5E8JA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with ram
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
SRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Molecular basis of RNA guanine-7 methyltransferase (RNMT) activation by RAM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5e8jA00
2G1PA 3JWJA 4M7RA 4ATNA 1Q0TA 3CJQA 5K01A 1O54A 5D1HA 3LKDA 3C6KA 3R0QA 4U7TB 5K0EA 4AZTA 5KYGA 5EQJB 2YVLA 1EJ6A 3DLIA 3UBTA 4ER6A 2XVMA 3EVEA 5FA8A 4BY9E 1EIZA 3BKXA 1HNNA 1EJ0A 4RYLA 1JQEA 5HFJA 2ZIFA 2ZTHA 4RTKA 3HVJA 2H00A 5GWXA 2XYRA 5EMMA 3UJ6A 3FPHA 3G7UA 3TPZA 1P91A 3CJTA 2GB4A 3DXXA 3M6XA 4FR0A 5D1NA 1JTFA 2UYOA 2ZULA 5BP7A 5K8VA 3HA3A 3REOA 4IV0A 2ZWVA 4MWZA 2QYOA 1M0EA 2VS1A 3M70A 4RWZA 1YZ3A 3A25A 5EMKA 1RJEA 4X63A 2YUIA 3KPVA 5M5BA 3OZRA 2ZCJA 4PCLA 4A6DA 4BP3A 4DZRA 2PVCA 10MHA 4X60A 5K0NA 4EK9A 2QY6A 4HC4A 3SGLA 4FT4A 4PYMA 3UJBA 3KHKA 3G88A 5U4XA 5GM2A 5KS2A 1FP2A 5FTWA 3P9IA 4KIFA 1KR5A 3EVDA 1T43A 1R00A 5E9WA 1TW3A 3LHDA 5E8JA 3VC2A 2PXCA 4PNEA 3KPJA 3KQTA 5BW4A 5CM2Z 4E2ZA 4K6MA 2ZBRA 5DTRA 4DKJA 1ZG3A 2VDUE 3KQSA 4IWNA 4RTMA 1VBFA 2NP7A 2O57A 4MTLA 2Q41A 5CVEA 5DT2A 2FK8A 3BGIA 2GS9A 4E70A 1QANA 1KYZA 3T7RA 2BH2A 3FPEA 3LPMA 3KR2A 9MHTA 3JWIA 2XYQA 4ISCA 2JH8A 4HG2A 2OB1A 2H1RA 3DMHA 5FCDA 4C06A 2P40A 1NW5A 4GF5A 5DM2A 4IKPA 4V0QA 4PONA 3MGGA 4PIMA 5EGSA 3BZBA 4RTRA 3FYDA 5CVVA 2CMGA 2NXNA 4DM3A 2R3SA 2FCAA 5HEKA 2E5WA 2ONYA 1ZKDA 4OQDA 5E9JA 5BW5A 2WA2A 1JG1A 1G55A 3P71T 5E1DA 3TMAA 5MHTA 2OPBA 4P7KA 3LSTA 2P3OA 4XUCA 5GOZA 2YTZA 1JSXA 4RTNA 3BWYA 3O7WA 4KWCA 4M38A 3GJYA 2IIPA 4OBXA 2HV9A 1NT2A 4KW7A 4QTTB 3VSEA 2PX2A 1VIDA 5DTQA 5EPEA 4FGZA 2AOTA 2PXXA 2C7QA 1NV8A 2AOXA 2I62A 3G5LA 1G6Q1 5HZMA 3BXOA 1SUIA 4KRGA 1L9KA 2ESRA 2YXEA 5IH3A 3GRRA 2NXJA 2C7PA 4RVGA 4DCMA 5HOQA 4MHTA 3H2BA 3VC1A 4F85A 3UJAA 3HP7A 3BGDA 1R8XA 3PT9A 3EPPA 1DUSA 1BHJA 1XVAA 5F2OA 4HSGA 5DSXA 5KVAA 1NBIA 5LR6A 2GH1A 2JJQA 3CBGA 5FQNA 5FADA 4FSXA 3DP7A 3L8DA 4EQZA 3EEOA 2PT9A 4R6XA 2YQZA 1SUSA 2LD4A 3CC8A 3SX0A 4C08A 2ZZKA 3FTDA 3KU1A 5EOVA 1UFKA 2B2CA 3KQYA 3T7SA 2PX4A 4LWPA 2ZWAA 2JHCA 3KR9A 5ICFA 2Z6AA 1D2GA 1X1BA 3O31A 1YFJA 4X61A 4P7FA 2AN4A 2PSSA 3JWGA 4DCGA 5LQRA 1XXLA 2H11A 4FS8A 3GIWA 1ZGAA 2IBTA 4YV0A 2KW5A 2VP3A 3DXYA 3U81A 1FJXA 1YF3A 1NW8A 1EQAA 3MCZA 2ZBPA 4WXHA 5E8RA 5E9QA 4PWYA 2OXTA 1NW7A 1QYRA 3A7EA 3CGGA 4BLWA 1UIRA 4F84A 3B3FA 2GAFA 4YMHA 3DR5A 2YXDA 1L3CA 3G5TA 3R3HA 4KIGA 1KPGA 2WA1A 5DPMA 3OFKA 2BR5A 2OYRA 8MHTA 3EGIA 3P8ZA 4E31A 1KP9A 3DUWA 3OU7A 5DX0A 3BWBA 1WXWA 1KHHA 5E2BA 2JG3A 1VQ1A 2PWYA 5BXYA 2BM8A 3KR0A 3AY0A 3EMDA 3HVKA 3HCCA 1QAMA 2PXAA 2EJUA 1WY7A 1XJ5A 2HWKA 2G71A 3AWIA 3FRIA 3BGVA 3LCUA 4LECA 5FWDA 4RTLA 5FQOA 4LWOA 5C0OE 3UJDA 4C07A 1TW2A 2NXEA 3V97A 3I9FA 3NMUF 3FTCA 3C6MA 1D2CA 3BWMA 5GP1A 3S68A 1MHTA 2ZSUA 1L1EA 3GO4A 1JQDA 3O4FA 3ERCA 5EMLA 2XVAA 2FK7A 5LQKA 1YUBA 3LDFA 2PGXA 3M6UA 4GQBA 2I9KA 3R24A 2XYVA 1SKMA 1DCTA 3CKKA 3HCFA 2UYCA 4XUDA 2CL5A 1JTEA 1SQGA 2UYQA 1H1DA 3A7DA 3GRZA 5FHQA 3VYWA 3E7PA 1P1CA 1KPIA 3E8SA 4X41A 3T7TA 1KYWA 5KQSA 5CCXA 4E32A 4RTJA 4EKGA 2XBMA 3ORHA 3DMFA 1QAQA 3ELUA 3B5IA 4AZSA 2OZVA 4YV2A 2UZ4A 1INLA 3T0IA 4M36A 2P3LA 4FZVA 5ERGB 2DULA 3FUVA 2G8NA 3Q7EA 3OU2A 1RI4A 3LCCA 1L3BA 1WXXA 3LL7A 3BUSA 3BWCA 4P7GA 3GCZA 4QVKA 3KPUA 2OB2A 3PTAA 4XCXA 1PRYA 2IFTA 3HA5A 1QZZA 4M37A 4Y30A 2G72A 2PX5A 3G2OA 2F8LA 3GWZA 4RVFA 5EIWA 1XCLA 3HM2A 3TR6A 3UZUA 1P1BA 5HIKA 4R8RA 5H02A 1DL5A 1V39A 3GDHA 1O9HA 5T6BA 5GIPE 3FTFA 3MQ2A 4E2XA 3SMQA 3SSOA 3THRA 2IP2A 3P2IA 3G2PA 4AX8A 5B1SA 2QRVA 2Z6QA 4BLUA 2BR4A 1SG9A 2G70A 3P9NA 3RODA 2NP6A 2AOTB 4RTQA 1Y8CA 3ID6C 5EVJA 4AZWA 4C05A 5LQUA 5EIFA 3TFWA 1EAMA 4MQ4A 1AQJA 1AF7A 3KPWA 3M4XA 4RTOA 3EVBA 1BKYA 5K0LA 1MJFA 4DMGA 1JG4A 1HMYA 1N2XA 2P7IA 2QE6A 3LBYA 3OU6A 3PVCA 3EVZA 4G56A 1R18A 3C3PA 4FSDA 1N7JA 1KIAA 3E05A 4IV8A 5F2KA 3TLJA 3HEMA 3HVHA 3MTEA 2BM9A 4HH4A 2ZZNA 3C0KA 3QV2A 3UWPA 1AQIA 5IKMA 2I7CA 3LGAA 1UWVA 3Q87B 4QQNA 3UJCA 2AOWA 1IM8A 2FHPA 3NDJA 3BKWA 3EVGA 4H0NA 4C03A 3OE4A 4UOEA 3MB5A 3SM3A 4ER0A 2IBSA 3IYLW 5DRYA 5KQRA 4CKCA 3PX3A 5K03A 3SSMA 2VDWA 4RX1A 4HGYA 3ELDA 4HGZA 3FUXA 1JSZA 2O06A 1SVUA 4Z2YA 2HNKA 2P8JA 1I4WA 1G8AA 1JQ3A 3C3YA 4OBWA 5EZSA 5ICGA 4R6WA 2C7RA 3NVKI 4P58A 2PBFA 5DSTA 4PYNA 2EFJA 3DXZA 3FPJA 1RJDA 1JG2A 1IY9A 3A26A 4GUAA 4HTFA 4YMGA 4PGHA 4DQ0A 4PYJA 4RTSA 2OBFA 1WS6A 3DULA 1R74A 2V74B 4OA8A 5GINE 5DM1A 1RJGA 5GM1A 5EKXA 3X0DA 1NW3A 1IXKA 1VL5A 1VE3A 3PS9A 4GOLD 2PY6A 4PYKA 5DTMA 5CD1A 4RSRA 4CWAA 3FZGA 3EEYA 3HA7A 5FULA 1M6YA 2NYUA 4P7JA 4U7PB 3NVMB 2ORED 4L7VA 2YR0A 4PIPA 3JWHA 3P9KA 4KDRA 4MIKA 2Z6UA 2AN3A 4RVHA 1NV9A 2Y1XA 3KQMA 3TRKA 5LQAA 4OQEA 5T67A 3FYCA 2V7EA 4Y2HA 2EX4A 5FUBA 5CVDA 5HIIA 1X19A 3NDIA 3PX2A 3TKAA 3HCBA 3KKZA 5EEGA 1F38A 4PYLA 2GA9A 3KQWA 2AVNA 1RI2A 1WZNA 4KVZA 1VP9A 3IHTA 3LECA 3FPFA 5P8WA 4EMSA 5C1IA 2JHPA 4XUEA 4CXMA 1I1NA 3UJ9A 4ER3A 4E30A 2B25A 3ELYA 1SQFA 3LX6A 2GPYA 3P2KA 3OCJA 5JR3A 3PLAE 4ER5A 4CKEA 3MAGA 1YZHA 5DWQA 1FPQA 2NNWB 3HTXA 