4XUCA

Synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd18 (1-(biphenyl-3-yl)-3-hydroxypyridin-4(1h)-one)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
b'NLLAGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Synthesis and Evaluation of Heterocyclic Catechol Mimics as Inhibitors of Catechol-O-methyltransferase (COMT).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 218
sequence length 218
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2015-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xucA00
3R0QA 5E8JA 1L1EA 3PTAA 2PX8A 3VC1A 3Q87B 4KDCA 5FHQA 3DXXA 4RTRA 1QAQA 3GDHA 1T43A 2JH8A 1WG8A 2JH9A 3KPWA 2ERCA 1KHHA 2PX5A 2PXAA 3UA4A 3KQSA 5LQJA 4PYQA 3KR9A 4Y30A 2UZ4A 1QAMA 5EMMA 5FQOA 3ELUA 4GC9A 4RVFA 1L9KA 4FP9A 3B7PA 3CC8A 4X63A 4X61A 3REOA 5K03A 5EIFA 3PFHA 2UYOA 3TOSA 4M36A 1JG4A 2CWWA 3LCVB 5LQKA 2YVLA 5EEGA 4KIFA 4R8SA 2WA1A 1KXZA 1PRYA 4DZRA 1PJZA 4Y2HA 4BP1A 1I1NA 2C7OA 3GU3A 3HVKA 1BKYA 1XJ5A 4GOND 5LQNA 2OO3A 3OU2A 5E8RA 1VP9A 4DKJA 5T64A 5EVJA 4DMGA 3LCUA 5CVEA 4G56A 2ZZMA 4E2YA 1X19A 2ZIGA 3OE4A 5F2OA 5EMKA 2VP3A 3LCCA 3TQSA 2C7QA 5DXJA 3EPPA 5FHRA 4AX8A 1QAOA 3KHKA 1M0EA 1KPGA 4FZVA 5EG5A 1JG2A 3G7UA 3GJYA 3L8DA 3KPJA 4F85A 4AZWA 2DULA 1N2XA 2PSSA 4ZTBA 2FYTA 3MTEA 4PWYA 5E1MA 1N7JA 2ZSUA 5E2AA 2E5WA 2N47A 1G38A 1WZNA 5HOQA 3M70A 2FK8A 1RI1A 5CVUA 4CTKA 3G88A 2JJQA 4XUCA 4DCMA 1BOOA 3G2PA 4H0NA 4YV2A 4OA8A 4P7KA 3EGVA 5DLYA 1P1BA 4R6WA 4C04A 5LR6A 3C3YA 4MWZA 5E2BA 1F38A 1G8AA 5FA8A 3HM2A 2EX4A 3PT9A 5K01A 5C1IA 1L3CA 5KQSA 1EJ6A 1XTPA 4DA4A 3P9CA 2PGXA 3PX3A 2PT9A 3HCAA 4DQ0A 5CD1A 2AOTA 4HSGA 4ER7A 4KIGA 2WA2A 1G6Q1 3HVIA 2H1RA 4QPNA 5K0GA 4RTQA 2UYCA 5MHTA 4PIPA 1Z3CA 4P7GA 2I62A 5CM2Z 4KDRA 3M6WA 4PIMA 5FADA 2ZLBA 3FPJA 5C0OE 5HILA 1XDZA 2IH2A 1UIRA 3E23A 4RVGA 2OB1A 5T67A 3K0BA 5E1OA 2ZBPA 4GOLD 3B5IA 