5E8JA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with ram
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
310
structure length
310
Chain Sequence
SRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title Molecular basis of RNA guanine-7 methyltransferase (RNMT) activation by RAM.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5e8jA00
1VIDA 1KR5A 3LPMA 3M6VA 4PCLA 4QDKA 5GP1A 3EPPA 1KPGA 2OPBA 4QQKA 2YXDA 3IEIA 3KQMA 5HIJA 1OR8A 2GLUA 5DTMA 2IDJA 3IV6A 3G2MA 5BXYA 3NVKI 3BKWA 5EMMA 3TKAA 4YUXA 1VL5A 3E23A 4KWCA 4P7JA 3DMFA 4ER3A 3MHTA 2UYHA 2XYQA 3JWGA 1P91A 1VQ1A 1YZ3A 1B42A 2AOTA 3AJDA 5DM0A 4E2XA 4PINA 5E2AA 1DL5A 2PX4A 5FADA 2CMGA 2FCAA 5EZQA 3UA4A 3FUTA 5FULA 3HVKA 2GB4A 3NDJA 1G8AA 5DX1A 1JSXA 4IV0A 1NW6A 4E30A 2ZULA 3A25A 1RJEA 4E33A 4PNEA 4RTOA 4QQNA 3DH0A 3R3HA 3CC8A 2EJTA 3TM5A 10MHA 4KW7A 4NECA 4HH4A 3C0KA 5DSXA 2K4MA 2AR0A 2R6ZA 2VDVE 2YTZA 4PCAA 3IYLW 4L7VA 3SMQA 2G1PA 1EQAA 5T6BA 3R6TA 2CMHA 1VPTA 4IV8A 3MAGA 3LBYA 3UZUA 1JQ3A 4CXMA 3KQQA 1L3CA 1YZHA 3VC1A 4RTKA 1QANA 1X19A 3SVZA 3EEOA 3UJBA 3DULA 3VC2A 3FTDA 5EGSA 3FTFA 3EGVA 3P9NA 2PX2A 1BKYA 3FPJA 4Y2HA 2HTEA 3KR9A 4HRAA 5CVDA 3TFWA 3KR1A 4HC4A 3UJ9A 3CJTA 2H11A 2AVNA 3BGIA 5EKXA 5FQOA 3K6RA 1RI4A 3EVDA 2EG5A 2OY0A 1X1DA 4PYMA 3HTXA 2ZZNA 3BWMA 5LQUA 1WXXA 4FGZA 7MHTA 2P7IA 3BGDA 4E2YA 5E1DA 3RIEA 5FHQA 3MGGA 1F3LA 2AN3A 4BLVA 3B3JA 4BY9E 1KHHA 2BR4A 1NBIA 3T7SA 3WSTA 3BKXA 3Q87B 4IWNA 2AOVA 1UWVA 3B5IA 4RVHA 1ZGAA 2BM8A 2UYQA 3HA3A 5KQRA 5EQJB 5EC8A 3KQWA 2OYRA 4EVIA 5EIWA 1JQDA 5E9QA 4POOA 4HGYA 5EHGA 3FPEA 1P39A 1IY9A 5FQNA 5T64A 2JH8A 2OZVA 3G7UA 3KQPA 2ZZMA 5JUWA 4P7FA 1EJ6A 3A27A 4OBWA 4X60A 4YV2A 4MHTA 1EG2A 2ONYA 3TRKA 1M6YA 2Y1XA 3MB5A 3UJCA 4WVLA 3OPNA 3OE5A 3P9CA 5ICGA 1HMYA 1F38A 3C6MA 3P8ZA 4IKPA 5HIKA 5MHTA 3OZRA 2EX4A 4QTTB 3A7EA 3G2OA 3EVGA 2NYUA 3C6KA 4HTFA 4C03A 2HMYB 2OO3A 2FK8A 3MCZA 5EEGA 1L3IA 3P71T 5DX8A 3G89A 2AVDA 2XYVA 4QVKA 3HVIA 3AXTA 3SX0A 5IH3A 1AQIA 2JJQA 5E9WA 5H02A 2AOTB 3UJ6A 1N7JA 2PVCA 2G70A 3FZGA 5EMLA 2DULA 4M36A 4PGHA 5KS2A 5CVJA 3G8BA 5EPEA 3B89A 3I53A 2P41A 2N47A 3MQ2A 1XDSA 1V39A 3DLIA 1XDUA 2QY6A 3FUUA 3HCBA 1INLA 3UJ7A 5K0GA 2PX8A 4Y30A 2QYOA 4QPNA 1JTFA 1VE3A 4P58A 4OA5A 4YUWA 1MJFA 5FA5A 3DP7A 3R9XB 3G5LA 2OXTA 2HR1A 1NW8A 5FCDA 4PIPA 5LSAA 4X1OA 4C4AA 4HGZA 4EK9A 5DXJA 3THRA 3UWPA 3JWIA 5DSTA 4FT2A 2GA9A 5K09A 3E05A 3S68A 3UJ8A 4JXJA 2UYOA 5EEHA 1G38A 1TPYA 5K0CA 4RYLA 1G8SA 3PVCA 4OBXA 3SSMA 8MHTA 4KIFA 3G2PA 4PGGA 4MTLA 4R05A 5EKUA 3ORHA 3EVFA 4M7RA 2PT9A 4ER7A 3PT9A 4PYKA 5K0NA 3TLJA 5CCBA 4X41A 4AZSA 4YMHA 1JTEA 5DXAA 5HZMA 4E31A 2IPXA 2WK1A 2P3LA 5ERGB 3Q7EA 3TQSA 3TPZA 1R18A 2ZBPA 3DXXA 4LG1A 2O06A 1FPQA 1Y8CA 3ANXA 3E7PA 3EEYA 1QAQA 1D2CA 5DM2A 3EVAA 1KXZA 3VYWA 2ZWAA 3FPHA 2I9KA 4GOLD 1SQGA 4CKCA 3GWZA 2CKDA 2ZIFA 3MCTA 5HFJA 2O07A 3KQTA 4KVZA 5HIIA 1QYRA 4U7TB 3TOSA 2I6GA 2FPOA 1L1EA 1JQEA 5BW5A 5LQNA 2Z6UA 4GBED 1ORHA 3GRRA 2XBMA 1EIZA 1IM8A 1KP9A 3PS9A 5F2KA 3GU3A 3AXSA 5DLYA 4CTKA 4CKBA 2B3TA 1R8XA 4PYOA 3LCUA 1N2XA 3TR6A 5CVUA 3I5UA 1O9HA 4ISCA 3G8AA 5CIYA 2G72A 5FUBA 3QOWA 5E2BA 4DKJA 2ZTHA 3BWBA 1ORIA 3NVMB 3MTIA 4PIMA 5FHRA 2AZTA 2BZGA 3GO4A 3REOA 2YXLA 4U7PB 2GAFA 3UBTA 4EMSA 1NBHA 3PX2A 1DUSA 5EG5A 2AOUA 3NTVA 1R6AA 3M70A 4EKIA 3O31A 4GF5A 4ATNA 4GOOD 1KYWA 5IKMA 5K0FA 1DCTA 2ZIEA 5GINE 4AUKA 2I62A 3V8VA 2OB2A 1IXKA 4GQBA 1MHTA 5FTWA 3THSA 2ZWVA 3FYCA 5EMKA 3KU1A 1KPHA 2ADMA 2B9EA 3GJYA 5T67A 4E2WA 1X1BA 4PYLA 3SSNA 2PSSA 3KPJA 3SR4A 4F84A 5FWDA 1EAMA 4QTUB 4GC5A 3FRHA 5E8RA 3GGDA 5B1SA 2G8NA 4V0RA 2IH5A 2P7HA 3GCZA 3B3GA 3NDIA 3V97A 4EKGA 3CCFA 3EVZA 4KDCA 1QAOA 3LCCA 1BOOA 4RVDA 5E9JA 4DMGA 5GIOE 3UFBA 2IDKA 5FWAA 4AZTA 1BHJA 5DPMA 4RTRA 4RTSA 2ZIGA 4R6WA 4PYNA 1TW2A 5DTQA 5GWXA 5C1IA 2PKWA 3DLCA 3KQSA 4GOND 3GDHA 4GOMD 3ELDA 3OE4A 3LDUA 3DXYA 3JWJA 3OZTA 4C07A 3P9IA 3GNLA 1NE2A 3HNRA 2PXCA 2C7PA 1G60A 2PLWA 1UIRA 4FT4A 2AN4A 4GC9A 5CD1A 2FHPA 3SGLA 4DZRA 4YUVA 5E1BA 4KDRA 5GIPE 2NXJA 1XCLA 2G71A 3G2QA 1YB2A 3TKYA 3AY0A 3VSEA 1G55A 3X0DA 2ERCA 3PB3A 1U2ZA 3EGEA 2P8JA 3JWHA 5LQKA 1QAMA 1X1AA 4PONA 4DA4A 1T43A 1PRYA 3L8DA 2IH2A 2NNWB 3OU6A 3G5TA 2P3OA 5CVVA 2BM9A 1YUBA 2VDWA 3ELUA 5ICFA 4BLWA 3GRZA 3MTEA 5K0LA 1SG9A 4CKEA 2BH2A 2Q41A 2FYTA 2VDUE 1JG4A 5EMJA 3NJRA 3EVCA 4KRGA 1FP2A 3BXOA 2ZZKA 3EVBA 3SXJA 4F85A 5G02A 4X63A 1I4WA 2FK7A 2HV9A 3C3YA 3LDFA 4FSXA 2WA1A 1L3BA 2YUIA 3PTAA 1H1DA 1ZG3A 3KQYA 4OX9Y 1VLMA 5HILA 3ME5A 1SKMA 5DRYA 2WA2A 1R00A 3ERCA 5K8VA 1ZGJA 2HWKA 5F2OA 4F86A 2C7OA 2BR5A 2OB1A 2ZVJA 1PJZA 1RI5A 4R6XA 3ELWA 1XJ5A 1G6Q1 5DRTA 5DT2A 3UA3A 5E1OA 2JG3A 3BT7A 2IGTA 3A7DA 3CKKA 3OFKA 1O54A 3O7WA 2IBTA 5EHIA 3K0BA 2IIPA 2PWYA 3HCAA 3PFHA 3P2KA 4M38A 3NWBA 3B3FA 2PJDA 1BC5A 1SUIA 5LR6A 5K01A 4DQ0A 2PX5A 4YUZA 3HCDA 1VBFA 3KR0A 5BP7A 3T7TA 3OCJA 4ER6A 3HP7A 3M6UA 4HG2A 1RI2A 3FPGA 2AOXA 2B78A 1AV6A 3F4KA 1RJGA 2P1DA 3I58A 3DMHA 3KHKA 4LWOA 3TMAA 1NT2A 1XXLA 3OZSA 3ID6C 3T0IA 1JR4A 3FUVA 2ZCJA 2AN5A 1TW3A 1WZNA 2O57A 3D2LA 2PGXA 1NW5A 2KW5A 1AQJA 