1U2ZA 4HRAA 3D2LA 2JH9A 2PKWA 4GOMD 5DXJA 3OE5A 3ELWA 3CVOA 1ORHA 2PJDA 3HNRA 1ZGJA 2PT6A 1X1CA 4V0RA 1D2HA 3EGVA 3PFGA 3UA3A 2ZLBA 5ICCA 1NW6A 2IGTA 3GRVA 4GC9A 5CVUA 7MHTA 4WVLA 5EMJA 1R6AA 3KQQA 3GXOA 3FUWA 3CCFA 3P97A 3ME5A 2AOUA 3G2MA 2ERCA 2PX8A 4B17A 2P41A 2IDJA 3R6TA 2B78A 5E1MA 3EMBA 5FWAA 5K0BA 3V8VA 1R8YA 5ICEA 3NWEA 5G02A 2ZW9A 4QQKA 3G8AA 5DXAA 1ZQ9A 3TKYA 4FP9A 1B42A 2QRVB 2CMHA 3EVAA 3OFJA 1KPHA 2DPMA 3UJ8A 1PJZA 4GOND 4KDCA 1OR8A 1XDZA 1G8SA 3A27A 5T64A 4DA4A 1VPTA 1N7IA 2PV0A 1XDUA 3AXTA 4QVGA 3WSTA 4CKBA 5K05A 2ZZMA 1KXZA 1NE2A 2K4MA 2VDVE 3B3JA 2IDKA 4GEKA 4PYOA 5EKUA 4E33A 3OZSA 4YUYA 2YX1A 2EG5A 4YUWA 5EEHA 5DM0A 1EG2A 2CKDA 3HCEA 4OA5A 2AVDA 4R05A 5EG5A 1FP1D 2WK1A 1JG3A 3SXJA 4EVIA 2O07A 4FT2A 5GIOE 3FRHA 4PYIA 2BZGA 3G8BA 3PB3A 3IV6A 4BP1A 2P1DA 1NBHA 3I58A 4E2WA 2ZVJA 2GLUA 4CTJA 4POOA 2BR3A 3K6RA 1M6EX 2HMYB 4C04A 3QOXA 3P2EA 4GOOD 3ER8A 5LQNA 3I64A 5JUWA 3ER9A 2VZ9A 2ZFUA 3QOWA 2JHAA 3RIEA 1X1AA 3UA4A 3MHTA 2EJTA 3FPGA 3LBFA 5K0FA 2OO3A 3MTIA 4X1OA 3PFHA 2A14A 3A4TA 2O05A 2QM3A 2P7HA 3DOUA 3EVCA 4GBED 3FTEA 4OX9Y 5FHRA 5K0CA 2CWWA 3DMGA 3B3GA 3NJRA 4EKIA 5HIJA 3GRYA 4DF3A 1JR4A 3B89A 1YB2A 3FUTA 4F86A 2I6GA 2R6ZA 4HTFB 1X1DA 1XDSA 1QAOA 4RVDA 4RV9A 2UYHA 5F2NA 5EHGA 5DM4A 4YUZA 1AV6A 2ZBQA 2IH2A 3P9CA 5K0GA 5HIMA 1O9GA 3GNLA 4PYQA 1I9GA 1ZHFA 2O0LA 3RW9A 3F4KA 4GC5A 5DX1A 3LDGA 3G89A 5E1OA 3MCTA 3UFBA 5EZQA 3TQSA 3DLCA 3KQVA 3MERA 3SR4A 1G38A 4O29A 2AOVA 3TM5A 5E1BA 2IH5A 1RJFA 2C7OA 1TPYA 2FRXA 1NKVA 5DX8A 2B9EA 2N47A 3TOSA 2FPOA 3HCAA 3HCDA 3KPYA 3I5UA 3NW9A 5CVJA 4CTKA 3THSA 5C9ZA 2HR1A 3IEIA 3AXSA 3KQOA 4PINA 2PWPA 1G60A 3FUUA 1XTPA 1F3LA 2YXLA 3LCVB 1VP3A 1VLMA 3NTVA 2ZIGA 3E23A 3M6VA 1P39A 3NWBA 5CUQA 5EHIA 3HVIA 5DLYA 4ZTBA 3TM4A 1YFLA 3EVFA 1RI3A 2AR0A 2HTEA 5CIYA 3B7PA 3KR1A 3R9XB 1L3IA 4JXJA 2ONZA 2AN5A 1RI1A 4ER7A 3GU3A 4BLVA 4QDKA 3UJ7A 3M33A 5K0JA 2IH4A 2IPXA 4PCAA 3KQPA 3BT7A 3GRUA 3AJDA 1BC5A 3OZTA 4YUXA 1BOOA 3DTNA 3EGEA 3M6WA 2B3TA 4E2YA 3SVZA 5EC8A 3LKZA 4QDJA 4QPPA 5LQCA 1WG8A 3CJRA 3G2QA 5HILA 2P3QA 4AZVA 2FYTA 2OY0A 2PLWA 2Y1WA 1FBNA 1Z3CA 4C4AA 3OPNA 3SSNA 2AS0A 4A6EA 2NXCA 3K0BA 5DRTA 4QPNA 4LG1A 5CCBA 1ORIA 2ZIEA 4YV1A 5K09A 5LQJA 3DH0A 4QTUB 4R8SA 4RTPA 4YUVA 3ANXA 4PGGA 2P35A 3GGDA 4AUKA 5E2AA 1Q0SA 3I53A 1XCJA 2AOUB 2AZTA 5FA5A 3LDUA 2OKCA 1RI5A 2ADMA 4NECA 5LSAA
chains in the Genus database with same CATH superfamily
4FBMA 1GPWB 3W2HA 1NQAO 4X8MA 4AJLA 1YVPA 3F2IA 4YBRA 3K1TA 1ML3A 3PUJA 3WNDA 3QMPA 1G20E 1S1MA 3OPVA 4R1PA 4ZHQA 2YVLA 4KVAA 4NZ9A 2AG6A 1MD9A 3U9LA 2H2WA 3A4YA 1A69A 4OQXA 1U2EA 1OXVA 5AYVA 2AYYA 4WDRA 2GZ1A 5DI3B 1MPXA 4JH0A 1CUAA 1JFVA 1I5OA 1IC6A 2ZTHA 3KYBA 2OHVA 4MCAA 5EMMA 4CCWA 3B5EA 4ON9A 3P94A 4YP9A 2GB4A 2W6OA 3WLSA 5ESXA 1YSCA 3LTEA 1JR3D 3A4LA 1QXSA 4CKBB 1ZCZA 2C9DA 2WP8J 4J16A 1M0EA 2VS1A 2NYAA 3AO0B 5DNYB 1GEGA 2GN4A 2WUVA 2YWEA 5KAPA 2PE5A 2BC9A 3UV3A 1N5LA 1D6MA 4XD7A 5H3LA 3T9EA 4ZCIA 3BS4A 1F6DA 3ROGA 5IG2A 2YY6A 2AXNA 1LBTA 5KS2A 2BBWA 5HFNA 4W9MC 2PZBA 4TYMA 4P4UA 1L6IA 3WFIA 4UTPA 2ZR9A 1T9HA 5BN5A 4LWZA 4DYVA 3IAAA 5BN3B 5CM2Z 3ESAA 3JATA 4MQUA 3NM6B 4C7VA 1KVUA 4CMHA 1U8TA 2YOFA 2YW2A 4QU5A 4YRGA 1E5VA 2AXQA 4ABYA 1OV4A 2B5VA 1H2HA 4KRFA 2FMUA 1V5EA 2Q41A 1WPXA 1J97A 1LX6A 1V4NA 4MKFA 1CUUA 5LBTA 4F3RA 4XCQA 3IH5A 3ZV3A 5IDXA 3RTAA 1KF0A 1SG6A 1U4NA 4FQ5A 2CWDA 1VKZA 3OOWA 4V2IA 4ID9A 3H2ZA 3SQMA 2JGFA 2W6PA 4Q16A 3TSWA 2OGZA 2OB1A 2VVTA 3WB9A 3WGYA 1MCZA 1U6JA 1U7OA 1X7HA 1W4RA 4RGYA 3I5MA 4OUDB 3BICA 5DN6A 4I2NA 1GNTA 3TTYA 3S7ZA 4BN5A 1VHQA 1LLCA 3PIIA 4PSAA 4WCFB 2W2KA 4AJNA 5FOWA 3WL6A 2IIVA 4LYYA 4MULA 5AUPB 3IVCA 1T2VA 3RWOA 1A7JA 1K6IA 3GGOA 4C3VA 2P3SA 3Q3IA 3I6BA 3JQPA 1E6UA 3CUVA 4GKBA 3JXEA 4CMCA 2DKFA 1FVOA 2NU9A 3O7WA 4P5EA 3UOAB 2AZ4A 5FAXA 2IUSA 3GF4A 5FPSA 1IQUA 5H59A 1E3EA 2RHRA 1KKLA 3HJNA 3W8EA 2OBLA 1AHHA 2E87A 4HO1X 3GPLA 3AG5A 2G76A 1DLIA 2HK7A 3AESB 3AUTA 3CE9A 1ZY2A 5AVSA 2C5SA 4O3MA 2JFOA 1A4IA 5BMVA 2WSBA 3HP7A 3CBQA 5ADHA 1H8ED 1AK9A 5CPBA 5IC4A 4KN6A 3BXFA 4AVYA 5GZ1A 1UFQA 1H4TA 1FL9A 2QE7A 3MJTA 4WGGA 3TLKA 5ETJA 3T5AA 3N0RA 1RLTA 2HXYA 4HH0A 2P1RA 3OCUA 1ZI8A 2NU6A 5ARDA 5JNSA 2YQZA 1OILA 3GQBA 4LZAA 4EGCB 2XYGA 3FI9A 1UFKA 2C3PA 1JR3E 2ZRCA 4YREA 1E1CB 2D59A 2R97A 1R4NB 3ABZA 5CAEB 1M2GA 1UJNA 1DPGA 1LSJA 2QY9A 4HFJA 3R76A 4B8WA 5KYXA 3ABRB 2PUEA 1R0BA 2FJPA 1KEWA 4C2BA 4S1WA 4YASA 5BWNA 4P31A 4YT5A 5SICE 2CVZA 5FWXB 3K8QA 3IUSA 4FS8A 2HT1A 4FNOA 2DFKB 3NQ41 2J5QA 3GAZA 2YZ7A 3ZDDA 1EQAA 1MB4A 1Z6QA 5E9QA 1SQ5A 4F4DA 1KAOA 5HKKD 4G6ZA 3F5DA 4Y6GB 1HPLA 5BPFA 1WQ3A 3DG9A 3JAWA 5IUNC 3IQWA 5F3WB 4ZHQB 1KJQA 4N65A 3SR3A 1WY5A 3DE6X 5CW1A 5FFFA 2FX2A 4QXRA 4CLOA 2VAXA 4OI4A 1FJ2A 4DSUA 1KAEA 4MYRA 3WYCA 1K75A 4B5LA 4LF5B 1IMOA 2JG3A 1RCFA 3HJGA 4FD2A 4PAWA 1KZ1A 4J6EA 2QMUA 3BGVA 5C2JB 2WPNA 1OYYA 5BV8A 4KXXA 2ONJA 5EZYB 3SNKA 2JFXA 4ZQCB 1V96A 3RPEA 3PHBE 1BFKA 1RACA 2XYHA 2X0EA 4UHKA 1S2NA 3IT2A 2XUOA 3LLCA 3O1HB 1MAAA 1PZEA 1R10A 1VE6A 4HB3A 4DW8A 2FW6A 4KO4S 1AJEA 5M29A 1OWPA 