4JP2A

Crystal structure of tt0495 protein from thermus thermophilus hb8
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
239
structure length
239
Chain Sequence
MERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-deoxy-D-gluconate 3-dehydrogenase
publication title The first crystal structure of NAD-dependent 3-dehydro-2-deoxy-D-gluconate dehydrogenase from Thermus thermophilus HB8
pubmed doi rcsb
total genus 81
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jp2A00
5G2OA 4L74A 4ZQEA 1LU9A 5IZ4A 4HP8A 1WDMA 3I9JA 3AU9A 1HRDA 5IXYA 3D4OA 1GPDG 3R3SA 2BGMA 1DB3A 2I76A 2HLPA 3ANMA 1PGJA 3LC1O 4R1SA 4YEDA 1KY4A 1LBEA 2NM0A 4J0EA 4PLTA 3DL2A 3PDJA 1SOVA 4G5HA 1R4MA 4BV8A 3V5NA 1P1FA 1WMBA 1XYGA 1ZO8A 1BMDA 3ZWBA 2FY8A 4WLFA 1ADFA 4NHEA 3CPSA 3DMTA 3E48A 1M75A 3DBLB 1BSVA 1R12A 1ISGA 3NGLA 5JDIC 4J2OA 2JD2A 2I3AA 5F1OA 4D0SA 3CIFA 3PRJA 4IIVA 4II2A 2WWRA 3AJRA 2VWPA 2OHXA 1IL0A 3B20A 3DB2A 3KRTA 1HYGA 3ENKA 3ZNNA 2RAFA 1MA0A 1HE5A 3V2GA 3P2OA 4KTTE 4CMIA 1CEQA 1JU9A 5DCUA 3ETEA 5I7EA 3WSVA 1PZHA 3PLRA 4A03A 3ETDA 2G0TA 4KDEA 2Y66A 2GN6A 2JD0A 3H6KA 3ZWPA 1X1EA 1H9BA 1YE3A 3GAZA 2AHRA 4WGGA 2CVOA 3PJFA 5BSGA 3NEPX 1A9ZA 4H16A 1EVJA 1E7WA 4LK3A 1ID1A 4M54A 4DIBA 1GCOA 2OUIA 1EFLA 1VSVA 3DOOA 5ER6A 4EITA 2AXQA 2BRUA 4D3SA 1JKIA 4ALKA 1PZEA 2D4AA 2Y1CA 3EVTA 1JVBA 3NUGA 3PGJA 3TZHA 1I2ZA 1UDBA 3NV9A 3RJ5A 1RYDA 3A4VA 5HA5A 4B4UA 1E3SA 3F9IA 2RH4A 2W8ZA 3LYLA 3IS3A 4ND4A 1PJTA 1C1DA 1RWBA 4YB8A 3H8VA 1ISIA 2DKNA 3SJUA 3LZ6A 3GNSA 1TLTA 3Q1LA 4JQCA 8ADHA 3QVXA 3K5PA 4CL8A 5CG1A 3JQDA 4E3ZA 1DC6A 3SC4A 4AG3A 1U7TA 4RL6A 5ER9A 2J5KA 2P9CA 4IQ0A 3KBOA 3ZHBA 4BGIA 3R1IA 1UXIA 2GZ2A 2PFGA 3GVHA 1PL6A 1B2LA 2NQTA 4MVJE 4IGFA 2H6EA 3C1TA 1C1XA 1Q1NA 3LF2A 3UCEA 4YVFA 3ASUA 3GDFA 3PQFA 3WNVA 5JSFA 3HG7A 2BFOA 3F5QA 4ONEA 3KTDA 2FPGA 4KUGA 1ML3A 1KY5A 3CZRA 2AW5A 3S2FA 4K9DA 1DAOA 2EKQA 4BO2A 4YWJA 2FRDA 4BNIA 1EBUA 4GMFA 4L4XA 4CLRB 3ABIA 4IQ8A 1ZSVA 4RGBA 1YS4A 4YJFB 3UAGA 1YDEA 1LX6A 3COSA 4M49A 5IXSA 1VL6A 3OA2A 3PDUA 3MTGA 3RC9A 4Z3KA 3PJEA 4MP3A 3LDHA 3AUTA 3ZGYA 5CEEA 5BSFA 2UYYA 4Q3NA 3RU9A 4LW8A 2QYTA 1HT0A 2FHSA 2GNAA 1Z7EA 4EGFA 4HV4A 2EIHA 1W0CA 3E03A 5ADHA 1X1TA 3V1TC 1Q7CA 1I0ZA 4OSPA 3GNQA 2V7PA 3PGXA 5JC1A 1YBMA 1NR7A 1QYVA 3FSRA 1LRLA 1VC2A 4R1TA 4TRJA 1GV1A 3OIDA 2AMFA 1JKJA 4QQRA 4UUMA 4YT4A 5AXAA 4PG4A 4IDBA 4IDAA 1R0SA 4JCOA 4WPGA 2CMDA 2W90A 2SCUA 3OM9A 1QR6A 3NDJA 3ZH2A 3JQ8B 3WQRA 2G1UA 4HNGA 1DHTA 3V8BA 1MFPA 1ISMA 3KEOA 1NPYA 2J3IA 3WWYA 2C2YA 1GDHA 2BI7A 3GK3A 4D44A 4XD2A 1GYRA 4FDAA 2B0JA 3H5AA 4DPLA 2QZ9A 1W73A 4LN1A 1RYEA 2ZCUA 4YJHA 3TZKA 4UEKA 4ILKA 2JD1A 4NJMA 4ALJA 3Q0EA 3U4HA 4F6LA 4YPOA 5B4TA 2VOEA 2NU9A 3GN1A 4MKRA 1Y1PA 2X0NA 4A0SA 1YDWA 3ZWVA 2VN8A 2Y1DA 4J3FA 3D5TA 4OJNA 3JQGB 3ZZNA 2J5RA 2VRBA 2O2SA 1GYPA 1SB9A 4GBJA 4J9UE 4RVHA 4ESOA 2AE2A 5KVQA 1EVIA 3U49A 1ZXLA 2RHCA 4TVOA 3C24A 1TB4A 2V6FA 4AJPA 3NX4A 4AL4A 4CM9A 1ZK4A 3AI3A 1X0VA 1YRLA 1ZCJA 3E9MA 3PPIA 2FSVA 4L73A 1GU7A 4PLPA 5DOZA 4CMEA 3GEDA 1ZIDA 3TZCA 1DC4A 1YJQA 3EZLA 4UUPA 2BGLA 5DOVA 4YT2A 3UOGA 1JVSA 2Y0DA 1GQYA 1G1AA 3FR8A 2WYUA 3WSWA 1J6UA 5LCXA 7ADHA 3OJEA 3UHAA 9LDBA 5BSHA 1B3BA 3JQ9C 1U8XX 1WDKA 1NPTO 4JJFA 3RASA 4DLBA 1MXFA 3UH1A 3GHHA 2X7HA 1VM6A 2AQ8A 3S1LA 1VJTA 4N18A 2VHXA 4EEXA 4GL4A 6ADHA 4CM9D 4WEQA 2YY7A 3ADPA 2DBRA 5U1PA 3HDHA 2OMEA 2Z1NA 2PZKA 4PLHA 4GAEA 1QP8A 1DIRA 3DWFA 3VDRA 4QEDA 2XXJA 1YVEI 4R1UA 3SLGA 3A14A 3D1LA 1R16A 4G65A 5COBA 1T24A 3ZWNA 4CM8B 3L6OO 1QYXA 3E5RA 1XU7A 2DTEA 5EL0A 4HY3A 4NBWA 3UKOA 2PZLA 4W99A 5KVCA 2E4AA 1DLIA 2YQ5A 1HSZA 5FEUA 2AG5A 3WBBA 4YXFA 1PTJA 5G0VA 2BGKA 1Z75A 2Q45A 1GD1O 4YAEA 1NP3A 4KQXA 2WD7B 3RROA 4YRAA 4ZJUA 1NXQA 5DT9A 3O9ZA 1G0NA 1BVRA 2AEMA 3PYXA 2VRCA 4TMFA 2J6IA 4ND3A 3BTUA 5CG2A 1U2GA 2Q2WA 4YJFA 1CQIA 2R00A 1E3IA 1I30A 3GOHA 1GQ2A 2NV6A 4L9RA 4XB1A 1YL6A 5CPFA 2C54A 3TRIA 4CMJA 4IZHA 4WASA 1UDCA 2RHRA 4DC0A 3U5TA 1Y8QB 5JLAA 4TSKA 4OXKA 1SAYA 3VHRA 4PN3A 2DFVA 4RO0A 5GZ1A 5A5FA 3PVZA 4DBVO 2J3HA 3JD1A 3PK0A 1WP4A 4KMSA 4DL9A 3SC6A 3WNQA 4BO0A 2E82A 2ZJ0A 3B1KA 4MJLA 5F3RA 2EKLA 3WTBA 5EERA 2VRCD 4CV0A 3FNFA 2DAPA 4J1NA 1XEAA 3WBFA 4QT0A 1XA0A 2WDZA 2WJPA 5DCYA 3X2FA 4CMHA 3UCXA 4RPHA 1X7DA 4GX5A 3GZ4A 3KB6A 4B4WA 4A26A 3RBVA 1I24A 3I6QA 3JQ6A 3LF1A 5DZSA 2VZ8A 2O4CA 5T57A 1SZJG 2EKPA 4YAKA 5BQFA 2B69A 1NWCA 3CUKA 4NBTA 4YBZA 2UAGA 4GX0A 2GYYA 1T4DA 3RSHA 1E7SA 1JLLA 2E6UX 1ENPA 2UVDA 4ND5A 4WLOA 2XXBA 5I9LA 1BVUA 1P3DA 4OSOA 4WLNA 1YJ8A 5A3JA 4MINA 1YL7A 4DLLA 1KVSA 1HDZA 1E6EA 2WD8A 4R3WA 1MV8A 1YB1A 2GZ1A 1ADCA 2X0IA 3M1AA 3ORFA 3ZW9A 4DYDA 1CDOA 1Y6JA 5F1KA 4KWIA 3L4BC 3WGTA 1R6DA 3PQDA 4AJKA 4R9SA 1OI7A 2RH8A 1TT5A 1ISFA 4BNTA 4Y6RA 1HDCA 4BKOA 3ZHXA 4RVUA 5ITWA 1DAPA 4ALIA 1NPDA 4R1NA 4MOWA 3EHEA 4FBGA 1L7EA 1E5QA 1QSGA 3AM5A 2IYPA 3C3XA 3HDYA 3EDMA 1H2HA 2PNFA 1ULSA 1HDYA 4H7PA 2I66A 4B3JA 1U7HA 1NHGA 2BH9A 3Q9UA 4FW8A 4EDFA 3MJ4A 3O8QA 3LC7O 3AU8A 2GSDA 3SX2A 1RM4A 3QSGA 4WCFC 2ZB7A 5JO0A 5F1PA 5ICMA 4KP7A 3P2YA 3DZJA 1F8GA 2VZ9A 5ENDA 5TJHA 1H6DA 4JN6B 