4XUCA

Synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd18 (1-(biphenyl-3-yl)-3-hydroxypyridin-4(1h)-one)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
NLLAGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Evaluation of Heterocyclic Catechol Mimics as Inhibitors of Catechol-O-methyltransferase (COMT).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 84
structure length 218
sequence length 218
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2015-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xucA00
1WXWA 3I58A 2I7CA 2JH8A 3B7PA 5DWQA 2PX4A 2YXEA 3UJ8A 5E1BA 4E70A 3CC8A 3FUXA 2NXCA 5CVJA 5DM1A 1NE2A 1NW6A 2XYQA 3KPUA 1SQFA 3CJRA 3KQTA 3KQOA 3GRZA 3P2KA 5CVEA 5JR3A 3UWPA 3KPJA 2P35A 3SSOA 2ZZNA 3THSA 3OE4A 2IBSA 2P3LA 4YUXA 3PX3A 2Z6UA 3QOWA 2ONYA 3BGVA 3T7TA 5ICFA 5GOZA 1H1DA 2P3OA 1UFKA 2PV0A 2BR3A 3IEIA 4P58A 4DM3A 4RTQA 2JHAA 3NJRA 2NP7A 4GEKA 2ZTHA 4RSRA 4MQ4A 3B5IA 4QPPA 2JH9A 2BH2A 2ADMA 3FUWA 3E7PA 4V0RA 3G5LA 4M37A 3GRUA 1QZZA 4RTLA 5FULA 1X19A 2JJQA 5LR6A 3LHDA 3CVOA 1R74A 3RIEA 2IP2A 2P7IA 2VP3A 2YUIA 2GPYA 2NXNA 5FHQA 1HMYA 1RI1A 1L3CA 2P8JA 2HNKA 3A4TA 3DMHA 2JHPA 1R00A 3CBGA 4U7PB 4XCXA 3UFBA 3EVAA 2ORED 3ER9A 3NWEA 4HTFA 3HVIA 5HZMA 3FPGA 5K0JA 4F85A 7MHTA 1VIDA 3SXJA 5HOQA 3GCZA 5FQNA 3CCFA 3ELYA 10MHA 3BGDA 4BLUA 1JG3A 1VP9A 3EPPA 3NDIA 5CIYA 1JTFA 2OY0A 5E8RA 2GAFA 2CMHA 1G8SA 1XDZA 1YFJA 1SQGA 2EJUA 3HCFA 4LWPA 4IV8A 1TPYA 4LWOA 5EKUA 5C0OE 2E5WA 2VDUE 2A14A 2I6GA 5CM2Z 2BZGA 5DSXA 1EIZA 2Y1WA 5T67A 4MIKA 5HFJA 1NKVA 3VC1A 5HIKA 4GOLD 2CWWA 3P9NA 4RVFA 1AF7A 5DM2A 4E2WA 5K0NA 2ERCA 1KPHA 1X1AA 2PXCA 5FQOA 4OBWA 1KHHA 5IKMA 3A26A 4Y2HA 3SGLA 4RTNA 3DXYA 3ER8A 2OB1A 3SX0A 1AQJA 2B3TA 3JWGA 1B42A 1IXKA 2P3QA 3KPVA 5K0GA 4A6DA 5K0EA 2WA1A 3KQWA 3JWIA 1ZGJA 5FWAA 3UZUA 3KQYA 2ZVJA 2QYOA 2OO3A 5BW4A 4L7VA 1NW5A 1NBHA 1JQDA 2GA9A 4YV2A 3FPJA 3FZGA 4OBXA 3HVHA 3ELUA 5CCBA 4DA4A 4O29A 1XTPA 4KIGA 3FPFA 5JUWA 4C07A 3ID6C 4GF5A 4P7FA 3G2QA 3A7DA 2ZZMA 2CMGA 4KWCA 2I62A 1INLA 3HP7A 2FCAA 3GDHA 3O31A 2BM9A 3MGGA 4RX1A 5EZSA 2IH4A 4E33A 3MTEA 1G6Q1 3LKZA 5B1SA 2CL5A 1F38A 1VPTA 1KP9A 3HA3A 3HCCA 3FTCA 1UWVA 3MTIA 3R6TA 3TKAA 2YX1A 3LECA 3BWCA 4AZSA 4HG2A 4ER7A 1JR4A 3FYCA 3LKDA 4FT4A 4X60A 3KQMA 3NVKI 5EZQA 3KPYA 5HIJA 3RODA 4C06A 3NMUF 2VS1A 5E9WA 3OU7A 4KW7A 3WSTA 5BP7A 1I4WA 1R8YA 3BKWA 2ZBRA 3TM4A 5GIOE 5C1IA 1O54A 2PWPA 5E1OA 1D2CA 1I9GA 2AOXA 3C6KA 4PYQA 5EMLA 1O9GA 4Y30A 1KPGA 5H02A 2OKCA 3QV2A 3I64A 2UYQA 4PONA 2OZVA 2YXLA 3ELDA 1VLMA 5FCDA 5IH3A 3TKYA 5DTQA 2ZSUA 4PYLA 4OA8A 1D2HA 3PTAA 3DULA 2V7EA 1SUIA 3HCBA 4RTMA 2GLUA 3MAGA 2IDKA 2ZIFA 1ZHFA 1R6AA 4MWZA 4R6XA 1FBNA 5EVJA 2UYHA 3BWMA 1G8AA 5KYGA 1G55A 1P1BA 2P7HA 3GRYA 4PYMA 4AX8A 4BLWA 5GM2A 1KXZA 3OU6A 4P7GA 3P97A 5CVUA 1TW2A 4C04A 1ORHA 3KHKA 4YV0A 4PYOA 5EIWA 3ME5A 1ZGAA 5T6BA 4BP3A 1JTEA 2OXTA 3ERCA 1JQEA 1IY9A 2P40A 3T0IA 5M5BA 3C6MA 2ZIEA 4E30A 3HM2A 4X41A 9MHTA 5C9ZA 3G8AA 3HVKA 4PCAA 4R8SA 3DH0A 3AWIA 3G2PA 2Z6AA 3UJ7A 2UYOA 3GNLA 3IYLW 2B2CA 2BR5A 1FPQA 3BZBA 5FA8A 2ZBQA 5EIFA 1ZKDA 2AOUA 2O57A 5E2BA 1NW7A 3E05A 1P39A 3OU2A 4NECA 1YF3A 4BY9E 3OFJA 5EC8A 1ZG3A 2AR0A 3UJBA 1QANA 4PYIA 3CGGA 3EVBA 4FGZA 4EVIA 3M6VA 5GM1A 4IV0A 4PGGA 3MB5A 1BC5A 1WS6A 3TFWA 3TR6A 5MHTA 3F4KA 3TRKA 1NBIA 4H0NA 5DM0A 1XDSA 4ZTBA 3FPEA 5DRYA 4JXJA 2AOUB 1RI2A 1AQIA 5DLYA 1HNNA 2XBMA 1JSZA 3BWBA 3PX2A 2FPOA 4DMGA 4G56A 4GUAA 3V97A 2OYRA 3CKKA 3EVGA 3I53A 5K0FA 2XVMA 2V74B 3LL7A 1DL5A 3X0DA 5K0CA 5E9JA 2ZLBA 1NW3A 2G8NA 3DLCA 3UA3A 3KQSA 2WA2A 4QDJA 1XCJA 3PFHA 2H00A 1MJFA 3LGAA 3B3JA 3DMGA 5E8JA 4OX9Y 1KIAA 2IIPA 4MTLA 2FRXA 3LCVB 4GC5A 5DPMA 3EVDA 5CCXA 2AN5A 1DCTA 1Z3CA 1XJ5A 4YMHA 3ELWA 2AN3A 4Z2YA 2IFTA 4RYLA 4C05A 4B17A 1WG8A 2PX5A 4EKGA 3KQPA 3HCDA 4FZVA 3M4XA 3IV6A 4KDCA 1RI4A 4PIMA 5EMMA 4ATNA 3PLAE 2PT6A 1L1EA 1M6EX 3R24A 3KU1A 3PVCA 2DPMA 4X1OA 4IKPA 4GOND 3BGIA 3G89A 3M6WA 2ZZKA 5EGSA 3TLJA 1G38A 2PKWA 2UZ4A 4C03A 3B3GA 1Q0TA 3A27A 3G8BA 5EEGA 5D1HA 5DX0A 2C7PA 3HCEA 3HA7A 2UYCA 5LQRA 1WY7A 1UIRA 4GQBA 4PIPA 1OR8A 5DXAA 5K03A 4F84A 3THRA 1DUSA 3DTNA 4AZWA 4OQDA 2QY6A 1P91A 2YTZA 5CUQA 1KR5A 2HV9A 3AXTA 3MERA 5LQUA 2HTEA 1WXXA 3NW9A 4ISCA 3NVMB 5F2NA 4C4AA 5ICEA 3P2EA 3R0QA 3CJTA 4P7JA 5HEKA 5HILA 4C08A 1SVUA 2GB4A 2ZWVA 2H1RA 5D1NA 5LQKA 3KR9A 1NV9A 2GH1A 1BKYA 3ORHA 4PWYA 4PYNA 5LSAA 3OFKA 5FHRA 3L8DA 5KVAA 3DP7A 4YMGA 3G2MA 5FTWA 3EMBA 1F3LA 4CKBA 4RTOA 3HCAA 2F8LA 5CVVA 2G72A 4ER5A 4FT2A 3I5UA 4DF3A 5LQNA 1M0EA 2XYRA 4E2XA 1AV6A 4YUVA 3LBYA 2AS0A 3LPMA 5LQAA 2XYVA 4LG1A 2PX8A 3PFGA 2PXAA 3GIWA 3OE5A 5DXJA 5LQCA 2WK1A 1EQAA 1Y8CA 3FPHA 1N7JA 4PYKA 1VP3A 5EMKA 2IH2A 5E2AA 5K0LA 3FTFA 3AY0A 3UA4A 4AUKA 1JG4A 1L3IA 3DLIA 4KVZA 5E1DA 4RTPA 3M70A 4R6WA 2IH5A 4CTKA 5DRTA 2ZIGA 2VDVE 2JHCA 4QVKA 2O05A 2OPBA 3P2IA 4RV9A 3RW9A 3LCUA 4GOMD 3LDUA 3GWZA 5GP1A 1X1CA 4POOA 2HR1A 2NNWB 4RVDA 2AZTA 3B3FA 2OBFA 1Q0SA 2EFJA 4HC4A 4HRAA 5EHIA 3OCJA 2AOTA 2P41A 3EGIA 2VZ9A 4KIFA 5FWDA 1U2ZA 2LD4A 4E31A 3P9CA 3FRIA 3FTEA 2NYUA 1XDUA 1KPIA 2EG5A 4DZRA 