4N3CA 3AWDA 1N75A 2ZBDA 1VDZA 5J4KA 4P80A 2ZSJA 5CM8B 4ZQGA 2M6LA 4KITB 2UVPA 4DDVA 3JATB 4AURA 2WWVD 4MLPA 4NS4A 4YJFA 3IPYA 3UMSA 3EDMA 3E9YA 1TEHA 1FRQA 4E32A 2E49A 1T1RA 4TXLA 1YR3A 1ACJA 2ZJ2A 3VKUA 5AKXA 2P1ZA 2NUTB 4NC9A 2YVQA 3QLVA 5D6OA 3OX4A 1TJPB 2RKBA 3K0AB 3R6DA 4M36A 4QSMA 4YECA 1U31A 1YI1A 2PS0A 3PUYA 4PQRA 1JL3A 2C77A 2Y2VA 3BWCA 1FFSA 1IY2A 1FRVA 1RE1A 2XUQA 3GCZA 4QVKA 5CA0A 1RE0A 2PEYA 4NH0A 1H85A 3M9LA 4NDNE 4BKMA 3D59A 3TB6A 2WMNB 2PX5A 1F06A 1OROA 2A30A 3TR6A 2A86A 2W2KB 1C4KA 2NZ2A 4ZVLA 2ZYWX 2H2GA 3F7TA 5AIAA 3SZMA 5IARA 5KDLA 3VKVA 3THRA 3GEIA 3QIVA 3Q98A 2O1EA 2VRCA 5FLXA 5J5CA 3SD7A 4MVCA 2X1HA 2HWUA 2NU9B 4BP8A 1WKCA 4PFSA 3PGVA 2NSJA 2H57A 3ILSA 4PLWA 3PR3A 2IZ1A 3VDQA 4BVGA 3OP4A 4HDKB 3ROMA 2I3BA 4MQ4A 3SS7X 3OM8A 5K3SA 4EI7A 1BKYA 2UUOA 5BMVB 2CMDA 5JATA 2QTVB 1G5PA 1R0LA 3F4LA 3R0VA 1NY6A 2W4MA 4E08A 3I8XA 2VRBA 2SCUA 3A04A 1M5TA 2EBWA 1B76A 3D8TA 3LLUA 3RSGA 3UUEA 2F1JA 2X7XA 1VBNA 4W9RA 3RT1A 3KOYA 1M0WA 1HUQA 4DBZA 4ARIA 2NU6B 4TTVA 3OIYA 3OZAA 3GQBB 2O8EB 1IM8A 3IQFA 3EVGA 4OI1A 1MGPA 4PFKA 2IUYA 3ZGOA 3I9KA 1JDTA 4TYWA 3FZQA 1RAAA 1YZKA 3O73A 2VHUA 3BJMA 3PDJA 3DE7X 1WV1A 4M1OA 4DXHA 3U37A 4XH9B 4CKCA 2WU0A 2A7QA 2BPOA 2WTBA 2BFOA 1I5RA 2Q5HA 2VUUA 1O95A 1JSZA 4CDGA 3CRZA 4J0KA 4XWAA 4LVUA 1G8YA 2QRGA 2VUIB 4NRDA 3SHFA 1ZGCA 2RHCA 4J0CA 4OBWA 5HM8A 1P72A 5ICGA 1YA6A 1DQNA 3NHWA 3A9UA 2EKBA 4P58A 4PYNA 5LP6B 3RK1A 1A2QA 2G04A 1R9NA 1DE0A 3A9WA 3VI3B 2QX9A 1I2CA 2E6KA 4PYJA 2QAJA 4IIYA 2ZJ7A 4QIHA 1LDYA 3EIXA 4GLLA 1IXKA 1QCYA 3QWHA 3RVBA 1UKAA 3BZWA 4JJKA 3UIEA 2BGTA 5FTJA 3ZXUB 1KJ9A 4D44A 3CUUA 4AKEA 1U9JA 2DWPA 4NFHA 4BNHA 3GG2A 1N0WA 3VX4A 1L4KA 2WF7A 1P5RA 3WDLA 4KDRA 1ZOLA 3FFAA 1T24A 4KX5A 2NPFA 1JB9A 3HPQA 1NDUA 1WB5A 5BQFA 4CETA 3BIWA 1EP9A 1C9DB 4RZXA 2GA9A 4ND7A 3GP3A 3DKRA 5KJFA 1SKYE 2JIMA 5E0OA 1EGHA 1O89A 2IITA 2O2JA 3KWJA 4XUEA 1KA9H 3D6TB 1P3Y1 1X80A 1OGIA 4HYTA 5KJCA 2J5BA 1BVYF 3UGQA 1V35A 2NO5A 2KQUA 1TFRA 3HDTA 1SD5A 1Q1EA 2UVPB 3EZ7A 3A2KA 3ZLTA 4YJFB 5AW9A 4QNRA 3OQNA 4HZUA 1CQPA 4LZLA 5K3CA 2NMVA 1GCAA 1L5NA 2X4DA 3QVXA 1VKOA 2JARA 1P9NA 2ZSBA 4LXYA 3PFGA 2HIAA 2YHIA 3B38A 2WUFA 4YIKA 5C8XA 1Q1BA 4C6SA 1SA0A 2QM0A 4XIFA 2AF3C 1KE1A 4REQB 5CA0B 4CM8A 1VYHA 3P97A 2OHHA 5ALZA 3PXDA 1U0LA 1ES9A 4R69A 4BQOA 4DCUA 4R98A 2ZE5A 4A10A 2HJ9A 2KSQA 4ODIA 3G1UA 4Q3DA 1DXYA 1V7CA 5GONF 5AJHA 5IULC 2BGNA 3HZOA 3AZOA 4EG8A 1JVNA 1RCTE 3TQCA 4J9VA 2IS1A 1NVUQ 3PLRA 1TTTA 1W0JD 3T95A 2CMHA 2Z04A 3ECCA 1FS6A 2BUBA 3L41A 4BAZA 1MO2A 3NANA 4C4OA 4DR5B 1QFYA 5L40A 1OR8A 2FP4A 3ENWA 5IT4A 2VSYA 5HIAA 2FQYA 4DV4B 2G07A 2PV0A 4JUDX 1ZJ5A 3Q7SA 4RD4A 3B1WA 4BLOA 4BUCA 3ICCA 3HUFA 3IVGA 4F8YA 1LBQA 2YX1A 4J4TA 1X9GA 5F9HA 3LYAA 1AF4A 2UUCB 1HFWA 1WNFA 3MLEA 1SCIA 3ONWA 4KE6A 4M1ZA 4ENUA 4MQ5A 1JI3A 4C0XA 4LHXA 2SCUB 4IGEA 1KR2A 3M2PA 2YZKA 3HBAA 4JT8A 4LJSA 1I36A 3PC3A 2B9VA 1QRDA 1VB3A 3MRSA 2JAHA 6Q21A 1BE0A 3FMVA 1ZA2A 1RWQA 2BR3A 2L0XA 3BH7A 3V6LA 1ONOA 4OHYA 5BSMA 5K8LA 4FKMA 3PE4A 5GV7A 1PVDA 4QL3A 3U4QA 2W8BA 3NH9A 1TM2A 3HJTA 3EVNA 4CMEC 1JU3A 1T6XA 2ES4A 4REMA 3TVTA 1ID8A 1EM8A 1NYRA 3CVJA 2CKMA 4JI6B 4BMOB 1KDTA 2VNSA 1L4GA 5GJBA 4LCBA 2YJ6A 1PF7E 5FXMA 3DE1X 2NO7A 3LPNA 4KQGA 3K5IA 4Z9BA 1CEEA 1YB2A 3P2YA 4WZZA 2WJ3A 1M34E 1PEYA 2OPHA 4WV3A 3K3PA 3NJ8A 5HUQA 2NW6A 1G17A 3L7AA 3X2FA 1PI3A 4Q34A 5KKNB 2P9CA 2OYSA 3EXFA 4BYMA 3HP1A 4QOSA 1GNLA 1WTAA 1NXWA 1L5ZA 1NQOA 4QAQA 4X1YA 5FPPA 3TRFA 1N1EA 4X9XA 1NP6A 1JHDA 3N8DA 3MWEA 1GWNA 3G89A 4R1SA 1KMCA 1DC7A 2H18A 2PSJA 3QKRA 4CL3A 4CM7A 3O8OB 3FSGD 4GXNA 4OP2A 4MS3B 2CL0X 2ZQ5A 4N1AA 4ZXPA 1OASA 2MSKA 3H18A 4FCTA 4DLUA 4K1XA 4DUYB 1E9AA 1T5IA 2Q9AA 2VYND 4FOOA 3THSA 4D7AA 1VRCA 2NO1A 4KP7A 3RKRA 3GFPA 5AVRA 2QRUA 3OQOA 1SUEA 3LA8A 4EJSC 3EXIB 5LQAA 2JLZA 3IRVA 1ZK4A 4KIUA 1O5IA 3ETEA 4OGFA 3TLZA 1KFJB 1TD9A 3A05A 2V4ZA 1RYMA 2Z5FA 3PHHA 3ZOZA 1Y3CE 2OR3A 3HMQA 5TNXA 1IOZA 3GU3A 4BLVA 3C48A 4BQRA 1KP2A 2HLNA 3T3HA 2IH4A 5HSGA 1BKSB 3ZK9A 2JI6A 1NN5A 1ZL2A 4FHEA 4MW7A 2GXAA 4JR2A 4GKAA 3IO5A 4FI3F 1RWNA 3IIEA 2IZ0A 3LKZA 3P9QA 3Q1KA 4JZKA 1PLKA 2M6KA 2MINA 2OP1A 4MJLA 2QD1A 4HZUB 2GBLC 3A1NA 3UTDA 4A92A 3LXUX 1YCGA 2C8LA 4MQFA 1NJ2A 1WU7A 2HJWA 1AHPA 3MJ4A 2JBAA 4NYIR 1B16A 2LV8A 1KI8A 1AKMA 1CUHA 1SXJA 2BONA 2NXCA 2WIJA 3GB9A 3GAFA 4YCNA 1SA0B 3EISA 1RAGA 1BXGA 4OXRA 3SLKA 1GQQA 2XB2A 1Q0SA 2C07A 5EE0A 4E6PA 4R1QA 2X6RA 3QYAA 4NCNA 3DZ8A 1W7AA 2PTHA 2DR2A 2OKCA 5DYTA 4CM4B 1Y7IA 3V9PA 3HUDA 1S2GA 4A8JA 4X65B 2V7TA 4MVJF 2QX8A 1FDUA 4QPZA 2GN8A 4EZBA 2CVFA 5I7UA 1OBOA 3Q3GE 1XELA 2BVNA 1G59A 2YN4A 1PDWA 2YVAA 3KWMA 3DLIA 1I0LA 3V8NA 1XVTA 3FTQA 1L5LA 4KCGA 2Y77A 1JDBC 3UT5B 2QJRA 2Z56A 5HFJA 3SYTA 1BHQ1 2VNKA 2BJHA 3PNKA 4Q7MB 5I9TA 1U1CA 3EY9A 3G7UA 2EP5A 2FP4B 3MWJA 3QMWA 4OXNA 5EJ9A 1V4BA 2BTQA 3PG5A 1OWOA 4WA7A 2PQ2A 2HQ1A 2W2VA 4OIMA 2H52A 2VJNA 3BE8A 4MEJA 3B9QA 5M5BA 2B92A 2ZCJA 3OTQA 2P9JA 2WEKA 4H31A 4PLVA 3VU0A 4NCXA 4EZEA 5K0NA 1EK1A 4MQBA 3OEHA 3AKDA 4L0DA 4K28A 3H1AA 1GQFA 4FT4A 1L4UA 3W5UA 4O4HF 3L05A 