4XUCA

Synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd18 (1-(biphenyl-3-yl)-3-hydroxypyridin-4(1h)-one)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
NLLAGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
publication title Synthesis and Evaluation of Heterocyclic Catechol Mimics as Inhibitors of Catechol-O-methyltransferase (COMT).
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 218
sequence length 218
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2015-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xucA00
3HA3A 5LQRA 4UOEA 3EVGA 3V8VA 4M38A 4RTQA 3ER9A 4PCLA 10MHA 4RSRA 1VQ1A 3G8AA 4DM3A 2O07A 3ELDA 1RI2A 2IIPA 4BLUA 1HMYA 3OE5A 2PXCA 4FT2A 3VYWA 5CVUA 4MIKA 1XCJA 3DXZA 4X41A 3UJ9A 4E31A 3UBTA 2GB4A 3NJRA 2JHAA 3P9IA 4RVHA 3PS9A 2AZTA 3HCAA 1WS6A 3IV6A 1JR4A 3D2LA 2FYTA 5JR3A 3MTEA 3KQMA 4HSGA 3NWEA 1NV9A 3DULA 4P58A 4RTKA 2E5WA 4FT4A 3JWJA 4K6MA 4XUCA 1XTPA 3F4KA 3UJBA 4C05A 1R8YA 4KDCA 1Z3CA 3QOXA 4E33A 2C7RA 2PX2A 3GCZA 5ICFA 3FPFA 5FA8A 4IWNA 5F2OA 3PT9A 2VS1A 4HTFB 2EJTA 5BP7A 4BY9E 1RJDA 3O31A 4U7TB 5EEHA 4CTJA 4E70A 5DTMA 3P8ZA 1WY7A 2F8LA 3NMUF 3P2IA 1QAQA 2UYOA 3VC1A 5M5BA 4IKPA 2ZWVA 2XYVA 4LWOA 2ZULA 3REOA 3P2EA 4HTFA 3GGDA 3T7SA 2BM8A 3K6RA 5JUWA 5KYGA 2AN4A 5E1BA 3QOWA 4GF5A 4ER5A 3PTAA 4KIGA 5EC8A 5IKMA 1ORHA 3DMFA 3C3PA 1P1BA 2NXJA 1EQAA 3PX3A 1EJ0A 3C6KA 2OKCA 2NP6A 5E9WA 4GC9A 1G8AA 4OBXA 5LR6A 1X19A 1M0EA 2ESRA 2G71A 4PGGA 3B89A 2QYOA 4FP9A 4PYIA 5GP1A 5K0LA 5GIOE 3BWMA 2YUIA 4LG1A 2ONZA 2P3QA 2QM3A 1SVUA 3DP7A 4YUZA 2Q41A 5LSAA 2QY6A 4QQNA 3OE4A 1AQJA 3ELUA 1NW8A 1KIAA 3FPEA 3L8DA 5FHQA 5DLYA 2XYRA 3KKZA 2BZGA 4R8RA 5FA5A 1KPIA 3HA7A 5K09A 5K0EA 5DX1A 2P1DA 5C0OE 2P3OA 4FSDA 5DTQA 1RJGA 3HM2A 3FYDA 5E2AA 1O9GA 2YX1A 4Z2YA 2Y1WA 1SKMA 1JG1A 7MHTA 5EMMA 4PCAA 5E9JA 4POOA 3G2QA 3FUUA 4RVGA 4KVZA 3AWIA 2PX4A 1YFLA 4PNEA 3ANXA 3PFHA 2B9EA 3G2PA 1IXKA 4PYOA 5E2BA 2GPYA 2AS0A 2ZIEA 5CUQA 5FQNA 3EVAA 1Y8CA 5EG5A 4PIMA 5KQSA 2LD4A 2PXAA 3LDUA 4CXMA 1KHHA 3LKDA 1L9KA 2PWPA 3DXYA 4R6WA 3V97A 5DSTA 5LQCA 1F38A 3EVBA 3HVJA 2IDJA 3NTVA 1VP9A 1AQIA 3Q87B 4G56A 4QQKA 4RYLA 1XVAA 5CCXA 2IBTA 3ERCA 2ZZKA 4FR0A 2WA2A 1O54A 4LWPA 2BR3A 2PT6A 2P8JA 1SUSA 2H11A 4A6EA 4YMGA 2VDWA 3BGVA 2FK7A 3EMBA 3DMHA 2AOWA 5ICEA 3KQWA 3I53A 3JWHA 3TKYA 5EKUA 3GRVA 5T67A 3FRHA 4A6DA 4GOND 2NXNA 3M70A 3G2MA 4V0RA 5T6BA 3B3JA 1RI3A 3BZBA 2PLWA 3NW9A 1FPQA 2JH8A 2NXCA 3CBGA 2OYRA 3FUXA 2FPOA 3K0BA 3UJ6A 8MHTA 3FTFA 1IM8A 2NXEA 4OQEA 5DM2A 5CCBA 2G1PA 4PGHA 3TPZA 1OR8A 1RJFA 3HVKA 3B5IA 3DXXA 3DOUA 4MQ4A 5DXAA 3TOSA 4AX8A 2G70A 2YXDA 1JTEA 5CIYA 3EGVA 3BGIA 1BOOA 2IGTA 1QAMA 3CJRA 2OB1A 2Y1XA 5ERGB 5D1NA 2B25A 2IH5A 2XVMA 3G2OA 4KW7A 1X1CA 2Z6QA 2O06A 4YV2A 5DWQA 3T7RA 5DM1A 2JG3A 1RI5A 4DA4A 4YMHA 3FTEA 3SR4A 2FHPA 4BLVA 3MQ2A 1H1DA 1XCLA 5HIIA 9MHTA 4OQDA 2OPBA 5GINE 4PYKA 3EEYA 1V39A 3KPVA 3R3HA 3A7EA 3HCCA 1JQ3A 2QRVB 3HNRA 3NVKI 4QVGA 3GRZA 1TPYA 2GLUA 2OY0A 3DH0A 1BC5A 5CD1A 3FUVA 1NW5A 4KIFA 2CMHA 4RTNA 3G5TA 5T64A 1NBHA 2QRVA 4O29A 5B1SA 5K0JA 1INLA 1VPTA 2JHPA 2N47A 2OO3A 3A27A 3EVDA 3PX2A 3THSA 3IEIA 2FRXA 3M6UA 2H1RA 2UYQA 1DL5A 3UWPA 3UJCA 5P8WA 5EQJB 2HMYB 1G55A 2EG5A 4E2XA 3KPJA 1D2CA 2ZTHA 1KPHA 3KPUA 3MERA 4LECA 5CVVA 4AZSA 5GM1A 4CKCA 1O9HA 2CL5A 3HCBA 2P3LA 2C7OA 2P7HA 2GH1A 4P7JA 2DPMA 2HNKA 2IDKA 3E8SA 4F86A 3BWYA 3LL7A 1VIDA 3TQSA 3A7DA 1JQEA 2PXXA 2PVCA 3LPMA 2PKWA 2ZBPA 5FQOA 4H0NA 3HEMA 1HNNA 1KPGA 3GXOA 3HA5A 4HH4A 2PX8A 1R6AA 4M37A 5MHTA 2CKDA 3KQVA 2AVNA 4DCMA 1QZZA 3LDFA 4EK9A 3CKKA 1YZHA 4V0QA 3KHKA 3UFBA 4P7KA 1X1BA 2KW5A 1KR5A 5C1IA 2PV0A 3SX0A 4KRGA 1NT2A 2FCAA 3GDHA 1JSXA 3SVZA 5EIFA 4CKEA 2ZWAA 5K03A 2DULA 3G7UA 4C08A 1SUIA 4NECA 2O05A 1EG2A 1TW3A 3HVHA 5DT2A 3OU6A 3AJDA 2GS9A 3OPNA 3LBFA 5HZMA 2UZ4A 1YUBA 3NVMB 4RWZA 3MAGA 5EZQA 3UA3A 3FPGA 3SSMA 3EVZA 5U4XA 3TRKA 2ZVJA 1PJZA 3DR5A 3U81A 1NE2A 2ZW9A 5LQJA 4RTJA 3KU1A 4E32A 2IH2A 2B3TA 1G60A 2IPXA 5EKXA 3FTDA 4U7PB 1KYZA 1L1EA 4BLWA 2G8NA 4ER0A 3OFKA 1L3IA 2BH2A 3C3YA 3TMAA 3GRUA 4QDKA 4KDRA 3DTNA 5E9QA 1RI1A 4Y2HA 2EX4A 3KQPA 4OA8A 4CWAA 4RTPA 4B17A 1ZGAA 4RTLA 4RTRA 1QANA 3O7WA 4PYLA 4GUAA 2JJQA 1JG2A 4DZRA 5F2KA 1FP2A 1I4WA 3LCUA 5EHGA 1VBFA 4AZWA 4DKJA 2PT9A 4FGZA 2YXLA 3PVCA 1Q0SA 4EKIA 2ZIGA 2ONYA 2ZFUA 3MTIA 1FP1D 3GO4A 1XJ5A 3TR6A 3ELWA 4YV0A 1KYWA 1I1NA 3C0KA 5K0BA 3H2BA 4E30A 1VL5A 2AOTB 2O57A 1UFKA 5ICGA 5K0GA 5BW4A 5HOQA 5KS2A 5K0FA 4PYMA 4RX1A 2ORED 2UYHA 1M6YA 1DUSA 3E23A 4PONA 2ZZMA 2IFTA 5HIMA 2NP7A 2AOTA 4RTMA 1JSZA 4CKBA 2VP3A 3EGEA 1ZQ9A 5K0CA 1N7JA 1WXXA 2WK1A 1N2XA 2R3SA 3GU3A 3ORHA 3S68A 5E8JA 3JWIA 4DQ0A 3B7PA 4L7VA 3ID6C 5GOZA 2C7QA 3E7PA 4GC5A 2HV9A 1NW7A 3THRA 3LDGA 3Q7EA 4OX9Y 2P41A 1JG4A 3C6MA 4GOLD 3LHDA 3LSTA 1ZKDA 4R8SA 3SSNA 2O0LA 3SGLA 2EJUA 3KPYA 5EVJA 4MTLA 3OZRA 4JXJA 1ORIA 5GWXA 4AZTA 1XXLA 3LECA 2AOXA 2XVAA 4GOMD 1VLMA 3A4TA 3KR0A 3CJQA 4QTTB 5EGSA 3SSOA 3MHTA 5EPEA 3A25A 3ELYA 2H00A 5E8RA 1I9GA 4HRAA 2OXTA 3FUWA 4DF3A 4YUVA 5G02A 4E2ZA 3R24A 5K01A 3P2KA 1Q0TA 5CM2Z 3OFJA 4FSXA 3M33A 3AY0A 