5K0BA 4OQEA 3S68A 1XCLA 5EPEA 4YUWA 4FSXA 4PNEA 3LX6A 2GS9A 3KR1A 3A7EA 2ZBPA 2PX2A 1EG2A 4K6MA 1PJZA 2CKDA 3BUSA 2HWKA 5K8VA 3P71T 1SKMA 2K4MA 3IHTA 1L9KA 1YUBA 3GRVA 4R8RA 1FJXA 2ZCJA 4DCMA 5K09A 4EQZA 2C7QA 2AOTB 5T64A 1BHJA 1ZQ9A 2Y1XA 5ERGB 2ZFUA 2QRVA 4DCGA 4M36A 3EVFA 1VQ1A 2O0LA 4FSDA 3BT7A 3DUWA 2N47A 3NWBA 4HH4A 4IWNA 4QVGA 4X61A 3DOUA 4PGHA 5DTRA 3LSTA 5EG5A 3R9XB 4QPNA 3K6RA 3MCZA 3C0KA 5EEHA 1FP1D 2P1DA 1RJDA 3QOXA 3UBTA 2ESRA 3KR2A 3SVZA 4YUYA 3VSEA 1N7IA 2QRVB 4KRGA 2I9KA 4R05A 2PLWA 4CKCA 1JG1A 1EAMA 1QAOA 1X1BA 2O07A 3GO4A 4U7TB 5KQRA 2R6ZA 3LDGA 2FK7A 3O7WA 3TPZA 2YQZA 4A6EA 4F86A 4YV1A 2KW5A 5KS2A 5DX8A 2O06A 3HNRA 4LECA 1X1DA 2ZW9A 5E9QA 2PGXA 3O4FA 3T7RA 2XVAA 2PSSA 1VBFA 3BXOA 4FS8A 1JQ3A 1O9HA 3Q7EA 2H11A 3LBFA 5CVDA 4RTRA 3CJQA 1EJ0A 3DXZA 2IGTA 5F2OA 1RJEA 5KQSA 3R3HA 3BKXA 3NDJA 3OZSA 3UJDA 5DT2A 3C3YA 3VYWA 4BLVA 2EJTA 3D2LA 3K0BA 4XUDA 1NW8A 1RJGA 3Q87B 4PYJA 4EK9A 1YFLA 5EOVA 1KYWA 4HGZA 5GWXA 3PB3A 5FUBA 2PXXA 4CXMA 3MCTA 2QM3A 3I9FA 3SM3A 3UJAA 3B89A 4EMSA 3HTXA 5ICCA 2C7OA 4QTUB 5G02A 5E1MA 4RTKA 1P1CA 4RVHA 3DXXA 5DX1A 2FYTA 2QE6A 4RVGA 5EKXA 1YZ3A 5GIPE 3G7UA 3SMQA 5U4XA 3EEOA 1QAMA 2AN4A 3AXSA 1D2GA 1SUSA 2IDJA 2YXDA 5HIMA 3UJCA 1R18A 1RI3A 3KQQA 2PWYA 3PS9A 2DULA 3AJDA 2PY6A 5DM4A 1T43A 4GBED 4E2ZA 3VC2A 5K05A 3TM5A 4RWZA 4YUZA 4WXHA 4M38A 5BW5A 3GXOA 1NV8A 4HTFB 1NT2A 3TOSA 2HMYB 2ZWAA 3JWJA 3HA5A 2BM8A 3MQ2A 1QYRA 2B25A 5DSTA 2PJDA 2PT9A 3TMAA 3FYDA 1XXLA 5CD1A 1BOOA 1MHTA 2AVDA 4P7KA 1FP2A 4RTSA 3DR5A 4E2YA 2PVCA 2OB2A 4ER3A 4UOEA 5FA5A 2FHPA 3HVJA 4QQNA 3SR4A 4E32A 5BXYA 8MHTA 4XUCA 2G70A 4PINA 3M33A 3EVEA 1I1NA 1ORIA 2C7RA 3EGVA 3P9KA 4EKIA 3NTVA 4BP1A 4QTTB 5LQJA 3MHTA 2VDWA 3C3PA 1PRYA 4HGYA 2PBFA 2YR0A 1R8XA 2AOVA 3E8SA 3OZRA 5HIIA 3REOA 3TQSA 4AZVA 4CKEA 4GC9A 2YVLA 3EEYA 3BWYA 3GJYA 1L3BA 3FUUA 3KKZA 4KDRA 1N2XA 4RTJA 3FRHA 2AVNA 5F2KA 3HEMA 4DKJA 4AZTA 3UJ6A 2NXEA 2B78A 5EMJA 4DQ0A 4XUEA 1JSXA 2FK8A 3EVZA 4CTJA 3PT9A 3KPWA 5FADA 4HSGA 1WZNA 1G60A 2Q41A 3E23A 1EJ6A 2AOWA 1VL5A 4QQKA 2NXJA 1M6YA 3M6XA 3KR0A 4V0QA 3UJ9A 2ONZA 5P8WA 1VE3A 3FUVA 4MHTA 2R3SA 3H2BA 3U81A 2Z6QA 3GGDA 3DMFA 4FP9A 5DTMA 3GRRA 3SSNA 1YB2A 4GOOD 2G71A 3LCCA 3P9IA 1YZHA 1RI5A 3EGEA 3EVCA 4OA5A 3V8VA 3G88A 4WVLA 1RJFA 3P8ZA 2B9EA 2IBTA 5ICGA 2BR4A 3ANXA 5K01A 4FR0A 3OZTA 3M6UA 3A25A 3G5TA 3G2OA 4PCLA 5GINE 1KYZA 1XVAA 2ZULA 2G1PA 3JWHA 1TW3A 1SG9A 4M7RA 4ER6A 1QAQA 3FTDA 3GU3A 1V39A 1IM8A 3EMDA 3SSMA 3T7SA 3OPNA 4CWAA 4ER0A 2EX4A 4X63A 1JG2A 5EHGA 3FUTA 3KQVA 3LDFA 4QDKA 5EQJB 2NP6A 2JG3A 2IPXA
chains in the Genus database with same CATH superfamily
1GXSB 4NMLA 5K2OA 2CXTA 1PR0A 3CH7A 5B6IA 2JH8A 2QN6A 5JD3A 2R6JA 2A8YA 5DM1A 5HXAA 1ZD8A 2X0NA 4CV2A 1S9HA 4E13A 4L57A 4QU8A 3R0IA 1PR6A 3SEAA 3GG9A 4X1IA 2REOA 1ZNQO 2ZCVA 4GYKA 1XTSA 2COEA 2YBDA 5EE5B 3U2QA 2XMRA 3RVOA 1TDJA 3IBYA 1K2WA 3NEPX 2RBKA 3KD3A 1ZJWA 3L6EA 1EUQA 5TSDA 4H08A 1XDBA 1QHIA 4CHTA 3SR0A 5JZMA 2XPCA 4WX2B 1VECA 2BR3A 1O03A 3LPLA 3VGJA 2WIDA 1ZIDA 4MQFA 3D3WB 1EVKA 2UDPA 1AXGA 1MB3A 1RJ9B 3L7OA 3OLWA 2BDTA 1Y5IA 1NIJA 2Z43A 3BDVA 3GRUA 4TYPA 2EHJA 2JLQA 1A9YA 2J31A 1JH8A 2RK6A 2AX4A 3AI3A 3JQRA 3Q6IA 1F2VA 4L5JA 4NL4H 4YPFA 5L4SA 1PJAA 2LIPA 5AIAA 3MILA 1IAQA 4YO8A 5CFZA 4UKDA 1SCQA 3QKSB 1NRJB 3NV7A 5GONA 2FEAA 1W5FA 4I8DA 3VPFA 4EJSA 4C3OB 4QQRA 2JPDA 3HO6A 1QHXA 4YVFA 5ADWA 2LWIA 4ZREA 3HR8A 1CQXA 1DSSG 3A2NA 3EGDB 3IOMA 3R3XA 1UMCA 4UW9A 4P54A 1DFHA 2F43A 2YWBA 1OXUA 3UMBA 4F06A 5AW6A 3RYFB 1DKQA 4C87A 3HY6A 3N3BC 4LSGA 3GUCA 1NLFA 5E8RA 1A8QA 4C7MA 1NKTA 3Q6MA 1FIUA 1IXZA 1ZAKA 2FEOA 4JB3A 1DKNA 2IYPA 5EI5A 3GNSA 5FPSA 3MCWA 2A14A 3LXMA 5CM2Z 5GGYA 1OZHA 3K0EA 4OQXA 4QT4A 2RHDA 4MPPA 1CG6A 5F5LA 3BWXA 1PT9A 3K16A 3LIIA 5I9BA 3EGDA 5JCOA 3SLGA 2PRKA 4PZPA 3EIWA 3HWSA 4KTTE 5CT4A 1ULAA 1I36A 3F46A 3X1DA 3M9XA 1UZUA 1SB9A 5DO9A 1NLUA 2P30A 4K3UA 1QGYA 2D5LA 2B3TA 2NNLD 2XE6A 3E8XA 3IURA 4TRMA 3UMSA 2GN0A 5KNDH 3SM9A 2IXFA 3CZCA 3R3WA 5HR5A 4M89A 5KZMB 2BHSA 3FVVA 3KUDA 4TMVA 4MAAA 1AG9A 2B5VA 1Q0LA 1KZ7B 3F1KA 2HJVA 3L7IA 1JQDA 4TUYF 3FWZA 1C8BA 4W9NC 4WOCA 3V42A 1YQGA 3I2HA 1MJGA 1YDWA 3GXBA 3M3PA 4O29A 1IJKA 1BWQA 1M34A 3VH1A 4EVRA 3D59A 4GU5A 2TMKA 4Y2RA 3VU0A 1VSQA 4J8PA 3EH2A 3MCVA 2ZIXB 1IY0A 3W2EA 2ZYWX 5EINA 3FCAA 2ATIA 4ZU1X 4N9WA 1GV1A 3CMCO 3UT5A 1ZWKA 1E1YA 2D1QA 5ESDA 2IEBA 2J3QA 1MN6A 4C88A 4CQMB 4LE1A 3MUNA 1LB1B 3RBAA 1NMZA 1SUEA 3TMYA 4AKSA 1B14A 3PC2A 1Z18A 2X4GA 3DKKA 2XMCA 4NS1A 5E9WA 5CDFA 1GTSA 2WU1A 2D4HA 3HKBA 1Y6GA 2JI6A 1X1SA 2H5JA 2JFOA 3BKWA 4MCJA 4OMDA 5EMNA 4B44A 1RRFA 1YTLA 1E3WB 2H1FA 2Y6VA 5A5DA 5LP6B 1DZIA 3KTAA 4YMUA 1IZ9A 2CLEB 5FJIA 1RAFA 2PUVA 2VWPA 4IKEA 2GN9A 3GLGA 1Z7GA 4BASA 1Z0KA 4BFUA 4BO7A 4PONA 3TYXA 1TIBA 3KL4A 2Y1EA 4YAOA 5ALPA 1X14A 3EBOA 2Q3JA 3QLEA 4HYYA 3CBQA 3I45A 2HNAA 3OTWA 5GV8A 4CKZA 3K9FC 1GQYA 1PR3A 2NVUA 4LUCA 3ZZNA 3KSBC 3OLVA 2XWSA 4Q9DA 3N1UA 4QG7A 2CCKA 3RABA 1RWVA 2OGWA 4EEKA 3TIXB 1ZS9A 2M98A 3CF4A 1UDWA 2ZB4A 3W8NA 2WTXA 3ZZMA 4LYFA 3IQGX 4XRRA 3GLGB 1ZNZA 1V4VA 1XZKA 2YHIA 4RFSB 