1EM8B

Crystal structure of chi and psi subunit heterodimer from dna pol iii
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
GEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRALTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAALWQQICTYEHDFFPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords DNA POLYMERASE III CHI SUBUNIT
publication title Crystal structure of the chi:psi sub-assembly of the Escherichia coli DNA polymerase clamp-loader complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 110
sequence length 110
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold DNA polymerase III, psi subunit 1em8B00
1EM8B 3SXUB
chains in the Genus database with same CATH superfamily
4UHJA 3QXCA 3EEOA 1GPYA 4UZEA 4KL8S 4XQEA 3TM4A 3R3WA 4WCFA 3JU3A 4ZCRA 3OOYA 3TTTA 2I3DA 2ZBEA 1QQAA 1S7CA 3CEMA 1J07A 4CM7A 1NHWA 1T0JB 3QWHA 2AC4A 3DBHA 4EYQA 3HJCA 3LYLA 2V98A 3PHCA 5ALSA 5EINA 4F8EA 1XVVA 5IAKA 1NNEA 2P2NA 4I1OA 1DJLA 4IIJB 4MSUA 3ZBQA 4CQLB 5IXSA 2XKJE 2BBTA 3ZWOA 1ZJWA 2H7XA 3U0VA 2ODTX 3ST7A 4CG1A 1T9CA 1DTWB 3QVJA 1BXKA 5IJXA 1HYQA 3LKVA 4J7AA 1UDRA 3H5IA 3QE9Y 1I4TD 2Z83A 2ZROA 2QTFA 1Z07A 2WPDA 4M8NE 3T95A 4FQ8A 5ALUA 3VDXA 4DRXB 1OLUB 3STYA 3D5QA 2AG6A 4UUOA 3SLRA 4BNJA 1CWUA 1Z0IA 3PRHA 3ISVA 3LCVB 3GGGA 4JVSB 4I4LA 4R1QA 1SU7A 3P0IA 3SC2B 3C7DB 3AMVA 5F2KA 4AMBA 5JPCA 3KZKA 4Z99A 2VRCA 4J0HA 4S1OA 3EGDB 1Q84A 2H4XA 4EH1A 2NUPA 5EG5A 5EIOA 1I5OA 4DLPA 3ZE1B 3ZI7A 4G4IA 4EMSA 5JROA 1M5RA 1J22A 5IC6A 4ZVNA 3LBIA 4ZMRA 4NCJA 3U62A 1NMEA 3HKBA 2PMBA 3DFIA 3ED1A 4Q1AA 4HAUA 5JBNA 4DSNA 1KRXA 3K0AB 1TYCA 1TK9A 4LYAA 4PLVA 4HLUA 1M2OA 3OPVA 5LLSA 3MM4A 2X58A 3H9JA 4P0TA 3W4JA 3L40A 4AJ1A 4X9XA 4CTJA 1RYDA 3LPMA 2YYAA 2E4UA 4DQLA 4FLFA 1E2HA 1RZ3A 1LZLA 4GKKB 1G7SA 1SD2A 1NZJA 2DLDA 1QO0A 2Y3IA 3DFZA 4BTEA 3CVUA 3LKBA 3I4LA 2HJVA 2XCQA 3L0ZA 5F1KA 2P0EA 2PK3A 3F2VA 1KSGA 2BJVA 3WK8A 5F1PA 1EU1A 1UMCA 1HZJA 2BMEA 1TUGA 2GEFA 3EWAA 5F73A 5LR6A 1JKJA 1Z88A 2GN2A 4O4LB 4I55F 5KNBD 5ALVA 3WYFA 2VDLB 1RC8A 1RU3A 2B94A 4MITA 1YOBA 3OPMA 5CDFA 3UWDA 1DE0A 2XWJI 2AHRA 5JD4A 5LIRA 4YJ2F 3V6MA 4DSOA 2V7GA 3L8MA 5ENVA 2FQXA 5FB3A 2JKYA 3WGIA 4KBYA 2UKDA 1E5TA 2XW6A 1OFHA 3QTBA 3TOVA 1XPUA 2HCFA 4XJVA 4A15A 3QIVA 4WLUA 1MX3A 3WRVA 4KW7A 1N5RA 3IAS1 2CLMB 3OAAA 4IXMA 3RS0A 5TIIA 5F98A 1U7UA 5I7UA 4IAOA 1Y4UA 4WVLA 2IU0A 1SD1A 3P0JA 4KYUA 3WDLA 5KNCA 1KI4A 3NIBA 3RYIA 5TLSA 3WLMA 4BKQA 4TM8A 1V45E 4FZRA 1QV9A 1PD1A 1NR5A 1WHTA 1QGAA 1J6UA 3IPLA 2WIKA 1S2DA 4FYPA 2WU0A 3S44A 1XN1A 2QGZA 3AI2A 4PHHA 3TE7A 4A8PA 4AS1A 3BHMA 2I8AA 4YFVA 1FTWA 3VYTB 4V0OA 4Q18A 1OZGA 2JF0A 3RT7A 4BMOB 5KX5A 1W1UA 2PH7A 5A05A 3R3SA 4B6QA 2JCVA 2J6HA 4FNMA 4QC2A 2A9QA 4A91A 5AMXA 2CVZA 2CDAA 5ICCA 3DOFA 1DJMA 3TRJA 4ZYTA 1IWOA 3ACCA 4Y2PA 4HWPA 1K0UA 1GN9A 1ORIA 2HC9A 3ICVA 2YWXA 1JKJB 5FV7A 4MQ6A 5J59A 3TRKA 4QLOA 2LGJA 3DVAB 4Q7LA 3EPRA 5CIWA 4TSRA 3ENVA 1K86A 5ER9A 2F9FA 3BD7A 1VPLA 3H2GA 6PFKA 2NZ8A 2C9DA 4TUYB 2YNMD 2FKAA 5CGZA 5IUKC 2YZMA 3MT7A 4WIAA 2C2BA 5D6OA 1EE9A 2EKLA 1WZUA 2ORED 2ZZMA 4JEHA 1PL6A 3ZHBA 1L4FA 3BTSA 3CZAA 3L1HA 4EPYA 4FEYA 1SOMA 2QIOA 3B2QA 4W1RA 1L5KA 5C37A 2QA5A 3CYFA 1T6ZA 3GGJA 3ETCA 4YA6A 2XCIA 2DAPA 1SEVA 3NBXX 3QX9A 2H4HA 5F5LA 4GBJA 4LXYA 4RPJA 1K1EA 2BEUA 4ARAA 3RYIB 1CT9A 2C2OA 3THXA 4US1R 1ACLA 4O4IA 1R88A 3KUKA 3F5DA 1U11A 4FOOA 1SKYB 3WGTA 4CEIA 3KOXA 3K70B 4FGWA 2BFNA 4AG3A 1Q7TA 4PLYA 3O4IA 4GBMA 1XLUA 1L7AA 1LBEA 1H05A 1UBMS 3NNDA 1LBHA 4JGGA 2XPCA 1QRUA 2XD4A 3UAWA 2XQGA 3RS3A 2RONA 1KBQA 4BYMA 4JN6B 5KX5B 1V5FA 4Q21A 3MA0A 4L22A 1VKOA 4X61A 1CNFA 1EBBA 1WMEA 4EKGA 5BWLA 3OFNA 3AQIA 4J1TC 3CO5A 3WE7A 3HP1A 5TRTA 2P9JA 3UB4A 4OFZA 1D2NA 1U8EA 1UBFA 1ECGA 4LY6A 1I0ZA 3MJ4A 3MYYA 1KE1A 2OY0A 2AZMA 2OCYC 3PJDA 1JR3A 3TW8B 1HQYE 1WSAA 3WA6A 1DPGA 1U9IA 5EA2A 4L6AA 5CA0A 4D97A 3OIUA 4TS1A 4Y9TA 4PSDA 4DLLA 4U39A 1F8XA 4FHZA 4RO0A 5DI9A 1U63A 1US8B 1VDZA 2Z2KA 1YZKA 4QL3A 1PK8A 4QNMA 5LBUA 2C2GA 1EQAA 3SOZA 3O84A 4PANA 1DXQA 1GCIA 1GGHA 1PR5A 3FMOB 2M6SA 1FJ2A 3I30X 3JRXA 3MMXA 4M1QA 5H1YA 5C18A 4NBUA 1PWYE 5AK6A 4DNXA 2BLNA 4RLFA 1YJ8A 3S3TA 1U5BB 2IYTA 2V8OA 4QDOA 2G7ZA 2Z09A 1B2RA 1M0WA 4COOA 3F1LA 2AOUB 5T5QA 1J1ZA 3BFPA 2H51A 1XP8A 5HKKD 5CNJA 1EDBA 1YK1A 4RX1A 4FEEA 2Z6AA 1XIVA 4OQNA 3SKXA 4K28A 4NDNE 2F4VB 2H4FA 3WIOA 3ZWAA 2LE0A 1N3IA 2PMCA 1C4WA 1KYWA 2P77A 3GFRA 3THXB 3LT2A 2FMUA 1TLTA 3D3QA 4KUEA 4O4IB 4EL0A 1B6TA 1N2CA 1R12A 1BW9B 4MVJF 4Y7CA 4GOJA 5I7RA 1F60A 1XCJA 2RG7A 5A4KA 3T5CA 3O82A 3NALA 4EMBA 2VPQA 3M6UA 1Z4QA 2MR6A 4GUDA 4V0RA 2BFBA 4AMYA 4WH0A 4LSGA 2HU5A 2VSQA 1YQ9A 1GZ4A 2I2CA 3GGDA 5DASA 5G4LA 4EUKA 4W9MC 1EG7A 3A9UA 2XY4A 4X1IB 4BKRA 1DUVG 2V8BA 3HVRA 2JLBA 4OLJA 1HYHA 1EZ1A 1I7PA 2AFHA 2JI8A 1G5HA 1MO5A 4NS4A 3R3ZA 3JYLA 1SCUA 1RLIA 1C7FA 4PS1A 1PVOA 4F1WA 3ONEA 3Q3CA 4DARA 1LK5A 4AJ4A 2H5LA 2O57A 1PBNA 4IDAA 4W8GA 1FMFA 3T3DA 4KR0A 2FOXA 4FBGA 4LWQA 4B3FX 4E88A 2XA9A 2D7CA 2CUNA 2FW9A 1XRQA 2D2VA 4BJ5A 4MEJA 5HGJA 4LNUB 1P0MA 4RVDA 1C81A 3AW9A 2Y67A 1VPDA 3P20A 3F74A 5CYFA 4LGMA 5CLFA 3D5EA 3DBVO 