5DA 3WFJA 1JQBA 5K0ZA 4JJIA 1J4AA 1BMDA 1ZK1A 2ZJ0A 1U3UA 2W2LA 2FWMX 1P9LA 1AGNA 1DIHA 3A1NA 3HQ4O 4XIJA 1SO8A 1WLYA 3G1UA 1XDWA 3ITDA 4GX5A 2EGHA 1BWSA 3D5QA 1KVTA 2EWMA 2YHIA 2NWQA 3JQ9C 3GDFA 4GGPA 2EF1A 4PLCA 1HE3A 1I3LA 3QP9A 2FHSA 4CLDA 5EERA 2J8ZA 3KBOA 4OKNA 2Q4BA 4XYEA 1I01A 2Y1FA 5J23A 2HMVA 5FI3A 1IHXA 3RU9A 1T4BA 4IQGA 3PFWO 4O0LA 4BKPA 3ZI0A 1PGJA 3MOIA 4PLYA 2O23A 2JAPA 1XKQA 1D7OA 3ANLA 3PHJA 4PN3A 5CEEA 5JC8A 4K6CA 1VSUA 2YHIB 3HB5X 3UXYA 3WGQA 1E7YA 1H2BA 1HYGA 1FDVA 4XGKA 5L3ZA 5GZ3A 3GVIA 4QECA 4WCDA 4AJIA 3S2FA 1ZK3A 2VYVA 4UVDA 5H81A 3ZNQA 1HDXA 4BUCA 1E0DA 2RHCA 3FI9A 3RJ5A 3B6ZA 1SAYA 4LSWA 1YB1A 1Q0LA 1S7CA 1G0OA 3DONA 3K6JA 4F3YA 5HRUA 4PLGA 3JQDA 1KBZA 1Z6ZA 1UXKA 4R5MA 4F45A 1H5QA 5JAMA 4LSMA 3WR5A 1YQXA 4HFJA 3UHAA 3ONEA 3EK2A 1SOWA 1YWGO 1Z7EA 3SC4A 1UP6A 3R1IA 1KY5A 1C3VA 4PRLA 4R4JA 3NGXA 3KOUA 1SEVA 3IP3A 3C8MA 4FFNA 4AJKA 3EZLA 1Y1PA 4GX0A 4J16A 3WGTA 1M2WA 3GAFA 1X0XA 4Z0HO 4EGFA 4XB2A 3N7UA 2ZTVA 3TZQA 1BXGA 1P74A 2Y93A 1PGPA 3CINA 3N58A 4GKVA 4CL3A 5JCXA 3E18A 1LSOA 1DB3A 4WCFC 2YV1A 3E8XA 5AOVA 4JROA 3H5NA 5KWEA 1GCOA 4KDEA 1UDCA 5IXSA 3WQQA 3EZYA 1LDBA 2PGJA 3VPXA 1DC4A 2D5AA 3L6EA 4BMNA 1KEPA 4HP8A 3EDMA 2R00A 3N74A 3G1TA 5THKA 4KUGA 3GRPA 2AE2A 4EJMA 4TVOA 3H9EO 4ZGWA 4R9RA 1A9YA 4OHUA 3K2EA 1D4FA 5HM8A 1YVEI 4UEJA 2O2SA 1W4ZA 3GC6A 1F8GA 3DHYA 1MC5A 4G81A 4ZN6A 3ZZNA 2IRWA 4GX1A 3PIIA 1Y8QA 1Z75A 4YEDA 3GDOA 1EVYA 3WMWA 4BNYA 3VPHA 4KZPA 3W1VA 1O5IA 2V6BA 4J1QA 5JAIA 1EVIA 4FS3A 2BMAA 4BL5A 5K6AA 4NMHA 3ZWWA 4N5NA 4YBZA 3GGOA 5JNLA 1NM5A 4BV9A 2G76A 4FFLA 4M55A 4ZQGA 4E4YA 3MJVA 4GLLA 5B4UA 1WDMA 5IDXA 4DQUA 3RKUA 1QXSA 2NTNA 4HADA 3WGOA 4PVCA 1YDEA 1HDRA 4F46A 1NX6A 3PJGA 1ZO8A 5B1YA 3WBBA 3DOJA 5BNFA 3WDSA 3BIOA 1KVQA 5A4DA 5MGBA 1UZMA 4IS3A 3PDJA 2B4TO 1Z74A 1P0CA 1ONPA 1FK8A 3QVWA 5TRTA 3FR8A 4B3IA 3AUSA 2GASA 3VHRA 1P1IA 2CF6A 3FSRA 4W9NC 3CZRA 3RUFA 1GYQA 1CF2O 1U1IA 3L9WA 3K2BA 4B3JA 1QLJA 2CD9A 1ZFNA 1PJCA 3GOHA 4II3A 3LF2A 1K3TA 1R0SA 2EP5A 1C0PA 5TJHA 4EBFA 2B0JA 3ITKA 1ZVMA 3CMMA 4WEOA 1PX0A 1ZJYA 3V1UA 1ZK2A 3F4BA 1XU7A 4F6LA 1ISFA 2BI8A 4FIZA 1NBOA 1F14A 4CM4A 5BSGA 5CDSA 4NNJA 2C59A 3AOEA 5HBRA 3I9MA 2P68A 2HMTA 2OP0A 4AJOA 2X23A 3VZSA 1WZEA 2WYWA 1N92A 4UVGA 1T2DA 4PG5A 3AOGA 2GSDA 4NHEA 2IODA 5TJ9A 1TT5A 2DTDA 1N7HA 1ZSYA 3W4JA 3GEGA 1H6AA 1E3SA 3KSDO 2EKPA 2AEJA 2GF2A 2WTBA 2OGUA 1HZJA 1SOVA 1XQ1A 3WWZA 2C7GA 2QQ5A 3WLEA 3H9JA 4I9NA 1Q0QA 2E37A 3RQSA 3DAFA 4CLHA 5KJ1A 2W8ZA 4UUPA 3ENNA 1O9BA 4BO9A 3D3WA 5U1PA 3BHJA 1TEHA 4Z6KA 3PRJA 1HLPA 4H3VA 3ZGYA 1DJQA 1LLUA 3ZV3A 3LU1A 4M54A 2A4KA 1YS4A 1KYQA 3BXXA 3PEFA 4LGVA 5A02A 2LDBA 1IY8A 1VJ0A 4GKBA 4U5QA 1GL3A 3HE3A 4YJGB 1MFZA 4AJPA 4CUKA 2HDHA 3LSYA 2HO5A 4RF2A 3S2GA 3DTTA 1BDMA 3JD1A 2VYVD 3RUCA 1JKJA 1C0LA 2IE0A 2PV7A 5L4SA 1Y9AA 2Y66A 3NT2A 3JQBC 3LVFO 4OM8A 3DZJA 2HSDA 3HNPA 3SLKA 4IXTA 3ICPA 3U4DA 1Q7CA 1HTBA 1HE4A 3GDGA 4IM7A 1LJ8A 3ENKA 2VN8A 3OA0A 4PCVA 5CAEA 1KETA 2CVOA 5L7TA 2Q1SA 4MJLA 1NYTA 4J7UA 3RC7A 4BNGA 3OQ1A 5T6BA 1DFGA 3CMCO 3CZMA 4ZD6A 2Z5LA 1DAOA 5L7YA 5IDQA 4MVJH 2FR0A 3SXPA 4WOJA 5JS6A 1I2CA 2PD4A 2G1UA 3DB2A 1W6UA 3KHUA 3QWAA 2BI7A 2BGKA 1E3EA 2HK7A 1EUCA 2VWHA 3H4VA 4XRGA 4JJFA 4CMCA 2P5YA 1U3TA 2O3TA 4JIGA 2UAGA 1ZMTA 3U09A 4J9UE 2DBRA 1YQDA 3H9QA 4MVJI 4FJ2A 5JPIA 4DBVO 4P8RA 3KSUA 3I3OA 3AY7A 3PDUA 4RDHA 4TWRA 3PK0A 4FDAA 3WGHA 4MVJD 3O26A 4FPXA 1SNYA 1X14A 1DIBA 4IMPA 1J5PA 1WP4A 3DAGA 4GSLA 2QRKA 1E1MA 3RWBA 2WD7A 3JQ6A 4ZHSA 1N9GB 3H7AA 1JLLA 4E5KA 5BNIA 3F47A 2JFHA 4IDDA 1B8PA 3D0OA 1ZEMA 5AXAA 3S8MA 1MXHA 1E7RA 4IQ8A 4NBTA 2NQ8A 2I99A 3R6DA 1UZLA 2JFGA 1CRWG 5KKCA 4MPDA 3FNGA 2C54A 1HEUA 1NPTO 5EESA 5CDGA 3OH8A 3JQ7B 1LSJA 1I36A 4D42A 3DWFA 3WOHA 1BGVA 5DBIA 1N5DA 1IUKA 2I76A 3VKUA 1PJ2A 2DFDA 2JHGA 2NU7A 3X2FA 2X6TA 4YTEA 1HF3A 1VJTA 1V8BA 3DO5A 1NFRA 3PJEA 4BGVA 5HWSA 1JKIA 1P45A 1LLDA 4NPCA 2PZKA 5T5QA 4NFSA 4LVCA 3E9NA 5IZCC 3UF0A 4AG3A 3H9UA 1YL5A 2X0IA 4GH5A 1IL0A 5MDHA 1Y5RA 1ZKMA 1AHHA 1O94A 2FOIA 4HNHA 