4LXGA 3WL7A 3ZW8A 4GMDA 4X5OA 5KQPA 1H2BA 1T2DA 4B4VA 4RAQA 3VSBA 3VR5A 4D80A 1LTKA 1KE2A 4D9JA 5JZVA 1UT8A 3RTBA 1GFSA 1IY9A 5LXTF 1ENZA 2AG1A 3ZDYB 3NUQA 1EGHA 2V5AA 4Q15A 2WTAA 3LY7A 1KFKB 4IZ6A 3UJ7A 3UB4A 1R50A 1SOUA 2FPSA 2FZ5A 3GMIA 1GPYA 3TPFA 4F91B 3GLIA 3S44A 4BFTA 3W2GA 3DPIA 2XNJA 3F4LA 3KLPX 4JJKA 2WJIA 1ZG3A 2WWTA 5C1BA 1CUSA 1V47A 2WRZA 3C24A 4FOPA 4PYIA 3TJRA 2VPTA 3AOGA 3UHPA 3ZV4A 3DE1X 3VSAA 3IAS6 3SX4A 3AYXB 1BC5A 1K4YA 1S96A 3F4KA 3DB2A 2JJ2D 2GBFA 3E9NA 3NXSA 4HAVA 4MRNA 3V7YA 1ABEA 2BM0A 2QLMA 1KQPA 3ZDRA 1BJKA 2H2WA 5LD2B 1NU6A 2OCPA 4NBUA 5E4JA 1Z7WA 1JSZA 3BWBA 1WF3A 1G4UR 4IYRA 3BTVA 3BXHA 4LJSA 4DMGA 5F7OA 2PNFA 4RA6A 2RCNA 3SCZA 4DCPA 1XRMA 3A1UA 3D6TB 3ZE8A 1FRZA 2DZDA 3AOEA 3DAHA 2CN1A 4XR4A 4Z9BA 3AM4A 5HIAA 4DYVA 2X8JB 5BR8B 1LX7A 3H4MA 4F4HA 3NAQA 2H00A 1DEAA 3LGAA 4MVXA 4ERNA 1VE6A 3JSXA 4RHTA 3SYNA 1SKUA 3PXXA 3DDHA 3QELB 3ZE7A 3H86A 4ASUD 5DPMA 4NFLA 1MRSA 2QTZA 2ZB8A 3JQEA 5DIFA 4N7RA 3K9GA 8ABPA 3Q7PA 2QL5A 3D8NA 4CLHA 3FNRA 4JB0A 2Q2NA 4KDCA 2PQMA 3UWSA 1RI4A 2PAFA 4IOKA 2OFFA 1FNCA 2I4TA 1LW7A 1WHSA 3QV1A 3ONNA 1PKEA 4LDQA 3DJYA 2VCEA 1CRLA 2ZYSA 3I4CA 3C87A 1VIAA 3CQ9A 1I0ZA 1O96B 2HA5A 1QIMA 1ZVQA 1NW4A 4L3VA 5F3RA 4RDXA 5KUTA 2C7PA 2MYNA 4BX3A 2N1BA 3ZWWA 1RPJA 1U1CA 1F2TA 1M6WA 2WD7B 2REXB 1TVKB 1Y8RB 4AZWA 4B09A 1CEYA 4MR9A 4DIEA 1P91A 5DK6A 3EW7A 5E6SA 2IW1A 3AXTA 2XH8A 4TQUS 2BI7A 3M0EA 1KQOA 2BJVA 4WRRA 5BNTA 4KHZA 1WCV1 3K9LA 1XYYA 3G0CA 4WZAE 4EY8A 1QHFA 1Q6ZA 2ZWVA 3J81A 4RTNA 4PWYA 1NV9A 2P5YA 3O73A 4WNAB 5CLLA 5JNTA 4IUYA 3OFKA 2GQ0A 3Q9UA 2GNOA 1CCWA 3LBHA 4ER5A 3UXYA 1YZFA 1DLJA 4CVNA 3AX6A 1T0IA 1U04A 2ZBGA 3NETA 5LQAA 1W88A 1ZLXA 3AVOA 5K3DA 1U7OA 3WRYC 1QCCA 1U0GA 2G1AA 3FNQA 3W2IA 2PFKA 5DXJA 4EG0A 3IRVA 2H92A 3CWCA 3D1VA 5FPTA 4DW8A 4TS9A 3AY0A 2BKUA 4FFNA 1J0EA 1EUCB 2FG6C 4R1MA 5E1DA 4B35A 3V7UA 1V95A 1V5IA 4F5WA 2ZJ8A 1H42A 3QVUA 4TTTS 3L7YA 3FVRA 4O02B 3K1TA 5I7SA 3CUVA 4DAEA 3ESQA 4LXYA 4YALA 5J4HA 1GR1A 4M9SA 2VRWA 1POWA 2OYSA 4GPAA 3ZGLA 4C7BA 2HR1A 4Y1RB 2O59A 4X3PA 2G28A 4OM7A 2C2KA 4AX4A 1KVQA 2JI8A 5I7OA 3EGIA 4TV9F 4YRGA 2Q5LA 2QUBA 3EF3A 5J40A 3CY6A 3DS8A 3FRIA 3QPUA 1SU8A 4GGOA 1U7XA 2FPIB 3AHHA 3HDQA 5JXIA 3M8KA 1KGSA 3DUFA 3W5VA 4YTEA 5HGXA 1GA1A 2OQRA 4UJ3A 4A6PA 4K6MA 1OLOA 3I01A 1VHQA 1CSEE 1PUIA 3Q8XB 3ZTTA 1WLYA 2DC1A 2Y0BA 1DIAA 3BCUA 3DWIA 4R8RA 4R7TA 2ZCJA 2QLFA 4W7SA 4B46A 1EJ2A 3R3YA 1J90A 5T64A 1TTQB 2XDQB 2GK6A 3UMVA 1F0KA 1BHJA 1JHMA 4P98A 3UM9A 2E4YA 3CR3C 4GPD1 1TMYA 4S12A 3TXXA 1HQKA 2NAFA 4DR6B 1NY6A 4HNAB 3CZ9A 3K6RA 3ND7A 2CKMA 4FYIA 2A5DA 2V5UA 4L15A 4AYTA 5JCJD 2RI1A 3INNA 3QLUA 4UAGA 2XUHA 3RM3A 2OK8A 4XM1A 1IQRA 1PBNA 2X1HA 2DP4E 1K27A 2E4AA 3ZE0B 4B48A 3NVDA 2VOEA 4RHYA 3MIZA 1XEWX 3T9DA 2XTMA 2BHTA 3UHJA 3EYWA 2W2OA 5B12A 4HLUC 2DTXA 1KMIY 2ZT5A 1GO2A 2R8ZA 4HUQA 3A37A 1JIJA 2Z58A 1M2JA 2GX6A 4RW0A 2Q9CA 2YQZA 4B7AA 4HYQA 2H4YA 3GYBA 4INOA 1PDVA 1ZJ4A 2QD4A 2QYHA 3Q0TA 3ZUPA 3Q2KA 1RQ2A 2AFVA 3H18A 3K8OE 4K6KA 2BMEA 2WAAA 3OQ6A 5LMNB 2AR7A 2GD6A 3AIKA 3INTA 3ESYA 3TSWA 2O8DB 3I2GA 1L7EA 1NW8A 5JAOA 1RJGA 1NJ2A 2HSWA 4HRVA 3QMVA 4N18A 1UKAA 3IEKA 3WHIA 1RYHA 1CDZA 4AO8A 1MG5A 2C1ZA 3T3EA 4HRYA 4C7OB 4TZ6A 2FUKA 2NU8A 3VJMA 2ID8A 1XP8A 2QM3A 3UJAA 3HYSA 5FL3A 2NSJA 1X1RA 4URFA 2Z8ZA 4HFNA 1V2HE 4DDVA 4QIHA 3FCCA 3WXMA 4DLSA 1GN8A 1VBNA 2AN1A 1N6RA 1FDUA 1ZEMA 2OCDA 3Q9LA 1UWCA 2FWPA 1C0LA 2YINC 1IWPB 1MEJA 3L3BA 3K8QA 1EFKA 1XXHE 2COUA 3ZD7A 1V8BA 2HHLA 1Y4SA 3DDWA 1WB4A 2JFHA 4LTNA 1NVUQ 3AEUA 4NV3A 5F9MA 4ZGBA 1EK6A 3BMOA 4AXBA 4MQMA 1PJQA 3EZ6A 1C3LA 1KJJA 4QFDA 4YEDA 3WIDA 1NUUA 4BNNA 5TQ0A 4C0WA 2IT1A 1RXVA 1E1QA 3S1SA 5IKPA 1Q1AA 1XNHA 4ZZ0A 3RRMA 1WWKA 3JWJA 1H2RS 4M0PA 1UC9A 1UWKA 1X3LA 1DGQA 2CVHA 3HPRA 3L1KA 4BPRA 2CY0A 3IELA 4FIDA 3GJ7A 2BELA 3M4JA 3OUUA 3RFTA 2ZDHA 2XQKA 3AY3A 1TYBE 4EYSA 8MHTA 4R98A 4G4GA 3VOSA 2RHBA 2G70A 3DD5A 1FRFS 4EI7A 1EXDA 3M33A 3OJXA 1I1NA 3GAAA 2BTQA 1XN4A 2R6FA 1TZ2A 3C15C 1NU8A 4ZGGA 4IX9A 2CFCA 3MSXA 3NHZA 3NKFA 4LMPA 3C16C 3NQ41 4C4PA 5L53A 1I3OA 2TMYA 4JYZA 3N9IA 4YGXB 5FA6A 4C4YA 2O8BA 1FVOA 5L4LA 4WXEA 1ELOA 2ECOA 2A1TR 3AG5A 3JQCA 5HIIA 1FTWA 1OXTA 5D3QA 1XZFA 3KXLA 4L02A 4FFLA 1OC2A 3WJ2A 2HI0A 3TNLA 1XZGA 4CEIA 5H0IA 1ATZA 3UGKA 1AA6A 1XNQB 2FI1A 5F78A 4XFDA 4ENSA 2QLLA 3LYHA 1U7ZA 4FHZA 3SDZA 4XIJA 4JLOA 4OHBA 3RFCA 4EPXA 1E8NA 1Y1KE 3BXGA 3BA6A 4O2AB 2ZRGA 1U6IA 1AUVA 4WZBE 3H99A 3OZ7A 3U44B 1YBMA 1P74A 1RKBA 3AETB 3OF5A 3ICOA 5K5EA 2QN2A 4OOEA 2QI9C 4MA4A 4XB1A 4J91A 1VE3A 2JIBA 3R3JA 1DRUA 1GP2A 2R3SA 1T1JA 1XDGA 3TNFA 1Q50A 2OR3A 4NTZA 4IFTA 3TLKA 3PD7A 3QU7A 2WICA 4K6CA 5A02A 3T7EA 4ZZ2A 4MQ6A 4MEJA 2BJHA 5IS2A 2FWRA 2AXPA 2C1EA 5JCPA 3QE3A 5TMEA 4B4KA 2A1UB 2R68A 1JDSA 4GLBA 1VE5A 3DCJA 2QLNA 3GPIA 2IBTA 2QVYX 1YD7A 4MWBA 1XPJA 2P62A 4PXAA 2NACA 1QYIA 1X9IA 3KT8A 2QRMA 3BFVA 1MR3F 1J25A 4M7RA 5L3QB 5AVYA 3H84A 1V39A 2FZKA 4UU8A 1RRGA 1XMPA 4BATA 2EX4A 1JG2A 5CCEA 4Z0HO 2C8LA 4HLUA 1DEXA 1D3AA 3N75A 4JYPA 1JHZA 1KJWA 2ZJ1A 1VJ1A 1WXWA 2EAUA 2Z04A 5A4FS 3GNQA 3VR6A 2XUZA 2BFPA 