5B30A 2NO4A 3L43A 3PNYA 3AOEA 1DC7A 5KYWA 3K0SA 4JEUA 2P9TA 4DMCA 2PE5A 4RIGA 1MFZA 2FFQA 4WZAB 4HADA 1ID1A 5LU9A 1NVMB 2HMAA 1ODCA 4G37A 4NICA 3TKAA 1T3HA 4DDMA 2QTGA 2NU8A 2W2LA 2J6CA 3HBAA 1A9SA 3KLBA 1D5WA 2CL6X 3A6DA 4YDHB 3CUKA 2NPFA 3SMVA 5LB4A 4L7VA 3LUCA 3R5HA 4NCKA 4GZ6A 3SBXA 1CF9A 3ANXA 3DWGA 3RVPA 3VHXA 3AF5A 3RG8A 2HCRA 1RHMA 2WJYA 1WLYA 1HFEL 2ZR9A 1CYDA 1LPNA 1VE3A 1KR5A 4ENUA 2BUBA 4J8PA 2UZIR 4TVKA 2IPOA 4D98A 5JJBA 1SZJG 1MD9A 2J32A 1T9ZA 1PDWA 1UM9A 1H2ZA 1X39A 2QGFA 2VJNA 3S2IA 4AUMA 3CH7A 4DSUA 4F7WA 3O1LA 1T5TA 1LJUA 2R25B 3CEPB 3GA0A 2YVUA 3EEYA 4C4XA 2AGVA 1JB1A 1O94A 4K05A 2CF6A 4MKHA 1LBIA 2ZEJA 3A2LA 4LZAA 2Q3HA 1VMDA 1FLVA 3RYCA 3P4UA 3INYA 4FQ7A 4D74A 4MWOA 1MT3A 1XQYA 2GN1A 3VPAA 2NT4A 3HFGA 4FZ5A 2Q2NA 5A3SA 3I1IA 4IHAA 2O8EB 3BJZA 2FI1A 2OKCA 5GY7A 1RRFA 3NASA 4UQPA 2HJSA 3ILYA 3IT3A 5BR4A 4RTLA 4XQ0A 3F1KA 3LIPA 3VR5D 1MXHA 3V8NA 2XWQA 1LKZA 1U80A 3OZDA 2WE8A 4FC6A 3U7EB 2FWIA 2QJOA 3NBUA 1CSEE 2VHZA 3SAJA 2WSMA 4TKUB 3ZLUA 4CIBA 2NU8B 4HX5A 1YFZA 3VTZA 1G98A 3I32A 1QG4A 3IBGA 1E3LA 3JQQA 3PNLA 3QV2A 1JFLA 4J75A 5JYEA 1M1NA 4ECEA 1KJNA 4J91A 1TTQB 1XTZA 2JLUA 2X4LA 2XUHA 3WLAA 5LIPA 3AV3A 1DQYA 4C4ZA 3PX2A 3TS1A 4EB3A 3AVUA 2PZBA 1QS0B 1VLQA 3ZDBA 3SSNA 3CRZA 1XROA 4II7A 9ABPA 4BX9A 4IDDA 4MVYA 2C77A 3FKQA 4U7HA 2DSTA 2VQFB 2PYZA 1GYQA 3KFVA 5IVKA 3KVOA 5AUOB 1IHUA 4G97A 4IICA 5BP7A 3G7NA 2X7XA 4WE3A 5CG1A 2W4IA 3JATA 2Q9BA 1Y4ZA 4J2HA 4K9LA 3QPDA 5AKYA 3RKUA 3AYZB 1QFSA 1RJEA 1HE4A 3PYLA 4AY3A 5FFNA 1AN0A 1FQOA 2WAXA 2N1MA 4GRIA 1YJAA 1QRAA 5CNIA 3LG2A 1OV4A 3M1LA 5A9SA 1DAMA 4L8YA 3V1KA 3Q12A 3ZDYB 4CF7A 1VP3A 1UDWA 5L6MB 2JFGA 3EAGA 1QZTA 4F97A 3SBDA 5FPTA 1N8SA 2EKZA 3EA4A 2BTOA 1U4SA 2C0QA 3U4AA 1KY2A 4E22A 5HRCA 3GP8A 1XTPA 1N9ZA 1MJ5A 1HFWA 1MEEA 3D5TA 4O2AB 2G7MC 4HQFA 3RSCA 2RGBA 3PT9A 2AQKA 2BMWA 3JD3A 1RMTA 4IPTA 5FPKA 4RU1A 3DTVA 3QVKA 4QYIB 4RV9A 5G1OA 5IAAA 1ILEA 2WTUA 2Z4RA 2XOKD 1F9EA 3QMVA 4HZUB 4PRZA 2I6TA 4TN1A 4R7TA 4BMZA 1JQKA 3AJEA 4BL5A 2ZAMA 2XLBA 3JQGA 3F47A 4BNDB 2B8TA 1M1NB 3AFMA 4A1OA 3L4BC 3L41A 3O2JA 4U0KA 1PS0A 2VHYA 3HZHA 2ZSKA 3MC1A 4DV2B 4FWTA 2EYQA 4Y67A 5M2QA 1M33A 1N2BA 1T43A 2I0FA 3SF8A 5CX4A 4MTCA 3FMVA 4MIKA 3RFFA 3FNGA 5IM5A 4Y98A 1CY4A 3G49A 3JZMA 4LG1A 3RIXA 3BHJA 3PRKE 4KBFA 3VI3B 2CCGA 1RXWA 2DYKA 2DH6A 3T7SA 1PGOA 5HA5A 4LGCA 4TXHA 3II6X 3TLBA 4ZRMA 4P81A 2PKYX 5CHEA 3NWJA 1U9JA 3JATB 4E13A 2D0OB 3DAGA 1SQGA 1NIPA 3VNSA 3WL3A 4BU0A 4IHQA 3WLKX 4BAUA 4G0YA 4B9AA 4IQ4A 3KDAA 1W2GA 2C54A 2BOVA 1S2GA 1Y8QB 2V9CA 2QE7D 3G85A 4L15A 4CF5A 4I8XA 1CW2B 1SFRA 2BFEB 4OXKA 3DAHA 5A0FA 2C00A 5CT6A 3MGCA 1MRSA 5I7WA 2O7QA 2A9RA 3AW8A 3JQFC 4NC9A 3HUEA 5TJHA 5AJYA 4CFZA 2PYDA 4ISBA 3W3AD 4BNWA 5E1OA 2BD0A 3NM4A 3TH5A 3VOTA 4C0AC 4Z1OA 5JR3A 1AV7A 1J0CA 3DTYA 1A5SB 4HN2A 3SIPA 4NK5A 2HFJA 2WM3A 2XCOA 4P84A 2JARA 4EFNA 4CIVA 2VJMA 2XZOA 3MRXA 3DTVB 2VNHA 1ULUA 2OGSA 2VWGA 5AOCA 3ZZ0A 3B1YA 1VG0B 5JXGA 2IY7A 1CCWA 3D3WA 2XRZA 4U7DA 1D4AA 1JFVA 1ORRA 2ZSBA 3JQGB 1UADA 1W9MA 1LS1A 3P8ZA 4M60A 5ECYA 4LV5B 5BQ3A 3M34A 4K9PA 1O58A 1XZLA 2EQ5A 4YFYA 3CNOA 4OHMA 5JCXA 4R2WA 1KJ8A 1VRVA 2JLZA 3GGCA 2HA4A 1YR2A 2OGWA 2WPNA 1EA5A 3ZWVA 1T15A 3WYBA 4A23A 4KK4A 4KQWA 4QYTA 2XHZA 3P0EA 4TV9A 4J1QA 1H4TA 5EPEA 2R7NA 4HS4A 4QPNA 3DB1A 1HOTA 2FEAA 5AT1A 1YD7A 5AOBA 1WSWA 4J6FA 1AO3A 3OP1A 1N5MA 3OZTA 3TDKA 2A5FA 2FXVA 4TT8A 1FTNA 1X9GA 1GY8A 3K5IA 3LT5A 1QTRA 2BY4A 3JARB 1I3MA 3MMNA 1GPMA 3TDNA 3VPXA 3C5CA 4FXOA 4EECA 3FI0A 4MVCA 2A84A 4B3DA 1MQAA 2J3LA 2ZXUA 4DLTA 3I2IA 4KVZA 1XHEA 2DR2A 1H65A 4PAOA 1QLHA 3OQ1A 3FSJX 1PJ2A 4R54A 1RM4A 4AX8A 4EZIA 4MUIA 5K0GA 3I3SR 3KPVA 3RFVA 3IL2A 3OPXA 2HBZA 5H59A 1QQTA 2FW7A 3PT5A 2JA1A 4UNRA 2AMLA 5I8PA 2CEAA 2ADOA 2H8KA 2OTCA 4D79A 4DMMA 3BQMB 1KFBB 1GFSA 4TTTS 3NT5A 1JTFA 3WJ1A 1EMDA 3AB7A 4JSRA 1TM1E 4EDHA 1T24A 5HWSA 1Z8NA 3H3JA 2P3QA 4UD6A 1JFFB 3KBOA 2YH2A 1VE7A 4GM0A 1NFRA 5BRJA 5DGHA 3RRYA 4JHXA 4LMRA 3VHRA 3VYVA 4CV3A 4IJVA 3HP7A 4I7EA 4LQ4A 2JFBA 4U02A 1GVNB 4XQCA 3VR5H 1SG0A 2P9BA 2Q9UA 3A11A 4QRHA 4UPVA 2FPWA 4BRUA 1EXDA 3IUYA 3ELWA 3FGPA 4WN9A 3H1GA 5FBVB 3NGLA 4ARZB 4HEJA 3WLJA 3TNJA 3B2NA 4FB4A 2QX8A 4J3FA 2RH4A 2WKQA 1QGDA 2AMYA 3GNSA 721PA 4PQFA 3FHJA 4FB5A 2PT5A 2FEPA 2ZPAA 3L4SO 4MVJI 4FR5A 1MG5A 2ZSJA 3IVXA 2XTAA 3U40A 4L51A 1VGVA 3AERA 4K6OA 3EWNA 3DMGA 1KQPA 3NT2A 4A3SA 1YWGO 3U9SA 1RMYA 2WJWA 4W7SA 5D3KA 2COUA 2G07A 2P40A 4JK3A 4V24A 5JMTA 1CQXA 2CVQA 1TL7C 2FRDA 2FDXA 3WO0A 2CNNA 4G81A 2JI4A 3REQB 1YQTA 1AA6A 4ZO4A 2CNWD 5C1DA 2QRGA 1W85A 3LLVA 2JH8A 1LTQA 4JB0A 4ETWA 3GGSA 4M1ZA 3V8VA 2HJHA 5DN6A 3SYRA 3NM5A 3BOSA 4H31A 2OILA 2ODPA 5IDYA 1NR1A 2IXTA 2I9KA 2K4MA 4F3CA 4GVPA 2XMSA 3DMHA 1E92A 2O0HA 3O8BA 3DLHA 2Z9BA 3INNA 4C6HA 2DUMA 821PA 2JFWA 2MINA 3OKFA 3JQ9C 2B1RA 2IH5A 1KSJA 1WIWA 4GC9A 4OBBA 3W7VA 5KTOA 1NKTA 4F9TA 3I9FA 3PTAA 1S2NA 1CJTC 3ZDXB 3LGAA 4KMRA 5KPJA 5CR9A 2JJ1A 1UT8A 5ECDA 4LI0A 4DJEC 5A04A 5HZHA 1RSZA 1QVRA 1DKUA 1VG1A 4JP1A 4PX5A 3TIIA 5J63A 1VPVA 2D1TA 4E5MA 2I3BA 1APBA 2C58A 3UV3A 2NTNA 2F3SA 2BR5A 4CM5A 5KJFA 