3NT2A 2HO5A 2EJVA 4B79A 5KJEA 3GGPA 1J5PA 1F0YA 3VVCA 3WFJA 3L77A 3BMNB 3WIEA 1TT7A 4TKLA 1LLCA 1PGPA 1I36A 3JQ7B 1NQTA 1M6HA 2Q49A 5JC8A 4INAA 4M1QA 3HJAA 3VTZA 1E77A 2OL4A 1RM3A 1NFFA 1TXGA 2VWHA 3AY7A 2RCYA 1XKQA 4BGEA 2A4KA 4MKZA 3QVOA 2RBEA 4I08A 4ZGWA 3EYWA 3IJPA 4N5NA 3HADA 4M8SA 2O50A 3DZFA 1RM5A 3FNEA 4Q3AA 2DQ4A 4HWKA 4H15A 1NR1A 2QYSA 3F3SA 3GA0A 1DDOA 3ZU2A 2EW8A 1A4UA 2PGJA 3VZSA 4ALLA 2FPIA 1ZKMA 4MPDA 4BKPA 5FWNA 1LTHR 2HCTA 3ANLA 3ROPA 4WLVA 4Y6SA 4A10A 1C14A 1NQ5A 1PJ4A 4UREA 3ZWYA 4Z6KA 3W4JA 2B5VA 2PD6A 1TA4A 4I8XA 3PFWO 5JS6A 1Z7BA 1BGVA 3JQCA 5IDXA 1E7RA 3W8DA 2PLAA 4XDZA 3VH4A 4XQ9A 4EZBA 4WOJA 1IY8A 1R66A 2EP5A 3EZYA 1NFRA 1BTOA 1LC0A 1MLDA 4II3A 3PYLA 5JO9A 1NM5A 2C7GA 1PJ3A 4ZVVA 3WWZA 5JE8A 3E82A 4TZKA 3U3XA 4XYMA 3MWEB 3RD5A 1A7KA 1EZ4A 3BTVA 1LDGA 3JYPA 4EJMA 1EE9A 1T2CA 4J4TA 3WXBA 5JCXA 2NACA 1E1KA 3W8FA 3OQ6A 1NASA 3I6IA 1VKNA 5JY6A 1ORRA 2I3GA 3A1NA 5G0UA 4OHUA 5T8KC 3JD0A 2VUTA 1R4MB 1MG0A 4H3VA 4J4BA 1I8TA 3IQDB 5JDCC 2CF5A 3GRKA 2VOJA 3V2UA 4CR8A 4IY1A 4U0JA 3WYEA 1XR3A 2Q46A 3W4KA 1EQ2A 2UUPA 4K1LA 3WS7A 3KVOA 3WGQA 8LDHA 4HXYA 3ZDFA 2NU6A 3GVCA 3D3EA 1P1JA 5K6AC 2XPCA 4BNGA 4RF4A 2VYVA 2X86A 4EEZA 2Q1TA 1V3UA 2ZQYA 3VVBA 1WLYA 4AJIA 5EINA 4YAJA 2GLXA 3S2GA 1NHWA 1UP4A 3PWKA 1QKIA 1I32A 4MVJM 4YACA 3AFMA 5F5NA 2C7VA 4L8VA 4R54A 1KVTA 3A9WA 1Z6ZA 1AN9A 1ONOA 1M6WA 2B4TO 5A3VA 3MEQA 4IS2A 1ZZEA 5BSEA 1BW9A 3RBXA 2VYVD 4FFMA 2PH3A 1H6CA 2B5WA 1HWYA 2D5AA 3C7AA 4O0LA 1WVGA 3PXXA 1P74A 3K9QO 1YQDA 1Z73A 4AJEA 1KEVA 4ZICA 3OEWA 1C1DB 1JWBB 2CVZA 2VHWA 3DMTC 4QECA 1PX0A 5DN9A 1H0KA 4E21A 5U4QA 3OIFA 4HNHA 1GL3A 4ZA2A 4GKVA 4TRRA 4NFSA 5IZCC 1C3VA 1EUZA 3U4IA 1Q0HA 2GD1O 3SLKA 3DTYA 4O63O 5EPOA 3SEFA 1KOLA 3PZRA 4U6SA 2JFGA 4XGIA 5IF3A 4L76A 1C1XB 3CINA 3DBRA 2W98A 4JJGA 4LCEA 5L9AA 2FZWA 4CODB 5JPIA 5KWEA 1VE9A 3GEMA 1V3TA 4WK6A 2I65A 2RIRA 1HE4A 1DIBA 4JBIA 1IULA 1XHLA 3ZV6A 2YZ7A 4MP6A 4FS3A 1GZ6A 4U7WA 4XWYA 2UDPA 4U5QA 3OP4A 4CMBA 3E9NA 2GUGA 4PRLA 3K96A 1LA2A 4TWRA 3RC7A 3ZNPA 3FBTA 1JWAB 1YB5A 1T2DA 3JQBC 3DFUA 2IZ0A 1QORA 3BMQA 2Y0EA 4AJ4A 4CLDA 2HU2A 4HADA 3IOYA 1EBFA 1SEPA 2X9GA 3I5MA 1DIGA 4GX1A 4X54A 4HFNA 1E1MA 4MKXA 1U8FO 3QVTA 2V6GA 5A05A 2ZYAA 2O3QA 1KYQA 3KLMX 1V3VA 1OBFO 1VLLA 2HMSA 3LQFA 5U9CA 3KYBA 1LLDA 2JHGA 1UDAA 2DTDA 4P4LA 2VHZA 4NK5A 5TQVA 1DFHA 1UXHA 1ISJA 1H6BA 3ST7A 2BKAA 5MGBA 2DFDA 1L1FA 4XR4A 4UEOA 3F47A 1K0UA 3GG2A 4K28A 1UXJA 2AQIA 2GN9A 1B26A 4CLHA 3PHGA 3FN4A 1H5QA 1TVEA 4BNNA 4WLEA 3G49A 3IKTA 2IEDA 1UZNA 4EUHA 4LCJA 4IMRA 1NVTA 1ZFNA 2VCYA 3GDGA 3MOIA 2VT2A 4UEJA 1K6XA 4CPDA 5JAMA 4YJHB 2C2XA 1Y81A 4NJMB 2V6MA 3I23A 3IAHA 3GGGA 2FMUA 3M1LA 3EC7A 4E2XA 2W2LA 1MC4A 4XJTA 4E12A 1ZK1A 4KTVE 2FR8A 1U3WA 3CXRA 3CMMA 3QWFA 4IDFA 2OBNA 1QYCA 4Z9YA 5IN5A 4CV2A 4DVJA 5B4VA 1PWZA 1IZ0A 3GGOA 4QFDA 5LDGA 1JDJA 2PK3A 1WPQA 1UP7A 2QW8A 3AM3A 3EY4A 2H63A 2CY0A 4NQZA 5HS6A 4E5KA 4PLFA 2WE7A 1HDGO 2CDCA 3AI1A 2CD9A 4FJ1A 3DHYA 3GG9A 1J0XO 1MX3A 3I4FA 3JQFC 4IZIA 5EMHA 2DPGA 4NIMA 2JFFA 1PGQA 1DLJA 3BXXA 4QTZA 4ZQGA 1IHXA 3PZBA 3L6EA 1I33A 1VL0A 4ID9A 2EHDA 1VPDA 1VL8A 2ZTVA 4R01A 5B12A 2ZIZA 3A28A 1JW9B 1AHIA 2R6JA 3RC2A 4IINA 4HKTA 2JCXA 2P2SA 3ZN2A 3KYDA 3G79A 4C7JA 1VJ1A 1X7GA 3F4LA 1E6WA 2YHIA 3DXFA 2CVQA 4RF5A 4Q9NA 1ENOA 3DHEA 3KM0A 3MCVA 1O9BA 1E0DA 3KZVA 1X14A 1ZMOA 3K2BA 2I5PO 4UVGA 2NLOA 1IHYA 1T25A 1GCUA 4XDYA 3IL2A 4P4NA 4Y9DA 1SEVA 2YJZA 5A04A 5B1YA 4W6ZA 1YH3A 1SOWA 1E7YA 3IP3A 2IXBA 1Q0QA 3MZ0A 3VTFA 4G81A 2EXXA 3K92A 5TLSA 4J1QA 4OM8A 1PJLA 2LDBA 1HLPA 3SVTA 2O3SA 3OJFA 4U8GA 3OEYA 1I2CA 1UXGA 4HBGA 2Q3EA 1BDBA 3IC5A 3WMWA 4YRDA 4IJKA 3WGHA 4BNFA 1QRRA 1CIVA 2WE8A 4GKBA 1M76A 5DBIA 1GR0A 3ANNA 3UCFA 1E3WA 3NTQA 3ROMA 3WFIA 4YJDA 4DQVA 1LDBA 3WDSA 3NT5A 1XU9A 1K6JA 4N54A 4YQZA 2ZTUA 5A9TA 5CAEA 1KIFA 3MJEA 1PL7A 3TNLA 1DO8A 4I5DA 2P68A 4OO3A 2G5CA 5L51A 1SNYA 1T2FA 2H5LA 1CF2O 4PZCA 1M66A 3JQAA 4E31A 2DBQA 4OXNA 3NJ8A 2GDZA 1P44A 1IZ9A 5KJFA 1B14A 1OAAA 5ILGA 4I9HA 1OFGA 5TRTA 4BO7A 4NDNE 3I3OA 4RCVA 4TRNA 5DF1A 4CM5A 3AK4A 3C8MA 2Q2VA 4HX5A 4IJWA 3AOEC 4O59O 4CV3A 2YHUA 1K6IA 1PIWA 3CH6A 2Q1SA 4BNHA 1ZW1A 2OZPA 3KETA 2HJSA 3QVWA 1ZJYA 4Q3BA 3D7LA 1N7HA 3KSDO 4LRSB 4BO6A 3Q9NA 2X22A 5JAQA 1A71A 2HSDA 1LRKA 3JQAD 1X13A 3FI9A 4A7PA 3AFNA 3GLQA 3S8MA 1TT5B 5IJZA 1UUFA 4I5EA 3HDJA 4BIIA 4U6QA 4KWHA 4XJSA 1IOLA 3T7CA 3JD2A 1QMGA 2B83A 1HE3A 2NVUA 4LMPA 3GEGA 1HKUA 1KC1A 3KSUA 1NX6A 3H9UA 2P4QA 4FC6A 4P8RA 2EF1A 4BUCA 4K6FA 1NYTA 3D4PA 1F17A 3IIEA 2IYOA 4NNJA 1PWXA 4Z9XA 1ZSYA 2GASA 5CDYA 4JP3A 1U5AA 3O8QB 5JY1A 1LSOA 2JFHA 3HUDA 1DFGA 1N1EA 3GPDG 3F6YA 5L53A 4DC1A 1VSUA 3JYNA 1D3AA 3GZNA 3W4IA 4WECA 3RAJA 4IDEA 1HYEA 2FR0A 2HKIA 1WXDA 4YJGB 4CQLA 3MJVA 3B1JA 3H9EO 4GWKA 1D8AA 3AM4A 4B8ZA 3E9QA 1PQWA 2HMUA 2CUKA 5BNFA 3WIDA 2YYYA 3H3FA 4QX6A 2OBYA 1P0CA 4R3NA 3GNTA 3BMCA 5KOIA 3ICCA 4RVGA 3VH2A 1KEPA 4CM3A 2Y1EA 1FDSA 5B4UA 1DRWA 1E1LA 1NAHA 4BHTA 2HDHA 2Z5LA 4OL9A 2HUNA 2H1SA 3JTMA 1BG6A 5FF9A 3VH3A 3DBVO 3U4DA 3STHA 1NQAO 2JAHA 3ZNQA 4FJ0A 1PJQA 5JAIA 2OGUA 3RFTA 1PS0A 