1OHHD 5E1BA 2I3AA 1NJFA 3OETA 1ISSA 1KVSA 4E70A 2WQ7A 4H60A 5EKDA 3ZIDA 4L5CA 1PDWA 4JJIA 5CVEA 2A9RA 2VRBA 1H5UA 3BFKA 3HM9A 1GCIA 2IEZA 5U4QA 3B6ZA 3IKLA 5CRIA 4YUXA 4REOA 1VPDA 1K9VF 1WMDA 2EIXA 3CLHA 1U9IC 1JN0A 2LDXA 5IDYA 4MV1A 1RPAA 4M1QA 5GOZA 4BGIA 2ZJ4A 2BZ0A 3E3OA 1M0SA 1Y8QB 3MTBA 2HMTA 4RHFA 3MUOA 1SXGA 4S24A 4AM8A 3H1AA 3SK0A 2EARA 3RBXA 4LGCA 1KQ3A 4Y9RA 4BFWA 4AF7A 4UPEA 4MVJA 7REQA 4ZOLA 2BH2A 1JDPA 4PO3X 2QEQA 4JA0A 4W1SA 1UJCA 2AW5A 4EITA 1G42A 2QG4A 1EXWA 1L4BA 2JJ1D 3BGSA 3UCEA 5K8IA 3AR4A 1M1UA 3E35A 2B4YA 2D54A 4PZ0A 4NBWA 4FUTA 2NXNA 3BDAA 3MINB 4KXLA 4N54A 1PS8A 1QCYA 4IWXA 2JHPA 3CBGA 2IHTA 2ZUWA 4B84A 5CDYA 4LRSB 1YB1A 1MPTA 3ZXIA 1RC8A 3P0JA 3SYRA 1M6NA 1W94A 3QITA 4KR6A 4R2KA 1SMKA 3CFYA 4YAKA 3OCXA 1TYDE 3E22A 3EPPA 3M49A 4TXHA 1O8CA 3OMWA 1AH2A 4XB6B 1J21A 2I4LA 1H6AA 1YFJA 1P8JA 3RC9A 3KKOA 4IV8A 1TPYA 1N2CA 3EXHA 4BLRA 5A3QA 3LFTA 1E89A 5CYGA 3SEZA 2Y1WA 4MIKA 3RH0A 3EQZA 3ETEA 5C31A 1DNPA 2R8PA 4P8RA 3P9NA 1MEOA 3QXCA 3K15A 4G37A 4YP7A 4BCCA 4P9NA 1HDOA 1RHRA 2DPYA 1FYWA 1Z68A 2I8LA 2NU9B 4ZYLA 3EPJA 2HHHB 2QRZA 4X84A 3STYA 2QVZX 2X3YA 3ENZA 5FLXA 2VDWB 2Q2OA 2P9CA 2R7MA 4LVUA 1OX4B 3USCS 4EA6A 4E6EA 3HBJA 4U7HA 2J3MA 4MP3A 2MINB 4WOPA 1AQJA 1KK3A 5K0EA 1EK5A 1A7KA 2V7UA 1THGA 2PIAA 2R4QA 3EGWA 2ZATA 1JDTA 2B36A 3B20A 4WZBA 1IIBA 3KVVA 3NO4A 3P4XA 5BW4A 1NBHA 3FPJA 5IJ0B 1SCDA 3ZD6A 1X9HA 3TTWA 2YVKA 4G67A 1VTKA 3DV2A 4AP9A 2GEDA 3T1VA 4KIGA 1KMMA 5JUWA 1NLMA 1TYAE 1QHYA 2FFAA 4JLVA 4LHYA 2W70A 4G8CA 2IYZA 2PS9A 1C1XB 2GCIA 1E1RA 4DY4A 5BSEA 1EQUA 5FAXA 4B6EA 1AHPA 2QUJA 2XE4A 4OF4A 1KSHA 2XW6A 4KWHA 1MB2A 1QSGA 3R75A 2EW8A 2OV1A 3KZCA 2W5UA 4QSMA 1B1CA 2IHKA 1JVBA 4Y2XA 4B6GA 4ZRDA 3WAJA 5IBRA 1M67A 3G79A 2W7TA 3WZMA 4ANFA 2IDZA 4ED9A 2ZE8A 3JYNA 4FW8A 1T2EA 5BRNA 4BMDA 4X60A 3EUFA 4EG6A 5A4IS 1BQEA 4D99A 4DR7B 3AR6A 1G20A 1S1CA 2WMDA 3IUPA 4N9QA 4RL4A 4A5SA 2YCBA 2RHTA 1QNFA 3K05A 5EJ9A 4ZI3A 4M54A 3FN4A 3V7FA 5D8DA 1PEAA 3DEZA 2PZMA 1RHKA 2VNAA 1IYZA 3C5EA 4I4TF 3TSAA 1O9GA 3PEVA 5JSZB 1BDBA 1N4DA 1VG9B 3U3OA 1F8UA 3NBUA 4OU5A 3TW6A 4CQMA 3CW9A 2BKAA 3DO5A 2WMYA 1R6DA 4TXMA 3RVBA 4EYGA 2WWYA 1M2WA 1ORTA 2YWXA 4MPTA 1OYVA 2ZS8A 1TZCA 2WZQA 2HAEA 3DULA 1RBMA 3JQ9C 5LNK6 2JIPA 1N5LA 2WUWE 3GVIA 4Z8XA 4MWZA 1W4AA 5EVJA 1FBNA 1G3MA 3RSHA 4OYHA 2W11A 1YZNA 3QE4A 1VDZA 4TT8A 2WHPA 2NG1A 3L40A 5A7GA 1SHUX 3K6SA 4PX9A 2D5AA 4INAA 3DVAB 1UEXC 4AWBA 3LH5A 2BGNA 2Z98A 2WUEA 2WVJA 1FDIA 2H65A 2GYWA 3O3CA 3VKVA 4KN9S 4CM9A 4LCBA 4YHBA 1KYXA 4LSZA 4B34A 5H9WA 2YYZA 1F8XA 1FVFA 3DAFA 2QJWA 4KNVA 4YV0A 2BKXA 2C31A 2YJ3A 5EIBC 4PGMA 3K5IA 4CL3A 1ULHA 5FDFA 3T0IA 2OHIA 3GWGA 3C6MA 3PK0A 1JEJA 3SJCA 1KJ9A 4TTJA 3UMJA 2Q1TA 1B8OA 3RUEA 2ACWA 1PW5A 3JCZA 3LGXA 2XMZA 2JBHA 2X0KA 4YECA 1A9QA 1PNTA 2Y1FA 5DKFA 2GO1A 3JD0A 4WKBA 4XDZA 4X6LA 5BQXA 1DKUA 5LYJB 1P39A 3L7BA 1Z6TA 4FEYA 2AD1A 4L4SA 1UJMA 1DBRA 1QANA 3R9KA 3M6VA 4FJ0A 5CA0A 1WZUA 3IPAA 3RUAA 1RXCA 2JKVA 1NBMA 2HDNB 2BD0A 4Q4AB 5EUCA 1SBIA 2Q21A 3TR6A 4ONEA 4EB8A 1GUZA 2X8JA 5DM0A 2ISQA 3PUZA 1JKIA 1CRQA 2G5PA 2GRJA 1S02A 2QIOA 3GLUA 3KAJA 3MJVA 4HP8A 1CF2O 4NJMB 1FMJA 5H68A 1JNXX 3IEMA 1HNNA 3ODPA 3X1WA 4XVHA 1J2EA 4A0RA 3V97A 1Q1NA 4L22A 1U1GA 3RRYA 5TF4A 3MGKA 2V74B 4H1VA 4LSWA 1K9SA 1VMAA 3X0DA 5C52B 1NW3A 3A0UA 3MMZA 5A3SA 3RG8A 4OAQA 1PZMA 5K20A 2TMDA 1KY5A 2Q7XA 4LX8A 4E3ZA 1VL8A 3I52A 2IIPA 1PZHA 4WINA 4XDGA 1V0JA 3LCVB 4CCAA 2FVXA 3VYTB 3N8DA 3VZCA 3SYTA 2JGAA 1UXIA 3P9XA 5TPZA 5F1PA 3RJTA 2P5UA 3R7SA 4RYLA 3QEBZ 1WG8A 4S0ZA 4P3YA 4ZVNA 1LVHA 2B20A 2BEVB 3C3CA 4G0OA 4PIMA 3WNQA 2UXBB 2QU8A 3LWNA 1PR5A 3CM0A 4L4ZA 2NQTA 3PVCA 4RZXA 1A5TA 4K6OA 5JD4A 4WUVA 5BYJA 3M6WA 2NGRA 5EPUA 2A30A 2P9GA 3FDJA 3QFFA 3NIFB 3R5FA 4OIMA 5FOQA 1I94B 3FJYA 1YB4A 2IHUA 2JGIA 2M6KA 5B58C 1JPJA 2XB2A 5J58A 2UYYA 2VHYA 3EUWA 1QTRA 3UPUA 1J2YA 4Q00A 3DFFA 1IBRA 1WY7A 2YV3A 3WGNA 4B4OA 5IDXA 4HTAA 4LHXA 2AV6A 5CM8B 1CVLA 3VI4B 1K7YA 3BQNB 5EHQA 3S40A 1HX7A 2XUGA 3VNBA 4KIJA 4HZGA 3KFXA 5FUVA 2D62A 3DR3A 5EMHA 3BPSA 3GGSA 1WUKS 4MUEA 3ROPA 4RMGA 3JVUA 1Z0UA 3RTEA 4GKKB 1HLGA 1CHDA 3UMRA 4ZQEA 3O5AA 4DR1B 2ZJ7A 3M1LA 2W8BB 1PEDA 1MB4A 2HSGA 5EKSA 3FFWA 4TPKA 4UE2A 3USZA 4NU5A 4ZI7A 2Q3CA 2O8FA 3GDFA 2GJAA 4KMOA 1PL6A 3QXXA 2YNMA 4M88A 5DNDA 1IE3A 4E2XA 2Y0DA 1AV6A 5IMBA 1K8YB 3OCWA 2D5IA 5DTIA 3TTTA 5B64A 1QQ7A 3C6XA 2C7VA 1NDHA 1S3GA 3BRQA 1XQ1A 2DPLA 2ZUSA 1U81A 3EDMA 3JPWA 2BONA 3M89A 1QPBA 2Q27A 2WZBA 4Q4LA 5EMKA 3U3MA 4D41A 3REFA 3WP1B 4AG5A 4RD3A 4TVOA 3OURA 3BL5A 4C0AC 1E4EB 3HBLA 1XF9A 2X77A 1XT6A 4GI3A 4HDAA 1ZUD1 3H11A 1A88A 4LPKA 4AUKA 5KYWB 3CKLA 4GZ6A 4M1YA 1EVJA 4UFOA 1SQ5A 3AVQA 2O1EA 6NULA 5HZGA 2ANBA 3A9RA 3AL3A 3WYFA 1QRSA 4DL9A 3KKEA 1KH3A 3Q5EA 1J5PA 2CLDX 3TWOA 3Q10A 4FIZA 4H1TA 3BFJA 1CQIB 1OGJA 2EKPA 4G09A 1AQ6A 1LSUA 2IV7A 5I8PA 1OGYA 3KKNA 2B69A 1S2GA 1WQ3A 5PGMA 4YQFA 5CFRA 5F3WB 1KC1A 2XDYA 3FB1A 1T5DX 3PHBE 1E4EA 3U40A 1FX0B 2NPFA 5JTUA 2LD4A 4N5DA 4HAXA 4A73A 1XDUA 4DZRA 4HO1X 5ECGC 2BGTA 3TD2A 1W5BA 4N0PA 4LCEA 3T8YA 2DEUA 1P1FA 1KARA 3SXUB 