4QO8A

Lactate dehydrogenase a in complex with substituted 3-hydroxy-2-mercaptocyclohex-2-enone compound 104
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
331
structure length
331
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Identification of substituted 3-hydroxy-2-mercaptocyclohex-2-enones as potent inhibitors of human lactate dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
total genus 119
structure length 331
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4qo8A01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4qo8A02
2O4UX 1PJCA 3DZGA 4PLVA 4RL6A 3QWBA 4XYEA 4FN4A 1LXCA 1QYCA 1BW9B 1NFQA 1O89A 3IAHA 3WGTA 1MX3A 5TNXA 2HMTA 3N74A 1VL0A 2HJRA 1R37A 1UR5A 2ILTA 3E03A 5I7FA 4YQYA 4BNHA 4AJ1A 2O2YA 1LRKA 3JQBC 3OQ6A 4FD3A 4AJEA 1JW9B 4CLEA 2YJZA 3EVNA 4A10A 1ENZA 2QYSA 4EBFA 3G1TA 2C07A 3QVSA 4KDEA 3O38A 3L0DA 2G1UA 1IPEA 3R3SA 4NJMB 3ZV4A 5C37A 1B8PA 1SEVA 1Q7CA 1NQTA 1V3TA 1DJQA 2QRLA 2X7HA 1UP6A 4DWVA 1MG5A 4RF5A 1I10A 1ZSNA 1ZUD1 4EUFA 5AXBA 2EV9A 2G82A 1U8FO 3KB6A 4AJ2A 1I2CA 3GRPA 4NFSA 4PFJA 3UHAA 1PL7A 3HJAA 4HUJA 1MXFA 1PGNA 1N92A 4Q3DA 1QSGA 1DEHA 3K92A 1ENOA 2PZJA 4G2NA 1WMAA 1LEHA 5KJFA 4J4TA 1ONOA 5AOVA 3U49A 2IXAA 5TGDA 4PRLA 1P3DA 2JJYA 4TZTA 2O3QA 4GAEA 4RF3A 1RM5A 4CM8B 1U5AA 4RCVA 3DDNA 2OP0A 3GFGA 4RDHA 2YV3A 4K6FA 5DBIA 3DOOA 2A94A 3CE6A 2HCTA 1L1FA 1Z74A 1HDXA 1ADGA 1JQBA 2ZTLA 5FI3A 4IZHA 3RFVA 1KEUA 3PWSA 4WLOA 3W6UA 2A4KA 1MXHA 3AI1A 3VVBA 1ZK0A 2X9NA 3DQPA 4U8GA 2VZ8A 1GQQA 2PD3A 1NAIA 1H5QA 1B15A 1Q7GA 3JYQA 4J4BA 4YYZA 1HEUA 4OIMA 1M2WA 1NVGA 1TLTA 1VSUA 4HFMA 1GPJA 4DPKA 2PZMA 5IZCA 4F6LA 2P4HX 3BTUA 3PRJA 4ALLA 1Y81A 1R4MA 3ROPA 5JY1A 4EW6A 4YJFB 2EKLA 4I8XA 4LVCA 1I8TA 4J7UA 3VPSA 4L4XA 2IYOA 3G49A 2JCYA 1GDHA 4B7UA 1Y9EA 5CDGA 2BD0A 3OECA 4WCFC 1LBEA 3I9MA 3EZYA 4YACA 2EJWA 2P2SA 4PIVA 1DRVA 2GERA 2EP5A 2HRBA 4M86A 4UEJA 5G0VA 1NQAO 3KSDO 3PFWO 3VZQA 3UFXA 4IUYA 5JW6A 1QKIA 3RASA 4R1TA 1U28A 4CQLA 2A35A 3ENKA 3H3FA 3ZV3A 1JVSA 2HO5A 5BQFA 2YDXA 4FFMA 1E3LA 3SX2A 1I01A 4MVJM 1QG6A 5FYDA 1D7OA 4OJNA 2W2KB 2V6MA 5JNLA 2X8LA 3OJEA 3LLVA 2BF7A 3LC2O 4P4LA 4E12A 1LRJA 2B83A 3INTA 5A05A 1HSZA 3LT0A 1YKFA 3NJ8A 2P9GA 1J6UA 3NTQA 3QWAA 5F1KA 2CZCA 1Z82A 3IUPA 2WDZA 1SAYA 3KO8A 1QP8A 4Q3BA 2OHXA 1M6HA 4CQMA 1FJHA 4IINA 4E21A 3QJ5A 3DAGA 5BSGA 4TRRA 3GN1A 4IM7A 5IDXA 1C1XB 1YOVB 5JCJA 4BO6A 1LDYA 1P44A 1QXSA 1N1EA 3UH1A 3A28A 4JP3A 1HKUA 2ZYDA 3K30A 4DA9A 3WYCA 1FXSA 1P1KA 3TZCA 4CPDA 3WTBA 1K0UA 3GPDG 2NTVA 3JCZA 2ZKLA 1CQJA 3CZMA 4YEDA 1TEHA 2PWZA 2IE0A 3GDGA 2BI7A 4PZDA 2BFMA 5H83A 1KC1A 3PQDA 3V8BA 1PJ2A 5TX7A 1OOEA 3N7UA 2OFPA 1KETA 5I7VA 1PS8A 3S2EA 4J90A 3HN2A 3RSHA 4XYLA 4JJIA 2NVUB 2BFOA 3AW9A 3NGLA 4M49A 3TOXA 3B1KA 3DAPA 4FR5A 3S2FA 3DC2A 1NVTA 4KTTE 3STHA 3ENNA 4GWGA 3KYCA 1IHXA 4I9UA 1B7GO 1FMCA 2Y1FA 3H9JA 3JQ9A 4GL4A 4XYBA 4TKMA 3SC4A 1EK6A 1NASA 2V65A 2QW8A 2VHVA 3EW7A 2C7VA 1CJCA 2PTGA 1IZ9A 2NADA 4LW8A 4BV8A 5A4DA 1QYXA 3OIDA 3C8MA 4J6FA 3C7AA 2WD7A 2JHFA 3RBZA 1OAAA 3FR8A 3GUCA 4TRNA 3KBOA 4B8WA 3FD8A 4FQ8A 5EERA 4LMPA 2X5JO 4B79A 1PGJA 5I9LA 2O3SA 1EZ4A 1XR3A 4CUJA 1U8XX 4J91A 5JDCC 4XIJA 1H6AA 4B4VA 3F46A 4LRSB 4RVDA 1PZGA 3WBFA 1P0CA 8ADHA 2BFPA 2OBNA 2PV7A 2D59A 3E5MA 1B8UA 5F21A 2Q2WA 4YBZA 3LZ6A 1HE2A 4R3NA 3GDOA 2JL1A 2BI8A 1R0KA 4GI2A 4Q3CA 2I66A 1NTOA 1RKXA 2HRZA 4G65A 4Z0HO 4EUEA 1VJ0A 4ZJUA 5T5QA 1PL8A 1IZ0A 4YT5A 4UUNA 4C7JA 3W4KA 1H6DA 2C54A 1U7TA 3TZHA 1JA9A 4YXFA 2DFDA 4BIIA 2VUSA 3JD1A 4ZGWA 4DREA 4PZCA 3ZW9A 3ZWXA 2QYTA 4IQGA 1DIAA 4UAGA 2I67A 1LC3A 2XPCA 4WE3A 3RROA 1Z7BA 1ISJA 4XQGA 2C0CA 4IS3A 3W4IA 2NU6A 4GBJA 1AXEA 4NZ9A 4WCFB 1T1SA 2H1SA 4E13A 4FS3A 1DSSG 2D4AA 4ALMA 2J3JA 1I24A 1Z75A 5GZ6A 1E77A 3D1LA 2G0TA 1TT5B 1D1SA 3SBOA 4NBRA 3WR5A 3DZIA 3I6QA 5IZCC 3DMTC 3K73O 2FZEA 2QRKA 3ZW8A 3KSZO 4EGFA 3INGA 1P0FA 3PGJA 1DC3A 3UF0A 1XKQA 1HYGA 3AFMA 3BAZA 2O3RA 1U3VA 1AXGA 4J9UE 3RCBA 3D7LA 4IIVA 4BO9A 1NVMB 4DXHA 2GZ1A 2VHXA 4W9NA 2YZ7A 4BNYA 4LISA 4MVJH 4CM8A 2JCVA 1XEAA 4RVFA 2DBZA 3AU8A 5EN4A 2IRWA 3QVXA 1ZSVA 3LT2A 1Y8RB 4N7RA 1WDMA 2YUTA 2DTXA 3S8MA 1DFGA 1K3TA 3IMFA 1CQIA 4WOJA 2VUUA 1OMOA 1PR3A 1E7SA 2JFHA 4PLTA 4K9DA 2CVZA 2WEKA 2Q1SA 4JGBA 3GT0A 2PKQP 1R66A 2PKQO 2X4GA 3CUKA 3BMQB 2X6TA 5TSDA 1PJSA 5L4LA 3WQRA 4R69A 4D0SA 2YHIA 4CL3A 2JD0A 1GYRA 2P5UA 3IKTA 3LC7O 3BA1A 4DC0A 1RM3A 2NV6A 3ANLA 3F4BA 3I4CA 1A72A 4DTIA 4YJFA 4IDGA 4AJPA 1ISIA 1J0XO 2WE8A 4B3JA 1E1KA 3F5SA 1C0PA 3HADA 2R00A 5F5LA 1HZJA 1T26A 3JQFA 1WZIA 4OM8A 3CZRA 1DC5A 3ZNNA 1BWSA 1CEQA 4E3ZA 3D4NA 2O50A 4MVJI 4RQTA 3H9QA 1NXQA 2B69A 1V35A 1Y1PA 4WGGA 1C0KA 4PG6A 3RQSA 3JD3A 1ZVMA 1UXGA 2GR9A 4X54A 4YJGA 2J3HA 4F3YA 3N58A 4Z9XA 3I9KA 2AQHA 3BTSA 2VRCA 2EWMA 5ILGA 2ZIZA 3SC6A 5DDIP 3R3JA 1UZNA 1LSUA 2A9FA 3AY3A 4S3MA 5JXWA 4TZKA 3K6JA 1X0VA 1ZK4A 1YQGA 1SOVA 4J9VA 3ZV6A 4OMUA 3GVPA 2IZ1A 4PZEA 1O5IA 1R4NA 4BKPA 2W2KA 1RM4A 1GFSA 2Q50A 4G5HA 4L4RA 3ABIA 3OFSA 1ZO8A 3NTRA 3CTMA 2EKQA 3WGZA 5LDHA 4CLHA 1E7QA 4GQAA 1AHIA 3JQAD 4R1SA 4CV3A 3ZNQA 4ROSA 3OMLA 3ZWOA 3LVFO 