2GRAA 2P91A 4CUZA 4MVJA 4RVSA 3LT2A 4LSWA 2B4RO 3UN1A 3WB9A 1LSUA 4BO9A 1P0FA 3WGZA 1YOVA 3K31A 4WUVA 2C0CA 4FR5A 4DXHA 1LDYA 5ICSA 2PKRA 4XGNA 3ZU5A 3CMCO 2IEBA 5ENVA 3WX0A 4Z0HO 4IMPA 5TGDA 5DBGA 4D46A 3RQSA 1C0PA 1LQUA 3R3JA 4XB2A 3R6DA 4FOOA 4BKUA 1JQBA 1ZNQO 3FTNA 4P4GA 1GUZA 4R5HA 4WCDA 4BO3A 2PV7A 4UAGA 2YV3A 2J3JA 4W7HA 4A73A 3L9WA 1T2AA 3GY0A 4MVJD 4KZPA 4I5FA 3PHIA 5C5IA 4JBHA 1D4FA 2AA3A 3DQPA 4M86A 5AXDA 3VC7A 3ZI0A 3ZU4A 3RU7A 3SJ7A 1KC3A 1C0KA 4R5MA 5AOVA 2X0RA 5GZ6A 1JTVA 2Q4BA 2ZB3A 4DIOA 2EWMA 1I3KA 1E7MA 4C7KA 4IIUA 4CLOA 1PGOA 3GR6A 5C7IO 2NTJA 4EUEA 4MIOA 3IMFA 3QP9A 1PJ2A 3JD3A 1LSSA 1R37A 1XGKA 1S7CA 3EK2A 1A5ZA 1XELA 4XYBA 4BB5A 5IDWA 5ITVA 4BNUA 1KEWA 4LVUA 3B6ZA 2F00A 3NDIA 3ZV4A 2YFQA 3WLFA 4ZN6A 5CEJA 3L9XA 1WMAA 3JV7A 4J7XA 1VJ0A 2P5UA 3TDKA 4Y6PA 3QWAA 2VWGA 4YYZA 5IFLA 3RUCA 1B15A 1R0LA 5T5QA 5A03A 3LC2O 1H6AA 1MUUA 4A2CA 1BHSA 1GTMA 3HQ4O 4I1IA 1DPGA 5DCWA 2YV2A 3ZWWA 4JGBA 2AG8A 3AUSA 1ZMTA 2B37A 4BNJA 2VT3A 4WKGA 5EIOA 5COQA 3UGKA 4E5YA 1H94A 4GGOA 4YRBA 3DMYA 4MDHA 3GDOA 1PU2A 3H2SA 3PTZA 3S2EA 3ZWCA 2IDZA 3GFGA 2VQ3A 3V1YA 5IG2A 5JDIA 4Q3EA 3ROKA 3QV1A 3JQ9A 1T2EA 1NBOA 5AYVA 4CLEA 4GX2A 2PWZA 1N2SA 4URFA 2OOSA 1U3UA 3P5SA 4QO7A 4AVYA 3F4BA 2D8AA 2JCYA 1VRWA 2OO5A 4UVIA 5JNLA 3ONFA 5GY7A 2HK9A 3C7DB 1ZK3A 2XAAA 4FSHA 4GI2A 1BW9B 1GFSA 4J4HA 5TJ9A 2CSUA 3FPCA 3WICA 1OC2A 2A35A 3MOGA 4FGSA 3HFGA 4Q39A 4UULA 1BWSA 3PHHA 1E3LA 5L40A 1M2WA 1XQ1A 2OP1A 4D3FA 2V65A 3DC2A 1VKOA 4RDHA 4OOFA 4GLOA 4YJGA 3DZHA 3BTOA 3TFQA 1E5LA 2CNBA 2D3TA 2Y68A 3ETGA 3OFSA 1FMCA 4QXMA 4FFNA 2HQ1A 2W2KB 1CQJA 3RUEA 5HRUA 3Q2KA 2DBVO 4CQMA 1DFIA 4S1VA 2C59A 1BRMA 3BZUA 1F06A 3BAZA 2IE0A 1GEGA 1YL5A 3N7UA 4XA8A 5KJCA 2POQX 1CRWG 4YCAA 1T1SA 2NTNA 1PR3A 1FF9A 5TS3A 5C3MA 3DBRB 4CM4A 1V6AA 1R4NA 1YONA 2NADA 3NAQA 1FXSA 5L3ZA 1L7DA 1U4OA 3PEFA 2Y93A 4JP2A 1ZBQA 4PG7A 3WYBA 3FBGA 1EUCA 1BXKA 3D64A 4XYLA 4R68A 2PGDA 3E6AA 3GQVA 3ZWXA 3IUSA 4RLSA 4ZD6A 3AWDA 3OIGA 2YFHA 4BMSA 4BMNA 4ITUA 1ZVMA 3OF2A 3T4XA 4PVCA 3TL3A 1D7OA 3NTOA 4J16A 1Q2XA 1DRVA 1LSJA 2O23A 3NDRA 1P31A 3HB5X 1Q0LA 3BMQB 4D7AA 1PEDA 4UUNA 2DVMA 4D42A 3INRA 3VPGA 4OMUA 5BT9A 1K3TA 1W6UA 5JYEA 1HE2A 3WR5A 4PG5A 3DHNA 1NVMB 3JYQA 5I9NA 5AXCA 1KS9A 1N8KA 4DREA 3WGIA 1U2DA 3ICPA 1E7QA 2BD0A 4R41A 5I8WA 1Y8RA 2ZTLA 5L4NA 1F12A 1XG5A 5AQ1A 1DJQA 1YBAA 2JKVA 3FCOA 4NU5A 5LDHA 5TNXA 4EW6A 1YBVA 1Z74A 2UUOA 5COAA 5G0TA 2C5EA 3FWZA 4BOYA 4ZQHA 3FF4A 1YB4A 3I9LA 4UVDA 3L4BA 2ZYGA 4XZ3A 2YQ4A 4TRMA 2GPTA 3PI7A 1MG5A 5KCZA 7MDHA 2ZJ1A 2BFPA 4J1SA 2DTXA 1QXSA 1MC5A 1I3NA 3RFVA 2X9NA 4GVXA 4DTIA 3INTA 3GMSA 4B3IA 3UFXA 1GZ4A 4BV9A 1S6YA 3CEAA 2YW9A 1C0IA 2O3UA 2HK7A 3CE6A 1NTOA 3DFZA 1C0LA 1OC4A 1P9LA 4B7XA 3C85A 4XEHA 2Y99A 2NU7A 4CM6A 1MP0A 3QVSA 4Z3DA 4DYVA 2X0JA 5JYDA 4XQCA 2AE1A 3TSCA 2X6TA 3I4CA 4WCFA 5CP8A 1OOEA 1ULUA 5CPBA 2GN8A 2ZQZA 4MVJI 4OKIA 1Y5RA 2HMWA 2X5OA 4OGWA 3RBZA 4TKMA 2WM3A 3OJLA 2HAEA 2W4QA 5DDIP 3WQSB 1K89A 2DUUA 3QQPA 1UXKA 4I9NA 3T7EA 4E6PA 4F45A 2YDYA 3BHIA 4KOAA 2E49A 4OOEA 5IN4A 4CLXA 1QV6A 3MJTA 3VAZA 5MDHA 3QE3A 2O2YA 1YQGA 4BB6A 4K6CA 3DDNA 4ZRNA 2DBZA 4ZRMA 3G1UA 4NG5A 2GO1A 4IDCA 5AXBA 3JQEA 3ONDA 4JXKA 5CDUA 3RUAA 1HF3A 1AHHA 2PZMA 1KVRA 3KYDB 3RJ9A 3U9LA 1H93A 2BF7A 3UW3A 3ONEA 1ZEMA 4RVDA 1I5RA 1AXEA 5A5EA 3NRCA 5AVOA 1NVGA 2W2KA 3UF0A 2YHIB 4NR0A 2NVWA 2Y05A 5CEFA 5KIAA 2C29D 2FOIA 4HUJA 1BDMA 1AE1A 1A4IA 4RV9A 1XLTA 1SMKA 2D1YA 2GERA 1IPFA 4CUJA 1PQPA 1YO6A 1GY8A 3GUYA 4GMGA 3H9JA 5IDQA 4EI2A 1HZZA 3H9QA 1GZ3A 3NKLA 3RVDA 4ZQBA 2Y1OA 3OHSX 4OQYA 2Z1MA 4G2NA 2LDXA 1O6ZA 3JSAA 4W9NA 1U1IA 4RF2A 2O7QA 3B1FA 4CMGA 1P33A 2D5CA 2DPHA 3KEQA 3MTJA 5H83A 3QWBA 3BMOB 3INGA 1AGNA 4BQRA 4JK3A 3PIIA 2OXIA 3WQQA 3DEYX 4GPD1 4CR6A 1HYHA 4BNKA 3U4CA 1ENZA 1FDVA 2EW2A 4I5GA 4PCVA 1K2WA 3CTMA 5B37A 1KBZA 2CDBA 3E18A 4MP8A 1MXHA 4PLGA 5TT0A 3VDQA 5T8KA 1GYQA 3MWDB 1E3WB 2DC1A 5CHEA 3D4NA 4WE3A 2D2IA 5JDCA 3GN2A 1VI2A 1WW8A 3EVNA 1I2BA 3AY3A 4NBRA 2E37A 3GRPA 1N9GA 1LRJA 4MVJF 3OJ0A 4PFJA 4DWVA 3LLSA 5K6AA 3GFBA 4IQGA 3VZRA 3G0OA 4FFOA 3JQAB 4MIEA 3VPHA 1R15A 3HSKA 1KVQA 4NI5A 1V0JA 5A1TA 1DC3A 4R51A 5J23A 1V8BA 3ROQA 5JCJA 3K6JA 1W8DA 4FIZA 1T4BA 2ZKLA 4KDFA 4WEOA 3E1KA 3EGOA 2TMGA 1ZXBA 1HEUA 2QIOA 3BHMA 3GVPA 4D41A 3PJGA 4RJTA 3TQHA 5C7LO 1HDXA 3E5MA 1LNQA 3KV3O 1RPNA 4O6VA 3VZQA 1K5HA 2NWQA 1LC3A 3HE3A 4OH1A 1M67A 1DC5A 1PSDA 2P9GA 4J2HA 3H3JA 5CDGA 1EEHA 1YGYA 1MFZA 5H81A 3OH8A 4E5NA 2B4QA 5TIIA 4NFHA 1SO8A 2O4UX 3MJCA 4PIVA 2AQHA 4L4RA 3Q3CA 2I67A 3ITKA 2DUWA 1QV7A 2VYNA 1EVYA 2WMDA 4FPXA 2NVBA 5JCJD 2H9IA 2JAPA 3QLJA 1HDOA 4UVHA 1LEHA 1U9JA 3DOJA 3D3WB 2F1KA 2NVUB 1J49A 3TOZA 3NGXA 3BA1A 3HZZA 1U28A 4A27A 2DU8A 3QW2A 4IUYA 3KUXA 5FI5A 4YAGA 2DT5A 2DM6A 1HSOA 3LU1A 5IZCA 1XIVA 3WJAA 3LT0A 3PLNA 3GH3A 1XSEA 2C20A 3RIHA 1HTBA 4CJXA 3ZWAA 3TPCA 4ZHSA 1Y7TA 2QX7A 2P4HX 2W2LD 1EFKA 3WJ7A 5FYDA 2VYND 2XF8A 1Y9AA 3GZNB 4FD3A 4NZ9A 3ZNOA 4E2YA 2C82A 4CQLB 5C7OO 1EMDA 4F46A 2Y0CA 1IYZA 4Y98A 2VUUA 4GSLA 3F1KA 4TVBA 3KYCA 4Z9FA 2DLDA 4AJ2A 4ZU3A 3VPFA 2D59A 