3LX6A 3HEMA 3I9FA 3PFGA 5C9ZA 4WXHA 3QOXA 3ER9A 1RJFA 2CWWA 5DX0A 3P2EA 5HIMA 3HVHA 1JG1A 4P7GA 2JHPA 4M37A 3KQOA 5EOVA 3TM4A 4C05A 4RTMA 3ER8A 1JSZA 4Z2YA 2Z6AA 2V74B 2EFJA 4RV9A 2UZ4A 3CVOA 5EIFA 5C0OE 3NW9A 1HNNA 4OQDA 2Z6QA 1NW7A 4BLUA 3FPFA 3LSTA 4MQ4A 9MHTA 2JHCA 3KPVA 3SM3A 5ICEA 2B2CA 3G88A 1YF3A 2IBSA 4G56A 5K03A 2O0LA 4UOEA 2P40A 4HTFB 1JG2A 4DCGA 2A14A 2JH9A 4RVGA 2F8LA 2FRXA 4DCMA 1EJ0A 5DM4A 5GM1A 2PBFA 3KKZA 5KQSA 3EGIA 3FTEA 1Q0SA 3FUWA 4E2ZA 3LCVB 4PYJA 3KPWA 3EMDA 2ZW9A 3R0QA 4XUCA 4P7KA 1KYZA 1VP3A 2QRVA 3M6WA 5GOZA 2GPYA 1RJDA 4A6DA 4ER0A 4C04A 4RTLA 3CJRA 1NV9A 4QVGA 1AF7A 3FYDA 2NP7A 1FP1D 3DTNA 4PYIA 5LQJA 4OQEA 3KPYA 2NXNA 1L9KA 5EZSA 3DUWA 3O4FA 4RTNA 4LWPA 4YMGA 3UJDA 2P35A 4V0QA 3C3PA 4YUYA 4RTJA 1R74A 3EMBA 4FR0A 4CWAA 4X61A 2R3SA 1JG3A 3DOUA 3HCCA 3BUSA 4ZTBA 4BP1A 5KVAA 3FRIA 4H0NA 3HA5A 2EJUA 4YV0A 2C7RA 3CBGA 3OU7A 4FP9A 4C08A 4XUEA 3RODA 3HVJA 2ORED 2PT6A 1XDZA 3DR5A 1X1CA 4AX8A 4RWZA 2OBFA 5JR3A 3BWYA 2PXAA 4R8RA 4DF3A 1P1BA 3FTCA 1R8YA 4KIGA 5CCXA 2NP6A 3NWEA 2YXEA 3A4TA 1ZQ9A 2ESRA 4HSGA 2AS0A 1NW3A 3DXZA 2YQZA 4GUAA 4QDJA 3R24A 3GIWA 3DMGA 1I9GA 3P97A 4MWZA 4RVFA 4BP3A 3CGGA 2AOWA 1XVAA 2VZ9A 3M4XA 3LKZA 3QV2A 5M5BA 5EVJA 5HEKA 1ZHFA 3M6XA 5LQRA 5DWQA 3B7PA 3BGVA 3AWIA 2ZBQA 2CL5A 5FA8A 1SUSA 3PLAE 1FBNA 5LQAA 3SSOA 3P9KA 4O29A 5DM1A 1YFJA 1RI1A 2VP3A 2UYCA 3LGAA 3PX3A 3OU2A 2IH4A 5K0EA 2PV0A 3GRYA 3E8SA 3IHTA 2OKCA 3EVEA 4XCXA 1WS6A 2XVAA 3UJAA 4E70A 5U4XA 3I64A 4R8SA 5D1NA 4C06A 1SVUA 1KPIA 2YX1A 2B25A 2NXCA 5E8JA 1M6EX 1UFKA 2ZFUA 2ZBRA 5D1HA 3HCEA 2XYRA 4B17A 5P8WA 2ZSUA 5HOQA 3LECA 3LL7A 2QE6A 4OA8A 5E1MA 5K05A 3LDGA 3HM2A 2PWPA 1NV8A 1O9GA 3RW9A 3H2BA 1WXWA 1VP9A 1XTPA 2IFTA 1SQFA 1Z3CA 2AOUB 1QZZA 4LECA 2V7EA 1P1CA 2DPMA 3KQVA 3P2IA 3U81A 1NKVA 2JHAA 2NXEA 3GRUA 3GXOA 2O05A 2GS9A 2PXXA 3HCFA 3LBFA 1D2HA 4XUDA 5CVEA 5LQCA 4RTPA 2YR0A 4GEKA 1I1NA 1WG8A 2LD4A 4MIKA 4PYQA 5CUQA 2H00A 2H1RA 5GM2A 1N7IA 2HNKA 3LKDA 2XVMA 2QRVB 5CM2Z 3KR2A 5DTRA 1D2GA 3M33A 2ZLBA 4YV1A 4PWYA 4ER5A 2ONZA 2QM3A 5ICCA 2GH1A 3ELYA 3HA7A 4RTQA 3KPUA 5KYGA 2YVLA 1Q0TA 3NMUF 1YFLA 2E5WA 4A6EA 4AZVA 5K0JA 4EQZA 3CJQA 3A26A 3LHDA 1XCJA 4FS8A 4K6MA 2I7CA 1M0EA 1FJXA 5K0BA 4QPPA 3FUXA 3T7RA 2PY6A 4RX1A 4AZWA 4FZVA 2VS1A 5BW4A 5F2NA 2BR3A 4CTJA 1KIAA 2P3QA 3BZBA 1ZKDA 3GRVA 1RI3A 4E32A 2IP2A 3OFJA 2C7QA 1WY7A 3BWCA 4RSRA 4FSDA 3MERA 2Y1WA 4DM3A
chains in the Genus database with same CATH superfamily
3II6X 1VIDA 3SVTA 4YHHB 4DUPA 4OHYA 4DCUA 2ZQ5A 3TD9A 2CLCX 3WIDA 4WZAA 2QUAA 2QUHA 5AW5A 5KTNA 3ZIAD 1J99A 2GLUA 1GG8A 1P5JA 4EELA 1E89A 1OIWA 4OD0A 1VM6A 4RFVA 1YULA 3KTAB 4RDIA 4B3IA 1C1HA 1N75A 1VMDA 1W46A 3CUVA 3WB9A 4GXRA 4MDEA 4DUYB 1NZJA 2TYSB 1I4TD 3LXMA 1E94E 1QIMA 3HGMA 3LPLA 2CXNA 2NTEA 4Q1AA 3IC5A 3QGMA 1XP5A 2BTQA 4LSGA 1BQ3A 5KC8A 2X1HA 3B8HA 3KHTA 5H7XA 4HQ0A 4RPCA 4QQNA 1E3DA 1N5MA 3GC6A 3Q5DA 1H2RS 3G9QA 3AONB 2PUJA 4F4UA 1KTIA 5ICMA 5TDHA 2YVUA 4G01B 1ZDMA 1YRWA 4WA8A 1CPYA 1Q0LA 2VRNA 2ILVA 3NETA 3U7JA 4ZYXA 2FI1A 3EWNA 3H1GA 5FWYA 1GTRA 1ZMRA 3VO1A 4D3DA 1XU7A 1E1MA 3H86A 1V3VA 2ACVA 4Y9TA 4D1YA 2ONCA 1L3CA 3CLTD 3KQQA 1R1DA 3ZEIA 3GLSA 2NU7A 1Y34E 1IM5A 4B3GA 4J0HA 4HGPA 1NN3A 3TW8A 3T4PA 4DIBA 1R9NA 3DMPA 2JA1A 1P3Y1 2EZ4A 2FG7C 1KYIA 2JA2A 1JKJA 1LDGA 5KWVA 1AURA 1RWOA 3H83A 3K31A 4BLRA 5CP8A 3DZGA 2DX7A 3L79A 5AH0A 1DBIA 1FX0B 2BELA 4N7JA 4OM7A 4LX8A 4DEYA 1UK6A 4FOTA 1XRRA 2HX1A 4XTRA 3PJFA 1NMYA 4J75A 1O1YA 1VHTA 2AN3A 2QMZA 3ESYA 1FXSA 5AHKA 3PUXA 4A15A 3G0IA 1W8DA 4LF9B 4WN9A 5EC8A 3WGTA 3AG6A 5HCUA 4B81A 3FF4A 4ARBA 2KB0A 3JZDA 5FTLA 1QO0D 1ZA2A 1NHWA 4V3CA 2FKNA 4ND5A 4WN3A 2WM3A 2AX4A 3JVDA 2ZM5A 4MWEA 3M0EA 5CXUA 1QBGA 4GM1A 4GX1A 2CBXA 1YDHA 4MLPA 2J85A 1QORA 5EUMA 3TK1A 1PJ2A 3FOZA 5FUXA 5BNZA 2RGXA 1KI2A 5F23A 2NYRA 2RIRA 2P9CA 4ZAWA 3IOBA 3O2SB 1QK3A 1GU1A 1TK2A 4TV8F 4XLTA 1MOPA 3AW9A 1N3LA 2W2MA 2ECOA 2EFDB 3QENA 3QY0A 1U6KA 4JC0A 4RLSA 4BRZA 4GOXA 5EWMA 4L3VA 3D0RA 5KTYA 2A5FA 2NYUA 3GLGA 4HTFA 2ODWA 1KK1A 3DOCA 2HIMA 4TKLA 3MCZA 5DOZA 2XCTB 4H9GA 3V9PA 1A69A 2JCGA 5CXSA 5LU8A 3ZW8A 3TPFA 1H4SA 4ZVTA 1H0HA 2WV7A 3CE9A 3K0FB 3GPCA 1YZLA 1ISIA 1T1GA 3I39X 4IIUA 1J20A 4Q16A 5EZYA 3OT5A 2P2YA 4KR3A 2E85A 2P41A 2N47A 1OGYA 3JQ9A 1QBKC 3MJRA 3QUSA 4TKVB 3S44A 1FNDA 1FK8A 4FLEA 4F2HA 1W8IA 1MAWA 2PGOA 1HV8A 5AD1A 3PJGA 2OM6A 2DWCA 2XYHA 1SJ9A 3NQ41 2PJUA 1O97D 4KRXA 2A1UA 1TF5A 4WK2B 4BKOA 4EHBA 4X66B 1PR1A 4Q4HB 1NW8A 1XJWA 2VG8A 1H2BA 3N86A 4UQLA 3S2EA 3W34A 2Q4DA 2W11A 5DXJA 1V7PC 1STOA 3TZ6A 2H4YA 1RAGA 2UYOA 1P7VA 2ZE5A 1IH8A 3U3JA 4W8OA 3STVA 4RYLA 1E6CA 1MORA 1QH1B 4DMFA 1DX9A 1AMUA 5B1DA 3ZHRA 4RXTA 3NHZA 4Q4AB 1WMEA 2BEUA 3KZCA 3JRNA 3GMIA 4D9KA 3QXHA 4X44A 2R97A 4IJUA 2FPPB 3C41J 4OFBA 1ZEMA 1CY0A 4YRPA 4DG5A 4ECEA 4EEZA 4ZIRA 4AX4A 2DR3A 2Y1EA 1QHGA 1RJ9B 2HEGA 1J90A 4XIGS 5E6SB 4YMHA 1G17A 4O3FA 1DC5A 4WBNB 1CRQA 3CX4A 1M7HA 1T0HB 3T54A 4B0PA 4RGYA 2BEWA 1BRMA 5CCBA 3KT8A 3BJZA 4GE3A 3WLPA 1KAOA 1MB4A 1OBCA 2QLNA 2I7TA 1QQTA 3MELA 4OHMA 1CQIB 3U3XA 4YCSA 5ARBA 