4M99A 2B30A 5FORA 2HV9A 5JNUA 2XUJA 3ETGA 2WYOA 1UK7A 2XX3A 5HYVA 1PJ8A 4HUQA 4RGYA 1OH8A 2Q2WA 4WRRA 1SK8A 2JGMA 3FW1A 4XIGS 1CR0A 3R09A 2GRJA 2R5FA 2Q49A 4J16A 1E59A 3IV6A 3SZGA 5B37A 3TMKA 4WBNB 1PT9A 4XVCA 1ZGGA 2IIVA 3PQCA 2VYNA 4J1SA 1W85B 1Q3HA 2PXHA 4KYVA 1YZVA 2GK6A 1ZOSA 4DLZA 2IQ5A 3SLKA 4DYDA 4HQ0A 1D1SA 5LSAA 3VPDA 2SCUA 3FB1A 2E21A 2YJZA 4C5BA 1GLNA 1IG0A 3BSYA 3VDMA 3ZI4A 5HF9A 1Q19A 1YL6A 3RHSA 3SS7X 1JNYA 1ULAA 1PD0A 3AU9A 3P2IA 4BWFB 5KMGA 4ZT7A 2H92A 3OESA 3X43A 1L7XA 3ZUGA 3W3AH 5CTJA 2QI9F 5IKPA 2EJVA 2Q4RA 1MO3A 4INZA 3IPRA 1EWVA 1N8KA 2F43B 2FFJA 3AJ9A 2BZ0A 3KKZA 3L46A 3MTAA 4H4EA 1ESMA 5EJ2A 5JNTA 3PX3A 2D3TA 1XMOB 4JA2A 4R0VA 1XNRB 3ENNA 4K0RA 4UOEA 1RRGA 2Q2QA 1AQUA 1XJQA 2I76A 5DVZA 3F4LA 3X3HA 2FETA 4IDEA 3GZNA 4D4LA 3O38A 3S1AA 2DTEA 4RQTA 5T4BA 3AVXA 1LCIA 4N3BA 1GKIA 3I04A 3K35A 3NTLA 4KGDA 1A7JA 4WKOA 1D4ZA 1G19A 5E8RA 3WGKA 4C87A 3VU9A 4CIAA 5I7EA 4AFNA 4ZTBA 2QL5A 3LVBA 4G36A 4C4YA 4MW9A 4HUQB 1N2XA 3LPDA 1RHRA 4Q4LA 2X3YA 2WQZA 5L3QA 1O97D 4OATA 1YB2A 4ZC1A 1G21E 3NIGB 4LSWA 4WOPA 2J8ZA 4F6RA 4YRDA 4B4OA 2NP6A 3HWSA 4DJDC 4ABTA 4ZAGA 8ATCA 1IY0A 1VIAA 2GOYA 3UJ3X 3KE9A 4AO8A 3ITNA 4LV8B 1A9YA 4L4SA 3A7EA 4UMFA 5HRAA 4GWLA 2R4TA 4JB2A 3BMNB 1HNZB 3ROPA 1DG3A 4KR9A 3EPHA 1AV6A 1GAWA 2QN1A 4OL0A 2F7SA 3WFZA 1W6UA 4CKEA 2ZIFA 4ZI3A 4FS3A 1U0NA 5K0NA 3AHJA 4M1TA 4UNNA 3RHTA 4CMAA 5JD5A 4OHUA 3C7AA 3DEJA 4F5EA 1GGNA 4EO9A 3AR5A 3HZRA 2W00A 4E1BA 2FSVA 5BSVA 1ABBA 3VKHA 2RGCA 1GGVA 3GJZA 3PHLA 2HT6A 2PXAA 1CPYA 4UDXX 5DV9A 1DBSA 4BGEA 1Q1NA 3SWWA 4MDEA 1V25A 2GRAA 3OT5A 5KTNA 2O8NA 2Z9DA 1HK7A 3GJTA 2WM9B 1Z35A 3L1JA 2AV6A 2F1KA 4RS4A 5K4AA 5JRDS 1XDUA 3ORFA 1ZJJA 1XMQB 3KZCA 3LXRA 3PJEA 5GZ6A 5JHHB 2H1VA 3HYRA 1GL9B 4LMPA 2JGEA 4UHBA 1TECE 4DDKA 2ZBRA 4J9UE 3VU9B 1XC7A 1W52X 2R8RA 2Y27A 4ZT6A 3VR4D 3WLFA 3OLCX 4RHEA 3FYHA 1OXSC 2WABA 2ATIA 1VHTA 3AIKA 3QVLA 5JWHA 1DRUA 1FL9A 4D9CA 1XN4A 2W58A 1TFRA 3LDAA 4CMEC 1CUJA 4U6SA 4KOEC 5F7JA 4OUDA 4S05A 1YF3A 1VFPA 1KJYA 1KMNA 1Y6QA 2ZB2A 4H17A 4TTJA 2O6HA 3IODA 1YHZA 1WNFA 3VDQA 1IQRA 1QF6A 1YQUA 4JI0B 1HXHA 3I9KA 3PXUA 4H1VA 2P78A 2PUTA 1VDMA 4G41A 4UNIA 5L4SA 4DIOA 5EQJB 1A50B 2I4RA 2Q2OA 2VATA 3RFUA 5DMXA 1G7RA 4GECA 1NW6A 5BXQC 1QP8A 1WCV1 1ZD2P 3IAXA 5BSTA 1ZH4A 2WINI 4NBTA 4B85A 2GTIA 4MGEA 1ATIA 1G8MA 1PWZA 1SU6A 5DX8A 3M81A 5JS6A 1OJLA 4NIMA 4B0OA 1JDJA 1HDRA 1NW8A 2IBMA 3RO7A 4CCWA 4BLVA 3BWXA 2GZRA 2P9YA 2ZWMA 1XAGA 2UZAA 4HLDA 2IXAA 1M6WA 4MRMB 4D99A 3FKJA 1W4CA 3V3KA 3VXKA 2YQ4A 3C1UA 5LA6B 1AGYA 4IMRA 1FNBA 1I3OA 3E9MA 3FHTA 1E79A 1VKNA 4AKHA 1K6MA 3BD8A 3QOWA 2VDUE 3DZBA 3KSDO 2CLDX 4OQLA 2IWHA 2KW5A 4I1VA 4RTQA 1R6UA 1YBAA 5DTEA 2CHEA 2IKQA 2NZUG 1C29B 1P2TA 2RGUA 4FTWA 4KLRA 2IHBA 2C0CA 3OETA 5C3UA 5BQFA 3J80A 5B2FA 5B6PA 1E3QA 3ADCA 1S9DA 3TLGA 1C41A 1MOQA 3KR1A 4QBGB 5LFAA 2YVQA 1HQDA 4DCNA 1WG8A 5CP8A 2I6QA 1X9IA 4CI0B 1NTRA 1T2FA 1R8JA 1YAJA 2G4LA 5DPMA 5HBGA 3R3JA 4BBPA 2H2FA 2I2FA 1TM3E 3AEZA 3DKPA 3GFVA 4X62B 1UBRS 3PL5A 3FNEA 3SP1A 2V1UA 4N47A 3RU7A 4OD0A 4MUXA 1FTSA 1A76A 1R2QA 4G2TA 4R68A 1IXYA 1ZNXA 3V1MA 3ZD6A 2A3RA 2NVBA 2UDPA 3I8OA 5HJ7A 3H86A 2ONZA 1IM8A 4YJ3F 4FMDB 1HT2E 5ER6A 2QX7A 4HTFB 1K88A 1LRLA 3HE3A 2EW8A 1G20E 2YWDA 4OHBA 3ETDA 2Z95A 4Q93A 5ARCA 3OICA 2W6OA 5IUNC 4PLHA 5CB4F 3PV0A 1M7BA 2CVOA 1LZKA 2V03A 3IR7A 7YASA 2X9QA 3BKXA 2H1OA 3CVXA 5FBLB 1C4KA 2ZZKA 5IAJA 3ZOZA 4Q7MB 4BGIA 1X1SA 4DUYB 2FTKE 4ACBA 4L8VA 4IWYA 4QT4A 2YXNA 3IAS6 2M32A 1NXPA 4RF5A 5FD8A 1Z6XA 2XECA 1JMVA 3FAZA 3GN1A 2RJOA 3IELA 2CSXA 1BXZA 4Y18A 2RHHA 3NOVA 4ZXFA 5HKLA 4RA6B 4TTSA 5JDIA 1CUEA 2IYNA 1YDFA 1RQPA 1U3GA 3RAFC 2ZWOA 4RKYA 5AK3A 4GM1A 2IYYA 3F46A 1VKRA 4R2LA 5LZ4A 1EWQA 1RM5A 2FF5A 3C6MA 1L9KA 1V9CA 2JCXA 4R6XA 4DCOA 2VUHB 4E70A 2C97A 1LQ2A 1ZSVA 2QTTA 5A4IS 2Z2IA 4QJ3A 4AU1A 3OEEA 1DCFA 4J03A 3P5BA 3ZXYA 3HA5A 3O3MB 3CEHA 3G8AA 5ERXA 4ND2A 1MB3A 5I7HA 3FUXA 3PTLA 4XUCA 2VYVD 4N0QA 1V1JA 4UDYX 3DHEA 3FYSA 1JWBB 5L51A 2JRCA 2F59A 2QLJA 4I1IA 1G8PA 2G8LA 4A2CA 4RBNA 1E2JA 1XRMA 1KPGA 2ZLBA 5F1OA 1U7TA 3LUGA 4F4UA 1ZINA 2J3IA 3T9EA 3AHGA 4QOGA 1TM4E 4QOHA 3L8EA 3DBOB 3I04M 4U8HA 1VIVA 3N39C 4FE4A 3SICE 4CU5A 2G80A 3KKOA 3Q9SA 2QRHA 5I3ZA 3G9QA 1EFUA 4X20B 4ZZIA 1XMPA 1N7JA 2Q5JA 3NV7A 1CJMA 1JHMA 3P52A 4LVOA 3WGYA 4AF7A 2BF4A 4JC0A 3N0XA 3KIPA 1EVQA 3N87A 4NS1A 1GZVA 1FNSA 1HY3A 4NCIA 4OHFA 1WMFA 2RGGA 2FPKA 3C3YA 3L7DA 5TXGA 4LKRA 3U61B 2W8ZA 3C3KA 3FCEA 2PMWB 3PQEA 1NOJA 2AVNA 2G6TA 4M7OA 3ZWXA 4F3KA 1JHOA 4BNYA 3R9XA 5FPPA 1QZXA 3CHYA 3WKDA 3TEMA 2O7NA 1XNGA 3SS9X 4M9XA 3FVRA 4WZ6A 3VNRA 5KU1A 2O8DA 4M9UA 1U3UA 2ZXFA 3X1YA 4NE7A 3OQHA 2CJXA 5KNCD 1W5AA 3VR4H 1JG2A 4MV6A 4BMVA 1KAEA 4JVMA 4GQBA 4MX8A 1VIDA 2OFOA 3W8RA 5JV5A 3GFPA 4W9NA 4CFSA 1FBTA 1G3RA 2O0MA 4R9RA 4U9IS 3O5AA 3SSAA 4Y2GA 4U2DA 4JB3A 3F71A 1R50A 4DE5A 2JAWA 3JTMA 1X3LA 2CLKB 3ND5A 3TPZA 2R8ZA 4G24A 3RRNA 3VYWA 2Q5LA 5JNRA 3C1OA 4DJAA 4II3A 3ZNQA 3TR5A 4CCYA 4AY5A 5IHPA 4MWTA 4UTXA 2DUNA 4G0UA 2MSCB 2P2YA 4HLCA 4PYQA 4HNVA 2PL9A 1LX6A 3FMIA 5E2BA 2VJKA 1OXMA 2NN3C 2Q0QA 3RSLA 3DZDA 4Q12A 