2FN7A 1CYDA 3BMCB 4AJOA 1I3LA 3IDSA 3PFFA 2JL1A 4BNMA 4CR7A 3IUPA 1AUPA 3P7MA 1BXGA 2OORA 1B8PA 4XQGA 4E33A 1O8CA 4PLZA 2PR2A 3FTPA 1O5IA 3JQBA 4NK4A 4NFYA 5G4LA 1A7AA 1UAYA 4BL5A 4AJLA 3KLPX 4MVJG 1FJHA 3VH1A 5T67A 1Y5MA 3HN7A 4OXYA 4WJZA 5EN4A 2IZ1A 4DIFA 3LK7A 2CDAA 1PZFA 4FQ8A 2AEJA 3WLEA 5F21A 4IS3A 4JBGA 4MIYA 2HK8A 3EMKA 2EG9A 2X58A 1YOVB 1DOHA 1DIHA 2Q1WA 4FB5A 1EVZA 1J4AA 4CMEC 3WTCA 5I7FA 4RQUA 4E30A 3AUAA 2GGSA 4CL3A 4EJ0A 3LT4A 1LI4A 3Q11A 4LMRA 4BNXA 3AY6A 4FJ2A 4LRTB 5K0ZA 3BMOA 3GT0A 3OQ1A 1F8FA 3G1TA 4RPGA 2AQKA 4XCVA 3RKUA 2I9PA 1SCUA 3DZGA 3FPLA 5TF4A 3GHYA 3FNHA 3BTSA 4YAIA 4XX0A 5G4KA 2QRJA 5A9SA 2YDXA 3H4VA 1E3EA 3H9GA 1E3JA 4GGPA 1WZIA 4BMVA 1O95A 3RCBA 2A92A 3S2IA 4S3MA 3BHJA 4PG6A 3KSZO 5L7WA 5FI3A 4D43A 2WTBA 4Q3CA 4R16A 5THKA 3RUIA 4RPLA 1O94A 4BO4A 3JD4A 1MB4A 1PJSA 2CZCA 1LXCA 3O03A 4AJJA 4E32A 3GVIA 4CLOB 2FWMX 5EJ2A 3PHJA 4MVJP 1UAGA 4XR9A 1O0SA 3DAGA 4ND1A 5HS4A 2UV8A 4DGSA 4AJNA 3F1LA 3HB4X 3G17A 4XQEA 1B7GO 3TZQA 3MJSA 3RFXA 3ZWMA 1ONPA 1LDEA 3FD8A 4QSMA 2EGHA 1T1RA 4UUOA 2WYWA 1RKXA 2EJWA 2PKQO 3IKVA 3C1AA 4B3HA 1PS8A 4DRYA 1ZK2A 2VWQA 3DAPA 1E92A 2VNAA 4U0KA 2OP0A 3Q6IA 5KJ1A 4J49A 3DBHB 1O89A 1DRUA 2GF2A 1ZK0A 4IDDA 5JFOA 5KVVA 3CKYA 1QYWA 3QY9A 3JQFA 5L4SA 2R00C 1Q7BA 3TL2A 4Z0TA 3HDQA 1I3MA 4K26A 2A94A 2JJYA 1CWUA 4DA9A 3JCZA 3DZBA 1Z45A 3F5SA 1OZAA 4J43A 1PR9A 3QRWA 1V35A 2AEFA 3FNGA 2GZ3A 1OMOA 3D3WA 1GUFA 1HXHA 1EK6A 5EQFA 3AW9A 3LVFO 3FR7A 4EUFA 3NYWA 3UICA 2A9FA 2HMTA 3DBLA 4Z0PA 4BO8A 3WGGA 1HZJA 4B4VA 5HM8A 2IZZA 2GN4A 3T4EA 3OICA 4TROA 4ZQFA 3HN2A 1U5CA 2GCGA 2TMDA 1WZEA 4XIJA 3TZ6A 4IPTA 4BNWA 4JJIA 2FZEA 4E5MA 5DNAA 4BNZA 2ZYDA 1ADBA 5KNLA 3A06A 2IXAA 4DUPA 3WG9A 1LJ8A 4DPMA 2Q99A 4O5OA 1FDTA 1H2BA 3DAFA 3N74A 1PS9A 2ZB8A 4E0BA 3I52A 1DJNA 1UZLA 4MO2A 1X0XA 1IUKA 1YWGO 5TSDA 4D0RA 2ZATA 2EEZA 4NU6A 4DQXA 4E2WA 4NBUA 1ZH8A 1CETA 4W7IA 2X23A 4WOKA 5TX7A 3U0BA 1ZUD1 3GVXA 2PGLA 4D3DA 3WOHA 4FCCA 3OSUA 2WSBA 3WMXA 4BVAA 4RQTA 4CQMB 2BLLA 3NTRA 4IGEA 1SC6A 4KUHA 1DHRA 3TOXA 1ENYA 1UJMA 1UZMA 2VNSA 4J7UA 1PJBA 3U62A 5CDSA 2O3RA 1GQQA 3HNPA 4RZHA 5G0SA 5BR7A 2PH5A 3I9KA 4CM4B 4E13A 1R4NB 3BIOA 2BELA 4XKJA 4C4OA 2IRWA 3Q2IA 4BNYA 5IDYA 4CMCA 4UVEA 3AI2A 1PZGA 4XYEA 1IE3A 3W1VA 4L75A 1GEEA 2EV9A 1ADGA 2BI8A 4N5MA 2QQ5A 2WYVA 5KKAA 1Z82A 2J3KA 3GAFA 3NT4A 3HHPA 2X5JO 4DQUA 1B8VA 4CM7A 4AJHA 2CFCA 4J90A 1TI7A 1H9AA 4TZTA 4BQPA 5JW6A 4PVDA 4FN4A 4NMHA 2WEKA 4A5OA 1DBVO 2C07A 1YKFA 2J8ZA 4BGUA 1XQ6A 1KETA 1CERA 3EW7A 1Y8RB 1EK5A 3L6DA 1EUDA 4JNKA 4FFPA 1P45A 1SB8A 1B0AA 2Y1GA 1R0KA 3AOEA 1FDWA 4W4TA 3OETA 3ZHZA 4CLRA 1GPJA 1XWFA 4E4YA 4LVCA 4DMMA 2NU8A 2NNLD 1JN0A 1X15A 4RVFA 4EYEA 2NSDA 2XOXA 1Q7GA 3I9MA 3H2ZA 2PD4A 3FWNA 3GC6A 1B16A 4B8WA 5T64A 1UR5A 2Q1UA 4IXWA 4B7CA 1A27A 1FDUA 1LDMA 4IDGA 4PZDA 2FSSA 3O26A 4NPCA 3VPSA 3PHLA 2E48A 1ZSNA 1D1TA 4YQYA 5THQA 4HFMA 1NQOA 2ZCVA 1E6UA 5I7VA 2PD3A 3U09A 3LSYA 4DBZA 2VTEA 1BXZA 1XDWA 4IJUA 1QYDA 2JHFA 3DZKA 2I6TA 5DBFA 3PJDA 4RZIA 4CMKA 4RLHA 4IJVA 3DBHA 4XYGA 3EAGA 1P1RA 4IM7A 4OAQA 3PIDA 3V2HA 3HWRA 3O4RA 2PKQP 3EUWA 3GMDA 4R4JA 1GUYA 2QHXA 2ZTMA 2HRZA 4YT8A 1KVUA 3K73O 4OQZA 4WCFB 1G0OA 4GSKA 5I8ZA 3TWOA 5JAZA 3CSDA 3JQ8A 3I9OA 3WYCA 3ULKA 1EDZA 2ILTA 5HBRA 5CDTA 3LLVA 3M6IA 2O7SA 5KJ6A 2VZ0A 5L4LA 2IODA 2X1HA 4XRRA 4PLCA 1ZEJA 1P1IA 3K8ZA 1KEUA 4RDIA 2J5QA 1SPXA 4CUKA 4F6CA 1U3TA 4Y8VA 2PA3A 4YA6A 2PY6A 2ET6A 3OMLA 4CMAA 1IPEA 5DULA 5GMOA 5ILOA 1LLUA 4J91A 4JIGA 4ALMA 5L95A 2PZJA 1GADO 2O48X 1FK8A 1PGNA 4PZEA 3WGOA 1NWHA 3TJRA 1B3RA 3L4SO 4MVJH 3VZPA 3JQGA 2O3JA 5KVSA 4OYRA 1YQXA 3DONA 3SXPA 2X8LA 3OBBA 5EQDA 5HWSA 3S55A 1NAIA 1XCBA 3B70A 3ON5A 2Z95A 1AXGA 4N5LA 2BHLA 4L4SA 4QO8A 1QLJA 1LDNA 3ZWOA 4JLWA 4FFLA 1JAYA 2B35A 4WNCA 2FR1A 2Y67A 1HLDA 3KXDA 1Y9EA 1TEHA 3KHUA 3RKRA 2X5KO 2CF6A 3PWSA 1A72A 3FHLA 1DEHA 1GAEO 2G76A 4E2ZA 4XGKA 5JMWA 4CQMD 2BFAA 4I9UA 4BNVA 4XIYA 3VKVA 4N7RA 5T6BA 2P9EA 2QG4A 5C37A 3O38A 1EE2A 4R69A 3RUHA 4CM8A 1RM0A 2BFMA 5BNIA 4YTEA 2C5AA 4FC7A 4TQGA 5DP2A 3I9NA 3TN7A 4OKNA 4D79A 1D1SA 3C7CB 4BKQA 4BO1A 2Y1FA 5F5LA 3GPIA 2NTVA 2VUSA 5JXWA 3D0OA 1HETA 1IB6A 3H5RA 2WD7A 4XRGA 2Q4EA 4CM1A 2HRBA 3FRJA 1DIAA 1N9GB 5IAAA 3L07A 1DSSG 1NFQA 4O1MA 5EESA 3RWBA 2FPPA 4PLVA 1E1NA 3W6UA 4ND2A 1HL3A 5GZ3A 4PLYA 2BMAA 1N7GA 5JMPA 4LSMA 2PTGA 4B4OA 1Y8QA 3DR3A 1W4ZA 4RORA 5JBIA 1G6KA 4FGWA 4LGVA 2YV1A 4W9NC 4WNIA 4Y67A 4AJ1A 3P19A 5BNTA 1P77A 3CZMA 1RJWA 2HJRA 1EQUA 1P1HA 4ROSA 4YDRA 2X9VA 2X4GA 3E8XA 3G3EA 2B36A 2EERA 3M2TA 2NQ8A 2VHYA 4PGFA 4L0QA 4HFJA 3UUWA 2V6BA 3VKUA 1UH5A 2QRLA 3W6ZA 4DLAA 3ENNA 3LT1A 4BNLA 3PP8A 1CJCA 1X7HA 2FP4A 3QA9A 4GH5A 3PYMA 5HTOA 4KUEA 4IXTA 3I83A 1ZJZA 3DO5A 5L45A 1A9YA 1B8UA 4P38A 3ASVA 2D0IA 3H65A 2P5YA 1HDRA 3GF4A 2QRKA 5TT1A 4YR9A 4GVLA 4EBFA 1U4SA 3TFOA 4BGVA 1MGOA 3QJ5A 4Q3DA 2QZZA 4F3YA 3F46A 3GUCA 4NH4A 1ISHA 2VHVA 3ADOA 3PWZA 1PL8A 4R9RA 5A4DA 3KO8A 3D5QA 4CMIB 3ZU3A 1P1KA 3DZIA 4M87A 3UVEA 3AOGA 2Q2QA 2EP7A 3OECA 3H5NA 1T26A 4W82A 3ITDA 3OQBA 3KYCB 1F14A 1YXMA 4E5PA 3C1OA 3SBOA 3N58A 4RPJA 2VTDA 