2IH5A 1SQFA 1XDSA 3NTVA 3EVCA 3LECA 3OU7A 3FUUA 4ER6A 5KYGA 1EIZA 3G2QA 3HVJA 3GRRA 3LKZA 1UFKA 4MHTA 3EVAA 2C7PA 1BHJA 3BWMA 4MQ4A 2GH1A 2B3TA 3T7RA 1XCLA 4L7VA 4BP3A 2F8LA 1SVUA 3FUTA 4NECA 4PYIA 3GRYA 5D1NA 2I6GA 5KS2A 4U7TB 1WXXA 2IDKA 4CWAA 5FA5A 2P7HA 2FHPA 5K0CA 5CVDA 3SX0A 1TW3A 4IWNA 4WVLA 1YZ3A 4HC4A 3A4TA 4PINA 3MAGA 4BLVA 3ER8A 4FT2A 3V97A 1G60A 3OFKA 3P71T 1ORIA 3QOWA 2ESRA 2BM9A 5CIYA 2Q41A 2Z6AA 3IHTA 3M33A 3M6UA 5DT2A 3P9IA 3ELWA 1VE3A 2B78A 1N7IA 3MQ2A 3UJDA 2XBMA 2JHCA 3K6RA 1VPTA 1JQ3A 3KR2A 3BT7A 5FQNA 3GO4A 2CL5A 3EMDA 5FWDA 1NW3A 5BW5A 3KQWA 3NWEA 4IKPA 1JSZA 4ISCA 1MJFA 5E9JA 2ZIFA 3D2LA 3TFWA 5D1HA 1XCJA 1XDUA 5DRYA 3OPNA 3TMAA 1BC5A 2P3LA 4LWPA 4RVDA 3FYDA 3C6MA 2NP7A 3SM3A 1R6AA 3CGGA 3H2BA 8MHTA 2IDJA 3EVDA 3GXOA 2PLWA 3F4KA 2ZBQA 3SVZA 5EQJB 4ER0A 3AJDA 3LX6A 2GS9A 3CVOA 3KU1A 3RIEA 1D2GA 4QTUB 4RVHA 4FGZA 4A6EA 3DTNA 3VC2A 2AOUB 7MHTA 5GOZA 1X1DA 2ADMA 3RODA 3SSMA 4E2ZA 5GM1A 4RX1A 5E1BA 3UJ7A 1G55A 3HA5A 5GINE 4E2XA 2AOUA 4LECA 2AN3A 3E05A 3UFBA 4JXJA 3TLJA 2FRXA 3HCFA 5K0NA 3ER9A 3MHTA 2OZVA 2ZULA 5DM2A 1TPYA 3KPVA 3UWPA 2O06A 2OB2A 5DX8A 3KR0A 4RV9A 2AS0A 4OBWA 5K8VA 3I64A 4YUZA 1JR4A 4C07A 1RI3A 4ATNA 1Y8CA 1YFLA 2ZVJA 3FPEA 4POOA 4YUYA 4YV1A 5CUQA 3BZBA 3ME5A 2H11A 3DMGA 1G8SA 3P9NA 2O0LA 3PS9A 4QVGA 4R8RA 5EPEA 1QZZA 3RW9A 3IYLW 3UJBA 2PT6A 5FUBA 3O4FA 3HP7A 4X1OA 3THSA 2P8JA 1ZHFA 2P3OA 3FPFA 2AVNA 1VL5A 5C9ZA 1P91A 2AR0A 3CKKA 3P9KA 4IV0A 1KPIA 4QQKA 3SR4A 1AQJA 4WXHA 3P8ZA 10MHA 5B1SA 5GIPE 5HIMA 2O57A 3IEIA 3NDIA 4OQEA 4DM3A 3TKAA 2P1DA 2PV0A 3OE5A 4OBXA 3CJRA 2PWYA 4QTTB 3EMBA 4GC5A 5T6BA 2VS1A 2VDVE 4LWOA 3BGVA 5LQAA 3DR5A 3V8VA 3EVGA 3DLCA 4PYJA 5HZMA 3JWGA 3FTFA 4PCLA 3BKWA 4PYMA 5DX1A 1R8YA 1TW2A 3AXTA 1EQAA 3R3HA 5HEKA 1YF3A 3DULA 3FPHA 1INLA 3GIWA 4P7FA 3TM5A 3UJ9A 3BUSA 4M38A 3A26A 4HG2A 1SUSA 3KQMA 1O9HA 3MTIA 