4ZOQI 1VM6A 4OGLA 4WOKA 5CXXA 5FOWA 1SQSA 3Q0EA 4Z53A 1DDIA 1T5IA 4A8JA 3U9TA 2Y05A 2M98A 4INOA 1E2PA 2X2PA 1LH0A 4RE6A 3T4EA 5JQWA 4IDPA 4I50F 3K8QA 2O20A 1V3QE 3NTXA 4EAQA 1LGYA 2PGAA 5DCWA 3IIEA 4W4TA 2ZYHA 5BORA 1ENZA 1JECA 4YN3A 1NN1A 1TMYA 5AVTA 3HFJA 4QUDA 5TB5A 4A6XA 4TSKA 1BRTA 2GMWA 3DDHA 1DX4A 1TYDE 1X15A 3DFFA 4RPGA 1JI3A 4D3YA 1TF2A 2DFDA 4HC4A 1RTKA 3GRKA 3PC7A 1WDMA 1EX6A 4POOA 1P8AA 3A4VA 3OCUA 3ZDQA 3U49A 1WXQA 2OHGA 2NSYA 3EVGA 4ASUD 5JFGA 1GV0A 1PJTA 2BELA 4EG7A 4ZCPA 3WGHA 1RM3A 5AHXA 3W5UA 5KSPA 1H69A 3PEVA 3T3GA 2CE2X 4WCFC 1JS1X 4BCCA 1FX0B 3LQRA 2ZB4A 3QEAZ 3WLHA 3A04A 3BL6A 2JFOA 2JHPA 5FPSA 2D54A 2BFOA 2RBGA 1Y7HA 3AIOA 3DDOA 3LRXA 3NRCA 4X8OA 2ZPTX 3JASB 3TSCA 5BV2P 1X8LA 5JALA 3H42B 1I2MA 1I5EA 3QBVA 4UU0A 3AHHA 3QI2A 5D6NA 2AZ4A 1PFWA 1NUTA 3G59A 4KX3A 4ZU1X 3RR2A 1F1JA 3W6PA 3C7CB 1JBEA 1MQ8B 2XQVA 5DO9A 3ZV5A 4E5PA 2JIDA 3WHIA 2PJRA 3QA3E 2ZWPA 1RCFA 1RCUA 1GR1A 2JFHA 4ACAA 4QQRA 1KI2A 1NMZA 2PMDA 1R0ZA 5DIFA 5CHYA 4KI7A 4TTVA 2IYOA 4GPBA 1SAYA 5ALGA 1A5ZA 4CETA 2PKRA 4BLWA 3FN4A 5FQNA 5JYCA 2ZE7A 1YH3A 3MTGA 3S6JA 5C8DA 1EA7A 3JWJA 2ZR7A 2Q7DA 2ATCA 2FWRA 3CUEF 4Q4DA 5JWOA 1T8SA 5AVSA 3N9IA 2F3QA 1QAQA 3UV7A 4G01B 2FLKA 3B20A 4YRTA 4XXHA 3L4KA 2GA9A 2B5VA 4IUDS 4GOND 2Z8YA 4HXEB 4C4SA 1KL7A 1PEAA 3FX2A 1V7CA 4KH0A 4S3MA 4GYJA 3TTYA 4WFQA 2W5UA 1I5RA 1L5MA 4F60A 4Y2TA 4XUEA 2VDOB 1IJKA 2ZU0C 4X0EA 1C14A 1KI6A 2XNHA 3BVPA 2LKCA 3N7TA 4U5XA 3L0YA 3FVQA 4P53A 2OK7A 4FJ0A 4ZICA 4QG3A 1VJ0A 1PG0A 1YS6A 5EE9A 2SECE 4F2GA 1PV4A 4X54A 5C46F 3G0IA 3THOA 5BR1A 3N0WA 2QX6A 3Q7RA 4ZK2A 4BIIA 1Y3AA 4F84A 2DHEA 4NF2A 2AFVA 2PS3A 3K1TA 9ATCA 4C2UA 2V7TA 5JARA 3IV9A 5EWJB 2V7XA 3TI9A 3U4QA 4M0LA 2ZBVA 2O8FB 1WMAA 4UEQA 3RU2A 3I76A 2DKFA 1KVQA 4W1QA 5H3CA 1ZD8A 2FEKA 3WB9A 5A6VA 4F04A 4NU8X 1VMEA 4IOLA 1GDDA 3YASA 5KJ6A 4A8HA 3UMYA 4L4RA 3ANSA 4BXOA 1QVVA 5FO1A 2PGDA 5IT0A 4J7UA 1KO4A 2O59A 4YJHB 5AFSA 1RBZA 2H52A 3KZOA 2CLEB 3HUUA 5FF9A 3KJIA 1IOZA 3O4RA 4A27A 5A02A 1WE2A 3REOA 4LY9A 2BRUA 3G13A 1DIOB 4JJFA 3NYWA 4X5OA 1Z6AA 4BFLA 1JHUA 2MYNA 4RY0A 2JFXA 1PZFA 3H0EA 3IMEA 1MAVA 4BP9A 5T8KC 1PZHA 4FFWA 1EUCA 1OIWA 1U3CA 1SOAA 2P1DA 5C7OO 1U0GA 3WKAA 2O0KA 4AXXA 3MTDA 1T1JA 4EKIA 1OFUA 1QHXA 2ZSDA 1F5NA 4S1PA 1KI6B 4PTZA 2UYQA 4ND5A 4B75A 5GONB 1DL5A 4GGPA 3W5DA 3ISTA 3M70A 4WTOA 1TMKA 5K3BA 3GEBA 1GM5A 4AIIA 3CUSA 1N6PA 3G9UA 4XX1A 2X5NA 2PS1A 3MRSA 5B1SA 3ICWA 4JMPA 1VCOA 3TKLA 1GAQA 1OC2A 2JFPA 1T5HX 4ZQCB 2AUNA 4BOYA 1H2BA 2DJ5A 1QIFA 1ENPA 4LBWA 4ESHA 1TC2A 1ZO8A 2EX4A 2VHUA 5B5SA 1QCYA 4JVOA 4KLZA 5A7FA 1WTCA 4Q6WA 3AJRA 3EIOA 1KYQA 2V4ZA 4QUKA 5G53C 4YIKA 1NQOA 4EF6A 1G66A 3NXSA 5DHFA 1DC4A 4JLBA 1CKEA 2QD3A 3QNUA 5JRJA 2JJ2D 3KPWA 4KV7A 2CL7X 1J8MF 4Z7NB 1UOEA 3KYCA 4ZQIA 1YI0A 3G0GA 3M82A 2WSSD 2YKGA 3C98A 4ZMSA 4ITUA 3AUAA 4RVOA 2Z2XA 3DDWA 1QP0A 4NFHA 3PU6A 1H0HA 3ILXA 1QFYA 1UBLS 3AHDA 1Q0QA 4FW8A 2IW1A 3NIWA 4HBGA 4HJXA 5DK4A 4QJBA 2O2HA 1IUOA 2Y1EA 4MVJP 4ZVSA 4OY3A 5ADVA 1H8EA 4G5YA 2R1ZA 1ZMRA 1HDGO 4GOOD 2YXDA 3ZI0A 4AL4A 1A1SA 4I5DA 2JBHA 4AWXA 4R01A 1YJCA 3UFXA 4N76A 1VLJA 3Q10A 1KYIA 1CY1A 2KMLA 3D7LA 4Y6LA 3TNDA 4LF9B 3LF1A 1R66A 1NC3A 3B48A 2D5IA 2GPNA 3PYXA 5EMMA 4E08A 5C1BA 1OF1A 2K2WA 5JJIA 4BMXA 3U6BA 3ZR4B 1NW9B 3G17A 2EIHA 2OOSA 2P5YA 4CDNA 5A3JA 2RAVA 1FVXA 5CX1B 1IN7A 4MVJH 3OE1A 4O2RA 2F8MA 2QRQA 3HU5A 1Q17A 1TQDA 3PICA 4E5UA 5JO0A 3OIVA 5I4BA 2QR2A 5AKJA 3CWZA 3RIYA 2CL0X 3DXFA 5J4YA 5L6LB 1EVYA 3OQ6A 1Q6YA 3Q8KA 2HF8A 1R8YA 2ADMA 2VXBA 1JKXA 2W2NA 1BE0A 5NULA 1T9BA 3CNQS 5AKEA 4G0WA 2IOYA 3KYCB 1HFKA 4TQGA 4MRPA 3JYHA 4YMIA 5KPDA 2OMEA 5DRYA 1EE1A 5H7XA 3KQHA 4GI1A 4TMFA 3FM9A 4XM2A 5DM0A 4Q9DA 3DLIA 4WSOA 3SCZA 3OSZA 3GBPA 1P4HA 4A4DA 4E31A 3WWOA 1DQNA 4UTVA 3R6WA 5EKTA 5KCMA 2YWJA 3I37X 4E7PA 2IY8A 1CUYA 1YFKA 1G4UR 2CLHB 2XMDA 2Q3BA 1UKAA 3FI9A 4OA5A 4N6OA 4D3SA 1FJGB 4BGVA 1SXPA 2WSLA 1A96A 1Z37A 4QELA 1RAHA 3WGQA 1YZLA 2EW2A 5DHQA 2YZKA 2P1ZA 4G2NA 2G08A 3GJXC 1FRZA 1NWHA 1UXHA 3ET4A 4KH1A 3PK0A 1ND5A 4H1UA 3RTEA 3LDGA 1URPA 1N6LA 2H1HA 1YIOA 2YZ7A 3UFXB 3PG5A 4AKEA 5COAA 3LKDA 3CA8A 3OZSA 3JQ7A 4ANFA 3W78A 4QSHA 1X86B 3EMBA 4NLLA 1F8YA 2CBZA 2GD6A 4X64B 2A7XA 3ND6A 1UPTA 3CMMA 2OP1A 3RS7A 2JCBA 5DYIA 2WMOB 3UJCA 3OPYB 4LVNA 3NHFA 4L8GA 2IHUA 1ZAYA 2ZM6B 1K6EA 2BEJA 2FEWB 4H16A 1A5TA 1H0SA 5ADWA 3R4VA 1RKVA 3DE2X 4CEJB 1PT5A 3RUCA 2B92A 2W43A 3GXOA 2Z08A 1UCFA 3JWHA 4N4AA 3SFTA 1ZD5A 1BVHA 5EXSA 2PVSA 3EQ8A 4GHWA 2GRUA 3DNMA 3LGSA 3SDSA 4W7HA 1AKNA 3DOCA 5JAHA 2DXIA 3MJTA 3S1SA 2FE1A 1ZM7A 3B60A 4LYYA 4ZOAA 8GPBA 3RK4A 3AL0C 3QQPA 4AJJA 5BXYA 1Q0PA 2LPMA 2Z8YM 1HYGA 4BNTA 1EP3B 2CXPA 4JUAA 3WBKA 5BWMA 1ESEA 3I8SA 2BCGY 4RC9A 2PGJA 3HY6A 3DPIA 1E5XA 4OSEA 3Q8WA 2PH5A 2FZCA 1U3WA 4GOLD 3MCAA 2BFCA 1IFXA 1LQTA 4FGJA 4EO4A 3V1UA 4PCAA 1G9SA 1XJ0A 3D6TB 2F3PA 2VZ8A 3WGJA 4PYJA 2O05A 4NDZA 2EFYA 3K5HA 4HWTA 5HFNA 4C3OB 4NATA 3HB5X 4JBXA 5BSRA 3WL5A 1T1EA 2GBIA 1FUYB 5CAEB 4Q4AA 3H5AA 1J2YA 1SXJA 4QREA 1GNVA 3K9FC 4CTMA 2BE9A 3C4VA 1G291 2CLSA 1PL0A 2YTZA 2R8OA 1SXGA 2WUEA 3RVMA 4NK4A 3HKEA 4PC3A 