5E8JA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with ram
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
b'SRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
molecule tags Translation
source organism Homo sapiens
publication title Molecular basis of RNA guanine-7 methyltransferase (RNMT) activation by RAM.
pubmed doi rcsb
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5e8jA00
4X41A 3FTCA 3A25A 5HZMA 4QQKA 1VBFA 3HVJA 1BC5A 3C6MA 1BKYA 1ZGJA 3F4KA 3HP7A 3KPUA 5EZQA 4CTKA 4DZRA 2OXTA 4YUWA 5G02A 4RTOA 1H1DA 4MWZA 5D1HA 5DTQA 1FBNA 5CVDA 2HNKA 2ZZKA 4M7RA 2ZZNA 2P7IA 3C3PA 5EZSA 3T7RA 2ZULA 4RTSA 5EGSA 3GJYA 4KIFA 5EVJA 1SKMA 3EVZA 4RTQA 1O54A 5CCBA 3KQOA 1WG8A 3UJCA 4IWNA 3JWGA 3NWEA 3OE4A 1JG3A 2AOXA 1QAMA 2EG5A 1N7IA 2FHPA 1AQJA 2XVAA 1KP9A 5DPMA 1XDZA 3P9IA 5JUWA 3BZBA 2B2CA 5K0BA 1PRYA 5LQAA 3B89A 3LGAA 1I9GA 1QAQA 3ER8A 1D2HA 2OZVA 4A6EA 5DX1A 3LECA 4HH4A 3JWJA 3LBYA 1KYWA 1SG9A 4RVDA 1G8AA 1KHHA 4CTJA 2VDVE 2ZVJA 3E23A 3G2PA 3FPEA 2NXNA 2ZSUA 3M70A 3OU2A 5GIOE 1KR5A 2I7CA 2ZZMA 4OA8A 2VZ9A 3EGVA 4M38A 5E9WA 2PV0A 1MJFA 5E1OA 5GP1A 3DXZA 1X1CA 3I64A 2R3SA 1G8SA 4RWZA 3DULA 1I1NA 4DF3A 5HEKA 5EEGA 1R8YA 2ZFUA 4AZTA 4EKGA 5CVUA 3HCFA 2AVNA 2PX5A 3QV2A 1RI1A 1FPQA 1NW8A 1NBHA 1G6Q1 2PY6A 1RI5A 1ZGAA 2P8JA 3EMBA 1R6AA 2AOWA 1KPHA 4HTFB 2JG3A 3BGIA 4X63A 5K0FA 2AS0A 4JXJA 4AZVA 1JSZA 1UIRA 2CMGA 3OU6A 5T64A 4RTRA 3TPZA 1YFJA 3KQWA 1VL5A 4RVGA 3HCEA 2B9EA 2EFJA 2YR0A 2VP3A 3ANXA 4FR0A 2VDUE 2NXJA 4BP1A 5EKXA 4R05A 2QRVB 1N2XA 2CMHA 3K6RA 4E2ZA 3KQSA 2G72A 9MHTA 3M6WA 3NMUF 1NV8A 3P2EA 2H11A 4LWPA 2IGTA 4A6DA 3EEOA 2BR5A 2P3LA 3LX6A 1NW7A 4P58A 1BHJA 3LL7A 1P91A 1X1BA 2ZWAA 3NWBA 1YZHA 3OU7A 1XDUA 1L1EA 3FPFA 3MB5A 4HRAA 4R8RA 4E33A 1RJGA 3V97A 5KQRA 3SMQA 2NXEA 2Y1WA 4DKJA 5CVJA 4X61A 3FRHA 3LDGA 3HCCA 5M5BA 4C05A 4RVFA 2ZBQA 3R3HA 2GAFA 3PVCA 4QQNA 4QVGA 5EMJA 3VC2A 4PYMA 1XTPA 2AN5A 3GIWA 3P9CA 2ZLBA 1O9HA 1L3IA 2PT9A 1RI3A 3DXYA 3SVZA 1P1BA 5K05A 4RTMA 5ICEA 1RI2A 1G38A 5C0OE 2ONZA 3G2QA 1JR4A 2PGXA 5FULA 4F86A 4HGYA 5E2BA 4P7KA 2PX2A 3NTVA 4EKIA 2OY0A 5ERGB 1VPTA 5GIPE 3A7EA 1TPYA 2BH2A 4ER7A 2WA2A 2PXAA 2V74B 3IYLW 4C06A 1FJXA 4OBWA 4F84A 3KR1A 2E5WA 1FP1D 3LBFA 3PFHA 1M0EA 1L9KA 2K4MA 4FT4A 5E9QA 4OQEA 2UYOA 3HCDA 3A7DA 3KU1A 2C7OA 3AY0A 3PFGA 2YVLA 5U4XA 2UYQA 2JHPA 3OCJA 4ER3A 1ORIA 3OPNA 2YXLA 3KQYA 1R00A 1XCJA 3HTXA 3C6KA 3IEIA 5CVEA 4ER6A 4E2XA 3MHTA 3EGIA 1DUSA 5FUBA 3FTEA 4YV2A 4DM3A 2C7PA 1L3CA 2PX4A 1NKVA 2H00A 3SR4A 3LKDA 1ZQ9A 4C04A 3KR0A 2ERCA 5GM1A 5FADA 3THSA 3NW9A 4ER5A 2Z6AA 2ZW9A 1SUIA 1ZHFA 3FUWA 1I4WA 1KIAA 4NECA 4E2WA 2QE6A 3X0DA 3LCVB 4HC4A 2AZTA 1QZZA 3P2KA 1PJZA 2CWWA 3FPGA 2XBMA 3DR5A 5E9JA 4KIGA 3UBTA 3G5LA 4F85A 2PJDA 2PSSA 4ZTBA 5DXJA 3EMDA 3FPJA 3I5UA 2ZBPA 3HVIA 4BP3A 3I53A 1R8XA 3IV6A 2ADMA 4PGGA 1RJEA 3DXXA 4QDKA 2NP6A 3HA3A 4PONA 2YQZA 4R6WA 3SSNA 3PX2A 4IV8A 4IV0A 4PYIA 4M36A 5EHIA 4Y30A 2HMYB 5FQOA 1WZNA 4HSGA 2JHCA 2XYRA 3GRRA 3KPJA 5K0EA 2UZ4A 3MAGA 1D2CA 3BWCA 5C9ZA 3EVAA 4YUVA 5KYGA 2Z6UA 1RJFA 4CKCA 3UJDA 1AQIA 5CD1A 2N47A 3FZGA 3OFJA 1UWVA 4P7GA 3AWIA 5T6BA 1JQEA 3NDIA 4PYKA 5DM2A 4GOLD 3CC8A 1N7JA 1IM8A 5CM2Z 2OBFA 5EEHA 3CKKA 1SVUA 1T43A 1V39A 2P35A 2YTZA 3G7UA 3MCTA 3PX3A 4MIKA 1WY7A 3MCZA 5CVVA 4EK9A 3ERCA 5EKUA 5K0CA 3EGEA 4C08A 2IDJA 1UFKA 1X19A 3G2OA 2JHAA 2NYUA 2PWPA 3MGGA 2IP2A 3A4TA 3TKAA 1EQAA 1P1CA 1YF3A 8MHTA 2PVCA 3P71T 4MTLA 3C0KA 4QTUB 4U7PB 2AOTB 3R6TA 2Y1XA 4C4AA 4EQZA 1ZG3A 3EVEA 3AJDA 2OO3A 2C7RA 3KKZA 3ME5A 5T67A 4EVIA 3KQTA 3DUWA 3CJTA 3GRZA 4KW7A 5IH3A 4DCGA 3PB3A 4R8SA 3BT7A 3BXOA 3HM2A 2GB4A 3OZSA 1EG2A 3EVCA 2GPYA 3DH0A 3GRVA 5H02A 5K0JA 3KQMA 5HIJA 1M6EX 2OB1A 3E7PA 3LKZA 5E8RA 1SUSA 3SM3A 5BXYA 4OQDA 2I9KA 5LR6A 2JJQA 4ATNA 2FYTA 3PTAA 5DRTA 2QM3A 2PBFA 3FTFA 5DTMA 3KPWA 1JSXA 5DTRA 5IKMA 4CWAA 2P1DA 4GC5A 2WA1A 2G71A 3MTIA 4MQ4A 4QTTB 4XUEA 1YFLA 3Q87B 3GRUA 3UJ8A 1VP3A 4HTFA 3REOA 1QAOA 3TQSA 4E30A 4LG1A 4ER0A 3RW9A 2IBTA 1WS6A 7MHTA 2FPOA 3ELYA 2O0LA 3ELDA 3ELWA 4PINA 5CIYA 2IH2A 5K01A 2P41A 4AZSA 4RV9A 4BLUA 3R9XB 4DMGA 4FT2A 4PYOA 4V0RA 5DSXA 5LQCA 3P97A 4BY9E 4U7TB 2B3TA 5FCDA 3P2IA 4PIPA 4GOOD 3DLCA 3FUTA 4PYNA 1JQDA 1ZKDA 4GBED 1KPIA 5FWAA 5HIKA 3NDJA 2EX4A 3HVKA 3M4XA 4RYLA 3T7SA 1HNNA 2IH4A 3UJ9A 2XYVA 3UA3A 3EVFA 3WSTA 4RTLA 2GH1A 1KPGA 1EIZA 4GF5A 3ER9A 3EVDA 3G88A 3KQVA 3BGDA 5MHTA 2AR0A 2G70A 5F2OA 3FUVA 3PS9A 4KDRA 1G55A 2B78A 2ZWVA 3ID6C 3LSTA 3P9NA 3KR9A 2PXCA 5K09A 2HR1A 2BZGA 3R24A 5GWXA 3DMGA 4DCMA 4G56A 3SXJA 3QOWA 5HILA 3GGDA 1EJ6A 1EAMA 1AV6A 4CKEA 4OX9Y 1RI4A 1BOOA 4MHTA 2G1PA 2HTEA 5BP7A 3GDHA 2QRVA 2BR4A 3DOUA 5CUQA 3B3FA 4FSXA 2AOVA 4OBXA 5HOQA 5EMMA 3SGLA 3TR6A 4RTJA 4PYLA 3LCCA 2EJTA 4KRGA 4K6MA 2OKCA 4M37A 2C7QA 3KR2A 2IPXA 3AXSA 3E05A 2BM8A 3KPYA 3MTEA 1IXKA 1JG2A 3AXTA 3DMHA 3P9KA 4RSRA 2GS9A 2LD4A 3B3JA 5KS2A 4E2YA 5ICGA 1Z3CA 2NNWB 5EG5A 5FA8A 4CKBA 2Z6QA 4LECA 2Q41A 4YV1A 5D1NA 1VIDA 3FRIA 3FYDA 3I9FA 3OZRA 1NBIA 4RX1A 3HCBA 2AN3A 1B42A 4YV0A 5CCXA 5EHGA 2DULA 3G8AA 1YUBA 4RVHA 1MHTA 