1LUAA 4QUKA 4JROA 2OFPA 4J7CA 5FFFA 4BS9A 3QWHA 5LC1A 4AFNA 1BXGB 3ZW8A 3M2PA 3RC1A 3TF5A 4P22A 1WDLA 5A02A 3H7AA 4IBOA 3ZHYA 5I7SA 4CV1A 3RI3A 4GLLA 1EDOA 5L7YA 4NBVA 3NJ4A 4NJOA 1ONNA 4D45A 1I01A 4FFRA 3DOCA 2G82A 5A9RA 4BO5A 2R2GA 5TC4A 1UP6A 4BKRA 3IJRA 1NNUA 3KOUA 6LDHA 1PQUA 1N5DA 3BMNA 3VPXA 3QWIA 3VOSA 2O3TA 2YUTA 3JQ7A 4M89A 1WWKA 4EJ6A 5KTKA 2EGGA 1V9LA 1GV0A 3HFSA 4WLUA 1SBYA 4JX8A 3W8EA 4PLWA 5G4KB 5A9SB 1PJCA 3QIVA 4HFRA 2I99A 1ARZA 1WAMA 3UXYA 3ZCXA 4PG8A 5L7TA 3WGYA 3BYZA 3QHAA 1N92A 4GWGA 4QFCA 3V1UA 4AICA 1JA9A 4RF3A 5H82A 1JKFA 3ZV3A 4J6FA 1WNTA 4DPKA 3IP1A 9LDTA 2NUAA 3K30A 2GR9A 3PQEA 1JAXA 2Q50A 4M55A 4FOSA 5A06A 4OIMA 5I9MA 1QG6A 3JYOA 2JCVA 5DP1A 3DTTA 1QLHA 4DMLA 1N1GA 4PRKA 3OA0A 4ALNA 3AUUA 2G17A 3R0IA 3L0DA 3X2EA 1I10A 3I1JA 5CFZA 1LLQA 1DXYA 3RUFA 1LQTA 1KERA 2ZK7A 4J9VA 4RPKA 4J0FA 2ZB4A 3RUDA 5KKCA 3OJOA 4J1TA 5G0WA 3K2EA 5K9ZA 4GQAA 4KQWA 3ZV5A 4B7UA 2HMVA 4YT5A 3JYLA 5ES3A 4LISA 1U3VA
chains in the Genus database with same CATH superfamily
3JR3A 4OH7A 3ZHOA 5P21A 1DG3A 1Y37A 1LU9A 2X1LA 3I45A 4DVGA 2M9MA 1MVOA 2W11A 1LKZA 3T4PA 4H4EA 2CCJA 5IP5A 1QPZA 4DY6A 3ICQB 1GG2A 2ATIA 4W1SA 5B3KA 4RFSB 3ANMA 4L5YA 1N2IA 1MX5A 1OSNA 1PGJA 2A4MA 2FOLA 2QB5A 1KY4A 1LBEA 4R1SA 4J0EA 3SNKA 3I2FA 4CHTA 1VSQA 4WCVA 4I2NA 1E98A 1ZR2A 5I6DA 4G5HA 2XNDD 1TGYA 3KHSA 2I54A 5EHNA 3DQQA 3GT4A 1XYGA 1ZO8A 4IIXA 2ZANA 6YASA 5KYKA 3W1WA 2FY8A 1ILEA 2KBEA 2CHQA 4GC9A 5LA6A 4B6FA 4ZYLA 1ADFA 1UPCA 1TFRA 1NUUA 1C2TA 1QJCA 1R88A 5CT6A 3SYLA 1M75A 1NBWB 1XO1A 2I2BA 3DBLB 1X1QA 3MCWA 4IRMA 3B2QA 3NGLA 1B74A 5T3UA 1NW7A 4PXAA 2Q4TA 2I3AA 4DLVA 1MX1A 5FTLA 4LGYA 1IOVA 3SQLA 3CIFA 3WDKA 3PRJA 4IIVA 4II2A 1NMYA 3KRTA 4U00A 1P5HA 3GT3A 1P39A 4Z4FA 1MQSA 4OPMA 2ODPA 1SHJA 3WQHA 1DJPA 5C1OA 1LQ2A 1IXKA 1HE5A 1G5RA 1VB5A 2AFHE 2Q6OA 1RKVA 3DHVA 3ETEA 2HPAA 3PLRA 2VS1A 2G0TA 5E9QA 3LUHA 3MXOA 3F6RA 3PDCA 3FBWA 4LOJA 4LOKA 2AZTA 2OSVA 1X42A 1RTTA 3T1QA 4DLRA 1X1EA 5BQPA 3D2AA 1YE3A 4AS1A 2JCBA 4JUFA 5HK8A 2CVOA 4I8IA 1BXRB 2GEFA 5D1HA 1EXWA 1L4UA 3NEPX 3Q3IA 5BSGA 1J8DA 1F8UA 1ND5A 1EVJA 1E7WA 2QPLA 4YJ2B 5REQB 3TGPA 2OUIA 5DNEA 1CQXA 2UXCB 1VSVA 1C9KA 4WKCA 2W5UA 3DOOA 3N2ZB 3ZTYA 4BX9A 3TI9A 4EITA 3FJYA 5JNSA 2DHEA 2C2ZA 1JKIA 1JILA 1N2GA 5CH3A 4ALKA 1Q57A 2Y1CA 1ZJWA 3CF2A 4BJHB 4HB4A 3NUGA 3EARA 5ED0A 1Y6GA 4QRIA 1EWYA 2J3QA 3E61A 4L85A 5EWMA 3RJ5A 1HT1E 3U81A 5CNIA 1UCFA 3Q8WA 5CA0B 4B4UA 1E3SA 4D0GA 2W8ZA 5ALRA 4QRDA 3KUDA 3EH2A 3IS3A 2PGAA 3IR7A 1WUJS 1A9QA 1RWBA 3IMGA 1ISIA 2DKNA 3N5KA 4B44A 1L4EA 4I50F 1QH1A 3U3JA 1U8TA 3Q1LA 3HXLA 4TMKA 4F85A 3QVXA 4ZDWA 1FZTA 2PSEA 3BIJA 3ZD7A 3SDBA 3H87A 1XRSB 4E3ZA 1DC6A 2IYTA 1A8SA 2FF7A 2B8TA 1Q83A 1NURA 1JEEA 1JA1A 1JQ3A 1SU6A 5DFAA 5ER9A 1EFVB 1I4OA 4IQ0A 3IRVA 3MGCA 3ZHBA 4TLAA 3HI4A 4BGIA 4ND8A 4B6JA 2O52A 4KBFA 4X65B 3ZGZA 2GZ2A 5IYZF 4KE7A 1PL6A 2GRUA 5D5PA 5I4BA 1UBLS 3U39A 2H6EA 4B4KA 3UJBA 2IH2A 1P29A 1C1XA 4RGQA 2HLDD 5DM4A 2JLCA 4V2IA 2QJFA 1AQNA 5IT9A 1A4RA 2D00A 1KSJA 3ASUA 3X1KA 4YV7A 5JSFA 1FRVA 2BFOA 2GK6A 1H3FA 4W5QA 2FPGA 4KUGA 4MXDA 4P98A 2PEYA 4K9DA 1EUDB 1EU1A 3EQ8A 4ZP1A 2EKQA 2WU4A 3H42B 1OXKB 5IPFA 4XAQA 4Y2UA 2A5FA 4BNIA 5BT8A 4ARZB 4O2LA 2XGMA 3M49A 2C88A 1TO6A 5KZMB 2WPDA 2H0RA 4ZI3A 2EOAA 5C51B 4TUYF 1W19A 3KS9A 2J7PA 3R5XA 2GARA 4M49A 3OX2A 3ZJ4A 3OA2A 1U0FA 3P2MA 4R2KA 4TV9B 3PDUA 4QC2A 3O0DA 5CIQA 1YCHA 5B6PA 2JAQA 4G0OA 3LDHA 2I7VA 5TMBA 2O1SA 4WOBA 3H6GA 2H57A 3O2SB 1J0CA 4LW8A 1OBVA 2EYQA 2GNAA 1GSHA 1N3YA 1DC8A 1DPFA 1U80A 1Z7EA 4NATA 4JBWA 3IOCA 4IJQA 4MRSA 1L3CA 1IN7A 4IIEA 1Q7CA 4P84A 3IEKA 4O2AF 1YZVA 1ZGJA 1VHQA 3PGXA 3G5MA 5K0FA 5JC1A 2XY4A 3SAJA 2BUAA 3GLSA 1CUJA 1EH5A 1XZGA 2JS7A 3ANSA 2BFEA 1HE8B 3LHFA 2BMEA 4GEGA 4QASA 5FBLB 1GV1A 1PNOA 4Y30A 3I05A 4PR3A 2AMFA 4GM1A 1D2EA 1JR3A 4YT4A 3SHTA 2SKCA 3BDVA 5FAKA 2XB4A 4IDAA 1R0SA 2TMYA 4GF5A 2ATXA 2W90A 5F73A 1IDOA 3WQRA 3NDJA 2D5BA 3ZH2A 2BCJQ 2PL5A 3KJEA 3QBJA 4YP5A 4HNGA 1DHTA 2IYNA 3QX7A 4QDKA 1N9ZA 4F9GA 3DAOA 3KEOA 3L04A 3D6TB 4MR9A 4F9EA 4PAQA 2QUHA 3WWYA 2JFQA 4V0OA 1GDHA 5CB8A 1IN1A 1G2QA 1VPVA 3W7AA 2DUJA 4LKOA 1XV5A 1CZHA 4LJ9A 3H5AA 1T6YA 3H3XA 3PXCX 2QZ9A 2F2TA 2O2CA 2VO1A 2W2QA 1RYEA 2R5WA 3PICA 4R1QA 4YJHA 3TZKA 3KQHA 1A8HA 4F6LA 3ZV7A 4ALJA 3M4YA 5KTRA 1C4OA 2VOEA 3F6PA 4B3BA 2YJGA 3TEJA 4ERNA 2IP1A 2C4VA 3GFSA 1KQFA 4ZO9A 4OJYA 1EP1B 3GJTA 4A0SA 4LXTA 3ZWVA 2VN8A 1UPXA 1HYQA 3PD7A 2JBAA 1ESDA 2XWJI 5IASA 4HEA6 4KEAA 1IQ0A 3PDIB 4CHGA 3QENA 2VDOB 1TLLA 1TB4A 2P3OA 4RELA 1JQJC 2C2KA 4MWTA 4PNPA 2WIGA 4EY7A 1ZHFA 3AQIA 2GFQA 4KQGA 1ZCJA 2B2NA 4RQBA 2FSVA 1Z47A 1GU7A 2R8ZA 4GW3A 1F6BA 1Z8HA 3GEDA 3RS8A 1YFJA 2WLSA 2B1GA 3FSGD 2QE6A 3KKEA 1NN0A 2VQDA 3P9NA 3QK7A 5DOVA 1U1GA 4HC4A 4JYZA 1SCQA 2VJPA 1V41E 1GQYA 1G1AA 1U90A 3EIQA 3FR8A 1Z12A 4JWTA 1OFUX 1S2OA 9LDBA 1A77A 1YS1X 4OQNA 5ALQA 5DGDA 4B9AA 1CFJA 1YULA 1J07A 1WDKA 2VP2A 3G6WA 3RASA 2VT6A 5JADA 4DW8A 3THXA 3WKEA 2VHXA 4EEXA 3H13A 1DKPA 4WEQA 3ADPA 2DBRA 4RBNA 3B52X 2OMEA 1FUUA 2O8VA 2PZKA 3G2NA 3K09A 4GAEA 1QP8A 1QYRA 1YZFA 2V7QA 