3KR1A 5E1OA 2P40A 1RI4A 3M6WA 3OZSA 5FWAA 3TLJA 4ER6A 1SQFA 1R74A 4X60A 1F3LA 1G38A 3B3FA 2G72A 4HGZA 1IY9A 2P35A 5FTWA 3OU2A 2I9KA 4QDJA 3LX6A 3UA4A 3CVOA 3E05A 4BP1A 2IBSA 3DUWA 2ADMA 2P7IA 4KWCA 4RVDA 2AN5A 2OBFA 3B3GA 3FPHA 1KP9A 3A26A 3BWBA 5H02A 4MWZA 4AUKA 5LQNA 3TKAA 1EIZA 3HCFA 2BR5A 2WA1A 4M36A 3EVFA 2AR0A 3G5LA 5FHRA 3R9XB 2AOVA 1BKYA 2ERCA 3LKZA 2PWYA 5DRTA 1JQDA 5EHIA 3WSTA 3HTXA 4Y30A 2R6ZA 2AN3A 1AV6A 2YQZA 1G8SA 3G89A 3P9CA 3P9NA 3BGDA 3HVIA 5EMLA 4HC4A 2JH9A 5DTRA 4PYNA 5LQUA 3FUTA 3FZGA 3NDJA 3G88A 4QPPA 2PGXA 5EMJA 2V74B 2PY6A 4X61A 2CMGA 3I58A 4R05A 3OZTA 2FK8A 4DMGA 3KQQA 4WXHA 2Z6AA 2Z6UA 4PIPA 4PINA 4ER3A 1R18A 2PX5A 2V7EA 3KQOA 5HIJA 3FRIA 5DX0A 5GIPE 3I5UA 4HG2A 3BUSA 3HP7A 3LBYA 3MGGA 2B78A 2CWWA 1U2ZA 4QVKA 3X0DA 3OCJA 5FCDA 4GEKA 3GJYA 3QV2A 3JWGA 3VSEA 4C4AA 1UWVA 3M6VA 4QTUB 5CVEA 1NW6A 1WXWA 1YFJA 5CVJA 4YUYA 2VDUE 2ZCJA 1G6Q1 1X1AA 1NV8A 4OBWA 4X63A 4QPNA 3FYCA 3LCCA 5HILA 3TM5A 4RTOA 3BT7A 1ZHFA 2I7CA 2YXEA 4C07A 5HIKA 2AOUB 1D2GA 3UZUA 5EIWA 5EMKA 4RVFA 5DM4A 2XBMA 4GOOD 5C9ZA 3DLCA 1AF7A 3O4FA 5DPMA 5EZSA 3MCTA 1R00A 3ER8A 1EJ6A 3AXSA 3I9FA 4X1OA 2AOUA 3DLIA 4F85A 3P97A 1D2HA 1XDSA 5F2NA 4PYQA 5DRYA 1KXZA 3BKXA 3EEOA 4E2WA 3IYLW 5EEGA 2C7PA 1XDUA 4PWYA 4FZVA 4ZTBA 3DMGA 3NWBA 2I62A 2HWKA 3UJDA 1VE3A 1FBNA 3CGGA 1MJFA 3IHTA 5IH3A 1MHTA 1BHJA 4WVLA 1M6EX 1QYRA 3HCEA 1ZG3A 1TW2A 2XYQA 3EVEA 2EFJA 5FADA 5E1MA 5LQAA 4RTSA 2NNWB 3GRRA 4E2YA 3ME5A 3KPWA 5BXYA 3GRYA 3LCVB 3R0QA 1P39A 5BW5A 1JG3A 1B42A 3P9KA 1YB2A 3AXTA 3OU7A 2PJDA 3KQTA 3PFGA 4YUXA 3NDIA 4YV1A 1YF3A 1XDZA 2OB2A 4IV0A 5HEKA 5HFJA 4M7RA 1NBIA 1P1CA 2AVDA 4AZVA 4CTKA 2OZVA 4EMSA 2GAFA 2K4MA 3KR2A 3MB5A 3MCZA 3EGIA 1SQGA 3SXJA 3PB3A 3RODA 5D1HA 3UJ8A 5KQRA 5FWDA 3EPPA 4MHTA 1T43A 5KVAA 3EMDA 3CCFA 5K05A 2I6GA 1ZGJA 3HCDA 2IP2A 2ZBQA 3UJ7A 1FJXA 2ZLBA 1WG8A 2VZ9A 4P7FA 3CC8A 1SG9A 3BXOA 3BWCA 4HGYA 4F84A 3EVCA 3G8BA 3T7TA 4DCGA 2ZSUA 4EVIA 4RV9A 5E1DA 1N7IA 1X1DA 2HTEA 4YUWA 3KQYA 3M6XA 3FPJA 4XCXA 4XUEA 4C04A 1R8XA 4C06A 2PSSA 1WZNA 2B2CA 3GIWA 3R6TA 2ZBRA 2PBFA 5FUBA 2ZZNA 2YVLA 2QE6A 2A14A 3M4XA 4P7GA 4GQBA 4ER7A 4ATNA 3KR9A 3RW9A 5DX8A 4PYJA 1NKVA 1P91A 3BKWA 3T0IA 3P71T 2UYCA 3SM3A 5EOVA 5LQKA 5CVDA 5K8VA 1PRYA 3SMQA 4BP3A 1L3BA 5DM0A 2HR1A 1L3CA 4FS8A 2VDVE 3GNLA 2IH4A 4ISCA 5DXJA 1NW3A 1UIRA 3GWZA 5DSXA 1YZ3A 3CJTA 4GBED 1QAOA 2NYUA 2YR0A 4XUDA 3TM4A 3FTCA 1EAMA 3RIEA 4EKGA 5GM2A 3PLAE 3I64A 5FULA 2BM9A 2BR4A 2JHCA 5ICCA 1RJEA 1JTFA 3KQSA 5K0NA 2GA9A 4OA5A 3UJAA 1VP3A 4IV8A 2YTZA 4R6XA 4EQZA 2ZIFA 3LGAA 3VC2A 3TFWA 4C03A 1DCTA
chains in the Genus database with same CATH superfamily
1SVMA 3EVNA 3LP6A 4NS4A 3WGIA 4AM8A 4BNJA 3D6VA 3A1DA 4BQRA 3V8VA 2B34A 4RTQA 1WXGA 3O9VA 4D4GA 1RWXA 1Z34A 2WNSA 3T4EA 3STYA 2NM0A 2CYCA 2J46A 3PTZA 1B43A 1M0EA 4E31A 2DHRA 3DXZA 1SZDA 4RACA 4H60A 2ZS9A 1YB7A 3A1FA 3DHWC 4IHJA 5J63A 3C8HA 3SXUA 1N2SA 1XALA 4FKMA 5I8PA 1UUFA 4I9FA 4KJXA 1RCFA 3AUXA 2G80A 4UXHA 4E30A 1VHWA 2IGBA 5JAHA 2QQGA 4X6YA 4XUCA 1XTPA 4LK3A 1JIKA 2AG1A 3B7GA 3KV1A 3V42A 1QBKC 3HNPA 2C7RA 1JA1A 5CLFA 4Z7QB 2JIQA 1BOFA 2R6AA 4IWNA 3ZQJA 2WB4A 4H7JA 4ZI5A 2H2AA 1V48A 1QF9A 1SHTX 1Z82A 2QVLA 2WICA 3L8MA 1ADFA 3K1ZA 1B76A 1Y8QB 4J03A 3S5JA 8ADHA 4V2UA 5IAAA 1XEWX 4UBKA 1QX4A 4IDEA 4WZZA 4U6SA 3T7SA 1JTVA 4JBXA 1R37A 5FOUA 4ZQEA 1KY2A 5EYPA 4I6GA 4A9AA 2QQFA 1ORHA 1BSVA 1P1BA 1XRJA 3L5KA 1NJ6A 2VDMB 3PR3A 1JPVA 1VB3A 3FW1A 4GH5A 2PM8A 5E9WA 1LPBB 1VXOA 1J0EA 2H1FA 1NT4A 2NV0A 2OT3B 2XTAA 5DHRA 4ID3A 5BO5A 1T10A 1UXHA 3JSXA 3EXIA 4AURA 2C2GA 2QGFA 5KCMA 5IFLA 3AI7A 3K5IA 4AJKA 4R54A 3FOWA 4MKXA 5F1KA 3IA7A 5AI0A 4A27A 2QY6A 4CEHA 4S1OA 1S3GA 1R88A 4E5YA 4P08A 4F9EA 4FMBB 2HMVA 1WCWA 1UPUA 2VTBA 1C1DB 2F43B 1DKUA 4DV5B 2PBRA 1QC5A 4QL3A 1QMGA 5HF9A 7MHTA 4H7KA 4ZQIA 4GSYA 4J2TA 4POOA 2QR2A 1DTSA 2XHZA 1DBQA 4IICA 4ZKDA 5AFSA 2PX4A 1F1JA 1KYVA 1NC1A 4C0AC 3MJSA 3R40A 3NHSA 1LXCA 3PFHA 3G2PA 4BV8A 1PGQA 4PYOA 3HFJA 3KVRA 2Q3DA 3GLRA 1N8KA 4OY3A 3DEZA 1PZFA 1YR8A 1OC4A 2DBRA 2R60A 4MV7A 4U9UA 2PXAA 3LDUA 4UTNA 4CXMA 3C8UA 3P0JA 4FC7A 5A4KA 3WWDA 2OSBA 4LF9B 1F38A 2BBOA 3HVJA 3G02A 1R4MA 2FG6C 2AI1A 5D8DA 1H65A 1PHPA 4FR0A 1QDEA 5U1PA 3UHPA 3U48A 2PT6A 4PTLA 1T5IA 3NT5A 4KNWA 1KI6A 2RI6A 4IH4A 2FK7A 3H1GA 3DMHA 1UK7A 1YAJA 2WIDA 1CFJA 2JAXA 3LX5A 4OL0A 1B16A 3RH0A 3O75A 1FZQA 1TKBA 5CX4A 3ZV4A 3WSVA 4BMOB 4EYSA 4YR9A 4PZEA 1PUIA 5D5QA 2NXNA 2FMIA 4X85A 3ETHA 5EJ7A 3PE3A 4ZO6A 2L18A 5JYBA 3AGPA 3HVRA 2VCYA 2PLWA 2YXPX 3NW9A 4CU2A 3K0BA 3B1WA 5DTJA 3CZ5A 1XRSB 3PQ8A 5FPQA 3TPZA 2EKDA 4KPUA 1JFRA 2WHXA 4XB6B 4RF4A 4KZPA 3RAFC 4Q9JA 4P4TA 3M4ZA 2NU9B 1VYHA 5AM2A 5C5DA 3KXLA 3BGIA 2ORYA 2YDXA 2GBPA 1R64A 4AMBA 3CZAA 2KLBA 2ODAA 3DVSX 1GSHA 3E9YA 1V71A 4NJMB 2PX3A 4MUFA 4GLLA 1RWWA 1HM5A 2Q6KA 2OCKA 3F6RA 2HKIA 4ZAWA 2IRWA 4O5OA 4ZHQA 3ZJYA 4YMHA 4X84A 2P4UA 2WM3A 5I5GA 1HK7A 1P4HA 5JNLA 3OF2A 1KU6A 1QPBA 2OCYC 3PD7A 4CZ2A 4F5ZA 5JARA 2AHRA 1WU7A 2FUEA 1MF7A 2HU8A 3K20A 1RXUA 1R50A 4HLNA 4M9UA 3ZLVA 2FP4B 2RJOA 4RDHA 4HP8A 3WIVA 5I9SA 3ILVA 5IDQA 3DMYA 