1H6BA 5JO0A 4Z9YA 7MDHA 3WYBA 1LNQA 2JCXA 1VJ1A 4YQYA 1FXSA 2Y1DA 5A3JA 5AXBA 4YPOA 3JQFA 4FW8A 4WLUA 2YYYA 5G0UA 3VPFA 1UXHA 3RC2A 4B8WA 2BF7A 4BKRA 4J4BA 1AE1A 3GUCA 2Q1UA 5TGDA 1E1KA 3HFGA 3TL2A 4JLWA 4MKZA 5DBGA 3WB9A 4BNJA 1JDJA 2X58A 5DCWA 1T4DA 4YT8A 2FSSA 2Y0EA 3AW9A 2A92A 1M6HA 2J5KA 4R5HA 4WLFA 5I7EA 3DAPA 5BSEA 1E3IA 1G0NA 4BQRA 1NVMB 1YOVB 1ZK0A 3BMQA 4RVFA 4EUFA 1EBFA 2AXQA 1O8CA 1PQWA 1GADO 1T2CA 4NDNE 5ICSA 2VYNA 3INGA 5THQA 2V7PA 1DRWA 4ZQBA 1WDLA 1CQJA 3AFMA 3DXFA 4FOSA 4IDAA 1X1EA 4UUMA 1PJ3A 1PZHA 3RBZA 4CPDA 4MVJP 1AXEA 1GCUA 3PTZA 5TQVA 3Q2KA 5ENDA 2Q46A 3PZRA 4EDFA 4W99A 2HKIA 4WEQA 4OIMA 1HDOA 3O8QB 1WMAA 4IMRA 2PZJA 2V6GA 2Q1WA 4DLLA 2QHXA 1R0KA 1VLLA 3R3JA 3AI3A 1ADBA 3BYZA 1WPQA 1IOLA 2P4HX 3KYDB 4IINA 5JE8A 2ZYGA 5KVCA 2GLXA 2OUIA 1UXJA 1IYZA 3V2UA 5G0WA 1Y8RB 2DBZA 3OJFA 4DWVA 4F6CA 4BO6A 4PLZA 3DZKA 3JQCA 1QKIA 3DHNA 1F0YA 3WS7A 2JD1A 3D7LA 5JDCA 1E6WA 4Z0PA 3GVPA 1SZJG 1LDGA 1U8XX 3CIFA 4DTIA 2Q1TA 1A27A 3LT0A 1PL8A 4DUPA 4NFYA 1ADCA 4BMSA 4CLRB 1FDUA 1ZZEA 2NV6A 4IDCA 2W4QA 1DPGA 4J1NA 1X7HA 4J9VA 1NWHA 1CEQA 1YJQA 1XCBA 3IP1A 4YCAA 3OETA 3GG9A 4BNUA 1LQUA 4DC1A 1XG5A 4DYVA 3WGIA 4PLHA 4CJXA 1IPEA 3W6UA 1LRLA 1JN0A 4INAA 1FDSA 4NH4A 4OJNA 4TQGA 5T57A 4CMEC 1E7QA 4KUEA 1NWCA 1B3RA 2Q49A 2ZATA 3O03A 4BNXA 5C7IO 3L4BA 2A9FA 4MKXA 4RF5A 3FNEA 5COAA 4LCEA 1W8DA 4CMAA 5GY7A 5TS3A 3RUIA 1TXGA 4PLFA 4BKOA 4R1UA 3INRA 4O6VA 1EFLA 1MG0A 2ZB3A 4QO7A 1RYEA 4I8XA 1UAYA 3U62A 5B4VA 3B1JA 3JCZA 1I32A 1QYWA 3C1AA 4O63O 3TL3A 1ISIA 3QVSA 1G1AA 1Z7BA 2HQ1A 4XYGA 4HFRA 4TKMA 3ZDFA 3L6DA 4K28A 5G4KB 4G2NA 1MXFA 1ZW1A 3V5NA 1A7AA 3D4PA 3DZIA 3MJTA 1SEPA 1GV1A 1I33A 1YXMA 1ZIDA 2Y67A 4Q3BA 1C14A 4RQTA 4RVHA 5ILOA 2YFQA 1LXCA 2IZ0A 4R3WA 1H94A 3WYCA 1YBVA 1MGOA 2Q2VA 3IQDB 2V6FA 3LLVA 3GT0A 4QFDA 2RCYA 1NTOA 3ZV4A 4BIIA 4Z9XA 1LX6A 1X0VA 3UICA 2D3TA 4DLBA 4IJVA 4YJFA 5KKAA 4WLOA 2LDXA 3DZGA 3ZWOA 3NX4A 4CL8A 1PJLA 4R01A 2ZQYA 3AOEC 4CODB 3UAGA 2WYUA 3NAQA 1ID1A 4NK4A 4XWYA 4OQZA 1H93A 1T24A 1QMGA 1QR6A 4IXWA 4M8SA 2P9EA 3ADPA 1ZBQA 4TZKA 3ZWCA 4IIUA 4QTZA 1H6CA 2ZYAA 1QYCA 2CVQA 3QQPA 3WQRA 3HDYA 4J2HA 4ZQEA 3O9ZA 2RHRA 1KVRA 2H63A 4OMUA 5JXWA 3MJCA 2ZIZA 1GR0A 2GZ1A 1RYDA 4B7CA 5A9RA 5JCJD 1E1NA 1LDNA 3MJEA 2PTGA 2VT2A 1Y6JA 4XD2A 4QQRA 3OA2A 3DTYA 2H1SA 3VPSA 5EQDA 2X5KO 3ZH2A 2NLOA 4WUVA 4A03A 2TMDA 1P1RA 4EW6A 1MB4A 2JD0A 4RF3A 4E30A 1G6KA 1S6YA 5C7OO 4CMBA 3AI1A 1JAYA 2O4UX 1K5HA 3ETDA 1LDYA 3VH4A 4O5OA 3RD5A 4D79A 4LMRA 5KTKA 2RH4A 4MVJG 1M67A 1PR9A 2HUNA 2BKAA 4YDRA 2XF8A 2BLLA 3TZ6A 4YRDA 1NPYA 1YKFA 3H65A 1P1KA 1PWXA 5JMWA 2QYSA 5G4KA 3WJAA 3ZWMA 3K5PA 4CM6A 4Q3AA 3RIHA 2CDAA 1GYPA 2C07A 4LCJA 4LMPA 2FPGA 3PYXA 4R9SA 3LC2O 5HS6A 1SBYA 4KDFA 4N5LA 5IJZA 3ON5A 1XQ6A 1CIVA 4AVYA 2OBNA 2AHRA 4RZIA 4R51A 2ET6A 2QX7A 5A9SA 1EE9A 1P1HA 4UVIA 3RBXA 5ICMA 4MKRA 4AJNA 4JP3A 4W4TA 3K73O 5DULA 1VC2A 1LTHR 4PZCA 2GN9A 5JLAA 3GNSA 3IOYA 3C7DB 3MJSA 4L4SA 4BKQA 4S3MA 2RH8A 3W6ZA 4M87A 2QYTA 5JC1A 1HZZA 2W98A 4K9DA 4IUYA 4URFA 1UXGA 2VTDA 4UREA 1R16A 3OJLA 4E6PA 2HJSA 1ENYA 4S1VA 2EW8A 2HK8A 1Z45A 1H0KA 3P19A 3GFBA 2Q45A 2VTEA 4FN4A 3G17A 1P1JA 2YQ5A 4H7PA 1XGKA 2ZCVA 3ZU5A 2D0IA 1GY8A 3PP8A 1B15A 3ROQA 2NVWA 4ALKA 1NQTA 1HT0A 1ZJZA 4N5MA 5I7VA 5K6AC 1MX3A 5T8KA 4D44A 3ZV5A 2G0TA 4OSOA 4ND2A 1YBAA 1NAHA 1K6JA 4RGBA 4CLOA 1JAXA 2G17A 3F9IA 1EFKA 2NU8A 1BDBA 3I23A 1CERA 3ONFA 3QWBA 3ROMA 4DMLA 4BO4A 5G0TA 4JXKA 1L7EA 3W8FA 4QFCA 4JP2A 2GRAA 2X8LA 3PIDA 4ND4A 4MOWA 4BHTA 4HV4A 3JQ7A 3ZWAA 1YB4A 3HHPA 1E92A 1N9GA 4WECA 4L4RA 3UCEA 4E5YA 2I6TA 3BTOA 2FRDA 1PZFA 5CDYA 2IZZA 3AUAA 1V3TA 1PSDA 2ZTLA 1EZ4A 3BMQB 1ISJA 5F5NA 1O89A 5BSHA 4BMVA 1JTVA 3GNQA 3ONDA 5H83A 5EIOA 4A2CA 2WE7A 1FDTA 4A0SA 1E6UA 3VDQA 2VRCA 4B4VA 3JTMA 1DIRA 2NQTA 3PI7A 3L4BC 3AWDA 2O4CA 4FQ8A 1T1RA 4OSPA 1E7MA 1PJTA 4MO2A 2WD8A 3FNFA 3KM0A 3ST7A 2JJYA 3KUXA 4XIYA 3UGKA 4U0KA 1LEHA 4DYDA 1UH5A 5L4NA 3F5QA 1P44A 1UUFA 3VH1A 4BNIA 3BMOB 5TT1A 3TJRA 1XSEA 1GZ6A 3KRTA 3U4HA 2X1HA 3JQ9A 