4HUJA 4AY4A 4TVSA 1Q1ZA 1DX4A 3D1JA 3RD5A 1ZXBA 1JE0A 1T3GA 1PJZA 1NVXQ 2CKDA 4JK3A 2HWKA 3WFZA 5LFAA 3NIWA 3X2FA 5CA0B 2AF4C 1YCGA 1KJIA 4EHFA 4QJIA 2OQ2A 4JWTA 2YICA 4Z0NA 1E6KA 3ZHUA 2QN1A 3WLMA 1OWPA 1G9XA 2WLSA 4EG5A 5J5VA 5I5GA 1W1UA 4Q3OA 5LQMA 3EK2A 3NDBB 1DXOA 1FU4A 1RU3A 1VLLA 1FS4A 1UPUA 5BR1A 2Q6LA 5JMWA 1CR1A 1RQXA 4F5ZA 4FMDB 4GR4A 1YIAA 5DMHA 3WOHA 2CGEA 1YHNA 3E82A 2DBYA 2IU6A 3ICCA 3Q7QA 3T3DA 6REQA 2CFOA 3KIPA 4IZOA 1BMQA 1XDDA 3VVBA 3UBTA 1WO8A 3DQZA 3LUPA 2V0GA 4HNTA 1UC5B 3O8DA 2HQSA 2XTNA 1W2HA 3N5CA 3OWHA 4WVFA 4I1IA 4B80A 1ONPA 1J5XA 3FKSA 3GO4A 4AJIA 2R6ZA 3OLYA 1I80A 3K71B 5HDBB 2B1QA 4YV1A 2IITA 2VAXA 4A6EA 3V2HA 4QARA 5DX8A 4GM1A 2IHNA 2V4ZA 5JC8A 2JZNA 2DY0A 1OIVA 2FJPA 2XVAA 2PSSA 4JUDX 2XE7A 4Q3LA 5TEWA 4NEQA 3OTOB 4Y7CA 5I4IA 4B3GA 3R5TA 1KEZA 1FX1A 3IAFA 4QHSA 3WMWA 2ZETA 2HF8A 3BKXA 3GGGA 2VJMA 5ALYA 1GAXA 3E61A 5D3KA 5FR1A 1N78A 1OIXA 5YASA 2Q9UA 3C3YA 3TSYA 4QGSA 3PWKA 1AF4A 3OM8A 3DT8A 4WADA 2GZMA 2JJ2A 1LBEA 3FGOA 5CTAA 5FTMA 3T4EA 4B4WA 2PRYA 3EOAI 4AQYB 5EOVA 1YBFA 4EY4A 4JP3A 2DVMA 4YYEA 4E0BA 1U3FA 1QF7A 4FUQA 1NYLA 2CE2X 2BFNA 4WNYA 3CRRA 4WLEA 4J03A 5A1JA 3SQXA 4XIFA 4K03A 4YJHA 1Z06A 4EMSA 1V9CA 4A2PA 4HXEB 4TLBA 3IERA 2VDRB 3KKLA 1X86B 4O4HF 5ITSA 1I10A 1P1CA 2C2GA 4X7BA 4EMBA 2NO9A 3RRBA 4P3OA 2PMWB 2QX6A 2PX0A 4Y6LA 5DX1A 5CP8A 1RJ9A 2GBGA 3RVLA 4H15A 5LKRA 3CVWA 2O7VA 3ZTWA 3F3MA 2YXDA 1VJ0A 2TECE 1R64A 4M76B 1EUDB 3H2IA 4CODB 1VOTA 1F9AA 1CUBA 2RB5A 2HUNA 2O2GA 4PCVA 1L7RA 5H3CA 5IW8A 3PUVA 3R5XA 3TZLA 1E8DA 1XV5A 2VFAA 4CLEA 4UHBA 3HWWA 5L95A 2R4TA 1KU6A 2HWUA 2JFNA 2GEKA 4F11A 3U4IA 4ZPJA 6CHYA 3GN1A 4NZYA 5TEVA 4YCBA 3UQYS 3SZGA 3AR8A 3P9SA 4HVCA 3RHSA 3ZKWB 2PXHA 1XVLA 2XSZA 3GMDA 2W37A 1ZH2A 1P3JA 4IINA 1QHSA 4P7KA 5AK3A 5ALJA 4F71A 1V3UA 4Q1VA 5AKZA 2RHLA 4GE0A 5K9ZA 4JEUA 1WXFA 4TLAA 5F35A 4HDCA 4M1EA 5FXMA 1Q7RA 4Q9HA 2VZ8A 4NENA 4YMVA 1L1RA 4Y9DA 2Y1CA 2JAPA 3FCOA 4JC0A 5FWXB 1RWQA 1PKXA 3EWSA 3OOJA 3O4RA 5CB0A 3OCVA 3QX7A 1KP2A 1GPUA 1Y1RA 3ZHOA 2QTLA 2J85A 1B15A 3EIOA 1TCAA 2VR1A 3HV0A 3E5MA 4I55F 1H4VB 3P0RA 2HN9A 2GPSA 1P7PA 4M49A 4YMWA 4AZVA 5K6TA 2IYWA 4LNUB 2WSBA 1N2EA 3EEYA 3GJYA 4Z7QB 5KPJA 3PQ4A 1PI3A 4OTZA 1EVEA 1BFKA 2JGDA 3KYDB 3PZRA 4K9OA 5F2KA 4ZIRA 4CTNA 3ESCA 2GPTA 4HNVA 5IFLA 3T3PB 3VPHA 1KI1A 3VPBA 4XWWA 3BTUA 4NZPA 5JS6A 4YQYA 2WNIA 1DCMA 3N28A 4Y18A 4A9AA 4ND7A 2UZ0A 4IDNA 3WOVA 3TRIA 3GLHB 4DJDC 4RSMA 3X2EA 4HGQA 3TOZA 2WG0A 3V1KA 3B7GA 1A8IA 1AUPA 1ACJA 3OF2A 3V4ZA 3RFFA 3U62A 1O2DA 1E2EA 1RADA 3IR7A 1U6JA 2FNAA 3QVTA 4X1YB 2F2TA 3DE6X 1MU0A 3WISA 2WV9A 5EWJA 2YBEA 4BNLA 2JL1A 2V4UA 4MKRA 1V11A 3P8ZA 2LCQA 4BMNA 4HDNA 1ZRHA 3JVVA 4NXMB 1AU9A 1MXFA 3U3ZA 3URKA 4BVFA 2LVBA 2XD4A 3I62A 3U44A 2G4CA 1BX0A 4GIBA 2BGWA 1XNGA 2FMIA 1P2DA 2F4NA 4ZAVA 4P32A 3VVCA 2KJQA 5HS6A 1E3MA 3OPNA 1NJ1A 1QMPA 1XYGA 4RLSA 4MICA 1Z4MA 1M8GA 5K4HA 4EW3A 5A5GA 3L0OA 4D79A 3H97A 1UXKA 4XX0A 2WKWA 4LI0A 1LRLA 4KUEA 2JFQA 3A4LA 1J56A 3PWSA 4EGAA 4ZCTA 3OKCA 1ZXXA 4ZOLB 1VFPA 2FOXA 3P2KA 4H7PA 5BSRA 2AKAB 8OHMA 5J2UB 3L77A 3W9BA 2Q1YA 4OSPA 3OE4A 1QWOA 2OV6A 4Z7NB 4UTPA 4C7OA 3EQ8A 2RKWA 1FE8A 2XRFA 3EAFA 2I3GA 4XOUA 1YQUA 1JB9A 2C88A 3EXIA 3CRNA 1VDMA 2B99A 5KO2A 4HQRA 2UU9B 2VKQA 2B6NA 2FSVC 3TIGA 3LOPA 1WSAA 3G02A 4KI0A 4A15A 4JV5B 2NP7A 1TM5E 4B3IA 4MQ4A 3C1OA 1J8VA 3B78A 4MP8A 5AJTA 4TV8F 4CM4A 621PA 2IHJA 4IG9A 3E7PA 1IBSA 4MPDA 4RY2A 3G5LA 1Q74A 2WVHA 4CLOA 1HG0A 2ACEA 4MS1B 5KYYA 4B6PA 3SPXA 5G1OA 3LVFO 1ZU4A 1LRJA 4GOKA 2E49A 2BMWA 4LVNA 2O7SA 2EW2A 2HWXA 4EUSA 4XPIB 3PUHA 1V96A 3EZ2A 4KQ9A 1AXRA 1UBTS 3KAPA 4UNRA 5KBYA 2AC7A 3SBEA 1POXA 1IONA 3EVAA 3UCFA 4QLBA 4Q4JA 2VXOA 4P5PA 4IS3A 4OMCA 3STHA 2JLSA 5IF9A 1VIDA 1ODFA 2NQ2C 3QKWA 2R6DA 1AKUA 3WQRA 4UVDA 4BLUA 2QN3A 3FUCA 4O1IA 5CPFA 3OIYA 4PPFA 1W73A 1JTFA 3T5GA 4HS4A 5CX4A 1T8PA 3PJGA 3T5AA 1BVRA 1IJBA 2QRNA 2VI5A 3DMDA 3PTZA 4GXRA 4IZHA 3B53X 4KQCA 4N03A 4UBNA 5D3MA 4I9FA 5C0OE 4BFVA 4EFMA 3DCNA 3HA2A 4DQXA 4BTEA 4NPHA 1F5NA 1UODA 4AJKA 2CD7A 3IMKA 1X0VA 3L8ZA 2DPXA 3TINA 4CCYB 2PXCA 1HDIA 2J7KA 3TZCA 3WYEA 4ZCIA 4KYIB 4R7ZA 1ZUNB 2VYVD 3JTMA 4RD4A 1S0UA 1KS9A 3MBKA 4JBWA 1RZ3A 2DHEA 4GDFA 1RP1A 1B00A 1M1ZA 1UAGA 4QRIA 3FZNA 4IUBS 2R86A 2PDAA 4MW9A 2ZVJA 2QYOA 1ADGA 2M1ZA 3JARA 3WS7A 1X7WA 2KMLA 2XMQA 3C4VA 4RD1A 4CKWB 4YRZA 4IQ8A 1X7HA 2VUSA 3LIPA 2FF5A 4GG1A 3VYSB 3JZAA 1GFZA 2PUBA 2ZE6A 3IO5A 3G2QA 4LHEA 5GOTA 5DLEA 1FFGA 2CXOA 2G5CA 2ZANA 3CLRD 3O2SB 2OHHA 4KWCA 1PAUA 4IXMA 1BXKA 1M6VA 2OCGA 2IOHA 4Y6GB 4IDQA 2XNCA 3Q7RA 3LPNA 3N53A 3R74A 4GVLA 6AT1A 2DR2A 1J4AA 2AXQA 1T5IA 3MJDA 5BRJA 2WDZA 1L4KA 4RBNA 4WPGA 1F38A 1J1UA 3V3TA 3NYQA 3Q3JB 3VVMA 1DJOA 4PLWA 4ZEOA 3QEJA 1U65A 4YRNA 2O14A 2IUEA 3NNDA 4HDNB 2F1OA 4EDHA 2J6BA 2P6OA 1XQYA 4NIMA 1UBMS 4XWOA 1WEKA 1QDEA 3LJKA 1WMAA 1E0KA 3BRWD 2GJ4A 4M7WA 4NK4A 3DDUA 5CPBA 1T9BA 4LOIA 3IIEA 3LQ2A 3BA1A 1MC4A 3EC2A 3NEAA 4ZYVA 1YQXA 2PWPA 5DMXA 5F73A 4IFBA 3U7RA 4YRFA 3IBGA 2W6IA 4FBGA 4Q9JA 2O0KA 4E08A 2DFLA 1VLMA 1ZH0A 1X7GA 2AK3A 3STUA 4TYNA 2VPZA 4RM2A 1E1KA 1IEVA 