1U6IA 3ZLTA 3ZJUA 1E2DA 3MJCA 4XCVA 2IYQA 4IIGA 4K6FA 4C7MA 5BN3A 4WLOA 3DTTA 2VDQB 3LFHA 4P3KA 1V3VA 1CDDA 1SCDA 2G04A 1QCZA 2XJ9A 4WNAB 5FWXA 1I3LA 4N7MA 3LQYA 3ADDA 1PBTA 3R24A 1AXRA 2LIPA 1V95A 4GOMD 1PEYA 3HJUA 2NV6A 1MVOA 4JFRA 2UVPB 1EDEA 2OGUA 3R7BA 4EYSA 1SUEA 4NWIA 3SZRA 3D2AA 1R9JA 2DHDA 3GJ3A 5CB6A 4TROA 1PGJA 1ZC4A 3L01A 2P9CA 1BDHA 2IS6A 4CKBA 4UBJA 2RHMA 1J8FA 4N1AA 4IUBS 4XFDA 3TW4A 1C5KA 1UH5A 1WXGA 3DF9A 3I6YA 5C4GB 2JGNA 3HXLA 1C0KA 2FDRA 2YUIA 4RJLA 3T5MA 3KXKA 3FTPA 3O8DA 1V11B 2DQYA 4C5AA 4BQFA 4FM9A 3RU9A 2PX5A 2NVUA 3C97A 2WSYB 4FI3C 5A3RA 3NPAA 1T1GA 4JUFA 3N2IA 4QUHA 1OAOC 2VTBA 3GLQA 3IQXA 4L50A 5KYUB 4C21A 1N8TA 1XMIA 1Y3DE 4WBXC 3CQ9A 2ZRKA 4ZAXA 4RK7A 3T7AA 4GX5A 2HMTA 1H4SA 2HSGA 1N7GA 5C3MA 2HZ7A 3KALA 2IZZA 1WDTA 4D6XA 1R0SA 1N77A 4I9UA 1I6LA 2HWWA 1FPQA 3BWBA 3K1ZA 3HKEB 4PX3A 4RZIA 5E3HA 4EG5A 5E3IA 4IVRA 1I8TA 1G8YA 4TL9A 1DKMA 2FK7A 5BN3B 1YUNA 1FFSA 1LRKA 5FWXB 3FMGA 1RYBA 1STOA 3WKBA 4BY9E 3T4UA 1V8PA 1G63A 3KQUA 3QW2A 4Y2XA 3EA0A 4FR0A 2X8WA 1VXRA 2UZ1A 3NTOA 4LHVA 4LYDA 1LSSA 4YP1A 5LUBA 4E07A 2YIVX 2DR3A 3ZH2A 2Q41A 3K0FA 3FCXA 3GRUA 5TY0A 4V02A 1T10A 2IA5A 1LSJA 4RKQA 4NX2A 3OU2A 3T15A 3HU1A 5JD6A 1G0NA 3V1YA 5DNDA 4L5AA 4CKBB 1TGYA 3M89A 8AT1A 1GPAA 2PRIA 4AD8A 4PNEA 1IY8A 3P2OA 1UJBA 3ZV7A 1Z63A 3VVMA 4M0FA 5K0CA 4I1PA 1E1NA 6ABPA 1ZRNA 4NU6A 2G1AA 4CKXA 1Y5MA 2K5UA 4I6EA 3T0FA 1QIHA 1RBQA 2D1YA 4XKJA 4AJLA 4E46A 4TV8A 2E1PA 2H1SA 5HRUA 3PVCA 3NONA 4QEDA 1ZXXA 4YRCA 2R4UA 3TIVA 5BVGB 2BP7A 1EQUA 3ED5A 1E61A 4BTVA 4EY8A 4DR3B 1PDVA 5G3YA 2IVZA 1CX9B 1E7RA 4MYSA 2MMGA 3ZZNA 3LWBA 5AJWA 5D5PA 4O4JA 4ER0A 4RH1A 3K2IA 1E6WA 4KO1S 1I2DA 3I5AA 3O75A 2Y2UA 3A6GA 3MTEA 5DRTA 5CFQA 4EYEA 5DYGA 1KAOA 1XZIA 2P30A 3D0RA 1NNUA 1VLHA 3ENQA 3FETA 2FUG1 3EDRA 1AK1A 3HNPA 1TYAE 1QNLA 5JCJD 1S2IA 1YU6A 3AVOA 2R1VA 3BWEA 2J9FA 1QB8A 3NHPA 1AKQA 4K26A 4R1TA 3VNQA 1W0KD 2FWPA 3V7NA 5FKJA 1VE6A 2QP3A 3EVNA 2O3UA 1RWXA 2HK9A 1UMBA 1JUDA 1BRMA 2Z5GA 4MZXA 3B1VA 4UBLA 3ULKA 4Z7OB 3D6JA 3PD7A 5EP2A 1JG7A 3SJ7A 5B7QA 2IYVA 5B3LA 2FDCA 2E49A 2MSKA 4LJ5A 4NOMA 1X1BA 3WADA 1GNPA 1SBIA 5DWQA 3HJGA 1CJUC 4R81A 4AQ7A 2VRBA 3ZCSA 5IJ0A 1N0WA 2IXEA 5TQVA 3S0JA 5K01A 1IEXA 5LMZA 3F49S 3ZOKA 1K7XB 3CJTA 4A6DA 3BRWA 4UTRA 1KEZA 1B7GO 3DV9A 4RQAA 4BNLA 1UPAA 1QE3A 1IYZA 3KPUA 1V1RA 2YS6A 5JCOA 2AFIE 2H0AA 1UPBA 1Q12A 5JSZA 1E96A 1PUJA 2A5GA 4L4ZA 2R8PA 1X7WA 3EIQA 3TTSA 2BGNA 4UE3S 3AO0B 5ESDA 4XI9A 2BP7B 4XGQA 1PYDA 1O03A 3K9HA 3STXA 2GBFA 3VH3A 3T1VA 4DW8A 3HCBA 4U7TB 3PFNA 4OVKA 2PRJA 4CV1A 1E8NA 2FEMA 4HAIA 6NULA 3RTDA 3PC6A 2L82A 2BSAA 3OE7D 1YC5A 4NU0A 1M2VA 1GZSA 1EXVA 3EH1A 5IG2A 5JQGB 3DDSA 1DC8A 1CEQA 3CX4A 4HDAA 4K03A 3R7SA 3VSDA 1QDUA 1E1RD 3FCOA 3UCEA 4EY5A 2DQZA 2HU2A 4C7BA 3A1TA 2ZYIA 4INJA 2XVXA 3CLSD 3D4PA 4AG6A 1H6DA 1RHKA 1UC8A 4F46A 2C83A 3OZUA 3INTA 4UNPA 1T9GR 1WULS 3JX9A 3QVMA 5FWDA 5KWSA 2NX2A 3P97A 3GMTA 4RZ2A 3WNQA 2G3YA 4XJSA 2K7FA 4RAOA 1YRQA 2EFEB 3IAAA 4N3CA 4RFSB 5BSHA 1LPPA 2FPOA 5IZCC 1OH7A 3HY3A 2AXEA 1LNZA 2MMCA 2VOJA 1U8ZA 4HFNA 4UARA 3EIEA 4JGIA 1LI4A 4EL5A 3LXXA 4JLMA 1AHNA 1T0IA 2J09A 3QEBZ 4OQPA 4JXXA 4FZVA 5BNZA 1WMSA 4V1CI 1V1RB 4ZCLA 2YV4A 2Q5IA 2FG6C 4AYXA 3V32A 4F06A 1QM5A 1TYZA 2JGLA 1CHDA 3MWJA 5IASA 1AS3A 1XJ5A 2JGKA 4IXTA 1E9CA 4UNQA 1X7WB 4JXJA 4OF4A 4FR2A 1ABEA 2B20A 1HRKA 2AYZA 3EXHC 2VNJA 3DFKA 4XVRA 3QFSA 4DCPA 4F56A 5F9HA 1PJBA 3LC2O 4C7OA 2PXCA 1F9AA 1WP9A 3OZWA 3UT6A 4XA8A 5IKMA 5IVPA 3NHWA 3U44A 1L4EA 2YQZA 2Z56A 5EZYF 2W6NA 3KQNA 1IN1A 3BH7A 2GZMA 3B3JA 3KOZA 4J3JA 2ZPUA 1XMSA 4K9NA 4QYWA 4DDTA 3KWLA 1OIVA 2BH9A 4P98A 5DGXA 1GTRA 2FG5A 6Q21A 3OEWA 5ALTA 3QHQA 1KYZA 3GRVA 3AM1A 2CK3D 3K2QA 3HHEA 3HY4A 8MHTA 2A9FA 2BFDB 2D2XA 3C74A 2BZGA 1EJ0A 3Q72A 2O2IA 5I9LA 2AI1A 3OQOA 2J85A 4L5BA 3FVVA 4C20A 4CUKA 1KNQA 1IDOA 5JCZA 2H08A 5DM4A 1UPUA 3IEPA 4MWZA 5EIWA 4LHEA 5EHIA 1HETA 2BTQA 3K7EA 2V97A 1CY2A 3A6EA 4XD7D 1EP2B 1FFYA 1ZSYA 4QGSA 2GNOA 3E9EA 1E3TA 5DNWA 5EJ5A 4MYTA 4G07A 1R8QA 4PIMA 3U60B 2Y1KA 3F3MA 2QT9A 4N7RA 5CMLA 1GTMA 4YRBA 3OUZA 2JBAA 2BLLA 4E4TA 1U1GA 1P2GA 3N86A 3N74A 5JH7A 3G0HA 4ZCIA 1E3WA 5EJ6A 1T6XA 1Y4AE 4FLMA 3ZCRA 5CA1A 5JS7A 1XZKA 5DLQC 1VCNA 1T4CA 4BBJA 2XNSA 1DJOA 1XA3A 3E7PA 3NFYA 4Z5XA 5CDSA 2CFIA 2GF2A 3GQBB 3ZD9A 2ZSUA 4CODB 3C8HA 1U94A 5IWAB 1Q0ZA 1S8NA 1T2EA 4ZYVA 3B5EA 1GTZA 2J5BA 3V34A 1OI4A 3VU8A 3CKMA 1JW9B 4FWBA 2QJTA 4B3TB 2IPLA 3B3QA 4FYVA 4YRSA 4D26A 1P5HA 1JH8A 5EUBA 4EB6A 2XADA 1XZMA 3QEOA 1BU5A 3PDHA 1Z5NA 2ZREA 4ROSA 1QOPB 1HG1A 2OB2A 4MCJA 5JDCC 2MOKA 3E3NA 3VAZA 2I2AA 3NWEA 4YYZA 4ZAYA 3F8WA 4G0PA 2WB4A 4UBKA 1YS2X 3WYCA 1WNTA 2OV4A 4YRQA 1Y4DE 1WO8A 1KMMA 1BEUB 1RVV1 1TUBB 2R6JA 1DLJA 1IVYA 1ENYA 1X87A 3EZYA 3KTOA 2ERYA 4O1IA 3ZQKA 2WB2A 2Q28A 5AKZA 5CBPA 4BKPA 3ORRA 4JR0A 1KZYC 2XGJA 1AG9A 1BU8A 1WP4A 4KQ1A 3UQZA 3VJRA 2VH2A 1SC3A 3RWOA 2A0UA 3P9NA 3ZE0B 4EELA 3F9IA 1R4MA 1NUAA 3A9WA 5AVRA 2ZUWA 4K6CA 4LXGA 4LK3A 3T7DA 1J7KA 1B8OA 2CVPA 3ZE9A 4A9AA 1GDHA 2JBAB 2FWBA 1KIAA 4MW5A 3RQIA 3F5SA 1VI6A 2K2QB 3GLIE 5CA1B 1XXHB 2GETA 1W8DA 1U6JA 2C2MA 