2R7NA 4AO7A 1VRCA 2BGGA 2B35A 4IMJB 2BEVA 2FW9A 4YRRA 3WBJA 1AGPA 4HCJA 4R1OA 4LOJA 3I05A 4L28A 2IJGX 3N2NA 1JU3A 3O9ZA 2J7PA 3LRXA 3RVBA 4DUGA 4N12A 1ZCZA 3KJIA 4YRSA 1MO2A 5FBZA 1D2RA 2Q2VA 5MN5A 5A4FS 4D74A 3M3DA 2WP8J 4LIPD 2FOXA 3TOZA 1J06A 2FR1A 2PG3A 4U2FA 2Q5OA 4XWWA 1SHZA 1R0YA 3KOXA 3QFTA 2DHQA 2JJ2A 2XGJA 3BICA 1ORIA 4MQMA 1AKYA 5HFAA 1Z16A 3COYA 3FSJX 2VJOA 3TKLA 1KSGA 3EIXA 3HACA 4RD1A 1JIKA 3Q6IA 2VATA 5BN5A 1DOHA 4W8HA 1A8HA 5IUJC 3E27A 4GX0A 1GUFA 1C7RA 1LK5A 1CEXA 1U9IA 2IZ1A 2WTXA 3OIYA 1FUEA 4ZREA 2IHVA 3CLRC 4JB8A 2MMGA 4F9GA 1IQRA 1YNOA 2DU8A 4YREA 1W94A 16PKA 2H1WA 3DEAA 1MZPA 4ZICA 1MMFB 2FW0A 3C1AA 1XEXB 4MRNA 1PSDA 2W6PA 1HF3A 4P2BA 1O58A 2CL0X 5A4IS 1JDTA 1P4HA 1ISHA 2ZWVA 2P68A 2A0YA 3KU1A 4FMCB 5EIBD 5HM8A 5KHLB 1EUQA 3CGWA 5KJEA 3L5OA 5F5NA 3GAFA 3G49A 3DQPA 4KFTA 4HGNA 5K8LA 1YJBA 2EC5A 4MQBA 2P65A 3IJ5A 5FWDA 5C7IO 1H0RA 4NYIR 1E3EA 4ZT6A 2XWJI 2XCUA 2VAVA 1AUPA 2QWXA 5AJYA 2XF8A 4MYSA 4P4UA 4WUTA 1CK4A 3W5HA 4PM4A 4HJXA 4ZMSA 3OKAA 4L8FA 4QYWA 4KIJA 1Z82A 3QF4B 4DMGA 4E07A 1R4MA 4JP5A 1MX5A 3TD2A 3AHGA 3TIFA 2QT1A 4N76A 3N3AC 4MOWA 1OB5A 2AF4C 1L1RA 3AR5A 3CO0S 1KO8A 2YHIA 1YD7A 2O5RA 1GZDA 2ZS9A 1IWBB 3GVPA 3N2ZB 4M83A 5C8XA 1QF6A 1PL6A 1RXSA 1Z06A 3PNSA 4L4UA 2Q4EA 4KXVA 4DSTA 4NICA 3PDUA 1S3GA 4L3WA 4UC0A 1A88A 3OY7A 2CYCA 5ER9A 3TLEA 1UIRA 2YIJA 3GLFB 2DBRA 2V6IA 1EWRA 4OSEA 4WRRA 3RV3A 1XCLA 2ZSFA 1COWA 4MZDA 3NO4A 5CR9A 4ND8B 4II3A 4TL8A 5A9TA 2REOA 3WISA 5MF6A 5JE8A 1EVQA 3E58A 4Y9UA 4CYMA 3GT7A 4P0PB 1PUIA 3C24A 5LCXA 3Q8KA 4PONA 1OBHA 3AR9A 3SFVA 3K6SA 1FFCA 1NBAA 4BXOA 3P9PA 1TQ4A 1VPDA 1XLTA 2IDZA 1SGWA 2UVQA 2VDWA 3KE8A 3MRTA 3PNVA 4K87A 4ENTA 2EHJA 2HSJA 2WKWA 4BVKA 2WWYA 1T35A 4DA0A 5AIBA 1JEAA 1ZNYA 1W4BA 2JGLA 1PBTA 4WNAA 3CSDA 2A3NA 3H87A 4BKPA 3BH0A 1IEXA 3GFTA 2P30A 4LYHA 3HKCB 2WA1A 2YUIA 4U7JA 1KJWA 2ZETA 3VR5A 1C50A 3AKDA 3CNBA 1FXWF 1VKRA 4LXTA 3DC7A 4PSCA 1U5BA 5EXEA 5EY5B 2VOEA 2GPNA 3FDJA 5HZKA 1A9XA 2NU9A 1CS0B 3MEQA 1C8LA 4F86A 1AKMA 2O1WA 3EZ2A 1GNTA 4IBOA 5CHYA 1J2YA 3H1TA 4EY5A 4DRZA 1XJ5A 1Y6JA 1V1JA 2QX8A 1Z0UA 3NRBA 1KO1A 2LCFA 1SQSA 4K6OA 4ZARA 1V1RB 3WA6A 4MS3B 2G7MC 4I36A 3EARA 4IGFA 2FEOA 1ORRA 3O7WA 1U80A 5DLQC 1HGXA 3WMWA 4J4HA 5JCXA 2IIPA 2IU3A 5AOAA 1NKSA 4HAUA 5ECGC 3D43A 3SBDA 5EWJB 3ZKWA 3SKVA 3U4QA 2OYSA 3FWZA 3K16A 1J5XA 1PR6A 1GKYA 3HP7A 1NVMB 5BNFA 4FXPA 5M04A 4MUBA 1VCMA 1KJZA 2BWJA 3MWJA 1SXJA 3CX6A 4RANA 4GXTA 4LHVA 1PG0A 5G3YA 2Y05A 4Z49A 3H11A 3H3JA 4U5XA 1U9IC 5G0TA 3VGPA 3LVFO 1XCOA 4RGBA 1XEWY 3OWOA 4QOIA 4RHXA 3N7TA 5C9ZA 5EHZA 4KR7A 3SD7A 4AFNA 2V03A 5DX0A 2QJTA 4G23A 3RT7A 4RTMA 2J3HA 1AN0A 1E2NA 1S9DA 3H0CA 5CEFA 3OH8A 5I9BA 2QT0A 3FRJA 2G80A 4LNAA 3D6UA 2INGX 4WSOA 1EFKA 3R7WA 2Z6QA 5BN3B 2I3AA 3HPRA 1C3VA 1P9RA 2B1RA 3D6HA 3DFMA 3M6FA 4UNIA 2Z3WA 3ZWYA 2EBFX 2JHCA 1ZJJA 3ONDA 2AE2A 1KMIY 3HK2A 1M2VB 3F8TA 3JQAA 1WDKA 3K1ZA 4LZZA 4EMTA 1I2ZA 1T1RA 2OWEA 5CCDA 1JG2A 4DCGA 4WACA 1PQPA 2A9VA 4CGZA 2QENA 1WLSA 3E35A 3T0GA 4DWVA 5BORA 4GMFA 4NNJA 3F71A 4ZI7A 1JH9A 1HDZA 1K97A 2YWJA 4ETMA 1GTZA 1WJGA 1VBNA 3JQGB 1M1NA 4AP9A 3FUWA 2OZLA 3I9NA 4BPBA 2MR5A 1U6JA 3M6WA 1Z4NA 1TUBB 2QUIA 2VYCA 3AL3A 4FKBA 3KETA 4QVGA 3GBPA 3UQYS 4GOJA 3SQMA 3ANTA 5DLEA 5L3QB 4JKOA 4EHNA 4ERNA 3DUWA 3A1VA 3FMIA 4YAIA 2XW6A 5E6RA 2DQSA 5AW7A 1IZZA 1YB7A 1AY0A 2QQGA 3DHVA 2QVGA 2EJWA 4U5QA 1UANA 1W48A 5DBIA 1U8YA 4G0VA 3CBGA 3L1UA 1BO6A 2FLKA 5KU7A 3U4MA 1GVHA 1UPCA 2CB0A 3UYLA 4GSKA 4YYEA 2BH9A 2B61A 1O6CA 5KTSA 3DDUA 1N92A 521PA 3EHEA 5DP2A 3QEAZ 4OGGA 2ATEA 5GAJA 1YZNA 4EYSA 1JEQB 4D4HA 3BHIA 4OKSA 3WYNA 1G8JA 5J2UF 3EZ6A 3VR4A 3NPMA 3WIVA 2DHEA 2FOIA 3KWFA 2NZWA 2O3SA 3RAFC 4RVFA 2HA2A 5DHQA 4Z2AA 3C85A 2A88A 4KQJA 4H7DA 5AI9A 1YVUA 2ADOA 3Q85A 4FGUA 4JUBA 4ZCQA 2PUAA 1B6SA 5EVJA 5KNBA 5JY6A 2WNHA 3B1ZA 5DT9A 4BV8A 4EVRA 2PHZA 4TV9A 4KXMA 3Q3VA 5DNWA 4RKQA 1PNTA 3C3JA 3C6BA 4ZRNA 2CL5A 2R86A 1YU6A 1CRWG 2ODPA 4KQ1A 2AJTA 3H2HA 3ZHZA 1RBMA 1YSCA 1KDYA 4ZK2A 3KTDA 2PX6A 5AI5A 3AERA 2PV0A 5ESDA 2FZ5A 1WHSA 3IILA 3OQHA 2HBQA 3HDYA 3PQ5A 3QX7A 3HO6A 3RJ9A 3NBYC 2F3RA 1NF3A 4CLOB 1J8YF 5FPYA 1XZAA 3ROPA 1SXJC 4OQNA 5E8JA 3E8MA 5JI3E 4Q4LA 1S8NA 4LRSB 4XFKA 5HOQA 1II9A 2WUVA 2OLJA 4I50F 5HDQA 4F71A 2AC7A 4BWYA 2IUEA 1VJ5A 2GD6A 3IURA 5CEJA 5LXTA 4URHA 1JFFB 1GKLA 1IBRA 2CYBA 3QFCA 3RIHA 1P0CA 4X6UA 2AQIA 3MINB 3RW9A 1K89A 5G1PA 3QUCA 4AJKA 4B46A 1EA7A 2FPLA 4FBMA 4UAVA 2I3ZA 4DJFC 3THWB 5HJEA 1QVVA 1R12A 2Z04A 1O6ZA 1WF3A 1IUNA 3L0BA 1BX3A 4R3NA 4RTPA 1I1NA 4PYQA 1K3FA 2H00A 2O1SA 4LJ9A 3WO1A 1CUDA 1SD2A 2XECA 4GL4A 3V9AA 4F3RA 2HSWA 1EFCA 3OJFA 3KR2A 5DTRA 5GQSA 2H4HA 4YJ2A 4UM9D 1SQ0A 2OBXA 1VXOA 3QEOA 3PNYA 4P35A 2FPWA 4X3CA 3T4XA 4B5KA 2G4CA 4HN4B 4FOSA 5J40A 2XDQA 3ET5A 2HQBA 1JECA 2CYAA 3P20A 3B60A 3IBTA 1L7XA 2FSGA 4FNAA 3WLIA 4GR4A 3V5NA 2V45A 1CDEA 1HDIA 1CB7A 1X3LA 2D2VA 3I52A 3BFPA 4R7TA 1RLIA 1FJXA 2FDRA 3QI7A 4L8VA 4MVJA 3C1OA 4NEQA 4QBFA 4AZWA 3EXAA 4KCGA 3DL4A 4Q7EA 4I8IA 2K87A 1CUFA 5COQA 4CMEC 1CJCA 2WDZA 3UXEA 2VPZA 3DPIA 3LGXA 