4RDIA 2GD1O 3NDRA 4IDGA 4W7HA 3AUUA 4XEHA 4IGEA 3AI2A 5FF9A 1U7HA 1PEDA 3I9JA 1E3WA 3OIFA 3PLNA 4IPTA 2EKQA 4ND1A 1PGNA 2CZCA 3IMFA 3JYQA 3RROA 3OMLA 1WWKA 2UUPA 4BS9A 3ICCA 3VTFA 3LT1A 4J4TA 3V2GA 3DMYA 4XJSA 2PKQO 1F06A 2FPPA 3RUAA 4AJ2A 3ZU2A 3NKLA 4ALJA 4K26A 3IJPA 2Y0DA 2JAHA 1Y9EA 1GPJA 1WNTA 3A06A 1KOLA 3F6YA 4E5MA 1V3VA 2X0JA 5DNAA 3EVTA 1RM3A 3ANNA 3KEOA 2FP4A 2BFOA 5I9LA 2E49A 2GO1A 2D59A 1PL6A 1ULUA 2DU8A 1DLJA 3EMKA 4DIFA 2X22A 2IZ1A 3KYCB 1YO6A 1P3DA 2BH9A 3P5SA 1BTOA 1P31A 5BNTA 2NADA 4A73A 4CLXA 4EEZA 2GN4A 4ND5A 4CM1A 2W90A 4ZVVA 1HYHA 3KYDA 1OBFO 2R2GA 1FDWA 2I66A 1OMOA 2GN6A 1K6XA 1DRVA 5JYDA 5JY6A 2FN7A 4JQCA 2GPTA 3IKVA 3L6OO 3PWZA 1EUZA 1R15A 3AM3A 4XB1A 4BNZA 1ARZA 1LDEA 2OOSA 1PTJA 2OZPA 3ROKA 2I3GA 3DBLA 1DLIA 4NBWA 5JDCC 3PGJA 2B83A 4NZ9A 1GEEA 4ALNA 2HCTA 1K2WA 4CR7A 5KCZA 3C7CB 4M1QA 4FD3A 1N7GA 1LC0A 1EVZA 3NV9A 2B37A 4WK6A 3L0DA 5DZSA 2VHZA 3GLQA 2IYOA 4W7IA 5DF1A 4KWHA 3FBGA 3HFSA 4DPKA 3C1OA 1PJSA 4CLRA 2VHWA 4ILKA 1RPNA 5DOVA 4ITUA 4N7RA 3GVCA 3DBHB 2BFPA 1LRKA 1BG6A 2VYND 4HFNA 4B7XA 4MINA 4D45A 2WSBA 4CMIB 2YJZA 1LLCA 4XCVA 2YHUA 3SC6A 1E5QA 1BXZA 2CFCA 4B3HA 1OZAA 5AQ1A 4Q3EA 5C7LO 3CUKA 2OXIA 4JNKA 2I5PO 4CM8B 2YDYA 2UV8A 4NI5A 4EEXA 3H3FA 4IDBA 3WLFA 3WTBA 2VNSA 1A5ZA 5KVSA 3OHSX 4QSMA 3MJ4A 4DQXA 2YQ4A 3L07A 3TF5A 5TC4A 4NG5A 5TX7A 2AG5A 1HDYA 2DBVO 3GRKA 3OICA 4IIVA 5A05A 4EUEA 3NGLA 3BA1A 5KJCA 1GD1O 2YZ7A 3HDQA 3JQEA 3WICA 5JBIA 2O3QA 1U2GA 4J43A 3ZHZA 3U0BA 2Y99A 1HDZA 4U0JA 1X1TA 2NU6A 1A4UA 4TVBA 3AY6A 4W6ZA 5EINA 5EJ2A 4BO1A 5L7WA 4GI2A 3VDRA 1MV8A 2NUAA 1LLQA 1MFPA 4B79A 5L45A 2FSVA 1IPFA 4BO7A 5F1OA 2PWZA 4PLPA 1XYGA 4HKTA 1Z73A 4IZHA 1JW9B 2I67A 2WYVA 3WG9A 1LRJA 5F1KA 3ZHXA 4KQWA 1WDKA 3ZWYA 4RCVA 4IDFA 1UZNA 4B7UA 4YAGA 5FEUA 2VWPA 3VH2A 1B3BA 3Q0EA 4KP7A 3WNVA 4KQXA 2VUSA 3PFFA 1PU2A 1A72A 1LSSA 3DC2A 3QW2A 4GQAA 4CM3A 4CMHA 4WKGA 4L75A 1X13A 4YVFA 3EAGA 4GGOA 5AYVA 3JQGB 2DTXA 4P4GA 3GY0A 1QLHA 3UCFA 3QHAA 5IFLA 3FNHA 4HWKA 4JX8A 1XWFA 1GEGA 4BNWA 3QWHA 3VZPA 3JQ8A 4HBGA 4YAJA 1NASA 2TMGA 5F5LA 3VVBA 1UP4A 1KVUA 4GPD1 4MP3A 2NNLD 2NVUA 3OJOA 4OOFA 2HMUA 3V8BA 2IDZA 3Q9UA 5G0VA 1XR3A 4LN1A 4GWKA 4AJEA 3I9KA 1LUAA 2F1KA 4RO0A 4X54A 2BGLA 4QUKA 2AE1A 4CQLB 4E5PA 1DDOA 3LYLA 4L76A 2OO5A 4EITA 4DPLA 2SCUA 4RPJA 4TRMA 2DFVA 3JD4A 1RM5A 6ADHA 4E13A 4IZIA 4J0FA 1I2BA 3KETA 2VZ0A 4XYBA 3VH3A 1HL3A 5EPOA 5T64A 1KVSA 3RC9A 2AMFA 2FPIA 3DFZA 2XXBA 3RUEA 3X2EA 4BQPA 3GEDA 4WOKA 1JVSA 3F5SA 4NBUA 2OBYA 4L8VA 1U2DA 4RVDA 3WJ7A 3ZWBA 1E3LA 2CUKA 1HETA 1N1GA 1R4NA 3AK4A 4IY1A 4YJHB 3RBVA 3RUDA 3WSVA 1A9ZA 1OI7A 1QYDA 1QYXA 4FJ0A 4GVXA 2F00A 4L74A 1E3JA 4J7XA 4NBRA 3FN4A 4A5OA 1ADFA 1PL7A 1Q1NA 5KOIA 3F1KA 3CKYA 4GX2A 2WWRA 2C29D 4P22A 2Q50A 3WXBA 9LDTA 3LDHA 3WWYA 4UEKA 5IN5A 4MIOA 4KWIA 4P4NA 5JFOA 1FMCA 1P1FA 3D3WB 3PGXA 4ID9A 1T26A 3HJAA 1J49A 1T1SA 1K6IA 4UUOA 3OJEA 1F8FA 3V1YA 2NTJA 2X7HA 4A27A 3GPDG 4XGIA 4N18A 4QX6A 2VHVA 1ZNQO 3K92A 4GL4A 4PG8A 4A26A 3PXXA 5TT0A 4JCOA 1DFHA 3RJ9A 1TA4A 4D3DA 3SEFA 4ZQFA 4CUZA 4YACA 3DMTC 3GMSA 4RF4A 2VZ9A 2UDPA 4PZDA 2H9IA 3U49A 3H8VA 4NU6A 3RVDA 3LK7A 3UN1A 5I8ZA 3V2HA 3BTSA 1ZSNA 1V35A 3QSGA 1H2HA 4RJTA 4E2ZA 4RPGA 3OEYA 3G79A 2FR1A 2Y1EA 3NT5A 3KLMX 4NJOA 3KYCA 2VCYA 4OXKA 3GN1A 5ER6A 2WDZA 1JU9A 1DOHA 3JD0A 3HN2A 3OECA 3ASUA 3PWKA 4Y6SA 3W8EA 4YA6A 4OQYA 3F1LA 4FR5A 1BW9A 2PNFA 3H9GA 1V3UA 4DL9A 4IQ0A 4D0RA 3IAHA 3NDIA 4YJHA 2Z95A 1QSGA 1B7GO 3RFVA 1U5AA 3HDJA 1EK6A 4FFOA 8ADHA 3D1LA 4WNIA 1LBEA 3JQGA 1PGOA 1Q7GA 2AEFA 3GR6A 3QVXA 3PHHA 3NTOA 3VPGA 2GCGA 2HMSA 4P4LA 5U9CA 2VZ8A 5KNLA 5DP1A 3E48A 5TF4A 3PVZA 5IDWA 4NBVA 1DIGA 4NIMA 2X4GA 3IC5A 3E1KA 4XR9A 1O95A 1T25A 2X0NA 3MTGA 2AW5A 4E3ZA 1K0UA 2NTVA 3KO8A 1N2SA 2EEZA 4R3NA 4YYZA 2JCYA 3TRIA 2H6EA 2HLPA 3NTRA 5A06A 3LQFA 4OAQA 1PZGA 3FWNA 1JWBB 1UR5A 5CHEA 3ASVA 4WLVA 3TZKA 4U8GA 1DAPA 1XLTA 2EJVA 4CV3A 2H5LA 1QYVA 1D3AA 4PGFA 3AJRA 5ITVA 3PYMA 3ZN2A 1NFFA 3DR3A 2DPHA 3L9XA 1ZXLA 3STHA 3RCBA 4NQZA 4RVUA 4CQMD 1C1XA 