5F52A 1WM1A 3NVAA 4M9XA 2Q49A 4OXNA 3X1KA 3V2UA 4AZ3B 3L7LA 3LDHA 4KFUA 1YS2X 2IDKA 4JBXA 3VZQA 3MWGA 4J16C 1X8LA 2AMFA 2O2JA 5A5EA 1H93A 2JF0A 1NF3A 4QXMA 3L06A 5JXWA 4CYMA 1APBA 1F8YA 4KN8A 2FEPA 3TIIA 1U94A 1T8TA 1YUMA 5HKOA 1XQVA 1IHUA 4IKOA 1MJ5A 4HUTA 3G0GA 1P7CA 4NAUA 2WWVD 3V46A 4Z4CA 3NP9A 2OZLB 3PXEA 4C04A 4UHHA 5DH9A 1PX0A 2Q3BA 2G1UA 3I2IA 3KHKA 4PYOA 4FONA 2FMHA 2HV8A 1GSIA 1JQEA 1OPXA 1Q3TA 1XF1A 2OZPA 3GEDA 3QLVC 1JQJC 1JA1A 1ZUIA 2AG5A 4J2OA 2ECPA 4H3VA 4ND1A 5KNBD 3BDIA 5AI4A 1AQNA 4MDEA 2QGNA 1UAYA 4XFJA 2HU5A 3CX3A 3T52A 1Y6QA 4JCCA 1DKLA 1HQDA 1J8FA 2CLHB 2NSDA 3DLPX 2H59A 3GJTA 3H16A 4D43A 2RSLA 3ZVKA 5I9IA 2SKDA 3P4UA 1GYRA 2CNWA 3N8HA 1G5FA 4FGZA 5SY9A 4YAIA 1FQKA 5KB3A 1T5SA 5EJ5A 4KI7A 5KJCA 3OZVA 3A9UA 4NBNA 3ISJA 1QPGA 3JYOA 3E5HA 1A5AB 1DBPA 1TO2E 3BRWA 3R0JA 3WKDA 4ALIA 1X7XA 3ZV7A 2QBYB 2FSFA 3NRJA 1P4JA 1SZPA 1ZM3A 1RMTA 3MBIA 4HDMB 3K5HA 4KN6A 4MUAA 4W7IA 5B3JC 1Z6XA 1ZCZA 4HD8A 2KM1A 3I1IA 3M9WA 4PC7A 2IUTA 4DPLA 1HNWB 2OCIA 3GH3A 4IH4A 2VRNA 4U8GA 4W99A 3C4QA 3RS7A 2GN6A 1ZUNA 1FDVA 2WTBA 5AVJA 3K2EA 1SXJC 2CW5A 5E38A 3KQSA 1F1JA 2WA2A 3RYCB 4BTVA 2Q1WA 4ND3A 2HQOA 4ND4A 4OBEA 3ONFA 4HB4A 2ATEA 4PC1A 3I6IA 4ZOEA 3AKDA 4BQNA 1AGRA 2WAXA 3WL5A 1NAIA 2IFTA 5KYUB 1Z7YA 5FB3A 4DLBA 5K03A 4I19A 4L85A 3S70A 5B1EA 4QDXA 5JBIA 2XR1A 3M4XA 3A8TA 1F48A 2D2FA 3FSGA 5EFOA 3X43A 4BQEA 5JPCA 3J81k 4S1PA 1PNOA 1ISPA 5A9SA 3GV0A 1NYTA 2EOAA 1T0UA 1SJ9A 1OZ0A 2O2IA 3FMFA 4UUQA 1P75A 4KE7A 3PGXA 3HB5X 3U13A 4UQLA 5I7RA 3C3EA 3RV4A 2BEUA 1S2IA 4PPNA 4KH1A 4D82A 3GBPA 2XKKA 1DBQA 3KELA 1YKGA 4KQ6A 3TQHA 5B55A 4RFLA 5IEJA 3MTQA 4UBIA 5BURA 1U1FA 2HB6A 3FYSA 4HDRB 4H16A 2HV9A 1MVNA 4H18A 1PQPA 5A0FA 5ED0A 3QX3A 1ZSVA 1U0FA 4EPYA 1Q3HA 1L5GB 4BYMA 2WKPA 3C1UA 2RCYA 2Z5LA 3HVUA 4IJQA 2AZMA 3R0QA 4V03A 3IQHX 5HEKA 1YV9A 3VAAA 5ICEA 4RFVA 3I9V1 1SC9A 3FPCA 1CYDA 4E14A 5LSAA 4BAUA 2H0QA 3VR3A 1P77A 2L0XA 3EPKA 2WZCA 1RW4A 3G2MA 2QTBA 2FRDC 1QG4A 1AY0A 3GBVA 1UOEA 2XNDD 3L82B 3R3SA 4GX2A 4HB3A 4DF3A 5AVUA 1M0EA 1ZH4A 4Q7KA 3D7KA 4HOYA 2QNBA 2HX1A 4DA8A 4R01A 5L7WA 3K96A 4G0WA 1HQYE 1BXGA 1WVIA 1YHYA 1U98A 2FSGA 3AB8A 1GHTA 2IYLD 1L6IA 3P26A 4M9QA 5AHXA 3OE5A 3AKZA 2IQIA 4MK4A 4BGDA 1M5RA 3H5TA 4QEZA 2DFPA 1N7JA 4PYKA 2SHKA 4GRAA 1GTJ1 3HYRA 1E98A 1L3IA 1SVWA 1YCDA 4RTPA 4H6PA 1HSZA 5AK0A 4RLFA 2PS1A 3HSYA 4JYAB 1LBTA 3L0BA 4G65A 3N59A 3QBDA 3AF0A 4U6QA 1RNLA 1DRJA 1H9CA 2MSEB 1XLTC 3R3UA 2IA5A 3NHKA 2GM4A 4JHLA 2YWJA 5BOSB 4ZPXA 2HK9A 5KYKA 2NNWB 2GK4A 5F5XA 3A58B 4G0UA 2O7NA 4UTOA 4LC1A 5CA1A 4OKSA 1B23P 1PJ3A 3U4QA 4H2DA 1QRTA 2JGLA 5AVSA 1B93A 1ZNYA 3H11B 2FQQA 2VF4X 1D2MA 3GFOA 4YNBA 2NUTA 5BYKA 1EFAA 1RRKA 2PJUA 3AHCA 3N0XA 1SAYA 3NRBA 4Q4HB 4CUKA 2O3TA 5BN1A 3SVTA 1F0YA 3A7EA 1SIWA 3B52X 3ZDFA 4X95A 1E79A 4DARA 2FLKA 1V7QA 3K30A 4O4LF 4B6FA 4DM7A 2B4QA 2BGGA 1TE2A 4RM3A 2FOIA 2HPVA 1YRWA 4TWZA 5K09A 1JMVA 3EWIA 4X97A 3ZR4B 5MN5A 1ZQ9A 2X3UA 3A6LA 4QPCA 1I14A 3ZQUA 3MHPA 1T1SA 2WQZA 1KDYA 1NBEA 3GA5A 4B82A 2VSXA 1N34B 4G5QA 1CEQA 1DC7A 3DUFB 3NT5A 4TROA 4BNTA 3SXUA 2IS1A 2L69A 1FLNA 5LDHA 3W6NA 1Y81A 2MIIA 1JL3A 5CT8A 1JDVA 5ADHA 1G21B 4JYMA 2KX7A 3OIVA 1ESNA 4RSGA 1GTRA 4G85A 3F5FA 1KRHA 5BW5A 1YNOA 1LQTA 2BFFA 3ETJA 4B4DA 2EG9A 1USGA 4DR2B 4URXR 4KUHA 3HYNA 4CKCA 4QJ5A 4U7TB 5H1YA 4QOIA 2KQUA 4CM9D 4EGQA 5KQRA 3FKQA 1YC2A 1V5EA 2RD2A 2WFZA 3O7WA 2IPLA 3FDIA 1Y4ZA 3MJ4A 4D3YA 7ABPA 4X6XA 3TAUA 8LDHA 3GLSA 3W3AH 1GU0A 3GUUA 4MTCA 1QQ6A 1TD1A 4FOOA 3N7UA 4OK6A 3U4QB 1ZW6A 4PLPA 1GFIA 1ECGA 2AQIA 5KYNA 2SKEA 1ZC4A 3UXEA 2RJ3A 3DXZA 5KQSA 1FF9A 4FB5A 3S2EA 4DV0B 5B57C 3GQVA 1I7SB 3AKCA 1WOYA 4ESVA 4LHWA 3SC6A 3LY8A 3UUGA 4IIJA 3ZDEA 2AJCA 4X61A 1COWA 1Q1GA 2NZUG 2HADA 2HYDA 4V24A 3WNDA 4ILKA 4D3ZA 1QP7A 2ASEA 2JA1A 4NQRA 4Q48A 1DX9A 4HF7A 4PG5A 4BJHB 2ZXUA 4JVOA 1NOKA 2X9NA 4BEJA 2WU4A 1CQZA 3BHIA 4YJGB 4I50B 4TTQA 1QUFA 5BVHA 3HZHA 4IIJB 3K2QA 1RVV1 3ZCQA 1ZN9A 1KZGB 2YVAA 1SOWA 3LWBA 4MEAA 1ESDA 3IVCA 1S89A 1QCDA 5U1PA 3W77A 5LWQA 2A9VA 1KJ8A 2ZXFA 5FOVA 3WHLA 5C7LO 2P6NA 3VI3B 5FTKA 2KS6A 2LW7A 2WLTA 4G36A 4RWZA 4F2HA 4YFVA 2I80A 2X13A 1HLDA 1SCKA 1Y80A 2DJ5A 2Q45A 2QV0A 1TKCA 2ZUDA 3A3YA 4TLLB 5SYAA 4W5JA 4NMXB 4XQ0A 1NQ5A 4ND5A 4C6TA 3CTPA 2BGLA 3HA5A 5I9SA 4CL2A 1U1IA 4G25A 1Z0IA 5DXFA 2PZKA 4MB6A 4GNKA 3SS8A 3ZLVA 2H7CA 4C4SA 3HC7A 4G1VA 3KOOA 4N5NA 1TVMA 1NJ8A 1ZOOA 5JAQA 3KB8A 4UHDA 4NFSA 1MEEA 2E4UA 2F8MA 4I55A 4WNCA 3K53A 1JZSA 1JBEA 2YV1A 1Z4JA 3EFBA 3WQSB 4ZD6A 1OE0A 2O1SA 4Y1GA 4CM6A 4X54A 2SBTA 4ZCRA 1Z39A 3NB0A 3NH9A 1FFBA 1HY3A 2Z4RA 5AI0A 3R7WB 2YR0A 5BWNA 2NVWA 4JOQA 1R8XA 4ECAA 4F2DA 5JWRA 1PV4A 1Y9ZA 5ESRA 1RT9A 1RQLA 3KDPA 1P5ZB 3KX2A 3MJSA 5BV2P 1Y6FA 1JSLA 4QGGA 2AVNA 3UJ6A 1ZD9A 5C53B 2G67A 3E18A 2PGJA 2F1JA 1H8HA 2FK8A 3KE9A 3KL2A 4KGDA 4MRSA 3RU2A 1G60A 1UPAA 2I54A 4JLUA 1A2BA 4MQEB 3SZUA 1ONNA 5ARBA 3M6XA 4RJIA 4Z49A 2KLBA 2FEKA 3QFHA 3LP5A 3D02A 2WMOB 3TI9A 4JODA 3JPYA 4AMYA 2ZRHA 4MHTA 1IMOA 3AERA 3LLUA 1BIFA 4LJ5A 4EY7A 5DP1A 3W5SA 4C2UA 4RKYA 1YB2A 1D2EA 4IFIA 1N5RA 3WFIA 2OEPA 3NOQA 3FE2A 