4PLHA 4WVLA 4D96A 1GZHB 1NF3A 2FQQA 2G9UA 2R7KA 4QEDA 4EDHA 2TS1A 4O4LB 3VDXA 4EI9A 3E35A 1ZITA 1S4MA 2LV8A 3PE6A 4JU9A 2FUCA 1VIDA 3OZXA 1GCAA 4L9AA 4MMZB 3SLGA 4D4KA 4BCDA 1R16A 3NFYA 4G65A 2PUAA 4CM8B 3EUEA 5AUPB 4LYGA 1QYXA 2GBIA 2Q3MA 3MF4A 3EWIA 4NBWA 3UJHA 2ZSBA 3S28A 4DY4A 4DIDA 2XR1A 1VCHA 1XE3A 5SY6A 1O6GA 2BLNA 5FEUA 3ZK7A 4YXFA 5FX2A 4UNIA 3KZNA 3U6KA 1PG0A 1J00A 1SUEA 2JGMA 2JJ2A 3O92A 4A2QA 4YAEA 4LYAA 2JHAA 4TTIA 3LA8A 4LHSA 2P11A 3GBPA 3O9ZA 1G0NA 2D1FA 2XD9A 5KYWB 4UBLA 2YZKA 1Q17A 3AP1A 5CVUA 3JVDA 2VRCA 4DLUA 4IEEA 4KLAA 1B6GA 4LCBA 3ZJYA 2E89A 4CL2A 3R9XA 6ABPA 1EFPA 4QBGB 1QDEA 1RJEA 4F7WA 1UC9A 4YJFA 1PRYA 4ARBA 2I6UA 2C8KA 3FUXA 3ET4A 3T7JA 2R00A 4R9VA 3TR6A 1P60A 1I30A 3SQWA 5TPZA 1W52X 1R0RE 1YL6A 2C54A 2H2AA 3EZ6A 4K9MA 3EMVA 2RHRA 3JSXA 3IMCA 5ECDA 1K6MA 1Y8QB 1BCRA 4Q7LA 4NYMQ 3PVZA 1SR8A 4BB9A 1WP4A 4KMSA 2IYQA 3WNQA 4F9FA 2O8NA 2E82A 2ZJ0A 2XYRA 3B1KA 1S3FA 3F7OA 4RA6B 5F3RA 2COKA 3HO1A 3TBFA 3WTBA 3BF8A 5EERA 4ZVRA 4CV0A 3RS7A 3DV9A 3HJHA 2IYAA 4KLRA 4LGCA 1XA0A 3EXHC 3JZIA 3UAVA 3BL8A 4CMHA 3FTFA 3UCXA 3QE9Y 1F6WA 3EDQA 3UAXA 3VM6A 1BRTA 3RVPA 4R2WA 3R3YA 1I24A 5C8VA 3JQ6A 1K4MA 1WW3A 1QWSA 1RQPA 3JALA 3EGWA 4KQEA 2O4CA 4LOIA 4AKHA 5JXIA 2B69A 3EVAA 2P77A 4I99A 3EVFA 1NWCA 3CUKA 4YBZA 4JMLA 1U2DC 2DE0X 3T8YA 5A62A 1J7KA 5KMGA 4GFDA 5IF9A 2MTBA 3B1XA 1CZUA 1ENPA 1W94A 2NO7A 1QQ7A 2YRWA 2YHBA 1KGDA 4U4AA 5FFNA 4JQOA 1SBCA 2XXBA 1BVUA 2UXBB 5CNJA 3BSYA 4B76A 2VRNA 1IAVA 3IQFA 5A3JA 1YL7A 2GF9A 3BXEA 4R3WA 2WD8A 3T7IA 4YCMA 3ACBA 4V0RA 2OV8A 4FXOA 5JD3A 5KHLB 1RXWA 2OG2A 2EZUA 2HBQA 2CLCX 5F1KA 2GYWA 3L4BC 5D85A 3FPAA 4DV7B 1EWQA 1NATA 2I4OA 3NHMA 3FOCA 3N07A 4ZPXA 1FRQA 2RH8A 5JYBA 1I4LD 3OFJA 3UMJA 5IUJC 1PNVA 4BKOA 4BQNA 3DE4X 5GOZA 2IOQA 3AZQA 4ZO4A 3MWLA 3CT6A 2Z6AA 2Q3LA 1N1MA 4J0GA 5HJ5A 4R1NA 5BR8B 4FOPA 1L7EA 3N76A 1QSGA 3P9RA 4N0PA 4QSHA 2J30A 3AM5A 5CM9C 1FYXA 4E4TA 3AI7A 2V55B 1JS1X 4FP9A 1DEOA 1H2AS 1VG1A 2Y27A 4B82A 3AILA 2X9QA 3G88A 1MT0A 2I66A 4RH1A 3VHLB 1NHGA 3Q9UA 5TS2A 1RXCA 4LRQA 2GSDA 2QZJA 3CW2A 4FNOA 4UM8B 1HNNA 3KCQA 3I9V1 3LSTA 1KZ4A 1XN4A 4MICA 3TYXA 4HR7A 2QROA 5KPJA 1SCIA 2Z2XA 4INJA 4KP7A 3L5OA 3EPHA 4G0NA 2ZSJA 2LKDA 1F8GA 2QI9C 1L5ZA 3F49S 3BULA 4UNPA 4AKTA 3PJRA 2WJJA 3QY0A 2AYYA 2EJVA 3GGPA 3DL4A 2PUGA 3C5VA 1P72A 5TQ0B 3VVCA 3WFJA 2HIMA 3AERB 3QXHA 1TT7A 1O7JA 4IIYA 2CJXA 2FNAA 4IGIA 4PBSA 3CS3A 3NMUF 1E3QA 2Q49A 2QN7A 4IR7A 5GINE 1C7IA 5C5CA 3HJAA 4DQDA 4UOEA 4MZXA 3TZLA 2BFFA 3KHKA 1JXAA 1NFFA 3IERA 3R24A 3AY7A 5ALHA 2RCYA 1XKQA 2A4KA 4W5NA 3G2KA 3R0XA 5IMBA 3O7MA 3NOQA 3QVOA 3I28A 3MUNA 4GZMA 4YP0A 1AGXA 3OQMA 2J4FA 3K8QA 5DEIA 1NRIA 1XRRA 3B5JA 4QUAA 5JU6A 1KP2A 4DJTA 2YNMC 5BSRA 3G0DA 1RM5A 2LE0A 2XIJA 2E4ZA 3DPUA 4Q9LA 1EXDA 1U3CA 4L9SA 1I4EB 4G1UC 4G0QA 1A5TA 2RKOA 4AX4A 4BLPA 3SQNA 2Y1XA 3VR2D 1X2EA 5JJLA 3U3DA 3RS4A 2Z4TA 2A8YA 2HRDA 3AGQA 1ZH0A 1ZKMA 3NTVA 2AJBA 2P3LA 1MAUA 4LTDA 5ADWA 2JZOA 4D8YA 5TXGA 3OOHA 1N5KA 4M1ZA 3TCXB 3TQSA 4WLVA 1ABBA 4PC3A 1PJ4A 4GP9A 4Z6KA 1OYOA 3E7PA 4XDHA 4ECAA 3CUSA 4I8XA 2DULA 3HP1A 2W0SA 1ZIXA 4L4YA 4WNAA 2AR9A 2VZLA 3JQCA 2VHJA 4M1KA 3WJ1A 2QRHA 5TR9A 5KYYB 5BVGB 3VH4A 4DR3B 4WOJA 3IVGA 3OLQA 3Q0IA 2J59A 3EZYA 1BTOA 1MLDA 4BNDB 2FJ0A 1NBAA 1M1XB 2C7GA 1RI2A 4I4NA 1PJ3A 3Q7EA 4JX9A 2R11A 5AKZA 5K0JA 3OZFA 1N8NA 3LYHA 3KYIB 4LHZA 3S68A 4XYMA 2ECPA 4N8EA 3AVYA 2HH9A 2W6ID 3MUFA 1MVNA 2CFSA 2JEYA 2EJBA 3M6AA 1CLUA 3BTVA 3RYIB 2D0DA 4L8LA 3IE1A 1M10A 1TCBA 2VDPB 2NACA 3RTGA 4EENA 4MUAA 4V0NA 1JFSA 1QQ5A 1WXFA 3I6IA 1DE0A 5JY6A 1ORRA 3AMVA 3QPBA 4LNAA 4F4DA 4WZAE 5G0UA 5B7NA 1W36B 3GH1A 1Y98A 2MSKA 3CNHA 1PBNA 4LC1A 1TEXA 2BWJA 3RAFC 2PWYA 4J4BA 1I8TA 1OWLA 4PAOA 2BEWA 1Z2OX 3UMVA 3HYNA 1WE2A 4HNRA 1U4NA 3EIXA 4EP1A 2BT4A 4UUAA 4GPEA 1KH2A 4DEYA 1GNQA 4IY1A 2Q46A 4E5SA 5K8TA 4HSEA 4UZFA 3DDZX 3WGQA 1QHHA 1YR3A 4HXYA 2Z83A 3HJNA 3ZDFA 3DVAB 2H4JA 2ODQA 3CM0A 2HCJB 5K6AC 1W59A 4RF4A 4BNGA 2ARKA 4LA4A 1N6NA 1FFXA 2IUSA 2GK7A 2X86A 1FXUA 1W5SA 1J56A 1B73A 2ZQYA 2ZSHA 3OE5A 3TO5A 3P2EA 3WRYC 5M34A 1GM5A 2W42A 2JKYA 1VE5A 4TOIA 1NF2A 1PO7A 1BOFA 3WL4A 2NO1A 1DBSA 2GLXA 3VRHA 2C5GA 4UM7A 3DUFA 1UP4A 2C57A 1LBHA 1LBTA 3K9WA 4HQOA 1O0BA 3WRXA 1H2EA 4IO0A 4AMBA 3A9WA 4Q6BA 2VEDA 2BFBA 3KE9A 1XQWA 3G5TA 3UBTA 2AMYA 4EUKA 5BN3A 2F1HA 2V3CC 4A8JA 1J2RA 1KFBB 4QXAA 1RR6A 3MEQA 5BYAA 2ERYA 3L0BA 4QM6A 1YIOA 3M34A 3PNBA 3UJ6A 2VYVD 3W5IA 4FFMA 4N01A 4MGZR 4FHDA 2C3UA 2QY6A 1HWYA 2NZVG 2YWDA 2B20A 5ARBA 2CUZA 3I73A 3IP6A 3C7AA 1UDWA 4O0LA 5EUCA 3CUTA 3JX9A 3U1VA 3WYGA 3PXXA 1U7ZA 1EIWA 4WDRA 4RTRA 4K5QA 4ZTBA 3IEUA 1Z73A 4HN9A 3IYLW 4PHGA 1SXJD 4C0KA 3PCTA 4D57A 3OEWA 1SXGA 3KHTA 2DRIA 2WIFA 3SM3A 4IF6A 1LJLA 1V8FA 3BWXA 3MA0A 3NDBB 5JAPA 3W8RA 4MR8A 3NWEA 4CU2A 1PX0A 5DN9A 4E21A 5HKAA 1SBTA 2NO0A 4KLCA 4KVGA 1GL3A 3NVDA 4E6EA 2R79A 1GL6A 2ZUUA 1NBEA 4GKVA 3L7OA 5F35A 4HJXA 3X1YA 4FYWA 3A9UA 4DN6A 4BEBA 2ZYIA 4ZZ0A 2GD1O 7AT1A 4O63O 1FFAA 1QB8A 2Q4DA 2XI4A 1UFQA 3U4QA 1Y8AA 1ZL0A 2FSUA 3HYSA 3JARA 4G41A 3FJ1A 2VCEA 1SKAA 5EMMA 5HPYB 1G3RA 