2CHVA 4M0KA 4TS4A 1XPOA 2CVOA 2QXYA 1O96B 3E9CA 1ND5A 3A9RA 3WGUA 1MB9A 1N5KA 3R4CA 1EXMA 1B8VA 1N3YA 3IBFA 1Z6AA 4JJZA 4NYJR 2WYUA 3E9RA 3JSAA 3LPDA 4IGEA 1GJRA 1YBAA 3BKWA 4H7JA 5KNLA 2X0DA 3OF3A 3AUXA 4KWCA 5A06A 3ZPXA 2O14A 3OPYA 3SFTA 1E77A 3JWGA 3IKVA 4EX7A 4E2FA 1L4MA 2PQ6A 4RULA 1R3UA 4BLOA 1TEVA 3L49A 4PINA 3ZHUA 4QOEA 1YCHA 4O4JA 1LBQA 3FYUB 1W19A 1H42A 2GF9A 3FUTA 2F59A 1U90A 2YWCA 3MUNA 2F8TA 4IV0A 5A0TA 4BIMA 3LA6A 3O38A 1T5LA 3LQQA 3RTGA 2IW1A 5LWQA 1B41A 2Q45A 1G5TA 5K99A 5BSHA 1M5TA 1Q84A 2QTMA 5AVWA 1M1YB 2RD2A 2VJBA 3LMKA 4O2LA 4FFRA 5LLSA 3PEYA 5T6MA 3G02A 4YAEA 5YASA 2GFQA 1K0FA 3KUUA 4Q3BA 4MP8A 5EA2A 2BUCA 4GZ3A 3LBYA 2DUJA 2IU0A 5TT0A 4DHEA 1Z6XA 1J1UA 3OQVA 3SVZA 3ZC3A 1KP2A 1JAYA 1NI3A 4HLDA 3UJBA 3FTFA 2R7MA 3HY3A 3IUNA 3H5AA 3HXMA 2GILA 3GLHB 1N8SA 4HRAA 3KVNA 1XU9A 4C29A 3GLVA 4FYJA 3ZDRA 2J9ZB 4NP6A 3CUYA 5JAQA 5KPJA 1D1TA 1O2DA 1XNJA 1SCJA 2NMVA 3CW9A 1BVYF 4D2IA 1Q7GA 4B45A 4NYMQ 2JRCA 1T2CA 1SB9A 3DDZX 4G5QA 2VQFB 2VH1A 4YCDA 1YS2X 4ZN6A 5ILQA 1NBIA 4RPKA 1SKYE 1UWVA 3I5XA 2BM8A 1IPHA 3O73A 4N3GA 4KSCA 2B0CA 2PAAA 1QC5A 2VO1A 3Q9UA 4FEAA 3U3KA 2G9UA 4AXXA 2OD9A 2BN4A 1A9ZA 2YWDA 3DG9A 3PRJA 3ZHSA 3OLCX 3B53X 3HXPA 5FRDA 1TAHA 2SKEA 3C8UA 4CF7A 1P5RA 1APBA 3OTOB 2EBUA 4IIDA 4P7FA 4AROA 2L42A 3MYYA 4BNVA 1QS0A 1GN8A 2EFHB 2QQFA 4HOYA 4E46A 2XH8A 4IAOA 2G82A 1L7NA 3CZPA 2COKA 3UJCA 1FLVA 4LYGA 1U1EA 1HMYA 3CLKA 3D8SA 3ITNA 3P8ZA 4IXWA 1H2AS 1JEOA 1C4OA 2FZEA 3A4MA 4DRXA 5HQ3B 2AFIB 1B7GO 1Z2OX 1H5QA 3GV0A 9LDBA 2XUOA 3RU3A 2NQ2C 3HUUA 3QTLA 1S2MA 1YZVA 1P81A 4FILA 4PQEA 1T2DA 3RVDA 3TBKA 2G0TA 2Y71A 4MVJI 4ZEMA 2O59A 2WPNA 2XUQA 3HVIA 3QX3A 4R51A 4A03A 4LRUA 2VF5X 2HC9A 4Q01A 4YRFA 3RKSA 3I4CA 2KLHA 2G70A 3FZNA 5EKTA 2VJMB 3B70A 4Q3AA 4UNPA 2VYNA 3U16A 4M36A 5KYWB 2VXCA 2XMDA 3FR8A 2JCYA 2FGJA 3MQ2A 3FD8A 3EPJA 5KOHB 1JG7A 1V39A 4HLCA 1I80A 4NOLA 3S40A 3EQ7A 1T6XA 4D96A 3HFGA 4UHHA 4HB4A 2YRFA 2FDCA 2C5HA 4R2JA 4JR0A 4OA5A 3KUXA 1NVWQ 1K9SA 1EVEA 3P32A 3OPYI 4HYTA 4DABA 1H1LA 4UAGA 4PPQA 1YA6A 5TVKA 3WFIA 4HGZA 4GZLA 4E88A 4OHVA 2KMLA 3ZDAA 1D8TA 3JWIA 4XPZA 4ZCRA 1FTSA 3M4JA 4QG3A 2FZGA 2VZEA 3FFXA 3G13A 4EG0A 3RF6A 1LPAB 3HB1A 5AVKA 2B8EA 2D5CA 2E37A 3F3YA 3EEBA 5CXXA 4YTEA 2Q3EA 5E7QA 3VHLB 1I2AA 2X2FA 2X3FA 4TVOA 2XOKD 2HCFA 1CYDA 4K0KB 1SKAA 3C3EA 1X15A 1EB9A 3Q2KA 3TL2A 4X41A 1BFDA 3PE4A 1RPNA 1J0CA 1ITZA 1QX3A 1ST2A 2AKYA 2IYLD 3B48A 4N6NA 4RH1A 3L6BA 3RVRA 2R8BA 4U7GA 4RJ2A 1SVSA 4YP6A 4BZXA 3IIKA 3TPZA 5A4AA 1BRTA 1NPTO 4KO2S 4P2GA 4QHTA 3OJ0A 1FPQA 2H0AA 3WSWA 3GLIE 4D4MA 4NLLA 4HK4A 3V7WA 2LNDA 3TQHA 4HNVA 1G5IA 3VI4B 1PIWA 4D57A 3NIFB 2VNIA 4MW5A 1JB9A 4JLUA 1Y6RA 1GAJA 1WZUA 3IDZA 3TLMA 4ZHQA 1XDWA 4MKFA 2AIRA 3CZ5A 1NLMA 2XYPA 5EJ9A 2ZIFA 1D4ZA 2XVXA 2O07A 4KVZA 2A86A 2F3SA 4J8PA 4X71A 1TKCA 5FTKA 4XWAA 3IDAA 4DL9A 5JO0A 1KJ8A 1IM8A 3BMCA 3PS9A 4MLZA 5U1PA 5BWLA 3OZBA 3JTEA 4KBFA 4UNQA 4WUVA 2X8JB 4YB8A 5CT6A 3RFFA 3GEGA 2DSNA 4PYOA 1FFSA 2FHSA 3ZE1B 2FP4B 5KMGB 3G6WA 5C8YA 5BSMA 3VZPA 3ZZMA 2PGIA 2Z0MA 1NE7A 1V11A 3G7NA 1L4LA 3LRTA 2PMCA 1W76A 4LRYA 2QG9A 4Q7MB 3WZ2A 1HKHA 4TLAA 4KN5A 1FYVA 2TMKA 3UWMA 2XB4A 4JDPA 5IN4A 5LZ4A 4HHEA 4OUKX 3SIWA 4EMSA 3ZH2A 2ZJYA 3EFOB 2XRFA 3GLKA 4CCYB 5AVQA 1PNRA 1QTQA 5LYJB 3C3KA 3EUFA 4XB6B 4MUFA 1DCTA 4IRUB 1K63A 2X8WA 4WXMA 1QE5A 1ZH0A 4BRUA 4JQCA 3RVKA 3THSA 4AJIA 1KVRA 1ZGHA 1M3SA 4O4HA 2DQ4A 4UEWA 5JMWA 2RBGA 1T4BA 1SZCA 1LFAA 1JGTA 1SOMA 2C9MA 4GGOA 1X1BA 1Y33E 2E3JA 1T6ZA 3AEKB 3DEYX 4PYLA 5CM9C 4JLKA 2FZLA 5ALQA 3SP1A 1W30A 3ZS9A 1E3MA 2WTMA 5JBIA 1N6HA 3B1JA 3IT2A 3BMNA 3T95A 4QODA 4M0MA 5KOJA 3DUFB 1E0KA 3UC5A 2MSKA 1U8FO 2NUBA 2LTAA 3FLMA 3B6MA 4AN4A 5TV2A 4U0JA 5EZ5A 1MP0A 5EXSA 5IS2A 3DA8A 2IDKA 3JQFA 2X22A 4PYNA 4QFCA 4ALIA 3C6QA 4RJLA 4BMDA 1E2EA 5GWXA 1PGQA 2X77A 1LDNA 2AXPA 2PK3A 1GFIA 5IG2A 2XZLA 3OX4A 2WG0A 3VZCA 2P9QA 4QSMA 4PRLA 5CA0A 4ARCA 2ORIA 4ML3A 1MRSA 4KQIA 2VUIB 821PA 1ZNWA 5KVCA 1V71A 4HDMB 1H3FA 4X7RA 3HWSA 1M0TA 3WTCA 4QUKA 4KQKA 4MRSA 4Q7QA 2Q1XA 1I4OA 5CJ2A 1ANKA 5FOTA 2FPUA 2OHFA 2BRUA 4KDRA 1EFTA 4U7HA 1OOEA 1SKUA 1ZVKA 4OLJA 4OUDA 3OT1B 3HR4A 2EP5A 3AIMA 4OATA 2P2NA 3OTHA 1B1AA 4E14A 4OLBA 3FNHA 4NXMB 4UULA 1B4DA 2FEKA 5JD3A 3ILSA 4N5HX 5LDGA 3O8QA 4KQCA 1X8KA 1DQNA 3RSGA 4TYWA 3SQWA 3O93A 1TJPB 3OOEA 3C8DA 1MO5A 1QHEA 1XZPA 1Z75A 4G07A 1E9AA 5LJLA 1N78A 2BFPA 3MTEA 3PCXA 4DDUA 1GHTA 1XP8A 2VKTA 2XNDD 2GN4A 1T24A 4JJKA 3FIJA 6REQA 1LF5A 4IIFA 1Z45A 3TMYA 1YH3A 4AMGA 4UEKA 2PS1A 5LKAA 1H85A 1M1XB 5EUBA 2BT4A 4C7OA 4QRDA 5CX1B 1L3BA 2JFHA 2J5BA 2JKZA 5K5EA 1BYIA 3BQMB 1UKZA 2HSZA 1MXFA 3VSDA 1BJKA 5IJ9A 5KWIA 2G9ZA 3SIXA 5IKXA 2B7CA 4DCOA 2FB9A 2JK0A 2BHNA 2WA2A 1R00A 4C4OA 4RWEA 2P6PA 2Y0EA 3IO3A 5F2OA 5FOQA 3B2EA 4A1OA 3GJZA 3PIDA 4B4DA 2C9YA 4IQ8A 1T6YA 3ASYA 4OAPA 3TW6A 1KU0A 4YQFA 1QMPA 1RI5A 3VTKA 3DKIA 1NW9B 3V8PA 5KU1A 2A5LA 1NGSA 2H8GA 3CUSA 5AM2A 1WXFA 3K0BA 2QV7A 3R3WA 721PA 1YC5A 2ZWPA 4EI2A 3B3FA 1ESNA 4BBJA 5HQJA 1USIA 5K01A 4JNCA 4LMRA 5F9FA 2JLAA 3BB3A 3L0DA 5TQ2B 3TTTA 1UWCA 