3PJEA 2FPPA 5ER9A 2A92A 1FDUA 4QO7A 3PQFA 3SJUA 3ST7A 4RVGA 3H9EO 4LCJA 2POQX 4U5QA 1VJTA 2W8ZA 3FNFA 3H5RA 4CQMD 1KEVA 3ZWBA 3D3WA 3H9UA 4RQUA 4AJNA 1PL6A 3H2ZA 5C3MA 1GTMA 4EZBA 3HB4X 1YJ8A 1U1IA 4TQGA 4A5OA 2QHXA 3TOZA 3VPGA 4KP7A 4O6VA 3BIOA 4IQ0A 3SLKA 1LDEA 1ZXLA 4B3IA 1KVSA 5HA5A 2HK8A 2Y0DA 5JAZA 3WFJA 1IL0A 4D46A 5IN4A 4JIGA 3WWYA 3E9QA 2O4CA 1F8FA 3ONFA 4IMRA 2ZTUA 2O2SA 3JQBA 3L6EA 4WECA 4D79A 4FOSA 3TZQA 4W82A 2NU7A 1VLLA 1YL7A 5JPIA 2NVUA 5EMHA 3VKVA 1I30A 2H5LA 2I99A 5F5NA 5L53A 1DXYA 1EBFA 4NFYA 5L4SA 2WWRA 1SB8A 3RIHA 3I3OA 3JQ8A 1PJBA 3C1TA 3GFBA 3WMXA 5JC8A 1R4MB 2DVMA 4RPGA 3NT5A 2HJSA 4DRYA 4D41A 4FW8A 1HYHA 1YB1A 4PLPA 3ZWPA 5T8KC 1Y9AA 4E33A 2GZ2A 1LQTA 3PYXA 4FC6A 4YJHB 5L7YA 3KTDA 3TSCA 3UCEA 1F06A 4XA8A 3KETA 2HU2A 4XJTA 4MVJP 3PJFA 4QFCA 3WTCA 4IXWA 3K2EA 1BRMA 4BV9A 1H9AA 1YQDA 4GGPA 4TKLA 1YONA 2DBQA 2EXXA 2QZZA 2VHWA 1RPNA 1XDWA 3S2IA 4D43A 3DL2A 4J43A 1M76A 1CRWG 4YAKA 1PQUA 1ULUA 4Z9FA 4FFPA 2BGLA 4J7XA 1X7DA 4NU6A 1ZMTA 1AE1A 2GCGA 4XCVA 4BO0A 4JBIA 2I3AA 1JVBA 3AY7A 2NVBA 3W8DA 1I3KA 5H82A 2ZCVA 2VT3A 1ZZEA 4CMAA 3GGOA 3Q1LA 3WGOA 3WICA 3UGKA 4E0BA 4NBVA 4IS2A 4EJ0A 3JYOA 4NPCA 4RZIA 5KVQA 3EHEA 3M2TA 1ONPA 2Y05A 3NAQA 4M1QA 4RF2A 4A03A 5I9NA 2F00A 3WFIA 4BHTA 1BHSA 5COBA 1R16A 1SBYA 4BUCA 4GGOA 3OP4A 2Q1WA 4OXKA 1Z45A 4QXMA 2OUIA 3JYLA 4ZRMA 4J4HA 4WCFA 1I2BA 1UH5A 2PZLA 3RUFA 2UV8A 3KZVA 3TRIA 4WK6A 4YQZA 3NEPX 1G6KA 4NBUA 1GADO 5KOIA 1KEWA 4HV4A 2XXBA 2WMDA 3BHIA 2PA3A 1X0XA 1EQUA 2EW2A 3HNPA 3ASUA 2DBVO 1PJ4A 2ZTMA 3SVTA 3RUIA 4Y98A 5TJHA 2FSSA 3ZU4A 3ULKA 3JQFC 2DUUA 4R5HA 2YQ4A 1DHTA 1W73A 2B4QA 3L4SO 4AJJA 4JX8A 1WAMA 3GZNA 2P9CA 5B4UA 4E2WA 3KLPX 4MP3A 1HDOA 3CXRA 4MVJF 4MIEA 4WLUA 3VPXA 4DIBA 3AJRA 2W90A 3MTGA 3KXDA 5ICMA 3KYCB 5LCXA 3IOYA 3PTZA 4Z0TA 1Y8RA 1SNYA 3S1LA 2ZK7A 7MDHA 3GHYA 4AL4A 1ENYA 1UXIA 1J5PA 3U4IA 2DU8A 3OQ1A 4QSMA 3GMSA 4LSWA 1G0NA 3WOHA 3FSRA 4EEXA 1BDMA 3WG9A 1GYPA 3TDKA 1HDRA 4GH5A 1LLDA 2OO5A 1PWZA 2E49A 4HNGA 5F3RA 4IDDA 4IXTA 1WXDA 3BMQA 3V5NA 3U62A 2C59A 5CG2A 1AUPA 1F17A 3TF5A 5EIOA 3GNSA 2WSBA 4GX2A 3PLNA 4UEKA 1RYDA 4XEHA 4UVGA 3VKUA 3DBVO 1X15A 4HBGA 2D0IA 3OM9A 4DPLA 2X9VA 1HTBA 2YW9A 1K6JA 5JAIA 4R54A 3JYNA 4TVOA 1YJQA 2X1HA 5U1PA 1E5QA 4C4OA 2H63A 3OH8A 1WDKA 3Q9NA 4YA6A 3DAFA 1DFHA 3U5TA 3WIEA 3FPLA 3ITKA 4LSMA 2VT2A 3LLSA 1ISFA 3OEYA 1OZAA 4M89A 4J16A 4MP8A 1O9BA 3GVHA 4Y6PA 2DTDA 3LSYA 4DYDA 3DBLA 5A3VA 1I0ZA 2EERA 1YE3A 2OOSA 2W2LA 3NT2A 5DBFA 4PLFA 3DZKA 3HFGA 5FF9A 5C5IA 4BNJA 1LQUA 1HE4A 2GD1O 2DQ4A 4O5OA 3OJ0A 1HE3A 1ZCJA 2CDCA 2VRCD 4ID9A 3TQHA 5FFFA 4IBOA 3NGXA 4Z0PA 1XWFA 3MWDB 3EAGA 4IPTA 4EDFA 1PS9A 5BR7A 5KKCA 4YJDA 4WPGA 5IG2A 4XR9A 1A4IA 1YGYA 3WSVA 3DFUA 5ILOA 2UUOA 3ZU5A 5JO0A 3MJEA 2GYYA 1N2SA 3HQ4O 3AOGA 4UVEA 3U0BA 4IQ8A 5JDCA 4AJLA 1A71A 1E1MA 2IYPA 3JSAA 4NFHA 4FCCA 3F4LA 2W4QA 2X86A 2ZYGA 1EE9A 1WPQA 4JQCA 3GG9A 5H81A 1ML3A 4KUEA 5G4KB 4AICA 1ZK3A 1NHGA 1ZIDA 4IJWA 5A03A 5L95A 5ADHA 4OOEA 3FRJA 1K5HA 2Z5LA 3QHAA 2FR0A 3H4VA 3D0OA 1YWGO 4DLAA 2P9EA 4J1TA 5BSFA 3P19A 4MINA 1VL6A 3C1AA 1T4BA 4RPLA 1GR0A 1NYTA 2P68A 3I1JA 1GCUA 3O03A 4ND1A 3RI3A 1QMGA 4IDAA 2OXIA 1I5RA 4N18A 5EESA 3D64A 3BMCA 2PH3A 4H7PA 5COAA 5GZ3A 3H5NA 4PVDA 5ENDA 3PEFA 1M75A 4Z9YA 1S7CA 2J6IA 4XYMA 4BO8A 1Q0LA 5THQA 2GN8A 5DOVA 2UDPA 2PGDA 2GN6A 4MP6A 1ZNQO 1U4OA 2AEJA 1NFRA 2YHIB 4P22A 3WGQA 4PLWA 3L6DA 1BG6A 3NJ4A 4MVJA 2JD2A 1DIRA 5DT9A 1DJNA 5FI5A 4LGVA 1E3JA 4GVLA 3DMTA 2FN7A 3O26A 1UJMA 3KRTA 3PYMA 1XSEA 4G81A 4GLLA 4NBWA 3UXYA 4MJLA 2E6UX 5KCZA 3WWZA 1N8KA 1EBUA 3VTFA 2I3GA 3VH4A 3E48A 3NV9A 1UXHA 4Q9NA 2CD9A 3VTZA 4PLGA 2GZ3A 2CDBA 4YJHA 3DXFA 3I9LA 1MA0A 3W4JA 2WD8A 2I65A 3Q3CA 4CMIA 4CODB 2VYND 1ORRA 4FBGA 4YJGB 5U4QA 3T7EA 3ZWYA 4JCOA 2XOXA 4PLCA 3PDJA 5U9CA 2C5EA 3LU1A 5THKA 4ZICA 3ICPA 5EL0A 1KVQA 4DMMA 1UP4A 2GN9A 3C7CB 3EVTA 4RF4A 3TJRA 4E30A 3Q9UA 3R1IA 1R15A 4YRAA 3HZZA 4JP2A 5I7EA 4CM1A 1GEGA 5G4LA 1R4NB 2ZQYA 3NKLA 3NDIA 4R1NA 1E7YA 3O8QB 4KWHA 4XGKA 1AHHA 5IJZA 2YY7A 2GN4A 1U3WA 5ENVA 5FWNA 4XR4A 4HP8A 1D3AA 3FPCA 3JQDA 3A9WA 1LSJA 1DLJA 4QUKA 1ZJYA 1O0SA 5CAEA 1U5CA 3F1KA 5T6BA 2Z1NA 2P5YA 4J3FA 4LMRA 5CPBA 1HWYA 4BOYA 2FMUA 4OAQA 4R51A 5BNTA 3P7MA 2XF8A 1BDBA 2PGJA 4DMLA 4D0RA 5ES3A 2I5PO 5DP2A 3INRA 2D5AA 4PLZA 3A06A 3TPCA 3NRCA 3PI7A 1CWUA 4UUPA 3D3WB 2PLAA 3C1OA 3T7CA 1XA0A 1P33A 3ETDA 1X13A 4S1VA 2BELA 2BMAA 3BXXA 1V3VA 5A9SA 4BL5A 3QV1A 4JK3A 1DFIA 1VC2A 1ONNA 2EKPA 5DNAA 4WKGA 2AEMA 2CFCA 1LDNA 4IMPA 5G2OA 4AJKA 4TRMA 3GK3A 4U6SA 1Q0HA 3C7DB 2VZ9A 4GX5A 1PEDA 4I9NA 1SCUA 3MJ4A 4EJMA 1DOHA 3ADOA 4HFJA 2FRDA 3CEAA 5KIAA 2GSDA 2O48X 3NDJA 5A5EA 1SEPA 5C7IO 2AG5A 1LU9A 3LK7A 2H6EA 3ORFA 5L4NA 4O63O 1C1DA 5KWEA 1K89A 4A27A 2PKRA 4F45A 1LSOA 2UYYA 1T25A 2I76A 3ETGA 1Z6ZA 3CSDA 3F3SA 3JQ8B 4N5NA 2Q99A 3WBBA 1HETA 5I7SA 3TL3A 4E5MA 3UAGA 2VN8A 1BXGB 4CMJA 3ANNA 3Q2IA 3GRKA 3PHLA 1DB3A 2ZB3A 1P1JA 1DIGA 1EUDA 3V1UA 1BTOA 3S55A 1C0IA 2FZWA 4CR6A 1BXZA 1NFFA 1E1LA 3IUSA 3E18A 1BVUA 4J1QA 1WNTA 4NK4A 2AE1A 1U2DA 2PY6A 1GY8A 4JNKA 4RVUA 4XQ9A 