2JFGA 4MYDA 3UHJA 5IF3A 5ITZA 2BZSA 1NVUQ 2F62A 1EFUA 3U3MA 3FRIA 1YI0A 2AUNA 3ZK9A 2CVPA 2BW0A 5L9AA 1DXQA 1P4JA 4WK4B 4CODB 3LXUX 4H6VA 1FNDA 3DCNA 3P94A 5JPIA 2VPQA 4JLVA 4DNFA 4F12A 3FTEA 3PUJA 2XADA 5KI6A 1U04A 2RIRA 3ISJA 3KQMA 4JBIA 1IULA 4NAVA 3D8TA 2J7KA 1IQUA 3O8DA 4I55B 2YZ7A 1TU4A 2FUKA 1GZ6A 1KYWA 1RRPA 4U7WA 5EIBD 1I9CA 1CF4A 1YJ5A 2UDPA 2OVFA 2HBZA 3HB0A 3UXHA 1FX1A 4EHAA 4MKHA 4PRLA 3LJKA 1NA5A 1QIIA 2OORC 1FDOA 2LD4A 4JZYA 3IBYA 5TGZA 5KDLA 1BJRE 3DFUA 2IZ0A 4AJ4A 1MO4A 4DA7A 4G8DA 1FX0B 5CM8B 1ZI9A 1F4VA 1EBFA 3TLKA 4BFLA 1SEPA 3JWPA 1JG7A 1KS2A 4URYR 1N2EA 4RENA 5JCZA 5J2UF 4N7MA 5IARA 3VFDA 1E1MA 2EVWX 2JIDA 3QEOA 4R1LA 9ATCA 5LMNB 1YB6A 1A9TA 1NMSA 3QVTA 2ZYRA 3OCCA 4TQUS 4YUYA 1QCYA 2X3YA 2NAFA 2O3QA 3C2QA 3KPJA 3QPCA 2O0LA 4WN9A 1ISSA 1DCMA 3IVAA 2YWRA 9GPBA 3GLHB 3A2NA 1G4UR 5ALFA 1NG9A 4HB3A 3VU8A 1O8BA 1OPXA 3LQFA 1S8NA 1LLDA 2P3QA 4C4TA 4ZZ1A 1JJFA 1T5DX 3G2LA 4ZJPA 2QVBA 1G8GA 4M1MA 3ZCTA 5C8YF 3DBIA 4DF3A 1U2ZA 5CDFE 1BWQA 1ISJA 3OZVA 1CEYA 5DNWA 4HQFA 2BKAA 1L1FA 1WABA 4C3VA 4XR4A 3SYMA 3K0AB 1KTVA 3VR4A 2A0UA 2SCUB 2ECOA 2A3RA 1T10A 3GG2A 5AI6A 1O95C 2QTVB 5B1DA 4Q9KA 1ZCZA 1R4ZA 1XVIA 1Y6RA 2B9EA 2RHHA 4BFUA 4RPIA 1Q0ZA 4FCVA 3ZH9B 1L7OA 3JS5A 3G49A 1TA0A 1BYIA 3MFQA 1O94C 3CHYA 3VHXB 3GLGE 5IWAB 3IPCA 3DEFA 3I5YA 4CEHA 2PZBA 1RMYA 1SIUA 3JPYA 1IHDA 3D7RA 3GDGA 1CJKC 1EVKA 4LX0A 2VT2A 4B43A 4E1BA 1K6XA 2QT1A 4CPDA 2WINI 4Q1VA 4JI5B 1MTOA 3L41A 2JFUA 2X13A 1D4OA 1E8MA 2ZIXB 4NJMB 4WA7A 4F2GA 2FMUA 3WWCA 4OHOA 2IBMA 3A4NA 3ND5A 4KG7A 1MC4A 1KK1A 1VRCA 3SS9X 3SGLA 4JVSB 3BRSA 1ZK1A 4JBXA 3KKLA 3MBKA 4Z9YA 1DDGA 3EVCA 1QYCA 1JJAA 1ZRHA 4G67A 4GICA 4KDCA 2RKWA 3GGOA 2OBFA 4XIFA 5LDGA 4QGSA 4ZGBA 5AW9A 1SD1A 4CF3A 4YAOA 2HEGA 1G17A 4KYVA 4Q7KA 4E4RA 3FE2A 4Y1RA 5HS6A 4EW1A 4LHVA 5TEWA 4YJ3F 1TK3A 4XIIA 4YMWA 4ZYZA 1DINA 2XT6A 3ROFA 1WNFA 4A0RA 3ZX4A 4B3CA 4HQKA 2P9YA 3N59A 3GG9A 5IC6A 5LLTA 3JQFC 4BX8A 5KYUA 4ZEOA 2ANBA 3PGVA 4KGZA 3EY9A 4DA0A 4BP1A 1M7HA 1PGQA 5LJLA 2R60A 4ZQGA 1ZA2A 1FVFA 3PZBA 4ID9A 2R66A 4UFOA 1VL8A 1JIVA 2ZIZA 1XMSA 4MQFB 3RC2A 3C8DA 3PBKA 4FYJA 4KMRA 4LKRA 4NICA 2W8BB 1IXRC 2QMHA 1NLFA 1U1FA 2H1CA 3NHPA 2VQFB 1EXNA 4QL3A 5TY0A 3M6XA 3DE1X 3N7AA 3G79A 4OGGA 2GT1A 4TGLA 1DZIA 1HFEL 1MJGM 1VJ1A 1X7GA 2FN8A 2NZ8A 2WJWA 2XSZA 3LRTA 3SY8A 3ZI4A 4EY6A 3YASA 5LQCA 5CYPA 1XXLA 3J81A 1IG3A 1R6TA 2ORIA 1USUA 4M1YA 2CVQA 4WI1A 2OBMA 3R9IA 3C45A 4RD2A 3AL3A 2IOFA 2PX0A 3DHEA 4D02A 1GP2A 4DJJA 3TLCA 2Y8EA 3Q9SA 2M6LA 4ER3A 3NH9A 4UDYX 3PX3A 2IY7A 2W7TA 3PUIA 4W6QA 3FPSA 2CVHA 3K2BA 4UVGA 2G08A 2OD2A 1T25A 9MHTA 4MV9A 3R4VA 3K1AB 2WT4A 5LP1A 4HUQA 4Y9DA 5AK4A 4DCTA 2V98A 2XH8A 1XZNA 3IB6A 3TQFA 4BVGA 4C21A 1QU3A 2SKDA 3IP9A 4W6ZA 3VPAA 3KJNA 3E3LA 3A04A 1E7YA 4A0FA 4Z1OA 3IDAA 3FGOA 1XMVA 1KKLA 2FMHA 1U98A 2QM0A 3P9KA 4IKOA 1G8MA 4OM8A 1IIRA 3HCFA 5J3JA 2WNHA 4PBRA 2IFTA 5SZHB 4DLPA 4OHPA 4IJ6A 2O3SA 3SVTA 1X19A 1I2CA 2WA1A 5H4GA 2WWFA 1X7YA 4HX2A 4JR2A 1BDBA 1SULA 4BNFA 4YRDA 2GPJA 1QRRA 3QFSA 1ZLYA 1CIVA 2AFIE 2Q8PA 2Y4NA 4GKBA 1Y42X 1H85A 3TTWA 4BMCA 2CLEB 2MYPA 4PYJA 1F51E 2C5BA 1PWHA 4FOTA 1E3WA 1Z68A 1ZOLA 2JEZA 3MTIA 1FNNA 3NTQA 3FDXA 2V8BA 3H04A 4YJDA 1CZOA 2ZG6A 3A4IA 3H84A 1C50A 3WDSA 1FSZA 3K4HA 5EUMA 4QZVA 3ZE7A 2R7NA 1MIOB 4C2TA 2HNBA 5BO5A 1Z8FA 2VDMB 2WPDD 3DULA 4V38A 4NMMA 1WLSA 4GXTA 4R8SA 4IO1A 2G9RA 4I5DA 1U5BA 2P68A 1NJGA 4J0IA 2J7PD 4YPFA 2RKBA 3WIVA 1ESEA 2ZBDA 3THWA 2ZWVA 2H5LA 3KL4A 4PZCA 2CWWA 4PGHA 3T0FA 4GR9A 3WP1B 3T9FA 2IU0A 4ZC8A 1ZG3A 5F7OA 1B0UA 4KPYA 1MT3A 1S2LA 4DLWA 4G8BA 2HWKA 1NF8A 4BVLA 5AW8A 1TW2A 3HABA 4H7IA 1NXPA 5ILGA 2FSFA 2UZ4A 1XA4A 4BO7A 3VR1A 4CM5A 2FUNB 3AK4A 2EZTA 3NPAA 3BEDA 4O59O 4EGCB 5DYTA 1RZVA 4DFDA 1UQRA 3P5BA 3MB5A 2R6DA 4I1YA 4LDNA 3FDIA 3QVWA 1GSIA 3G02A 3MSCA 4Q3BA 3KSDO 4BO6A 1V25A 5E6SB 2UZ1B 3P0JA 4OK6A 3RO7A 2HSDA 2HC9A 3CLKA 3WLQA 2OLEA 4A7PA 1A9XA 3GLQA 1FRFS 1TT5B 3ZOKA 2VXYA 4MW7A 4I5EA 4BVFA 3UJ8A 4KWHA 1OF1A 3T7CA 4AQDA 2B83A 3SYTA 1HE3A 3IBGA 4LMPA 2BEVA 3RTBA 1E1QA 3E7DA 2V97A 4MW9A 4N5DA 4D9FA 5JNWA 5H8WA 3WK4A 3QEAZ 3H17A 4C7XA 4D9NA 2RGRA 3U7QB 4UJ5A 4UJ3A 4F2PA 4V0QA 4BJ1A 3D4PA 2WU3A 3IIEA 4YLGA 2IYOA 3S29A 1ZSYA 2GASA 1CBUA 1C5KA 2ZKIA 5JY1A 3KE8A 1LSOA 2ID4A 3HUDA 3I32A 1KU0A 1QIKA 3UOWA 1TYAE 4YRZA 1N1EA 1E5DA 3IMKA 3GNLA 4N8DA 2HIAA 2QL7A 3OFND 1OHHA 4JR1A 1NSFA 3JYNA 1D3AA 2BZ1A 3NWPA 1VL2A 4QOIA 5CLGA 4UTXA 4IDEA 4P53A 2UXDB 2FR0A 2BIFA 4CKXA 3U56A 1UOPA 4MTCA 4GPBA 4O0MA 3B1JA 3H9EO 3RVBA 3UJPA 4EHBA 5A6SA 2CNDA 1YUNA 3AM4A 3GXOA 4OMDA 4W7SA 4EHFA 2WQ7A 5A7HA 1YFKA 2FLKA 3QSYA 1G6Q1 2O20A 2VYCA 3HCOA 3D8UA 3E3OA 4NYJQ 2OBYA 2OCGA 4QX6A 2Q28A 3RVMA 3BMCA 4Q1BA 1T9GR 4MRAA 1RU3A 3QLEA 1G19A 2O2GA 3O9VA 4J03A 5J2UA 1ECBA 1L5HB 4L78A 3VH2A 1ZX1A 4MYSA 3WL6A 4R0VA 3X0DA 2Y1EA 1QZZA 1KE2A 5B4UA 4KWEA 4OBEA 3VDMA 1MCZA 1V6SA 2P2YA 1NAHA 3K4QA 4G9BA 1VRVA 1DEAA 3FSJX 1XTZA 2ONCA 4FFSA 2QVCA 2CYCA 5LQMA 1BG6A 1NV8A 5AUOB 1L7AA 1NQAO 4OQXA 2MYUA 2C4WA 1OROA 4PYNA 1C9YA 5JNVA 3RFTA 2GRAA 4MS4A 1UJ4A 1EUCB 1ZUHA 4D8WA 