4Q12A 4BFXA 1J22A 2VTEA 5CFNA 1I2MA 3EF0A 3ZG6A 1GAQA 1F5NA 2EWWA 4BE9A 4LK2A 2DCUA 3EPRA 1J5PA 2J87A 2P9YA 4RA9A 2I71A 3U4QB 1W34A 2W8BB 5LBIA 2Y1KA 9LDBA 2IWHA 2V3WA 4DV0B 1EM8B 4IWNA 2ZVDA 3UMVA 1RQGA 5EE9A 1NJ1A 3Q7IA 3W9UA 4MTLA 1W36D 4F97A 1M2WA 2IDZA 2FZGA 3H9JA 4L3VA 3H5VA 1Q3TA 2VHWA 2IEBA 4MYTA 2YFKA 4TLLB 2W6ID 3KR2A 3AEUB 4MO2A 4WXRA 3INGA 4Y6RA 4PC7A 5AJXA 3V00A 1TO6A 1JVSA 2BHTA 5EXSA 3SZLA 1SKAA 3FWYA 4S1OA 1O77A 1Y9ZA 3EPKA 2HHHB 3EF3A 3NEJA 3OQBA 3RTCA 1AY0A 4X1YB 2D06A 2ECQA 2FW9A 4U00A 5L3RA 4OHVA 4MR9B 2NXNA 4RK5A 3RLIA 2CHQA 1M2NA 4IHKA 3MWEB 2ZYGA 1GD1O 4OX9B 4EQ6A 2C3OA 3O74A 3NPAA 3DA8A 4WLVA 5TMBA 1Z39A 5EP4A 1VGQA 4UBOA 5B64A 4D8VA 2BFFA 1ZVJA 1SH7A 4G09A 3BWYA 3OSUA 5LMUB 2B1IA 2PX2A 2AQ8A 5EPEA 3OX2A 5F35A 4C78A 1Z35A 4ABTA 5LYJA 1P1HA 1QF9A 1GKLA 1D5CA 1MB9A 3ETNA 4N7BA 1JMYA 3UMJA 3QY9A 5JD3A 1XDWA 4I4LA 2R8EA 3JQBC 1PT6A 2EEPA 2RK3A 2D1FA 4DBVO 4DB2A 2JCXA 2IYOA 3EIQA 5AI6A 2YIMA 4N5IX 3BSFA 3N6RA 5E0KB 5BN4A 1H93A 1OFIA 4J1SA 1DEHA 3I32A 4EGFA 1QRUA 4YJGA 4C5CA 1NBIA 5TVGA 3U44A 3LNTA 1M7HA 3CBGA 3HGMA 3PUWA 3QU7A 2QQ0A 1PJTA 1ZK3A 3HFJA 4M88A 3T3NA 3KP1A 4N9WA 5JYDA 5LQSA 3IQGX 4ZJUA 1HSOA 2H0QA 2OLEA 1W94A 4MQFB 4BMYA 2YXBA 3KQYA 4OOFA 3WIUA 1H69A 2JBAB 4F12A 1SXJB 3JZIA 1W75A 1H94A 5T3UA 4RHFA 1D2GA 2B37A 2YY5A 1E4OA 4FGLA 4MRVA 5ALSA 4QFBA 5I5EA 1ZH4A 1BXGB 3UMRA 1NR5A 4OLAA 1ZGAA 4M0LA 1K66A 2VP3A 2XNDA 3U56A 1UKYA 1VJGA 1U8CB 4PN7A 1SCNE 1UZMA 4A8JB 4BLWA 1OZAA 1QYRA 1Y8QA 1OUMA 3A7EA 5H4GA 3OA0A 3HWX1 5KTPA 1APBA 1H65A 2R86A 3SLRA 1BH2A 2XMCA 3OTHA 1K7SN 4RKRA 3SQOA 3TEFA 2X0KA 3MGKA 5SYAA 3HYLA 4OHKA 2ZPAA 1UM8A 3WDSA 4IFTA 3AOEA 3S2YA 2XW6A 4FCVA 1KP9A 4V0NA 2Q0HA 4XJXA 1TFUA 4WK0B 4CNQA 5E2BA 2VC2B 3EFOA 3WLPA 2GM5A 1UXIA 5A3SA 4WCDA 2EFHB 2VA8A 4EF6A 5KWVA 2BTQB 3M1AA 5JNWA 1HDGO 3C7AA 4P0QB 4CBVA 3O82A 5KU1A 3PR1A 1EVKA 1HL7A 1E2JA 1XDBA 3NBUA 5FQOA 3UVEA 4HKTA 5CITA 4L22A 4MIYA 3FTCA 4ZC1A 5ALJA 3TG8A 1QVRA 5L3QA 1Z3IX 3KSMA 4INJA 3V9AA 4Z54A 3CN9A 3M89A 1QFXA 2ZAGA 3TECE 2A8YA 4GECA 2R7AA 1S2DA 2R47A 2XVAA 2QI9F 1GZHB 3G8DA 2P2LA 3VU3A 4JYCA 1XU4A 1HO3A 1UT6A 1Z4LA 3ZE7A 2W11A 4FPXA 3VZDA 2OMKA 4ASUA 1SKMA 3FOEC 3A10A 4LJ9A 3QU2A 3KT8A 4DM7A 1CY1A 1JDVA 1JTVA 2Q21A 4COOA 4RZIA 1H1DA 3A7DA 1QHFA 1U0TA 3HJUA 1DHTA 5AKHA 4RMGA 4PLPA 3WKBA 2ODBA 2Q45A 4FYIA 4MYDA 1G4AE 3SI7A 3T9AA 4RA9B 5PNTA 3GP5A 2ZE6A 4RQUA 4X41A 4GWLA 3LAWA 1Y98A 2XB6A 1VJ1A 2HY7A 1TKAA 3ZWQA 1YFZA 3DMFA 3HQ4O 2HSJA 3ORHA 4TWJA 5ALEA 1XPRA 4E09A 1FCJA 1Y3BE 4S1NA 5TVKA 1DARA 4B2IA 1DX9A 4BKQA 2BH9A 2D54A 2G8NA 3X1MA 3TRJA 1L3BA 1MJGM 1XKXA 3H2KA 3LK6A 3BGSA 1U1IA 2B34A 4H16A 3ZZTA 4IDOA 3D0OA 3EDYA 4A2QA 1I14A 4JLAA 4BKOA 2WMDA 1Z6ZA 2XRMA 2ZOSA 2C03A 2RMKA 2IFTA 1CNEA 1XMSA 5AESA 4P2GA 2VUTA 4RVFA 3A4IA 3IEUA 4G26A 3DHNA 1UDBA 3ZLVA 3STVA 4A26A 1QF7A 3D7KA 4EG3A 4DLLA 3NKLA 3T94A 1YE3A 5GIPE 2FP3A 3FTFA 2Z8YA 1P6XA 2NIPA 1FFBA 1NBEA 3L4EA 3SSOA 4NTZA 3AL0C 2IP2A 4D9GA 1XHFA 2BFFB 4EG6A 3CNNA 1KGDA 3N2GA 3D4LA 4KQ2A 2MSWA 3JWPA 3IDQA 2VYCA 3AR4A 2LGJA 5LYJB 2I2DA 4HB4A 1X9HA 2PZKA 4QHYA 3BK7A 1A7KA 4R8LA 1EA5A 5IEBA 2FXVA 2GBIA 3LH5A 3NP9A 5JTTA 3KE8A 1MJFA 5BN4B 3NTQA 1DJLA 1RPNA 2GASA 2DPGA 5F7ZA 2I80A 3LZDA 3LQ1A 5FL7A 4B87A 1UPFA 4GS5A 3KL4A 4IMJB 1HA3A 4CPDA 5LN1A 1DMRA 3ANYB 1IUPA 5KYYB 4WXMA 3K31A 3WRWA 3R5JA 1LBIA 1BDJA 4JBIA 4BQIA 2V7PA 3OIFA 4M0EA 3EQ6A 4AK9A 3KHTA 4HNVA 1O94C 4R9VA 1CJMA 1Z7YA 3ZHUA 3A1TA 4DCVA 4C4TA 4IL5A 4WPGA 3GT4A 4MHSA 1MRZA 1EVZA 5B1YA 2AG5A 1EFAA 5FEMA 1XDGA 2QK4A 4HAXA 2VP5A 4JQCA 3TIGA 3L82B 4EB6B 3MSXA 2VH1A 3KSZO 1Y6FA 5KTTA 3BD9A 5D7BA 5FFNA 3T99A 2GGSA 3M1YA 3BSYA 3PP8A 5FORA 2JLAA 4M8SA 4Z2YA 1FTQA 3L9XA 2D4HA 4QT0A 3RASA 1YKGA 2HSGA 3F5FA 2F90A 4DQXA 4E21A 1SOAA 2JCGA 3KELA 5IC5A 1Y8QB 5CFLA 1FMJA 3MJHA 1EFCA 4QC2A 1RJDA 2WAOA 3OTIA 1DS6A 1NXQA 2TYSB 3AW9A 4M83A 4PGHA 3WISA 3FJOA 1RR6A 3ZGVA 4RXUA 1KI6A 1XU9A 2Z09A 1GZ7A 3HRIA 4OA8A 3RNLA 4ZYVA 2ASVA 3U6KA 1P0IA 4G0OA 4EHKA 5DSZA 3VTKA 1VE3A 4N7JA 2GK4A 3AETB 3JRWA 4UCWA 2IU0A 3EZ6A 5F5NA 5CBKA 2QVLA 3DZJA 3OJLA 3EFOB 3JQQA 5HHTA 2ZREA 3C16C 1YB7A 4IQ0A 3FJ1A 4C4YA 1E2MA 4Q03A 4F5EA 3GHHA 2QTHA 4D02A 3LJKA 4KBYA 3H8WA 3PFNA 5H81A 3WGUA 1T2FA 5F9MA 1H9CA 3WWZA 3GLGE 4GL4A 3EULA 3IB3A 4M7OA 1KJIA 4URWR 1UBUS 3WYFA 2XLBA 5CT5A 3NT2A 1RYBA 3NDIA 3P1JA 4MV4A 5L3QB 1M1ZA 3HCBA 5T4BA 4KVGA 2CL6X 3E1GA 5KU7A 3KQWA 1IBCA 1MZPA 4DHWA 5BORA 1P6UA 3NVDA 4R1OA 3LVRE 4XRRA 2RE8A 1MQ9A 1X7GA 1G21E 3C85A 2RKWA 1E9RA 1E89A 4JB3A 2PL3A 3VNQA 4AY4A 4EPVA 4QOFA 1TADA 1TRKA 2B25A 2O2EA 5IMSA 3CLRD 3R8FA 2I3DA 5A9SA 2X5KO 2XI4A 1E1DA 4NSNA 1VHJA 4KUGA 1TEVA 2XWQA 4Y1RA 3NHLA 4HRAA 2AN9A 5EWJA 3UATA 4BMZA 4KDEA 4D25A 4FN5A 2AW5A 1EDEA 3CYFA 4P0PB 1N2OA 4ZDIA 1YZUA 1C3EA 2AN1A 2ZLBA 1UF9A 2EBUA 4FD3A 3T3MB 2D5IA 2JRLA 2XADA 1SK9A 4YXFA 2PAAA 5GADl 3CR3C 1QRAA 4OQLA 3VNUA 1OWMA 3V4SA 3LHSA 3BYZA 3WIOA 1G7RA 5CK5A 4EG7A 2WQ7A 1KTVA 3IJEB 1RTTA 3PBKA 4YK7A 1WUYA 5JYEA 3DONA 4MB2A 1J49A 4LXIA 1I1HA 1OVGA 1TU0A 5F4ZA 4F1JA 