3VR4D 1VTKA 1QV6A 2VSXA 3L7KA 4PO8A 4WHMA 4XIIA 4DCVA 1VYVA 1ODJA 2O7VA 4EGQA 2Q6IA 2PPLA 2JLVA 1ZFNA 2V7QD 2KWIA 4QU9A 2X5OA 2XVZA 2BM0A 4DSNA 2PGNA 3ID6C 4W5RA 2PZBA 3FUVA 4B80A 1ULZA 5JADA 1LF0A 1P73A 3EDQA 1B0AA 1Z4IA 2C82A 1G291 2YJ5A 2Z4RA 3WHPA 4LDPA 5ALYA 3OZXA 2OTCA 2W8ZA 4U2EA 4YMSA 2BTOA 2CHFA 4O2RA 3WHIA 4IJ5A 1Y82A 4RC9A 4LJKA 4UBOA 5EE3A 3I2IA 5K6AA 1LLQA 3HLYA 5HTOA 3PDWA 3HVHA 1L7RA 3KQOA 5T4EA 4B82A 4E5DA 2PXHA 2IUYA 3FPCA 3MRVA 1G18A 4WCFA 1WWKA 2UZ4A 2J5QA 1YS9A 2JGEA 4ODIA 3R1IA 4KHZA 3EYWA 3HNOA 3VSCA 1O94A 4Q1VA 4N01A 4J3NA 2JAWA 2VCHA 4CV1A 1KJQA 5EFZA 4US0R 1YCDA 7ABPA 4JEHA 1M2JA 3WBBA 1PF7E 1QWOA 4J7CA 2E49A 5FO0A 3ZI0A 5DYIA 4XAQA 3PHCA 4E2WA 1KS2A 1UINA 2HV8A 1PK8A 3OLYA 4AQDA 4B73A 3HXKA 2Q6TA 3AM5A 3VI3B 5KCMA 3PRKE 5KWSA 3UWSA 2IYVA 1QYDA 4EJSA 1NQAO 4OGLA 3DO6A 4FCCA 3I1IA 5B3KA 1FYXA 1KEUA 2RK6A 3R74A 7REQB 1N0WA 1HDGO 3EMDA 1MOQA 2ZW9A 4H16A 4F1KA 2HSDA 2QLFA 3K71B 1EDDA 1XTRA 2UKDA 4HKTA 4XLLA 1B8PA 2P9TA 1NV9A 2P9JA 8ABPA 1VL1A 1CUGA 1UP6A 2C3UA 4OKNA 4PYIA 1PQ4A 3TLGA 1RHJA 3KJGA 4OQEA 3UJHA 3I32A 4F2GA 4ZAVA 4UAUA 1ZMXA 1O5OA 2C9CA 1H2XA 2V6JA 3OJEA 4MAFA 4K6CA 4EIWA 2HXYA 2I7XA 5H70A 2G1KA 3CLTC 2P6RA 3HCCA 5E3JA 2WUWE 2W2KB 1VKZA 3H84A 3QELB 4RPIA 4WASA 1MEEA 3R44A 5HM6A 3ZG6A 3T1TA 3VKGA 3GJ0A 4L95C 3UFXB 2FMHA 3BRQA 3RODA 3JQ6A 5JSUA 4JI8B 5FPTA 5H82A 2PT6A 1P62B 1QZUA 3GRCA 2HU5A 4L0MA 5D87A 4C4TA 2FSIA 1GL6A 1F20A 4IHJF 4R8RA 2HYIC 1OKKD 4BRSA 3V7NA 1J2TA 1G8KA 4IDDA 4Z0PA 3RFXA 1NFFA 2O3QA 3E3OA 3EQ8A 3WYDA 5CLJA 1GUDA 3DZFA 1LDBA 3P97A 5DB4A 2PPVA 4LF6B 2R8OA 4K2AA 3MLBA 1LH0A 4BBZA 5LPNA 1QHYA 2V6MA 2V7TA 3D6NB 1G16A 3LKZA 1S7CA 4MJ7A 1UBGA 1WM1A 2VYQA 4KMSA 1D03A 4BJ6A 1Y1QA 5EMNA 2YV1A 3M4NA 2VJCA 3Q2IA 4TXLA 3TN7A 2N1MA 3BF8A 5FA8A 2O2CA 2BM1A 2Q7DA 4BLTA 3NAQA 1X7XB 4D9EA 2GKSA 3WRXA 2HU7A 1HSZA 1PX0A 3IHKA 5CFLA 4RPJA 4YRZA 1V8PA 4ZAYA 4JLPA 3BK1A 1U8CB 5HCNA 4HAZA 4G2TA 1OXKB 3EZXA 4ZYTA 3P0RA 2BHLA 2O0HA 2OKCA 1KMNA 4JCOA 4YMWA 4B4UA 2XVAA 2W2PA 2RHHA 1A2KC 1Z39A 1VCIA 2MSNA 2PN1A 1T1JA 2VN8A 3I64A 1DWQA 2J87A 4ZVOA 5LYYA 1TQ8A 5HWSA 1GDHA 3CR8A 1CIVA 3D31A 3IJEB 3WK7A 4EW6A 5JW6A 3ZZ0A 1R8SA 2OUIA 2A0UA 3KWJA 2CDAA 3O9MA 3LL7A 1FDOA 3N0XA 3SR0A 4CF3A 1XE3A 4QT0A 1NXWA 3ZGZA 3FPKA 1CVIA 2FPRA 1HG0A 1XD2B 4FQ8A 1KVSA 2GPAA 3A2MA 4PY2A 2EF1A 4IJKA 2EYUA 1GYRA 1PT9A 1IPEA 2Y8EA 4R3WA 3MRXA 1R9JA 2QL9A 1RQ7A 1UFVA 2DCMA 4JIMA 2HB6A 3LUJA 4JOSA 3OFSA 3IMGA 3HCFA 4UEQA 4WCFC 4Z5XA 2JLZA 3OHPA 2QI9F 2RE8A 4Z1MA 2YR0A 1NIPA 2YZGA 4MIKA 1KZHA 1DLIA 3AM1A 4R9RA 1Q6YA 1NBMA 2H1RA 1N7IA 2D4AA 1O94C 1O97C 5L3RA 2QRKA 3FDZA 1Q92A 3NOXA 1Q7CA 1DIBA 1CIJA 3JQ7A 5AOVA 4AZ3A 3P27A 2YC4C 5EJ5A 4DR3B 4XDYA 3BWXA 3ZDBA 2OFWA 2PD6A 2QIOA 1WP4A 1LY1A 3OURA 3R20A 4H7FA 4ITVA 1RM4A 1N2OA 2BZSA 4PXAA 5K51A 3ZZNA 1HT3A 2WMDA 1XR3A 3QFFA 1RSZA 5F2NA 1EE1A 1JEYB 5KJ6A 2A59A 2VH2A 2WHPA 1FRNA 2IEDA 2JASA 4XSVA 4ZU3A 4DV5B 3OECA 5B12A 1R8QA 3ES9A 1RI3A 1Q20A 4NU5A 2X40A 3ZH9B 1EWVA 2JGDB 1CZRA 3A8TA 1WTCA 1IK6A 3B8EA 3E1GA 3NYRA 4N3CA 2WJGA 1G21B 5SZHB 3TVYA 5JNSA 4CF5A 3TCKA 5EE5B 4CMHA 3AOGA 4JXXA 3IVXA 5DK6A 1SBHA 3EXIB 3S3TA 3X2FA 2GEKA 3OZDA 2FSVC 3AUKA 1RCUA 5BXQC 4UDXX 4AF6A 5B37A 1RMYA 5EI5A 3HR7A 4TTSA 3MTQA 5GVSA 4IGAA 4ENSA 1B42A 4CLRA 3DZIA 2OESA 1CHNA 3VU9B 5FADA 1AKNA 1EDEA 3K4QA 2J3EA 3JQBC 1QPGA 4PSUA 1QLWA 3NC0C 3HU5A 1NATA 3OMLA 4QUBA 4DMMA 1NW6A 4WOJA 4W8GA 1RJEA 5AJWA 4IINA 1K98A 2BP7B 2QLMA 3QEKA 3V6LA 4DTIA 1MDBA 1QIKA 3D2AA 10MHA 1QMGA 2NZJA 4E5YA 4RHYA 4P92A 4FEGA 4LOIA 1C1DA 1BQEA 3GZJA 3L8YA 3RUHA 1T3TA 1EG7A 3JRWA 3QU9A 1RRFA 4HLNA 3ORQA 2ODEA 1Z33A 2UVPB 3GJ5A 3HDHA 1SVMA 3ICCA 2GAIA 4JFAA 5BUQA 5I7SA 4P81A 3A9CA 1P2FA 3ZTYA 4D0SA 4LZOA 1KARA 2CJPA 2P2GA 3ZYZA 1EU1A 1HXHA 5U9CA 4NK5A 3D8BA 4K9RA 1I2CA 4FHCA 2P9FA 2GYUA 2CN1A 4PPFA 1XNHA 1M0SA 4XGQA 4DREA 4D9BA 1Z5WA 2VQSA 3UJ9A 3WL4A 4C2BA 4I99A 2C4TA 1WV1A 2Y77A 2AVNA 1OXUA 3CJTA 3DAPA 3R5SA 4I66A 3MQFA 4HQ6A 13PKA 3KJXA 5K20A 2ZJFA 1PCXA 1LNZA 2WUGA 1FFXA 3BE4A 5EIBC 1UF9A 1WXXA 2QTNA 5BNIA 5DF1A 7MHTA 1E9SA 1EVKA 2W43A 3OJOA 2R1TA 4KOAA 4KYIB 2KJQA 1F3LA 3WYGA 3LYLA 3UYKA 2B7BA 5A3RA 3BKXA 3Q87B 2C2WA 4LC1A 5IT4A 1ZGAA 3KT3A 1N2EA 1UZUA 2PYIA 5F5XA 2OYRA 1XCGB 3ISJA 3EQZA 1KQ3A 3LLSA 3PNPA 4LXIA 1VI5A 5TE9A 2JANA 4L0CA 1DV2A 1JQKA 4IGIA 3ADPA 3A0UA 3EDMA 4EITA 4S2EA 1TKAA 2Y76A 4JT2A 1JXAA 1Z13A 4HN2A 2ZZMA 2WWGA 1S2LA 3FHJA 3NHAA 4W5QA 3HXLA 1WKCA 2JGFA 3KVRA 3PSHA 5BT8A 5FFMA 4M1KA 2C2ZA 3PXCX 1E60A 4H1VA 1OV6A 2I0FA 4M9UA 1CZHA 2NSLA 3BJMA 2GNAA 2ODNA 3RVMA 4EYOA 4YT4A 2D1TA 4IIJB 4DIMA 1PJ3A 1C3OB 4PVDA 4RFSA 1PD0A 2FUEA 1GCIA 3G2OA 2GBIA 2R8XA 4P83A 4KMRA 1DFGA 1VHJA 1GEEA 1QGDA 2X19A 5HJ5A 3RUDA 1PHRA 1ML4A 4Q34A 3GRAA 2GHRA 3KBOA 5L53A 1AQIA 1HL3A 3U13A 5CB4F 3HYSA 5H02A 5KX5F 3MJ4A 1U3UA 1XB2A 2Q6OA 2YJNA 4AY6A 1BA2A 1QFSA 1A0OA 3E9DA 1NONA 3MSCA 3O8BA 4ZVLA 3VH1A 4B4WA 4B2YA 1KZ7B 3K8QA 3PQ3A 4D44A 3DTYA 5JEEA 2BMWA 1IQ0A 2VVTA 3ETCA 4L9WA 1V8DA 3D4IA 4M9RA 5DW3A 1FYEA 2Z58A 5TGDA 3TLZA 4PHGA 4ZDKA 