1DC6A 3OQ6A 2FR8A 3VZRA 2FZEA 1H9BA 5C3MA 1P77A 3AU8A 1XEAA 4XRRA 5LDGA 4Q9NA 1Q7BA 4FSHA 1KC3A 4UULA 5DOZA 1O0SA 3ROPA 1NHGA 3V1TC 2JD2A 5COQA 3SVTA 1YRLA 1C1DA 1BRMA 1GQQA 2J6IA 2I9PA 1PJBA 1DRUA 3OM9A 3RI3A 3A28A 1U9JA 1C1DB 2AQIA 4CM9D 3GG2A 4IDEA 1WW8A 1U5CA 2HRBA 3VVCA 4D3SA 3DZFA 4BGIA 2J3JA 2J3IA 4CMIA 2BGMA 3DEYX 4O1MA 4ZQHA 4Z9FA 4NK5A 2HK9A 3FTPA 1HKUA 2P91A 1ZK4A 1ZMOA 2C20A 2Y68A 3H3JA 3OF2A 1AN9A 4R1TA 5A03A 3TN7A 3UH1A 4AJ4A 4XA8A 3DBRA 3SLGA 1YOVA 4WE3A 4PLTA 1ENZA 2VOEA 4LISA 4LVUA 3I1JA 5FFFA 2I3AA 4ZRNA 4HX5A 4KTTE 1U4OA 1HDCA 1XHLA 2O3RA 3KV3O 4XQCA 1GZ3A 1GZ4A 4E31A 2B4QA 4ZA2A 3WMXA 3ZCXA 1NVTA 3BHIA 1I3NA 3Q11A 2YUTA 3WIDA 1U3VA 5EL0A 3E9QA 1GQ2A 3ZNOA 2PGDA 1SPXA 2OHXA 5L9AA 3FRJA 2PY6A 3BTUA 1I3KA 3VC7A 5IXYA 1OOEA 1UAGA 4JN6B
chains in the Genus database with same CATH superfamily
2GUGA 5EMLA 4KQKA 1ZI8A 4PM4A 5KTNA 3WYNA 4F97A 1TCCA 3I01A 5FI1B 3RO7A 2B4RO 5ERYA 1L5QA 3JYNA 2O57A 3NVAA 4WASA 3DE4X 4ZVUA 3EEOA 2IS2A 1SM4A 2Z9DA 1NRWA 4KGVA 3KVRA 1BD4A 4Q9KA 2FUKA 5FA8A 1X92A 5I5EA 3KTAB 3GEIA 3BAZA 4C0AC 2PD6A 1FS5A 3URMA 1UM8A 1FXWA 1GVNB 3DBRB 1YK0A 1KMCA 1T8SA 1CETA 3LVQE 4OJYA 4QJ3A 1RKXA 2F8TA 1DQYA 3MTJA 2QQGA 3W5AA 2WINI 4UNIA 2IPNA 1H2AS 3UKOA 3C1UA 4GI3A 4R98A 3OQIA 2CF5A 4BVAA 4OXRA 4BWYA 4HDAA 5CT9A 4YR9A 5LLDA 4G4SP 1YS1X 3DWGA 4I4CA 1MRZA 4MVJA 4MIEA 3UK7A 3NETA 4J0CA 1BW9B 4R1SA 4JZKA 4QO8A 2C03A 2MWMA 3QLJA 4FFSA 4W8OA 3DZDA 1IY1A 4QU9A 1VJRA 3AFHA 4QQNA 1K89A 1P6UA 5IDYA 4OHFA 3RK1A 3FCOA 1RKVA 3BWXA 2JIQA 2FPIB 1NY6A 3TQHA 4AP5A 4JT9A 2XUZA 3IS3A 3Q1LA 5AJZA 4N3NA 5H70A 1ZNXA 3SLRA 3G2OA 4ZI7F 4X1KB 2J5QA 4QRIA 1MOPA 1Y81A 1T5OA 3PR3A 4RQBA 2JANA 1X9GA 2IOYA 4LDJA 4ENTA 2ZPUA 1FFDA 1NUAA 1I10A 1TJ3A 3D5TA 4DZRA 1NJSA 4DIUA 1UBFA 3FKQA 3PC2A 2VHTA 3BF7A 4HDMA 1ACLA 4EPRA 3WWPA 4ALIA 4N47A 1CF4A 5BQFA 5AP9A 3ZU4A 1BROA 3GELA 4BASA 4DC9A 5IZCA 1G17A 3CVOA 1T3LA 3TLMA 1APBA 2IA5A 1Z4JA 2JBWA 3JPYA 4KXQA 4V38A 1CC1S 1OROA 1I51A 3FY4A 3D43A 2VJKA 3ERCA 4JI6B 2QZSA 4PZYA 1D8AA 2QTMA 4TVKA 2JFZA 1CDEA 2PS3A 4JJAA 2WJHA 2EWWA 1TB4A 5JPCA 1ORRA 2H4YA 3N39C 4TVSA 3OKCA 3NNNA 1W88A 2ZVDA 1OXXK 1A9SA 5A4IS 2YIVX 1S4QA 3GAMA 4FB5A 1EFTA 4CM9A 3BQMB 2WJ3A 3ZHYA 3KZVA 4F71A 4H1TA 5FLXA 2VDLB 4AS1A 2M2IA 3BC1A 4HB3A 4MI6A 5E1DA 3RVRA 3BH0A 3I0NA 4HQOA 5FL3A 4CM8A 4GI1A 2HMAA 1M76A 2RBEA 4FNAA 4XWTA 2V4UA 3CX4A 1X7ZB 1NXPA 1ECGA 3K3PA 3O83A 4OLBA 2HHLA 2GSWA 3BN3A 1TA9A 2JH9A 3B7GA 1C30B 4Y18A 4E5NA 4EHLA 1AUPA 2YOFA 1I9CA 2YXEA 1QHHA 4L5CA 1DL5A 4W8GA 4HTFA 1BX3A 2ZKLA 5IJ9B 3BIJA 4RD1A 3QLVA 2QTVA 4BYMA 1YHZA 3KHKA 3R40A 4Z8YA 3U44B 3UXEA 1WCXA 5JS1A 1GQRA 1C4OA 1UJMA 5EE1A 3C5HA 1YF3A 1ZW6A 4EJ0A 3MCUA 3HL0A 4ESEA 1YGYA 3WGUA 4CIAA 4I1PA 1PT9A 4EYQA 1YQGA 1DBQA 4JD5A 5EMNA 1S4MA 2VP5A 2W2TA 2WM9B 2CSXA 1VDMA 5IBPA 2HRDA 4C30A 3VSAA 4ZAXA 2CXNA 3H5RA 3MS2A 4OPMA 4TLLB 3MUFA 2VKQA 2QUIA 1Z6PA 1OLSB 2VJYA 4NEHB 4BQIA 1DXQA 3N3AC 1Z9BA 4H6VA 5FPSA 1UOOA 4QLOA 3Q6IA 1H22A 2C1EA 1VKZA 4JLNA 4N0DA 3TO5A 3X2SA 4WOPA 1LLFA 3ZZ1A 4YJGA 5CG2A 4BLTA 5LCXA 3M6UA 3U4IA 4M9CA 5LQJA 2ZYSA 1X39A 2AXPA 1KRHA 3ZW8A 4C07A 2VWGA 2DJIA 5JHGB 5ICGA 4A1FA 2VC2B 3IP7A 4KFTA 2I7XA 4UAJA 2PD3A 3WSTA 2M32A 5BT8A 4JHXA 1DKPA 3JAWB 1SIOA 2JS7A 2C31A 3Q9LA 1I5RA 4A0QA 2AOWA 1RRVA 4XM0A 4DA0A 2H9AA 1J2EA 2AOTB 3WP1B 2WG1A 4OI0A 4TKVA 3C15C 2AK2A 3RT7A 3WSWA 1E4OA 2JATA 1XI2A 2XY4A 3FPCA 2G9ZA 2GPBA 2WU4A 3N2NA 4Y98A 3VHLB 4B35A 4LJ4A 3HJHA 2P2NA 5I7SA 4NBNA 1G2IA 3A7EA 3ESYA 1ULSA 3ZWNA 5CLFA 4OUDA 5I9TA 2DSNA 4C4RA 2YRWA 1QBKC 3ETNA 2HIHA 2F1JA 3UWKA 1L7AA 3KTDA 3RLFA 1GQYA 2GK3A 2OFOA 3I05A 3OU6A 2WBLC 4G9EA 4P58A 1ISHA 4XVQA 5AVOA 3HVJA 4YK7A 4IH4A 3PX3A 3TR5A 3UW1A 5KAMA 2YRFA 3DV0B 5D5HA 3SEAA 5KOYA 3DPIA 4BO2A 2A5LA 1XMOB 1ZGJA 2D5CA 3MZ0A 2IOHA 4H35A 1L9XA 4R84A 4HNSA 4Q93A 1Z33A 4HWTA 4DVGA 3DZHA 5IAEA 5AO9A 4YONB 2EJUA 4JBYA 1J8FA 2IYPA 1ML3A 5BSRA 4BGEA 2ATEA 2XPCA 1BJKA 3L77A 3SIWA 5AHWA 3MBOA 3PNPA 1DBSA 4CEIB 4H7FA 2YXBA 3G82C 5KJEA 4B4OA 