2QMZA 5ESWA 4F11A 3ND5A 1T2UA 1SBTA 2YIVX 2X23A 4M0UA 2V03A 2V6BA 3EUWA 3NGXA 1Z12A 3NC4A 4KRXA 4Q0MA 1AHIA 4EI9A 1XALA 2FZVA 3BGOS 3KV3O 1HEYA 1E2IA 1AQYA 3CQ9A 1PTJC 2C2MA 1IHYA 3N2GB 3OFJA 1U3TA 3CXUA 3Q0EA 3HE3A 2CHGA 3NONA 1VYTA 1Z0IA 4M49A 5FL3A 1JAIA 1UH5A 1U7PA 2C04A 4YHBA 2B7CA 3A3KA 1JU4A 1XDUA 4MWBA 1MB3A 4G01B 4GEKA 2W2TA 4PYOA 3EQ7A 1FTYA 2IPMA 4UHDA 1JV2B 3GLIA 5AM0A 2EG5A 2WWFA 1N6HA 2EW1A 4JJ4A 4UD2A 3U4HA 3VR4H 2WFMA 5TMEA 2HLDD 1YOBA 3PFKA 5AHOA 5LDHA 3QZUA 3CB4A 4HEJA 1KJ8A 1RM3A 3OWHA 4GVXA 2OLKA 2XDQA 1NBMD 3N07A 4EUFA 2G82A 4FOSA 4MP8A 4JLDA 1XQ1A 3R5TA 3MUOA 1Y8RA 1I2BA 1AE1A 4E22A 3AQIA 2Y0CA 2JDIA 3DSRA 1E0DA 4U0KA 3W9BA 2PKEA 3CU5A 4F9TA 2WABA 2Q4OA 2QJOA 3FLEA 3QUCA 4X84A 1VKJA 3GJRA 3DF9A 2JZNA 2OCKA 5J1SB 3DZKA 2FJ0A 3PHLA 1RRFA 1QZXA 5DXFA 2ZTLA 3FUCA 4R31A 4LSWA 4WCFC 3OP1A 1B93A 2II6A 1RHRA 4IZIA 3AR2A 5FOTA 3SG0A 5HP4A 1ECPA 1XDSA 1IB6A 4RVDA 3V8BA 3ZN2A 1ZS9A 2I22A 1GQRA 3GH1A 4DWJA 1MTZA 4EHLA 1DUIA 4PYQA 1ZKMA 2ZDGA 1T6BY 1M1YB 4JBGA 4TN5A 1OZ0A 1KY4A 4JB2A 3R5FA 3RC7A 5CB0A 1EGVB 1X13A 1AA6A 1X39A 2FDRA 3OC6A 2VTDA 2WZCA 4K40A 1QRSA 1W2WB 1FA9A 2OESA 3Q8XB 2G9QA 3PXAA 3FPSA 2CXHA 4Q7EA 4G8DA 3RVDA 4IXWA 2BFDA 2QP4A 3ZV7A 3RGGA 2IYNA 5DX8A 3TOSA 5IPFA 3OHMA 3CKLA 2ZK7A 4RSHA 1FFWA 2GRJA 3I5UA 1T5LA 2WPDA 1IY0A 5B2FA 1T9GR 4D79A 4EG5A 1YQEA 3GK3A 5L3SB 2CV0A 4S0ZA 1L2TA 1W8DA 1N9ZA 1P1IA 2JJ2D 3P4YA 3SQWA 3NWBA 1N3IA 2Q8NA 3HVIA 3V3TA 4LZJA 3R9KA 3GR6A 2CB9A 4WNYA 4C7XA 1RI1A 1VL2A 3KEQA 3G0OA 2GILA 3OO1A 3LLMA 3Q3CA 3QIAA 4NCIA 5E4TA 4RDHA 2PL9A 3RJZA 1RJ9B 3K32A 4Z7JA 2ZU6A 3DT9A 2VK1A 4ESEA 3PFBA 1C0IA 1GGVA 5A9SB 4FX5A 3HRHA 1EPUA 3DTNA 4TVKA 4Y1RB 3BIOA 4FLEA 1XBTA 4GFDA 4GW3A 4BZPA 1R5JA 1RBQA 4G97A 5CMLA 1F17A 1HSZA 3C5WP 4C4AA 3NHUA 1Q50A 3OZGA 4NYJR 1L7QA 3PQDA 5TF0A 3BXZA 4ARAA 1SIBE 3K0BA 5DRTA 1NC1A 4DMHA 2FMIA 3PQ7A 4WVFA 4XIGS 1HE1C 1XCBA 1R50A 3KLBA 3OFND 3QUAA 1K8QA 5DW3A 1XCJA 1ESMA 1U5BA 2R751 3GUCA 1N1GA 4NCAA 1QOZA 2JLCA 2PRYA 2ZSFA 3KVNA 2VSFA 3PICA 3CJQA 3ZH9B 4BL5A 3NV7A 5K01A 3EUEA 1W4AA 1MENA 2GPJA 3AI7A 2H1LA 3L7KA 3R0QA 2VDNB 3WTCA 2ZIXA 4N0PA 3GDFA 4D98A 1VL1A 2ZE8A 1UXHA 1QLJA 1OTXA 4K6FA 2E4XA 3ABOB 3EVTA 4J16C 2ZIFA 3RS5A 1QMPA 3A6GA 3W6ZA 3V1YA 2K2QB 3JASA 1W5EA 2ORYA 1QK4A 2G25A 3ZDEA 1JEYA 3WR5A 3WZLA 5FD8A 4MCHA 1U3FA 4J3JA 3AF2A 5BP7A 3GLHE 5IT9A 1U98A 1YQXA 2EFGA 3GFRA 1CBUA 5DIZA 3UK1A 3FG9A 1S0UA 2GO1A 3R41A 3W5DA 3WGTA 1L7PA 1YCFA 2QV7A 3V8PA 2J0QA 5BT9A 3K70C 3C3EA 1A9ZA 4YJ3F 4C6HA 3A31A 2PVCA 3PQEA 4S04A 3D8SA 1P4GA 1ULZA 4OFWA 2XDQB 5LZ7A 1M0SA 4PYMA 3AKCA 2F2TA 5SYNA 1NTRA 2FEXA 4YO7A 4ZI5A 3TOVA 4EA7A 3QY0A 5CB4F 2PS3A 3P9IA 4UEKA 1D6SA 2HT6A 4Q4AA 3BDVA 1C9NA 4BECA 2RFLA 4D3SA 3MG9A 1BJRE 5BW4A 1ZK2A 2VATA 3DZFA 3GT0A 2XCOA 3EIUA 4K86A 1GPMA 4RHXA 2IUEA 5K51A 3PT5A 1IAQA 5JS8A 1PO7A 5KHLB 4HNAB 2J9XB 4Z3KA 3ZQJA 1IZ8A 4EO7A 1NXTA 3P7MA 3HCNA 4RPHA 4TVOA 1STOA 5BY2A 1TJ3A 3QEJA 3ZY3A 4TKLA 3RJTA 4TS1A 1AB5A 1D2AA 1DCKA 4G0VA 4TKVA 3ZZNA 3FW1A 3RSSA 2I7TA 3EXHA 3IDSA 1YAJA 4M8KA 4JITA 5C1BA 4KXFB 2Q7XA 1XRQA 1PJSA 5IAAA 2ZRQA 1X42A 1X1SA 2BEUA 1Q44A 4G3XA 4WLNA 4QREA 4V0QA 1WB9A 2RBGA 3BXHA 2KPOA 3T3EA 2DFPA 1PNTA 2IXTA 3RFVA 2DF8A 5K8CA 4Z51A 5GAJA 2ZRBA 1NXXA 2GBPA 2IW3A 1PDVA 4EVSA 4JIMA 2JAXA 3VSBA 5ERXA 3TZLA 4QXQA 1UDAA 4IXMA 4XUCA 3V48A 4E5UA 1W30A 3PI6A 3AEZA 3SC6A 2RC6A 5M2QA 3FR7A 4QT4A 1TD1A 4JLPA 1N6PA 4JVSB 4M9CA 4W5HA 3GCWA 4BMVA 4F5ZA 3THYA 1NHWA 1EWQA 3ZZMA 2AKEA 1FU7A 4EJFA 4Z49A 3BXOA 1CY0A 1N25A 1TX4B 4X66B 3EOZA 4UJ5A 3S4YA 4LY3A 1KBZA 2OBNA 3F3SA 1U0FA 3P27A 4F85A 1OXUA 5ILOA 4EJ6A 4OM8A 2J0VA 4TXHA 1YQUA 3LW8A 2XTMA 3O6VA 1KQ3A 3VGJA 2UZ1A 2X13A 1ILWA 1ECCA 1U7DA 5DHRA 4DL9A 3GNQA 1QSGA 2DH6A 1XNHA 3EH2A 4EQZA 1DP4A 1PT8A 1H66A 5IF3A 3PQ6A 6ABPA 3WHKA 2C9OA 1QF6A 4MRSA 4IUCS 1LPBB 2MR5A 2OMEA 1Y37A 1JHOA 3H6KA 4MVJI 4EKDA 3MRVA 1U1EA 3T7SA 2ZKLA 3NJ4A 2QSUA 2RH9B 2EQ5A 3A6JA 3NCHA 4AF8A 5HR5A 5D2CA 4XYGA 4XYEA 1R4ZA 4X64B 1XV5A 4HVLA 1H3NA 3ICVA 4CN9A 5LQRA 1YBMA 1CF2O 3ZDRA 4CF7A 2PLFA 3SYMA 4IINA 1U5BB 4IWXA 1FJXA 3PEEA 2C2GA 3D7NA 4LHVA 1MGOA 4QA9A 1IDOA 1XZIA 4N41A 4NBTA 3ZGZA 3H1TA 3DMTA 1UPTA 3PQ4A 2ZIXB 1AKVA 4ES6A 1GLNA 1TIPA 8MHTA 4GWKA 3VU1A 1SPXA 1Z68A 4UUOA 1B74A 4XX0B 4ZOBA 4CFZA 1FC0A 1WXWA 4TWZA 1SU7A 1KHHA 1T2CA 3JASB 3JYPA 5BXYA 3A0RB 4DR3B 5ECWA 1KHTA 1RPZA 1JEYB 1UPUA 1WP4A 5E7IA 3ZEIA 3STHA 3LNCA 2HWKA 4NESA 4EITA 1RKBA 1QUFA 1XFAA 3E9CA 4LWOA 5B6JA 1G8FA 2OFXA 3CZPA 4EHBA 4QLBA 1YU9A 2J6CA 5D84A 4LDRA 1NNSA 4EHDA 3NUQA 3HHEA 2GBGA 4JBXA 3KKQA 1JQDA 4KQHA 5DHTA 3PHCA 4IUYA 4NV0A 2G83A 4BMDA 1AK1A 3OPQA 4KBGA 4CV3A 2C29D 2FLKA 3KC2A 3ZUPA 3LGXA 4AKSA 6ADHA 3IEXA 3GNTA 1H8HD 4Q4AB 2OV1A 2FQQA 4N3NA 4IYRA 4HGRA 3QLVC 3TNYA 2QXTA 3E7PA 3ZLBA 2POCA 4Z5XA 1RWOA 3R5XA 2ID7A 3HDYA 4D0LB 4Q3KA 1T5HX 2YCLA 1TOAA 1Q1QA 3H5LA 3IOMA 1YRQA 4JLVA 4MA4A 5E3JA 3WL8A 4FFBA 4P33A 5AI4A 1LRLA 1QVWA 5EKDA 1C0KA 4FZVA 4EG1A 2DULA 5HIIA 3CVUA 1WEHA 4TKVB 1D8TA 4DG9A 3ONDA 4BRUA 1JKIA 2CXPA 2FA9A 5AOCA 5JISA 