2ZJ4A 3V8BA 3MWFA 1RLJA 2VS1A 1DMSA 3FTNA 4XTRA 5EWMB 2E5FA 3IE1A 3KSZO 5JZOA 3VO8A 2GYYA 3T0GA 3E6AA 4WOCA 4JLWA 3V4PB 3WQQA 1T36B 2BCJQ 4IKOA 3CW9A 2O4UX 4Q82A 5EKUA 3VC2A 1KBZA 3KKEA 4ZALA 2PX2A 3FCAA 2JI6A 3CB4A 5F1YA 1NG1A 4DR2B 1U04A 4XD2A 4E6EA 4M49A 3I2KA 4AZSA 1Z2PX 3T52A 1GAEO 1RKXA 2EFJA 5DT9A 2FPIA 3HPRA 1YR8A 5HE8A 3B1KA 3O91A 4BQIA 4ZVPA 1VHJA 1BMTA 3HCNA 1GILA 2WP8J 1TZJA 4GLFA 2YNMA 4JOCA 5HDBB 5C9ZA 1JHXA 1GCUA 4MV9A 1EXWA 2G9QA 4MA4A 4DSZA 3NOOA 4ZDJA 5B6IA 5K3EA 2ES4A 5LDDC 2CD7A 3FDIA 1M76A 4PNPA 4OI2A 2WJJA 2GWHA 2VHXA 3ZQJA 1ZOPA 3CVJA 1TZMA 1C1DA 1KSHA 4QQFA 4PGMA 2GWRA 1FU4A 1FRVA 1GFWA 2R8YA 4OYYA 2B37A 2J5XA 4W1SA 3HV0A 1EDDA 3DVSX 1TCUA 3NC1C 2WVGA 1NW3A 2VYQA 5REQA 1F4VA 3CLVA 4RELA 4CWAA 2GO1A 2X5XA 3FHOA 4W82A 1XVTA 3JQPA 5T7BA 4GR5A 4MLDA 4EHDA 2JAPA 3EH2A 4G8DA 2EAUA 1G9TA 2W37A 5EZ6B 4FT2A 1M8JA 1SCNE 1PU2A 1HMYA 4FNGA 4FJ2A 3UMRA 5LDHA 4TMKA 2R1UA 3EPKA 1Z5WA 3ZCVA 2P3OA 4X85A 4LNAA 4YI5A 5K1ZA 3V46A 1I7DA 2CXNA 4TWJA 1SVUA 2AXQA 2W2VA 3FUVA 4Y7DA 3S70A 4YPOA 2HSEA 3GLVA 2XBLA 3PBKA 1J33A 3B6KA 4L0DA 4OSPA 3DAYA 1KAQA 2J9RA 4YT5A 3P2KA 4NOKA 5KAPA 1C0EA 1QBGA 1ZGCA 4CUJA 4DADA 1RW4A 2PRYA 3R41A 4W5JA 2C2HA 2E6UX 3WLNA 3TEJA 5K05A 4BP3A 4DB2A 1U28A 4MHSA 5IKEA 3A6HA 4HLNA 4PO9A 5FWYB 1AOXA 2GKOA 4G85A 5CYOA 2B4RO 4JI4B 4QD3A 1HKHA 1KWKA 1QHGA 1F8GA 2JZCA 1O5OA 3GHHA 3GT0A 2GHRA 4WEOA 1C3VA 2P7IA 5A6SB 3WICA 1BWPA 1EAYA 1W19A 3ZG6A 3WGVA 2OPBA 2V9PA 1A95A 3E22B 4LRUA 5L4LA 2DWCA 2GARA 2INGX 1XTBA 2J0UA 4WXHA 4F86A 4MAMA 5IJZA 5L95A 1KSFX 1U1CA 1AKVA 1BDJA 2Q3FA 4OQQA 5ENZA 5REQB 3D54D 2OAQ1 4XARA 2I6SA 4NH4A 4KYTA 3KTFA 4RVHA 1JHDA 4QLBA 1K5PA 1C9EA 2VAVA 3UENA 4Y2VA 1JQBA 1XI2A 5CBKA 3HL0A 3G2NA 3N8HA 2Z6QA 3H9GA 2FFBA 4R5MA 1EFDN 1EHYA 5FLXA 1P0IA 1WCIA 2OCBA 1GNRA 2JKVA 5T67A 3WNDA 4QUAA 4IWNA 4LBVA 2CXRA 3CNHA 4G5GA 3MWDB 4Y1FA 2QI9C 4FE7A 3EARA 2PQMA 4EG0A 3HJTA 2B6NA 2HHLA 4G67A 4IJ5A 4PC6A 2EOAA 3CG4A 1GSHA 4ID9A 4TWBA 4XYBA 5AUNB 1E5LA 5LOVF 4DV6B 3L04A 3K8OE 3KC2A 1K3UB 2IVFA 1WUKS 5TSDA 5IK2D 2QVLA 1CRQA 4L85A 4P2BA 4R8LA 5SZJA 3SZLA 3HM9A 2G09A 3UMJA 1DUSA 2P6MA 1EK2A 3UGQA 5E2IA 1YJBA 2CJYA 4HAXA 4KWHA 4DHEA 2GJ4A 1W48A 1IZ9A 4NEHB 1DDOA 3L7AA 1CQJA 4K46A 1MUUA 3BL8A 2C03A 3JQAD 5BWNA 4JIGA 4G09A 1N6KA 4B4KA 4HXFB 5K09A 1KDRA 1J20A 2PR7A 2Q1UA 3KB8A 4CUZA 4P54A 4K88A 3A4LA 5F23A 1PZGA 4NOJA 4XQ9A 3J7TA 2DH5A 2J7PA 4PV7A 5HK9A 3HZZA 2ZUFA 4DB4A 4XH9B 4MPDA 4WCDA 5CVCA 3S8MA 3KLPX 1D2RA 5AOVA 1IMJA 1R3DA 2EGUA 4IIEA 1WABA 4UPEA 1AKWA 2IIBA 1JTVA 4R9SA 3F3KA 3I1FA 1UC9A 5H02A 2MSEB 3FJOA 2H4WA 4ZCMA 4P0QB 4GP7A 3OE5A 1M8FA 1MIOB 1PR0A 1OFIA 1AK9A 1WHSB 2GEKA 4YJFB 5HMMA 5TGDA 3AKZA 3REGA 3NEYA 1RXUA 5ED0A 5IMSA 2GVNA 3O8NA 2JW5A 5CD1A 4KFCA 4X1OA 5ALQA 5EKXA 1ACJA 4P34A 1FFEA 2HHAA 5LLTA 4LBZA 5KUTA 1YRBA 3D6HA 2C3PA 2RHDA 4DRZA 4XPZA 1W9HA 4DUGD 4Q66C 4OB8A 5ALDA 3LLCA 2P9QA 2N3ZA 3G1TA 4HWKA 4EX7A 1S0UA 3VX4A 4KQJA 2WSBA 3VHLB 1EWTA 2XEXA 3KT6A 3VYRB 4B7UA 2KM1A 1BMQA 1CQJB 3C3WA 3DBRB 1JH9A 1G21B 2AT1A 3SQOA 1KORA 3QLTA 1L7NA 3T06B 1FFDA 3IO3A 4O2LA 3L7IA 4NZ9A 5ALNA 2VQ3A 4RYLA 4DCCA 3W79A 3SHTA 4UBMA 1ZOIA 3MEQA 4UOQA 2BM9A 4WJZA 4EVSA 4KR2A 1ULBA 1RAFA 3B8EA 3F96A 3CLSC 4GRDA 2J5KA 4NYJQ 3QHPA 5LN1A 4KRFA 1YZ3A 3RKSA 1ZONA 1N9GB 2G9VA 1A5AB 2C2WA 2W6ID 3BMCA 3DL4A 1QMPA 3EBOA 4IG4A 4QTZA 5LMNB 2BTEA 3OEHD 3PUXA 1KHHA 3DSRA 2BKVA 3KSRA 4RH0A 4YIHA 2O3RA 4PYLA 5DMHA 4Q3DA 1F2UA 2ABWA 4KFTA 4YHHB 2X5OA 2ILVA 4A0RA 4RNCA 4OQXA 4ZGWA 4F0JA 5L3RA 4EG6A 3ZVLA 3KQKA 1Q6ZA 1QQ7A 1X8XA 4HVTA 3WLSA 4E5YA 2HMWA 1WQ1R 3A4TA 3NKFA 4G89A 1DAFA 3LCCA 4FKBA 1VZ2A 4XLTA 4F5DA 4TYNA 5GJVC 1U7WA 3ETEA 1LVUA 3SX0A 3A3NA 4NPAA 2IYUA 4DQ0A 1M1ZA 1N2JA 3UHPA 1F4LA 4LYGA 3W9BA 2IGTA 1KH2A 4QRIA 4BO9A 4DYVA 2OO5C 1D2HA 3HXKA 1ML3A 1B26A 1M6YA 2X15A 2B98A 2IDKA 1FFHA 2V6IA 3KXIA 2GZSA 4OHWA 1T29A 5AJTA 5FXMA 5L3SA 3MHTA 1U31A 4I8DA 3L1KA 2J33A 1IZ7A 4P0PB 3BICA 3GCDA 1UKEA 3A31A 5CVEA 3MJSA 3OQNA 3IA7A 3INGA 2FN7A 2OPHA 3V8PA 3IUPA 1TNDA 3MF4A 4KC0A 2WIFA 4R3NA 5COQA 5BSMA 3V2HA 3ZE6A 1IU9A 4B32A 1GD1O 3KO8A 1II8B 4ZZ1A 4PXAA 2UXBB 4O3MA 3EOZA 4QXPA 5L4NA 4PCVA 4R9NA 3PNVA 3QELB 3WRYA 3HUDA 3A2NA 3QENA 4RHFA 5L45A 3OSUA 3H5NA 4UHEA 2A30A 2HDWA 3SIWA 2G9UA 4R05A 3RF6A 4JKYA 3QUCA 5BYAA 4AT1A 5FCDA 2W11A 1RM0A 2OYSA 1YHYA 2Y0BA 3FG9A 4QHYA 1NSTA 2CXOA 3RHFA 3TLMA 3HS3A 4ZHQB 4N3NA 2F64A 5HIAA 2D7DA 2FR1A 3CPSA 4GQAA 2BFMA 1FUUA 2CBXA 2YR0A 4LI3X 2VXYA 3FLAA 5FUQA 1M34A 1RE0A 1WA5A 3TD6A 3LQ4A 1V16B 4BQRA 3WYGA 2IYPA 4B6PA 4AP5A 1COWD 2NADA 4X6LA 1JI0A 1UWVA 5CGQB 4D41A 2GT1A 2M2IA 2ZI5A 1CRPA 1HLFA 2NV0A 4GPIB 3VH1A 3DKVA 4JR1A 2EKDA 5DE3A 4EEXA 2HDHA 2IE0A 3B9QA 3QVVA 4RK5A 1EWRA 2VJAA 3IQWA 3QLJA 1HGXA 4R8VA 3MLBA 4Z0PA 1BSVA 3PENA 1DIBA 2QE7A 5KKAA 4ZCTA 1TM7E 3GH3A 3PFHA 4PZAA 4H6XA 2D1SA 3OQVA 3RNLA 3UXEA 1MC8A 4HUTA 3VJLA 1H5NA 3F3YA 4LFBB 2WPDD 3CNLA 1U0SY 2GQ0A 2ZB3A 2OCAA 3I5UA 1KRWA 2CJWA 1QR6A 2P4HX 3RFXA 1I32A 4YP9A 4JC8A 1Y1TA 3HWRA 4NBKA 3V9AA 4EJSC 4A2WA 3JVVA 4MJ3A 4GQIA 4MW4A 3UUEA 1Z62A 1W4AA 2VRCD 3BKWA 