4WVLA 4Y2HA 2ZCJA 5DXAA 4XCXA 3FUXA 2BM9A 2VDWA 4XUCA 4AX8A 2XYQA 4FGZA 2NP7A 5LQKA 2IDKA 5K8VA 4PIMA 2JH9A 2FK8A 4YUZA 4KVZA 2OB2A 3EVGA 3LHDA 3S68A 4XUDA 4X1OA 1HMYA 1L3BA 4PCAA 5DM1A 5DLYA 3TOSA 3UZUA 3HA5A 4PYQA 1AF7A 5KQSA 3M6VA 2GA9A 1JG4A 2I62A 3FYCA 5FHQA 3FTDA 3EVBA 2YXEA 1VE3A 1VP9A 3GNLA 3BGVA 2AVDA 3B7PA 2PT6A 2VS1A 4GC9A 1NV9A 3TFWA 2AOTA 1O9GA 3PLAE 3VC1A 1M6YA 3UJ7A 5F2KA 2O06A 3RODA 5LSAA 3M6UA 5DX0A 3P8ZA 3TRKA 4QDJA 1Q0TA 3CGGA 5HFJA 3OFKA 5LQNA 1NW5A 3FUUA 1XJ5A 1TW2A 5FA5A 4C07A 3HA7A 2IIPA 2HWKA 3JWIA 3VYWA 4X60A 10MHA 5EOVA 3U81A 1SQGA 2QY6A 2I6GA 3DP7A 3TMAA 2H1RA 4YMGA 4PGHA 3BWMA 1TW3A 3GU3A 3GO4A 4YUXA 1JTEA 3G8BA 4DQ0A 3K0BA 2IFTA 5DRYA 4OA5A 3HCAA 1U2ZA 4YUYA 4Z2YA 2P7HA 1XDSA 4O29A 2FK7A 5LQRA 3UFBA 1X1DA 2AN4A 3GRYA 3MERA 1X1AA 3TM5A 4BLWA 2O57A 3I58A 1DCTA 2CKDA 4LWOA 1EJ0A 3CVOA 2P3OA 4R6XA 3PT9A 4IKPA 3M33A 3LDFA 2PXXA 2P40A 2CL5A 5C1IA 3FPHA 3EPPA 4FSDA 3B5IA 1NE2A 4H0NA 5K0GA 5ICCA 3G89A 3MQ2A 3DLIA 3M6XA 1NT2A 2AOUA 3D2LA 5LQUA 5EQJB 5K03A 1XVAA 3LPMA 4P7FA 3UJ6A 1P39A 1RJDA 2ZIEA 4GOMD 2YXDA 1QANA 3H2BA 2FCAA 3HNRA 3JWHA 4KDCA 5ICFA 3GWZA 3T0IA 2NXCA 4YMHA 2IH5A 1F38A 5GM2A 2P3QA 3KQPA 4C03A 3KQQA 4QPPA 3UJBA 4AUKA 3CJRA 5HIMA 3BKXA 4P7JA 5DT2A 2O05A 4UOEA 5E1DA 4PYJA 3CCFA 3KPVA 3LCUA 1IY9A 1XCLA 1Y8CA 2ZIFA 3BKWA 2HV9A 5DWQA 3SSMA 4DA4A 4QPNA 1YZ3A 2V7EA 2PKWA 3Q7EA 3KHKA 5K0LA 1QYRA 4AZWA 5FQNA 4GOND 1FP2A 2OPBA 3BWBA 1JTFA 3LDUA 2ZIGA 4QVKA 3TM4A 1XXLA 2O07A 3ELUA 1Q0SA 3OZTA 3R0QA 5DM4A 4BLVA 5JR3A 3UA4A 5FTWA 3ORHA 3NVKI 4V0QA 1F3LA 4FP9A 3E8SA 2B25A 1R74A 2BR3A 3DMFA 1JQ3A 3HEMA 5GOZA 3A26A 1D2GA 4EMSA 5DM0A 4POOA 2DPMA 1NW6A 1WXXA 2EJUA 4GQBA 4FS8A 4GEKA 3NJRA 4PNEA 2ESRA 3T7TA 1ORHA 5DSTA 3UJAA 4E70A 4RTKA 3GXOA 5GINE 5BW4A 5K0NA 5HIIA 5EC8A 1INLA 2IBSA 3C3YA 2UYCA 2GLUA 2R6ZA 2G8NA 2KW5A 3OE5A 5F2NA 2PX8A 3THRA 1G60A 4E32A 3L8DA 3TLJA 3DTNA 2FRXA 4WXHA 2ONYA 3GCZA 4CXMA 1VLMA 5EPEA 4B17A 1VQ1A 3NVMB 2AOUB 2A14A 1OR8A 5E2AA 2WK1A 5E1BA 3G5TA 4E31A 3QOXA 5EIFA 3O4FA 3HVHA 4GUAA 4PWYA 2JH8A 2YX1A 5BW5A 5KVAA 3CJQA 3O7WA 1WXWA 2PLWA 3A27A 3O31A 4HG2A 4ISCA 4PCLA 4FZVA 5EMLA 4HGZA 1YB2A 3UWPA 2OYRA 5FWDA 2QYOA 3CBGA 1DL5A 3TKYA 1JG1A 2ZBRA 5EIWA 3V8VA 1R18A 2ORED 2F8LA 4L7VA 5E1MA 2ZTHA 5E8JA 3VSEA 1KYZA 1SQFA 4KWCA 2UYHA 2PWYA 3G2MA 3RIEA 3SX0A 1NW3A 1KXZA 2YUIA 3BWYA 4RTPA 5LQJA 3SSOA 5DX8A 5FHRA 5P8WA 4RTNA 3B3GA 5B1SA 3EEYA 3IHTA 2XVMA 3BUSA 5EMKA
chains in the Genus database with same CATH superfamily
1RU3A 2XWBF 3QGMA 2VATA 3PUKA 4J9UE 5MFZA 3GGPA 5C32A 2AYXA 4YCAA 2CZGA 3UG7A 1B0PA 2XGSA 2ZIZA 2ZU6A 4XIYA 5LBUA 1QLWA 5G4LA 4YRRA 3THXB 2PM8A 2X40A 3B2QA 3OOEA 1J8YF 1TT7A 2XA9A 1FVXA 4U1RA 1SNYA 1U02A 5CVDA 2HNKA 2XT6A 2I4TA 2OCYC 2CHQA 1LDEA 4BVEA 5EGSA 3V33A 5A3JA 3PGKA 1B6SA 3O9VA 3PDHA 1HQKA 3K09C 4Y0VA 1X7XA 3GUYA 1IN1A 4HUTA 5IN5A 4LRSB 3P52A 4J1TA 3MZ0A 1NMYA 3NBUA 4V1CI 5FTLA 4OY3A 1N7IA 4M9UA 2MSLA 1QB7A 2GJ9A 2ZITA 1GZ5A 4UBJA 1A8HA 1QAQA 3AHEA 1AKYA 2ADFA 2PAFA 2W4QA 4M0PA 2OYSA 2DRIA 3K8YA 3QUCA 1XN4A 4BO6A 4Q4JB 2IP1A 3ZE0B 2Z1NA 3ASYA 3ZG6A 4C76A 4IWXA 1E2EA 3O75A 2AXEA 5J43A 2HWXA 3LW7A 1N6NA 2XNKA 5HM6A 3NHWA 3RBVA 4Y9DA 2DPLA 3T4XA 3EGVA 1IEXA 4D0GA 4GPEA 3COWA 3V7WA 1T36B 2Y1OA 1OLSB 2J0VA 2H4ZA 1WEKA 1F1JA 3M4JA 3GNSA 4LC1A 3DULA 3GLHA 5FWXB 3NORA 1HFJA 4XPIA 4LGCA 1ELOA 4MV5A 2QRHA 3SEAA 5KNBD 4CWAA 1F7UA 4HDKA 4IQGA 4I3HA 3LDHA 1SIUA 1V4VA 3HXLA 4G8JA 5BYBA 1E89A 2XIJA 2G9UA 4PS1A 5AQEA 3KQWA 3WIBA 1VL5A 3N2KA 4DMFA 3I62A 4C7VA 1MB4A 5F1OA 1V4NA 2Q5JA 1MIOB 3ANXA 4Z6KA 4AJPA 4RAOA 4PSDA 3K0CC 3MXOA 4BP1A 3WNCA 4BFWA 2HOQA 3UW1A 1X1RA 2WJVA 4PC6A 3OTHA 1HZZC 1PJ2A 4P84A 4DDWA 3AHJA 4YQFA 3E5NA 1LSOA 4LCJA 2XZTA 2ODNA 1EGVB 3OBBA 3ZNPA 1N77A 2GK3A 4S2UA 3AG5A 1ZISA 3HCNA 4Q3CA 3E61A 4URUR 1P91A 2ZWAA 2J3IA 4HDNA 4CU5A 1U31A 4U39A 1S0UA 2QTGA 3O9ZA 3SMQA 1ULBA 2WE8A 3TN7A 1ACLA 2B34A 2XLBA 4JMPA 1K7XB 5ECDA 3EXG1 2HJ9A 4JT2A 5DHRA 3FMGA 1YB4A 2BCJQ 3FRHA 3IMGA 4L95C 1OH6A 2HW8A 1O0SA 2OBBA 3I5XA 1ODIA 4AKGA 1FFBA 1MIHA 3OM1A 4M54A 4DMRA 2CC2A 5ISMA 4RADA 1B8NA 1KVUA 3HBFA 2BSXA 4KIUA 3SQDA 2WB2A 4WZBE 1DBVO 1NIPA 1U1IA 1XVVA 4F86A 4XR9A 3HDJA 1PV4A 3ICPA 4WWHA 4OL9A 2GZMA 5DNWA 3F0TA 2YFHA 4O2BB 2G9QA 5ALNA 1R6UA 2ZCVA 3RC1A 2X8JA 2IHKA 4JR0A 1RBZA 4IF4A 1GSHA 4W8HA 1R0KA 2I3AA 4FT4A 5E7JA 3BN3A 4Q02A 5J5CA 3A7DA 5LQDA 1FW6A 3BTVA 2NGRA 4KLZA 2AI2A 3QG1A 1A97A 2KS6A 3A4LA 4RDCA 2JS7A 1N2HA 1SVKA 3UN1A 4CW7A 2DZDA 1JR3E 2F3PA 3G8CA 4ZANA 3MS4A 3RUAA 4IQ4A 2H0RA 3AZQA 4QO8A 1OZ0A 5JPDA 3L43A 2Z98A 3MHTA 2ZQYA 1M2NA 1WHSB 3DB1A 1LPAB 1GYRA 1W34A 2CY0A 3HDHA 3R40A 4UU8A 3SR4A 2OC4A 1R64A 4UHCA 1KJ9A 1ZM2A 2ZB8A 3NDRA 4TXMA 4FE3A 5FADA 1NBME 3SQLA 4DIOA 3L0PA 3H1PA 4ZEXA 1M54A 1Q77A 2X8WA 1ZC4A 5J3JA 3E4DA 3OMWA 2I4NA 2DG2A 4S2EA 1N25A 1SQ0A 3L05A 4TXJA 4EELA 2VHCA 4ZOAA 4Q03A 2GZ2A 3K9QO 3BSSA 4L22A 4DBLE 1KYTA 1TK9A 4ZTBA 1GQSA 3FHCB 2GKGA 5DXJA 1I3LA 4QHTA 4UVGA 1GLVA 3QXGA 2D3TA 4H3SA 4K5QA 2YY6A 5IVDA 3IV6A 5C5IA 3U7FB 4D0RA 1EBUA 3O4HA 5D6NA 3NG1A 