3E3LA 1HRDA 4J2OA 4EHFA 2WTNA 4HV4A 2GVZC 4BEVA 3HA5A 5TRTA 4O5AA 3MJDA 3H5RA 2G72A 2BEUB 3OIUA 4EY6A 5HUHA 4C2AA 3HO6A 1DX4A 4K9SA 2X2FA 3A14A 2DTDA 3JYNA 3LQYA 3VR4D 4BNLA 1AKWA 3BL5A 3CB2A 2XAAA 3GDHA 3P2MA 3R0ZA 2I2CA 4L51A 5T6BA 3ZR4B 2Q3LA 3WRYA 4QM7A 3DYBA 2F17A 3O0DA 3SBOA 4HYQA 1XVLA 4ZDWA 1IRXA 1R5NA 1SOUA 3LUHA 1T35A 2WJPA 2PSDA 4ZO8A 1RKVA 2Z6QA 3D8BA 1UUFA 4MWSA 3M82A 4Q01A 5TQ0A 3QVWA 2JD0A 2XTAA 4DLWA 2WNIA 4AZWA 4YR9A 4C05A 4PPQA 1V6AA 2UKDA 2P9HA 2G17A 4A0FA 1TKCA 1X7WB 1W4BA 4UCQA 2QRZA 1AF7A 1BEZA 1K92A 3HFGA 1A50B 2OBXA 2XRYA 4IJUA 2PUJA 3WYBA 2B6HA 3OU6A 1KWGA 2A9RA 1SIOA 1V25A 3PCRB 3TXYA 3L0BA 3L4BA 1XX6A 1QV9A 3ICOA 1Z4JA 3ON5A 2PSFA 3HEMA 4LEIA 3U3XA 4I4TA 1EEHA 1AQIA 4RE5A 2BTOA 1C3JA 4C9BA 5AM3A 1UWVA 4DWVA 3MFYA 4BKUA 3VDNB 4MI6A 4WE3A 2J32A 2FUKA 3HLTA 1O6GA 1Y4UA 1UFOA 3KYCB 2DFVA 5IM5A 1YASA 3NEAA 5LUAA 2ZM5A 1JYEA 1MT3A 1V95A 1N2GA 4I2VA 2CUTA 1F2UA 3N6VA 4NE9A 4EB8A 1FDRA 2NTNA 5JASA 3MRXA 3QVTA 3T34A 1EHIA 2B7LA 1WVMA 3QUTA 4PQEA 4F1WA 1C1DA 2RGWA 3OLCX 1YRYE 3DT6A 3DE0X 3V4VB 1TKRA 3FUXA 3GFBA 4JZYA 1WCV1 4IDNA 4C20A 2GN9A 3MOIA 4ZVMA 4IRMA 1LDGA 2VSOA 3DGFC 2G09A 1SCBA 3FVRA 2IYRA 2SKDA 4R6WA 3WHPA 4X8HA 3EHEA 4TSRA 3SYNA 3DXZA 4DABA 1E9DA 1B41A 1Z34A 3H2GA 4IBOA 4AL4A 6NULA 2Q3EA 1CVLA 4M1EA 1EXVA 3NFYA 3HYRA 1R74A 2EW8A 2QP3A 1BEUB 1WXQA 2WYWA 1YACA 3K7EA 4NJMA 1PJ2A 2P91A 5FA6A 5DGHA 3X0DA 3IA7A 4ENRA 3PXCX 2AUTA 4ZI3A 1IBLB 1S2OA 1P77A 2C9CA 4AWXA 2RHGB 2DTEA 1M6YA 2FGJA 2FEPA 4LUCA 4C3OB 2WHPA 5JO9A 3W9SA 4O2AF 2WQZA 1UK9A 2Z6UA 2AN3A 3OESA 5C8VA 4NYMQ 1R6VA 3KS9A 4OQEA 4OLFA 4U9HS 3FYCA 5AJUA 2IHNA 3UMBA 4CZ2A 5A5GA 1XMQB 4BHTA 3LCMA 4IDDA 4HQOA 4ZCPA 1JRLA 1E0SA 3EPJA 1OXKB 1PZNA 1T3TA 3WRVA 4GPD1 2OM2A 4HMPA 4OPMA 2JIZA 2R2GA 4KFRA 1SHKA 3AFIA 4LSGA 1RHKA 2F3RA 4L5CA 3ZJTA 4Q6BA 2YZNA 3EXG2 4CU2A 4ER3A 3TEJA 4H15A 4MVJM 3P2KA 2CJPA 1V2GA 4TOIA 4IIHA 1MFZA 1J09A 1LSOA 1XUOA 1FPQA 4EEZA 4RL4A 1CDDA 3MD0A 2JH9A 2D8AA 2IKSA 3Q8WA 5F12A 4CW7A 4D9BA 7AT1A 4BASA 1IUKA 2IEYA 1ZM9A 3BXPA 2DUNA 2G8LA 1T3SA 3SLGA 2A6PA 1XVUA 1P1RA 4FFBB 4X8LA 5LMNB 4DC9A 3SCZA 2UDPA 4B31A 4UDXX 5BSKA 1X9IA 2YWGA 1A4RA 1RXEA 3GLRA 3HY6A 4C0QC 3OE1A 2VK2A 2WP0A 2ZRIA 2QN6A 3GMIA 3HFRA 3MAJA 3P4XA 1IE3A 2Q62A 2ZPUA 3M34A 4NBRA 1PNRA 2FTKE 4TWRA 1NX9A 1DUVG 3F73A 2JKZA 3L18A 3D5QA 4M0PA 5FPKA 2I2FA 3D3NA 1IUNA 1R8YA 2ORIA 4N5HX 3N3AC 2P5SA 5HFAA 1X1EA 4MKZA 4LRXA 4DNPA 3WV5A 2HJRA 2ZXUA 2P62A 2O1SA 1GQYA 3EVAA 1SVSA 1GYRA 2NLOA 3IBCA 4GRDA 4HWGA 5TQ0B 2P11A 1G7CA 2CFSA 4HDSA 2V5VA 2CK3A 5COQA 5IVKA 1KBQA 3G7NA 1W35A 4J07A 4R7GA 3REQA 2XRZA 2FKAA 4R9RA 3Q3HA 1CJVC 1O8CA 1Z8FA 1ZCFA 3K9HA 1S96A 2QNBA 4Z9FA 4KLCA 2DBRA 1EVJA 3A6LA 3CZ5A 5EEHA 2QV0A 4B3IA 4YR7A 3F96A 1NQWA 4Z7OB 8ATCA 2J3QA 1CQXA 2FB9A 3HCEA 4IOKA 1WABA 1H9BA 3NAQA 4OA5A 4YO8A 5JCXA 3MJVA 4XIJA 3RUDA 2OTCA 4D0GA 4XE5A 2BFAA 4U5QA 2VPZA 4EA6A 1EVIA 1NOJA 1TLTA 3MT9A 3D4IA 2UZ0A 2FEMA 1L5MA 1DNPA 4MWEA 1JH9A 3K5WA 1Q91A 3FTPA 2XMGA 1N6KA 1WOYA 2YWXA 4QM6A 2W7TA 3CLUC 4CNBA 2PMKA 5E95A 3PEFA 1X1AA 1VRVA 1N4AA 4E1AA 4ZYYA 1A72A 1E60A 2OO3A 3K9WA 3PFHA 1K89A 4RD3A 1BE6A 3R8XA 5HNKA 2YV4A 4DILA 3TRHA 4QXAA 1A9YA 5D6NA 4GPIB 3PUVA 2HA3A 4L73A 3N53A 4RFSA 3VOAA 1O0BA 4BDSA 2OXCA 3E5NA 3NHPA 1FVFA 3UWKA 5JS1A 3NORA 5JVDF 2I6GA 3E9ZA 2OCPA 2NTYC 2Y1EA 1P7WA 2R00A 1Z75A 1E61A 2GN6A 2QP9X 2ZSEA 4GQIA 3TFQA 5C37A 4AC9A 2R1VA 3B9PA 2D5CA 4WKNA 5KOJA 2IH2A 1KU0A 1TM4E 4NJMB 3D8UA 3ZU5A 3UW3A 1NPDA 3DVRX 2PXHA 4JUIA 3ZK7A 4B3JA 1OX4A 3MLBA 1ISSA 5EZQA 2C8KA 3S99A 1XP8A 3W2TA 2WHPB 4PPNA 4BIMA 1AGXA 2AOVA 2QWXA 3BIXA 3LC0A 3PE6A 3PYLA 4P54A 1EXMA 1BWQA 1K88A 4GI2A 4QXMA 3QE3A 2N47A 3OM1A 1K68A 4UREA 2APJA 2IEAA 4RJKA 2GZRA 5FUYA 5DYIA 3EWSA 1WAMA 2FWNA 3CS3A 1D2MA 1Z4KA 3FUUA 3T5DA 1RBYA 5KNCA 1E5TA 3DNFA 4U1RA 3B2NA 3C39A 1SCKA 2ODQA 3K9NA 1QQ7A 3MMZA 5ALKA 2E82A 3NFRA 3CUYA 4OK3A 1NFRA 3R9IA 1NSYA 2IXEA 2J30A 3KXLA 1JLHA 3A11A 4J0DA 4KTTE 4LDAA 1UJBA 3RUPA 3JVUA 1SXJC 3WLAA 4F3YA 1OBVA 4V1CI 4QPPA 5LQCA 2NQTA 4RSMA 1DKPA 2OY0A 3RVJA 5AM2A 5DEOA 5CVTA 3ZE9A 4ZIRB 2EKLA 3VR6D 4EGSA 2XKAA 3CF2A 5GY7A 2QTAA 4HXGA 1LV8A 2IV3A 3UW1A 4A6EA 1KAQA 1ZUHA 4QPNA 3QMMA 1ORIA 4A8JC 5CD9A 3UTCA 2AUMA 4NXMB 1PN3A 1NIPA 3VVCA 3X1KA 4IX1A 4JMLA 4UD6A 5C31A 2RHHA 4FC6A 5CTAA 2FN9A 3LDUA 1VCMA 2BFEA 2ZRJA 4NECA 4W7IA 1PG5A 4BVBA 1J9EA 4G0ZA 4Y2UA 3LC2O 3RIMA 3S8EA 4BXOB 2XUPA 5PGMA 5F23A 3CX4A 3R9XB 2IOYA 3PUXA 1KARA 4PLHA 5EJ4A 4Q9DA 3PNVA 4HS4A 2WHEA 5C81A 4ER6A 1A8PA 1EJ2A 2JEZA 4BY9E 1GIAA 3LPAA 3A1EA 1FYDA 2F43A 1QRTA 4M0KA 1T10A 3KSAC 4HDSB 3V42A 3M6XA 4KODA 3RKSA 3REQB 4CCYA 4ZAZA 5D1NA 5GQSA 1XAHA 4IH1A 5KREA 2MMCA 3B2QA 3DHVA 3C5HA 4MWTA 5KTMA 2VNAA 2KWIA 1J5EB 5CVCA 3FYUA 5E3HA 1OHHA 1LC3A 4B3SB 1I80A 2FX5A 4KWHA 3SZRA 4W5RA 1AUQA 2I33A 3LD9A 5JJIA 2BP7A 2ZJBA 4IOLA 1VPEA 1BVRA 3HZZA 4I1PA 1ZGBA 3D64A 5F33A 3BMOA 4XVQA 3CSDA 1HDRA 1KR5A 4DSNA 3HFSA 1N2SA 4NMWA 3Q9UA 2PXCA 1Y9DA 4ZOQI 1ESDA 2Y76A 3KPJA 4I4CA 4TX1A 1HNWB 5H0IA 2PMCA 5DO9A 4HVAA 4TM8A 