3RVDA 1PS0A 3GVXA 3HDYA 3WQQA 5HWSA 5DULA 3WGHA 3E6AA 3WNVA 1H2BA 1PJ3A 3WMWA 3AUTA 2J8ZA 2VWHA 3VH1A 2OORA 5JC1A 1NWHA 4E6PA 2NU9A 3K96A 4NR0A 3COSA 1TI7A 2DFVA 5ITWA 2HDHA 4E5YA 2NVWA 3TWOA 1E0DA 3GC6A 4E31A 1OC2A 3PZBA 4PG8A 3NT4A 3UKOA 4XDZA 1LDBA 2FP4A 4R01A 1I2ZA 1LUAA 4P4GA 1U3UA 1YVEI 4YAIA 2ZB4A 1VKNA 3RUEA 3ZWVA 1QR6A 1X1EA 4BKQA 2V6FA 3RAJA 1E3SA 3Q11A 3DTTA 4BO5A 2W2LD 3PXXA 4XD2A 1YL5A 1SC6A 1VPDA 5DCWA 5T8KA 3EUWA 1M66A 4RVSA 1LLUA 4II2A 5AQ1A 1NQ5A 3ZV5A 1EFLA 1W4ZA 4AJHA 2X58A 3QWIA 4N5LA 1UAGA 1D8AA 3GGGA 2VRBA 3HE3A 4GSKA 3KSUA 4OSPA 4DLLA 1BVRA 3FBGA 1LTHR 5L3ZA 4CL8A 2C7GA 4RPHA 5GY7A 4CMHA 4CUZA 2QRJA 3KEOA 2DTEA 2B4RO 1E5LA 3PQEA 3H7AA 3JQCA 1JAXA 1I33A 4DQUA 4BNFA 5G4KA 3CIFA 3L9XA 2JFGA 2LDXA 3EK2A 1BGVA 2Y66A 1MP0A 4KUHA 5JYEA 3GZNB 3AOEA 1N7HA 5BSHA 1VL8A 1XLTA 3MEQA 3OA2A 4MIOA 4MPDA 4CMEC 2EF1A 3ZNOA 3GA0A 1LNQA 3WJ7A 3WLFA 1JWAB 2X0JA 2AW5A 1QRRA 1KS9A 3KM0A 5K0ZA 5DF1A 4NQZA 3BYZA 3V2HA 3EYWA 1PZFA 2AA3A 3MOIA 4L9RA 3W8EA 4C7KA 3QA9A 1X1TA 2DKNA 1Q2XA 1HYEA 3UICA 5T57A 1GUFA 1DC6A 1T2DA 1KERA 3LYLA 3M1AA 2O3UA 4AVYA 3GNTA 4OSOA 3DBRB 2OGUA 4CM3A 2B0JA 1VRWA 3DB2A 3PHIA 9LDTA 1HF3A 2J5QA 4E2XA 3Q6IA 4XB1A 1LSSA 1XGKA 4J0EA 4YAJA 5CEJA 2DLDA 2PD4A 1W0CA 1XQ1A 1GZ3A 2VOEA 2B37A 3PHHA 4MVJD 1ZEMA 4RGBA 4BMVA 3ZWNA 1L7EA 2VHYA 3FHLA 5ITVA 4DC1A 2RHRA 4CM7A 2XXJA 1UUFA 1B2LA 1VM6A 4E32A 3GUYA 4IDCA 3VH3A 3FNEA 1KC3A 3B1FA 5CPFA 5TJ9A 3RFTA 1MC4A 3HDJA 4NDNE 4URFA 2UVDA 4CM4A 3DBLB 5JCXA 2CSUA 3KV3O 4IDEA 4P4NA 1DHRA 2P91A 3CMCO 4K26A 2CF6A 3RKUA 5B4TA 4IDBA 5HS6A 3ONDA 3M1LA 2QQ5A 3DMYA 4RLSA 4RPKA 3VDRA 5G0SA 3DHYA 5MGBA 1JLLA 3O8QA 5CDUA 2Y1EA 3R0IA 4M54A 3KUXA 1R12A 3EMKA 4FFLA 4CJXA 2AMFA 1K6XA 3X2EA 3I9NA 2E4AA 2PK3A 3LC1O 1JN0A 3I83A 5HTOA 4CMBA 1UP7A 1HE5A 2BGMA 4QQRA 3V1TC 4DLBA 4I1IA 2IODA 3B20A 3RJ5A 4W4TA 3WJAA 2EGHA 1LJ8A 3KLMX 4NJOA 1SO8A 3AUUA 1MFZA 3AU9A 2Z1MA 3AUAA 3IP3A 2HQ1A 5F1OA 1TA4A 2PGLA 4XQEA 2FPIA 4L74A 3F9IA 4YAGA 1QLHA 3F5QA 1YH3A 1MGOA 1Z73A 5JCJD 2HAEA 4FJ1A 1TT7A 3DZHA 3ZDFA 4YR9A 2EP7A 4CM9A 3LF2A 1F12A 4XB2A 4ALIA 1ID1A 2TMGA 1U3TA 3VZSA 4DBZA 2VWPA 3BMCB 3L6OO 1I3LA 1LDMA 4O1MA 3FNHA 4L8VA 5G0UA 1GYQA 3WGYA 3ZGYA 4BNLA 1B3BA 1VKOA 4BKOA 3D5TA 3RJ9A 4J1SA 4ILKA 1PSDA 4XX0A 1LI4A 3VPFA 7ADHA 1N9GB 1C0LA 4WLEA 1ISMA 5HBRA 1J49A 5COQA 4F6CA 1P9LA 3JD2A 5F1PA 3I5MA 2RIRA 1PZEA 2YYYA 4BB6A 3DOJA 3W8FA 4BNTA 2JHGA 1DO8A 3VZRA 5DP1A 3WB9A 4OQYA 3ZHBA 4D42A 4ZHSA 1PJLA 3OQBA 1P45A 1WW8A 3FI9A 3B1JA 3ROMA 1BXGA 1WZEA 2PZKA 2X9GA 3VPHA 4A7PA 3PGXA 1K2WA 3A14A 1E6EA 1MG0A 4HY3A 4CV0A 5EQDA 1E7WA 3V2UA 2JAPA 1JDJA 4O59O 3OA0A 2Q1UA 4OHUA 5CHEA 3ZHZA 4CLXA 3WLEA 4K28A 5EINA 4MVJG 4B4UA 1FDWA 3PPIA 3ZCXA 1DLIA 3RUAA 4CMIB 1T2CA 5BNIA 4IDFA 4BO3A 1D4FA 3BMOB 4R4JA 3F47A 3GVIA 1EDZA 1EFKA 3RC2A 1WWKA 4GMGA 3AWDA 1BSVA 4LRTB 4PCVA 4CLDA 5CDSA 4J2HA 3HDHA 3KVOA 3JQEA 3ZHYA 2Y1CA 3BHJA 5KVCA 4CLOA 3DHEA 4II3A 3FBTA 1GCOA 2Q2QA 4RZHA 4CLRB 2G5CA 1E6UA 3AOEC 2HMWA 6LDHA 1ZKMA 2VYVA 4HWKA 4WJZA 2D5CA 1NPYA 2Y1OA 2C2XA 1EVIA 4BO4A 3MOGA 1UXKA 4TSKA 4UREA 5IXSA 1NM5A 3F1LA 1FDTA 1F14A 2AQKA 2I6TA 3H2SA 4TRJA 3U9LA 3E82A 3AY6A 2D2IA 4MKZA 2C5AA 3PK0A 5G0WA 2G76A 2YFHA 5K6AC 2ET6A 2WM3A 1ZW1A 5IXYA 4OXYA 4Y9DA 1DAOA 1RJWA 5JO9A 2CVQA 2ZB7A 3HSKA 2OBYA 1DPGA 1Y6JA 2DC1A 1CIVA 1OC4A 2GO1A 1O95A 5L51A 1LDGA 1ADCA 1AGNA 2BHLA 2Y1DA 4PG5A 4WLFA 2ZJ0A 4XJSA 3T4EA 3VH2A 4AJ4A 4WLNA 1Q0QA 1RWBA 2EIHA 3PWZA 1UZLA 5A9SB 4ZRNA 1YBMA 3RUDA 4R9RA 4H15A 3S2GA 4IY1A 3IJPA 5CFZA 4JLWA 4U0KA 2WE7A 2V7PA 3K9QO 4IJVA 1F8GA 5TC4A 3RKRA 1PGQA 3JYPA 3OJOA 3GVCA 1PR9A 1E3WA 1T24A 1PZHA 1IULA 3ICCA 1C3VA 2Q49A 4QTZA 1UDBA 2C82A 4GX0A 4I9HA 2ZTVA 4IZIA 4QEDA 4YAEA 4BO7A 3E1KA 3KEQA 5JY6A 1JU9A 1PTJA 1EEHA 1K6IA 2WJPA 4BNMA 1C1DB 2R2GA 4BO1A 2O7SA 4P8RA 1H9BA 3IKVA 2HSDA 1UAYA 3LT1A 2VNAA 2NTJA 3T4XA 3TL2A 3OJFA 1E7RA 1OFGA 1YBAA 4RLHA 1SOWA 4FGSA 1YXMA 3FCOA 4QECA 5ICSA 4E4YA 2QG4A 4M55A 4TROA 2VTEA 2DT5A 3DONA 4NHEA 1MUUA 3CINA 4PLYA 4CV2A 2PH5A 4Z3DA 4J2OA 2D8AA 4R3WA 4DIFA 3AFNA 5AXCA 5A1TA 3AM5A 5I8WA 3DBRA 3ZWMA 5L9AA 2OZPA 3GNQA 4BNUA 2EG9A 4DQXA 2FR8A 4OXNA 2O7QA 4AJIA 1QLJA 3VOSA 5HRUA 3MJVA 3QIVA 1ISGA 3PYLA 4A26A 3MJSA 4OOFA 2XAAA 4B7CA 4BGIA 4OO3A 4MKXA 3UOGA 3I9OA 4EJ6A 3OEWA 4NMHA 3DR3A 4FJ0A 3U4CA 1VI2A 5JYDA 1HXHA 2IXBA 2Y0CA 2E82A 1KEPA 1P1FA 2SCUA 1T2FA 3HG7A 3UN1A 5KVVA 1RM0A 5AXAA 3R6DA 1OBFO 1S6YA 2AQ8A 2B35A 3FWZA 4JBGA 4QX6A 4OL9A 3B6ZA 3QVWA 4D3DA 3M6IA 1JKJA 5IN5A 2VHZA 4L73A 4UVDA 4EYEA 4IGEA 3PVZA 4LK3A 1XU7A 4AFNA 3KYDB 4Z6KA 4GPD1 4CV1A 4JROA 4TWRA 1PQPA 4OQZA 1WP4A 5G0TA 3P5SA 3HN7A 3UUWA 4BNIA 3MJCA 5L7WA 1UDCA 1XIVA 4R68A 5JDIC 4XKJA 1IPFA 1G1AA 1PX0A 1C14A 2C20A 3P2OA 4E5PA 2X0RA 3GMDA 3JQGB 4HFRA 4B4WA 2V6BA 3OIFA 4A2CA 4BVAA 1GU7A 4U6QA 4MVJE 1JTVA 4ZQEA 3DZFA 1CYDA 4FFRA 3DOCA 1MLDA 4PLHA 4A0SA 1B16A 1WMBA 4D44A 5A04A 3WSWA 3QP9A 3AI2A 4M8SA 3GGPA 3L9WA 3I4FA 3GY0A 3ONEA 3MJTA 4WLVA 4ZQFA 4NG5A 5DBGA 3PIDA 5JBIA 1T4DA 4PG7A 3FTNA 1QYVA 2CMDA 1NNUA 3GDFA 3KHUA 4FIZA 1LRLA 2CY0A 1E3EA 