1DZIA 5FA5A 1NNEA 1HNZB 3AIIA 4RHEA 1PGNA 2OQIA 4LRXA 2P6NA 5G0SA 1XALA 1G98A 4EPTA 1NMXA 3WDLA 1U2SA 1YZGA 4WT7A 3RK1A 2GD2A 5IM4A 3UUFA 4EZIA 2I87A 1TU0A 1DAMA 2JGMA 3F0TA 3P0HA 3RK0A 4QLAA 221PA 4FD2A 5T7BA 2OO5A 1YHYA 1RYEA 4OBXA 5I9TA 1RP7A 4QRHA 5B7NA 1Y5NA 3ZQJA 1X7HA 4M7RA 3IV7A 1PQYA 4B09A 5BYAA 4MRAA 3MB8A 3HJNA 3NKVA 2PGDA 3U3MA 4ETWA 3C7DB 1VGQA 3ZU2A 3MUFA 4MV5A 3TLXA 4O0LA 2VTBB 3S6JA 1GFZA 3BJIC 1UEXC 2JFQA 1PJSA 2XD4A 3HY4A 1JIIA 4LWQA 5CFOA 2ZRCA 3E7PA 3EEYA 4KEAA 4NCXA 1TLTA 2P2LA 1VJ1A 2C98A 1EFPB 3C3BA 3OX3A 1ZM4A 2VBIA 2C4UA 3QKUA 2DRIA 1ZSNA 3JTMA 4WD3A 2XV1A 5EXXA 3F6RA 4IXTA 5TT1A 3T3GA 3ZVKA 4S05A 3DZKA 1SQGA 1JHZA 1RWVA 3NXKA 1RRMA 4R16A 1XTJA 3H6KA 1XFDA 4QWMA 1BGVA 2ICAA 4M9SA 3VOSA 3AM4A 3C7CB 2D4HA 2J0VA 3PENA 5EJMA 4AJLA 3A2KA 4K8RB 3G7SA 1LD3A 1Y7TA 1FLAA 4MYUA 1UBOS 2W6JA 4NC9A 1SELA 4ZO9A 1IM2A 1RYYA 3QK7A 1ADJA 1MENA 4Q1EA 4AO6A 2PZKA 3NVDA 1XTKA 2CUKA 4I9UA 3T5MA 4ZD6A 4G0OA 4EEKA 5ALPA 3R5TA 2EQBA 4DLAA 3HJGA 3O8NA 4LYYA 1AV7A 2JLWA 1ZM3A 4IZIA 4BV3A 1WZEA 5TEWA 3RRJA 4NCIA 1JHOA 2PIAA 5HNKA 5L7YA 3L07A 3NTVA 4YMVA 1R6AA 3NHWA 5EJ7A 5IPFA 1IN1A 3CEPB 3BREA 3L6OO 4NYIQ 3QH4A 1TQ2A 4EAQA 4UUAA 4RCYA 1P0MA 2FW1A 4GQBA 4M0LA 4G85A 1G2IA 1OPRA 3D3EA 3S99A 4IQGA 4OIMA 3T7AA 3TCNA 5B58T 1VKOA 2Z2ZA 2VQEB 2R8ZA 5IEJA 1GRCA 2YUTA 3GLIB 4H7EA 2UXDB 3FAZA 4AKIA 1NVAA 3IERA 4ZCSA 1USUA 3WL8A 1OTXA 3GGDA 4P4GA 4DXDA 1HR0B 4F6RB 2SCUA 4BJ3A 3ROTA 4DJEC 4LRTB 4L27A 2YMPA 3HJTA 3W4IA 4KDCA 3FJYA 5JU6A 3AZQA 2C0PA 2D1YA 4GAEA 1KRXA 3U4AA 3UFBA 1X1TA 4AZTA 3FCEA 1TC1A 2IIBA 5BY2A 3KVOA 3KYIB 4P0QB 1AZWA 2R87A 4IHQA 5BYKA 2PKWA 4D5EA 2Z9BA 3JASB 2RHLA 4NU6A 3OC6A 1VJDA 2AQ8A 4B3MB 4TZ0A 2VUUA 3LDUA 3P9IA 4IDGA 3ZLJA 1FQJA 1TCAA 3OKFA 4LOAA 4WESA 2JC3A 2QVYX 3BRCA 1ZHHA 3FWPA 1ZI6A 3IUYA 2AN4A 3IOYA 4FT4A 5B53A 2NU8B 2Y9MB 1KYYA 2GCIA 2XUZA 3M3HA 4HFJA 3G2QA 1KETA 1ZQ1A 2Q3DA 2VP0A 3KTAA 4GQIA 3AO0B 2Z2XA 4HNQA 4LA4A 4LZNA 5AW3A 2OO5C 4MUJA 1DAKA 3UHJA 3GP8A 4PF1A 1MB2A 4Y0NA 1AKRA 2AC2A 4INZA 2RB4A 1MW8X 2IDMA 3D3JA 3NXSA 4INAA 3SZLA 2GCOB 3T38A 4B79A 4EHKA 5CVVA 5BV0A 2O3RA 2XODA 3UNXA 1T5HX 3RAJA 3CPJB 5E7JA 3NJRA 4BQFA 1IZ9A 3OA0A 4I1UA 3PKIA 2OXIA 3EAQA 3A1SA 3GRPA 2EVWX 3MJHA 2VEOA 3Q1LA 5G02A 2J30A 1G4UR 2DPHA 2EW2A 1SZPA 3NBXX 4LDAA 3MT9A 3KQYA 1P29A 1PFGA 4KDFA 2HGZA 4MKGA 5L7TA 5HDBB 1LPSA 5LMNB 4TLBA 2TS1A 1FP7A 2OV2A 3I76A 3Q3HA 2XITA 3EZFA 3Q0IA 3VPAA 2D6FA 1ZRMA 1NLUA 3O0DA 1EWKA 1Y3HA 4JC4A 3L0OA 5BV2P 4UUQA 2W9XA 4PLGA 2P79A 4H1UA 1CJSA 1U1IA 1KO7A 4O4LA 2W5UA 1O54A 1WIWA 2YYSA 1FX0A 1ZUD1 1HH4A 5EIHA 4UTPA 5LP6B 4YDRA 1KI1A 2H2HA 3UOWA 4AMUA 5LR6A 3OBIA 3NBKA 3RS5A 4JUFA 4YUZA 1JWLA 2PU5A 3DBVO 2B99A 5ITZB 2BLNA 3EMVA 2CEKA 3GXBA 3EWAA 4EABA 1RI2A 1VPVA 4LFBB 1UQTA 5JSZA 3LRPA 4XR4A 1UPTA 3TMAA 5J2TB 4JU8A 1XXLA 3EC7A 4GLJA 4CZ2A 1ZHOA 1IN8A 3F6YA 4MMXB 4OIFA 1TW3A 1N8NA 1XYYA 3D2LA 2C5BA 1ZS9A 1U2RA 1VI2A 3AQIA 3P9XA 3R9KA 1AQJA 4B7UA 3IL2A 1RADA 2GETA 3DS8A 3A3OA 2XQKA 4D9JA 5TY0A 5IAJA 1RCFA 2IVZA 4LDJA 5BPFA 4MROA 1ATZA 3FLAA 4TWBA 1BWSA 1OWLA 4I4LA 3NP9A 1KVUA 1UBKS 4N0MA 1GGKA 3LO5A 3TM4A 3VBEA 2M6KA 4RE5A 3FOFC 3HA2A 1DQPA 3VYRB 1J2RA 3SIRA 1A2QA 1IAVA 1OFHA 2M9MA 2QZSA 2YN0A 3CURA 3LQ4A 4S1PA 5K2MA 3SEAA 3FJOA 2GXAA 1UBCA 3IXLA 5GZ3A 1RLTA 3H19A 4ALNA 3DZ8A 3OFVA 1R5JA 4OQFA 5A3VA 3TTVA 5FT9A 1L4UA 4HMOA 4D6PA 2ZK7A 5ALJA 2QTWB 4L8WB 3K9CA 3K0FA 3V7FA 4DILA 3HJFA 2B4TO 3F5DA 5D51S 1C4WA 3IAS1 4JEMA 5AQEA 2P3SA 2WWXA 4PLVA 2H9YA 3WADA 4H7IA 2L17A 1FFHA 3EGIA 4TKVA 2WB4A 2B4YA 2QX9A 4Y2YA 1DC4A 4LE1A 3QVGB 4PANA 5ICSA 1TM2A 4D3SA 1YK0A 4KSYA 2D06A 2GN6A 4EHFA 2ORYA 3I37X 1CZOA 3X1ZA 1YFKA 2C3MA 3HN7A 5G1NA 4A6DA 2PUEA 3A28A 1XZGA 3DQQA 1D2AA 4DJTA 1OFGA 2BFBA 2R1VA 1PLLA 1SAYA 2PH7A 3FNBA 1SN7A 4NV3A 4U2KA 4YA6A 3RV4A 1E8DA 2O50A 3DOIA 3NOQA 1HE2A 4NDZA 4KFCA 1JEEA 1A82A 3P2JA 2VDLB 3GG2A 1CCWA 1QH1A 2R3SA 3G8YA 4UNRA 5BR1A 3KKNA 1KH3A 1Q7RA 3M4ZA 2C4NA 2QN8A 2JCBA 2YN4A 4JYPA 4RQAA 4XFJA 1GPDG 1OA1A 1RJ9A 4XIJA 4EW2A 1JV2B 1X1CA 5EE1A 4WBNA 3MC1A 4P3PA 1NAIA 3AQ4A 1N1DA 5L4NA 5HW0A 4G89A 3HV2A 3CMMA 2QJWA 4HDAA 4JVSB 4Q3EA 1HLFA 1MVOA 2ILTA 4QYIB 3HWX1 1MPXA 1CQIA 3OWXA 4B35A 4QYXA 5LLDA 3DMGA 2VIIA 1Y4UA 2ZBVA 1E2MA 4C7JA 1DIOB 2AOWA 4K9OA 1F9EA 1A97A 3EQ9A 5FB3A 5H3CA 3JQEA 1UDWA 1KK0A 3A6LA 5LQRA 1RKBA 1F8YA 2WHXA 3DVRX 3UTCA 5DNYB 3A1FA 3HU1A 3ONVA 1U2EA 1E9DA 5C8ZA 3HXQA 4CKCB 2R6AA 1ZJ5A 2J09A 3SS8A 4I55B 5KYXB 5IZ4A 1JYSA 1RPJA 2IYXA 1R9MA 3U60B 1JNYA 1YOVB 4BO2A 2IEIA 1VLZA 5TQJA 4POAA 1HL7A 3EULA 4MPTA 3LL4A 5AKEA 3DF7A 2G5PA 1RDFA 2C4WA 1EMDA 5D1NA 4YAJA 1SVUA 4YRMA 2JKYA 1J24A 3TINA 3L7DA 4FDTA 3TTUA 1X14A 4CTOA 2ZFUA 4G1BA 3AHEA 1U1CA 1DEXA 2X0KA 2E89A 3LF1A 2I78A 4KBGA 2QE6A 4RPGA 4UJ3A 5E1MA 5I3ZA 5IKEA 5K05A 1QIGA 2VSFA 3W5AA 4CIBA 3NRJA 1PD1A 3DFZA 4ZDIA 4MQFA 3T7KA 2BGKA 4X8HA 2AOUB 2JIBA 5LUAA 4JFRA 2V7EA 1DPFA 4UFNA 4M86A 3PPYA 2PXXA 3WXBA 1D2HA 4M6WA 4BTVA 5JTUA 3P2YA 2DG2A 2Z3VA 3STHA 3TEFA 1BEUB 4NZOA 2AMFA 2GDZA 2E55A 5ALMA 3UAGA 3LBAA 1C9MA 