2FPWA 3UN1A 3F8TA 2WSIA 3CC8A 3RIGA 3EA0A 3VUFA 4BO9A 2H16A 3OUZA 3QBVA 4LBZA 3WGZA 3EVZA 5BV1A 2XKJE 3L49A 3BS4A 4S0XA 4QM7A 3VX4A 4DZRA 4DXHA 2W6ZA 2AOTB 3LAWA 3CB2A 3ND9A 3OZEA 5T4FA 4Q9JA 4KR7A 3TQOA 2DFNA 4RM2A 3D81A 4Z0HO 2G5TA 1RLJA 1OUMA 2VNHA 1MC1A 3LV8A 3RQSA 1A0OA 1C0PA 4D46A 2YBDA 3DNFA 5JSQA 8MHTA 4NQRA 4FOOA 2PX6A 5CITA 3BJEA 4FQ5A 4NS1A 3FTNA 3TMYA 1MOPA 1GUZA 1IC6A 1WR8A 4F38A 3ZDDA 4BO3A 1JHYA 2HA5A 4A2WA 1E1CB 3ZDZB 3HB7A 3GLIB 1T2AA 3GY0A 4WWHA 2BC9A 2WABA 1E5TA 4I5FA 3PHIA 5C5IA 5BWBA 4ENPA 3KKZA 1DL5A 1R5NA 1XDUA 2P6UA 4JBHA 3CKMA 6GPBA 3CZ4A 5CXUA 2UUBB 3ZQUA 1K92A 1KC3A 1C0KA 2BE7A 4PPQA 4R5MA 2H4ZA 3LTNC 2JLVA 1JTVA 4QPPA 3LX4A 2C77A 3ILXA 1SVLA 3SDZA 4BYMA 2XGSA 1FNBA 3OF5A 4TS1A 4C7KA 2Y0PA 2QM7A 4P86A 1PGOA 2ZR0A 4IXMA 4EUEA 3AFOA 1GDDA 1TCAA 2UZAA 1EWTA 2ZBPA 2IXGA 4HLUC 1AK2A 4MB2A 3UATA 1LSSA 1R37A 1XGKA 1S7CA 2HWXA 3CWQA 1XELA 2H7VA 2QN8A 4QOHA 2RGWA 1HM5A 4XYBA 5FOVA 2R8OA 4BB5A 1MBZA 4LVUA 1V4VA 5TPZD 5BPFA 1TCVA 2F00A 3ZV4A 1GKUB 1HK7A 1G20B 3S0JA 4TN5A 2MSCB 4OHXA 3EIOA 4YRPA 3WLFA 2FJPA 4EMSA 3QNUA 3STVA 3JV7A 4YRSA 1IHOA 3A1SA 2VWGA 3N7TA 4KQKA 4D9KA 2R3SA 1B15A 4I4TB 3LWDA 4UFNA 1R0LA 1RHRA 4QODA 5EHQA 4AZVA 1TJNA 3A8TA 3CVVA 1YNSA 3SZLA 3LC2O 4A2CA 5A03A 4DV6B 1BHSA 3C3EA 2C31A 2X0FA 1W88A 2WUVA 2YV2A 3BORA 3HNRA 3ZWWA 1CIJA 221PA 4JGBA 4AT1A 3N9IA 3RANA 3TSYA 1NVDA 2B37A 5A3SA 1MENA 3M6MD 3SXJA 3UJ9A 2CLMB 1FMJA 3RYHA 4MW0A 2EJTA 5EIOA 4O2BF 5TPWA 3UGKA 4MS1B 5BR1A 2CT8A 3EEYA 2SHKA 4YNBA 1M8PA 3NYIA 4RE6A 2X3FA 4MDHA 1WZCA 3ZWCA 3H8JA 4DYDA 2VQ3A 2DEUA 1XPUA 5IG2A 3PQ2A 3GGJA 1WOYA 3GCXA 3BWMA 2HSGA 3I37X 4Q3EA 1CPYA 3HLTA 1OTXA 2F6RA 2EATA 4UD2A 3UTCA 4MQEB 1H23A 2HWUA 4X90A 4CLEA 4LIPD 1Q92A 1JPUA 1J70A 4DG5A 4URFA 5L3VA 3R7WA 1I2AA 1U3UA 2C2GA 1LTQA 3HA3A 1WO8A 2XOEA 2JCYA 4HGPA 4JHLA 4B09A 1V1RA 4UVIA 5JNLA 4HXEB 1U7OA 1IY1A 3ONFA 1XLWA 2R86A 3GEEA 3PXEA 3R0ZA 3OOSA 5GY7A 4LSGA 2KM1A 3NVKI 2ZJAA 3ORRA 2HI0A 4IIJF 3C97A 1BW9B 3IAM6 3P9ZA 5E9WA 3RTAA 1MZPA 2BMJA 4ZU1X 5TJ9A 1HA3A 1QHXA 2XLBA 4QU9A 3WICA 5ADUS 4M76B 1MH9A 2A35A 3BEOA 3PQ6A 4JXJA 3ICWA 3W9BA 1OVGA 3TX6A 4Q39A 4AKEA 1V7ZA 1BWSA 3D1VA 3PHHA 1FCJA 2W2MA 4R1PA 4ZOLF 3U1BA 4JUCA 1E0JA 2VVTA 1HDEA 3KZKA 4K0RA 2IYRA 2ODBA 3DZHA 2JIBA 3OC6A 1S5PA 1CR6A 4RK6A 1PYOA 1RE0A 2AHOA 2Y68A 2BYTA 4MO9A 4YCCA 5TVGA 4QXMA 1C1YA 4FFNA 4U9UA 2HQ1A 2HBRA 2WQZA 2GJKA 2QR2A 2IZOA 1CQJA 2BBSA 3P96A 3Q2KA 2DBVO 3MHPA 3N70A 1DFIA 1ODKA 3NS7A 4S1VA 3G23A 2GD0A 2OGWA 3I8XA 1GEGA 1ZM9A 1YL5A 2XZPA 1DAMA 3PC8A 4XA8A 4B45A 4QOGA 5KJCA 5DMXA 2A7QA 1MRZA 3A4TA 4ZXFA 3RARA 2NV0A 1VKJA 1T1SA 1VLZA 3DMDA 1Q44A 1L5OA 2XUZA 4LXYA 3V1TC 1X7ZA 4PQFA 3JZAA 2J32A 3O4JA 1ZUNB 1T3TA 1ZPDA 1K08A 5H3CA 3ISVA 5I9IA 2IOYA 1U4OA 1W2HA 1U99A 2Y93A 3BAFA 3GA7A 4M9UA 4PQEA 3DMNA 2G8LA 3WIOA 1NE2A 3FBGA 4IMJB 1I6MA 2HK6A 4WV3A 2PZEA 2IHBA 4J2TA 3E6AA 1UKAA 4BU1A 3GQVA 2O8FB 4EI8A 4HZUA 1V5EA 4XUCA 1QFYA 4C3UA 4QOJA 3QQ5A 4ITUA 1W4RA 5AW6A 4PVCA 1XNGA 3TL3A 3U2QA 3PNOA 2E4VA 1X80A 4J16A 1Z3CA 2Q0HA 3GQBB 1J0BA 4R84A 4P4SB 4WKNA 5EJMA 3NDRA 4EG4A 1C29B 3HB5X 4TLMB 4PTLA 2PE5A 4WUTA 1QCDA 1PEDA 5AI5A 4NXNB 4D42A 5JVDB 3INRA 5CW2A 1Z4PX 5IJAA 2GILA 3VPGA 3WA7A 4UZSA 1Y8CA 5FA8A 1HE2A 5FPKA 1J8QA 4LVOA 4DA6A 3H5IA 5HQ3A 1AHPA 4ZREA 4YUXA 3AINA 1UK8A 1KY2A 3OX1A 2BD0A 1CJVC 4D2IA 5I8WA 4JI0B 4Q4CA 1Y8RA 1FMFA 4WKPA 4JITA 5L4NA 5E6UB 5EOVA 5CK5A 1MJGA 2ST1A 5LDHA 3IBFA 4PCLA 4C5BA 3WAGA 1Z74A 1L7PA 2Q8NA 2UUOA 821PA 3IUBA 3L7JA 4BOYA 3M9XA 3G0HA 2D7CA 3SOZA 1WCWA 2ZYGA 3KEFA 4IHJA 2V59A 2GZMA 3D3KA 3CYFA 2AK2A 5JHGB 3DA8A 1ZGCA 1I7QB 4F93B 4JUDX 3R7BA 5GP1A 2DTXA 1QBKC 3G68A 5CVEA 1I3NA 3ZCSA 2NUTA 3INTA 2ZW9A 2OYCA 3GMSA 2XJ4A 2ZROA 3AG5A 5B1HA 1G6OA 4ZQCB 1T13A 4LHEA 3VC1A 1C4XA 1GZ4A 1QFXA 2J09A 3TLJA 4CKWB 5LOVF 2YW9A 2LCFA 1C41A 1JFLA 3A4MA 4JSRA 2O3UA 4D4JA 2QN2A 3KFVA 1JG2A 3TG2A 3CE6A 3KTAA 2O8EB 2JHPA 3L01A 3HYRA 5JOQA 1EXVA 5ECYA 3C1UA 3M3PA 3OJXA 2YVKA 4B7XA 2M1ZA 3C85A 4MUEA 1DOAA 1NOJA 4AM8A 4BFZA 5H3HA 5BP7A 5I3ZA 5JSUA 1JG1A 1QF6A 1SKQA 1EI9A 2A78A 3KP1A 5EE5B 1T0PA 2AE1A 3Q8KA 1Q91A 3TSCA 3TRJA 2VTBA 5I7RA 3HLYA 1P7PA 2BM9A 3I4CA 4PU0A 2AFVA 2EEPA 2PZ8A 4A6EA 2GSWA 3ER8A 2ADFA 3M89A 4YONB 4LFCB 4COOA 3KJHA 1OX4A 1W49A 4FDUA 4OQEA 1NP6A 5DGXA 4J1TC 4OGWA 3RBZA 4DCVA 1R6VA 3ED1A 3PFCA 2IUUA 1UFKA 3TEFA 1NF9A 4IVPA 1G7TA 1K89A 3NB0A 3QQPA 1O08A 4I9NA 4PGMA 2YXDA 3HI6A 3FKQA 1J39A 3DB1A 3ZHCA 2KB0A 1U9YA 2YDYA 2JAXA 2PKEA 3IP8A 3IUEA 5EZYB 3MJTA 4OF4A 4DCOA 3LOQA 2R65A 1J2TA 2X40A 3VJRA 3AVOA 3QUBA 2ZSKA 3WWDA 4EHLA 2QF7A 2DPYA 4BB6A 1FBNA 5KB3A 3DDNA 5FBWB 3C8HA 4QREA 4E88A 7MHTA 2WT9A 1DG9A 3AB8A 2BGIA 3R5HA 4LTMA 4MW5A 3FF1A 4ZRMA 8ATCA 3OHMA 4NG5A 5KNBA 1T1JA 5DTEA 2GKGA 4Y2XA 3RG2A 1F1JA 4Z0NA 3RUAA 3L8MA 2E1PA 1AHHA 1KVRA 1JKMA 3BF7A 3RJ9A 1Z83A 5K3AA 2HXGA 1USGA 2CV0A 3UW3A 4RVDA 1RVV1 5KDOA 1AXEA 1VLVA 3UV3A 3THRA 3NRCA 5A5EA 2YHIB 4KXUA 4RKFA 5EXEA 1QF7A 4NR0A 4KQHA 4G23A 2NVWA 4KVZA 1TTQB 1S02A 4UQOA 2FOIA 3O4IA 3WLAA 4K8OA 5CU7A 1S8AA 3GUVA 3CN7A 4HUJA 4NJEB