4ARBA 2Q4EA 1AD2A 3LXUX 4L02A 4YWHA 4U7FA 1DAHA 4F92B 4UBNA 5G0SA 5TMPA 1N8TA 3CVJA 1ZM2A 4WCVA 2P5TB 3D4IA 3IMEA 3EA4A 2J9XB 3F7OA 3N6VA 5CP8A 1Y3HA 1U8UA 2AVNA 5CFRA 3KVOA 4DV4B 2ZJ1A 1DUIA 5AKEA 5B64A 3NOXA 4KE7A 3MGKA 2BEWB 5GWXA 1NGSA 1XU9A 1ODSA 3OE7D 1YCDA 3QFTA 5DGIA 1HMPA 2I0FA 1G7SA 3CO5A 3LIIA 4QVKA 5D2CA 3P0JA 3FPAA 5BSFA 4XR4A 3VR6D 4JYBA 3NRJA 4C6HA 2PUBA 3IEVA 3ZCQA 2NZWA 4MYRA 1ZXXA 4J1TA 2VA9A 3TB4A 5L40A 5K51A 1RKUA 1CUDA 2J7PA 5AI4A 5E4JA 4IICA 3RRJA 2IC5A 2F3QA 1IEVA 2JZNA 4JYCA 2ATVA 4Q6BA 5DSZA 1KDVA 3FIJA 1Z7WA 2FZKA 4CLEA 5I8WA 3IE1A 2XD9A 2XCOA 2L0XA 5A0VA 2V65A 2YWXA 4X7BA 4EZBA 2W93A 1A82A 1UODA 3P9ZA 2H0RA 3ZS8A 1W0KD 1NKSA 3SYMA 3GBSA 4DSUA 4RIGA 3Q72A 2IUYA 2GPNA 3GQVA 4J7CA 1T6ZA 4UZEA 1M1YA 3R7WB 1BU8A 1NURA 2E82A 4TYWA 2G80A 4I9GA 1OXVA 4ENQA 4HBZA 1ESEA 4K8RB 4LHVA 1P81A 2RJ3A 4JJZA 1U5BB 2YRXA 4X8LA 3BXZA 1NPDA 2CNKA 4E0BA 2E4AA 4LF7B 1J8YF 3EVBA 4LMAA 3NBMA 1DX6A 4FFPA 2JGDB 4L1KA 1P0MA 4CIBA 1VI6A 1Z34A 3V4ZA 4QXOA 5JNRA 3JASB 1CWUA 1JQKA 5C5CA 3ISVA 4RK4A 3SOZA 3V9AA 3ZIDA 4HAWA 3F6CA 2FPPB 2F1OA 2C7RA 3DTVD 1JYSA 4AJLA 4C4AA 2Q3FA 3OY2A 4H9GA 3DL0A 4XDGA 3U3DA 1HY3A 3OVMA 3GLUA 4EYEA 3TRFA 2IXDA 1OX4B 1E3TA 1VG8A 5DIFA 4HWRA 2QJRA 4ODIA 4B0PA 5TIIA 1CJVC 3D3NA 3WK9A 3V8NA 1GGEA 3GZNA 4QPPA 3LY9A 1AS2A 5H3CA 3SSMA 2J08A 1EBUA 1U7TA 1W4LA 4L50A 2RGRA 2OORC 4KR7A 1IXKA 4GW3A 1PZMA 2DKOA 1BO6A 2WUEA 3VZBA 1K8ZB 4OHBA 4UTVA 1C9JA 1T2FA 1TK2A 4GRIA 4Y6QA 1T8TA 3QJGA 3FZYA 3NTQA 4H7HA 4YWJA 2ZSDA 5IC6A 3V46A 1UIMA 2YVQA 1EK5A 1JHPA 2FUEA 5IVDA 1T9AA 1W8IA 2Q5JA 3GJXC 4Q03A 3NNDA 4YMSA 3S68A 3ID6C 3TNLA 4MYSA 2IHVA 3DQPA 2H7CA 2ZUEA 3GUVA 1E5TA 2FDXA 2O2YA 1JU3A 4AXXA 5IK2A 1NDHA 4L78A 1DIAA 4L9WA 5HUHA 2YY7A 1LSUA 3C6XA 3U3XA 2IYQA 4JP1A 3DKIA 5K3CA 5AVTA 4WFJA 1RAHA 2QLMA 1YMQA 4JBGA 4TGLA 1M3SA 2X0EA 2WKWA 4CCWA 1NNSA 3OJCA 3QVTA 1YZHA 8OHMA 2GXAA 2XNSA 2BHRA 3A9WA 2HZ7A 1CB0A 4TMKA 3UOAB 3A05A 3PQDA 4R0VA 2KWIA 3W5JA 3THXB 4D41A 2NUPA 2XSZD 1VLVA 1H2ZA 3M9WA 2O3UA 4KH0A 2VDKB 5IF3A 4LF4B 4OL0A 4G0WA 1VIDA 4QGAA 1DTSA 5BVGA 1ZYUA 5A1TA 3CW2A 2YW2A 4YFVA 1Z2DA 3OFND 1KMQA 2XB4A 2X2EA 2CNOA 2ZYDA 3FUTA 3T34A 3W90A 2P3SA 3T7DA 4Y8VA 1U2RA 1GUBA 3C3XA 3QE9Y 5G40A 1PBTA 3TQIA 3TWOA 4MHTA 3F90A 3ZWOA 4GR9A 1T4CB 1H3NA 2H3EA 5KJ6A 1CX9B 2PPVA 3KSMA 5H02A 5CCEA 2NYRA 2Q99A 3JQAB 3THWA 1H9AA 1IJEA 1V5EA 1FZQA 2BDEA 1HLDA 3WIEA 3GHYA 2HCBA 1CE8B 3EGXB 4LRSB 3W9YA 4ZJUA 3JASA 4CKZA 2E3JA 1D1TA 2AL7A 3PHGA 2YDXA 5IBRA 3RFTA 1HORA 3COJA 4N0EA 1YBMA 3QKIA 1C1YA 4XDZA 5TNXA 3IDSA 1VSVA 3DBHA 4OB7A 5HOQA 3MLAA 1MQ9A 2VI5A 2PAAA 5A9TA 5JBNA 2BELA 2EDCA 1MC4A 5A4FS 3FWZA 2BEWA 3HGQA 4R05A 2QZ9A 4NR0A 3A6GA 4GMFA 5CURA 5E1BA 5FPPA 4ARZA 4ARUA 1Q5PA 4TRRA 4XJTA 3OCZA 5F7ZA 2D6FA 5DYNA 5HUQA 5L3QA 3F97A 3WA7A 3G9UA 4MYDA 4OQNA 4DVJA 8LDHA 1INLA 1RHJA 2Z57A 2QORA 1S7GA 1K9SA 2O2HA 4WCFB 1EVEA 1ZGZA 3FB4A 3WZ2A 4Z1OA 5ENVA 2C7QA 2OFWA 1BCRA 2W00A 3UXHA 4LDPA 3QLTA 4LOLA 5HCNA 3HO1A 5DE3A 1QP4A 2G88A 3EWAA 3T6KA 1VMKA 3F8WA 3NWBA 1L1EA 3HS3A 4MO9A 2XTMA 1A3CA 3PUWA 4GLBA 3DLIA 1Y6GA 3W9UA 4TKZA 3HEBA 4PU0A 4ZGBA 4ESVA 3HI4A 4KHZA 1UMBB 1YB5A 2EKLA 4FFMA 1D2RA 2QW8A 4UHFA 1NN0A 4YBRA 5F3WB 1Q7EA 2GPYA 3BFVA 3VBCA 2OV1A 5KHAA 2A30A 4Q39A 2XECA 4DV0B 3RRBA 1ETUA 1FP2A 2PR2A 2BN4A 3ED5A 1DKNA 1R6VA 2VVTA 3EIUA 1FCJA 2ZFUA 4UM8B 5TB5A 4L7VA 4D96A 1JFVA 1U2PA 1VMIA 3G8YA 3IL2A 5CITA 2PCJA 4H7KA 3WNDA 2E48A 2QL5A 4K46A 1XD2A 1HE5A 4FC7A 4KXLA 1ZCAA 4D3FA 3ZDBA 4RIFA 3H11A 3LZ6A 3PXDA 1XNQB 1B41A 1CY7A 3TR6A 3U4MA 3HYLA 1KOGA 3ZXYA 3GRCA 1MX9A 2GJ9A 3ZHQA 3HSYA 3MWEA 4Y2YA 4D4IA 2JCSA 3ZDXB 2D4AA 1NXTA 1UP7A 3PICA 5ITWA 4EUNA 3NC1C 1XJCA 3BSFA 1UFQA 5T4BA 3QEAZ 1ZG3A 3RIYA 2Q07A 3SKYA 3ZI4A 1NI4A 3JQPA 4NCAA 3ETGA 4AKSA 3GK3A 3FSJX 4P2GA 1AURA 2IXGA 3PHLA 1RI5A 3ELDA 1DJOA 5BW4A 1B00A 2MU1A 3GLHB 4NJMB 2B8TA 2HU5A 2JKVA 2NU9A 2Q6LA 3B70A 3HU5A 3IBCA 4D3YA 5IN4A 4Q3NA 1AV7A 5ECYA 3U1BA 3ZCRA 1LNSA 3MWEB 4AX8A 2LW7A 2Q9UA 2X8AA 1L7OA 5AXCA 2XOKD 