4F3TA 2GLUA 4D99A 3DH0A 3N2ZB 4UAVA 2AQHA 3SVLA 5AT1A 1DWPA 1NJ8A 4KIFA 5DF1A 2DXIA 4Q4JB 5T64A 5CFLA 1HC7A 4PZZA 2QDKA 4N8SA 3A1TA 1PJQA 3S81A 1U3UA 3ON5A 3UAGA 2WC1A 3C6XA 1XGKA 3IEIA 4L3VA 3UWPA 1SCUB 1V8PA 1SJ9A 2PKEA 3ZD8A 2OFPA 2OVFA 3HUTA 1UKVY 2D00A 2D5IA 2GO7A 1GQYA 3OIWA 3MERA 2O8DA 1NF8A 4U5XA 4BEJA 3ANNA 4KMRA 1IWOA 1KI1A 1ZC3A 3C6YA 3CG4A 2YBEA 3NOXA 2IEAA 4PX3A 4EG6A 5JECA 3LL7A 1U99A 2OLJA 1HG1A 3KWFA 2F1IA 3ETDA 5DNDA 5FBLB 5KPDA 1IVSA 2QL6A 1AK9A 3LHKA 4B3SB 1Q7BA 4H3KB 2BOVA 5AXDA 5K8IA 2RHHA 4MJ3A 3E7WA 1JXQA 4OHCA 2FJPA 1L0BA 2FQYA 1YA8A 1G3UA 2NYVA 1N2CB 3RC2A 3NHZA 3C5HA 3O9ZA 4C29A 2QRMA 2QN8A 2XQJA 2D2IA 4A1FA 4KRGA 5J23A 1R9NA 2WILA 3TLBA 1OZGA 5G4KB 3SVZA 3O1LA 2PZBA 5TMDA 2C7VA 3O2SB 3WX0A 5BYKA 4Q12A 5BSGA 3NBYC 4Q05A 5CFMA 1KMHA 1TO6A 1RNLA 3EH1A 1NYTA 2QPOA 4EAQA 2GS9A 3OPNA 1KK3A 2X5JO 2VSXA 1CC1S 4IXNA 4C4XA 5JMOA 4HQRA 1IY8A 3AUSA 3O4VA 5BYAA 3I4CA 2I6QA 2JFXA 1QIJA 3FWNA 1CR4A 4YH1A 1K8QA 4FYIA 3GLTA 4JUFA 1M5TA 2ZTUA 2GEJA 4JLBA 4RQTA 2DTEA 4H6PA 4UU1A 1NL3A 4AKGA 5ITZB 4NZMA 2X6RA 3SCZA 1BN7A 3LV8A 4X3PA 4DY4A 2RGNA 1WEHA 4Q9DA 2LR0A 4QFCA 4BWGA 1HSOA 1A3CA 4O2RA 4AP9A 2RHRA 5BRNA 2ZITA 2BLNA 2HEIA 3I8XA 4B3JA 1L5HA 1UBOS 4ZTZB 1DRWA 4FQ7A 4D8WA 2NU6B 1AB6A 3ROMA 5KDOA 3NDRA 2EBWA 1DXHA 1K86A 2VQDA 2BUBA 1OGJA 3AH8A 3LM8A 1VBFA 1JR3A 2XNJA 1KR2A 3CMMA 2RJ3A 5HE8A 1RBMA 1SHJA 3O92A 3O8QA 2QX6A 4YAFA 2QMHA 3K0CC 1KEZA 3ELWA 2VJMA 5IKEA 3T38A 3U19A 3L6UA 3OHSX 5CT5A 2JFPA 3DDOA 5JCPA 3SQNA 1GPH1 4GIBA 4WGGA 5HOQA 2DCMA 4DNOA 3VJKA 4XVCA 1YMVA 2OGTA 2FPIB 1JEQA 3BM5A 3G8DA 3V9PA 4BBJA 4X94A 1GDHA 2VOEA 1WHTA 4CKBA 2QLLA 2VZLA 3QVMA 4WLEA 1KDPA 2LXNA 2BISA 3EGEA 3JQFC 4KEAA 1ELOA 2WK1A 2XT6A 3ZEIA 2ILTA 2FSSA 4F97A 2MSWA 3T1OA 4R9VA 3QPAA 4XGNA 5TJ9A 4JJ6A 1YJ8A 3OT4A 3PNSA 5CCEA 1Y82A 1JDJA 2PUTA 4Q4DA 5KKNB 2YOFA 1X7ZA 3OJXA 3WLMA 3NVAA 3GRFA 4NKRA 5D3MB 2Y6VA 5ALLA 3UWKA 5CFNA 2QW0X 5C1DA 5ILOA 2IODA 3E6AA 1E64A 3SSNA 1TJ3A 4ND7A 2QR5A 5DZSA 1OWPA 2PS0A 3W1EA 2OXCA 1KZ7B 2IY9A 2X2FA 3GVIA 3LUCA 3OQVA 3L0CA 4BNFA 3TQIA 3DJFA 2V0NA 2FE1A 3KKPA 4HDKA 4JX8A 4LYDA 1VSUA 4O8CA 3OZXA 1ZO8A 2FR8A 2YH2A 1I9GA 3H1PA 4QX6A 3SQLA 5DASA 3RYCA 4D74A 2XV1A 4IEFB 4ZQGA 4ZI7B 3ZQUA 3QWIA 4TLCA 3WYCA 1V16B 2DZDA 1FVOA 3Q2OA 1BXRA 3CF2A 3W3AH 5E1OA 2P40A 3DBVO 1UDWA 3C43A 3UWMA 5B7QA 1NLUA 3GJ6A 2D2EA 4YDRA 4F3RA 4G37A 4HAOA 1OJLA 1FBTA 4OAOA 2V4MA 3BQNB 1AS2A 3H86A 4IQ8A 1PT5A 3FUCA 4IUCS 3C5VA 1QO7A 1KI3A 1YZQA 3U13A 3U3RA 1LBSA 1M2GA 1CV2A 1X6VA 1YZFA 3HSKA 3AHDA 2PZKA 4NLLA 4YAGA 1I1OA 2G6TA 1KH3A 2Q5LA 4AUKA 5LQNA 2BR5A 2BELA 4U7JA 2FDCA 4DMKA 2EF1A 2BDTA 1IHOA 2JA1A 1XZKA 2E4XA 1QHHA 2WYWA 5IW8A 1GFWA 1MO6A 5CW1A 3PSAA 2X58A 2VWGA 4ZT7A 3TQTA 5AXBA 1S8AA 3P9CA 3RU2A 3BIFA 1FPMA 4IIJA 4V24A 4I4IA 4HC4A 4EG7A 3Q0TA 1F48A 2BEVB 3QKTA 1E7WA 3GVPA 5AHKA 1H5QA 4ND8B 2HPVA 3OZTA 3IE1A 4WXHA 5F5LA 2Z6AA 3BD9A 1K4KA 4Q66C 4HDMB 2GFQA 5EZYF 1WBJB 2P9EA 3A2LA 4F3NA 2QUKA 1RLTA 3FA2A 2VYFA 5CA1A 3K9WA 3FF4A 5T4HA 2OCPA 5CDYA 4KUHA 3OUTA 1NRJB 1QHXA 3PQ3A 3IUMA 1BYUA 1J5PA 1WVIA 2HB6A 3H4MA 4RKRA 3TDKA 3RIMA 2R7KA 5B58T 2G04A 1K9VF 2VHCA 2GRAA 1CY0A 1EVKA 2WJZB 1W76A 1PDOA 2JCSA 4KJZA 4BXOB 4MWTA 3DQPA 1T9GR 4I1YA 4N41A 1AUOA 3IVXA 1U2TA 5ITWA 4OUDA 2WB2A 1MPTA 1TXGA 4C07A 3T95A 1N8SA 1Z5VA 4LISA 3LBAA 4MUMA 3R3YA 4TRMA 4WZBA 1RE0A 4CE6A 3DKRA 5J4HA 2BDEA 1JW9B 4A3SA 4UPEA 1CBUA 4FKBA 1ODJA 3W5DA 4UDXX 1N5JA 4AS3A 4W6ZA 2ZGVA 1HTWA 1U7DA 2FW1A 2QRNA 3QKRB 4NONA 5DHAA 4HDSB 3V7UA 5CFPA 1KXZA 5F2NA 3U0BA 3N0TA 2G1AA 2B2NA 4C4TA 1Q1GA 1XRMA 3IEKA 3ED5A 1Q15A 1TK3A 3NATA 3NKLA 1AMNA 3OZEA 1MPXA 4OFWA 1MJFA 3ZE0B 1JYEA 1S01A 5EPUA 1O7JA 4JI6B 4RMNA 1FUUA 5HJ7A 2ZJZA 2ZXEA 4F5WA 5L3SA 4OHPA 1TW2A 5KTNA 1OAOA 4BB5A 2XUOA 3JW8A 5B55A 2B21A 1KGDA 1BMQA 1XZ8A 2HJVA 3CLVA 1DIGA 3FDZB 4P7BA 2GO1A 2EV9A 1NY5A 2P77A 4U8GA 2QI9C 4UVHA 6NULA 1GDTA 4HPWA 3ZWBA 1LV7A 2XLCA 4RE5A 1QV6A 4JP5A 4ZOCA 3T9DA 5ALGA 3TINA 1A72A 1UZNA 3I6BA 4B76A 1K0UA 1LH0A 2WV9A 3EUFA 2OB2A 4PZCA 1A98A 1ZOOA 4EMSA 5D84A 2H2WA 4CTKA 7ABPA 5I5EA 2OZVA 5I4KA 4PNPA 3GJZA 3VFDA 1T8RA 1I2CA 1IIBA 3K2QA 5AJUA 4YIHA 2WP0A 1VGQA 1OXVA 1SKYB 1DG1G 2H4WA 4NX2A 3RODA 2HQ1A 4A0SA 3CUSA 2Y0DA 2EWVA 3OSZA 2OD7A 1T3SA 4AULA 4L74A 1B8NA 4ACAA 5IZ4A 1PIWA 2F48A 1KFJB 3BMCA 1FJXA 2B5OA 1ZMTA 4FHCA 2C57A 2PTHA 3PQEA 4YPOA 5IU6A 2JAUA 3GCXA 3RD5A 4B33A 2FZ4A 4RV9A 3GPDG 3M6XA 1CE8A 3H2IA 5GAJA 1S2IA 4BO0A 1W581 2G25A 1CEEA 3EA0A 3K5HA 4GFDA 4PV7A 3WGMA 2YIJA 3F47A 2HIAA 3DCNA 3T3NA 3NIWA 1EA5A 2JPDA 3AFOA 1PWEA 4DLPA 4BJ5A 1N0VC 2GEKA 2HGSA 1OYWA 3DPIA 2R5FA 3QVWA 4M9ZA 3RVOA 2OWDA 4ATNA 4ARIA 1TEZA 1RWKA 4TT3A 2EEPA 1B6RA 4UMVA 3B6JA 3G13A 1VRCA 3HJBA 1RFLA 1II8B 3F2VA 3BL5A 4W1PA 2IX3A 4WEQA 2HR1A 2HJSA 1M34A 1PE0A 4OKNA 4Z4HA 3GAZA 1QU2A 4FI3F 2QSZA 1KEUA 1SG0A 5IAKA 1T4GA 4LEIA 3DW1X 1ADBA 4Q1EA 1PFKA 5JI3E 3NBXX 3QWBA 2J85A 4AP6A 5AW4A 1M1YB 4FYMA 4LXIA 3H8VA 4H3SA 4RNCA 1CJUC 2B3DA 2LDBA 4U00A 5KB3A 1JX6A 4EFNA 4IKEA 5L7TA 5CYOA 2FEOA 4IH9A 1WXDA 4LNUA 4BNDB 3GT0A 1ISPA 1YR9A 