1PQYA 2WWGA 3DEZA 2YQZA 4JP5A 3RHFA 1CUCA 2V8BA 1XFDA 4LW8A 1EUYA 5TJ9A 2NSYA 3OTWA 4IDAA 2QZJA 1GY8A 2HMYB 1TQ8A 5DI3B 2C8KA 4FI3F 4L5IA 1MZVA 1A50B 3MAGA 1PL0A 3QE3A 1TEXA 3HWX1 3KJFA 4OYHA 1QE5A 1JPVA 1N2EA 4C30A 5KYGA 4L08A 1J7JA 2NQ8A 3UHFA 2OLJA 2ZYSA 3BPSA 3SHTA 3FCSB 4PYKA 2TSYB 3CC8A 3D6AA 3S1SA 2VHQA 4EPXA 1RC0A 1BHSA 4BNYA 3IQIX 3Q88A 3D2AA 4TKLA 3D3KA 1PNQA 2MMCA 2GBPA 3MCZA 2WG0A 4CL3A 5K0CA 1Y9DA 5ALUA 1VGQA 2IDJA 1CJUC 2H0AA 3STTA 2ASVA 1UPAA 3CMCO 3MQFA 4KWEA 2QM0A 3JQFA 2D4HA 4PANA 2IYUA 3L7KA 2Y1XA 1XK6A 2ZI5A 2YRWA 1W5BA 1M6WA 3B9PA 4KW7A 2DBRA 5KS2A 3MWKA 1CF4A 3KSAC 4F4FA 1Y6JA 2PT5A 1JPNA 4Z0PA 1PDWA 2OZPA 3VU3A 2FU5C 1KO1A 1HI9A 4RAQA 3IESA 4LHZA 5K2OA 3TW0A 2CJWB 3JSXA 2V0CA 2OHHA 2OV4A 4YMWA 4TT3D 4K6CA 5DRTA 1FYDA 1SFRA 1II8B 5DTRA 2H2FA 3GLGA 2O3SA 2NO6A 4J2OA 4CM4A 4YYZA 1QZXA 4QEZA 4CCYB 3ABZA 1RYHA 1GQRA 2K2QB 2OSBA 4G63A 1P0MA 2XXJA 5G3YA 1LCIA 1E1YA 5F9MA 1KRXA 4HMOA 3D54D 2Q3BA 4QBFA 1MC1A 3KAJA 1LNZA 4EECA 5J2UF 1DUIA 1FMCA 3KKLA 4B4KA 3VNVA 1M34B 2HSGA 4XDZA 4UHKA 2GMWA 4QYXA 4RD3A 2R84A 4YO7A 2I2XB 3OFVA 4FN5A 3G0DA 2MINB 3TQHA 3KQLA 3DLCA 2PGIA 5E3JA 1BDIA 1Z2DA 1AXRA 1EFRD 1L6RA 3QG5A 1NKSA 2W48A 2CD7A 4UE6A 3UUGA 1HC7A 1GLNA 3F5DA 4RHYA 4EMBA 2HZ7A 4KPUB 4KWTA 2PGOA 3FYUA 3PGA1 4RTLA 1H23A 2GH1A 2O4UX 3E4CA 3H13A 1N1MA 3R20A 4G23A 4ND6A 4FCTA 2V96A 3TTYA 3LXRA 4KCGA 1NXXA 2I65A 3QPBA 1G291 2W4IA 4EYSA 5MHTA 4MLZA 1Z0DA 1I13A 3KR9A 2FQYA 4A1OA 2RI1A 3B38A 3HYCA 1T3GA 2YVAA 3H3XA 1THGA 3R9KA 3STUA 1L4YA 3VHXB 5JJKA 3TE6A 1NVUQ 2AH5A 1ENYA 1Y9JA 4D9IA 4MHTA 2XF2A 1VE9A 3BORA 4F9EA 2XUDA 1SXQA 3CTPA 1JYEA 1PG5A 1JWAB 1AKVA 3D6HA 1TU3A 1IM5A 3QVKA 3HQ4O 3EYAA 4ZT3A 3V4VB 4DDTA 2K87A 5DTJA 3BWVA 3LCCA 4LZWA 2C2XA 2WHRA 3M4ZA 3Q5EA 2OKCA 4M37A 4UXHA 4XJSA 2FN3A 2JIDA 3P9KA 5EE0A 5FNVB 3EXFA 7GPBA 1I6WA 4E2YA 5ICGA 5I01A 2QLBA 3NZEA 2HGSA 2Q41A 4WD3A 5M34A 4AKIA 1RJ9A 2XY4A 3FYDA 1VLVA 3OM8A 1JIQA 3QW2A 3LLVA 1G7RA 2E1RA 1DXQA 3L07A 1Z3IX 3DMDA 3KT6A 1SIBE 4CKBB 3OSUA 2IXEA 1XELA 1EHYA 2C1EA 1N8NA 1U3DA 4MXDA 1SCKA 5ED4A 2OR3A 1I5OA 1QFJA 1BN7A 4LXXA 5I48A 3ILHA 5ALGA 2XNDD 1BN6A 2IDKA 3ND6A 1H0RA 2HBRA 3VR2A 1C3EA 1T0JB 1VG8A 4YRAA 4V1CA 1GTMA 1S2NA 3MAJA 3E7DA 2OCPA 4ZU3A 1L1RA 1N2JA 1YB5A 1N2CB 2GXUA 4FMPA 4IG9A 2OXCA 5LWHA 3LTEA 2WFMA 421PA 2OO5C 3CIFA 4URWR 2RI6A 1C9MA 3IIKA 1VE3A 3U09A 1XMXA 2GHIA 1J9EA 1K06A 2HFJA 3WY9A 5AM3A 1O9GA 1PGNA 2CGEA 3QEMA 2RBEA 2HFKA 5AKKA 5ADUS 1IJKA 4IYRA 1SCUA 3KUUA 2CVOA 4W4TA 2C2OA 2N1MA 1YE8A 3CLRC 1D6MA 1SCDA 4M3NA 3RODA 4BN0A 4JDUA 5BSFA 2C9ZA 4S24A 3IURA 1VLJA 3AL3A 3DG9A 13PKA 1AKTA 1SRQA 4L8WB 1M5RA 3FUUA 3W4KA 2C8LA 5IJ0B 1ONOA 2PS0A 4I8XA 1U4OA 3N2LA 4UKDA 3S2EA 4AMZA 4NCKA 1IVNA 3MCVA 4W5HA 2YDXA 2QYSA 3W5AA 1TPZA 1TW3A 5DLQC 1GAEO 3DGEC 4IH1A 3K0BA 5HF8A 4EPWA 2H16A 3K8ZA 5A5FA 3GDFA 5EJ9A 3WX0A 1T5HX 4M0EA 4NV0A 1JIXA 1T91A 2EFGA 4DG5A 2GEVA 1UZAA 3JD2A 4E3ZA 2PZ8A 4HFJA 1L5RA 1OTXA 4JH0A 4X6LA 2ZAYA 4CETA 1GG9A 1FZTA 5KHLB 4CNBA 1XEXA 3RC3A 3TTVA 4FVTA 5C1IA 1DDGA 2XTAA 1ZESA 5IX8A 4DA8A 1FYWA 3KT3A 1JGTA 1B8UA 1Z7BA 2Y4NA 1AT1A 4ANFA 1IG3A 4OLAA 5CYOA 5K0GA 5KOHA 3A6DA 5EZ6B 5KAMA 3SS8A 2RH4A 4IS3A 4OXKA 3ZE8A 4KGDA 4XGKA 5CCEA 1UXHA 4KACA 1DG9A 1OTYA 2YWEA 4HRVA 4TTIA 5AVJA 4NBTA 1P1JA 2FF7A 3DBRA 1XVAA 3GEHA 1U7ZA 4K3VA 1EP3B 1QNFA 3AHIA 5IYZA 1KOLA 2B4YA 3CX8A 3OZDA 2NIPA 4LA4A 1S2DA 3KT0A 1ZC3A 3P2YA 4ZKDA 3GLGE 3Q7QA 3W0LB 1XRJA 1SBCA 1VSUA 3Q0EA 5AJUA 1ULAA 3C7AA 2XYHA 1QGUB 4AULA 4HNUA 1QTIA 4QQ8A 4AJKA 2D2VA 5BNTA 5JY1A 5L3ZA 3PR1A 5KJFA 2IPLA 4QPNA 2AKAB 3PQDA 4F72A 4TPKA 4TZKA 1OE0A 4UARA 4X1YB 3K0EA 4Q9NA 2VJPA 1WOYA 2IX9A 4FGKA 1TM2A 4OQLA 3CZ9A 1LBSA 2HJSA 3V5NA 4MW7A 1JEOA 2Q3HA 3DTTA 5JYDA 2EP8A 3QU5A 4MS3A 1G20A 4LYHA 4BO7A 3NJ8A 2ZIGA 1R0ZA 4LTDA 1Q7CA 4NCNA 3GD7A 5EJ4A 2O07A 3OG9A 4PQYA 3R77A 3ZGYA 3CNHA 3BH7A 3OIWA 4G24A 4OI4A 2HXYA 3B78A 2FFAA 1VKRA 1POWA 2BR3A 3SZMA 2Q1SA 3BZWA 1EEXB 4P38A 4R5MA 4B31A 1H4TA 1KY5A 3H5RA 4B76A 3TRJA 1OB5A 2YL2A 3IT0A 1X1QA 4J90A 1PX0A 2FEAA 2WU1A 1TF2A 3B60A 3CNLA 3CRW1 3DKVA 3N74A 4JLDA 4AMBA 1M75A 4UM9B 4AG6A 2NUTA 4KOEC 4OK5A 2VTBB 1XPJA 4KN5A 4TVOA 3QX7A 2ZT7A 4PGFA 4RFSA 3VH2A 4B43A 2E4ZA 3ZUPA 3U7IA 1FP7A 5K0SA 5ALJA 5TT1A 4LN1A 1G5FA 2JI9A 1NBEA 3LG2A 4V0OA 3ROTA 5E9AA 3D3WA 4E32A 1ENZA 1H42A 1VLMA 1NPDA 2V45A 3M5PA 4OGGA 2WNIA 3PPIA 4B17A 3TZHA 3QFCA 2VJCA 4MTCA 4CGZA 4XX0A 4OU5A 1IQRA 4IJ5A 4Q47A 4E31A 2VCYA 4RJTA 4JIGA 5AJZA 4PRZA 4ZJUA 3ZHTA 1U65A 4KR3A 1WXWA 2PLWA 4XB6B 1KS2A 4UM8B 4WN9B 3W5IA 5IAGA 5BVHB 2IVZA 3LF1A 1DIOB 2PQMA 4PR0A 1T35A 1XEFA 4C89A 1VJGA 2JD1A 3O4VA 3SVTA 2ZBRA 4ZEMA 3SDBA 1BNCA 4NYMR 4C4XA 2F8LA 4BMOB 4BO1A 2H4WA 4KO2S 4Y2XA 1WF3A 4I8DA 2B61A 1U1GA 1E3QA 2D5CA 4HSEA 1I0ZA 4OG2A 4RGVA 3RIEA 5KDOA 4LC9A 2YXBA 1RZUA 3IUJA 4DREA 2XVMA 1J56A 1D1PA 1TLTA 3RSQA 3FWKA 2RGCA 1XZMA 1SWVA 2ID9A 4ZCQA 2V9ZA 2VJDA 1USVA 4EAAA 3KEMA 4RH1A 4KQJA 2C2GA 2CFRA 2CXXA 1ZSVA 3VPAA 4GYKA 4CIDA 3GLFE 5AFSA 1LS1A 2P75A 1I2AA 3L0IB 3Q6MA 3OETA 2GVZC 2DUNA 2QUBA 2X2FA 