1I8TA 2HBYA 1IWPB 2PSHA 2ZWAA 1TJPB 4Q3LA 3T1QA 4G5HA 1KH3A 5CJPA 3F3SA 2H8GA 4ENRA 3E9EA 1WF3A 2NP6A 3UK6A 1FZTA 1OILA 4D4GA 4BNVA 5BYAA 1OZFA 2IVZA 4MA4A 5JSFA 1HFEL 3A9RA 2KJQA 2QTCA 3G8BA 2HGSA 4GVLA 4MEJA 4OBEA 3HLYA 4FQ5A 5H7XA 2QG4A 5DI9A 1S1MA 5D00A 1GT91 2IXBA 1KAOA 2PGOA 4PINA 5AICA 5ES3A 2FPGB 4ZT7A 2R00C 1EGAA 3SBEA 1QORA 5E9WA 3ULKA 3QOXA 1GTMA 2P2LA 4DARA 2VRCD 4F11A 5KHLB 4RTMA 4Y67A 3EXG2 4X44A 221PA 1GRQA 2BEVA 2ZVQX 1JBEA 2FETA 4PRZA 5CPBA 2N9UA 2WIDA 4WGGA 1K4MA 3I1IA 4WZAB 4PVDA 4EY8A 5KYTA 4L3WA 2GRJA 4MQ6A 4TM8A 1YDWA 2G07A 3QXXA 4M7WA 5CX1B 2WKPA 5BQXA 5LOVA 5JJIA 3GF4A 4HOYA 2XGJA 1RRFA 1M2OA 1BFKA 4JL6A 3I6QA 1U2ZA 4TYQA 4BJ1A 3C3WA 3JWIA 3I5MA 3KKMA 4NARA 4TSFA 5TLSA 1T1IA 4C88A 2WM3A 1W4RA 1T3GA 4HATA 4ONEA 1ORVA 1IAVA 1NRXA 3H8SA 4XCXA 5F1PA 3VTZA 3CXRA 4XSHA 5JATA 2C2YA 2VAPA 3HPQA 4P84A 4KJZA 2C3UA 3KZXA 3LBHA 3OM8A 4Q1BA 4H1WA 5FTLA 5KVQA 2NVOA 1F2DA 2P9BA 4ZO4A 1O94C 1AKYA 2J7PD 3FVRA 3FX2A 3HKCA 4ZVRA 3CE6A 1EWTA 1OI2A 4YJFB 4F6RA 3SHQA 4D25A 5C4IA 3QIVA 5EXXA 1I3MA 3NCHA 2EHJA 4MVJE 2IH5A 4RSRA 1QP0A 3EMVA 4KQMA 3LUKA 3PVSA 4BFUA 2WJAA 2RG1A 3VU9A 1G3MA 2VHCA 1VPDA 3IT1A 2RGNC 4BO8A 1QCCA 2RAUA 1F6BA 3LT2A 4PIMA 2WTXA 3RUHA 2QAIA 3LWDA 4QOSA 2PH5A 2NMVA 4D9NA 2BM0A 1DSSG 5A7HA 4CV0A 1PG0A 3KPWA 2CUTA 3W06A 4KITB 3LFUA 2R5FA 4RIIA 2I6UA 3T4EA 3PHCA 3W05A 3FUCA 3RANA 1Y3FE 4B0OA 5LMUB 2FUG6 1J6UA 1RACA 2WWIA 3NHPA 4H27A 2XKBA 3FHOA 3H1PA 2ZB4A 4LYEA 5JY1A 1NXWA 2FEMA 3R5HA 4LK2A 5THXA 4FYKA 4BP1A 2GEKA 2VLIA 4CQMB 2PX5A 4Q3CA 3KYBA 4XW2A 3GFTA 4NU8X 4YRBA 1RLUA 4RWZA 4MGIR 1NZJA 2VT3A 1JLMA 3H2BA 4QATA 4RXUA 3WXMA 2PGNA 2XQVA 4PPFA 3FCAA 3LGSA 1L4YA 1NUQA 2FPRA 1KFCB 5FL7D 4C7XA 1KQPA 1USWA 5E4YA 5JSHA 5AJTA 3DDOA 2O1SA 3VZQA 3MM4A 3VA7A 1E96A 1KY4A 3IIJA 1F8YA 3EIOA 7ADHA 3P2OA 5HKLA 3KSBC 5DCUA 4XLLA 3E5HA 3W34A 1NHWA 1AF4A 3HH8A 1K0FA 4Z51A 1R4NB 2WV9A 5DLEA 2HUPA 1MCZA 4JL8A 3UGJA 2I34A 3UW3A 1VGQA 3I6IA 3RJZA 4HYYA 4I7EA 4MCHA 3PEWA 1MF7A 2XT0A 4NNPA 4R41A 1U0FA 3TW8A 2I6QA 5IVHA 3DGEC 3ZEIA 4ZI3A 1IHYA 3K9GA 3HJFA 3E3OA 3GP3A 4RV9A 1E77A 2ZS8A 3ZU3A 2DLNA 4NENA 1EI9A 1TUEA 2R6JA 3VAAA 3BGDA 3VPAA 3WYFA 4DMKA 4BQOA 4TV9B 2ZE5A 4AY6A 3UMGA 3JV7A 2Z09A 4EAQA 2NO7A 3N3BC 4EHBA 2C82A 2BLNA 2AQ8A 5KAPA 1ZQ1A 1NVXQ 4UCQA 1ZESA 3DW3X 2FF7A 3E7PA 4RFSA 2XB8A 3IAS1 3VYUB 1USIA 2FW9A 2V54A 4YB8A 1G38A 5IRCD 1NXXA 3SCZA 3MIZA 2HIMA 4OXNA 2Q5OA 2LPMA 2H5JA 2VZEA 4S24A 4DIKA 5FAKA 3PC8A 2NACA 3MILA 3BMNA 5HRCA 1XAHA 2W2XA 2YWHA 3PXGA 4NABA 1P62B 1YH3A 4HRXA 2B4KA 3HZOA 3OLQA 2NZYA 4IYJA 4RA9A 2PUTA 4C01A 4MJXA 4D5EA 1R4MA 1XA0A 3W2FA 2VO1A 4B4WA 1NA5A 3NHAA 4PG6A 3MBIA 1I7LA 5EWJB 1AUQA 2JK0A 1TEZA 1SWWA 4TV9F 2KE5A 3QVLA 3OLVA 1IM8A 4V0NA 1SZCA 1BKDR 4MDYA 4XDYA 1X7GA 2GF9A 1I24A 4QDKA 3A70A 4LSZA 1W36C 1Y0BA 1K68A 4KR6A 4C9BA 3MCVA 1J97A 4QBHA 1SK8A 2GTHA 2GNOA 3WX0A 3ROGA 1PEYA 1W35A 2BUAA 4TXHA 2RHLA 1JA9A 2DQ4A 4LYHA 2OXTA 3TPCA 2NSYA 3WK7A 2LKCA 3OKAA 4AK9A 2H1CA 2XMQA 4P92A 2VQ3A 2R4UA 4K0RA 5KIAA 2WJJA 4MITA 2E6UX 2QN3A 5DBEX 1M9NA 2DR0A 2A0KA 2QT0A 3IAXA 5LU8A 1NVGA 1N0WA 4H7JA 1AMOA 2MINA 3KSZO 5AW2A 3IKTA 2WFZA 4P0QB 3QZUA 1DELA 4JGBA 3TLXA 2EJBA 4YUVA 1ONOA 1N6NA 1X9IA 2WOJA 2C7VA 1UDAA 3EXHC 3INTA 4F3NA 1RJ9A 4FBGA 2P9ZA 3QH4A 4A0FA 2I2DA 2VXBA 3MIIA 4FFWA 2TMYA 1ZHHA 1U7UA 3OF5A 5C1BA 5CFZA 1F12A 3SX0A 3FHLA 1PS9A 2O07A 3JQAA 3ZNNA 4QBFA 2QUBA 1TM3E 3IR6A 2UUOA 1SVIA 3KPYA 5FI5A 1EQUA 1E4EB 4YJ2F 1SCNE 2HA5A 4WNCA 1Q1EA 1R0WA 3BCHA 1YQWA 2XVMA 1QQAA 1WR8A 4LHWA 1G63A 2B69A 1L5FA 4OEHA 1T91A 3D3EA 4TSKA 2HJRA 3O9VA 5K8TA 4IEFB 5DV9A 3R76A 1C1XB 1ECFA 2PKCA 5AIAA 3PLRA 2IPMA 1GNSA 2YMPA 4GHWA 2O1EA 4XQGA 5DSXA 4M0EA 2QUZA 5B1SA 1V11A 2V5UA 4BTLA 3I9OA 1D6JA 1E1RD 2Q3EA 3SFZA 2GYYA 5JALA 3FMPB 4US1R 2HPVA 2ZRKA 4WVFA 5GV8A 4XDHA 1E7SA 3ADDA 2FZWA 2JJ2D 1NUHA 5L3VA 1A9XA 5AVRA 3H2IA 5AW8A 1HFWA 3QBEA 3EB9A 2MOKA 5FUVA 4MR8B 2RBGA 3ZS9A 1QVRA 1M2FA 3WGKA 4OHMA 4ME6A 1J4AA 1BMDA 1UOPA 1ZK1A 2D3WA 3AEUA 3NBQA 3PITA 