1KJYA 5ICCA 2VPPA 3D8RA 3WGYA 1QIDA 4B3XA 2YIDA 1EUCA 1ZINA 3C5WP 5IPFA 4JGBA 4G41A 1N6LA 2OV8A 3PDUA 3K05A 2Q27A 1X7DA 1UOOA 4ZQBA 5B3JA 1FRNA 4AJ1A 2GARA 1N6HA 1TYAE 3E03A 1JAZA 5AJWA 1VQ1A 4UBJA 4YJHB 3I1FA 1MTZA 1QJ4A 2BSQA 2XCLA 2Y67A 5LWQA 1I30A 3REGA 4G4IA 3K9LA 3N86A 3AGQA 2PZLA 4MIKA 3E18A 2B8NA 4A8JA 1NN0A 4KK3A 1VJ0A 4EL0A 1CQIA 4KGXA 4R8MA 4DG9A 1VDMA 2XT0A 3MTEA 3LA8A 2VVTA 1A9XB 2BFFA 2OOKA 3HDTA 3ONVA 3K71B 3GAMA 4WGFA 3DMTC 4GZ5A 4B44A 2RHJA 1W46A 2CL6X 1AV7A 2CE2X 3LFUA 4C05A 1NHGA 3PNBA 8GPBA 1J23A 2BFBA 4FHDA 4NQZA 1EXDA 3OLYA 1F5NA 5FA8A 3ONDA 1NC3A 2PSFA 1MV5A 5BNFA 4WSOA 2EZ4A 3E1KA 3ZGVA 3L93A 3OBBA 1EUYA 2FUG6 2VQSA 2I80A 3R3XA 2P6NA 5I7WA 2A9OA 1N75A 5JXIA 2UYOA 2VPYA 4GE0A 4PSKA 1SC3A 2GD6A 3D3QA 4LWOA 2GXAA 2BJWA 1KXJA 4MVJI 1HT1E 1FLNA 1QHFA 1SB8A 1UOQA 2CXSA 2FKNA 1SHLA 1Z8DA 3DC7A 1SURA 4RWEA 3PNMA 4BVBA 2CSXA 2NX2A 2O54A 2QTAA 1MUUA 1XD8A 4GXTA 2A1TS 5LDGA 3DF7A 3D5QA 3DMFA 4NG5A 3W2FA 4B73A 2RARA 2NXJA 3OA0A 1EQAA 4HL6A 1PJRA 3PQ2A 2VEDA 4D92A 1O6GA 5LKAA 2FZEA 1A5TA 1M1NA 2C97A 2XMRA 4TT3D 3TDMA 3S1AA 4AMUA 1CVRA 4YLGA 4PGGA 1YBHA 3B89A 3OESA 1BU5A 5GIOE 4KO1S 5I8ZA 4LG1A 1TRKA 3U17A 4IEIA 3VR4A 3ZHQA 3RT1A 1A1VA 2Q41A 3BFKA 4DDTA 2HPHA 3AM5A 3L8DA 4LHXA 4MRVA 4X1YA 1WP9A 4HNAB 4Y6LA 5FLKA 4UUAA 1QJCA 1NUAA 3WOHA 4GI7A 3DC2A 4M7OA 1KPIA 5K3DA 3A6JA 4NABA 2POCA 3AUFA 3IQIX 1RJGA 4Y6PA 4OLHA 4Z2YA 4ZRDA 3MELA 2DPGA 2GTIA 3TTVA 3M5PA 3E5HA 4Q48A 721PA 3B2NA 3MUNA 1KEVA 1II0A 1CU1A 1TMKA 3RC8A 1FXUA 1UF9A 2AFHE 4TKZA 5DYIA 3URKA 4WTOA 4G5HA 2I76A 4P4GA 2Q3BA 4PRYA 3UXHA 3LP5A 2REBA 4RADA 1E3WA 2J9FB 1P3JA 2AJCA 2GAOA 2VDWB 4J49A 1QE5A 3OY7A 2NO5A 5KSZA 1K7XB 4RPLA 2XPCA 3OQPA 4OHFA 1H4VB 1T35A 1TOAA 1Q3HA 2HJGA 3ZLJA 3DZGA 5KYXB 4U39A 2HH9A 1E6KA 4MWOA 4ARZB 4H1HA 1H42A 3KELA 4XFDA 2AEJA 3LQ2A 5B4VA 3C24A 3DZKA 1YASA 3BAFA 2PQ0A 4AJ2A 2Y0EA 2QGZA 4KVGA 4N5NA 3FFAA 3TLYA 2FN4A 3I5YA 4KQMA 4ZDIA 3DCYA 4MUJA 3GLHE 1W2GA 1AE1A 3QE2A 3C14C 1MTOA 3D4BA 2FPOA 3MW8A 2WJJA 2OZKA 1O6CA 1RQRA 3E8MA 4GKBA 4HVTA 3VUEA 3T8YA 4II7A 4EF4A 2Y05A 4F8EA 1OR8A 1CF2O 1RJFA 2ZRKA 3MGBA 3ROTA 3U5TA 1N6RA 4KSYA 2AMFA 3RB8A 2OM2A 2CZQA 1UXOA 1BU8A 3KUUA 4ALIA 3TZKA 3BCSA 5ERGB 4MA5A 2YV3A 1NU8A 3F5QA 2IV7A 3KAPA 3V8QA 3VDMA 1POWA 5JJCA 1S2LA 3RT9A 5DWQA 3HUDA 1XQVA 1N6PA 1ENYA 1G1MA 1E4OA 2QPTA 4WERA 1GN8A 2OO5C 1XCLA 2XODA 1QIIA 2ORWA 3MLBA 1X9IA 3MAAC 1TF7A 3BX1A 3QNMA 4IDQA 1CDOA 1T2CA 2JGDA 3VR4D 4CF4A 4IHAA 5HRCA 1KORA 1C0LA 4UVDA 4P5EA 5KWSA 4WQMA 5CD1A 5A5FA 5NLLA 1VI5A 4RTNA 1T5BA 3G5TA 4JJIA 3A70A 1RRPA 5EJ6A 3GLIE 1ZH0A 4DNQA 3WLFA 2OO3A 1RPAA 1DWQA 4MQLA 4Q02A 2PJRA 3ITDA 4MRNA 2IPAB 3HLKA 3M6UA 3MLAA 4TM7A 2RAFA 5JZVA 2EFHB 3COWA 4L85A 3H5WA 1IDN1 1RPZA 4BEVA 5REQA 1GRVA 1U2GA 4LW8A 1FDTA 3EXHB 3T3HA 2BBSA 2B37A 2I6SA 3I30X 4NJEA 2XMPA 4E2XA 2IZ0A 3NAGA 3VKWA 2M6LA 1PQWA 1Q3TA 5KU1A 3RSCA 3HCBA 1TMGE 3DPSA 2JI9A 5KQGA 3I37X 1U5AA 4QDZA 3KZXA 1DC4A 4IG4A 2QVCA 4QHTA 1E3JA 1JVBA 4KO4S 4LFCB 4N5IX 2HW8A 4DS3A 2ZBPA 1CR2A 3UUFA 2DHDA 1ZWKA 1WZ2A 3OZ7A 3D8HA 1AZTA 2P2GA 2VJDA 1GNQA 5ADUS 5FNVF 4C0QC 1NRWA 1M2NA 4RK7A 3ADBA 2CKDA 2AVNA 4ZICA 1QZZA 5K0SA 3OMWA 2ZI9A 4LRUA 1OB2A 3PGLA 4B3FX 3SZRA 1QHSA 4RJKA 1F3OA 5FLYA 3T3MB 3D1VA 2QUJA 3ZHTA 4TV8B 1A9OA 1P7CA 5HQ3A 2KSQA 5FPPA 1H9AA 5CLLA 3V3TA 1M8KA 1A27A 1DWOA 1ZHOA 5TEWA 4GP9A 5JLAA 1T3TA 5BYJA 3NKVA 2UZ4A 1ZVQA 1SPXA 3M83A 4I19A 1SVKA 2EEZA 3BD6A 2P5YA 4N12A 1U5CA 1YE3A 3P4UA 5JD6A 3U39A 2PZEA 3B6EA 5D3QA 3HKBB 2CFSA 2HDHA 3DR5A 4TTTS 1NE2A 4YAUA 5LQJA 3U7HB 2B3TA 2ZI7A 1U7PA 1TU0A 2J59A 4P86A 2XXJA 2RH4A 1PV4A 3H5AA 5FP0A 4A15A 3I2JA 1RQ2A 4HJRA 3FMGA 2INGX 3GRUA 1RP1A 3BE6A 2C20A 1YRAA 4B17A 1UBFA 2IU0A 2PNFA 1P4SA 1DG3A 4FE7A 5J4KA 4QYWA 2JJQA 3T9CA 4RGYA 5KOYA 1Q1BA 2P2NA 1IUOA 1M1XB 1GSAA 2RCYA 1THMA 3KLOA 1IOZA 4RD2A 3RS4A 3G9QA 1GILA 3TQHA 2YVQA 1U31A 3L46A 5A03A 1IVNA 1T3GA 1Y1SA 3ANLA 3I73A 1XO1A 3QXGA 1XZLA 1FDIA 1EDZA 1JE1A 1AQLA 1ZZEA 3KWLA 2Q5HA 4BO4A 1F8YA 4LDJA 3VKFA 4IDNA 4NARA 4E5NA 1GYPA 2AOTB 1IEXA 4YRZA 2J0EA 2QX7A 3JTMA 4I9NA 5AXAA 1XJQA 3RTDA 2WHEA 2Z30A 3EEQA 1P4JA 3EQ7A 1YL7A 1ZUNB 1C14A 1OXKB 1KJ9A 1DIBA 1VLVA 3MT9A 5TRTA 1KF0A 1PW5A 1VBMA 2K5UA 4DQKA 5F1YA 1HDEA 4HAZA 4OI1A 1ZICA 1NQWA 2EKBA 4LDRA 3PGMA 4B43A 1N2XA 5A4FS 1DBVO 4HWOA 2G5TA 3CEJA 3ZHOA 4F71A 3LOUA 1BQ3A 4ZPXA 2ZIXB 4LHZA 2R8YA 4G2NA 3SHFA 1R4AA 4CF3A 5AW1A 3F6PA 3PJEA 4HQLA 3C3AA 4A2PA 1NJ5A 1BW9B 4P82A 1NLFA 4TRRA 3WICA 1EWVA 2Y3IA 3BD7A 1OFGA 4GOLD 4UFNA 3KT6A 1QGZA 1F2TA 3KTAA 1XU9A 5KX5B 1Y7PA 2ABWA 4KE9A 3UMJA 4B8YA 2QVZX 1OI7A 3EGWA 2WF7A 3GQVA 1TTTA 2V1XA 4KXMA 4FXOA 4E1BA 4CETA 2AOXA 4OHUA 1PR4A 1ZJJA 3KR0A 1LTKA 2CVQA 4X90A 3UG6A 4II2A 1OTHA 2CWDA 3I1JA 4TUYB 1ID1A 3DO5A 5HKAA 5ER6A 1MAWA 4M49A 4D9KA 1SQ5A 1IDOA 2G1KA 4ARBA 1XDGA 3E82A 3ICWA 1ZH6A 2H4ZA 4Y2XA 1L7XA 1QWOA 4EPRA 5CVTA 4X45A 2ZU0C 5IXSA 4A03A 4FGLA 3BOSA 3JALA 3LKBA 3CVXA 2VDPB 3QJGA 4P3KA 1ZOIA 1VG9B 1ZPDA 3NB0A 3OIGA 1G5FA 2O7VA 4M22A 4ZP1A 3WNZA 1FY2A 2QU8A 4UMFA 4QTYA 5CCDA 5A4AA 4IBOA 4O25A 4PSUA 