1JAHA 2CUTA 4Y1RA 3SXUA 2ZVDA 2GKOA 3O91A 3DZJA 1QKKA 3FFWA 4LJ6A 4ZCMA 2ZAOA 1HKUA 1ES9A 3C3JA 4JL8A 4P2GA 2HQSA 1N36B 1GL7A 2EG5A 1U9JA 4QM6A 5JNSA 4RF2A 5DBIA 4DTCA 1MMFB 4PAGA 3EH2A 1YCHA 1Q3KA 1R4NB 1Z4PX 4PZEA 4V02A 5FYDA 4JL5A 3IPAA 4WLNA 3OTOB 4MRNA 4TKUA 2Q3DA 3MRVA 3HYSA 4O25A 2YY7A 1M10A 2O23A 1CEXA 2P65A 3P0IA 2XCOA 4L4ZA 4UMFA 4CM9A 2X8AA 4JQZA 4ARZA 4BLPA 3DYBA 2GCOB 3UXYA 1PL8A 3EG5A 4NBVA 3MMPA 1G8SA 3PHLA 3VI4B 1TIKA 3PKIA 3QTLA 2YWBA 3CKLA 3HNOA 1CW2B 3Q0IA 1E6EA 1GN9A 1ZI8A 2FOXA 4RFVA 1TQHA 4DAOA 1REQB 5AK0A 3LUBA 4B6PA 3EZLA 2JFYA 1GFIA 3HCFA 2BRUA 5ALXA 3T12A 4EUHA 3H5VA 2W6OA 1RRVA 1G6Q1 1DIAA 3FKSD 4LNUA 5IDYA 3RYCA 3OQHA 2TMGA 3UAVA 3V3TA 1E8DA 1O6GA 4G86A 1QCCA 1VLZA 2JA2A 2XD4A 2WYHA 4WZ6A 1RLOA 3VNAA 3H19A 2JANA 5FNVA 3E22B 3TPZA 3PDCA 1XNRB 2BBTA 1ISSA 3QF4B 4WLOA 1EJBA 1IBSA 1FTGA 1NJ8A 2VUUA 5KVCA 4DV1B 3U4QA 2FFQA 4AAYA 2HJVA 2R5WA 4CDMA 2ZR7A 4NDAA 4HVAA 1E3EA 2G72A 3OE1A 3NMUF 1TF7A 1MT0A 3DR3A 3LQ4A 4LWPA 4MRMB 4WZBB 5KVQA 5CFPA 5GADl 3KAPA 1ESNA 2P3LA 2OGTA 2IYWA 1TM3E 2C3PA 4FGWA 3LL7A 1A7UA 3D4NA 2AXQA 5G1NA 1NVFA 3HUDA 4AZ3B 4QSHA 3HBMA 2CF6A 1EK1A 4UM7A 5CVJA 1QHGA 1I2ZA 4ZT2A 1E3DA 3PQ8A 2PL3A 1N0VC 3HFSA 2Z8YM 4E3WA 1NVXQ 3LDGA 1LTHR 2J7KA 4W7HA 1JHZA 2VYNA 1S89A 3BRCA 1W5SA 3G2LA 3TXXA 4E21A 1APBA 1BFKA 3AVOA 3G1WA 3IGFA 1CDOA 4EY7A 1D4FA 2XKAA 3QHQA 2QN9A 2WTUA 4CG1A 4E94A 4RDHA 3NC1C 4CI0B 1HDYA 5FIUA 5EHXA 3WGNA 5LMNB 1M2OB 1N2CE 2EX0A 4N39A 1ZX1A 1KDPA 2FZGA 5BQOA 1XRMA 2C5AA 4Z9YA 3NTVA 2EX1A 5CP8A 3TD2A 3V6LA 2JAHA 5LOVA 2C9YA 2RD2A 3SYLA 1W75A 5KYTA 3A7EA 2IBMA 3UWDA 4EY8A 3BC1A 2OPHA 1S6YA 1WU8A 4F84A 1NJ6A 1YL6A 3DBHA 5TQ0B 2PMCA 3N2YA 3A6FA 4W1RA 5DOVA 4OXQA 1EVKA 5H4HA 2PMBA 2PMKA 2CYBA 1BG6A 5AKIA 5E6SA 5IJAA 3H4IA 1JPUA 5CA1A 3ECCA 3TLEA 1X77A 3SFTA 4BUCA 3L7AA 4CCYA 1OGIA 1X80B 4H60A 4TL6A 4Z9FA 3ESBA 1VPDA 3MSCA 5EJAA 1KVRA 1SA0A 2PRKA 5CJJA 3RKSA 3UUFA 2JNWA 3UQZA 1OPRA 3H2ZA 1A5AB 5T3YA 2IHUA 1E7MA 1MAHA 1XKXA 2VYVD 1FDWA 2QVBA 1Z75A 4UPVA 2ZQ5A 1EDBA 2D0PB 2QGFA 3IEIA 1MV8A 1GGHA 3KLBA 1J23A 1UC8A 2O1SA 1CFJA 3K8QA 3KDPA 5JY6A 1F0PA 2B7LA 3KTDA 2VHZA 3FSGD 3H99A 1C14A 1ZQ9A 4H35A 5L8VA 1C8BA 2XBUA 4QBKA 4D2IA 3HABA 1GAWA 3H1TA 4ZAWA 2OCXA 3R75A 3CZPA 1XXHA 1P4HA 1H6AA 1SZJG 4HC4A 1NOKA 5JISA 5JQGA 1KYQA 1RM3A 4UTZA 3PUZA 1XMQB 2A67A 3K0SA 4RPJA 2B3DA 2WHPA 1WDLA 4C4PA 5KTRA 4HEQA 2CNBA 2O2CA 3I45A 1ARZA 4ZZIA 4MP6A 3OIDA 1GFZA 3I5UA 1RJWA 3L8YA 2PKYX 1D4AA 2QDKA 3KT8A 3TL6A 4Q7EA 5JCZA 3GQBA 4ZO6A 5A4MS 2L0XA 3K5HA 1WM1A 2PZBA 1Z73A 2BMAA 1EVYA 1AQUA 2PKXA 3BMCA 3C5HA 4IFIA 1WW2A 5G41A 4ZYXA 3V8NA 1N5LA 4XFDA 1S2MA 3DKIA 4JEHA 5JFGA 3DUFA 3KJQA 3DBLB 2OFOA 1KJ8A 1RQRA 2R47A 3QU9A 3U4IA 4DEXA 1H2RS 5IVPA 4K7JA 1VE7A 3HB1A 3FZGA 3BFXA 3NT5A 1J06A 4LJKA 4OATA 5C80A 1N7JA 2IUSA 1XRSB 1JG7A 2BMWA 3IR5A 4JBNA 3PX3A 1OPXA 1A3CA 1RXYA 1SHZA 2PVSA 4GQAA 1X1SA 4NBUA 2DCMA 2B8WA 4UUQA 2ZUVA 1WCV1 4XYBA 5B37A 4B3BA 3FFAA 4MGHA 3G2OA 1X19A 4U3JA 3T0FA 1PWHA 2CHUA 3MGGA 2IHJA 1XT6A 1JHDA 2X6QA 3IODA 3TJZA 1V8DA 5ENVA 5CDHA 2VWPA 3R6TA 4DMMA 2Q7DA 3CLVA 1DARA 3N05A 3RVMA 3V55A 2HJWA 1IZYA 1D9XA 1GTZA 4G1FA 4IQ8A 4BNJA 4CG2A 2D5LA 5COBA 1M8GA 2QTHA 5DHSA 3BT7A 2GAIA 2Q3EA 2Y68A 1T0HB 2HY7A 3ZZUA 2Q2WA 1Y7IA 5FBKA 3C74A 4H3HB 5HIJA 3E7PA 1TI7A 4JOBA 3D1LA 1XTBA 3PNPA 4MB2A 2E2WA 3U13A 4YXWD 3QLVA 5LR6A 1Z39A 2Y2VA 1F14A 4KSYA 3TDNA 1A7JA 1QO0A 4MVJD 4IMRA 1CUDA 1L5FA 2Q07A 3CH5A 5IP5A 1DP4A 1U3CA 2PGJA 1SMKA 2IU4A 3FCOA 3MUNA 3MTIA 1H5UA 4UE3S 3SC3A 2FPSA 3KWLA 5K8UA 1YFLA 3ZGLA 1E2QA 4CUKA 4NNOA 1QAOA 4EO9A 1QIJA 4AK9A 3HRKA 4X94A 3P0EA 1EK2A 4K9PA 4AJ1A 4F4DA 1TM4E 4RVSA 3C85A 2OC9A 4FLEA 3QEBZ 3HKDA 5TS3A 4OYLA 2MSNA 3DKKA 4WJZA 1F8YA 5JJBA 3DA8A 3OLYA 2YIMA 5H70A 1IQ0A 1H8HD 2DFDA 2WMOB 3TIFA 1GLGA 4N0DA 5A6SB 4B3JA 2H4HA 2NZXA 5K45A 2BGKA 2GN1A 4M49A 4V0LA 1G8MA 3ITDA 1I4LD 2J46A 4F46A 3SLGA 4JI1B 3IOBA 3B20A 4ESVA 4JUBA 1NE7A 2C4UA 5ALZA 2WNSA 1A9ZA 4XJTA 5JXJA 3WLSA 1KC1A 2R7AA 2AR0A 1KI6A 2BJWA 3GVHA 3OVMA 3VR2D 1UZMA 2OMKA 3IUSA 4WKGA 1MW8X 1EUZA 1PS0A 3O1HB 3PD0A 1G5TA 4BZXA 1VB3A 2X19A 1U3WA 3NS7A 1BGXT 3UO8B 3Q8MA 1L5MA 2WR8A 4XIFA 1TJYA 5EP1A 1HYBA 1WHTB 1XO1A 1Z9BA 5H80A 2ZUCA 4BB6A 1ULUA 3LQRA 2AZDA 5HJ5A 1MN6A 1O95A 3O7MA 5G0VA 3B3FA 4FSXA 1BWQA 1QIEA 2AOVA 5TPWB 5K1ZA 4BJ5A 1SPBS 2PD4A 5KYWA 2NYRA 2KX7A 4TUYF 2HBYA 3PWTA 1TVMA 1PV1A 1VPEA 2G3YA 2VHXA 4KRGA 4NEQA 3E9DA 3TPCA 1R0WA 3MTEA 1JG2A 3OHSX 1VCHA 2PZLA 4B6RA 1I30A 1D0VA 5AT1A 4JSYA 1SC4A 2NN3C 4L0CA 1NX9A 5FA8A 5B1IA 4BHTA 5HUJA 3AEKA 1JJAA 4Y9RA 2Z6QA 4BP8A 2A57A 3VR4A 5EINA 5BQFA 1GPYA 4FHGA 2XSZA 2HADA 3IH5A 4AJIA 2JGJA 4N6GA 4BPBA 1DS6A 3SR0A 3JZMA 1OBVA 1G98A 1UBKS 1B42A 4HB2A 2NO4A 4IP0A 3LC1O 5LM3A 5F78A 1YUBA 4D9BA 1NU8A 1KOFA 2P11A 1MHTA 2YYYA 3MTDA 4CM4B 1MU0A 2PWZA 5FV4A 4PZZA 2O7VA 3BE5A 4KNVA 4TMYA 5F7ZA 3QVXA 5B53A 3W5HA 3WLTA 4AW9A 5K8VA 5KNDA 1SK9A 1W2GA 5DK4A 2QENA 2VJMB 4KVZA 5JZ9A 1DIBA 3FDJA 1EGMB 3RUHA 4O2BF 3RHSA 4UAUA 5HPYB 2QZ4A 2YCLA 1VIAA 1CT9A 4PAQA 4WK4B 1EK5A 1MDFA 