3KAKA 5DTRA 5KSPA 2ZRMA 3ZCXA 2E4ZA 2HADA 2XKBA 3B6ZA 1NVAA 2YHSA 3RBZA 4JFRA 1KZ6A 2ZWMA 3LU1A 5IAJA 4KR9A 3S2SA 3WMGA 1QIEA 1ECBA 2M9MA 2GEVA 5C8YA 1FPMA 1PFUA 3RC9A 4RFSB 3UN1A 5JJLA 2A0XA 1QANA 2R44A 1E2EA 2NSHA 3WS7A 4BVLA 2ZAIA 2RDMA 3JYOA 1F2TA 3GZNB 4Q5IA 3UXMA 5C3UA 3I8SA 1R6BX 2D5AA 3ZHSA 3JYQA 1RFGE 3VH3A 3ADBA 3KWLA 1KVTA 2Y4NA 3AR7A 1E2KA 4N3GA 5AVOA 3E4DA 3W1EA 3EDCA 3EYAA 3DOHA 4MOWA 1EHCA 4UCXA 3LOPA 1N0UA 3KJHA 1LK5A 4MV3A 3RIGA 4CHGA 1OX4B 3M4NA 5IJXA 1I6KA 3AL3A 2QLLA 3SQLA 1JG1A 3SYKA 5E1DA 1Z56C 3JQAB 3KT6A 4ZO6A 3CIOA 3OCYA 4KUHA 2P3OA 1ZP6A 2YTZA 3VVBA 1P2UA 2H2HA 2IIPA 4QYXA 3EA4A 3D4NA 3GT7A 4K6CA 1KDRA 4FGZA 3F8WA 2OXFA 1UBLS 3KG2A 3AI1A 3NXKA 4F2GA 2AOXA 1TQ6A 1ZUNB 1TMYA 4UBNA 3NBFA 1ZK1A 3COWA 4UUPA 3MJFA 4S05A 2ESRA 5E4JA 1QONA 5SYMA 1Q57A 4HJRA 2PWAA 2V1UA 3K6JA 1CRLA 1BWRA 1Y1SA 1T13A 1HDCA 4I14A 1ITZA 1CZOA 1UP7A 3MWDA 4H4CA 4JVNA 2FN8A 4QO7A 4YFYA 1OA0A 3X1YA 1C2YA 5I4CA 3QPVA 4IFBA 3DP7A 5K99A 1WDMA 2GF2A 4YYEA 1KVSA 4QUJA 4FYYA 1CB0A 4M7WA 4BN0A 4YRBA 4RLFA 3Q6IA 2XUZA 4JJAA 5LZ5A 2XT6A 4G0NA 1P18A 5K2OA 4YGYA 4GX5A 1L7AA 5JIBA 3Q2OA 2IY9A 2F48A 1PR4A 1RPJA 1MVOA 1O6CA 5J40A 3TNDA 2A1IA 5AW4A 3X44A 4KNVA 1XXLA 1ZD9A 4YLEA 1JIIA 1UEJA 2FSVA 3OEEA 2PMWB 1KU6A 3E7XA 2BFEB 3EOAI 3K30A 2FJUA 5B3AA 3ESRA 5IYZA 4JLMA 3DKVA 1E18A 1S3IA 3PKIA 3PQ5A 4PLTA 4RJIA 1FS4A 3IAXA 1ND6A 4G0UA 2H7XA 3GH3A 1G19A 4FZ3A 2FSSA 2QOEA 4INZA 3KUUA 3L5OA 5FFMA 3CUEF 4V3CA 1E58A 3ICPA 4CT4B 5JT1A 1U1GA 2P27A 4JC4A 3DPSA 3DUWA 3OU7A 3HUUA 4L7QA 4YRDA 5BQXA 3LY8A 4M0CA 5IFLA 4QD3A 5JWOA 3LE8A 4WERA 1ZUD1 1GXSB 4Q3OA 3D31A 3AY0A 5CH3A 4CCYB 2Q6VA 4WY2A 2DKOA 2BM0A 1DQSA 3LMKA 3IESA 1PT7A 4LCEA 4X7RA 3VO8A 4CDMA 4TUYB 1L9XA 4IDHA 1G6OA 4O0MA 4RNCA 1F9AA 3VZRA 3FOCA 2HN9A 2IVZA 3FYUB 3I1IA 4FXPA 1W2GA 1QWOA 1MHTA 1SRQA 2VDLB 2BP7B 4L0MA 4Y98A 5E9AA 1KXJA 3O3NB 5IN4A 5HF6A 2GPTA 4HSEA 3X43A 4YXWA 8AT1A 4JS0A 4AYXA 1JTEA 3VZPA 3JSXA 1TNDA 3PDCA 2W6ZA 4AUEA 4DZZA 1NOIA 5EGNA 1SU6A 2AK3A 4YAEA 4J49A 3T0GA 1ZN9A 5BN1A 1YS1X 4Z0PA 4B6RA 4BWFB 1JFLA 1FP4B 4C76A 2BEJA 2XTZA 4JY7A 3L79A 1QAQA 4WWHA 3C3MA 3NX4A 2IPOA 1GA1A 4YCSA 3MWYW 5C8YB 4RGBA 1CWUA 3K0CA 2V6FA 1XYGA 4RKQA 1DOHA 2ACKA 3CF6R 3HJHA 3Q7EA 3QKWA 4MUYA 1MABA 3PDHA 4DT1A 5FEUA 5JCZA 5J9FA 2RAUA 1SZPA 4UVIA 4WOJA 1AG9A 1F2TB 3D1VA 5JCPA 1PNQA 2AI2A 3I0ZA 3JTEA 1CZKA 2HBRA 2XE7A 2BFMA 3CUWA 4TMVA 5TY0A 3TPCA 4K9KA 4Y30A 1E1LA 5GONA 3ROFA 1VE9A 2BFBB 2HJVA 2X22A 2NSLA 3CRMA 5FPTA 3HM2A 1MP0A 3A06A 3WQRA 4E94A 4ERNA 1GZ6A 1N8KA 3EH1A 1X3SA 1YHYA 1ORTA 3JQ8A 3OPMA 4ZEWA 1GTSA 2DPLA 4ZCRA 1H6CA 4NE7A 1NONA 1EUCA 4CODB 4CIWA 2J9RA 2G5GX 4KFCA 3UFXA 2GEJA 1LSUA 1RQ2A 4CRWB 4RAOA 3ZZ0A 4EYKA 3AVWA 1KORA 1P0PA 1BA3A 2ZEJA 2IOFK 2AC2A 3E3OA 4R01A 5FPYA 2GCPA 1YS9A 2C4NA 3WB0A 2CB0A 3GJTA 2WFLA 4HQFA 1GU1A 2YRFA 1EDBA 1O94D 4YAWA 4F93B 2XCQA 4X6YA 1EUDB 4XDHA 2ZTMA 1EFRD 3TFWA 2C1EA 3GJ4A 4KX3A 3M4XA 4YTEA 5ARBA 4E3WA 4G5YA 3AB3A 2BIFA 3AF5A 2A67A 3C1AA 1M1NB 3EAGA 3JD2A 4O4LF 2WOOA 4DMGA 3PVCA 4E4TA 2QJTA 2ZYSA 2R8XA 5LXTF 4MJ3A 1Z4OA 2LCFA 3MWDB 4XWWA 2XWBF 4OKIA 3O8QB 3NBAA 4PQFA 3RAPR 1EP3B 2Q9BA 2DBVO 3H5WA 2ZAMA 4P3NA 4B9EA 3I72A 1IYZA 2ADOA 2KLHA 4KQ9A 4Y2TA 4BVEA 5IKMA 5M34A 4MYSA 4COKA 3UJCA 1ONPA 3N8NA 2HCRA 4FTWA 4B6EA 4EGJA 3QSYA 5HGJA 2ZJ8A 1SUBA 4ZAFA 1M75A 2IIQA 1O3YA 1BYIA 1G16A 1XZBA 1TRHA 3Q40A 4AXBA 2KI5A 1DJQA 1Y7HA 2H9YA 2F6RA 1XXHA 2VJPA 2DCMA 4TRMA 5K03A 4RULA 4BVKA 4BNZA 3ZTTA 1ZR4A 4GEGA 3UUFA 1E3DA 3KJFA 3VKGA 4OBBA 2CFTA 1BE8A 1TMOA 5G1NA 3R5SA 4OHBA 3L02A 1FUYB 4AMVA 4RZHA 2TMKA 4IHJF 2I6FA 5IYZB 5C5DA 1V1RB 2VPPA 2Q1UA 2ECOA 4HTFA 1SBIA 1G5RA 2CJWA 1T2NA 2COUA 2O50A 2TMDA 4OL9A 3RRMA 3TMKA 4RHTA 3KEFA 1UANA 1E8DA 3C8DA 4N03A 1QC5A 3FGZA 1CD5A 4MKIA 4IFIA 5KNLA 4ZQEA 3W8NA 5BQOA 2REXB 1W96A 2VJBA 1C9EA 3CWQA 4IJ6A 3K1YA 1R3UA 2AFIA 4M55A 2Y9PB 1C8LA 4LX8A 2VF4X 1FW8A 2VDJA 3DPIA 4S12A 2NYUA 1XQYA 4BATA 1X0VA 4PIPA 3M9XA 1C3LA 4UOZA 4HN4B 1H2RS 4F9GA 2B69A 3KL2A 4AP5A 1NYTA 2XWPA 4FCCA 4V0KA 4CVNA 1XZDA 4D9KA 2NU7A 1FNSA 4BNIA 1YU6A 4LXHA 2V65A 4BV2A 1N32B 3L6BA 4R9NA 1KMQA 2V97A 3DZIA 4XFJA 2Q6KA 2P5YA 4CXMA 4IDAA 1Z8NA 2EGUA 2ZITA 1L8XA 2GPYA 3MN1A 2WKQA 3QXHA 4OGGA 4RY2A 4UMDA 3TQHA 1PZFA 5JR3A 1A76A 2O2ZA 1P3DA 3COVA 4ZZIA 1B0PA 3C70A 1N9KA 3SDSA 2EQAA 4BNDA 2ZJ3A 4JYPA 1RXWA 4KPGA 3DFUA 3O91A 4QJ3A 3HNRA 1E5QA 2PT6A 4C0BA 1VJDA 4WK4B 4PICA 2QUHA 2WU3A 2IHVA 2NUPA 3DDUA 1MABB 2QUIA 1JHUA 4MNTA 5KINB 2Z2KA 3CLKA 4UNSA 5CG2A 5ELXA 1BGXT 3N2IA 2JGRA 3CLSC 4IS2A 1Q19A 2PEZA 2OAP1 3M5WA 3ME5A 3G2MA 3I09A 4D57A 2O5RA 1GGEA 4R2LA 1G42A 4U5XA 5FOSA 3OT4A 4MJ7A 4C22A 1E62A 3LUKA 1YJ8A 3AP2A 3JQ8B 3CH6A 3K5PA 4QAJA 2IXGA 2G1AA 3PXEA 1Y7PA 1YKFA 4Q82A 1LJ8A 3UFXB 1Z5WA 2J3KA 2I67A 2Q3DA 3K8OE 3LKBA 1ZRMA 4HDMB 4KE9A 3ETJA 3QKSA 3T3IA 4J03A 4PSDA 2C0CA 3DLAA 2R1TA 4RY8A 3CEAA 4FC7A 2WFLB 4YRPA 3D6MA 3T1YB 4DRZA 1G8SA 5LP6C 5CIQA 3SZ3A 3KWFA 4JN6B 1YR8A 2UZIR 4G5QA 4K9RA 4YI3A 3WYNA 4CEJB 2ROQA 3E1SA 2XMRA 3FA2A 5FBZA 2PZAA 2PTGA 5I5GA 