3OU2A 4LY3A 2I9KA 3Q8LA 1K1EA 2EYQA 4GP6A 2NUTA 1Z88A 5ABPA 3UQYS 3G2NA 3JQDA 4H59A 4L6IA 3URMA 2V6JA 2Y2UA 1RQXA 1U8YA 3MF4A 2WA1A 1G5HA 1YSCA 4YRDA 3TW8A 2XCQA 1C0PA 2Z1DA 3IAUA 4L0DA 4E4YA 4DSAA 5C1OA 4Q4AA 1XRPA 3CXUA 2WSSA 3D4OA 3GYBA 3OZWA 4ND3A 2ZUTA 3SHOA 4BRZA 2LRHA 3E61A 4TLEA 1CDZA 1AO3A 2BKAA 1L7EA 2ZS8A 4NFLA 4F9GA 2QMOA 3Q1LA 4UNPA 4D4KA 5DNYB 4GDFA 2BCEA 2CB9A 5UKDA 4QYSA 1SIUA 2KYRA 3S2FA 1DS6A 3WYAA 2H31A 3VAZA 3WY9A 2W2XA 2CMGA 1Z47A 3G2JA 1C8BA 3HEAA 1UDXA 4FDMA 1AGPA 3EARA 1TUIA 4IM7A 5LP6C 4F4DA 1Y8ZA 3H13A 4WFQA 5SYMA 1V5EA 3AL2A 4RY8A 1QP7A 1GVHA 1KS9A 2WYUA 4FEYA 3HBJA 4BZZA 2O2XA 4ZVKA 1LLDA 4NZNA 4KIJA 2HK7A 4D4HA 5KTPA 4QVKA 2X0DA 1M7GA 3H16A 4LOIA 3W8FA 4QTUB 1QHNA 3KJZA 3WKCA 4F3KA 3A9RA 4TKVA 1T4CA 3P9RA 1D6MA 2SKCA 4MV6A 4QPNA 1N2BA 1E9CA 3ZTWA 2X1MA 5HILA 4QOGA 4PC6A 4PXAA 1RXYA 1ZDMA 2R11A 5HIKA 4KMMA 1V5FA 1VLZA 3PEFA 3E1SA 4EUSA 2Y99A 4D1YA 2PU7A 3N9IA 3DLCA 3E0XA 5DPMA 4ZV7A 3OEWA 4MICA 3A0RB 3OG9A 3A9UA 1KFCB 2F8MA 3OWOA 3OPMA 4K6HA 1NF2A 4KFRA 5EIOA 1CS0A 1YMUA 4BMYA 5DSZA 1OX6A 3VTZA 3W7AA 3PJRA 4HJXA 5HG0A 4D8YA 2FPRA 4ZQHA 2NPFA 4FFBB 4HYTA 3IVRA 1TTHA 1RAAA 2E18A 3NWBA 3SEAA 2Y8EA 1WRBA 1BNCA 4C0WA 3IHLA 1MHTA 5IH3A 4BKMA 3DL0A 2MSEB 5K6AA 4DBLC 2E6UX 1XR3A 3CXRA 2YASA 1Z39A 2XKAA 1Q11A 3SF8B 2JEOA 4D6YA 4F2PA 3AUYA 5CEJA 2IXFA 3HYSA 3PF8A 3TAHA 3UOGA 3B6MA 4V38A 2V5VA 5C4IA 5BXYA 5BW5A 2PKCA 1JG3A 3O8OA 3EUEA 1J8YF 2LWIA 1RHKA 3IUEA 4B83A 2XEDA 4JCCA 3NDIA 2GN8A 1F1BA 2M1XA 2JFWA 3D8SA 4JZKA 2ZXUA 2WTNA 3FZQA 5KOHA 5CA0F 1A5AB 2ZUCA 4QASA 3P9ZA 5G0SA 4YMVA 1C8KA 2VG8A 2WSSD 3VZPA 2AZXA 2R6HA 3QPWA 3EPPA 5FWDA 3T7JA 3VR5A 1G3RA 3R7BA 4H4EA 3BTVA 1M6NA 1LB1B 4BRWA 4DV0B 3DD1A 4R2HA 1GZVA 1ZK4A 4MMXB 3NYIA 4INJA 1SG9A 3CW2A 4GL2A 1K3TA 3QMMA 4GG1A 5KIAA 3RAJA 3AERB 4XPIB 3OETA 4AWXA 4Z1OA 1GAXA 4LZPA 1V8DA 1M6VA 3LXMA 4H27A 4M0KA 3TLCA 4XYEA 2PBFA 4PSVA 3WMWA 1K6XA 2XUJA 3B2EA 4LDQA 4P7GA 4ER7A 4RU1A 3CT6A 3KJNA 4BNIA 2CUZA 3WBJA 4KNVA 3V7YA 4TMZA 5K0ZA 1GADO 3EXEB 1XIVA 3NIBA 1FXSA 5EOVA 3PJFA 2EATA 4US1R 1OYVA 3GCWA 3U7FB 2ECPA 1RXVA 3MGKA 4HUTA 4FS8A 5HDQA 5ALOA 5IJZA 2AC4A 1EVZA 5DDIP 3V7WA 1UL1X 1N78A 1UIRA 2OEPA 4KUEA 3K1AB 1G20B 4CLOA 2YR0A 3BPSA 1WPGA 4P2BA 3N58A 2HSDA 2KBFA 3RNOA 1AUQA 3IOBA 5GM2A 3PPIA 3U3ZA 1R5NA 4NAHA 4CV3A 1S2OA 1Z3IX 3MM4A 1I4TD 2FZWA 3FRJA 3R6GA 4OSEA 1PBTA 4Q9IA 2ZUSA 3W7VA 4EHLA 1XCMA 4O0MA 1XQ1A 1UT6A 2BWJA 4CF5A 2QL9A 4WLOA 3ZIAA 1KK1A 2GYYA 5J43A 1DELA 2VHQA 3IBFA 421PA 2Y77A 3IAM1 2GYVA 3WNBA 5JBQA 1HDXA 1V37A 5IBCA 221PA 1V1JA 4KQ9A 2YBDA 4O4LF 1U02A 3BB3A 2BCGY 2RH5A 3RRMA 1LNZA 2XTJA 4BVHA 3FMOB 1OX5A 4YB8A 4D42A 5LDHA 1SCBA 2GZMA 1HRDA 2ADFA 4UTOA 4ZWNA 1USKA 3KQNA 4YIKA 3L7JA 2DERA 1MRSA 3NV9A 3HCAA 2E2WA 5E3JA 1R0WA 1BTOA 3NWEA 5LZ9A 1ONPA 1B14A 1XCGB 2HO4A 1A9TA 1S2MA 3DBRB 2Z8YA 1DHRA 2WWGA 2A88A 2C77A 2FW8A 1Z28A 3D5EA 3LPAA 5F1PA 5FF9A 3VR5D 1Y9DA 2CBGA 1D6SA 3PKIA 2JVIA 2X0RA 1UQRA 3LGXA 1W5EA 2R7AA 1ZA2A 2WBLC 2FRDC 4J1SA 2D0IA 3O2NA 3DFZA 2YFQA 4OHXA 4PC7A 3UAYA 2N0SA 2XQGA 2ODNA 1PG0A 2NO4A 4EUKA 1YFKA 4WKPA 4CL0A 3PHHA 5BW8A 5AVYA 4YYZA 3K0EA 2NOAA 3JZAA 4R7GA 3P2EA 3GGDA 2QX4A 4LPSA 5JUWA 1E66A 3TL2A 3UGTA 1M8PA 3TUZC 1G2QA 3T41A 4Z1MA 1WOMA 4UW9A 4LHSA 3RU7A 5IKMA 1MAVA 3DFUA 3D02A 3AX6A 3EW7A 3D8TA 4H2DA 3PX3A 3SX4A 4ZN6A 2H2DA 2H4XA 3D0KA 3QGMA 4YMUA 3O3NB 2XUKA 4BNKA 4DARA 3PGA1 2JLXA 1IHYA 1LC3A 4KE7A 2J33A 2X7HA 1D4AA 1J1ZA 3DUFB 3FFBA 3FCSB 4Q24A 1AMUA 4ZCSA 4H7HA 4Y2YA 4ZXFA 1GFZA 3AR3A 3M2TA 3TLAA 4QLBA 5D6NA 3BWMA 4RXTA 4PTYA 1CB7A 3FVTA 3O95A 4LJ9A 2EZUA 2VK2A 4B2LA 4DL9A 3KQLA 4DV4B 2DAPA 4QQNA 1QKKA 3IUYA 1KIAA 3ZTYA 3T1HB 2O19A 1XZDA 2BMJA 4JV5B 1KQPA 3U7IA 4J6FA 2QG4A 3CRVA 4TZKA 5FEUA 1Z5WA 3KTDA 4CMIB 1X8XA 3OZAA 2I54A 1E98A 3HJRA 1IXSB 4D44A 3EISA 5BV0A 3HN2A 2FTKE 4YJ3B 1UZUA 5KQPA 3ZIAD 3UUWA 5AVRA 1O57A 4JB3A 3WK8A 3IXMA 4RQAA 2IPMA 1XNGA 3DFIA 5L8VA 2RI1A 2ZIEA 13PKA 2YW2A 3V00A 2GT1A 4R2MA 2P6OA 4PIMA 3U40A 1B26A 1G17A 2QZSA 1FU8A 4TMXA 3L6OO 1UPXA 3SSAA 1KHHA 1P2GA 4C9BA 3JD2A 4COOA 1JMVA 4CN9A 3WYDA 4G86A 2I67A 5BSFA 4GRAA 4EITA 1YCFA 3FCAA 2QJOA 3HQ4O 4NCNA 4RYLA 5ENVA 5FLEX 3RTCA 3VHXB 4B85A 1D09A 2ZAGA 3CY6A 3IP1A 4GX0A 4ALMA 4P3XA 1E77A 1OZHA 3RVJA 3DP9A 3U16A 1V7QA 1WBBA 1CNEA 1SK9A 1US8B 3F1LA 4LE2A 4LDNA 3LBNA 4QECA 4Y2QA 5C5IA 1J56A 1PU2A 4O2BA 4DYDA 4ZYXA 2Q5JA 2BY4A 2EZTA 3OZUA 2PSEA 3JAKB 4XOUA 1WLYA 3W79A 3GPBA 3ZNNA 4UFPA 3ZCRA 1DRKA 2GESA 2QLNA 4NWIA 1U7ZA 1ZIYA 2PL5A 3T7EA 1N1GA 2IL1A 3SEZA 4EGFA 5IZCA 1E2LA 8MHTA 2VQFB 2HF7A 1FUEA 5KKAA 1LSOA 1T24A 2JNWA 2R4TA 1EUQA 2NXEA 5I9LA 2HZBA 1A5SB 3GLHA 4OCZA 5EP4A 2EGGA 5LZ5A 4HZUA 3ZGNA 3CZQA 3V4RA 1UC9A 1YRQA 4ZOAA 1M2VA 3NS7A 4EUFA 2I7DA 2Y9MB 3MJDA 4D3SA 1W2HA 2ZJ5A 1J2JA 3X1ZA 1ZSVA 3LVBA 2HU7A 3ZVLA 4F56A 3BH7A 2OCBA 3L0ZA 1Y4AE 5D1NA 4Z1MD 3W4KA 3SF0A 2P4SA 4U7WA 2F9MA 1CUVA 1DEXA 1C29B 1SZPA 1YQEA 4WJZA 1UBNA 3HBNA 1H6BA 4RSGA 1ZM3A 2R25B 4EG5A 2OXRA 3WRXA 1P2DA 2FHPA 3LUPA 3MQ2A 3O8NA 5D3KA 4LQDA 3O8CA 3HKCA 1WHSA 2FAXA 1T9DA 3RE1A 2CHGA 3RTAA 