2XSZD 4JGGA 3FYCA 5ALOA 3DHWC 3N2GA 2PA3A 3RS5A 4AIIA 1B3RA 3CWZA 1Y5MA 3MFYA 3ORSA 2NPIA 2PT6A 2ENUA 2QRZA 3I83A 4MWDA 1W35A 3U44B 3DLTA 1FBTA 4RXMA 1PFQA 1WKCA 2XR1A 4FTWA 4O4LA 2ZJBA 3VPHA 3H9GA 4HDOB 1AHNA 1UANA 4TUYB 4F5DA 2VNAA 4M8IA 2K5UA 4JI3B 1XQVA 2QVZX 4L3VA 4JXKA 3ZCRA 2W6ID 3ZY4A 5HFJA 5LB4A 4O4IB 1H69A 4JLKA 4R84A 4ASUD 1L8QA 4HNGA 4S05A 1WW3A 2XDWA 3VM6A 2H48A 3QVJA 1DC8A 4G84A 4IGIA 2FPMA 4RMJA 4FOTA 1S2IA 5TJHA 4BJ3A 1ZOOA 1Q83A 2YJZA 3PQ7A 4PGHA 4WOBA 3GU3A 4Y67A 2ZQZA 4AUEA 2ONCA 4DA9A 2CFTA 4HOYA 1ZWLA 2J3QA 4W6QA 4P9NA 5CHEA 3F6SA 1N5IA 2NU6A 3A10A 1JB1A 5ENZA 2VDLB 2HRRA 3U19A 4A8PA 5LKAA 3FTPA 4U8GA 4WUTA 1LRLA 3L9WA 4JROA 3H1BA 1F5NA 1Z6GA 1DBPA 1QV7A 4ZI7F 3TSWA 2A5FA 3IB3A 1T9GR 2EHDA 5HS6A 2HK6A 1K4MA 1ODFA 3M33A 1DQYA 1IBRA 2W6IA 3NOOA 4JOQA 4ZRMA 4K9NA 1N8SA 4RQUA 16PKA 3KZKA 2RGWA 2WT9A 2Z2IA 2OGSA 3DOOA 1FNBA 2IPAB 3VKWA 4DJFC 5TPZD 3L18A 2C92A 4KFCA 5DZSA 2X9NA 3KE9A 2HRZA 4NQZA 3USCS 4PPYA 3P5SA 1JUDA 5K51A 3UK0A 5JAHA 2HNAA 4Q9LA 3TPFA 2VN8A 5DBGA 1P39A 4KQXA 1QH0A 5CH8A 1JLHA 3O8LA 1U81A 4A0RA 1NLMA 5BN3B 4B3IA 3KHUA 3MSXA 4LXIA 3CA8A 5LYJA 1P8JA 5IAKA 1KQOA 1ECLA 1FNMA 2W11A 4RHXA 4XVCA 2Q4BA 3W8NA 2X3UA 3CCFA 4MUBA 4BFUA 3AR6A 5T3UA 4TN1A 1EP9A 1RE1A 4W5WA 5ITWA 5AJVB 2OP1A 4ZCPA 2O3QA 3PFNA 1V9CA 2HCFA 2Z2JA 3CEJA 3LUCA 3CLSD 1MJGM 4CLRB 3CVYA 4PZCA 4RD2A 4CIWA 3BWBA 3NNDA 1SK8A 2HEIA 2JGEA 1HM5A 3CLTC 2R7MA 4L15A 4PC2A 4CVNA 4M53A 3SJBA 4EVQA 3U6KA 1NLZA 3T94A 3CNEA 4V0QA 1KYYA 1PYGA 3BMCB 3CNQS 5C1OA 1E2PA 1Z2OX 2B25A 2GERA 2IX3A 1RVV1 4ZV7A 4L76A 3CVVA 1EQ2A 5NLLA 3FOZA 1D2GA 1T4BA 1Z7WA 3IERA 3ND5A 3AUKA 1K98A 3VOBA 5KTPA 1PJSA 3NWOA 5K6AA 1LQ2A 3H1FA 3C48A 3WWYA 4UPDA 1QQTA 3A04A 2QSZA 3DWIA 1CJVC 4LVUA 2XWJI 2J5QA 3EOAI 3GXOA 4X66B 1FVFA 4MGKR 5K0NA 3S7TA 1AM4D 5CT9A 3JZDA 3ND9A 4YALA 2Q3CA 1YC5A 3FFXA 5EJIA 2I7XA 2KW5A 4MV3A 3F6CA 3ETHA 3VMFA 5F2NA 3GB9A 4DOMA 1E5DA 2HQ1A 3R7LA 1MJHA 2H3HA 3W8FA 2GHRA 2PL1A 2Q5EA 1QVRA 3JRXA 4RGYA 4WXHA 3CPSA 3W5JA 1RADA 3C8ZA 2NO7A 1II0A 5LYYA 3RTDA 3TTTA 1H66A 4GXRA 4XQ0A 5KO2A 2ODWA 5E2AA 4Q9JA 5BMVF 4GNKA 2JH8A 1OHHD 3ITKA 3PU6A 4UU1A 4RY2A 1GHTA 2AFHE 3GWGA 3EUFA 3GVXA 5JAMA 1JQJC 2HPVA 1UUFA 4HGZA 2PKQO 3OCZA 4NFSA 4PLWA 2XQGA 4BIMA 2HRQA 3JQAD 4NMMA 5LDGA 4MGZR 3BL5A 1H9BA 2O48X 1B0ZA 2XHZA 3RWMB 4EW6A 1SA0B 1X92A 721PA 5KTMA 2EWMA 5DMHA 1YS2X 1WETA 2XQFA 4MA5A 3JVIA 4YAIA 3JRNA 1VRCA 3V3KA 3VSEA 3C2QA 4GOJA 1DWUA 4F45A 3EFEA 3RSGA 4ZHSA 5IEJA 1LLCA 4ETNA 2V98A 3CINA 1QIFA 3LO8A 4KWIA 4RLFA 4JDPA 5CLFA 1PYDA 4Y6QA 4U2DA 4UM9D 5AK3A 1IZ9A 3ND8A 3TW4A 3WWCA 3A25A 4BVAA 5HZMA 2MR6A 2BMFA 2PUCA 2R48A 2XMSA 1QNLA 1RQNA 4P3YA 3NFRA 3BREA 3G82C 1WEHA 2GHQA 1HFEL 1UPTA 3R5HA 4Z0HO 1XOIA 2WD7A 1EX7A 1U1DA 3P9XA 3PI7A 4KQ1A 4N82A 3AB8A 1T4CB 4LQ4A 4N3AA 3I2FA 1OLUA 1BXZA 2P7IA 3MW8A 2W83A 2HREA 1U5BA 2CW5A 3PXDA 1MAAA 4JLPA 4JP2A 3BILA 3THYB 4AS3A 2JFPA 3IP3A 2V7BA 3KQOA 2J0UA 4AJJA 1JG3A 5LA6A 1E92A 3G2NA 4Y1GA 3DBOB 4WLEA 3A1CA 2QW0X 5DPMA 1GPBA 4WBNF 3BRWD 4A6PA 3A3PA 3B89A 1SH7A 2RK6A 3KVVA 1MAWA 2QKYA 3BB4A 3LGAA 5EP2A 1Z63A 3ER8A 4XTRA 4WOJA 4CTNA 4I50A 2JH3A 1E69A 5SZKB 3UVEA 2QTZA 1NJSA 4HWPA 3PIRA 3VR5D 1E6MA 3WA6A 1RHJA 1SZPA 2ARKA 2H1HA 2QN3A 1IBMB 2I7CA 2IHNA 3GPDG 1WMFA 4IQFA 2EP7A 2WYUA 5A6SA 3TVTA 4BO4A 2B83A 3DD1A 5HBRA 4RHUA 2BH9A 1W36B 1R4MA 4B3RB 3TVYA 4RZSA 1CNEA 1ENPA 4AZTA 1NAIA 1ZN9A 4F1KA 4GMGA 1PU2A 4UUNA 3FTQA 4PLTA 1W9HA 5BSKA 3TEJA 3TIVA 2F9FA 2FN7A 5EIAA 3W4JA 3Q1KA 3HMKA 3S27A 3SMVA 4XYGA 5T8KC 1T2VA 4KJZA 2CLLB 4IO1A 5FFNA 3DF9A 1AZWA 1JAIA 1IQPA 4IIUA 3H0KA 3RREA 1U8AA 5DK6A 4OJQA 4AY5A 1NNI1 5JO0A 1QIKA 2GCOA 4PBRA 3QI2A 1YBHA 3HKCB 4YCJA 1C9JA 1O4VA 5AK5A 5JS2A 5IF9A 4YCBA 2IV3A 1ZVQA 3CUTA 2GAJA 5DYIA 1GZ7A 2QRVB 4BVFA 1H3NA 3V80A 1X74A 2WQ7A 1E7SA 4ZODA 4HGPA 1DTWB 1K2VN 1W0JA 2EKZA 2ZREA 4D3YA 1MLDA 3CRRA 4WI1A 4YS6A 1RAIA 2GJ4A 3D8TA 2JBWA 1NF3A 2Y1WA 3E8XA 6CHYA 4QZVA 4RENA 2EBWA 4PXSA 1XZBA 1W29A 1XHEA 2ZRDA 2BHSA 4ZVMA 4M6WB 2O5RA 3HDGA 4QQNA 4XEUA 5GVSA 3QJ5A 5CYPA 1WXQA 3R7WA 2C5LA 2PT9A 3AEQB 3KFVA 3LD9A 4KXYA 1GT91 3ZGOA 4EP1A 1H6BA 1W5FA 3B48A 3SPXA 3EJWA 2OQVA 3E0XA 4BFLA 2JLUA 1U0HC 2JCXA 1QQ5A 2M6RA 4WFKA 2ZE7A 1TEVA 2A9KA 1NA5A 2IYFA 4N1AA 4X93A 3UOGA 4EKIA 1YWGO 5LMCA 4QULA 3HUTA 3AUSA 3GPBA 3DZBA 1M6NA 4BBJA 3W2GA 1XZNA 2BH2A 3L1VA 4OJYA 1GA1A 2XMRA 2EARA 5IXSA 1UFQA 2D4AA 4DJ5X 1C7FA 1YJ5A 2CHEA 1EM6A 2DF8A 2AGVA 1OBOA 1EPUA 4LHXA 3QVUA 1WDTA 4L9AA 4MV7A 4R31A 2IUUA 4D9CA 2FVYA 3OWXA 3RWOA 3DEJA 1TKBA 1H2BA 2H9IA 2HQBA 1EB8A 3CKMA 1CCWA 3G0GA 4DBLC 3C8UA 5DDIP 3OEHA 1L8OA 3IDQA 3CCBA 2QPAA 1LPPA 1T9ZA 3MJHA 1FQKA 1DCMA 5DLDA 4JXXA 4FEGA 1DBRA 4B8YA 3RS9A 4M0UA 4P08A 1OD6A 1JHVA 4COOA 3DVLA 1EWRA 3NATA 1XQ6A 5CT6A 3X2EA 5BNZA 2P78A 3T35A 5K3SA 4UW9A 4P53A 3F6YA 3K35A 4INOA 3SLKA 5F1KA 3WGYA 5GM1A 2Y71A 3D3WB 3NW9A 3T54A 3VOSA 3OP4A 1EJ2A 4BKUA 2MJLA 3REQB 2QG6A 3DV0B 4ZDJA 1P7YA 1Y6ZA 3TZCA 1Z0UA 2ZT5A 3HDVA 4W1QA 4ETIA 4EG4A 5DCLA 4ENWA 4F85A 1MG0A 1QOQB 3QE9Y 3UPDA 1Z0KA 3PFIA 1HLFA 3F6PA 