5BT9A 3RUCA 5JMWA 1ISHA 1IYZA 4PRKA 4RPJA 3E9MA 3Q0EA 1R6DA 4OKNA 1HZZA 4CM9D 2OL4A 4YT8A 4DUPA 3QW2A 4K6CA 1YS4A 1O94A 2PD6A 4Y67A 3GR6A 3OETA 1E6WA 1U7HA 1N9GA 5CEEA 1LX6A 3U09A 3GAZA 4CMCA 1ZK1A 4XGIA 3QSGA 5B12A 5LC1A 4QO8A 2Y68A 4ND4A 1QORA 1IY8A 3GQVA 4R16A 1H0KA 4ZQBA 3V2GA 3W6ZA 1SZJG 4CR8A 1DDOA 1UXJA 3WGIA 3GG2A 4CM6A 5AXDA 1GQYA 1E1NA 3IC5A 4EUHA 4PG4A 1DRUA 1KYQA 3FR7A 4K1LA 3H65A 4XGNA 2YFQA 3GOHA 4BQPA 3GEGA 4I5EA 3VC7A 2C29D 4NU5A 4CUKA 4D7AA 2EW8A 3HHPA 3PJDA 5TIIA 3JV7A 1XG5A 5JMPA 4DPMA 1ZFNA 1T2EA 2HMSA 4ALNA 1ADBA 2BH9A 4P38A 4FFOA 4CMEA 3BMOA 4Q39A 4CM4B 4KMSA 3RWBA 2Q45A 1ARZA 1EK5A 2DBRA 2J5RA 2WYUA 3DBHA 3RC7A 1XYGA 1H6BA 5A5FA 1RYEA 1BXKA 2TMDA 3AUSA 3ZHXA 1DBVO 1T2AA 1T1RA 1H2HA 1OI7A 3JTMA 3ZNPA 3PHJA 4BGVA 4CLRA 2H9IA 3NDRA 2V6GA 3IQDB 1PJQA 1PWXA 5TT0A 1Q7BA 3BZUA 4D45A 4DBVO 5A02A 2BGKA 4RO0A 2Z95A 5JFOA 3FTPA 5J23A 3MZ0A 2VYVD 4WEQA 4PGFA 2PNFA 3ASVA 3K31A 4GMFA 4I5GA 3SLGA 5BNFA 2JCXA 1O8CA 4DQVA 4JJGA 1H94A 3DWFA 1N1GA 5TLSA 2C2YA 5LDGA 4KDFA 5GZ1A 1KY4A 3AM3A 2HMVA 3U4HA 4BB5A 1HDCA 3JQAA 4R5MA 3JD0A 3I23A 1JKFA 1JAYA 2FY8A 4OKIA 1NAHA 1ZH8A 1Y7TA 2VQ3A 4F46A 1TXGA 4XWYA 1XU9A 1NX6A 4BKRA 3H9GA 4PVCA 2NSDA 2IZ0A 4WNCA 3TNLA 3L07A 1Y5MA 2Q1TA 2NLOA 3D4OA 1U9JA 2CVOA 3QRWA 2B5VA 2PFGA 3PZRA 5C7OO 4XRGA 5L7TA 1A7AA 2NTNA 4UUMA 3HB5X 3FF4A 3VAZA 3SXPA 5TF4A 3CH6A 3WYEA 2NACA 2X5KO 3DTYA 3HFSA 3BTOA 4LCEA 3E8XA 1FDVA 3NX4A 5IDYA 2UUPA 3SEFA 2X23A 5DZSA 1YB5A 3FNGA 2GDZA 3WXBA 1N7GA 3EGOA 3QWFA 4JJFA 4DL9A 2O3TA 2WTBA 3UVEA 4INAA 4YWJA 3DFZA 2Q3EA 4DVJA 1EVYA 2B5WA 3RU9A 5JSFA 1PU2A 1Z7EA 3C24A 1GD1O 1H6CA 3TFOA 5JE8A 2HMUA 1A5ZA 1L7DA 1ZMOA 3RU7A 2IDZA 4MOWA 4YT4A 4I5FA 1V3UA 2O3JA 5B37A 3JQ7B 1PGOA 1G0OA 4YDRA 1V8BA 2J3KA 1E3IA 4QT0A 3HWRA 4HNHA 5AYVA 2UAGA 2IEDA 5KNLA 1O6ZA 5MDHA 3QE3A 1NBOA 8LDHA 4CLOB 1IOLA 4UVHA 2HLPA 2EGGA 3WIDA 1A27A 1GZ6A 4WUVA 2VOJA 4E5NA 4ZN6A 3ADPA 2X0IA 3OHSX 4YRDA 4ZQHA 2ZYAA 5TS3A 1HLPA 1CETA 4BNXA 1MB4A 3ZU2A 1SMKA 2RH8A 4HKTA 4BMSA 1HDZA 1EE2A 1Y5RA 4JXKA 2NWQA 3DZJA 3KOUA 3O9ZA 4ND2A 4BNKA 2OP1A 1Y8QB 1GUZA 1HSOA 3KYDA 1D1TA 2RHCA 1KVTA 2YV1A 4ONEA 1BMDA 2F1KA 4WEOA 2BKAA 3TN7A 3MTJA 2YQ5A 3GPIA 4BS9A 4PN3A 5TT1A 2Y93A 4IJUA 1P1IA 1ADFA 2E37A 1KVRA 2IEBA 1FF9A 2QIOA 4NK5A 2GF2A 3ZZNA 4RV9A 1BW9A 3G3EA 3JQGA 1EQ2A 4B8ZA 5DN9A 4GKVA 3MWEB 3H3JA 4J1NA 4N5MA 1VJ1A 4OYRA 4RORA 2HUNA 1TVEA 4N54A 4BQRA 4GSLA 4DIOA 3K2BA 1XHLA 1B3RA 2EJVA 4MO2A 3E5RA 3ITDA 4WCDA 3ROKA 3NYWA 1DIBA 3L77A 1A9YA 1KIFA 3WYBA 1E3WB 4BNVA 5T67A 4NJMA 5FEUA 2DAPA 3AM4A 4ALJA 4B7XA 5IDWA 1CDOA 1ZK2A 2B36A 1EMDA 2GASA 1P31A 1HRDA 3EC7A 4YB8A 3CMMA 4J7CA 2ZJ1A 4KOAA 4W7HA 3VVCA 3ZWCA 5IDQA 2HKIA 1ULSA 1B14A 2NQ8A 4Y6SA 1HDGO 2RBEA 5HM8A 1YBVA 1QV6A 5HS4A 4H16A 1LLQA 1YL6A 3UCFA 4FC7A 5K6AA 1I3NA 5DOZA 2R6JA 2HK7A 1B0AA 2WYWA 4MIYA 4GVXA 3F6YA 4KZPA 4YT2A 3AK4A 4BNZA 1YO6A 1IUKA 2X0NA 4KWIA 4RDIA 4EI2A 1UZMA 4ND5A 5EQFA 3VDQA 3BHMA 5L40A 1A4UA 1QV7A 4FB5A 5C7LO 4LVUA 1NR1A 3ON5A 1ZSYA 3QVOA 5EJ2A 3QLJA 4W7IA 1I32A 4EITA 4KUGA 3IL2A 3L4BA 1M67A 4HADA 4GWKA 1X14A 1GQ2A 1AN9A 3OIGA 4Q3AA 4CR7A 2YDYA 2EHDA 4WNIA 5KJ6A 2J5KA 2WYVA 1VSVA 2VUTA 4ALKA 1TB4A 1EUZA 3PIIA 1GPDG 3DEYX 3OICA 3MCVA 4ND3A 1A9ZA 1JWBB 4D3FA 3AI3A 2DPGA 3HUDA 5I8ZA 1XELA 5EPOA 1B26A 1U4SA 1EUCA 4UEOA 3BMNB 2NU8A 1IB6A 3ZWAA 1HT0A 1YQXA 4UVIA 4U7WA 4TVBA 5L45A 4R9SA 4I5DA 5DCYA 1F0YA 3M2PA 2Y0EA 4KQXA 5CEFA 1WVGA 1J4AA 2VZ0A 3KYBA 2Q4EA 3EY4A 4IIUA 2OMEA 5A9RA 1PIWA 2VTDA 5JLAA 1HLDA 3UW3A 4GLOA 3PJGA 2FPGA 1R0SA 3DHNA 3OBBA 3Q2KA 2GRAA 4NBTA 4XZ3A 4IJKA 5KJCA 1XQ6A 3U3XA 3OJLA 3I9JA 3HDQA 3LDHA 4L0QA 5TQVA 4EEZA 3LT4A 4BNWA 2Y67A 4DGSA 2VCYA 2BFAA 2JD1A 2JKVA 4L76A 5DCUA 5TRTA 1V0JA 2HK9A 3JQ9C 3SJ7A 3OF2A 4FSHA 1LA2A 4B4OA 5A06A 1PJTA 1U2GA 2NQTA 4E2ZA 5ER6A 4Q3NA 4ZA2A 2QX7A 2ZB8A 1V6AA 1WLYA 1C1XA 1YOVA 3ROQA 4J0FA 1MFPA 1SB9A 5B1YA 5B4VA 5CDYA 1P1HA 3V1YA 3GZ4A 4YTEA 1QYWA 5JDIA 5BSEA 4OH1A 1ZEJA 2GLXA 2J3IA 1FDSA 2E48A 2AE2A 2GPTA 3CKYA 4FFNA 4LN1A 1MV8A 2AXQA 3JD4A 2B4TO 3PWKA 3DZBA 4KTVE 4XIYA 1IHYA 2Y99A 1JKIA 3ZN2A 3IIEA 1NPTO 3PDUA 1YDWA 2FSVA 1KVUA 1NQOA 5KTKA 1YDEA 3RC1A 4GX1A 4BMNA 1UDAA 2PR2A 3GHHA 4HFNA 4E2YA 5CDTA 3VZPA 1CERA 2W98A 3U4DA 3IJRA 3EDMA 3G79A 4HX5A 2P4QA 3WDSA 1NP3A 2VWQA 5T64A 2RAFA 4BKUA 3UCXA 4L75A 4AG3A 3ZH2A 2JFFA 2QZ9A 3QQPA 2YV2A 1PQWA 4NH4A 1QYDA 1W6UA 4Y6RA 1YRLA 5JAMA 2Q2VA 4NI5A 4NNJA 1NR7A 4ZQGA 1EDOA 2FR1A 4CMKA 3FN4A 3GLQA 2EEZA 3JQ7A 1ZJZA 1A7KA 3DBHB 3QVTA 2ZQZA 2I9PA 3PP8A 5I9MA 3C85A 3BTVA 1X7HA 4XDYA 3PFFA 2ZATA 4FOOA 3RBXA 1GL3A 2VYNA 3IDSA 4FJ2A 3GF4A 5JAQA 3W1VA 1SPXA 1DIHA 4ESOA 1DAPA 1HL3A 4L4SA 2D1YA 3ANMA 1KY5A 2O23A 4BNGA 4XYGA 3GAFA 4BGUA 1E7MA 1H93A 4CQLB 1NPDA 3GN2A 3WGGA 2NM0A 5AVOA 2Y1GA 3TZKA 2GGSA 2JAHA 4YCAA 4DYVA 4XRRA 2X22A 4FPXA 1Y8QA 4NIMA 5GMOA 2X5OA 3TFQA 2LDBA 4J49A 3ZWWA 2YHUA 3GEDA 4M87A 2DUWA 4ITUA 1GAEO 4E5KA 4W99A 3PLRA 2CUKA 3DO5A 4GKBA 3JQAB 2GUGA 4W9NC 1YB4A 1DC4A 1GZ4A 1DRWA 3D3EA 3QY9A 4YVFA 4AJOA 3WX0A 4BNNA 1GV1A 4TMFA 2Q4BA 5A3JA 2VWGA 5KJEA 3WNQA 