2XNHA 4AY3A 3TXXA 3THYB 1N5OX 2B7CA 3UV3A 2IXTA 4TQUS 1ZI8A 4P31A 1N4AA 4L27A 3RS0A 1BE8A 2NUPA 4GXRA 3VPGA 1JQKA 1P75A 2AE1A 2FSHA 3NLLA 4MP3A 2QU7A 2HBQA 3GK3A 3GRZA 4LHYA 5DKFA 2P9JA 1BC5A 4R1UA 2X0EA 2O0HA 2SCUA 1IWPB 1LW6E 2ZJ1A 4NPAA 4TS3A 3W3ZB 2XUQA 1IZZA 5K0JA 3H8JA 5B1SA 1QYXA 2JHPA 2P9GA 3WMRA 3BIXA 1R0KA 3LLSA 2A9JA 3GLIA 4DV3B 2C2MA 3IERA 2WJIA 3DLBA 3ZGOA 4B3MB 4UKDA 3ZWDA 1HKUA 4I2NA 2AYZA 5EQJB 1RKUA 3PYLA 2ZUEA 1OXSC 4GKJB 1WULS 3KOUA 4N01A 4YDHB 5CLJA 5G3YA 3WL3A 2P3LA 1V9CA 2V03A 3ZDEA 3UC9A 2HNKA 1CUHA 1RXEA 2IDKA 2Q7OE 5TT0A 3FD8A 3WHPA 2BGJA 1BDMA 4QELA 3T7CA 2COEA 4D45A 1W2WB 1KY5A 3FHLA 3UB2A 4L9WA 4IDAA 3QKSB 1RRKA 1JHAA 3SMVA 3I12A 4M0LA 3GXOA 5MHTA 3WLSA 1FP7A 2J3HA 3KG2A 1G0NA 3NTRA 3OECA 4NEGA 3PQ6A 2AXPA 2QLJA 1IBLB 1JT9A 3KHKA 2KW5A 1KR5A 4DT1B 4G0MA 3MINA 1VE7A 1ENOA 4PCVA 4LDAA 4HT3B 5BQXA 3B6IA 1EK2A 2VH1A 4HNVA 1OXBB 4Q4CA 1C41A 1UPBA 1R9JA 4LF7B 2QVBA 2BTOA 5BN4B 4YLYA 3DZIA 4KAXA 2OHHA 1WNTA 3NIDB 2I87A 4OB6A 3THXA 3HVHA 5LQSA 1JFTA 1Y37A 1OLXB 1RC0A 2GJKA 2EHJA 3GP8A 3S29A 3EVZA 4PZLA 3RRFA 3TSOA 3TF5A 3UGJA 1YCHA 4IYJA 1V41E 1T8TA 1JQJC 2GERA 1C3OB 5JNWA 5DYTA 1D03A 1FSSA 1VXRA 1JAXA 4M1OA 4RLQA 4KXVA 4AK9A 2I91A 4DEVA 2OV2A 2QQ5A 4CDRA 1UMDA 1VCMA 2G88A 4Y0VA 4DCVA 4HN9A 4Y2HA 2QVGA 1Q21A 2RAVA 4P9NA 1PS9A 4WW0A 3KYCA 1ODIA 3BZWA 3NP9A 1X1RA 3RFXA 2R85A 3LLUA 2VTDA 1FP2A 2C4NA 4V3CA 3F8WA 2J6CA 5FTNA 4L4UA 1KQOA 5H3CA 3UANA 2X77A 3INYA 2HSZA 4NV3A 1EK5A 1I3LA 2OXEA 4OVKA 3SYKA 4PPGA 1XA3A 2PZMA 2WWYA 5CYPA 5AKJA 3V4FA 1UM9A 1Z2EA 2HJHA 2X7XA 2BKLA 1NVBA 3GJSA 3Q3CA 4P53A 1J2EA 1O94A 1RM5A 3H2BA 3RJ9A 4L8GA 5CDTA 2P1ZA 3O2JA 5JQGF 2RGRA 4D0SA 4FYPA 3AOEC 3D6JA 4RJJA 2V3VA 2JIBA 2UYHA 3M5WA 2WIKA 4PGFA 4PONA 3IELA 2W2OA 1UOEA 1YIDA 2WR8A 4RTMA 1YZKA 2VP3A 4C88A 2ZXFA 3W34A 3U7QA 4EJSC 5J1SB 2O8NA 1D0IA 2ST1A 3BWVA 2FFBA 3I2YX 4FCVA 4R41A 1P7PA 4NBTA 4TV9A 4YQYA 1J2RA 5GZ3A 4AO7A 2QD2A 1IIRA 2Q1UA 4N0EA 1TYBE 1QYVA 3E7PA 2FGJA 3R5HA 4LS3A 3MCVA 4KQGA 5HM8A 2HV9A 5JS6A 4F11A 2ZRMA 3GJTA 4MCAA 4PZ9A 2CZCA 1OGIA 2P41A 5C8YF 1N9GA 2C9BA 3MWEA 4M89A 2CJPA 4OFBA 4LXYA 1TQHA 4UZEA 1L7RA 3LSTA 4NTZA 4W8OA 5E6SA 4C0JA 5JTTA 1T0JB 3L3BA 2ZIWB 5FR1A 1XTUA 3OCUA 3I6MA 3IUPA 5GWXA 3KUKA 5I51A 4O4HA 5CB6A 1E0DA 1GPBA 2NTEA 3CO0S 2H2FA 2HN9A 5EGSA 2Z2YA 5FI0B 3BA1A 5BSEA 1EDOA 5JZMA 1OFVA 2WZQA 2XTMA 2OP0A 3EIHA 5EP3A 2HYIC 2OXTA 3AUUA 3L1VA 4LGMA 2I2DA 4OXNA 4AW9A 4EJ6A 4EPVA 1Q0TA 3RTEA 4U2BA 2HAEA 2B8JA 2HHLA 4LXGA 1KIMA 3L1JA 3DWEX 3PHLA 3R0JA 4H0CA 4I3HA 4IO0A 4AXBA 4NMXB 3BBPA 4WBNB 4MARA 1GD1O 1SRQA 2QTRA 4NOMA 1REQA 4KXLA 1J8DA 5DGHA 1ZVMA 4EPWA 1GL9B 5E7QA 3X1WA 5FTWA 4FZRA 4I3FA 4JLWA 4CG2A 3LX6A 3OCXA 1ZNXA 3H9BA 3BXXA 5AI4A 1J2TA 1PZMA 3RUDA 3A3NA 1KI7A 3V7FA 4JOSA 1ZNZA 1T4DA 1L5GB 4O4JB 1TU4A 2BHNA 2BFOA 1J42A 2BMFA 2VBGA 3LCMA 3TD6A 3USCS 3ZIUA 4CKCB 4U6NA 1HYHA 1EZ4A 2Y0BA 1P81A 2H1IA 1PK8A 1BKYA 4MVJM 3CPSA 4QU0A 4UEJA 1JQDA 2C5EA 3FG9A 3WSTA 5EWLB 2JLYA 3JQ9A 4YAWA 3VVLA 2PLFA 4JBLA 2AD5A 2ZYWX 1YTUA 3TO5A 2IHTA 2PAAA 4AKIA 1PGNA 2BSXA 2IQ5A 5AHXA 3RUHA 5SY4A 2A0FA 3E8XA 5GJWC 3X2SA 1KMMA 2IVFA 1AUPA 1H2BA 1Z8FA 5F21A 5EMJA 5BN3A 3CISA 3LLCA 1BA3A 3A10A 1O94D 4KIWA 4XQGA 3KU4A 4BNNA 1DXYA 3ML1A 1VJGA 5ALVA 5HCNA 3LIPA 4MWBA 5EKTA 1XEXB 4HPXB 4O02B 1TCUA 5LXTA 1PSZA 5C31A 1SQSA 3ET5A 3GN1A 3NNNA 4HLCA 4JXZA 1C4WA 1PWXA 3HN7A 5FI5A 1PL8A 5GIPE 4AO6A 1VMIA 4RDXA 2WUEA 2HBYA 5D1HA 4C0SA 4FFNA 2J9GA 2XADA 3P20A 3Q9NA 4Y1EA 4BMNA 1XZGA 2QT9A 4DJEC 1YFJA 4IUYA 1Z36A 1F7VA 1UPFA 2IUEA 1G6Q1 5CG1A 1KI9A 4X63A 4F1JA 4O3FA 5LU9A 1H2RS 2BN4A 4FIDA 3BSWA 4GHWA 4XJXA 3B52X 1XELA 3CH5A 1OBHA 3GY0A 1CQZA 1P4RA 3M3HA 2EP8A 2FMFA 4F45A 1PF7E 4MIEA 5DM4A 3DE7X 2FOIA 1K6MA 4I1PA 4TZ6A 1V7PC 4ERXA 5CYGA 1EEHA 1UPTA 4Q37A 4LJRA 3MCTA 1RAIA 1XD2B 3FOAA 3JQAB 4HDRB 2G4LA 1OX4B 1L6IA 4EYGA 1B73A 3QVTA 1G4HA 1XMIA 2HUNA 1F17A 5KYUA 3OIUA 4GNRA 1Z6TA 3PFWO 1EP9A 4JDUA 4TN5A 2Q9UA 2FMUA 3I45A 4Q18A 4MGYR 5C7LO 1BDJA 1IXZA 2MMCA 1XB2A 4UDNA 2XWPA 2GTPA 5FADA 5LNK6 1D8AA 1OI4A 5AK6A 1BMFA 3OOYA 2E89A 4QWWA 1WSWA 1ZH4A 2REQB 4OMDA 3IP8A 2CEKA 2L0XA 2MT9A 4NZPA 1O8BA 4WVFA 2TECE 4LXXA 1YR1A 1AKEA 5A4JA 5KHLB 3KBBA 3IL2A 1AK2A 3DW3X 2WSBA 3ETLA 4RVUA 1ISIA 4FCCA 3SLKA 3WRWA 2BEUB 2Z3ZA 3NBQA 3QU4A 4NF2A 1CT9A 2Q3FA 1HF3A 1VRWA 2ZUUA 3JVEA 4OI4A 2HJRA 4QODA 4TMKA 5DOVA 1ML3A 2D1FA 4M2LA 1EP2B 4D8UA 1ADJA 1ZXBA 3WIBA 4EG3A 3WNVA 3OQ6A 1V3VA 1H93A 3O4GA 4J9UE 4G3XA 4RD6A 3TPCA 2Z1MA 4YWHA 1AQ6A 3BMNA 3F6CA 4X54A 3UYLA 4LVCA 4ZDKA 3KP1A 3JVUA 2X4GA 3PXCX 4C0LA 3IIMA 1LK7A 1EI9A 2ZSUA 2J0QA 3PNQA 1N7IA 7REQA 4ENVA 5FTMA 2OD9A 1K5HA 1L4EA 4Z0HO 2DEUA 1R8XA 1XLUA 2Q5QA 3R6TA 5TLSA 2W2MA 1U0NA 1H4TA 3NPMA 3C1AA 1GT6A 1Q0HA 5AKHA 2V4UA 2WD7A 3LXRA 4CRWB 3KJQA 1YOBA 1N3YA 1JDNA 2P68A 3WL6A 3WWEA 5A02A 1MX3A 4D4IA 3H05A 3NUGA 5CA0A 5JEEA 3VO1A 1P0FA 4AD8A 2HBRA 3IR5A 4RANA 4YRRA 4N6OA 2YS7A 3ZI4A 1KJQA 4LC1A 4XCQA 4DCPA 6CHYA 1MZVA 1X39A 1RAHA 5DXJA 1PNVA 4G97A 3VR1A 5A5EA 1DOZA 4OJYA 2V98A 5IYZA 2V6GA 1DKLA 1XJ0A 4QXAA 3TM4A 5IJ9A 2WNIA 