3HVIA 5HUHA 4DDUA 4LOLA 3A6EA 4J49A 4C43A 1NBWB 3TEMA 5IZ4A 4WADA 4FIZA 3TQFA 3AOEC 3G02A 4E12A 1X2EA 3IKLA 4F2HA 1AF4A 5B58C 2WKSA 1PZMA 2QI9C 4Z86A 5AVWA 3O8RA 5TV2A 5C51B 2GXAA 3CLTD 1DQSA 5E2IA 1LI5A 4HSGA 1A7KA 5LYJF 1NN5A 3BTUA 4LBVA 1N5OX 2UZ4A 1K4YA 3UJPA 4AY4A 5LOVB 1F20A 2F2TA 1IOWA 4IXDA 4G97A 4RGQA 2DHCA 3NGMA 4Q1AA 1V6CA 1JQBA 4GPIB 3D7MA 1JQEA 4JEMA 4GG1A 5T57A 5LU8A 1XPOA 3CRQA 4KLRA 3WK8A 5FFMA 1ZLYA 4KH0A 4LHSA 1IOZA 2YW9A 1V39A 4IGFA 1LBTA 1YJ8A 2X0JA 3BB1A 2JJ8A 2YMLA 3HFGA 1M33A 2QRUA 1U5CA 2P5YA 1O3YA 3FF1A 3LT5A 4OHVA 4QT0A 4YRMA 1T5SA 1ZK4A 3A9VA 1A5SB 1ODKA 3BMNB 3VU9B 3I32A 4E07A 1HYHA 2BKAA 1P1CA 1W4BA 2YXPX 2Q8PA 3IQFA 4OVKA 4MTLA 4QDXA 3RIGA 1YZYA 1P8AA 4JLNA 5ALIA 4D4LA 3L40A 3U7JA 4YX9A 1XKLA 1QH1A 2PSFA 3AJDA 3CW9A 4I5IA 4YBZA 4DS3A 4ZI7A 2OLEA 3ME5A 2FEWB 4EVIA 2Y0EA 2XMGA 4QQRA 5B36A 5LZ9A 3CTMA 2YZKA 3KD2A 3J7AC 1K2WA 4KUGA 4AURA 3HB7A 3OZSA 1USIA 3Q7RA 2ZCUA 4G9EA 3ZHBA 3QLUC 4GBJA 5H02A 3ZLVA 4ZQEA 4TVBA 2H4XA 2FRDC 2I9KA 3LT0A 1AURA 2ZS8A 4JHLA 5JTTA 5LIPA 2CCJA 3GEDA 2BGJA 1O03A 2H2AA 1ZQ1A 3GFBA 3KJIA 2W00A 4HADA 4KIJA 4BB5A 2DLCX 2YICA 2P6UA 5C81A 2Y0CA 5F5XA 1QP0A 1BU5A 5A5DA 4W5RA 1NVVQ 3G0OA 1FFHA 1FOEB 1Y7PA 2V65A 1Q7EA 2FWAA 1XTTA 2NZJA 3EF3A 5T4FA 4I66A 3E3AA 4EHDA 5LD2B 2GN4A 2GK6A 3P26A 3PGVA 3RAFC 1JBKA 2FPOA 2ZRAA 3E3OA 1P1KA 3EBPA 3IVMA 1NRWA 1KI9A 2C5FA 4NV1A 5BR8B 5BN4B 4EKYA 4TXNA 4TS3A 4X64B 1FJGB 1UBMS 5IAEA 3HBLA 3ROFA 3NBFA 7REQA 5T8KA 5FWAA 3HVKA 3CMMA 4PXYA 1YTLA 2PXHA 4HEA6 4G65A 5LOVF 1DRUA 3TTSA 2HUPA 1Z8NA 3TMKA 3MC1A 3WSTA 5BVGA 1U0BB 3X2FA 1H93A 2G7MC 2VNJA 2A8YA 4JZKA 3TSCA 2AEJA 1Z6ZA 4GF5A 4Y8VA 2QAGA 3FDXA 3GG2A 4OB6A 1FFYA 3QEMB 3LDAA 3DYIA 4A0QA 4MPPA 4IEFB 1T2AA 4LOIA 4ND7A 2J6HA 4IMPA 4ZYWA 1GTSA 2D1FA 3WLKX 1E0SA 3R7FA 5JS8A 5GWXA 1W36C 1RS0A 4NE7A 1ZCZA 4G4JA 4K9RA 1ZRMA 3D6NB 3U17A 4JEIA 1PUJA 2AG0A 1RLJA 2FR8A 3HYRA 1NI4B 1DJNA 2A3RA 3IP9A 3O4GA 4JYMA 1EWYA 3UJNA 1RYMA 5KYYA 4Y1RB 4GPZA 3SXUB 4ETMA 3N70A 5E6RA 5LNK1 2W5UA 1P5ZB 3OECA 5ERYA 1OFHA 5CBPB 9LDTA 5JPIA 2GJ8A 1FRNA 3KOYA 4A7PA 4EYOA 1JA1A 3C3MA 1NDUA 2VUHB 3N5KA 3QVWA 4LX8A 4CKBA 1LDBA 3SC4A 4EPTA 5TEWA 1WE2A 4MLPA 5CCDA 4RQTA 1QCDA 3NHZA 3I2JA 3IELA 3ROQA 2VJKA 1AMNA 3JSAA 1D1QA 4MQLA 4WFIA 3FKJA 5BWLA 5BNFA 2LIPA 5EHGA 1M1XB 1I7DA 3RFTA 3A4VA 3RUDA 4MCAA 2BM9A 4AX8A 4MDEA 1UDBA 1T9AA 1ZW6A 1OI4A 1P7WA 2HF2A 4MVJG 3ROPA 3T5TA 5KWJA 2WJZB 2QP3A 1Z6TA 3SS9X 2VA9A 3U7HB 5JBNA 1DV2A 5DHAA 4RLQA 2XNCA 1FSZA 3W2TA 2OECA 2C7GA 3INNA 1SVIA 2AA3A 4RL6A 2W8BA 3ABIA 3R7BA 4WA8A 3DEFA 2QRPA 5I5GA 4XX0B 2HA6A 5JRJA 5L3SB 1C8VB 1TX4B 3LK7A 1ZH0A 4R4JA 3F5SA 2ZOSA 3KOUA 5HZKA 2QTNA 2VT2A 3B7PA 4RACA 1AKNA 2W2LA 3VNQA 3DT6A 4MPJA 4XR4A 5L7YA 4CM8A 1HYEA 1WV0A 2QWXA 1TM5E 1E3MA 2QRJA 3KSZO 5CB4F 3W06A 1RWVA 4R41A 1L5HA 5BYJA 3B1XA 1BA3A 4BBPA 3ETNA 1XUOA 1UDXA 4GI5A 4P98A 3V8EA 1Y9EA 2DPGA 3A1EA 1Q0TA 4CG0A 1ZWKA 3JASA 2KYRA 2R96A 1CG6A 5C7IO 1NF8A 2HWKA 2MINA 4UCQA 3VYWA 4X60A 4GGPA 3I04M 1M6VB 1SQGA 2OZLA 2SCUB 3VO8A 2O2IA 5KTKA 1BH2A 3GO4A 4WW0A 1J00A 2C0PA 2V4ZA 2ES4A 3DE3X 2QIOA 1JVBA 4OA5A 2GEBA 1RLMA 2UDPA 1LBEA 2IA5A 5JD3A 3RUPA 3QH4A 3TL2A 3PFWO 4N03A 1C1DA 1JHMA 3A1TA 4BLSA 4HNSA 3S2SA 3LZCA 2EBHX 2OA0A 4CTMA 3PP8A 3SF0A 4IX1A 4QXAA 5A9TA 5B7PA 4EI9A 3KKKA 3LDFA 5JVDB 3UAZA 5FAKA 1L7RA 1GV0A 2WVAA 4WGFA 2XRMA 4ZVOA 2DERA 1YAHA 4JJ6A 2OHIA 3A2NA 2AJLI 1FDSA 1TA0A 3GXBA 4NIMA 5REQB 2P4UA 1NONA 3ROKA 3TR0A 4RF5A 4ZRDA 3VFDA 4IO0A 4HDRB 4KYTA 4OQQA 2J30A 4NMLA 2YOGA 3GLHE 3I9MA 3IIMA 2QT0A 4G0QA 1PN3A 3KUKA 1WMEA 4Z49A 2IH5A 2CWDA 1RHUA 4I1VA 3WV4A 4AUKA 2BI8A 4MIOA 2BDTA 4WLUA 5JNLA 4M46A 1I7LA 5DWQA 1JDSA 4ZIRA 1KBZA 3DMYA 3WADA 2NACA 4U63A 3HB0A 2JJYA 3W3ZB 1QHHA 2GZHA 3BFJA 4M7PA 2XTJA 2XF8A 5DASA 3A31A 2ZAIA 5HTKA 3H9EO 3F46A 3H2YA 2JIMA 3O9MA 3T9BA 1OIVA 5CB0A 3LDUA 2V0NA 1PAUA 3MWFA 4AJLA 3ELUA 1E64A 1AA9A 2E48A 1F4VA 2W2XA 3ORHA 4PX9A 4DQXA 2NUAA 2XI4A 3FBWA 3AVYA 5H82A 1R27A 3CLUC 3QKSA 2O3RA 4QIHA 1RKQA 5DHPA 1N3YA 4AJEA 4ZHQF 5DM0A 3DVRX 4RJKA 3EF0A 1TTHA 2CXUA 3MAAC 4FS8A 4K6GA 2O2SA 4DE5A 4OMDA 5AW0A 1ORHA 4JUCA 3ROZA 3L4KA 3GLIA 3JAWA 2FMIA 3LLMA 1SKUA 3B8HA 4BMVA 1CQWA 3H2IA 4ESEA 3LIPA 4HN4B 4C0LA 3PC8A 5DBOA 1L4GA 4HPWA 1CUBA 3QQ5A 3OE5A 3FYTA 4EF5A 3AIMA 2WWRA 4FQ8A 2W98A 3QFTA 1XD2A 5TX7A 2IPNA 3GCZA 1E2IA 3OE7A 3IUEA 4FDTA 1M66A 2GO1A 1B2RA 4M1YA 4ZYZA 4YCNA 4KFRA 2AOUB 5SYNA 1Z0IA 2WHEA 4B47A 1N2GA 2O0MA 2PTGA 1LSSA 3KYBA 5DYWA 4ABYA 2PAAA 3D2BA 2REQB 4B3FX 4MRSA 1S2GA 5D00A 4GM0A 1J97A 5TDHA 3UFXB 1EXMA 5JVDA 2NLOA 1QP8A 3IIIA 5IVIA 2QR5A 2BKLA 4HZIA 2CNLA 3ZQUA 3QUAA 2QX9A 2YUIA 2H31A 1J99A 1PKEA 1UPFA 1Z12A 2R85A 4PNZA 3UWSA 5JCPA 2JLXA 3GFTA 5IJ9B 4Q1EA 5FORA 5B1SA 4BE7B 3WLOA 2C96A 1KZ9A 2EATA 3VH1A 1R88A 3N8DA 2C9OA 2C42A 3LI2A 1C80A 3GOQA 2P9YA 4ZD6A 5HF6A 2ODTX 1JHAA 2UYYA 3AEXA 3FAZA 3GJ3A 3KCQA 2QX6A 1ESMA 1Z0SA 2CE7A 4LHEA 1XLUA 2NT3A 3ADPA 2B94A 3U40A 5EE5B 1RBQA 2GNAA 1COWA 3OBIA 1S02A 3OP1A 4PX2A 4TV8B 1SOAA 2PZAA 3QUTA 1VPLA 3DAOA 2HJGA 4L7QA 1RAHA 