4BKUA 4KK3A 3B6IA 4O0MA 2A59A 4C7KA 2ODNA 3CLUD 1KNQA 3RLFA 1HL7A 3WL4A 1Z5NA 3ANXA 3RRXA 3PWZA 1Q16A 2XUDA 4JY7A 1XFAA 4B7ZA 1ZY2A 3A25A 4TTPA 2XADA 3OBIA 4YUAA 1Y9EA 2DUWA 1IY8A 3LYLA 5JV5A 4N7JA 3V8MA 1I32A 3GLGE 2ZULA 4K5QA 4QYWA 3N87A 3SQWA 2Y1KA 1T1EA 4MPJA 3H1GA 1AV7A 1UXJA 3DZHA 2CCGA 3AIOA 1VMDA 3FUTA 1UEIA 5EZYF 4ASUA 4HY3A 2PZJA 5JANA 3LBNA 4O4IA 1PV2A 1O4VA 2C4TA 2JAOA 4TMKA 2VJAA 5DDIP 5FTLA 2ZYIA 2VHCA 3AFHA 1GVHA 2JAQA 1F8FA 3G0OA 1WUYA 4A8HA 4IVRA 5I7UA 3TR0A 4ACAA 3C70A 4S1NA 1GNRA 2O0JA 4RKEA 1CUAA 1ZGCA 2P3LA 1MCZA 1P4GA 2TYSB 2YDYA 5J1SB 4OGKA 5IBCA 5EL0A 4EP1A 4CM5A 1JKFA 2V7PA 3DC2A 4XPIA 4URZR 2FX2A 1P0CA 3NRCA 1U3GA 5IVIA 1BTOA 3M3DA 1BCRA 3HL4A 4E5SA 4AKIA 2WWFA 3B1ZA 4LZJA 3R44A 5C5DA 1CUZA 2NZWA 3PI6A 4JVSB 4NDZA 4HR7A 4RTLA 2JJQA 1AHHA 2WW8A 1B41A 3HP4A 3NOXA 5B2FA 1NQUA 3LHDA 4TQ9A 2PMKA 1E0JA 2DQ4A 3GLHE 4GS5A 5G53C 3N7TA 3PQ8A 3EAGA 1H3FA 4OHXA 4M83A 2HNKA 4RUKA 3ZU3A 1UM9A 1VE9A 5SICE 2X5KO 3T1OA 3UFBA 3ZU5A 5J4LA 3IE2A 4FR2A 5K4AA 2RJNA 1CT9A 4OP3A 2AKYA 2CLFB 5REQB 3RVNA 3A9TA 1R15A 3EXAA 1ZESA 5HOQA 2AF3C 1JX6A 4HFRA 1PTJA 1XKLA 1NI4A 3KTDA 2EZ8A 4KQFA 1IHYA 1UK7A 5F77A 3DYIA 3FYUA 3FPBA 3G5UA 1C8LA 1CUJA 4EH1A 4LGMA 3P4YA 3AEXA 4JL5A 1R5OA 2QM8A 4WV3A 5DSXA 3Q40A 3V5NA 2W48A 3O3OB 2BGKA 4C9BA 1TCUA 3I6QA 1GPNA 2OP1A 1B74A 3BBPA 5I9MA 1X7ZB 2V7QD 1CJUC 1MABB 4LXIA 2DKNA 3SNHA 1RZVA 5IM4A 4YJ3A 4K9KA 5DBHX 1LPMA 1RP7A 2ZQYA 3LWDA 3P9YA 3JWGA 1M6VB 4MRRA 1LBSA 4MRAA 4DDMA 4UTVA 5CB4A 3OQOA 2AMLA 1R0RE 2WF6A 4N1AA 4M1TA 5AI5A 1AB5A 1HI9A 4MHOA 3O47A 5FWAA 4DGQA 1VPLA 3NTRA 4F4IA 2FN3A 3RS0A 1KC3A 2AH5A 3OAAA 1YRYE 3COYA 3EULA 3CZMA 1QS0B 1AKVA 3ELUA 4MVJE 3A1NA 2DWQA 1SKQA 1M2FA 1ZA2A 5D6NA 3T12A 3HU2A 2GESA 4B8ZA 4H4EA 1XRSB 2J3KA 5L7YA 1I2MA 2FUG1 3ET5A 1E5QA 3EOBI 1MO5A 1T6ZA 4HXGA 4MEBA 5F7ZA 5TQ2B 1ZYUA 4B43A 3GAMA 3MGGA 4L3WA 4RX1A 3WKAA 3MMXA 2CV2A 1EK2A 1YJCA 3LKZA 3S0JA 4BNUA 1WZEA 3HA3A 4J4HA 1NOIA 3R6TA 3TKAA 5LLDA 1NUSA 5G1PA 1RYDA 2YX1A 1AO3A 1QS0A 2XEXA 3H2KA 3SZ3A 2JK1A 3ZJ4A 2FEXA 2MWMA 3FYCA 4LYEA 4JJ4A 3OJLA 5IN5A 1JIQA 3CUEF 3FOBA 3AVXA 1QNLA 3IPLA 3THYA 3G1TA 4H31A 4OQMA 1DWUA 3W6UA 3CUSA 2OBYA 1AVTA 1PK7A 3HL0A 2EBWA 4WSOA 3SIPA 3LUGA 1P2FA 3JR3A 1R0SA 1D2CA 2A88A 2BDUA 2L18A 3C6KA 3PHJA 4INJA 1Y37A 1Q7GA 2W2KB 1KPGA 1RKVA 3A6ZA 1JZQA 3VU3A 2FWIA 1FZQA 4EARA 4LRTB 4BUJA 4DS3A 1E7QA 3HG7A 3R40A 2GKSA 3HMQA 4JT9A 3GRCA 5FH9A 5LQDA 2PNJA 4WTOA 3FCSB 3WAGA 1ZUWA 4FGWA 3WLAA 3PPIA 4PR3A 1W88B 1ZHFA 1YH3A 3KDAA 1AC5A 3OM0A 1ZH8A 3E0QA 1JAIA 3ANLA 4IIXA 1QVVA 2J3IA 4LYGA 1G55A 4DCVA 3INYA 3ONDA 3ZIUA 1NBWB 4RD6A 3OBBA 5BSUA 3RKUA 4TM7A 4IOMA 3I92A 3OU6A 1H65A 5K7SA 3WL8A 2HBYA 2VP6A 3LA8A 1F6DA 2OC9A 4QO8A 2FPRA 3PUXA 3AU9A 2PKEA 4OGWA 3PNVA 3N39C 1T9DA 1VPEA 1FJGB 1JE1A 3A2KA 4R2LA 4KLNA 3U7GA 3LQQA 2XCLA 3HDHA 3R7AA 2JIZD 3HR7A 4CDGA 1T8WA 4ALJA 1E1MA 4ES6A 4NCXA 4AAYA 2YFQA 1NRIA 2Y99A 3HFGA 2E85A 2WJJA 3KFVA 4U7JA 3UB2A 4R68A 4EF5A 3C41J 3NR2A 4EHBA 1R0LA 5I48A 5KIAA 1HFEL 3ZVMA 1DPFA 2PLNA 4AC9A 4BY9E 1TU3A 1JXQA 4RZ2A 4B6JA 1OJ7A 1JAYA 3SBXA 1P33A 2WB4A 3IKTA 1DXYA 3EVBA 3E22B 2H1IA 4CMIA 4DHWA 2JGMA 4RDHA 2WF7A 1IRXA 1A71A 1R8SA 5B4VA 4BMVA 1G64A 1N2HA 4EJFA 1Y3FE 1Z45A 5AM0A 1X8JA 3LT2A 5I51A 2YC4C 1RI2A 3MF4A 2Y8EA 1AQIA 4D81A 4EMUA 4NMMA 5TF0A 3AI7A 5CDFE 3TG2A 2PSFA 3FR8A 1M34E 3IP1A 3TZ6A 2LCFA 2XF8A 3HDJA 4IHAA 5K0FA 3QOFA 4R2JA 1EHIA 3NANA 4WERA 1FW6A 1I7QB 2R6AA 1Y82A 5SY6A 2CHQA 3GRPA 1XMOB 4G2NA 3CG0A 2E18A 2HCTA 2ZS7A 3BRCA 1JYSA 3KLMX 4TN1A 4FQ8A 3ZV5A 1LUAA 4GMGA 3GFPA 4OMUA 3GA0A 1NXTA 2IPMA 5H3HA 3W06A 3I39X 3KB2A 1HC7A 2IS2A 1E3DA 5DHQA 5E3IA 4B5KA 3ELWA 4WGFA 1TEXA 1XX6A 2VRCD 5CDUA 1PR9A 1F2TB 2QMUA 3PEYA 4PO8A 3G9UA 4FZVA 4J2HA 3QFTA 4Q3CA 1YJ8A 1T1RA 5EMMA 4X1OA 1ZR2A 1JW9B 2C7BA 4LDPA 3UW3A 4B8YA 3LG2A 2Q6IA 3O8NA 2V6JA 2FPGA 1A27A 1X7DA 2EZUA 2R8EA 4RULA 3EQ2A 3UWMA 5KOYA 1OWMA 1JDBC 5TMBA 5IFKA 1CDOA 2VN8A 5GQSA 1SELA 5HE8A 3Q85A 3RANA 3DDCA 4WA7A 1Q2UA 4LOJA 2O50A 2BMJA 3TMKA 2C04A 4GM0A 2FN4A 1WHSB 3QFCA 4ND6A 1ES9A 2R79A 3QSGA 4CFYA 1Z15A 1SM4A 4YJGA 1YVPA 1T8SA 1ZU5A 1T3ZA 4AJLA 1NT4A 1JQAA 4IQFA 4E1VA 4H1WA 4AVYA 4U3JA 1UBCA 4ZQBA 2R6HA 4DMKA 1SFRA 3DEFA 3OEED 3I04M 4GD3Q 5FTWA 2CMKA 6LDHA 1C3OB 1YI0A 5BN4B 4DDUA 2OSBA 4FYVA 3V1YA 3O75A 3I5UA 3AEUB 4FT2A 4OHVA 5LQNA 2IZ7A 1KBQA 4RETA 5HTOA 1ZK0A 2P4QA 2UVQA 2WPDD 3ZZ0A 5HKKD 3DMPA 2GGSA 2CNDA 3P2OA 3PGA1 4AKTA 3DBRB 2IOFK 3QBEA 4JI0B 1ZPDA 4H7FA 4C0LA 2JIRA 3PA8A 3F98A 5DK4A 1EP3B 1FVXA 1CP2A 3BMQB 1XWFA 3GGJA 5C8YB 3ZWAA 2CVZA 1WD5A 3X1MA 3NBZC 1F7UA 1QIHA 2ZJBA 2BY4A 2ZIGA 2C0QA 3CPEA 3LGSA 4A0FA 1L6RA 4FHDA 2O05A 3ZBPA 4XAQA 4CF5A 2HHJA 4IM7A 1W49A 3GWZA 1OPRA 4W82A 1X1CA 1O5IA 1HYQA 3O90A 1G8YA 2I2XB 4RVDA 3BK2A 4UNNA 4KIWA 2QDXA 4NDAA 5EHIA 3DAYA 2IY9A 4A23A 1DEHA 3GJQA 1HOXA 4N0EA 3K0SA 4WBXC 2HXYA 2NVOA 2Q5JA 4M1WA 1MXHA 4FLMA 4HX5A 3B36A 1XUOA 4BVLA 3BXEA 1NULA 3VSDA 5IYZB 1YI8A 3HBAA 2ZUTA 3KQHA 1V6CA 4UMFA 3WLPA 5K0SA 3W5HA 3BUSA 3I9JA 1YAHA 5JRDS 2Y66A 1QG0A 3V33A 1DPGA 4J94A 2XZTA 3IGFA 