4BNXA 3CLTD 1U5BA 5LOVF 1FEZA 3QA9A 3KAJA 3QEMB 2Q1SA 1DAKA 3I64A 5BUSA 4JBYA 3FTQA 4TOIA 4GKAA 5ES4B 2BM9A 2YC2C 3C7DB 4ZYTA 3Q3JB 5IXYA 1VP3A 2APJA 4TYPA 1LS6A 1TC1A 5IUJC 1PUXA 3FCEA 4UOEA 5AXCA 3T5DA 4LC0A 1DV2A 4AMVA 2VPWA 3RBVA 1BMFD 4KAJA 1DJQA 1JHMA 1Z6YA 2Q1XA 4B84A 2VJLA 4B1FA 4R83A 1NVUQ 1NSYA 1GGJA 1GL3A 2C82A 2PVSA 2WG1A 1ECPA 1RVV1 4F1KA 1GTSA 3UBTA 2I33A 4M21A 2QT1A 4Q7LA 3SICE 1V2HE 1YVEI 1F0PA 1TVKA 1GPDG 3PS9A 4S1TA 5JSFA 2FWNA 1KVSA 2V5AA 2JK0A 5EIBD 4OFZA 1ZZGA 2OGZA 1C1XA 2KS6A 1YT5A 2PD4A 3HMQA 2F3UA 5MDHA 4D6PA 3NR2A 4UHHA 1T36A 3SDBA 3NYQA 1V1RB 1R0CA 2WF9A 4PLCA 1IPHA 4JL8A 4DR2B 1YI1A 5DJ5A 2BGNA 4YCLA 1QXSA 1J4AA 1EX1A 4QULA 2NZJA 3WIOA 4RKEA 3X1YA 4B4VA 2GJSA 5H16A 4DIFA 2J3KA 2IE0A 4PCUA 4UBIA 3O31A 4CTJA 3NMUF 1NVFA 2ZQ5A 4AUEA 5BSHA 2IS4A 4O4LA 2P3SA 4NC9A 4B6JA 1C3LA 1RQGA 2XMBA 3PDIA 3PPWA 1A2KC 1LDGA 4OPMA 1OW3B 1SIBE 3AIKA 4PG5A 5ECWA 4BTVA 4N48A 4Q4HB 4KIGA 2J3DA 2X5OA 4M1WA 5DGIA 2QP9X 3TW4A 3IIKA 1VM6A 3H2SA 4CQMB 1QH1B 1YDEA 1I3MA 5T57A 1YS7A 2Q2VA 3M6MD 1KE1A 2ESRA 2PHZA 5B3JC 5MFPA 3RGGA 1XKLA 4X1KA 3AF2A 2MSNA 2E9SA 1OYOA 4EI9A 1AUXA 3RF7A 1BCSB 3E9QA 4XIGS 3ST7A 4ENUA 2HA5A 3I0NA 5EGNA 3SC2A 2R6GA 2VNIA 1MH1A 3FWYA 5E2IA 2ZSDA 3UO8B 2EW8A 3VYUB 1QH9A 3T06B 3ZY2A 1PDVA 3K5PA 4KI0A 3J81A 3EA5A 3L06A 2PGIA 3Q1KA 3S2ZA 1ZCFA 5BURA 3VR0A 4EYOA 3QKIA 5DLYA 5F7ZA 3VZRA 4A8JC 2ZT6A 3MJCA 3P9QA 4IXWA 4PHHA 5CHYA 4N7JA 1WPXA 1QQAA 3I42A 1V11A 5DTQA 4J75A 3MILA 4A82A 5JVDF 5ITVA 3FYDA 1YFZA 3I5XA 4TRNA 1JEYB 2O3SA 1WMDA 4L5IA 1IZYA 4I55A 4N8EA 1YFLA 4UZSA 1EUDA 4DCCA 4F5DA 5AESA 1F8XA 4LRYA 2D3WA 4MS1B 1DLIA 1TECE 3BXEA 3DAHA 3EVAA 1Y8CA 5CUQA 4DMLA 1PDWA 1RIFA 1VG0B 2Q2NA 3BF7A 4MS3A 1L7BA 4N39A 2XCUA 4P8RA 5EWJB 3DE1X 3L4BC 4CTNA 1Z2PX 2WSMA 5JFGA 4FUQA 4JMLA 5ITSA 4FNOA 1NVEA 1V9LA 2WFLB 1HPLA 4MLZA 4NOKA 3IAS1 4O2AB 4MQFA 4P4UA 3IVMA 3ASUA 3C1UA 2AUNA 2HRRA 3AEKB 4LWPA 5CXUA 2BR3A 1GTL1 1R0LA 4E13A 1QF7A 5LUAA 3GLGE 3EMBA 3ZU5A 3JR7A 1J7KA 3GUHA 1Q16A 3NV7A 1SKBA 3JWHA 4CU5A 1FQKA 2ZRBA 3TN7A 4A1OA 3DM9B 3DL2A 1L4UA 2DKOA 4YRTA 4B35A 5C5CA 6REQA 1Z8HA 4M8SA 2EJWA 3HB1A 1NXWA 4EVRA 2VDRB 3Q9LA 3U60B 3U49A 2O3TA 4HAIA 2VNAA 3AF0A 5LBTA 1UEJA 2GA8A 4K3VA 4Z2AA 5CCBA 1VHDA 2XCRB 4MI1A 2C9MA 3PIIA 2QRHA 3EAQA 2YJNA 4LAFA 4NEHB 4XYGA 5DXAA 5SZJA 5TC4A 1P18A 1KK0A 1GA4A 1KSJA 1GCOA 2G70A 1NMQA 3D4PA 3ZS8A 3OX4A 2ZRIA 2PG3A 1YKSA 1LPSA 1PV2A 1JG6A 1FUIA 1GR1A 4Q9AA 4GYYA 3BB4A 5BVGA 1LTQA 6PFKA 3M1AA 2XVMA 3NONA 4CUKA 4M0MA 5D2CA 1MQ8B 1U2SA 4BV3A 4ECAA 4ZDJA 1DO0A 3C41J 4YV2A 2ZJ3A 2X9GA 4KMSA 1Q50A 1U3FA 4RKYA 1F9EA 1WCIB 1CJCA 4RD1A 2NU8A 3W5IA 1UC8A 2Z83A 4QAJA 2GAJA 4LV6A 1BN6A 4L8VA 1EMDA 3WDKA 3KFLA 3I5AA 1ZEMA 5FEMA 2J3QA 3WBFA 2GPBA 1K3UB 3P9YA 1EWKA 4J3FA 5AICA 4P3PA 4QGHA 1QRSA 2Y1LA 3NVKI 1IJKA 3WB0A 4Q3KA 1TK2A 1Z25A 5AVTA 3BF8A 3ENKA 1ZD9A 2J9RA 5IJ0B 2IF2A 1TZMA 2J30A 3A1EA 3ZQ4A 3FHCB 1GNTA 3ABSB 2CE7A 2VHXA 3E9EA 4MVCA 5B1HA 1NVTA 4ZEMA 5IP5A 1A8PA 1Y3IA 4Q1VA 1CD5A 4WV3A 1LFAA 1U8FO 4D79A 3OZDA 4B31A 2HMYB 2IIQA 3K70C 4DMFA 5L3QA 2EW2A 1TTQB 2ZB3A 2IS1A 3CRQA 1JLLB 2JA2A 3OLCX 4PSAA 1RHRA 1V4BA 1TTPB 1YRYE 1FS4A 4GVLA 3FHTA 1L1RA 4LRQA 3ZE2B 1GRNA 2AW3A 5C7IO 1FP4B 3VMMA 4I8XA 3LPMA 1JKXA 2ARKA 3F4LA 5IG2A 4UM9B 1Q7CA 1QG2A 2ENUA 3K6SB 3JATB 3AF3A 1NP7A 1QHYA 1KPGA 1CZRA 1QGUA 4FJ0A 1TQ4A 4KN8A 1JHZA 1XTKA 3GG9A 4RLFA 4DR7B 2XUHA 5DGTA 5JZSA 2XOXA 2X6QA 3D8UA 3HNOA 3VPDA 4RKWA 5F1OA 3N2YA 5JH7B 3DLAA 4LVUA 2A9QA 4Y1RB 1LPPA 4OQNA 3TI9A 3ZWCA 2IJGX 4ADSG 4ZAGA 2HMUA 2DULA 4UHJA 2KWIA 3FZNA 4B32A 4C08A 4JLMA 4CEIA 3C8DA 4LJ7A 2CN1A 2VUUA 2W8BA 1LF5A 1Z0AA 1O6ZA 2BP7A 4AUMA 1TX4B 4QVIA 3E84A 2QM7A 3OPVA 1M66A 2ZAYA 2O2DA 2ZVJA 4PFKA 4PVDA 1XPUA 4KRFA 1A5ZA 1IYZA 3RRBA 2DQKA 3FPCA 5FUVA 3MMPA 4U7PB 1KYZA 2ZJ8A 1EPUA 3SI7A 4G5GA 3A37A 3AV0B 2D1QA 2VUIB 4FGSA 5ALKA 4BE9A 3FX2A 4HWSA 1HNZB 4Q01A 1U2GC 1UMKA 4MUHA 3DTVA 5T8KA 4EG1A 3FJOA 3K53A 2C3YA 4RTLA 1ZGAA 2DFVA 5FBWB 3GEIA 4B6RA 4Z9BA 3RC1A 3HXKA 1OAKA 4XWKA 1N2ZA 1NKTA 1MW9X 2AF4C 4FX5A 4OH1A 3RS2A 1ESCA 4ZCIA 1QGED 2ACKA 4GUDA 3K73O 1DDIA 3SJZA 3TZLA 5I9NA 2BSAA 3ESBA 2Z0MA 3ZVNA 1N0HA 2JD0A 4DRXA 3GEHA 2CCKA 1C80A 3R8XA 4MP6A 1GXSA 4CN8A 4NVRA 4C7OB 1K97A 1ZSNA 3BFVA 4FZJA 1A77A 1UBRS 4PAOA 3UB4A 5K0GA 3VNQA 1QSGA 2OR3A 3NI2A 4JI3B 5E4YA 1CRPA 2CK3A 4F4IA 2EOAA 2H92A 4WUTA 2QKYA 5LBIA 2YC4C 2DBVO 5JALA 3GUUA 2RD2A 1JSZA 2SICE 4JBWA 1E3EA 3JQ8A 2YKGA 3ZIDA 3H9UA 4ARCA 5ALIA 3N2GB 1J20A 3NHLA 4TN1A 3OQMA 4WASA 3S68A 2OOSA 4QUGA 4NYIQ 4C6HA 3FB4A 4TMFA 4DVGA 4EIWA 4ZZ1A 4HBGA 5CB4F 2C2ZA 5JTUA 3AYZB 3OUZA 2CFCA 1I7QB 2J48A 5A3QA 2R00A 1U7HA 3N05A 4BMZA 4D9FA 3I9KA 4D81A 1PFGA 1SB9A 3AZPA 5BV7A 5LA6B 1J5XA 4IMJB 4QDOA 3ND9A 1ZKDA 3CIOA 3G82C 4K26A 4QYIB 4B7ZA 1NI5A 3EPHA 4H31A 3FJYA 3KPYA 4CIBA 2ZBVA 4NCBA 2WWIA 3I9NA 3P0IA 4CMBA 1CUAA 4W7SA 4XDZA 1M0TA 4EA8A 1VSQA 1ZJYA 1JKFA 3AY3A 1KYTA 1FP6A 3ZWQA 4R84A 1TLFA 3AL0C 2H00A 3ZNQA 5I7AA 4ZIRB 1JNXX 1SCNE 3PD1A 1D4ZA 2OQRA 2FZ5A 2NO1A 1QYIA 4PHGA 1OFTA 3RPEA 1EFVB 4R0VA 4FMDF 3ZW7A 1Y9AA 