3BFKA 1WUIS 4KIFA 4KN9S 4YQZA 1F2UB 3QWHA 2F90A 2I7DA 3PUWA 3RIYA 2XZDA 5B2EA 2GPSA 1Q57A 1QAMA 2BAGA 2E4VA 2Z4RA 3K0AB 3NHBA 3OIGA 4J07A 5JWOA 2FPPA 1JILA 2NV0A 1ODSA 4L4SA 4X45A 2D8AA 1AMOA 4JR2A 5BO5A 4F92B 5ESXA 5JWHA 3WLNA 4LY0A 5DX1A 2WW8A 3IPXA 4UNSA 3GV0A 5IK2A 4S04A 4RVDA 3P9SA 5JD4A 1ST2A 2EERA 5FX2A 3NWJA 4IJKA 2HYDA 3M5WA 2EC5A 2NXNA 1COWD 3A6GA 3M70A 1KE1A 1U1CA 2X0NA 5LD2C 1XK7A 4D5EA 3WSVA 5C35A 3H11B 3NH6A 3G49A 2PUAA 2ZRGA 2DSTA 2I3BA 1X1CA 3UC5A 4B7XA 3RT7A 2OE2A 5F5NA 4BPRA 5I3ZA 5KNCH 4BNTA 4L5CA 4IKEA 2Z30A 2Y1KA 1XZKA 2CLOB 2WIKA 3MNFA 2PCLA 4IX9A 4HDKB 1E2UA 3K5IA 3X1JA 4MS1A 2R00A 1PR9A 3K9BA 2X5XA 2W2PA 2VOJA 3E3MA 3PHCA 2V7PA 5IDWA 2OBMA 5IK2D 3IHKA 2P68A 4AZVA 1IK6A 3WRYC 1DJLA 1GP2A 1Z35A 3GEGA 4PBSA 5SZHB 4D8UA 3K70B 3MVEA 3HO6A 2QUZA 2ZRMA 3WLLA 1GZ6A 2JBHA 1J39A 3CLHA 3NV7A 5CBPA 4H7FA 4WOCA 1O0BA 1A1VA 2FN4A 4HYQA 1NVTA 3HJCA 3KKNA 3MHPA 1VECA 3RTGA 4UTVA 1ZH8A 1OX4B 1Y1RA 2NZ2A 3H6HA 4JUIA 3ROMA 1E99A 3FYSA 3M6WA 3MIIA 4YYEA 2H11A 1JLRA 2JIPA 2WICA 3CWQA 3KXLA 3OF2A 4GFDA 3KB6A 4B5LA 4JCCA 3OU7A 1AKMA 3IUNA 3PNVA 5F98A 2EKDA 3II6X 2R2AA 2QN7A 2DPHA 3CSDA 4J94A 4LZAA 4I4CA 4IDOA 3PXXA 5J1SB 4C1BA 2HMVA 1KZYC 1VZ3A 1X7XB 1Z0JA 3D7NA 1PK9A 4M1EA 3ZV3A 1IDN1 2I29A 1HPLA 2I2BA 3VC2A 1Y3CE 5AJWA 7AT1A 2G1KA 5JZBA 1BCRA 3H2HA 1S5PA 4RTMA 1XV5A 3W5DA 1SXJD 4YTEA 3ZGZA 3KG2A 4E4RA 1US8B 2MSKA 2VAWA 5LP6A 1CJMA 1WZ2A 3UAGA 3IRVA 4C01A 3QVGA 3JR7A 4QOHA 3ONNA 5EGNA 5GIPE 5AYVA 5DI3A 3WGOA 4JJAA 1XZHA 2LCQA 3B52X 3URKA 1M2VB 2FX5A 4N9QA 3SYKA 3LBFA 4HS9A 1ORWA 2XUHA 3VR4H 1L9KA 5KX5B 3NAQA 2K4MA 4J3FA 2O0HA 4NCHA 1K97A 1X39A 2ZI3A 4P4SB 4O5AA 1H2AS 4OMFG 1VLQA 4J4TA 5I7RA 1GRVA 4C7KA 5IMSA 2WJPA 4X8MA 4UOQA 5FB3A 1OAAA 2QR3A 2ORIA 3B3QA 3BCSA 2E7ZA 4KN6A 2Z4TA 4M21A 1AQNA 2NYAA 3WZLA 3RRXA 2X41A 3A37A 2Z4SA 3PNOA 4HAOA 4XQGA 4HQFA 3TNFA 4JLOA 2HWYA 3FI9A 3I1FA 2JZNA 3C6KA 3TRDA 1WMAA 4Q15A 3RM3A 3T7IA 4D45A 4Q4CA 1JH9A 3AX6A 1BDMA 3TIIA 1I9CA 4R8LA 4EUFA 2C03A 1MABB 4K26A 5JYCA 1WXDA 1WPQA 3VO9A 2FPRA 2ZB4A 3DMRA 3LA8A 3S99A 4F6LA 3BMNA 1U11A 3LCVB 4BO3A 1N32B 2BELA 2J9RA 3EA4A 1JDNA 1KEEA 1E9SA 1MX1A 5F3WB 4KIGA 2E1PA 2IKSA 4ZU1X 3KYJB 3VYVA 2HN9A 4M55A 1X7ZB 1UPBA 1UMBB 4X20B 4G9GA 1T5IA 3FPJA 3W79A 1T6NA 2G8LA 1NR7A 1Z5WA 3OOYA 4N8EA 4GEGA 1PGJA 2QD3A 5H59A 3U7EB 4DCTA 3UV7A 2J9YB 3PK0A 4F38A 4WBNA 2BC9A 2FSHA 1E3JA 4OQMA 5E7IA 2QBYB 1BXRB 2FQXA 4HK4A 1AGYA 4JVNA 3EBLA 3WMWA 5A3QA 4IV0A 2O0JA 3IVCA 1E5XA 1NYQA 4Y30A 4HLUA 3IT3A 2OV6A 5FQOA 1A8SA 4N8SA 3F7NA 5C9ZA 5G3ZA 2ZWPA 2BEVA 4MJXA 1KZ1A 1NUUA 4TYPA 3LAWA 1WQ1R 4R7GA 4CKCA 3G2HA 4BX2A 3K6SB 2PUBA 1X70A 1UT8A 2EFEB 2WF9A 4DGSA 4QBHA 3Q2OA 5BV8A 3AKCA 3QVOA 4U7GA 3V8MA 2GXQA 5FA6A 2PNJA 9MHTA 2W2MA 1P1FA 4K9LA 4W63A 1H2HA 2HU2A 1YIAA 3PEWA 3KZ1E 1O5OA 2PD6A 3A4TA 3PE4A 4C6TA 3PWZA 2VDRB 1EHCA 1QG0A 4QTUB 3P32A 4W7SA 3UKDA 4LJ4A 4Z3KA 4OXXA 2AOTB 5F9HA 3PHBE 5JAOA 2OO3A 5LZ8A 2WZCA 4B35A 1NUHA 1I7QB 3KKZA 3PQ5A 1GWNA 3R7SA 6ABPA 1YMVA 4W9MC 2PZMA 5AVTA 2Q5IA 3QYAA 3K4QA 2L42A 4W6ZA 3GRVA 3GBPA 2QYHA 1DQZA 1ZD2P 5I7OA 4JXZA 4CM1A 1BD3A 3CVJA 2A88A 4FEYA 4N4AA 2LNDA 4F21A 2F3TA 1ZVJA 3QA3E 1UMCB 2YMQA 5MF6A 4HGOA 1E9AA 2WU8A 3M4YA 4MEAA 4X90A 3VHLB 2FN8A 1WP4A 1SGWA 3SOPA 1KEUA 1CETA 2ZRCA 2HLHA 4WQMA 1SKAA 4GC5A 4BJHB 4DUGA 4MRPA 1ZVMA 4QUAA 1QQBA 3C8HA 3FSJX 1X42A 4WFJA 3KJXA 3MM4A 1UBGA 4CMKA 1K8QA 4NY1A 3V8QA 1F0YA 4OFWA 7MHTA 2JGLA 4HEA1 4ZTUB 2GGSA 3ELWA 4TRMA 4DSUA 3H04A 3BK1A 4FOSA 3JALA 3KYDB 4V0RA 4DM4A 1PR1A 2WJ4A 1TC2A 1V1RB 3W8RA 1PR2A 2GF2A 5KNCD 3KZOA 1J8FA 3N5CA 5AKJA 3U9TA 1SXJE 1ID8A 2E3JA 2CLCX 2IHYA 1CUZA 2ILTA 3B1KA 1JT9A 4MARA 1LGYA 3L4BC 3PF9A 4M1MA 4PZ0A 5DKFA 5G53C 3T3PB 3O8NA 1N3BA 2X0IA 3U9LA 1VG1A 4PM4A 1CRZA 2DCUA 4JNCA 4ZU6X 3DHEA 9ABPA 1E3LA 4DCPA 2E6UX 3G88A 3MBIA 2HIMA 1G8FA 1DIHA 4RVNA 3PD1A 4N12A 1X7GA 5TSDA 4U9IS 3PS9A 2B78A 4QOSA 2ATIA 2PXCA 2XE4A 4ZC8A 3RB8A 4YT2A 4HDAA 5FF9A 2WD9A 2OUKA 4F4UA 4N7BA 1BYUA 5KNCA 1NWHA 2FEOA 4UBIA 1J0XO 2CFIA 2JPDA 2ZJOA 2I7TA 3A14A 1SIWA 3B8EA 4BTEA 4GWKA 4B7AA 4EBFA 1ADGA 1XTKA 3MD9A 3DOUA 1FTWA 3INRA 1QFSA 2H1SA 5CVVA 3L8HA 4DVJA 2FTKE 4R2JA 4KP7A 7REQB 2FFHA 2JFHA 2CL0X 3EA0A 2C7QA 2W42A 2OCDA 2V6JA 4N9WA 1RPAA 1Z34A 5KHOC 1M7HA 1THZA 2GS9A 2Q4EA 2ZYIA 2WTAA 3GJQA 2A1TS 2NNWB 1OXUA 5CNMA 1J2RA 3ANLA 2XAUA 2CT8A 4A0SA 3ET4A 1PZFA 4IEIA 5ECGC 3IVRA 2EZUA 2C5EA 5SV2A 2MT9A 2J3DA 4GECA 4OFZA 1WUYA 4MPTA 2X4GA 5DGTA 1C7RA 1NXOA 3RU9A 3ICEA 5EJEA 4RVHA 4DTIA 1G7TA 4C0JA 4TQUS 4C3UA 1QDLB 2ZRPA 4IIXA 3FOCA 1XNQB 4XUCA 1W1UA 2RGUA 3U4GA 4EX6A 2XQIA 3L6DA 4H08A 4BQNA 3JU3A 4U7DA 2X5NA 4OB8A 2HIGA 3KALA 4J75A 1C9NA 4LJ8A 2JAOA 3DVAB 4FXOA 1CDEA 5AESA 3UGJA 2I1LA 1TYEB 2QTVA 4LYEA 3ORYA 4QICA 5DTEA 2PS9A 3LHDA 4KRXA 1GZSA 3OAAD 5EE3A 3S68A 4JYCA 1PR6A 4XUDA 3T5GA 4M2LA 2XVYA 3ZGNA 1VB5A 2WC1A 4LFBB 4FPXA 1BS1A 3GAFA 3S2FA 2NMVA 4E4TA 2QQ5A 5GZ3A 1GQOA 4BWGA 5DYGA 1Z68A 4GC9A 2EZ4A 1DBQA 1GYQA 2WDPA 3WE7A 3N7TA 5FH9A 4S1WA 3ETLA 4KBGA 3OJ0A 4UZEA 4X00A 3TAHA 3UT0A 1FYXA 5DWDA 