2R66A 2EKLA 4GPD1 3S7TA 3S0JA 1Y9ZA 2WJVA 4JC8A 5TQ0B 5B64A 1XLVA 4LK3A 3P52A 4GVLA 2Z2KA 5GZ1A 3O4GA 2OOKA 3RS0A 3VR1A 4B7ZA 5H4GA 2X1VA 3MBKA 4LOHA 1V96A 4R01A 5EXTA 5JCOA 1YFLA 1NVDA 1CSEE 4CLHA 2FR8C 3LP6A 4A6EA 1RQPA 4J0EA 5G4KB 3W6NA 2FP3A 3LHDA 1V35A 4UHJA 5AVJA 3IP9A 4LY6A 4NYJQ 4XJTA 5KVQA 4F60A 5LM3A 4N48A 2OD7A 3GIDA 5AVTA 2PQMA 1BMFD 3CUWA 5JHGB 3CO5A 3GRVA 5B2EA 4BCCA 3ROXA 5E38A 5BSGA 1P1KA 4U7DA 2VYVD 1ZNZA 3ENQA 4FYIA 3NGMA 1FS6A 1Z37A 2BFMA 4LV5B 1KR5A 3W7BA 1KRHA 1PVDA 5GP1A 4UTRA 3SQXA 4NL4H 2YXDA 5G0WA 1MB0A 4ND8A 5JJIA 1T4GA 3KV1A 3L7NA 1YB6A 1E6EA 5DHRA 4WCVA 1V16A 1LJ8A 4UUOA 1RYBA 3KDSE 2Q5QA 2XMSA 3WWPA 3WR5A 2N9UA 5DJ5A 1J7KA 2AOTA 3AJDA 3QLVC 5TC4A 3RRNA 5ALOA 3QE3A 3C6YA 2CMGA 2FXIA 1Z4QA 2A6PA 4WXPA 3QBVA 4K81B 2FUCA 4YJDA 5JRJA 3GRFA 1V6CA 1GLNA 1K2VN 4DLBA 5ADUS 3DT6A 3ZDCA 2D2XA 4L16A 4MICA 2Z1NA 2ZR8A 3VPDA 4KPYA 1UKVY 2VNJA 1QG4A 4QE3A 1U9CA 1VRWA 2D0IA 3MS2A 3RYFA 2EP7A 2AR0A 3E1KA 3SC2B 4L7VA 1UT6A 4EY8A 5JYDA 1P6QA 2J46A 1YTUA 3JARB 4GEGA 1CS0A 2X41A 4EHAA 1SK9A 1EGMB 2ZTLA 4WZAE 5JEDA 2CMKA 1JQ3A 2JLSA 1QIJA 2V7QA 2WF7A 3KCNA 2Z30A 3KZNA 3UWDA 1QANA 3AP2A 4PG5A 1K8RA 4M0PA 5DNEA 1LDEA 2WIJA 1P5HA 2IEBA 3JALB 1BFUA 1IC6A 1CY4A 1T4DA 1PR2A 4X1IB 3UMCA 5JSHA 4PAMA 3IVCA 2ABWA 4MW0A 2XUDA 1Q1BA 3WTBA 5LQMA 1RI4A 2DECA 4TSFA 1XZLA 4PHTA 1F12A 4ILKA 1DFHA 4YJ3F 1B8UA 4J0GA 4JBNA 3PC2A 3W8RA 2X15A 3TQFA 3GEHA 4AWAA 5EYPA 1AK1A 4B3HA 2GQ0A 4LQLA 3LPCA 4JL8A 1OJLA 2G5GX 1PFVA 1LWNA 4TUYB 2NVOA 3P5BA 1YU9A 3T7SA 3DWIA 2X6QA 4CV2A 4LPSA 3ZVRA 3HA3A 4DTCA 5KZMB 4NONA 4DBVO 5JD5A 3NTUA 1NF9A 4NMMA 4NSNA 1PTJA 3EUWA 1K7SN 2RAFA 4HGYA 3BRWA 1SM4A 3AY6A 1WAMA 3BOSA 3OEWA 4E7PA 3ZWCA 2HU8A 5JXIA 2IU4A 2C7BA 5T64A 3KQPA 1W85A 2AXNA 3D0OA 4JN6B 2OCPA 2ZT5A 2APJA 3A14A 2K7FA 3CRZA 4GXNA 4HNAA 4OBWA 3K2QA 2HNAA 2XQIA 4Q1CA 4BTLA 3BDVA 3JYHA 3Q6NA 3O4VA 4PO3X 3ZWNA 1DI0A 1A5ZA 4BO0A 3MIIA 5BN3A 4DZZA 4N0EA 2WU4A 3KK0A 5KJCA 3ICQB 2EX4A 4M9QA 2QRZA 3NASA 4L9AA 2CXRA 2DOKA 1CULC 2ZYSA 4GI1A 5AHWA 4QOHA 4EEXA 2V7PA 1KS9A 3S29A 3VZBA 4GI3A 4HEA6 1RRKA 1V7CA 1L5WA 2PRIA 1M8KA 3FBWA 3QVSA 4GLOA 1MN6A 2QR2A 4DB2A 1VPEA 5GZ6A 3UY4A 3M6AA 1KZ9A 3CTPA 4QDZA 1A5BB 1VFPA 3DEIA 3JQGA 3W78A 2NO6A 2PKRA 2QR3A 4XQGA 4DBLC 2G4VA 1ZINA 4YQEA 3H6GA 5EPEA 5A3JA 1K8QA 3UATA 3I53A 3HYTA 1J23A 1TUBA 1XDUA 1F8UA 1KVTA 2JD2A 3FVRA 2R1ZA 4JUCA 3KTFA 1FJHA 1N2SA 1X13A 2Y67A 1EPUA 3W06A 4E5VA 3DP7A 3ZBUA 2YHUA 4R1SA 1XC7A 1JNXX 2GCGA 2W6QA 4FIDA 1ISJA 1M5UA 1S1MA 2ZB8A 3E22B 4JEIA 4EJ2A 1HFWA 1KAHA 1SH7A 2OQ2A 2GRUA 4O4IF 4X1YA 2HA4A 3R8FA 4S1NA 3UJ8A 3PC6A 1FCJA 1G38A 4MUNA 4BQRA 3TLCA 2BTEA 1A8IA 1JWAB 2NSDA 2ZRFA 2N46A 3A37A 8MHTA 5IXJA 2J08A 1JBQA 4RMHA 4MTLA 4KGZA 4P86A 4IJWA 4ENWA 2ZI3A 2D2IA 2VHZA 2A5JA 4BFLA 3EAFA 4PYKA 1JEQA 2PVSA 1V47A 4UDNA 2HA5A 3L1HA 3NBAA 1O5TA 3ETDA 3N70A 5DXAA 1GGMA 3P4YA 3ZXSA 2HN9A 2HMAA 4AURA 1URPA 1ZK0A 2ZBPA 1L7AA 4LG1A 1E4EB 1R5OA 3WGYA 2QMQA 2V58A 2A35A 3BTUA 3OUTA 4RSMA 3RWOA 1FFDA 1CF2O 2W2NA 4G24A 2MHCA 4LF4B 4MCJA 4GRDA 1D2CA 5JZVA 3UMMA 1QHFA 1UPXA 4KGDA 1L4EA 5GONF 4LJ8A 1DBRA 3V1UA 1XBTA 1T3LA 2J9FA 1ONOA 5C18A 1P44A 3KQTA 3HFJA 1J2EA 3O5AA 2IZ6A 3MPUA 3S8MA 1I94B 2JFWA 4BC1A 1XKLA 2ZYRA 3OAAD 4IRXA 1WW3A 4MMYB 5MGNA 4NATA 1K1EA 2OENG 4KMMA 1U9JA 1J9GA 1NRJB 2DLDA 3RANA 4CTKA 1IXSB 1PJQA 2XA9A 1LGYA 4M46A 4R1NA 4WLNA 3V80A 4CCAA 4Z4EA 1NRIA 2RHTA 4X62B 4L7QA 4B74A 1RE1A 1RHUA 1XWIA 2HNBA 4D82A 1QRSA 4O25A 2VRBA 1D6SA 4EY4A 4F38A 1D1PA 2PSHA 3MTAA 3S55A 1Z4OA 3VDQA 5I9IA 1OH7A 1X7WA 5FHRA 3QBJA 1MOZA 1T8RA 1JFFA 1OBVA 1PTJC 1E3IA 2PIDA 3PKJA 4ZOEA 3USCS 3U4IA 3MINA 4BFSA 4B2LA 3GVHA 4BV2A 5E6UB 3VR6A 5A5VA 5JNLA 2VT6A 3AI7A 5TXGA 1C9YA 5BURA 3ZNNA 2OLKA 3CNNA 3OQJA 4DLTA 4GNRA 2HHLA 2YIVX 3ITKA 1ZI9A 4I7EA 5KHOC 1MHTA 3AVUA 1ISMA 1RYDA 5KTOA 4FM9A 4QUEA 5E0OA 2ADMA 4WQMA 1HDOA 3IPRA 4UASA 4Q3OA 1US8A 3DBLA 3G85A 3DOFA 3LT2A 2NO5A 4AJOA 1P3JA 4HN9A 2O8FB 2DH5A 4RCZA 2EU8A 2HEIA 1TMOA 4OY3A 1ONNA 3FCCA 2BGMA 3OFND 1FU7A 1YKGA 3L7CA 3MJCA 5KAMA 4PC3A 2ZTUA 2IQIA 4RQTA 2CLLB 4G2NA 4RVDA 5DV9A 1M2GA 2RKOA 2VDNB 1XRLA 4AY3A 5CDHA 4H7HA 4Y6RA 5LLTA 2OBYA 1NI5A 3LXUX 5CT4A 3I0MA 4RH3A 3DZJA 3ZDDA 2PBLA 2D0OB 3D1LA 3W8DA 4F8YA 1EP1B 4BGIA 3HM9A 4OFXA 4UBMA 3RU9A 4D0RA 1XYVA 4H60A 4KNVA 6LDHA 4HBZA 3UH0A 2LIPA 2PXCA 2ZB3A 1ZUNB 4B6PA 4YAKA 5B1HA 3EX7C 1Y7LA 3S27A 4E1AA 4WLOA 1HG1A 3N2KB 4CMJA 4R0NA 2OM2A 3NATA 5L6MB 1YWGO 1G55A 3X0DA 1U3WA 2C95A 2V7XA 2QD5A 2QW1A 4DUZB 2VPXA 4MGYR 3KTOA 3O2QB 4DXAA 3FYUA 2CNBA 1CJUC 1PJRA 2X9LA 3ANSA 1CC1S 2DWPA 3GJTA 3OSUA 1HUQA 1NVBA 1DRKA 4KZKA 1I10A 4CKEA 2IYTA 3TSYA 3W1VA 4L0QA 4PLFA 2DHDA 2J7KA 1NN5A 1X7ZB 4HQLA 2R4UA 3U3ZA 2VUTA 3KB8A 3VH4A 4KRGA 1QV9A 2GTHA 1DWOA 1M1YA 3Q98A 3S1LA 3WJ7A 5F64A 4X63A 5K45A 1MTZA 4O63O 2HV9A 3OMWA 1D7OA 1WPRA 1IOLA 4TRNA 1E2KA 1JHQA 3B7GA 2MSLA 4G6ZA 4GMGA 4RK5A 5JXHA 4HB3A 5DI3B 4F4FA 4TROA 1SKMA 4BMSA 1NDQA 1FUYB 5CH5A 2ZT7A 3QKSA 1JJAA 2O8VA 1VSVA 2I71A 4F72A 3GLHA 4B7AA 3I30X 1DSSG 1VLJA 1GADO 2LUOA 3B36A 