4K8OA 2VBGA 3KOWA 4GOKA 5CDUA 3WYAA 1TGYA 4FT2A 4DLTA 4UE3S 1TKBA 4RPKA 2DVMA 2HB6A 3H3FA 1Z5PA 4UJ3A 3NIFB 2C2HA 1V2HE 2XF2A 4QRIA 3NP7A 1VCIA 4QJIA 3I58A 4II7A 4LVOA 4NVRA 1TYEB 3U1VA 3NOVA 5JSKA 4CMGA 5JFGA 1AD2A 4LNAA 4NOJA 4KSCA 3OTOB 2PWZA 1ZISA 3H1PA 5H80A 1XXHB 3MTIA 3GRAA 2BJWA 1U63A 5F2EA 1SIUA 1YJQA 2ODWA 2XE6A 4Q18A 5AXAA 3VFDA 1Y48E 3BWEA 4N0DA 5AJTA 3VSDA 5AW3A 4Q00A 4FEEA 4RD6A 3WTBA 4Y9UA 5BWCA 4JI8B 4GSKA 2P75A 3TLXA 3MWGA 4OAOA 2AQIA 1V8OA 1ZIYA 4WI1A 4G2NA 4QYWA 4A2WA 2P6MA 2ZIAA 3H5OA 1QX4A 4HTFB 2UYHA 2CJWB 3C5VA 4MKGA 1WSWA 1T3ZA 3BD7A 1DKNA 3C6ZA 2IYLD 3DOEA 4ZYZA 5IAKA 4XZ3A 3UCFA 4B2PA 1ZH2A 3BULA 1PSDA 2V59A 4AJ4A 2WYVA 2GD0A 2VPTA 3O94A 1ODKA 1Z6YA 3BHIA 1G2IA 2AFIB 3LDGA 4KZKA 1XN1A 3CMCO 4F72A 1DT5A 4FM9A 2QL9A 3EIHA 4OSPA 3ND7A 1K6JA 1T4GA 1YI8A 2OGUA 4O4JF 4RDIA 4HQ0A 3JX9A 1OH5A 1G63A 4R81A 2NVOA 3L8HA 4HX5A 2PQ0A 4F3CA 2NVWA 2DRIA 5CVJA 1NJ5A 2JRCA 4AP6A 4ARUA 2R7NA 1PK8A 3AXSA 3UF0A 4G24A 1VP3A 1BQ3A 1QHYA 2ZIGA 4DCMA 2PLNA 3QEOA 3PNOA 4B7ZA 4UUNA 3ZWAA 3ZLUA 4Q3NA 2X8WA 1HTTA 3PE3A 4IXNA 4TTIA 3U48A 3B7PA 4U0JA 3HLYA 2ONZA 1QO7A 4L2IA 4NU5A 4BJ1A 5K20A 1P8AA 5EMNA 1F8FA 1L8OA 4QDKA 3WGGA 5K0JA 1GNRA 1E64A 4IEEA 4KO1S 1JB1A 1K3TA 2WLTA 5FOVA 3ZQ6A 5K4AA 3SU8A 2HRBA 1PWYE 3G49A 4QATA 5H68A 5EQTA 2I4OA 4G8JA 4RE6A 1TZ2A 5IFKA 1WG8A 4BNDB 2ISSD 2VTBA 3KU4A 3HI4A 1G3IA 1HDEA 1TTPB 3S7TA 5KMGA 4BN4A 3IP6A 4HUQB 2HJSA 1FBNA 1P7PA 1XZNA 2XT0A 3H5IA 2J5KA 3KIPA 3KKMA 4LXGA 4MH0R 2J0SA 3C3KA 2EKDA 3B8HA 4U39A 3SSNA 1ISFA 1P5JA 3UNXA 3E6AA 4X20A 3SOZA 2NUPB 3TLBA 2H4HA 4PGGA 4OSOA 5A5FA 3QNUA 4R0NA 3KZCA 1SMKA 4NOMA 2HU5A 1GPKA 3HACA 3PJGA 1UEXC 4I1SA 4XD7D 1CDZA 4TM7A 1RI5A 1E6LA 1BRTA 4L75A 3WO1A 4B3XA 1JQJC 5LSAA 4QGHA 3IHKA 4DLNA 3LKDA 3C6KA 4FVTA 4AZ3A 2WJGA 2FPPA 3IOYA 4PANA 3CURA 4BGUA 3RV4A 4H4EA 2EZUA 1KJNA 4XAQA 5KYNA 1QQ6A 3WA6A 1GUDA 1PJQA 3QKSB 1FRFS 5EJ2A 4E5VA 4O4IF 4QECA 1JS1X 1J33A 1P91A 1D8AA 2HA5A 5TPWB 3RHTA 5L6MB 4G07A 4ZAYA 1TJYA 1VLJA 2K5UA 1A7UA 2GDJA 2H5EA 3IAS6 5JPIA 2M6RA 3JWEA 4R0VA 5FI0B 4D3DA 1G8KA 4ILEA 1PGOA 3I2KA 1T3GA 2JS7A 2G4VA 5IT5A 3G23A 1PYOA 5DWVA 2ZYTX 2HCBA 2PT7A 3DCYA 10MHA 1MA3A 4TKMA 4Q37A 1PQWA 2XLCA 4RVCA 1K4KA 1D03A 1W5TA 3I8OA 2BMJA 1Z82A 4TZ0A 4BFZA 4G63A 1V45E 2VEDA 2YS6A 5E9WA 1Q0QA 4BNKA 5L4SA 3I6IA 3RYFA 1U0GA 4PNEA 3EGDA 3GBPA 3SIWA 2YMLA 4WBNA 2F62A 1TZKA 4CIDA 4Q9HA 1N3YA 3A37A 5JSYA 1TTHA 2QAGA 3MTDA 1W581 4L95C 1FDVA 4GX0A 2VF2A 2VDUE 4MK4A 3DZBA 3EXHC 4LQDA 1N2ZA 1QIHA 2ZJ0A 3U3KA 3VU9A 2ZUBA 5F78A 2NTVA 2YFHA 3DBVO 2LR0A 4TQ9A 3T7RA 1PSZA 3ZBTA 4EYQA 4ZZ3A 3FYTA 1QO0A 3BC1A 1PFKA 1NQVA 3RYCA 1V6SA 1XF1A 1NW5A 2P40A 2ZJYA 3IQEA 1AS3A 3MS7A 4LHEA 5GZ6A 4IKPA 1G5IA 2V6GA 3DMYA 1FVXA 1VHDA 1Z62A 3Q7PA 4KXUA 3A1CA 4N12A 2QE7D 2MYPA 1U28A 2W2QA 4UVDA 3KB6A 3G68A 1GUZA 4IILA 1JEQA 2NZVG 4NBLA 2RHOA 1MX1A 4TSFD 3S2GA 4CM1A 3UOWA 3Q2IA 1JHYA 5J4YA 1XQ9A 3DDSA 4K0RA 3VDRA 3J81k 2AD1A 3JVEA 1FRZA 4PBRA 3S29A 1NURA 2O2IA 3FKJA 3GPCA 3NRBA 5BV2P 4M9RA 4Z7NB 2J3DA 1R8QA 2W0SA 1T8YA 3W7BA 3WWEA 4R8VA 3C14C 3CNEA 4TS3A 2REQA 2ZDQA 4IMRA 1G6Q1 4DJJA 5JAOA 2H4WA 3KTDA 1W1WA 1XLWA 2RC5A 1CUZA 3JQFA 1U0JA 4G1EB 4D56A 3HYNA 3CISA 4RVGA 3VX3A 1FBTA 3U7QB 5FAKA 4DCTA 4L2IB 2ZJAA 1RQPA 3IBSA 4U3JB 3LQKA 5FBQB 1UAAA 2X0FA 5AH0A 1RS0A 2FN4A 2HF7A 4GE0A 2OZLA 4ZZ0A 2CZGA 2IY7A 1THMA 4G5XA 4MUNA 3FOZA 4L16A 4DCOA 1CIPA 4TL9A 3TLCA 2ZANA 4EF4A 2JLBA 1W85A 1V9CA 3GMSA 1Y3IA 1ULTA 1C80A 3TZCA 1RXYA 1ZOOA 5SV2A 4CF6A 3FTDA 5I47A 5KMGB 4O4JB 2PMEA 2XUFA 4ZKEA 3WNBA 5AW2A 2CXSA 1GDTA 1N6RA 4NR0A 4P36A 4LWPA 2Z58A 1TJ4A 3CCBA 2V9CA 4X20B 3L5KA 2FZ4A 1WUTA 1KJZA 1NU6A 1EXNA 3EEIA 4M2LA 2NTJA 3WE7A 2OV6A 3DMTC 3G2LA 5FOUA 3KE9A 1YIAA 1BJKA 3U81A 3ZDFA 2XUAA 3LZ6A 5C8ZA 2A0WA 2YZ2A 4XQ0A 1BXKA 2HA7A 5JDIA 3TBFA 1KEUA 1VBKA 1KVRA 1R0XA 2PU5A 3GFGA 3ZPXA 4CM6A 1E5LA 1NNI1 1JGTA 4AZ3B 3I9V1 1JEJA 4MO9A 2FPPB 2GAFA 4OQYA 2YHAA 4QYIB 5F1KA 3TXAA 1TB4A 1FX1A 1JQBA 2SKCA 3GNSA 5CLHA 1V16A 2RHBA 3EQZA 3F6BX 5JROA 2O8FA 2FQWA 4ZQIA 3DHYA 2F7SA 1GFZA 4A2CA 3AVUA 4H6XA 1ODTC 3KYIB 3R3WA 2ZI9A 3FNEA 2BKLA 3ZVRA 3HVKA 3NHJA 3AEKA 5D3ZA 4FHFA 5HWSA 1XJ5A 3U5TA 2PKCA 1MV5A 1TA9A 4PG6A 3D6HA 1CVRA 5AQEA 1KSGA 1PAUA 4J75A 1LPPA 1EFPA 1BO6A 1PFWA 1XMPA 3I9FA 2P4QA 4X1IA 4LI0A 2AG1A 4NCKA 3S68A 3HXQA 2R6JA 3AUYA 2Q5JA 1V8DA 3ZYZA 5KOIA 1CF9A 1OFVA 4GI1A 4YWJA 4CLRA 2CFCA 1N6OA 2FW1A 4GQBA 3ROKA 4TL7A 1Z88A 3EXAA 4K03A 4ZU1X 1VLLA 5JCOA 4L9RA 4YNBA 4ZT6A 4AX4A 4BGVA 4JK3A 2H2DA 5IANA 4F7WA 1PVOA 1HORA 2H2IA 3LCRA 4H60A 2DQ4A 3RYFB 4X8OA 4DLBA 3TLGA 3H97A 1WJGA 3RSFA 2AC7A 4NG4A 4EY8A 3NTXA 4WBNB 4JI3B 2QAIA 1IM5A 1V71A 2A5DA 1ST3A 2B94A 2VRCD 5HMMA 4CJXA 1KYWA 3AH8A 5HKLA 5CCXA 4I55B 3RBXA 1GUBA 4DR4B 2PJRA 4WJKB 5JSQA 1TQHA 2CV2A 3DR3A 3IODA 1JT9A 4ZI2A 2VRNA 3C3AA 1L7RA 3OPXA 3RM3A 2P3LA 2VDOB 4RIEA 3BBLA 1T5SA 1QGDA 3D5TA 1QV6A 1WXXA 3LCCA 4B79A 4EI2A 2X3YA 4BWVA 3HR7A 1KSHA 4GKVA 5JNTA 1QHSA 4WRRA 1WXDA 2W2PA 1ST2A 2QR2A 4IH4A 1LNSA 1XMIA 3WGZA 3DYVA 2ATCA 1ZIPA 1F7UA 5JECA