4MDHA 1VE9A 1LC0A 1ENPA 4CQMB 2G17A 5KVSA 3D5QA 3L4BC 4H3VA 2VNSA 4Q3EA 4FDAA 1GV0A 1MC5A 3QWHA 3CPSA 5A9TA 1EVZA 6ADHA 2AEFA 4BO2A 3C3XA 2CF5A 3K5PA 3ZI0A 4KQWA 5CP8A 1P74A 4WASA 1WDLA 3RBVA 3RC9A 5JS6A 1TT5A 1B8VA 9LDBA 1P77A 5IAAA 2GNAA 1GEEA 1R0LA 1KBZA 1N5DA 2IZZA 1NHWA 3G1UA 3NTOA 2FHSA 3WS7A 4R41A 3GEMA 5KKAA 4Y8VA 1ZXBA 2FWMX 4W6ZA 2RH4A 2NUAA 4ZU3A 1W8DA 3ETEA 3H5AA 4UUOA 5IZ4A 2R00C 3A4VA 3E9NA 2FOIA 2BRUA 3H8VA 2AHRA 3H6KA 5KJ1A 4ZD6A 3X2FA 3B70A 1XCBA 3G0OA 5IFLA 1P1RA 1CF2O 1ZBQA 1X7GA 4JBHA 4ZVVA 3PHGA 4U0JA 1HDYA 3OSUA 4A73A 4Z3KA 3I6IA 3G17A 3D4PA 4RJTA 4UULA 1GUYA 1NWCA 3O4RA 3IS3A 2CNBA 3FWNA 1KOLA 3RD5A 4CM5A 2ZCUA 1PGPA 2CDAA 4WOKA 3WQSB 3VHRA 5CG1A 4XQCA 4I08A 1IE3A 3P2YA 3TZ6A 3A1NA 2WD7B 4OGWA 3I52A 3RFXA 3ZU3A 3JQ6A 3K8ZA 2D3TA 2RCYA 2Q46A 1I3MA 3IP1A 3LQFA 4R1UA 3LF1A 4YRBA 4YPOA 2BLLA 4O0LA 4HXYA 2AG8A 1E92A 4BGEA 1Q1NA 3NUGA 2AQIA 2NNLD 3EZLA 4D3SA 4B3HA 4JN6B 3BMNA 4IGFA 3RUHA 1FK8A 4CMGA 2DPHA 4MKRA 2DM6A 1I36A 3GH3A 5K9ZA 1EVJA 1LLCA 5IF3A 1V9LA 4QFDA 4FGWA 4RVHA 1M6WA
chains in the Genus database with same CATH superfamily
2J59A 5JANA 3DZGA 2XTNA 3OCXA 4C2AA 3KR1A 3QWBA 3DG9A 4KLZA 5F33A 4JKYA 2QN6A 1O89A 3WGTA 5CNMA 2ZPAA 4H1VA 4BZXA 3LDFA 2HJRA 1R37A 4RKFA 3QX3A 1FQJA 3KB8A 2VDWB 3UWMA 1JWLA 4YQYA 3TVYA 3S7TA 3Q3EA 3R40A 4JIMA 4NCHA 4E5VA 4ENPA 1AT1A 3IVGA 1PKXA 3I42A 1ITZA 2R8YA 4GRAA 5D1NA 2YJZA 3EVNA 4Z86A 5LQSA 2C07A 5LOVA 1VHJA 1C9NA 3QVSA 5DRTA 1W581 2JHCA 2G1UA 3L0DA 4IZOA 4X44A 3IGFA 4X85A 2AJTA 4A2PA 2NO6A 4HI0E 2W70A 2Q3FA 2KB0A 3ZZ1A 5BN1A 1XD2B 4HVTA 1JL3A 2W58A 2ZANA 1TJ4A 1UP6A 3LBNA 1A8PA 4LSZA 4OBEA 4DZZA 4F86A 3IV7A 5KU7A 2G25A 1R00A 4ZJYA 1XDSA 2G82A 2YC4C 3O4GA 3QKIA 4CTOA 2W2OA 3NPMA 1I2CA 3GRPA 4IOJA 3WLNA 3PENA 5A2QA 2HXGA 3N5CA 3HJAA 4IAOA 4ENWA 3T7TA 1N92A 1TD9A 1UKCA 2GVZC 4RESA 4RTMA 1P3Y1 1S3FA 1H9CA 1Z8DA 1DUVG 3DULA 4X71A 4EK9A 4J29A 1U0BB 3RRZA 3GOQA 5HFAA 6ABPA 4RANA 4KAXA 2I34A 4BJ6A 5TGDA 3VR5H 1FLNA 1TAHA 1FYEA 1U7WA 1LVHA 2ATCA 4UQOA 4ZQIA 4ZCSA 2O3QA 5KYWA 2O6LA 2IF0A 1RM5A 2Y76A 5DWQA 5FTWA 3U2QA 1HE1C 2IELA 5I7WA 2P90A 2XD4A 4ML3A 2PWAA 2P2LA 4K86A 2BHTA 4URYR 4NDZA 3SG0A 4D9GA 4C6RA 4LRWA 3RFVA 3P32A 3PWSA 4BBJA 4KPUA 4A3SA 1EVEA 2A67A 2X9NA 3AXTA 2F2TA 3LI2A 1JHRA 2VJNA 3PCTA 3QLTA 2VZ8A 3UWOA 5E6SA 3UJAA 1V47A 1GQQA 5KC9A 1Q7GA 5BRNA 3N2GA 5HKOA 2P1RA 4RIGA 1TF7A 4FEYA 5ERXA 3SOZA 2XUZA 1PR6A 1NVGA 2ZSKA 1E9VA 1BN6A 1H2EA 5EXPA 4C0HA 3RTBA 2YXEA 4OQDA 3GUHA 5F78A 3IRVA 2BMVA 4QQ8A 4FFWA 1ORHA 5IZCA 2P4HX 5EI5A 2GFHA 4HNSA 4HRYA 2PQ2A 2VNJA 4B3CA 3LX4A 3KUCA 1NJGA 4P7JA 3B7WA 1F8YA 1PR1A 4I8XA 4LVCA 2UXDB 4OUKX 2DLNA 4GVPA 3VPSA 1FUYB 1M34B 4YV2A 3IUBA 1Y5NA 4G23A 2FKAA 4N12A 4WBSA 5KDLA 3G49A 5AVZA 1CHNA 2JCYA 4B7UA 4U5XA 1QRAA 1KI1A 4U2KA 4RD2A 3BHNA 1QC5A 3FWKA 3I9MA 3EZYA 1SIUA 2BTOA 1U7OA 2C5FA 3D1VA 4YACA 5CH5A 2CLMB 3PSHA 4JJ6A 2GERA 2JZOA 3PNKA 2EP5A 2FVXA 1NC1A 1SPBS 2GM5A 3UFXA 2O7RA 1K4YA 1IXKA 4N82A 2MYPA 3RASA 1DUIA 4Y2SA 3FMVA 4PY2A 2NOAA 5J4YA 4D9KA 4AZWA 1AKTA 4U63A 3H3FA 2HO5A 2A0FA 3Q0TA 3C4VA 4RVNA 5ALYA 3VO2A 3ZYZA 2YDXA 2VG8A 1L5OA 2VFAA 3FKJA 3F97A 2GVNA 1I01A 2JIOA 2V59A 3AYZB 3SX2A 4AUEA 4GECA 1A9RA 1D7OA 2Q29A 5HK8A 1U2PA 2W2KB 4FZJA 4YQFA 3NXKA 4D96A 5B6JA 1DDGA 4IIEA 2IH5A 1XMVA 1RCTE 1SELA 2C7BA 4H77A 2BF7A 3BRWD 1KI9A 1NIJA 1VA4A 2WSSD 2XCUA 4O08A 2B83A 3UGTA 4E12A 5I4CA 1VYVA 2FEPA 3B9QA 3L5KA 1HSZA 1ECLA 1YRWA 3LT0A 2P9GA 4J0IA 4QLOA 4UNPA 4C4YA 4F21A 2A1IA 3QWAA 3TTWA 2CZCA 4ZC8A 4X20B 2BDTA 3PITA 1M2GA 4JB0A 4NMMA 1GAQA 1QP8A 5LMZA 1D6JA 4OEHA 1NLMA 3QKWA 1EUQA 1M6HA 4CQMA 1FJHA 4E21A 4EFDA 1FS6A 1X87A 3OQVA 3R3YA 3KUKA 2YMMA 3DAGA 4ND8B 4RKRA 4B32A 4FX2A 1ZM7A 3VX3A 2OK8A 2AOUA 4EA6A 4F96A 2E4YA 1P44A 2NUPB 2W71A 3GO4A 4BLWA 1HKUA 4DA9A 2P78A 1YUNA 3K30A 2AOXA 5FL3A 2I6GA 5KQRA 3P0IA 3HBFA 3NYQA 5LZ2A 3TZCA 4CPDA 4G4SO 4EHFA 4Y9UA 2J87A 3HEAA 3AV0B 2NTVA 1U4NA 4F5YA 2C04A 3VR2D 1TEHA 1DWQA 3OZVA 1M74A 5JFTA 2OV1A 2YXDA 5FFMA 3CJTA 1GFZA 3AZQA 4N41A 2BI7A 5SYAA 2BFMA 4UQLA 1PTKA 3VU8A 2CMHA 2MMGA 2ZJ2A 4QHSA 3V55A 2XGSA 4DSAA 2ZWOA 1QDEA 3EFEA 5ELXA 1PT7A 1PEKE 1PS8A 4O2AF 2A3NA 3RSHA 4RK1A 2NVUB 1V71A 2PRKA 2X76A 1X80B 1Z9BA 1KO5A 4O0MA 4H7HA 3TOXA 1WF3A 5AK5A 1YIDA 3B1KA 4FR5A 4J16C 3QVKA 4JLUA 1CVIA 2M6LA 3B78A 3W9UA 4DM4A 3P5BA 4W5RA 2GYWA 4KTTE 3STHA 1QIIA 2HFKA 2VP3A 1L5VA 3ENNA 3LQKA 4GWGA 1P91A 1UPAA 1P4AA 2E4XA 4LKRA 2Y1FA 4LHYA 4BXOA 4X1KB 3BJZA 4GL4A 5CCDA 4KJXA 4TKMA 3SC4A 3DF9A 1G9TA 4EFLA 3AKZA 3FI0A 3A0RB 1RMYA 2QYHA 4HQKA 1TIPA 1BFUA 5ITSA 2C7VA 1CNMA 1FPQA 3OUZA 5L6LB 3DMHA 1IZ9A 2NADA 1R64A 2V7WA 3BFVA 4LW8A 2Q6KA 4DV1B 1YVPA 1QYXA 3OIDA 3C8MA 1DJOA 5KNDH 3C7AA 2AUNA 2JHFA 3RBZA 5ED4A 1H2WA 4Q1VA 4XTRA 4YROA 4DJFC 1VMEA 5CITA 1Y7PA 5DMHA 2X5JO 5I9LA 3A6FA 3LCUA 1EZ4A 2B20A 1TJ5A 1KDYA 2IS1A 4XIJA 2WPNA 2NO9A 3I45A 4JLDA 3F46A 1WDWB 2J48A 5T4HA 1QRUA 1ZGHA 4HWPA 1ND5A 1EU1A 4I81A 4J2TA 2PV7A 5D51S 4K88A 3H0CA 3E5MA 5F21A 5KOHA 2Q2WA 3W5IA 4RVCA 3HKDA 2WTNA 2BI8A 1LPNA 1HFWA 1QHIA 1K7SN 2I66A 1NTOA 1O03A 