3CUKA 4J9VA 4GP6A 4KXLA 4B3TB 4DYDA 4OHZA 3K09C 1CBUA 1PEDA 1QIHA 2IGTA 3AB8A 1QF7A 1E8NA 1T1EA 4IQ4A 4R7ZA 5UKDA 4FDMA 2PGLA 5F1OA 5T4BA 1YJCA 1YONA 2C1EA 1Q22A 4KFRA 4UXIA 4X0EA 2DFLA 4JBYA 4P54A 2QSJA 3L1VA 1SKBA 3VSBA 4W5WA 1GILA 2NV0A 1IJFA 3SYRA 2CFTA 2PKCA 3PEUA 4KO8A 3X1JA 1DQRA 3FPAA 4LWOA 1NT2A 3PYLA 3Q7TA 3C3XA 1PEAA 4EGFA 2DQYA 4UARA 2WV9A 1PUJA 3LC0A 1EHCA 5DYTA 3W77A 1TTTA 1MIOA 4A7PA 1C9JA 4XVUA 3QOXA 2HPZA 3SBXA 5BOSB 2JL1A 3U5ZB 3T1NA 5ITSA 1FTQA 3NIBA 3ZCPA 3HVRA 4J03A 2KSQA 2OP0A 4RMJA 2BGNA 2X5JO 3FGOA 4ZQEA 1BDJA 5JFTA 3OQMA 2NUPA 1IEWA 2X8BA 3GEDA 5EIFA 4HY3A 5HQ3A 4J16C 3ZVNA 1DE0A 2AFIA 3I01M 4QM7A 1IXZA 2EZ9A 3PUWA 3QPBA 1HE8B 1NW7A 2A5DA 2BMJA 3M1AA 4X5OA 3PD0A 1NX6A 3HYNA 4XRGA 1OMOA 2P4UA 1SUWA 3L92A 3E9ZA 2EXXA 1KO5A 1K7YA 2GEUA 4PQGA 3BTOA 1NQWA 4ZOBA 3RC2A 3PGVA 3WY9A 3VJKA 2C8JA 3R5JA 1SXJE 4QJ4A 1W36B 5CA1B 3LFHA 4IG9A 2J07A 5DFAA 2ANBA 5AWFC 2VJMA 5BNWA 4MNTA 1SBIA 5GM1A 5JAHA 2GLXA 3OLXA 4GVXA 4MV1A 1OLXB 1P7CA 4W4TA 2AI2A 3HDJA 4EP1A 5KOHA 4RM2A 1UT5A 2HK6A 4AUMA 5KSZA 1PN3A 3MMZA 2XDAA 1RXEA 3CE6A 1JW9B 3VNBA 4MQUA 1G2OA 3VNQA 2QRVA 3A2NA 1Y5MA 1FFBA 1RJDA 3BULA 3A58B 3E81A 1VGVA 2PKYX 4RELA 4XTCS 2PZMA 1YVPA 1Y8AA 2BFEB 2VWGA 3W1WA 4KREA 1E3SA 2R96A 5ENVA 3H2ZA 4RTNA 1WBJB 1KU6A 1CJBA 1W2HA 2WUFA 5ALTA 2V7WA 2CT8A 4OJMX 4Y6GB 3RFCA 1R74A 1L1QA 1I5EA 2J48A 3W5DA 4ZTBA 3HI4A 5KVAA 3H4MA 1ODLA 3FYUC 4L6IA 1HQCA 4HTAA 4YJFB 4A0SA 4F3TA 2EJUA 4HR7A 1K88A 5F98A 1M7BA 3OUUA 1BJRE 1A04A 4XWKA 2FPGA 1JN0A 3ZWMA 5I5EA 1EFRD 5BRAA 3FMOB 3ZY3A 2JFVA 3R0JA 2HRDA 5JR3A 3OEEA 1M2EA 2GHTA 1I14A 1Z5PA 3P5SA 1NC1A 1X2BA 1DOZA 3DJYA 3QPCA 1TLLA 3KEFA 3MJTA 3SYMA 2WNIA 4YQZA 1L8LA 1CUIA 1ZD2P 3GIWA 3KM0A 3KJZA 4Q9JA 4B3DA 4AYXA 1C7QA 2YNMA 3C98A 3A06A 3A36A 5DDIP 1R64A 2EKDA 1D0IA 2V3VA 2ZB7A 3AIKA 3GOHA 3T1OA 2JCVA 3LYAA 1PS8A 3CBQA 1E20A 2AG5A 3LVQE 5IUNC 4EG5A 2AXQA 4R1QA 2X2PA 1JA0A 1A9RA 3WHKA 1JDVA 1EFLA 2DUUA 3SU8A 3WBKA 2YKGA 2GEFA 4UZEA 3UCEA 1FZTA 1FSPA 4PPNA 4N0QA 4EW3A 3SS7X 1S2NA 2FP4A 2H1FA 3E8SA 3QNMA 4PGFA 2AN9A 5CBPB 2PBRA 1HQYE 4MYRA 1DIAA 3MOGA 2XADA 4X7BA 4DA6A 1EB8A 3EJ6A 5HKLA 3FSGD 4OHPA 1GTL1 1A76A 1GNQA 4HEA1 4L07A 4X1KA 3WK5A 1F2TB 5P8WA 4M21A 3S2YA 3TMKA 3EFOA 4YGXB 2Y1DA 3Q3JB 4CCYA 1JJVA 2J3QA 2ZP1A 2HQSA 2ROQA 4NV1A 4V0NA 5LYJA 1Z8NA 3IQEA 1J8MF 3H8WA 3KKPA 3W3ZB 2X0RA 4YXWD 1XPUA 1X9GA 3KYDA 1AO3A 3DMYA 3NWOA 4MXDA 5I9NA 1SVIA 4HWTA 2HJVA 3VPCA 3FOEC 2F4NA 2CY0A 4D9NA 3GMTA 4NDAA 1C7IA 1LFDB 2NXEA 5AW8A 4CUKA 5JYBA 3RROA 1SU4A 1KMMA 3FWHA 4Y9SA 3TTYA 1QRUA 1WXEA 3AEKA 3VC7A 5GM2A 3L04A 1JA1A 2C29D 4C14A 4FB5A 1FUKA 3ROKA 3TOXA 3W79A 2G1AA 3Q9SA 4CLXA 3CZQA 1LQTA 1E7YA 3KVYA 2ZROA 1MNAA 4YLEA 3OHSX 4NEGA 5K3CA 1TT5A 2JAXA 2VRCD 4O2BF 2FSPA 4BNWA 4HT3B 1Q0TA 4NNPA 4MEBA 1NJ8A 1E0SA 2RGCA 3ENNA 2CBGA 4KC0A 1XCJA 4F91B 4E15A 3RC8A 3EUEA 1WB5A 4HH1A 1NQTA 2FZVA 2A1TR 3BE6A 1TAUA 1M7GA 2QGFA 3KIPA 1I5RA 1RXIA 1F7UA 2ZI9A 2ZRAA 3TEMA 2DFPA 2P0YA 5C34B 4DN6A 1X86B 4M9CA 4CU2A 3AFNA 3DLBA 2Z56A 1MTOA 4MA5A 3PXGA 1VMKA 4FCTA 3EPPA 4RA6B 2DTXA 2UVDA 3H13A 3OT1A 3TXXA 4BO1A 1XF1A 4B5LA 1II0A 1Q0RA 3REGA 4KGXA 4YRAA 2PWAA 1FNMA 4C6TB 2AA3A 1R4NB 1MC8A 1L4GA 3V4SA 3MWKA 3L0CA 3E4DA 5A9SB 5AK6A 1QM5A 5T8KA 3L6CA 1TQ6A 3HPQA 5TVGA 3BTSA 5NULA 5DHTA 5LNK6 5KQPA 9ATCA 2ZRMA 2D00A 4X24A 4OV6B 2AE1A 1JMVA 4MVJE 1VHLA 4AKHA 1UMCB 3OM9A 3HBAA 2DY0A 5CX1A 5THXA 1NNLA 2YQ5A 4OMCA 3TM5A 2X0JA 1LSUA 3C0KA 4R2LA 2GJKA 2YXPX 4RADA 2YNMC 4HH3C 4MQEB 2IYPA 4QULA 2WZQA 2XNJA 3LW7A 3NHUA 3V1KA 1RC1A 2FQXA 2O48X 2XTZA 4W7SA 5I5GA 2CMHA 1VPTA 1L5MA 2GHQA 2XOEA 3UZUA 1S3IA 4H2DA 1KQOA 3PNBA 4E0BA 1QK4A 2HDHA 2I8AA 3O6VA 2Q2WA 5AVUA 3EEOA 5H8WA 3F46A 4OMDA 3FTDA 4CKWB 1SBQA 1U2DC 1F0PA 1N0VC 3F6BX 3QXSA 4YS6A 5B3JA 3O26A 2B5WA 4JJIA 2WKPA 3LUAA 4LYJA 2XKBA 1U0SY 2GD0A 4QWWA 5I4BA 1FJ2A 5LFAA 1RIIA 3O8OA 1E79A 1QHXA 1Q16A 3NHFA 1NNUA 4TLLB 1JAZA 2W6IA 3F9CA 3OF5A 1ZC4A 3VUEA 5EIXA 4RU1A 3MTDA 1BE8A 3U61B 2YJZA 2FKAA 5J5VA 3VR2D 4KACA 2R68A 2GZRA 3L8ZA 4XRRA 4D4LA 4PRKA 1RRVA 1T9KA 3D7SA 1ZU5A 5DCLA 4TVBA 1QQBA 1EEXB 4LI0A 3FOCA 2G09A 2B20A 5CM8B 3WDKA 2P9HA 5LB4A 1BS2A 3G9UA 2OCGA 1MQAA 5J63A 5AW2A 4M2LA 4DMUB 3VPFA 4B83A 2WILA 4ZPJA 1K3UB 4HDSB 1SBTA 1Z2NX 3GVXA 5B30A 1BCRB 5F9HA 4BKUA 4NFLA 1NXVA 1TDJA 3CZAA 1T5BA 1WVGA 3S5UA 2A7QA 2PLNA 1JT9A 5LP1A 1O0CA 3IAFA 2IXBA 4G37A 4MVJG 4YRJA 3LAWA 3I0NA 1RWQA 2OMKA 4MV8A 4RVOA 4ZOLF 4G5FA 3ORSA 4UUMA 3UAXA 5CBKA 1FE8A 4FOPA 4LISA 1USVA 4H6WA 1C41A 2J9YB 4U7WA 3E3MA 3EXG2 4BFCA 3RCBA 3KNZA 4EARA 1CD5A 1NTOA 3K5WA 1IN4A 1BWPA 4HZUB 2GFIA 3AF2A 1U31A 4OMFG 3ADDA 1YL6A 2C20A 4EPWA 2W22A 2BFDB 1U3CA 1ZSVA 2OCAA 2ZU6A 1VKNA 3I2GA 4U6SA 2XMZA 4WERA 5DNAA 1W59A 1JEJA 5TQVA 2DUNA 4QXPA 1IJBA 1TYDE 2XTNA 2R00A 3UW3A 4BKRA 2YDXA 5E0KB 1SQ5A 2QYOA 3DHNA 3PEFA 1YVDA 1QH9A 1SC9A 5EZYF 4Z6KA 2H07A 5IT5A 5BWNA 4MV3A 2X6TA 1F60A 4RVSA 4PIPA 4Y18A 2M1ZA 4JUDX 5FWYB 5HCIA 4CQJA 3FLBA 1AXGA 3JS5A 4DJDC 3PL1A 3QELA 3ZY4A 5I7HA 4PQRA 2HLDA 1A4RA 1FFGA 2DKOA 2WOJA 3PWSA 1OI3A