4I50B 4TMYA 2W2LA 3S2UA 3GEEA 1QPZA 3ZE9A 4KKXB 4EG4A 3LUFA 4E22A 3DVLA 4GPZA 2BKVA 4L9AA 4RBNA 1MAAA 4MR7A 5K5EA 1JG2A 1T1EA 2TECE 2EGHA 1QIJA 3HKDB 2IV7A 3D5QA 4JI0B 3UPUA 1KVTA 2ZJ5A 4OHRA 4QDOA 4PO9A 3JQ9C 3AHIA 3G02A 3T0IA 4HGQA 1T3TA 2EF1A 2X2OA 4MUGA 4KODA 1DXHA 1DRKA 3G1WA 3PQ5A 4NFLA 1XKLA 2G1JA 3IEUA 3WB2A 2FHSA 5BW6B 3VM6A 5LU9A 5EERA 3UQYS 4RKQA 1WMFA 3KBOA 2Q4BA 4R2JA 1I01A 1IBSA 1Z7YA 2HMVA 2Y1FA 4XI9A 5LWQA 3RU9A 5JWRA 4OI1A 1DNPA 4HMQA 1JHRA 4O0LA 3RSFA 1V8FA 3R0VA 2P6OA 4RY9A 2B2NA 2WSSA 3DL7A 4G84A 4O2LA 4K6CA 2XMZA 2YHIB 4FP9A 4LJAA 3OJWA 3U4QB 3BUSA 3BL8A 3FSEA 3WGQA 4QXRA 4QXAA 4FFBB 4WMLA 2GTPA 2P75A 2QVCA 2FFBA 4DV7B 5TVGA 4KSYA 4X6UA 4TXMA 2AFHA 3KC2A 4FWBA 4L8GA 3FI9A 1KJYA 4U2EA 3WGVA 4LSWA 2HLDD 4B45A 3CJQA 3Q40A 4NP6A 4I3GA 3RGWS 2B30A 3N6RA 5BRJA 4LPSA 1QH8B 5HRUA 4N3BA 1B4DA 4ZRDA 1U2EA 4JELA 1KBZA 3RODA 1Z0UA 1M33A 1XRMA 3W04A 3F6EX 1I4TD 3L8HA 2IYLD 3VJKA 2Z4SA 1OXBB 1OYWA 3VPDA 2ODEA 3X3HA 4RV5A 2XT9A 2F1RA 4HFJA 2WA1A 1QIDA 3ONEA 1DWUA 1T9GR 1SOWA 1NBMD 3F74A 1MQ8B 4MMXB 1TVKB 3O8DA 4Z49A 2CMFA 3K6KA 4WBXC 4R4JA 4NL4H 4DB2A 4WKPA 3OEED 2IQIA 2H54A 3DZ8A 3BSWA 3IP3A 3B1ZA 4I1OA 2D0DA 4K9RA 1P5JA 3DKKA 4GX0A 5FQOA 1N6RA 3L18A 4J16A 1M2WA 4B43A 4BAZA 4KPEC 1OYOA 3GLGE 1X0XA 2HT6A 2CEKA 1Z2EA 3WGLA 3ACDA 4B3MB 4GKVA 3N58A 2VR1A 3RU3A 4CL3A 4U00A 3UWOA 4E11A 5JCXA 1OXUA 2C3MA 2DHEA 3MWKA 1J1IA 1OTXA 3MTEA 4HN9A 4HXGA 4WCFC 4G0VA 1ZMBA 1R5NA 5F77A 4TLEA 1ODKA 2WU3A 1CUZA 5LA6F 2ERXA 5C32A 2I1LA 1PAUA 3X1YA 2A1UB 1NBMA 2HWYA 1XNRB 3AF3A 3TCKA 2P4UA 4TLDA 3DDWA 2FW0A 2HLHA 2IYTA 3MUEA 5BRAA 2FZLA 1OTYA 3G1TA 1M5RA 4IOKA 2H31A 4KUGA 3GRPA 1YZLA 3SYNA 4YCJA 4EJMA 1Z39A 2V59A 3OJXA 1FQOA 4TVOA 4V0LA 1A9YA 4OHUA 2Q3MA 1LBIA 2B4AA 3MHPA 3N86A 4BRWA 4UEJA 1EHYA 2D4HA 2W6IA 4PC1A 5KNBA 1XF1A 3DHYA 2IHBA 1YZGA 3T3PB 2QN8A 3KP1A 2VXOA 3SQXA 4UPDA 3WMWA 3GDOA 3GMIA 4BNYA 1A9OA 1O6GA 1U2DC 5FR2A 4KG7A 5JAIA 3KQVA 5K6AA 2FZCA 3I62A 2R5NA 1AZLA 1K08A 2WKSA 1W5AA 2KQUA 2Q3HA 2RJOA 4JBNA 1UPFA 1EX6A 3ZWWA 5AVVA 5HZKA 4X84A 1J70A 4G24A 5J4YA 2OQ2A 5EYPB 1I7DA 1JBQA 1M2NA 1WKBA 4ZQGA 4ZYTA 4M55A 3RT9A 2JAQA 3HUUA 3JARB 4MB2A 4GLLA 4EFKA 3HB0A 4B48A 3SJAA 2ZBUA 5AUPB 3OG9A 2MSWA 3SZOA 2ZP1A 1AOXA 1Y8CA 4HADA 5HG0A 2HGZA 5DWVA 4ZARA 1K27A 4TXNA 2PT9A 2FFAA 1RBMA 1U9ZA 3AY0A 4WDRA 4EY6A 2EYQA 4F93B 5A4DA 3BIOA 4RTSA 1UZMA 1AUXA 1ISPA 5JNVA 1Z74A 2IPLA 1ONPA 2PQ0A 3HEAA 2H5IA 2GASA 3AUSA 2GN1A 3EZXA 3WL8A 4IZOA 2C9BA 4F3CA 1U1IA 4B3JA 3M89A 1QLJA 3IVRA 4D97A 5EJEA 2WWYA 2YWBA 5J4HA 2XUOA 3M4ZA 1K3TA 4N12A 1EINA 1PSZA 3IALA 1FVXA 4HVTA 4K9MA 1NBIA 4TV8B 2GA9A 4ZIRA 2GD6A 2V0NA 3EF0A 1ZK2A 3F4BA 3O8RA 5JSKA 3WNBA 3OP1A 1XU7A 1JQLB 3PT5A 4TMTA 1ISFA 4FIZA 2ZR0A 2DQKA 1L5WA 3O93A 2I8LA 4RS3A 1GNLA 4CM4A 3RB8A 4TYPA 5BSGA 1MNAA 1AZTA 4NNJA 3TQTA 3AOEA 2PKWA 3I9MA 5FBRB 2J87A 3BD6A 3CN9A 3EN0A 5T7BA 3CUTA 1QHHB 1W2WB 4FMDB 3DEAA 4IUBS 3QBVA 1CUSA 3T1HB 1C30A 1R6BX 1Y4ZA 1XD8A 1KEEA 2A86A 1AKNA 4JLBA 1HURA 4AMVA 1ZSYA 3CEMA 2E18A 2D62A 4OTZA 2XEDA 3OKFA 4Q4HA 1JLRA 1Z13A 2EKPA 5F9MA 3CZ5A 1LWNA 2OGUA 3GFSA 4MV1A 3WWZA 4YXWD 4LCBA 2YL2A 2PIAA 2QQ5A 2V1XA 3PNOA 3WLEA 2IY8A 1RWMA 3TTWA 3WYGA 2E37A 3RQSA 4CLHA 1JEDA 1GILA 2ZR8A 5KJ1A 2W8ZA 3OCUA 1SUAA 4D8WA 3ENNA 1VPWA 3D3WA 2D00A 5KS2A 2PLNA 3TUJC 4P93A 3T7SA 2VF7A 3M5CA 1CZRA 4RVOA 4AW9A 1DE0A 4YJKA 2GS9A 3UMJA 3U3MA 2QY6A 1DJQA 3ZGYA 1A9PA 2WU0A 1XP5A 1CUYA 1V6CA 3EBPA 3WMFA 3PEFA 3FHCB 2XGGA 3HKCB 3BRSA 3IX7A 3UYKA 4LI0A 3U3ZA 4YJGB 1X7YA 5HUJA 2VNHA 1MFZA 1KZHA 5BVHB 4L95C 1VYVA 3JWHA 1UIRA 4ZVSA 3SQWA 1MMFB 1SU8A 3QF4A 5EJ7A 1C0LA 4A15A 2PV7A 1AA6A 3TTUA 1WG8A 3OLCX 4B3CA 1U8CB 3NT2A 3RW9A 3H3XA 2ASVA 5B7PA 3HNPA 4UBLA 5K0LA 3SLKA 1IY9A 3L49A 3N8GA 1MV5A 1XQ9A 1QRDA 4O08A 3IIMA 1EG7A 4MHSA 4V39A 3CUYA 1HTBA 3RM3A 1Z16A 4K6KA 2G70A 3ACCA 2BFNA 3LM8A 3SN6A 1EP9A 1FTSA 2AYYA 3OMWA 5AK4A 3K71B 2FX5A 1KORA 2IW3A 2H1IA 2I2FA 4FEAA 3TMAA 2VFAA 2P6PA 4BX3A 2C61A 3LLMA 4MQLA 5JXGA 5FB3A 4UZFA 4OSEA 3IEXA 1KETA 