4J07A 1YCHA 4UXHA 4DDMA 3I2GA 3L7NA 4Z0HO 1LI5A 3C45A 5B53A 1YCFA 1VB5A 3LTNC 4C7JA 3KT0A 1H6DA 2Z2XA 1M9NA 3TZHA 4KNYA 3HJFA 3FUVA 4HG2A 1CZKA 2DFDA 4ZGWA 3V7NA 2R1VB 3A1WA 3C3PA 1NBME 1NQUA 3D9QX 2JEZA 1LPAB 3ZWXA 1Y0BA 4R05A 4UAGA 3WYNA 4BAUA 4EMBA 5B64A 3M82A 4WE3A 3RROA 3T3PB 1Q50A 3CVXA 1ISJA 4IS3A 2JIMA 4HDNA 3GLSA 4Z8YA 1QF7A 3O90A 2QL5A 1Z25A 1EM6A 4ARVA 1TGVA 4NZ9A 3SYNA 1FJGB 3C3EA 4PE5B 2H65A 3KPUA 4ALMA 2J3JA 5FDFA 1Z75A 1NVWQ 1LPBB 1E1RD 3D1LA 4QEKA 1TUEA 4P3YA 4YXWD 4GLBA 4JT9A 5BN3B 1I1NA 2ZZNA 2P4UA 1GRCA 3DMTC 1SHJA 3ZW8A 3BRSA 4OMFG 4Q18A 4BFYA 3INGA 4FK8A 1ZM9A 2OO3A 4Z5XA 1RU3A 3EF3A 3IBTA 2NUAB 3UF0A 1RYMA 5CM9C 4NENB 4FIDA 1VECA 5JVDB 4A6XA 5KYYB 3QX7A 2FPLA 4DCVA 5KDDA 4GBMA 2ZWIA 1O0BA 1P18A 1XZNA 2O3RA 4U2DA 5J1TB 4J9UE 4BNTA 5DU2A 3RGWS 3PWTA 5AVVA 1SULA 2IOFA 2QSZA 3R3WA 4MWZA 4L50A 3RV4A 1M5RA 1QX3A 3IDQA 2BV3A 2YVQA 4CM8A 1BS1A 1E2BA 1O94D 3MIIA 2Y2UA 4RVFA 1DCKA 5DRYA 1RIFA 3RS2A 3JAWA 1QPBA 4UBLA 1YZNA 1P75A 3LT2A 4PX3A 1L0BA 2C9CA 1F2UB 2EKBA 3IP9A 3LVRE 4WZBA 3R7SA 3SFZA 4XLLA 3LHDA 4CT5A 2FCAA 1JIUA 2J45A 2DTXA 4Y2JA 2CXRA 3MMXA 4RPIA 3U4QA 3VZDA 1AS0A 2DGDA 4WOJA 2BJVA 3B6IA 1RJDA 3TECE 1PQ4A 2OMKA 2IS6A 4HVCA 1E7SA 1KMIY 4JI0B 2WEKA 2Q1SA 5JH7A 4G1VA 5C1BA 3RRJA 2PKQP 3LL4A 4YX9A 1PSWA 1Y1QA 3CUKA 1IY1A 5TSDA 4D9HA 5A4KA 5KC8A 3WQRA 3DNPA 4KGDA 4ER7A 3LRTA 4CL3A 1TTQB 1KXZA 2B1GA 2VIIA 5EUQB 2NUTB 4I6JA 3BA1A 3IKTA 3NAMA 1BX3A 2OHFA 1RM3A 4G6ZA 4PS1A 4PX5A 4RMGA 3ANLA 3K1AA 3I4CA 4OK5A 4XFJA 4EH1A 1MTZA 4AKEA 1U0RA 4DCOA 2XWSA 1RAEA 1XLVA 2II6A 3N9IA 2GT1A 1FMFA 1S3IA 3GLIB 3CTPA 1C0PA 5KYUA 2RCNA 1T9CA 2ECOA 3T5GA 4FYPA 1XZLA 3JVVA 3WB0A 2JS7A 1KA9H 2QE7D 3R8CA 1QWOA 1Q20A 2O5VA 2VR1A 3JQFA 1WZIA 4L0DA 4H6WA 3VYSB 4E3ZA 3U3JA 3D4NA 1DADA 1GSHA 2N47A 4JC0A 1NXQA 4N5DA 5EWJA 4WBNA 4WXRA 5J4VA 4B2LA 4CG0A 3NM5A 4FKBA 3F9CA 4U2GA 4LXUA 721PA 3GRAA 4F3YA 3DGEC 1YQUA 3I9KA 5ARBA 3RANA 3QXGA 5KEIA 1H69A 5BUSA 4P3PA 2JFOA 1J8YF 4NOLA 3SC6A 3UAVA 4YRZA 2IYWA 1NOIA 1X0VA 3GXOA 1ZS9A 1QAMA 2L17A 2V4ZA 1VIMA 4J9VA 1U65A 2AV6A 1TPZA 2FJUA 3PUZA 2JGFA 5AM0A 5JD5A 1GTL1 4R7ZA 1O5IA 4B71A 2NO4A 5CYGA 4BKPA 5LOVB 5LMUB 4RABA 5CB0A 1GFSA 1NTRA 1ZISA 1RP7A 1Z2EA 4JOCA 2H31A 1G8SA 3SM9A 3OFJA 1NW5A 3ABIA 1ZO8A 2Q6OA 4OI1A 1RYHA 3TKAA 2JGDA 5LSAA 4BMOB 2LZ0A 4Q7JB 4DC9A 4QQNA 4FZ3A 4DHWA 1H85A 3RRFA 1VHLA 3JQAD 4U9HS 3T3OA 3LXXA 5FUVA 1G8HA 4LJ6A 4ZKDA 2O8EA 3CUSA 1GWNA 5JVDF 2W8BB 2CMFA 3R6GA 1FDUA 3PQFA 2X8AA 3SJUA 3ST7A 4RVGA 4L4YA 4U5QA 1A4RA 3DO6A 3KJFA 3UWDA 4KIJA 3A26A 3H9UA 1HQDA 3NU1A 3IP6A 2O59A 5KS2A 2ZYRA 5KYWB 1U2DC 3N53A 3NHSA 5CD9A 2GFIA 1WPXA 2PGIA 1YJ8A 4TQGA 1BVYF 2QHXA 4MW0A 3TOZA 3VPGA 2HNKA 4MW1A 3ZE0B 2VDQB 3KV1A 4TTRA 4UBIA 1O5TA 4P7KA 2Y0DA 4M9XA 5LLSA 5JSYA 4D46A 1Y8ZA 1THTA 1U8UA 4WX2B 3T12A 1F8FA 2EARA 1JG2A 2I0FA 3QLVC 3L18A 4IWNA 2A0KA 3MN1A 1Q12A 1DI0A 2QXYA 1JAHA 4L08A 3HYTA 4W82A 5E6SB 5KSPA 4GP7A 4CIDA 1FPMA 4WKCA 2DWPA 3MWJA 3VJLA 3A6KA 5EMHA 2GS9A 3EIOA 3N2GB 4S24A 3BDIA 5IM5A 2YH2A 2ZS7A 1SZPA 4ZT5A 5DTMA 4DR7B 4OBXA 4OLHA 4H17A 2NW6A 1RZ3A 1W5BA 4Q4AA 1NKSA 3CCCA 1HEYA 5K3BA 2WWRA 4RENA 4BLVA 5CLJA 5GTDA 4K0RA 3OZEA 1SB8A 2JIZD 3RIHA 1KNXA 1XTTA 2OV4A 4KFCA 3ORRA 1YVUA 3C1TA 3S28A 3JYHA 4L0MA 3WMXA 1V3QE 2FKNA 2JG3A 4G86A 4RPGA 4C5AA 2AOTA 4D41A 1FNCA 5BWNA 1JYFA 1YB1A 2BR5A 3WBJA 5T8KC 5FUQA 4E33A 1FDRA 2VBFA 4BLTA 4IHKA 2C5GA 3KTDA 1IH8A 3TSCA 4B6EA 2CFOA 3NM4A 2CHVA 2Q21A 4U39A 4G1BA 3P0HA 4XJTA 4DA8A 2BMDA 3L7OA 1K7CA 3WTCA 3GT3A 2Q6VA 4IXWA 4EEKA 1V5IA 5LKAA 1SVUA 1BRMA 1WUTA 3ROGA 1Z07A 4BV9A 1H9AA 1NF9A 4N39A 1E0AA 1UF9A 4KPFC 4DQXA 2KBFA 3UFXB 4I9FA 5ERGB 4DJTA 1V1MA 3H1TA 2DBQA 4CCYA 3DPUA 2D13A 4KGVA 3ANTA 3W2IA 1W44A 4M7RA 3FA2A 4KQJA 6PFKA 1I94B 1RPNA 1XDWA 1QQTA 2V1UA 5AVQA 3MOSA 1CRWG 3ANXA 5LOVF 1ULUA 3FNQA 5HNKA 4Z9FA 1E66A 4FFPA 1U0FA 1X7DA 4MSUA 4ITVA 1Z2NX 4NU6A 5LWQA 1AE1A 2BTEA 2VSYA 3ETJA 3EFBA 2J67A 3H6GA 1N33B 2BDUA 3K9BA 3FHOA 1ZOPA 3AY7A 4QDXA 1Z0ZA 1HT3A 1ST3A 3S2YA 1ZZEA 1KP9A 2YIVX 4D56A 1KWKA 3GGOA 1XEXA 3EZXA 2B4AA 2WJYA 5EXTA 1C7QA 4D6PA 5CA1A 4NBVA 4N6GA 3GBVA 4EJ0A 3JYOA 1PZMA 2OPHA 4E5UA 4UTVA 1LBHA 1Z4JA 3PUKA 3DKPA 3EHEA 1ONPA 3L8EA 3NAQA 4FHFA 1T9AA 4A03A 3BOSA 3CZ9A 2H5EA 1GGKA 2AOUB 3IURA 4AZ0A 4EB0A 1BHSA 2KBEA 1NP6A 5KI6A 1R16A 4LS3A 1FP6A 3PPWA 1B43A 1GGFA 3QU7A 4GGOA 4WY5A 4BUCA 4BQEA 1PQYA 2OUIA 4UPVA 3OJWA 1C8BA 4DDTA 4B3MB 3MTIA 3CY6A 2JFNA 1L5ZA 1I2BA 3GIDA 1UH5A 3QE0A 5CT5A 3NHRA 2QTFA 3RUFA 3KZVA 3TRIA 5BVHA 2FEWB 1BX1A 4OCZA 5AHXA 1NOKA 1KK0A 4OHOA 1NW7A 1CY4A 4ECEA 4NBUA 1GADO 4NYJQ 4Q7QA 1FNNA 2F8SA 3T41A 3BHIA 2ZTSA 2PA3A 1NYLA 5ISMA 3WA7A 1X0XA 1EQUA 3HNPA 2WPDA 4NZPA 3JALA 2DBVO 4KCGA 1Z68A 2ZTMA 5DSTA 2FSGA 3RUIA 2HQOA 1S3GA 3TRJA 4Y98A 1YR7A 3KUDA 2Z3VA 4OPMA 4R5HA 1KDRA 3RJTA 4ZO6A 4BWFB 1XA4A 3L4SO 5ANRB 3R2JA 3FUXA 4CIWA 5MN4A 4TL7A 3Q4GA 1U2QA 1C81A 3AF5A 4DDHA 4E2WA 1D8TA 1HDOA 4MVJF 4BPBA 1MX5A 1LZKA 2IYLD 2X2EA 3N07A 4NAHA 1EFTA 4MW4A 4PONA 5E2IA 2W90A 3NOXA 1EDEA 4HOYA 1B93A 4OHBA 4KIGA 2EX4A 4L4ZA 3JQRA 