1W581 3G79A 4UUOA 3FDIA 4TZ0A 5ALRA 2WSSD 1D4OA 1PL6A 1UJCA 2B4QA 2ZIAA 3RRZA 1PWEA 4LMBA 4LXGA 4RQAA 3WQRA 3ZZNA 1Y3IA 2G28A 3W2EA 1QG4A 3R8XA 3WB1A 1HNZB 3EZ7A 2PEYA 4CQMB 1XX6A 5JAUA 1NOJA 4O4IF 3DP7A 3KYDA 1Z7EA 4FJ0A 4EHJA 1MOQA 1VFNA 2WG2A 3ZBQA 2XTNA 1Y8QA 2O8NA 5CXSA 5B58T 2NSJA 2EFDB 1HURA 5DRYA 3TZ6A 5IANA 5AW8A 1HE4A 3FVVA 2E37A 4NAHA 4N3CA 5JCOA 1R4AA 2AJDA 4H9GA 2IS4A 3EIEA 1NBMA 1U7TA 2LDXA 2BCGY 4XZ3A 4Y6SA 4FUQA 2FH5B 1I4DD 1T5DX 2GARA 2OT3B 2WPDA 5CNIA 3LY5A 3NETA 3SXPA 4B3MB 2W2KA 2ASEA 4XYEA 1A9YA 1SOWA 3BIXA 1SKYB 1M1UA 2AMFA 3I6YA 2JLAA 1V71A 3JPYA 3HBNA 2PLAA 2CL5A 3G9TA 3FPHA 1U63A 2CYAA 3PQCA 5HK9A 2N9UA 2XVXA 4FW8A 1GRNA 4BWFB 4EF6A 1YR9A 2AYYA 5K3FB 1HA3A 4H0NA 1E8NA 4GVPA 3OPYA 1MB2A 2RKWA 3NTUA 3OZUA 5IXJA 4YWJA 3AR4A 3O90A 3NTXA 3JAMA 2G4LA 2WZBA 3I05A 5AJXA 4MYHA 1HORA 1GPMA 1V4BA 2BEUA 3LPMA 1WVGA 2FWBA 3L8FA 5IKXA 2WUEA 1T1GA 3UHAA 2R9VA 4KDCA 1QGYA 1CU1A 2RH9B 3BJEA 3PUVA 3T0IA 5A1TA 3SZRA 1A77A 1QR6A 4ENSA 1K7CA 4FSHA 1XYGA 3KQQA 5F33A 1EFUA 3Q85A 3K9FC 2GUWA 3BKXA 4EO4A 3KLOA 2O59A 1ACMA 2E55A 1NX6A 2QLFA 2ZYTX 3IQDB 4RCVA 3ACCA 3LCUA 1NDQA 3T5PA 2FW0A 5FI1B 1EP1B 2DR2A 2RHGB 4TTSA 3WR5A 2X14A 4JNKA 4LAFA 3HU3A 5K0LA 2A2ZA 3Q9NA 1T4GA 2YH2A 1U8XX 2YNMD 3T3EA 1I2BA 4N65A 5A3RA 1GZUA 1DAKA 2VNSA 4E09A 5KTSA 4DR6B 1LJUA 5FNZA 2OFPA 4BASA 4D4KA 3AL0C 4J9VA 5F9FA 1Q0SA 4C4ZA 1F9EA 2Q29A 3FCCA 2QJRA 3DB2A 4URZR 3DYVA 4RPKA 4HS4A 1S01A 1BXRA 2OXEA 1O95C 3NVKI 2JJ2D 3SD7A 1UXJA 1YB6A 4YUAA 1QYXA 4HNHA 4A8JA 4EMSA 3VO1A 1O94D 1MO2A 1NP6A 1X7ZA 2V6MA 4YR9A 3GGGA 3SWWA 2WIGA 3M9LA 1TFRA 5BRAA 1K63A 1T5OA 2GTHA 3CT6A 3FNFA 2GRJA 4ND3A 4UUBA 1BO6A 1QHFA 1ATIA 4DWJA 1T8PA 4YLEA 4KYIB 2DUMA 1C30B 4RK1A 3U0VA 4C0QC 5C3MA 5CBKA 4QU0A 1U2SA 2H4FA 1NBOA 2J0QA 4D8TA 3G5UA 3DFZA 3DTNA 3VQTA 4F5ZA 1EUQA 2J85A 2G07A 1K9VF 4LSGA 4CV2A 3CUEF 1Q0ZA 5JNRA 4GMDA 4KQ6A 2UZ3A 3K0FA 4DGQA 4JYBA 3HI4A 3Q41A 3QIAA 3ZY5A 1XMIA 1Z25A 3GAZA 3O4FA 3LUHA 4EHKA 2AFHA 1N33B 1PWYE 3CJQA 3O7WA 4V38A 3AEZA 5AI8A 3WXBA 1MTZA 4FFNA 1G3IA 4NK5A 3KB1A 3A1VA 4QGFA 4DR7B 3RDPA 3VC7A 1XTSA 3KQUA 4AFNA 1PJ3A 1WY5A 5HTOA 1J5EB 3ZK7A 2GXSA 4BVHA 4M1WA 5FLYA 1KEVA 2GSWA 1ZBDA 3CKYA 3SHFA 1P5RA 1OGYA 2PWYA 2MHCA 1E3WB 4LE1A 1KJIA 4Q7QA 4Z54A 1A82A 2IEIA 1YS6A 3R3UA 4X6UA 3SSOA 1IHDA 2ZE6A 3H5TA 2PMWB 4JR1A 4R7TA 1TYAE 2R87A 1Z88A 4CI9A 5FPHA 1FIUA 3WGZA 2PUDA 1WVMA 3PFFA 4KMOA 3JYQA 3W05A 3I0NA 4BIIA 2GZ1A 4NXMB 1TIPA 3ZCUA 5CVTA 1BKYA 1ZGJA 4FDAA 4B80A 1EFDN 4I9FA 3NBXX 4AX4A 4WNAA 4HAYA 2PTHA 1Q2XA 2ACEA 2XCLA 4RW0A 1M8FA 5DTQA 3EZ9A 4Y18A 5JFOA 5M3BA 3B1WA 3LY8A 4PR3A 5J4KA 5FBLB 1PHRA 2J32A 3GJYA 3FH0A 4TUYA 2PD3A 4XB1A 4XDYA 1EK6A 1UKCA 4OHRA 2Q4TA 3QKRA 4NZPA 1WIWA 1Q0PA 1TCVA 3UT5B 5KMGA 2O8DB 1QTRA 3EEQA 1KP9A 3R5KA 4KK4A 4BB0A 2J6IA 1DXHA 1ZEMA 3U5TA 5IEBA 1YA8A 4YMUA 2OGZA 2UVQA 2OBNA 1OBFO 3LECA 1ORTA 4PC7A 4BZZA 5JPCA 1FFCA 4PLFA 1E5TA 1KHHA 4DDKA 1UKYA 1T5LA 2ZVJA 3KTFA 4B0PA 1CP3A 3E9CA 3G7SA 2M2IA 5GIOE 1YQTA 2YVUA 1YQQA 1YFKA 4N3GA 4EA9A 5EXSA 2PV0A 4C7BA 1KI2A 2R3SA 2ECKA 4MUFA 2AF3C 1ZFNA 2GT1A 3N0WA 4MWCA 4RKQA 2CDAA 1PP4A 5HEKA 2ZFUA 4UTPA 3JQ7B 5BMVA 3ZIAD 3L84A 3UMSA 3VPCA 1EU1A 3DFUA 5F12A 1MVLA 3BGIA 2VAMA 3O3CA 2C1XA 2ZDHA 4OL0A 3T8YA 2AKEA 2VI5A 1KP2A 2NO0A 1YNSA 4YRSA 3K2IA 3ZXUB 2I87A 1QUEA 2ZB7A 1Q0RA 1Y1QA 2YR0A 1GTVA 4NS1A 4CIBA 3TQRA 1ECCA 1L5NA 2QZ9A 1XRPA 1VMEA 2ZE5A 3MWJA 1IK4A 4NZ9A 4KPGA 4JKOA 4HVCA 3H5WA 4E2ZA 4HWOA 1IUKA 2Z58A 1ZA2A 4ZOBA 1GTRA 4I1SA 3GG9A 4BAGA 2XH8A 5JSZB 2WKWA 3FKQA 4RD6A 4H1HA 4P58A 5IDQA 1CP2A 1VC2A 3U4AA 4FFPA 5A4IS 4W5NA 3HKBB 2B2XA 1I4EB 3BJRA 3V97A 3I0MA 5IT0A 3PDIA 1JYFA 4J1NA 5C7YA 4IIJF 3DCJA 1J07A 3FPSA 2YJ4A 2AI3A 1RFLA 1SBZA 2RJOA 4NU6A 4GP7A 3CW8X 3RYHA 1YAJA 2O2JA 2JFUA 3WSWA 1PFYA 3V8PA 4LBZA 4BGVA 3UAOA 3PXGA 4F5YA 3L6OO 1XTPA 2X5OA 3QBJA 3V1YA 3EGXA 4QYWA 2Q6KA 4GR4A 1KFKB 3TDKA 2YWJA 2I8AA 4YJKA 3L8MA 3C4VA 2CNNA 3A28A 3EXIA 2Y1EA 4NMXB 1NT4A 2PX2A 2N3ZA 2ABWA 2BEVB 2DHQA 3JQRA 2BPOA 1VPTA 4YT5A 4MDFA 2OEPA 3OIYA 2WA2A 4K9OA 2IT1A 4Y7DA 4XUGB 1O8BA 3R9IA 1ZK1A 3FHLA 5AI6A 1VE1A 4DQDA 2OHFA 2L69A 2XT0A 3FHTA 2GK4A 2HLDD 3L7NA 3OOSA 4CT0A 3SBDA 5H5JA 1LTQA 4GWLA 4ER3A 2OG1A 1JDVA 1OUMA 1BHQ1 2XITA 5JSHA 4K6FA 1P9WA 1R66A 1B6GA 3QHPA 2O5VA 3UMYA 5CVEA 3AW8A 4MUXA 1TQ4A 3HU1A 4WEQA 5KREA 1F2DA 4E5UA 2FX2A 1W52X 3T7CA 1GSIA 2WIBA 3OJFA 1QZUA 4QSMA 4U4AA 3VR6A 1UXOA 4Q0MA 1NPTO 3QIVA 1IC6A 3F71A 2C54A 2DAPA 5G2OA 2HSZA 2R1ZA 5LWQA 1V16A 1ZHFA 1YZNA 3BULA 1QVZA 3IO5A 2Q0XA 3AF1A 1SUEA 4HRYA 3SBXA 1QK5A 3TB4A 4E2WA 2H5LA 5A1JA 1Z0AA 3MTBA 3S8EA 4UAJA 2GO7A 4PN3A 1PFVA 3FPGA 4YFYA 1GFWA 2UVPB 4II3A 2YZ2A 4AM8A 1O57A 3HBJA 4ZTZB 1IYZA 1ZH4A 1RNLA 1O94C 1KSJA 3ULKA 1OX6A 2OM2A 1TF5A 2J33A 2W2OA 4NZOA 4BP3A 2E4AA 4EB0A 3ZHVA 4L9SA 2ZSDA 3BYZA 2Y3IA 2GCGA 1ISHA 3LNCA 3T41A 3LX5A 3FNIA 3EQ8A 4PLHA 2C9BA 4JJ8A 1XVUA 2BIFA 2BFWA 2HF7A 3C1UA 3OJWA 2FPGA 4LRTB 2JHCA 3DAGA 3EDOA 1SBQA 1C7IA 2WF5A 3KPJA 4GR5A 5TLSA 1RJFA 4EDHA 2CXQA 1BAPA 2QORA 1S9HA 1XL0A 4JI6B 4P7GA 1CZKA 1US8A