2CVOA 3D8HA 3L7NA 3NG1A 4HTFB 1PG2A 3GLIA 4G85A 3LTNC 1GG8A 1Z06A 1RPJA 5EKUA 4LX0A 2CLMB 1CJUC 1MVOA 1DFGA 3JXEA 1RZRD 4I1YA 3CMCO 3CZMA 4NZZA 4ZD6A 1O7JA 2G4VA 5L7YA 4RS4A 3UTCA 3CUUA 2QGNA 5ARDA 5IDQA 4TTTS 4V1CI 3CLHA 2G1UA 4DM3A 2PA0A 2QLBA 1SBCA 3PUIA 2BI7A 3V1NA 5EFOA 4XPIB 1YC2A 4XRGA 4JJFA 4GMDA 5L6LB 1CQWA 3TGLA 2YR0A 2P5YA 2P2GA 3OQMA 1R1DA 1TMGE 2O3TA 5EHQA 4BX8A 1JQJC 2IQ5A 3DDSA 2O1XA 1J8DA 1JI3A 3O74A 2GHIA 3WA6A 4RH3A 2QTGA 2DBRA 3AFGA 5CTJA 1T6YA 3DMDA 4JOQA 4KJXA 5E6UA 4JI7B 4ZZ3A 4FJ2A 4KXFB 3PF9A 3NTXA 2OCAA 1NRJB 2NSJA 3NJRA 3H1TA 2GEVA 4JUDX 4U5XA 4QSHA 4I9FA 3AY7A 3BCSA 4DMHA 3I5YA 3HCDA 3O3NB 4FDAA 4YRLA 1K06A 4HDNA 2FSVC 3R3HA 2GAFA 1WMDA 1X14A 1DIBA 5AJXA 1FYFA 3HDTA 3T3DA 1J5PA 3QUCA 3EA5A 4GSLA 3M4XA 4YI5A 2CUNA 1T9CA 4POOA 2YCBA 3F47A 2JFHA 3GEPA 1B8PA 4ZI2A 4B6GA 1KDTA 3CNHA 4JASB 3NUQA 2I6FA 5E6SA 3W6OA 3OT5A 2BGNA 1CJSA 3UHPA 2EKZA 3H1FA 4MQFA 5HIMA 1QJCA 2QP3A 3TZLA 5BV7A 1TUGA 5K0TA 3HJCA 2I1WA 1W76A 2IBTA 1NPTO 4LDZA 2RK4A 1BVYF 3JQ7B 4WK0B 1VGRA 1I36A 1YC5A 2F9FA 5JFTA 1ECPA 2XDYA 1G21A 2I76A 2IHYA 4JDUA 4Z9AA 1WUIS 1T2VA 4JQYA 3VKUA 3L6CA 2F55A 4GM0A 1E58A 5C8YA 2O2XA 1YDGA 2NU7A 4WTOA 5ALNA 4F85A 1X80A 3HO6A 2F3SA 5KOHA 2ZT6A 1NFRA 4IFEA 1J5XA 2QTNA 2PZKA 3DF9A 3R7WA 3OZRA 5T5QA 4NFSA 3RR2A 4E51A 1A0OA 1N34B 3E9NA 4G9BA 2A1IA 3JYHA 4AG3A 3LIPA 1YL5A 1JJVA 3G5LA 3SHVA 1IL0A 4GNRA 4DXDA 5MDHA 1WXWA 4MULA 2PU7A 5AVXA 5CGZA 3IAS6 1AHHA 4BFLA 1DAFA 1WMEA 2PM8A 4NECA 4N8DA 3W7VA 1H6BA 4WVLA 4PXSA 5HKBA 3DD1A 1SUEA 3ANXA 4QXPA 4LXHA 1GTZA 1Y1RA 2UVPB 3KNZA 3N0WA 4BMXA 5EHZA 4S12A 5C5DA 2Q1XA 1ZL2A 1QHIA 3DW1X 4I4LA 4YQYA 2CV2A 3IQWA 1EDBA 4Z7NB 4YPOA 4FW8A 2OFFA 2YYYA 4JVMA 3I2HA 3VPFA 1UBNA 3LOUA 2RAVA 1A8SA 4YHBA 3CX8A 3KXIA 5DNUA 6REQB 3NW9A 3RC2A 2XB6A 2BF7A 5KNDA 2JZOA 3UT6A 4BKRA 4J4BA 3AF2A 3MWGA 3HFGA 1T9DA 4JLWA 2XI4A 4MKZA 3WB9A 3ZBUA 2QGFA 4BNJA 1TW2A 2X58A 1CP2A 2FTKE 1QF9A 1U9YA 1W19A 2GCOB 1UWLA 5JZSA 1RLOA 1M6HA 2J5KA 1NQVA 4WLFA 5I7EA 3LWBA 3LHIA 1OAOA 5IP5A 2ZBRA 4P7GA 1G2QA 1G0NA 3FVQA 1YOVB 4EHIA 16PKA 1ZK0A 2G6BA 2XUAA 3HR8A 4RVFA 2AXQA 4DZZA 4EUFA 4U7DA 1PQWA 5HKKD 2XZDA 4NDNE 3O4JA 3VYWA 1V1MB 4YASA 4DCSA 3WISA 5GTDA 4C2BA 5ICSA 2VYNA 3INGA 2IUUA 1DC8A 4CU2A 4LOAA 5AVQA 2V7PA 1NXSA 4OREX 2J7KA 2DH6A 4UUMA 5EHXA 1PV1A 2JAOA 2IGTA 1SCIA 5JXIA 3K7EA 4WV3A 1NXOA 3RYCB 4RTQA 1E9EA 4IHJA 1FOEB 2EZ9A 4I1VA 4C0KA 2LCIA 1J2TA 3PZRA 3VRHA 4OJQA 5KSWB 4Y0NA 2PKXA 4NPHA 2AN1A 2WIKA 4NEGA 4XIIA 3ZY6A 3F6PA 3FFBA 1CR6A 1BIFA 1R0RE 5B55A 1DEKA 4YRGA 4YREA 4IMRA 1Q1AA 1Z17A 2PZJA 3TTTA 3TNDA 1R2QA 4FEEA 1R0KA 3R3JA 4IINA 1WPQA 5ANRB 4FZVA 2ODQA 3G5AA 4B82A 2NSLA 4LRXA 3UHFA 3H6GA 4LF5B 4JC8A 4P7KA 4R2HA 4BN0A 4MEBA 2OBFA 5G0WA 5IVPA 4CEHA 2GCOA 2V6IA 3GUZA 3EEFA 3OHMA 4PLZA 3TS1A 3ZHRA 3JQCA 3ZWKA 3C3CA 2NO5A 1FFXB 3IMCA 1WZ2A 3KOZA 1P2DA 1TAQA 4MGKR 4OQFA 4QASA 4C20A 3SK0A 2BHSA 2VYQA 3WS7A 4C05A 5AW1A 1CULC 2JD1A 3D81A 4BIMA 2Z2YA 3HV0A 4G4SO 1Z5PA 3CIFA 3HWSA 1FNNA 3EGIA 4DTIA 1G8KA 5AKJA 4EW2A 4JYAB 3LT0A 2I62A 1IY0A 2JLRA 2GJ4A 4I55B 5B1HA 3CA8A 3IVGA 4AYXA 1KTIA 5H59A 1ZZEA 1BDJA 2AN4A 4PQGA 2A9QA 4PGMA 3UH0A 2WZCA 3GLGB 4J1NA 1T0JB 4J9VA 1CEQA 3BWYA 4UD2A 1ZHOA 4C21A 3OETA 3L8FA 4DC1A 4YMVA 4QRHA 2X77A 2VJDA 3M7IA 1T1JA 1ZX1A 2FPUA 2Q5HA 3R6GA 3GJYA 5GV7A 2QE6A 3GARA 1JUDA 1X9HA 2OV6A 3RK0A 1NR5A 2FHPA 3P4YA 1JFFB 1XCMA 4HR7A 1USUA 4KO8A 4U2GA 2ROQA 4KUEA 4BNXA 2ZATA 2PBZA 5C7IO 4FR0A 1ITZA 2BEUB 5IYZF 3TUIC 5AKLA 4DLWA 2QL6A 3FNEA 2BFFA 1W8DA 1KEEB 5JS8A 3A9UA 1JG4A 2IH2A 1V8DA 2EIXA 5FTWA 3QVJA 3MN1A 1TK9A 2BKEA 5J4LA 4N3AA 4MVWA 4AY4A 5CD9A 5KQLA 3HJRA 1O8BA 1FRNA 4KIFA 1X1DA 3L7YA 1KH1A 4DDKA 4EPYA 1QIEA 3OZTA 2IPOA 2PPLA 3LXMA 1WVMA 1RYEA 1YRAA 1GFZA 4FN5A 4I8XA 4MZXA 5CVJA 5FNVA 2ZXUA 1HNZB 4ER0A 3FW1A 2VQ6A 2ZU0C 3L3BA 1I32A 1R3DA 1QYWA 2IS6A 1KZ6A 4Q7KA 1Z7BA 2YNMA 3FCXA 3LS2A 5EIBC 4XYGA 1WU7A 1YU9A 2ZYUX 4HFRA 4K28A 5G4KB 3VDNB 4QLBA 3B9PA 4OM7A 3V5NA 2FWNA 1EA7A 1A7AA 3DZIA 3KWLA 3MJTA 4M60A