3NBQA 4QU5A 3IVAA 3I3SR 1ZO8A 5EE9A 1RPZA 2ZFUA 3C5VA 4BU0A 1NR1A 1DC6A 1JIUA 5H59A 3M5PA 4IOJA 1ND5A 2VH5R 2GHIA 4QVGA 1OT5A 4Q02A 3OJFA 3T5TA 1UZMA 3CLSD 2H4FA 2O9JA 1ISHA 3HBMA 2JLZA 2ZJ6A 1YXMA 1O8BA 2Q6KA 1J7JA 4JI4B 4O4LB 1YR3A 3VSEA 3EXG2 1SG0A 5HRUA 4F3RA 3IIKA 2MSCB 3AESA 4FZRA 4LC9A 3OTQA 3GFSA 4OXQA 4U02A 2GXUA 3KU4A 4UM5A 4NFYA 2A92A 3VKWA 1WMEA 4GAEA 4K87A 4NFHA 1J6UA 3B2NA 4HQNA 7YASA 3O4FA 5ULLA 4POAA 1WABA 3G2LA 4XYBA 4BC0A 7AT1A 2A58A 2HQ1A 2GR9A 3WK9A 1W36D 1X42A 2O3JA 4JUIA 1FOEB 5H9VA 1VKHA 4RU1A 1SC4A 1KMCA 1QX3A 2ZXEA 1JPNA 5HK8A 2IV2X 4N8DA 5KJFA 4R1OA 4F3KA 4WY5A 3UBMA 1DMRA 5DT2A 3D3JA 4YP1A 1U02A 3N7AA 3D2LA 3GAFA 4ZCPA 5C7YA 1J70A 1U5AA 1UWLA 2ZRNA 4DMHA 1MGOA 1Y0BA 2W2LD 4R51A 5GWXA 1JAHA 4DHEA 4R0VA 2VTBB 1UBHS 3SJBA 3C7DB 5E6SB 4YCMA 3BMOB 4S2EA 1XQWA 1GUYA 3DBIA 4RVHA 3WADA 1WCYA 2FXVA 1Y7IA 4IPTA 4MVJF 4ZO7A 5GJVC 4RVGA 1SG6A 1ZNWA 3QM1A 1Z83A 3WLTA 1XZMA 2R66A 3RRJA 3TVYA 3RAPR 2A84A 1TQDA 3D4IA 3KQQA 4H6VA 2RI0A 5EWMB 3LZ6A 2C83A 3MG9A 2WJWA 4LE2A 4MWDA 4XD2A 2DULA 3U0VA 1GSAA 2LV8A 2PY6A 2QTVA 1YKSA 4CV3A 1P80A 2J4DA 5BW8A 5K05A 1SHTX 2PJRA 3Q8WA 3DXFA 3L7CA 3PICA 2HJGA 3W7AA 3RSCA 1G6KA 1P4SA 1L7OA 2GBLC 4MI1A 4D4IA 2Y1DA 4FMCF 3VU9B 2F9LA 2BGMA 4NR0A 3ROMA 3MQ2A 4AT1A 3NH6A 4LV5B 3DZJA 4EPTA 5INTA 3RYFA 4YRAA 1QLWA 4Q47A 4RTSA 2BFBA 5DBIA 3RQSA 2GBCA 3T0GA 4E2YA 5BXYA 3O8OB 3AGPA 4DJJA 4E32A 4BFXA 3ZDAA 1MTZA 5DBOA 2WYIA 4LNHA 4IJ5A 1YB7A 3JATA 3PQ5A 2CDRA 2ZWPA 3OKPA 1L7PA 1V16B 3BJEA 2BFMA 4OJTA 4D3SA 1YMVA 5KHOC 1FXUA 2WYWA 3ZW9A 4EHKA 3KJZA 4C30A 5JIBA 3T34A 5LQJA 3KOZA 3SD7A 1TXGA 5IVDA 1OFUX 2HXSA 2FUNB 2NUTB 3A9CA 3PDWA 1Z28A 1SBNE 2AOVA 4RK6A 1JDZA 5FLKA 1LNZA 2YVLA 1J23A 1XWIA 4V0ME 3T7IA 2KI5A 3R76A 3CIFA 2ZJ2A 2Q0HA 2Q0QA 3TRDA 4OJKA 4WFQA 1UQTA 1LW6E 4DQ0A 2C4VA 1I3LA 1UEJA 1PZXA 2WINI 1YOVA 3DKVA 3D8SA 3IHWA 5FADA 4BN5A 3PCTA 1JMKC 2AOWA 2EP7A 3LCJA 4MMYB 5AXAA 1QVAA 1EESA 2BI8A 3S2ZA 2OG2A 4GUDA 3T95A 5HFAA 4AMGA 4EABA 1CQWA 1LDGA 5TX7A 4BE4A 1V8DA 2HF2A 5I8ZA 3DMFA 3NTLA 3PKJA 4IXDA 3IQZA 1AHNA 3LU1A 4LJ7A 4ND2A 4DILA 1NJ6A 4JJGA 4RAOA 4TWRA 1R8QA 2QQEA 3DPSA 5TPWA 1MAAA 3U39A 3W8DA 1YCHA 4TYWA 2Z9DA 4MUNA 3LF1A 3L8YA 3QY9A 5C3UA 4OIFA 1G0OA 5CURA 4QGHA 2ETXA 4RCZA 5GINE 2V0CA 4XSGA 4QBKA 1QVRA 5AOAA 3O4GA 3WYCA 1P8AA 2OFXA 1D6MA 1FC0A 1M8KA 1XO1A 1QAQA 3CW8X 5FEUA 4EATA 4ER0A 5LP6A 1IZ0A 1OUMA 1DT3A 5DEIA 1JLMA 4QDKA 3JRNA 5JECA 1BRMA 4C7XA 3MMSA 3HKCA 3QVSA 4X24A 4Y8VA 4DIKA 3O2NA 1MOZA 1GR0A 3KVYA 4ZP1A 1G21E 3RQIA 3NM4A 5DN6A 1K63A 2HMAA 4ZGWA 1H9BA 2MMCA 5B7GA 4Z4EA 2JJMA 2QE7A 1RMYA 3I1FA 3OCZA 1CJCA 3LOUA 4EHLA 2IYFA 5LA6B 4LXUA 4PQRA 1CR2A 2VF5X 4X85A 1CR0A 3W0LB 5HYVA 1V6AA 3HKEB 1XPUA 1Y3AA 3A4NA 5A4AA 3MTGA 4AS3A 3I9NA 5ICFA 2QJRA 1Y9AA 2WTEA 2XCIA 1XMXA 3K32A 4RHEA 1MPXA 2YHIB 3IP8A 5IM4F 2VPWA 4L2IB 4EF4A 1ADBA 2XNDA 3OA2A 3B5IA 4OJNA 4L4XA 1Z25A 3RVMA 1EA5A 4R8LA 1LPBB 4DANA 1EBFA 1JAZA 2VDPB 4WW0A 5EQDA 1N3LA 2ZB7A 3ILSA 3PGKA 4NWIA 2Z5FA 1OZGA 1M5TA 1PGPA 2EZ4A 4IH9A 2R2GA 3WG9A 3ESRA 4EB0A 2QTVB 4FX2A 4DBZA 2FTKE 5KSZA 2YUIA 2CVFA 2WOOA 1J20A 3PL5A 2VO1A 4WD3A 2NO1A 1E62A 2P8JA 2PR2A 1Z33A 2QSZA 2VAPA 2XSZD 3E1SA 3FVWA 3QVGA 4U7PB 5KX5B 1S2MA 3AF6A 3NWEA 2F1RA 1UINA 5GY7A 3CO0S 3WGYA 2H54A 2OYCA 4AJ1A 3ZV6A 5HF5A 3PFFA 3UHAA 3ZCPA 2HNBA 2A0FA 3MS2A 3NZEA 3NDIA 5CIYA 1LCIA 1O0SA 3E81A 2ZRKA 2YY7A 2UZIR 1I9CA 4GGMX 2VCHA 4X0EA 3ZOZA 1O97C 1T6YA 2C29D 2VDUE 3GHHA 4PLYA 4JMLA 5CHEA 1TQ2A 2IEAA 4NSNA 1W5EA 2F6RA 1VMIA 1LFAA 2AW3A 5LP6C 1ODLA 3TAXA 5BSGA 4WJKB 1Z26A 2I65A 2BW0A 2ERCA 1WULS 1NFQA 3G0BA 1EFCA 1PBTA 1RWPA 1UXOA 1VJGA 1NLYA 1F9EA 2XMSA 3E3MA 1TUGA 3S27A 4X1KB 1JR3D 1AA9A 2GPJA 2VAWA 4IRUB 2UAGA 4MV0A 1S8NA 1ZDMA 5CT6A 1QIDA 2J08A 1A9XB 1G4HA 1GQSA 1P1HA 4I8IA 4IVNA 1V7CA 3FY4A 3JWIA 2BTOA 3RS4A 2AYZA 1DAFA 1L5ZA 3GPCA 1CIPA 4L7VA 2C54A 2Z5VA 5FOXA 5BYBA 2PO7A 2NZXA 3A1WA 4Q82A 1KHTA 1U80A 2J3DA 4FBMA 3K72B 3HDTA 1OY1A 2CXSA 3FPFA 4UTZA 4FXOA 1VM6A 2M6LA 1JUDA 2CMGA 1SVLA 3FLBA 4MUGA 3ZE1B 2JEZA 2VK8A 2I62A 4G0PA 4R0MA 1VHTA 3KJFA 3GUYA 4UVGA 5B1DA 3ZWDA 1AO0A 2ZI9A 4A2WA 1G6Q1 3QTBA 1WXQA 2YWEA 3LUKA 5LOVF 1IQ0A 3TLBA 1NVBA 3MYYA 2QI9F 4GPTA 5I45A 2DUMA 2OBNA 4NNPA 1OI3A 2JFPA 1U6KA 2VUHB 4YJFB 4P4UA 2GERA 2G0AA 2R1VB 2VPPA 4ZALA 1S2LA 3WWEA 1B8PA 3IAAA 1FTGA 2HGZA 4NU6A 4EPRA 4DSTA 3KQMA 4TV8A 1K3TA 3OQNA 1C1XA 4N82A 5EZQA 4B6RA 1I13A 4XXHA 3QE9Y 1EVLA 3R8FA 1XU7A 3NHYA 5EJ2A 1WDWB 1JSCA 4W8OA 4NBKA 2EJCA 5FOWA 2EFEB 4ALLA 5L3QA 1Q7BA 5HM8A 2NSYA 5SZJA 2WJ4A 1JR6A 2ZRBA 1E9BA 3TUJC 5ALDA 1FDWA 1RAEA 3QYFA 4M6WB 1N1EA 1FNMA 3KV3O 3SQOA 3BS4A 1HR0B 2YXLA 3F9IA 5EP1A 2AJLI 4DWOA 4DYHA 1W85A 3E1GA 4NX2A 1TM4E 2B1IA 2EL9A 2QMHA 3MTJA 3VRHA 4E4TA 1XN1A 2DH6A 5IK2D 2PWAA 1ZGZA 1F12A 2HHAA 1C7JA 2V7EA 2O2XA 2FR8C 1FBTA 4EKEA 5ILOA 2M6SA 1G8KA 3COWA 1FLAA 1YGYA 2J67A 4XSHA 2X8LA 5E7QA 1L0BA 2FFJA 3UAYA 3U37A 5KYGA 3DOHA 3IJRA 2CUTA 4X3CA 4CCWA 1OC4A 4OD0A 2B4KA 3EHDA 4U1RA 3RT1A 5JAMA 5JYBA 4UCXA 3ZE9A 3U3RA 3W6PA 3JVIA 1QDUA 4C2TA 1TA4A 1PT8A 3SQNA 4RCYA 2VWHA