5FA5A 2X5XA 5EJ8A 4BXOB 5BR4A 2R79A 4PGHA 4RA9A 1GFWA 4Z0TA 1Y8RA 2RC5A 3OZDA 2QN3A 4KSCA 1U0SY 2D2XA 2ECKA 1ENYA 1TZ2A 3HBJA 4QPPA 3QE9Y 1O97D 1QMPA 3L7LA 1PW7A 2PMEA 2ZJAA 1V1JA 1OVMA 3NHWA 1KU6A 3AJDA 3OQ1A 1JG6A 2ZAIA 4IFBA 4LA4A 4LSWA 1K3FA 4QU0A 1R18A 4ZVQA 1U1GA 2ZUCA 1LW7A 3WOHA 1MW8X 2WM2A 2YX1A 1GYPA 1H1LA 2M9MA 3PV0A 4BGDA 2H2DA 3LBIA 1HDRA 3D8NA 1SOAA 4XM1A 1A76A 3DOIA 3FHCB 1XN4A 2E49A 3GGCA 1ZVKA 3OM0A 3OBIA 1M5TA 5DEIA 3WO0A 3PGVA 5B1IA 1HT1E 2C59A 4DV6B 3DMPA 3PFNA 5TGZA 2E4ZA 1NF8A 2AX3A 3K5WA 2P6PA 4I7EA 4JVLA 4UEKA 1RYDA 2UYCA 2J0QA 4HBGA 3FDZA 4QPJC 2ZUTA 5DHSA 4AO7A 3RC8A 3OM9A 3D02A 2VH5R 3DZCA 3R7AA 2C42A 2B30A 2JFXA 2X9VA 1A2OA 2LD4A 3HCCA 3I34X 1K6JA 4BJ5A 3AVTA 4R54A 5AJVB 3JSXA 1AH2A 3EH2A 4MWTA 5U1PA 4JB3A 4QTUB 2H07A 5KOHB 4PPGA 3OH8A 1WDKA 4FX5A 1E79D 1Z36A 4Y9TA 1CJTC 3HKDB 4QQFA 5IWCA 3VV2A 3U5TA 3WIEA 3DE1X 4YN3A 3ZE7A 2HADA 1QG0A 2AG6A 3MM4A 1ISFA 4G85A 4GPEA 1DDIA 1NUAA 1VCHA 4J16A 1C3JA 4MP8A 4NDAA 1JQDA 1TTTA 2QEQA 1QZTA 2GCIA 4XVQA 3VU9A 4KXVA 2KPOA 4D4IA 5IM4F 5HCUA 3SIPA 4AK9A 3CISA 1OAKA 2C3PA 3UM9A 4ER0A 3UYLA 4G0MA 4QLBA 5DBFA 3HFGA 5C5IA 4OA8A 5AOAA 1LQUA 2DQ4A 3U9TA 4O5OA 1CUGA 1PBNA 1ZL0A 4C76A 1F51E 1MV5A 1SUCA 1EAYA 1E4EA 1T9ZA 1W5TA 1G2PA 3OX3A 4MUMA 3HFJA 4X7PA 3TQHA 4DMRA 4C3ZA 4XX1A 1MOZA 5LLTA 1DUSA 1HDEA 1RWOA 3EWAA 3RUPA 4EDFA 4P3OA 2BIFA 1YDFA 1FFSA 3WV4A 1X7XA 1YGYA 2P0YA 4NBSA 1IEXA 1J2UA 1UOPA 4RC9A 2CKDA 3IMCA 1ORIA 3COVA 3X1XA 3DE2X 1X1SA 4ARIA 3HQ4O 1MO6A 3Q40A 3U0BA 5K8CA 4F5DA 1GSOA 2C88A 5DNVA 2CGEA 2OBMA 5K01A 4WXMA 1JR4A 1A9PA 3HRIA 4ZVUA 2IP1A 4UTOA 3QPUA 1J06A 3ZIUA 4S1TA 2F43B 1RD4A 3ODGA 1K4MA 2ZBGA 3WLAA 4EQ6B 4C89A 3KELA 2FF5A 3MCAA 1ZK3A 3N2LA 3DE4X 5A03A 4KO4S 5ADHA 2GZAA 4FBLA 2W6QA 3DE5X 2FR0A 2MJLA 4PTLA 1V6CA 1YWGO 3DWGA 4HB0A 4AZTA 5IULC 2DWQA 4B46A 3FB1A 4B83A 1CRZA 3S1AA 2Z4SA 4WFIA 4KLAA 4ND1A 1NYTA 2VJCA 3DAYA 3JAWB 2OGSA 1KXJA 1QMGA 3UXHA 2OQ2A 3KX2A 3RBAA 3K5HA 4N18A 5EESA 3MUEA 3D64A 1GKUB 2KSQA 4WZBB 2LV8A 4JI5B 1C29B 4KO8A 1JB9A 1D2MA 2QT0A 3QX9A 2XRFA 1DKQA 5CYPA 1VOTA 1Y4AE 4QELA 1JLSA 1GKLA 1S7CA 1WMSA 1TQ6A 3QFFA 1Q0LA 2JI6A 3MQ2A 5BPFA 2GN8A 3IV6A 5DOVA 5K8UA 2PGDA 4GYJA 1SHUX 1ZNQO 4LHZA 1FXUA 5BSVA 1ZUNA 3OCWA 1QIEA 3K4HA 4PLWA 1OBHA 3L6DA 4JLVA 1TA0A 1R4ZA 2JD2A 3H11A 1DIRA 3M8KA 3PC6A 3IPAA 1QH0A 2VK1A 3QF4B 2BGUA 2QY6A 4G07A 3N28A 4GVLA 1RWKA 1JSCA 1YB7A 3DMTA 4F2PA 4GOMD 1UJMA 1O6BA 3PYMA 1XSEA 4G81A 4NBWA 5IMSA 4S04A 2GJ4A 4MJLA 2E6UX 5CB6A 3OU2A 2Z56A 1IZYA 2AK2A 1RKBA 4KXFB 3CNNA 1UXHA 4D9FA 3V8QA 2OAGA 3FLEA 4FB4A 4PLGA 2B3TA 1JU3A 2E4VA 1YDMA 2BN4A 2YWCA 5CLIA 5FKJA 5IKMA 3I2JA 4KNVA 3BILA 5KYTA 1E0JA 5ALMA 3UG7A 3MSXA 5BOSA 3WK7A 4WBNB 2V45A 3CLRD 4JB8A 3ECAA 3Q3CA 4XGQA 3TJMA 2VQEB 4YUVA 1M2OA 1VPLA 2CNDA 3AKDA 3ND7A 2RGEA 4FBGA 3GLFA 2HLHA 2JHPA 3IDZA 2W7TA 3ESAA 5EKXA 2QL7A 2XOXA 3G7SA 3PDJA 4PLCA 2C5EA 5AJWA 3T3MB 3EPRA 3DNMA 2SHKA 4BECA 3SZRA 2XT0A 4W9RA 4FFVA 2JLYA 1P3JA 1Z0DA 4JMPA 3HWSA 3V9PA 3A3KA 3NP7A 4R9NA 3R3XA 1ZPDA 3T3GA 1YDHA 3HZZA 3WNDA 8GPBA 1KAHA 5KPJA 5I7EA 2GBFA 1GEGA 1W4AA 1RWNA 2GPAA 2QK4A 5AJHA 2GEKA 5B7GA 1E7YA 1ZHHA 3DYIA 4XGKA 2QU8A 5FTJA 2NYAA 3KYIB 5FWNA 1TMYA 1XZPA 1FQKA 4XR4A 3GROA 2PUAA 5E8RA 2A9OA 3SVLA 1PTJC 2XT9A 1LSJA 5CT6A 1DLJA 5FWYB 3ZBUA 1O0SA 2JGDB 4Z4QA 4P0PB 4GI3A 4LMRA 4QUIA 1GGVA 2DPLA 4OAQA 4PCLA 2CBGA 4ZYTA 3IBSA 4KO2S 2O8EB 2K87A 1F38A 3RK1A 5BNTA 2XQJA 3L6UA 4N76A 3GFQA 3LCCA 1E2PA 3IAFA 1ZD9A 3PRHA 5F7ZA 3W05A 1WY5A 1XT6A 4MAMA 3NWEA 4QPZA 1BE8A 2I4LA 3K2IA 5K51A 4HN2A 4BAZA 3PI7A 4C4XA 1DCFA 4LHXA 3UAXA 3L8HA 1DKMA 3VXKA 5I9IA 4RLFA 3U7FB 4DG9A 4CIAA 1H0RA 1G21E 4S1VA 4CL0A 4OSEA 1E0SA 3H1EA 1UBEA 4UTRA 4BL5A 1K8QA 4LJ7A 4ZIRA 1P0IA 3ZY3A 5CA0F 2JI8A 3UHPA 4JYZA 3TXAA 3HXMA 4WKGA 1P80A 1XJWA 2FZKA 4IMPA 4AMBA 5LZ4A 3COZA 1SRQA 1WF6A 3O8BA 4TRMA 3CG0A 4U6SA 1ABFA 2F67A 4II7A 1EWKA 1QB7A 4KIFA 4CIXA 1GILA 4GX5A 4EX7A 4I9NA 2O8CA 5DK6A 1WDTA 3I1IA 3QFTA 5BYBA 1SD5A 2I2CA 4LRQA 2SKEA 3MT0A 4MV6A 3RYFB 4FNAA 1UBOS 4YCSA 2ACVA 2GFQA 2OGWA 4O25A 2J32A 2O48X 2Q8PA 4XX0B 1Z2AA 3RSQA 1L9XA 4TXJA 4I3HA 3K9FC 2P7HA 2F1RA 1XVVA 1P5FA 1BGWA 2HX1A 1RPTA 1QHSA 2AF3C 2R1ZA 4LJKA 4MH0R 1GZSA 1H22A 1U0NA 4N1AA 3ZE8A 4IMJB 1HLFA 1UBJS 3AUXA 4Q3OA 3PXGA 4F45A 3ETGA 2UYYA 2I76A 2HRQA 2W4MA 1Z6ZA 4N40A 2HJWA 3WBBA 1D2NA 2Q99A 3JTEA 3HY3A 1G5TA 3PUIA 3C14C 1RRGA 2VN8A 1GPWB 3PUYA 4JOSA 4R0VA 1ZY2A 2AOTB 1VCMA 2UYQA 3PHLA 1P1JA 3W1EA 2CZQA 2GBGA 3SHTA 1KYYA 4CTKA 2CNLA 3AGPA 1BTOA 1GU1A 1U7UA 3GMTA 3V1UA 4WBNF 4CR6A 1O96A 4Q7KA 3LPMA 3SZ3A 4RZXA 1Q6YA 1L3CA 4Y9SA 1ZCAA 2VRWA 1H8HA 3BD9A 1K0FA 2HHLA 3LKZA 1W1IA 1PR4A 2IPNA 1R8XA 5B1SA 5JSZA 4H7IA 1U2DA 5IK2A 3AERA 2QYOA 3IA7A 4UBJA 3GVXA 3AHJA 5JUWA 1E9SA 3RVPA 1V1MB 2QJRA 1E1CA 2XDWA 5CB4B 4Y0AA 1Z5NA 3VH1A 3K0KA 3NETA 2MCFA 3PQ8A 3D6JA 2ETVA 3PT5A 2XCQA 2Y77A 3IQHX 1M6NA 2CW5A 2PKCA 4B9EA 1I7SB 1QRDA 2WNIA 3O75A 3QLUA 2ZUUA 1N1MA 1EWQA 3QLVA 1TI7A 3WMGA 2HDHA 1EWYA 1H65A 4E5YA 4D0LB 2BFWA 5FBKA 3UGQA 2LWIA 4NBNA 4HLNA 1ECCA 3AR8A 2XY4A 4I0WB 