1B1CA 1SB8A 3WMFA 1U3DA 3D8SA 3VC7A 1EZZA 2O48X 2Z5FA 3CKKA 4MKIA 3OX1A 2A9PA 2FSFA 3DP7A 3KOMA 5A2GA 1VB3A 2F1HA 3FHLA 3IT0A 5EPUA 1M34B 1YDEA 1ZCAA 2ECKA 2HHJA 3GEGA 3CZMA 4LY0A 2K6GA 4P4NA 3WMEA 2QNBA 1H4VB 3OE4A 1ZESA 5HHTA 5HEKA 4PM4A 5G41A 2BN4A 2B2CA 3H2YA 2VJDA 4RVGA 1RRMA 5LKRA 2CHVA 2QPTA 1J2UA 3M5DA 2ENUA 1VLLA 4CHGA 2HL6A 1M6EX 3LYHA 2W6QA 1TT7A 2WJ3A 3CISA 4ZZ2A 1I33A 2O3SA 3GEEA 3U81A 4F5YA 1N25A 5BQXA 1CUZA 4DLAA 1OI7A 3Q6MA 2BGJA 4TYYA 4LYFA 1CF2O 3AM3A 1CBUA 2JK0A 5M29A 4TRNA 5GGYA 4FKZA 3IB3A 1KP9A 1RIFA 4UKDA 5ICMA 2Q5HA 3KU1A 4HOYA 2QMUA 4PIVA 2FP4A 1E2BA 2B99A 3SSOA 5KYYA 5EXEA 2GJSA 4ZMBA 1AA9A 3WKEA 4D3XA 4R0NA 1LDBA 1GADO 3NC4A 3DZKA 3MS4A 4GWKA 1P91A 1N5LA 4IDCA 3N8KA 2X5JO 3FYCA 1GGEA 1SUSA 1YB1A 4JYCA 4KU4A 1G1MA 1QH9A 5EE1A 3PDCA 2R65A 2WFZA 3ESZA 4N6GA 5CIYA 1U3FA 4CHTA 5BOSB 1K7EB 2XBUA 1V5GA 3UJNA 3F78A 4RZUA 4EZBA 4KN8A 4Y2UA 2XWBF 3PGJA 4L9SA 5E7JA 1KETA 3DG9A 4RQBA 1DKNA 1J23A 2QTBA 2Z8XA 3C43A 3KQTA 3Q7PA 4YCLA 4EJ6A 4JLJA 4OOEA 4L2IB 3HDJA 4RJKA 4REQA 5ERYA 3GJ0A 5I3CA 5IM4F 5EOVA 1CB0A 4C03A 1P5ZB 5KTSA 4R4JA 1JHZA 4OJMX 1FB5A 4K9KA 2IWRA 3L0DA 2VT6A 4BKOA 4EPWA 5KYTA 5A0TA 3F3SA 4FVTA 2QL7A 5D3MB 1M83A 4ZODA 1P9WA 4B2YA 2LP4Y 3L7LA 1MX5A 2FPLA 2IEDA 5ALHA 3OWOA 3F73A 1LDYA 1P73A 1Z5VA 1TZ2A 3HQ4O 2E89A 3H2IA 4YCJA 3W05A 4CJXA 3FPAA 4XE5A 3ER6A 3IE0A 4IG9A 5IAEA 1SIBE 5E9JA 3ELDA 5IUJC 3AWIA 3GH1A 4E33A 5FV4A 4Q03A 3MTJA 4MWEA 1M0EA 2ODQA 4IGKA 2CNWA 3T4PA 3G2JA 2X77A 2QQGA 1JEYB 4KNYA 2VT7A 4HMPA 2BZ1A 2WI8A 1FLNA 1I6MA 2Y6VA 4QQKA 4X6UA 3EODA 5FP0A 2J3MA 5B7GA 1GPKA 1XRLA 2CYCA 3GDWA 4DXHA 2EG5A 3S4YA 2W2TA 3MQ2A 3IP6A 3C6QA 2XTNA 4NESA 1T6NA 1EM6A 2XRMA 4G5OA 4U2CA 1GPBA 3KQMA 3CSUA 1A9TA 1WCYA 3G3EA 2Q5CA 2VWQA 3UK2A 3DD1A 1A0OA 2E5WA 3GCXA 1H5QA 5IVDA 4MK4A 1L4NA 1CUDA 4C4PA 5GVSA 4HN4B 1G5QA 2NZXA 2JJ8A 1T91A 1KMIY 4REQB 3L7NA 1YQDA 3TQCA 5KZMB 3ERCA 3PYMA 4LJYA 2EJCA 2QSJA 4ZAFA 2LZ0A 2J67A 3PUKA 4YV7A 4ILKA 5K7SA 1AT1A 2IPMA 2WWXA 2B5WA 3ICOA 4LCEA 5G0UA 3W6UA 1KYXA 3SZUA 1EX7A 3QF4B 1ICEA 1ZIDA 1JG3A 2W0MA 3BCUA 4CQMA 4TLCA 1IL0A 3H2KA 3GVIA 1L8OA 1DXOA 4BNKA 1JJIA 2WDPA 5DW0A 4KPUA 16PKA 3LDHA 4V0ME 4ZV7A 3BCRA 5DM2A 4P4SA 4IFTA 2JHFA 1YJXA 4N18A 4OFBA 2V3VA 3AUYA 2E82A 2GFHA 2GX6A 2PSDA 3BAZA 1Y1QA 3FUCA 4INPA 4LPKA 5BYBA 3CF6R 3E15A 4X7MA 1UZAA 1T0UA 1XFAA 2C31A 3NTQA 4DWWA 1JJ7A 1L2TA 2JA2A 2XXJA 3D0QA 4RHUA 3H5LA 1TEHA 4GX1A 2GZAA 4RD2A 3WB1A 1XAIA 3WJAA 2XITA 3AF1A 1KDYA 4BWVA 5LXTA 1BFUA 1VQ1A 3LQ2A 2G72A 3IVCA 3Q11A 4Q1FA 2PWPA 1UBOS 1R74A 4BO1A 2VIIA 1RHJA 2WFMA 5C8YB 1I1OA 1W8IA 3OZFA 5HOEA 2AH5A 2QY6A 3HDGA 2GYUA 4JQZA 1LBQA 3C3CA 3GUUA 2DT8A 2ZRCA 3AR7A 3PWKA 4KB5A 3V48A 1PJ4A 4GSYA 3ESYA 1ZH0A 3EZ6A 1SGWA 2PUHA 2ARKA 3KYBA 2I2XB 4YPFA 4Z9XA 2BDEA 4C08A 1TQ4A 4CDGA 3RVBA 4TKVB 3WIDA 1K4YA 4IJ6A 4OGFA 4CI9A 3IHTA 2FUG6 4OBWA 4I9GA 4EEKA 1WMBA 5JZ9A 1YV9A 4JENA 3B5IA 4XVQA 1FA9A 1TVKB 3R7NA 3U7FB 1UZMA 5IP5A 2YCLA 4QFBA 6CHYA 1TA4A 1JJBA 3RREA 2XUQA 3VNBA 4KPUB 1KYVA 4MIYA 2ZS9A 5H4GA 1G64A 1R0BA 5LP6F 1W36D 2QDKA 3LHIA 1U0FA 3CN9A 5AK5A 2CHQA 1OFVA 2J9ZB 2X8JA 4QXAA 2R6FA 4KXFB 1R5JA 1H2EA 3AUFA 5EJAA 1LJLA 4I5FA 1CP3A 4KFRA 2CXQA 2XEDA 4GMFA 4WGFA 3SLGA 1L5YA 4EHLA 5SV2A 2XUDA 4HUJA 2V7VA 1F3LA 3HB9A 1YK0A 2TRSB 3NTVA 2I4NA 4OJQA 4O4HA 1YVRA 3UTDA 4EM6A 2AJ8A 3G0DA 3Q6IA 1NVUQ 1J49A 4MB0A 1A2OA 4HT3B 1XQ9A 1SKBA 3GAFA 1Z74A 2I3GA 2AG8A 4DEXA 3RS5A 3EEFA 5B6JA 4MS4A 5LB2A 1XLWA 3UXMA 1FLAA 1DHTA 1TQ2A 4NR0A 4HI0E 3CBGA 5ETJA 3C3PA 1C4XA 3TWOA 3CRQA 4W7IA 3T7EA 3WG9A 1Z45A 2IUUA 5AXDA 2IV7A 4M0EA 1VRCA 4OU5A 1EJ6A 1MX9A 1TKBA 1XU4A 1EFVB 1OBCA 1TK3A 3G6WA 4G1BA 4GLBA 3QJYA 1OA0A 4LK2A 4X71A 4F6LA 3C3EA 4RJ2A 2HD4A 3QRWA 1I7QB 3DT9A 2JGIA 1I94B 4B48A 1F2TA 1XK7A 1U8CB 2EP5A 4WZBE 3RVRA 3L06A 3P0RA 4QPJC 1A9ZA 2ZRDA 2FJUA 4V0KA 3G8CA 1XZHA 3EVFA 1LTHR 1HSOA 3TZCA 5FBWB 3U3XA 4M6WA 1R1DA 1AKMA 2A3NA 2X8JB 2HBYA 2QN9A 3D4OA 3ZCUA 5AW3A 1SBQA 1UEJA 1MC4A 3HN7A 4Q9AA 3Q41A 3G9TA 1XDSA 1MAUA 1SIUA 2G0TA 1PRYA 3MLEA 1U1EA 2QOEA 5BV0A 1YB4A 2WRZA 2SKCA 5K0JA 5CXSA 1Z39A 1IBRA 2MIIA 3CCFA 3HL4A 1WXXA 4S1WA 5DNYB 4JD5A 1H4QA 4BFUA 4Q7KA 4ZO6A 3U09A 1DDGA 1P77A 1RDFA 1SWWA 4U63A 3CF2A 5A03A 2ETXA 3ORHA 1RP1A 4P7BA 3VSCA 1BVUA 3T9AA 5G1PA 5FAXA 4DG9A 3G5AA 2Y99A 3AEUA 5KVCA 2ZRIA 4CL3A 2QQ5A 1V39A 2D62A 2ZBPA 3P4YA 4YAOA 4Z0NA 5C35A 3Q4GA 2Y4NA 4NZPA 4MP3A 3IQZA 1L4UA 3GWZA 2VUUA 2IBSA 5EHXA 1XRPA 3JVUA 5KYVA 3DH0A 2AZXA 4A0GA 1DEHA 1Y4SA 3FRHA 2Z98A 4NCNA 4DVJA 1E2EA 5PGMA 3TB4A 1DCTA 4Z4IA 4E1VA 1ND6A 1I30A 1NXWA 2YJ3A 3GB9A 2ZIVB 4RLSA 1L6RA 8ABPA 3ZGOA 1XZAA 3FWNA 1QKKA 1VHQA 1VI5A 1W75A 2CCKA 3EGCA 2CXUA 1JU4A 1OXBB 1KR2A 3JQRA 2P5UA 1GTJ1 5DB4A 3KETA 3L0IB 3GFFA 3RC7A 3WWDA 1OI2A 4FYKA 3D1LA 4PTYA 1F2TB 5D5QA 4G65A 1C7JA 4GSLA 1XELA 2QYTA 2YRXA 1XTJA 1KIMA 2CMKA 1AU9A 2YYSA 3K4PA 3Q5GA 3K73O 1GUFA 4M9RA 3RUIA 4AJNA 4ERXA 1DG9A 3BGIA 4IVQA 4K8OA 3D0OA 3CJQA 4BUCA 4IHJB 1PR9A 2ZK7A 1RYMA 4OTZA 2QVGA 2E37A 4K40A 1OYVA 4W5NA 1ZJYA 4RVSA 2YN0A 4FFRA 3QNWA 2GUWA 1RPNA 1MP0A 2HWYA 3GLFA 3RVJA 5J5AA 