4GGPA 5T4FA 2AX4A 2C3UA 4AS2A 1WEKA 3M6WA 1J9EA 2CJXA 2CDAA 2IYXA 4MRRA 1SQFA 3T9AA 4KRYA 1YBVA 4XGIA 2EFEB 2IDMA 3E53A 3DKKA 1NLYA 2G72A 5A4DA 3L77A 3R77A 2IYNA 2XNDD 3CVOA 4GWKA 4QDJA 4Q82A 4YA6A 4CT4B 2IBSA 1LCIA 1RU3A 2FPKA 5CT9A 1JXOA 1Q77A 2ADMA 2H18A 3HJTA 1IHDA 3B9QA 4RAQA 4BP8A 4RK1A 3DTVD 1NR1A 3TR5A 1OXTA 4CM9A 2QZPA 3WYFA 4N49A 3HRKA 2F6RA 1BROA 2VT2A 3TMKA 1PL7A 4KXNA 2PWYA 3OTHA 4PE5B 4RCYA 2UKDA 5DHQA 3NT4A 4DIBA 3IIIA 1LZKA 5AOBA 4ON9A 4EGQA 4K87A 4PLPA 1DX9A 4Y6SA 1EHIA 4TWJA 2X0KA 4MVJF 4I4CA 4OJTA 1VIAA 4J0EA 1DIOB 1PYOA 3I6QA 5J4YA 4H7PA 3BTSA 4DDVA 3F49S 4DSNA 2MSDB 4PAGA 3KQKA 2X2PA 4BL5A 4HLDA 3GPCA 3ZX4A 2DLNA 3CG0A 4PIPA 4Q6WA 4M1YA 2CK3D 4KGDA 1ZI6A 4ERNA 4ZO7A 1FRFS 5A1JA 3BSYA 5C1PA 3QBJA 4L6AA 1QVZA 3WB9A 3VUFA 2CLEB 2A9FA 3H11B 4GD3Q 4LJYA 5AIAA 4YV0A 1MQSA 1UMCB 1FYFA 1WXHA 3CCBA 3D54D 2BFDA 4L3OA 1IHUA 1KZ6A 4N3NA 3X1MA 2FKAA 3R0ZA 3VH1A 3T7KA 2FSVA 4F6CA 4FB4A 8OHMA 1NV8A 2NVUB 5GV8A 3C3BA 3CTPA 4MVJE 4H4CA 1AJEA 5G0VA 4CQLA 4NNOA 3FPLA 4QPDA 2AEFA 1EFLA 2Q45A 3HXPA 1HNXB 4BJ3A 3A9VA 2FN8A 2H29A 4A91A 2XMZA 4B4WA 1BFDA 2B6HA 2BGKA 4LOKA 4AKHA 1QP0A 2AN9A 1R00A 2VJKA 4XCVA 2G9NA 4B6PA 2CL7X 1C3VA 1PEAA 2YZKA 3ZWPA 3PQCA 2OGUA 2WFAA 1O87A 4HOYA 5AK4A 5DRYA 1FYVA 4KYIB 2QTZA 2G5PA 4RA9A 3B8HA 3NORA 1NF3A 1W4RA 3TOXA 5CBPA 2I62A 3Q11A 3U4DA 4PM4A 3JQGB 2O5EA 2DWQA 4RL4A 2BFCA 1V7ZA 3B48A 3QVXA 4NQRA 4I9HA 5JJBA 2F64A 4NENB 5JD5A 3NHFA 2YHUA 1U3DA 2GASA 4OIMA 1H1LA 3P5BA 4F1WA 4RCVA 3W8RA 5DCWA 4JQOA 3W6OA 2XD9A 1GHTA 1SG6A 4FINA 1MRZA 4NEQA 3VXKA 1YQTA 3P9KA 3DAGA 1XWWA 4RMJA 4LQCA 3KKQA 2GN9A 3A6GA 2ZRHA 3IEPA 4CM9D 5K8UA 5L4SA 4YUXA 1QFSA 3GFFA 1TLTA 3QEBZ 3ITNA 1DAMA 4URZR 2HREA 3OZCA 3MMXA 3TAUA 4Q7QA 4JOCA 2VTEA 2GCPA 5ESRA 4O1MA 2UYCA 3ZKWA 4FFWA 4HXEB 1LBTA 4XLTA 3EFBA 1WCYA 4PO9A 1ZEJA 4JGGA 3OPYB 1XQWA 5DN6D 1N3IA 2HHHB 1E4EA 1JN0A 4IUDS 1LY1A 4W1RA 1CIVA 1NZDA 2QLMA 3F98A 2Z3VA 3WNCA 1NMEA 1PFWA 4F5YA 5LP6B 5A4MS 2CKMA 4GW3A 2RHCA 3DZHA 3U09A 3DAYA 3HR8A 2IBMA 3BTOA 3Q0IA 3DTYA 1D3AA 2AFIB 2GPWA 4PG6A 3D3KA 2NTYC 3TSYA 3OP4A 3WKEA 1L4BA 2E4AA 1JH8A 2H1LA 3DOJA 1PG5A 2QZJA 2QXYA 3INRA 3RARA 4EECA 2EHDA 5TARA 4LK2A 3D7KA 3UCEA 1FZTA 1UWLA 4KRXA 2J0SA 1EVLA 1MO5A 2JFNA 2XB8A 2YXNA 3H5TA 4WKOA 4KR9A 3V6LA 3VH4A 4CCYA 3SQDA 4G1FA 1QCDA 3WOVA 4MV5A 1OTYA 3KZ1E 5JSUA 5CVDA 3SMQA 3AEUA 4HFRA 1TD9A 3OT1A 3ZYCA 1L3CA 4I5FA 4LYJA 3TGLA 5H80A 3N8KA 4QDXA 3WYBA 4NAVA 2WLSA 5K0EA 4G5YA 3FMPB 1NRXA 4OHWA 2AIRA 1NMYA 1SOWA 1E9DA 2QMQA 4MEAA 3RYHB 1ZW1A 2DM6A 3PENA 5JNTA 2UU9B 5D5HA 4IQ0A 1X3LA 5FULA 3FR8A 5IWAB 4YJGB 1G21B 1M2EA 1KO8A 4W5QA 3S55A 4F46A 4ZREA 5BMOA 3LGAA 5TVGA 2BE7A 1E7RA 4KX3A 5H68A 2NLOA 4B3BA 3I5MA 3UAOA 2RHBA 4IY1A 4NE9A 3ND8A 4RSRA 4U3JB 3GI1A 1P0IA 1K7YA 3DGFC 5I7RA 2P8SA 3TG2A 5GVRA 3VX4A 3L8ZA 2XIJA 3N74A 4C5BA 5A0VA 4RE6A 1NP6A 1T6NA 1XSEA 4N3AA 1R0ZA 1CB0A 1MRNA 2H5JA 2JZOA 4NSNA 3N2KB 2VUHB 5MFZA 1JR4A 1DKQA 3E9DA 2GEDA 5CXSA 5LPNA 1B7GO 5IAGA 1CVIA 3NALA 3DEFA 1NN5A 1WQ1R 1RMTA 1OH6A 1U8ZA 1TO1E 5EPOA 3WLNA 4LF8B 1RVDA 2JFHA 4D98A 5JMWA 4E33A 3ZLUA 5AK0A 4ESEA 1WD5A 2CNDA 2XDWA 3QE3A 5F2OA 1X8JA 2PH5A 3V8NA 3PT9A 1NULA 4HTFB 3L0OA 2VXOA 3WDLA 2A9KA 1GQ2A 3RSQA 2O48X 2YY5A 4YCDA 3LWBA 3P2IA 3V1MA 1U94A 2CFRA 3T0FA 3R5JA 3ZHBA 3MZ0A 1UEXC 2RBEA 4Q9NA 1UP4A 1XMSA 3OZGA 1LEHA 4QXRA 2Q4RA 4E5SA 3UHOA 1YDWA 3I0ZA 3PNVA 4CF6A 1NXPA 4EKDA 1MGPA 2V7TA 2BEKA 1D7AA 1U11A 3H0CA 4GC9A 3U7JA 5KSOA 1R0XA 5FBQB 1AB5A 5HGJA 5JY6A 2QY9A 4S24A 1ZOLA 3KVYA 3QUCA 4LHWA 4MI9A 2I6XA 5E38A 1ZJ5A 1AZWA 4PYIA 5DHPA 4BFLA 1AKQA 4O1IA 5FAXA 4AN0A 5BXQC 2G1JA 2QM3A 4LJ4A 3WI7A 1P7WA 3ZWWA 2FQ1A 2IUYA 4MV9A 4FR5A 4FI3C 1JSCA 1X74A 4IIVA 5FFNA 3ESDA 4UHKA 4KB5A 5J2TF 3TLGA 2YFKA 3V4SA 1E69A 5ALFA 1O0BA 4QTXA 1LW7A 1TYEB 1JJIA 4N6NA 1XFDA 2R4UA 3O82A 4Y6OA 5AVXA 4AG3A 4JUCA 1TEVA 3C87A 4YRNA 2CHEA 4KMOA 4AJPA 5C8ZA 2ORIA 5CFZA 3K92A 1Z0UA 2PKYX 4EYQA 2B9EA 4JOBA 4UBOA 3PFFA 4FHGA 2ZJ0A 3AILA 3LQYA 2CDBA 4G5SA 1V45E 2BMWA 3BMQA 3MTJA 3MIZA 1JU4A 4Q7EA 1Y7IA 2B0CA 3VMFA 1Z7EA 4R69A 3B51X 3U3MA 3IQHX 4JEUA 4HMOA 3T34A 3V97A 5IKPA 3H84A 2I3AA 4B47A 5KHAA 4KQWA 4IRXA 3TZQA 2MYPA 2ONKA 2Z04A 3W06A 4O2LA 1U8TA 1V35A 2X14A 3K9GA 5BWLA 2A9PA 2QTTA 3PQFA 3M4NA 3M49A 4PIVA 3PKJA 1D1PA 1ZP6A 4P4SA 3IPCA 1CUZA 4IILA 4HNHA 3C3MA 4ZAYA 1RHJA 2O5RA 3B60A 3GRVA 4XTCS 1ESMA 4ZOEA 4ZU6X 4UJ5A 5AKYA 4HDOB 4A6DA 5BMVF 3MYYA 3GLGA 2PAFA 3LLMA 1G38A 4B6QA 2CLLB 3C16C 4PN7A 1B41A 1DEAA 4CM3A 3H9JA 4JI5B 5ICSA 1RI3A 1TCBA 2P2CA 5TS3A 1TQDA 4PLVA 1SCAA 3CVVA 1HH4A 1XU7A 3K8QA 4PPQA 4KPFC 4JL5A 3AUJB 3MT7A 3CZCA 5FIUA 3PC4A 2ECQA 3NHBA 3GR6A 3NTUA 4R8LA 3H6GA 4RJIA 1PJBA 1E99A 4US0R 3LQFA 3ESCA 4G4SP 4J2OA 4QYTA 3QKWA 1E59A 3UM9A 3DG9A 1SKUA 4G5RA 4E4RA 1D1SA 2R8OA 1O97D 2Z58A 4M88A 4XWAA 1H0KA 1IN7A 4N40A 4MB6A 1HMPA 1NVMB 3B1JA 1DEOA 2FDXA 2GN0A 4KN9S 1RXSA 3U4CA 1FVHA 1ECCA 2OHOA 4XJSA 5DYYA 5K0CA 3OQHA 1TVMA 5CM8B 4IGEA 5DBOA 3SZOA 1CRZA 3X2FA 1CR6A 5ED4A 1TZBA 1XBTA 1YOVB 3BDIA 2IHJA 4DJFC 5A06A 1G63A 3E15A 2C0CA 2FUKA 5J2UA 4FFMA