4DBLC 5BN4A 4PPQA 4YCLA 4DMHA 1TLFA 2BW0A 3LDAA 4YGXB 5GWXA 4H7EA 4C3VA 1ZESA 2BSAA 3NT4A 3UKOA 3W5CA 4XDZA 221PA 3E2MA 2O1WA 4JJ4A 4OQMA 1Q1ZA 3KCQA 1XEXB 1YVEI 4YAIA 1US8B 2ZB4A 3NBMA 5CA1B 1C9KA 4C7MA 4PWYA 3AR3A 3LRXA 2XMCA 3EZ9A 4FE4A 3TIGA 1E1QD 1X1EA 3SSMA 3RAJA 1E3SA 1TD1A 4GXTA 4ED9A 2PZ8A 3HZRA 4FE3A 3CRNA 1UOEA 1V11A 3DTTA 4KE8A 4XD2A 5T8KA 1EPUA 3NPAA 2QV0A 4AZ0B 1M66A 2GSWA 4RVSA 1LLUA 5DNDA 4B3FX 3HCRA 3MWDA 1C7FA 4L5CA 5J3JA 4MV5A 1EFLA 2X3FA 3D2BA 2PWPA 2Q2OA 1H2XA 1W4ZA 4DT1A 3NASA 4MX8A 1ZNYA 3GGGA 1H3FA 2VRBA 3OE7D 3R5SA 2QW1A 1CZNA 4KQ9A 2JF0A 5BVHB 4CMHA 2C7GA 4I1UA 4RPHA 4C7VA 2G4VA 1N4DA 4CUZA 2QRJA 3KEOA 2NP6A 4KJZA 2OQVA 2PUTA 1A8QA 2JGRA 3FNRA 3LKBA 2JDID 5TDHA 5B3JC 1LS6A 1Z4IA 2CHFA 5EY5B 3JALB 1JJVA 1N0VC 1VYUA 2PMDA 4ZQCB 2HA2A 4BNFA 4C4PA 3GJRA 1VB3A 2DR3A 3SHOA 1Z17A 1WQ3A 2WJZB 3AB7A 5EEHA 4LECA 2DUNA 1IXSB 2FFAA 2Q7OE 3F6EX 2XA9A 2ZZKA 2H7YA 4UARA 2PKYX 4LZPA 5ETJA 1JT9A 5F2NA 1T4GA 1UM9A 2V58A 2WWTA 1VBFA 5ICMA 1LVUA 2FUKA 2ZT6A 1C1HA 3T1HB 1SIBE 3D6FA 4JLSA 3ZVNA 3PX2A 5DB4A 1EINA 4FNGA 4RA9B 4GP6A 4K03A 4EPVA 1XCLA 1N2ZA 2QG9A 3MF4A 2YJ3A 1KS9A 3KM0A 3FX2A 4Q9IA 2A5GA 5K0ZA 5DF1A 2DP4E 3KL2A 1X9GA 3H7IA 3IE0A 4CCAA 2J07A 3PNPA 3IXLA 4OGGA 3V2HA 5CCBA 1C7RA 3EYWA 5A3QA 1Y33E 3MOIA 4C7KA 4PV7A 3AF3A 4V0ME 1VJDA 2F4VB 1H1LB 1CUBA 2AJBA 2B8TA 2P1DA 3BWCA 5CVUA 1DV1A 1FX0B 2NZJA 4YLYA 2R8XA 1KBOA 2PLRA 3OQOA 2B0CA 2IA5A 2Q9BA 1SG9A 3GNTA 4MYRA 3TTUA 1I2MA 2Q7XA 2B2XA 2B0JA 2ZOSA 5H80A 1VRWA 5DJ5A 3PHIA 3MCZA 5LBUA 1E4YA 3FNIA 5BW8A 1PWEA 1RZVA 3H2IA 3NYRA 5LNK6 4C7OA 4XPIB 4WJKB 2BFFA 4D9IA 3FDZB 4J0EA 3AKYA 5ENZA 3CRVA 2DLDA 1W0CA 1XQ1A 3O1LA 5FUYA 4D6YA 3PNBA 2VOEA 3I9V1 2I1LA 1ADYA 4RGBA 3PHHA 5AJYA 3BS4A 4BMVA 3L6CA 1U0OC 1P7VA 1NVBA 2EZ8A 2VHYA 3FHLA 4DC1A 1N5RA 1ZITA 4CM7A 4DLYA 4MDEA 4F4CA 4O4LB 2OYCA 5A7FA 2PL5A 1KZGB 4DE5A 2J0UA 2VDKB 3C5CA 1UUFA 1G16A 1NZFA 2XYVA 4DNXA 4JEUA 1QFSA 1DTWA 4QUDA 4E32A 1HE8B 1FBTA 3GUYA 4AY4A 2C5BA 3FNEA 1E6MA 5CPFA 5I7RA 3P9YA 5CA1F 4RQBA 1SC4A 2UVDA 4CM4A 2JGMA 2P40A 1F7UA 2CSUA 4IDEA 3WK4A 2XMRA 1NN3A 1N0HA 1DHRA 1A0OA 4B43A 4GYKA 3E3LA 1N8SA 3ZDAA 3ZCSA 1RQRA 1G8JA 1W85A 2Q5IA 1V39A 3I28A 3I8OA 4K26A 3RKUA 4DSZA 3IQFA 3ZDRA 5C18A 4M83A 1E4EB 5DNWA 1X8JA 3FOWA 2FHPA 4RQAA 5AKJA 2J3LA 2W6OA 4DUZB 2ORVA 1YJAA 3G5UA 1DCMA 2EBUA 2VPQA 3I0NA 5J59A 2Z98A 2NSHA 5CDUA 1Z2OX 4IV5A 4M54A 3U40A 4BEVA 1UWCA 2ZJ5A 5LQKA 3L4JA 5HCIA 1CFZA 2X7XA 4C4RA 1XMIA 2AMFA 4PC2A 5CLFA 2WHYA 2HWXA 2XBLA 3B53X 3LC1O 2XCRB 5ULLA 3R7FA 1WUYA 1TPYA 1JN0A 2G36A 3I83A 4R2LA 3O2SB 1UP7A 5HKKD 2BGMA 3LPAA 3AV3A 4I1IA 5AKZA 1P6XA 3B20A 3RJ5A 2W2NA 4W4TA 3GRYA 3W6PA 4YK7A 3FTQA 1IWPB 3FZGA 4QJBA 3KLMX 5AICA 4B3RB 1MT0A 3E9YA 4KYTA 1G5IA 2Z1MA 1PFWA 3AUAA 4UD2A 1M1YE 3IP3A 1BWRA 1X6VA 5F1YA 1TA4A 3GJQA 5B2ZA 621PA 3GIWA 3HYRA 3QFCA 4PSVA 4Y6LA 3ZHRA 1JJBA 3F5QA 4FCWA 4BFLA 5I4KA 1YH3A 1PJRA 2HAEA 3S1AB 5LQDA 4YR9A 4L9SA 4DDUA 3SN6A 1F12A 5DLEA 2W42A 2E0IA 1PT5A 1U3TA 3VZSA 4KPYA 3ABRB 2FB9A 5I3CA 5JCZA 2EOAA 2VWPA 4OUDA 5BV8A 4RVOA 4D9BA 1LDMA 3MILA 4O1MA 4PC3A 2PJRA 2UZIR 2FG7C 4K9KA 1VKOA 1T8TA 4WHMA 3RJ9A 3GJ4A 1T1JA 1KSGA 1KMMA 3SR4A 3QY0A 3IB3A 4X95A 1N9GB 5HBRA 1J49A 1TW3A 5T4FA 3USZA 1Q16A 1ZUNB 3OTHA 5JEEA 1MA3A 1YE5A 3JD2A 2ZXEA 2C7RA 3EXHC 2RIRA 1PZEA 2AXPA 3G9XA 4TYPA 3B7GA 1C3LA 1U7DA 1GPNA 3WB9A 3H11B 5DP1A 2VUHB 4D42A 4ZHSA 1H5UA 1SVMA 1PJLA 5I8PA 1VZ3A 3DV9A 4UTZA 4EJSC 1USUA 4A91A 1WZEA 2PZKA 3VPHA 2EATA 4K2HA 4V39A 2JAOA 3QYPA 1NATA 5TF0A 5KHAA 4O4LF 1S8FA 5E0OA 5BV0A 3O8RA 3FZQA 1NUHA 3C8UA 1HPLA 3V7UA 1YD7A 4UPEA 4LDNA 4CKYA 4XWWA 4HYYA 2I71A 2G09A 2IHBA 3H1PA 3WLEA 5BOSB 3IH5A 3MWFA 5E2AA 4X91A 3RUAA 1M2OB 4BFUA 5HE9A 4ZEWA 4PO8A 1XK6A 1TZKA 1EDZA 4ZOEA 3WHIA 1WWKA 1IPHA 5EXEA 4PCVA 3AWDA 2G80A 1H4QA 1ZOIA 3GJXC 2ZDGA 4FYKA 1BZYA 4Y3UA 4J2HA 3UAYA 3UHJA 1C4XA 3EQ6A 1N5JA 4QQKA 1KYIA 1NE2A 2IU0A 4RTOA 1WHTA 4IL5A 5LP6C 1S2DA 2HMYB 3BHJA 3DS8A 3ELBA 4FOLA 3WKEA 5KVCA 2Q4OA 3QKRB 4II3A 3VR4D 4BFCA 3INNA 4I9GA 4RZHA 3MAJA 3MYYA 4LOIA 5BV1A 5ECGC 1NN5A 5AVTA 3SWWA 2FFHA 2PGOA 3AINA 4GZ5A 4J0CA 2D4HA 2G5CA 3Q7EA 4CHGA 1FFWA 2IX9A 2RBKA 3PBKA 4QBKA 4ARUA 1GTJ1 1QGED 1NPYA 1QTRA 1WVIA 2D5CA 2C2XA 3ZY2A 5JNSA 3PLAE 3MOGA 4FKZA 3F1LA 1F14A 2AQKA 2K6GA 1QU2A 3FKQA 3PFBA 4PGGA 5AP9A 2K7ZA 1Q1AA 1C9JA 1MCZA 2QLLA 3PK0A 4FW9A 4MJ7A 1PYGA 1UINA 3KOWA 1FB5A 5EJGA 1KL7A 5I7UA 3LYAA 1SC9A 3HL4A 4EARA 3NV7A 4OXYA 4PYIA 5D3QA 4CG2A 4US0R 1AF4A 3FVRA 1RJWA 3BG5A 4B6PA 1IN5A 3HSKA 1Y6JA 3PGLA 3OPNA 4GNRA 4QDJA 2GO1A 1CIVA 2CB9A 5B58C 1O95A 1S2IA 3E22B 4CCWA 1LDGA 2G5GX 3DEFA 3G0HA 1AGNA 2P9TA 4FZ5A 3BIWA 3UUGA 1MB3A 4X3OA 3EXEA 2PYDA 3KKZA 4I55B 1GL9B 4HLUC 4WLFA 3T4EA 4RTPA 2GJKA 5ECWA 1RWBA 1NC3A 1Z08A 4PC7A 1QO7A 2YN0A 5EIBD 3SNKA 2OQRA 4FHEA 1YBMA 4JI6B 4FNOA 2FN8A 1P7WA 2NPIA 4S2EA 2WF7A 4M8KA 1OASA 4E70A 1HC7A 2CKMA 3LPCA 4IY1A 1SKYE 1VBNA 2PYIA 2WE7A 1TJYA 2D1QA 2JCGA 2QM3A 2WIGA 2C2MA 3LUGA 5EMNA 2O8CB 3RKRA 4DWWA 1E4OA 3JYPA 3MWYW 1OBVA 1O7JA 2WAAA 5M5BA 2X41A 1EJ0A 4HRVA 4WIAA