3GRZA 4FYYA 2XTJA 2GM5A 4NAUA 4HVLA 5JFOA 2Q6TA 4BCDA 4X7PA 4OI4A 1RR6A 3O8OA 4RPIA 1QO7A 4Y2RA 2WBLC 3DZHA 5AI6A 4LJ7A 3S2SA 2FQQA 2IPNA 4TWAA 3HN2A 3HBFA 3V8MA 9MHTA 4XWWA 5E6SA 4MJXA 1ENOA 3LQFA 3VSAA 4PVCA 1VL0A 4R1UA 1SCQA 2HQSA 1G8AA 1U0HC 2OMKA 1KU6A 1QFJA 2LV8A 4P33A 5A06A 2NSJA 2EW1A 1D0IA 3I3OA 4X45A 4ALMA 4X1KA 1V6CA 3L18A 4HWGA 1M2HA 4ZI7F 1M1YA 2B2XA 4FBMA 3LPLA 3U7IA 1VYUA 1YQWA 2NO7A 5JJLA 1CUHA 2O1SA 4J6EA 4XB6B 1RWWA 3WMGA 5HW0A 3V6LA 5JXIA 3QVOA 4TZTA 3QG5A 1R5NA 1RXIA 5LU8A 2TECE 3K9QO 4WERA 1RBYA 1RPJA 3QLVA 4I55A 1MR3F 4K9MA 4XVHA 4CMIA 4HLUC 3IXQA 4KQEA 5E9QA 5I7VA 2VI5A 2X23A 1GFZA 1DOAA 2BW0A 2CMDA 2QN2A 3BWYA 3HJRA 3I9V1 3LF2A 2FZ4A 3NETA 1X3SA 4OXIA 3PQ5A 1KH3A 1NKSA 5FNVF 2PUWA 5TGTA 3ZVNA 1QPZA 4NCAA 5LBTA 4Z3DA 1IEVA 4BVAA 4HXYA 1KOGA 1TLFA 1BZYA 1H22A 1DZ3A 4HGOA 2DX7A 1IBMB 2ZATA 4O2BF 3GLFB 3QXSA 2Y8EA 4OBEA 1P74A 3MFYA 4Z4CA 2VEOA 2Q21A 1NT4A 1X7GA 4S0XA 3IQFA 1JAIA 3LL7A 2NLOA 1L7QA 1X7ZA 4NE2A 4D6YA 3AUUA 3PHIA 1N6NA 5K8JB 2GLUA 1W5EA 1JIUA 1Q2XA 1AMUA 3CTPA 3MCUA 4JT8A 1OTHA 1UBNA 4H4CA 2QUAA 3LUPA 4QEZA 4BJHB 1IULA 1UQRA 3HBJA 4UM7A 4R7ZA 1OWLA 1M1YB 5JAPA 5E6UB 1AGXA 3UJ9A 1GU1A 4JLVA 4Z6KA 3D59A 3R7FA 5MGNA 2HYIC 4Y2YA 1H9AA 3EJ6A 1O9HA 4DCVA 4K9SA 4UUNA 2Q62A 2NGRA 1XQ6A 3AL3A 2PGXA 3DV0A 4UAGA 3COWA 5AJVB 1MEJA 5TEVA 1E7SA 3ZGVA 1MW8X 3SG0A 1P81A 5I4CA 4I55B 1Y8ZA 3KEMA 1MPXA 3R3XA 1RQLA 4JZKA 1SZCA 3CR8A 1HI9A 1XZQA 3OD5A 5FOXA 3TSZA 3I6MA 2A92A 4YJ2B 2PPLA 4QOEA 1PJRA 1E2LA 3BD9A 3UK1A 3VAYA 3I5YA 4HDQB 1KVSA 3DWEX 5L7TA 1G5IA 2OZPA 4OHYA 3HB4X 4Q3KA 1N2EA 2ZIWB 4C30A 4EB8A 1UMDA 3ZHYA 1VMAA 5CDFE 4YLYA 3FNHA 5KOJA 1QONA 5BNTA 2YWHA 3JAKA 1W29A 4W8HA 2V96A 3E7DA 4ESVA 4L5JA 1X7ZB 2Z43A 3ICCA 3OWHA 1TU3A 2CNDA 5JJCA 5JMOA 1CZNA 2BFPA 4EVQA 1MRZA 4PG4A 1IWBB 3E8SA 1Q7EA 2WD7A 3BE4A 2LD4A 3UWPA 4CLXA 1GXSA 1ODFA 2YFYA 5TT1A 3AF6A 1OC4A 3GR6A 4BO5A 5CM9C 5A1JA 2DB3A 4GXRA 1EGMB 4PPYA 2VJOA 1DS6A 1LVGA 5I7OA 2Q46A 4MGHA 2GDZA 3AU8A 2C04A 1N8NA 2RGRA 4QZVA 3B1JA 3DV0B 1TQ8A 1EX9A 3AEQA 1GPDG 3H1BA 1E3EA 2WLSA 3KUUA 1KQOA 5HXAA 4H7IA 121PA 4GMXA 1MNQA 2SNIE 4FOSA 4OUKX 1UIRA 3THSA 3W2GA 1TRKA 4BO3A 4ZEMA 5AVQA 1MX1A 1PEKE 3N59A 4IEFB 1NI3A 3RVDA 4Z7QB 3JSXA 3P0FA 1QHFA 1QZ3A 2GBCA 5TMBA 1B00A 1XVAA 2C8KA 1TO2E 2HDOA 2X7JA 5IC5A 1HR0B 3K9WA 4HY3A 1EEXB 1GGKA 3UWMA 3BMQA 2JZOA 5KU7A 1TM5E 2PRZA 2GXSA 2WF8A 3C85A 4KJXA 3RAPR 2WJPA 4EQ6A 4ZGGA 3PXAA 2C61A 1J2EA 1F51E 2MYPA 1U9IC 1HE1C 1SBYA 1VE9A 1QGUB 2QR3A 3B2EA 3H87A 3LSYA 4IW3B 3UT5B 4M22A 1OBOA 2PGLA 4AJIA 4CL8A 5GTDA 5KOJB 2WT8A 4BN0A 3JAKB 5TPWB 4L76A 2PFGA 2VTVA 3R6LA 4YHBA 4ASUA 2IUTA 1XLTA 3WNVA 5HIKA 3GOQA 4M1OA 2HJRA 4MVJA 2JLQA 3ABOB 2WKWA 3IPXA 1JG1A 2WD7B 4LHZA 4DABA 4ES6A 1N2OA 2RMKA 1NF3A 1GXSB 2F48A 2R3SA 3QEMB 3QXHA 2REBA 1E98A 3IBTA 3LWNA 1M6VA 5ABPA 3R6DA 2XMRA 5CU7A 1QIKA 4DV7B 4C4TA 2QEQA 2ONKA 1QF9A 3QHAA 1NF9A 1W0CA 3A1WA 2C8VA 2D0IA 3FOBA 4UW9A 3R3HA 4WQMA 4KREA 3HVUA 4RY2A 2C4WA 1ZA2A 2OFFA 4G5FA 1SHTX 1VECA 1DU4A 5DGCA 4TSFA 2OV8A 5ARBA 3BWDD 4WA8A 2PUVA 4ZTUB 2P3SA 2VHJA 5IAGA 1PL8A 3GFTA 4KMSA 2R8XA 5B58T 3CVYA 4DMGA 3ZNOA 2A88A 1F17A 4RTSA 1E2GA 1GZ6A 3IS3A 1MA0A 3Q87B 4BKMA 4CLEA 1EFCA 2P0YA 2H3EA 5BNIA 1W88A 2GA8A 3AP1A 4ZOBA 1JR3E 4XIYA 3SEZA 1U8YA 3BMQB 3QVGB 2PLAA 2ZUDA 3HCWA 1YXMA 3HLKA 1W36C 1TMOA 4BVHA 1QK4A 1EX1A 3WDSA 4YMVA 1FXWA 4TKLA 2RHLA 5KWEA 2CMFA 1Z9BA 3CLRD 3VGJA 3PA8A 4UZFA 3K6SB 3AX6A 3WFIA 3ZKAA 5IWCA 1A9QA 4D3ZA 4N5LA 2VYND 5CUQA 1KEVA 2QLBA 1J24A 2I80A 3EG9A 4G5QA 5DOVA 5DCLA 3RPEA 3RHZA 3OLXA 4ZVVA 1KE2A 2B8WA 5FA6A 3PIRA 5J2UB 1O2DA 1OX5A 1O5IA 1M6VB 3ZV6A 3U48A 4IIVA 2FHPA 4Q3AA 1Z4JA 3BEOA 3AOEC 3UGKA 1UKVY 1X94A 2YMLA 4K6HA 1BEEA 2XHEA 4G1UC 4QFCA 4TV8F 2QYSA 3BWMA 3GW8A 1N2CE 2AE2A 4ITVA 5DBOA 1SHKA 1JLRA 5JAMA 4UJ3A 2HO4A 1RWMA 5KINB 4E03A 1AXGA 2XOXA 4LJRA 1GFIA 2CSUA 2QZJA 2WA2A 3KTDA 3NUZA 5DI3A 3U5ZB 2RARA 1CEYA 3TOCA 2ZSEA 2A1UA 1QORA 4B8ZA 5KTMA 1RQRA 2QVBA 3BORA 2HLNA 3L7YA 1SXHA 4UM9D 3VC3A 2OG1A 4LDJA 1L1EA 4AQDA 3JYPA 1W88B 4JB8A 3BIOA 3U39A 1VPEA 4MQ5A 4HDNB 4RDXA 2H0QA 2OGTA 1Z7BA 2CHFA 4M1KA 2XZDA 4QGFA 5BUCA 2EBWA 5I9SA 5IKOA 3SI7A 3KHUA 4CR6A 1ONPA 4PRLA 1EZ4A 3OIGA 3A1VA 2YXEA 4I1YA 2P9GA 2RK4A 3T3EA 4YWJA 3LSTA 3SC4A 1O94C 3FCUB 2PVPA 3HEAA 4Z4HA 5FAKA 2CF5A 1ISMA 4BMPB 3IP3A 2FMTA 3I62A 3L7MA 3C3JA 1Z2OX 5EL0A 3RSZA 1J8DA 3E03A 3BMOB 4DOMA 1UUFA 3IAEA 1A27A 1W0JD 1WOMA 3PPVA 5KHOC 3ZCXA 2I4LA 1B2LA 4OB7A 1V35A 2YV2A 4TUYF 4OX9Y 3TRIA 4RF3A 1SXQA 5E9AA 4D44A 5TX7A 4MS1A 4BLOA 4DILA 1PIWA 2WM8A 2GZ2A 2Q6IA 3Q85A 1FQKA 4HYQA 3LHFA 4HYYA 5LQSA 3DHNA 2IEAA 2OCKA 1O08A 4WY5A 3TLXA 2XT6A 4J1NA 2O54A 4TKZA 1UJCA 2C4KA 2LWIA 2NZYA 3BZWA 4E2XA 4NYIR 1TW3A 4GKBA 5HKBA 2DLNA 3JWIA 3EXAA 3N8GA 5CEFA 4CT0A 4HB4A 2XMCA 1OU4A 3DE5X 1JSXA 1QHEA 4NQZA 4LGYA 2R6DA 3EVBA 4L9RA 3WIBA 3D1JA 2WTNA 3BZUA 4GRAA 5JEDA 2A1UB 4B46A 1Z5PA 2B3DA 4F7DA 1CR1A 1K2WA 4EKEA 3H11A 5HCIA 4EJ2A 1L5LA 1M2KA 1ZN8A 5KBYA 2NSHA 1EBFA 2BCEA 2I6UA 1O6ZA 3N1UA 4RHTA 3RGGA 2WSSA 4P7GA 4BMCA 1FCJA 2MYTA 1HQKA 2VPWA 1H42A 3HH8A 3AKDA