3HNRA 3QV2A 3HEMA 2A14A 1XXLA 5EGSA 4AZSA 4YMGA 3DXZA 4RTLA 1JSXA 1R8XA 1RI2A 3M4XA 3OU6A 3T7SA 5GWXA 5K0BA 2IIPA 4GF5A 5H02A 4FT4A 3CBGA 2CMGA 3LGAA 2P41A 5DSTA 1L3BA 4YUXA 5EKUA 5U4XA 3VSEA 3M6XA 5GP1A 5LQRA 1O54A 3G8AA 5E1DA 4YUWA 4E31A 2NXNA 1I9GA 4YMHA 5F2NA 2ONZA 3HVHA 4UOEA 4LG1A 1Q0SA 2IPXA 3UJ6A 4GUAA 2AOWA 2O07A 3OZRA 1MHTA 4KVZA 5EKXA 3WSTA 5EIWA 4EK9A 3G8BA 3KQOA 4PYLA 2I9KA 5EC8A 4HRAA 1JTEA 2QYOA 4RTJA 3BGIA 1RJEA 3DLIA 4C05A 2ZZNA 4PYKA 2GLUA 1D2HA 2BH2A 1WS6A 2BR4A 2NXEA 1AQIA 2YXDA 3LDFA 5ICCA 5M5BA 3LKDA 3SGLA 3PX2A 2DPMA 2QE6A 2BM8A 4MIKA 4QDJA 3LL7A 4R6XA 2OKCA 2YX1A 3MGGA 5EZSA 4RWZA 1RI4A 2EFJA 4GEKA 3AY0A 4C06A 4RTOA 3NJRA 2Y1XA 3OZSA 3G5LA 1I4WA 3MCZA 4HGZA 4C4AA 2PBFA 2ZZKA 2PXCA 3I53A 2IGTA 5CVVA 5DTQA 2VDUE 1DCTA 1R74A 1L3IA 3B3FA 3I5UA 3KQQA 3PLAE 1NT2A 2IP2A 4AZTA 3FZGA 3Q7EA 2YR0A 3EVFA 4F86A 3BWCA 1HMYA 3LSTA 2JHAA 3QOXA 2UYHA 2P7IA 1X1AA 3HCBA 4E33A 2ZTHA 5EZQA 3TM4A 1SQGA 3FRHA 3GCZA 3GRZA 4B17A 3UZUA 4CTJA 4OX9Y 5DSXA 1Q0TA 1KP9A 3DOUA 3DMHA 1FBNA 1AF7A 4M7RA 2H00A 4AUKA 4X60A 5DM0A 2ZCJA 3ERCA 1QYRA 2OBFA 3P2KA 3BGDA 5CCBA 2B25A 2K4MA 3O31A 4U7PB 5KVAA 1P39A 3A7EA 3C0KA 2JG3A 2BR5A 2GB4A 1JQDA 4GOOD 3SMQA 3R6TA 4PGGA 4DF3A 5BW4A 4CKBA 4RSRA 3I58A 4RTNA 2HNKA 3ANXA 3ORHA 4KWCA 2NNWB 4AZVA 1V39A 1ZGAA 2OY0A 2OXTA 3P97A 4QPPA 4F84A 3SSOA 5DXAA 2CKDA 1VIDA 4RYLA 2QY6A 1NE2A 3C3PA 4RTMA 1M6YA 1YB2A 3FUXA 2ZW9A 1YFJA 3R9XB 5ERGB 3G5TA 1RJGA 3KPYA 2AVDA 3BWYA 1QANA 3CJTA 3LBYA 4R05A 2GAFA 2YTZA 4HGYA 4X41A 1ZKDA 3TPZA 5K0FA 4RTPA 5EEHA 2GA9A 2ONYA 3PVCA 5LQUA 2G1PA 3DUWA 2PVCA 2BR3A 3EVBA 3GRVA 3KR1A 5GIOE 2G71A 2HV9A 2HWKA 3PB3A 4MTLA 5FWAA 3SXJA 3IV6A 4FSDA 2PKWA 1OR8A 2YXLA 1P1CA 2OPBA 3UJCA 2Y1WA 1KIAA 4FS8A 5E9WA 2V74B 3S68A 5P8WA 4FSXA 4E30A 2ZIEA 1NBHA 2KW5A 5LSAA 3MB5A 1JG1A 1VLMA 3PFGA 3LBFA 3LDUA 1KYZA 3HCEA 1IY9A 1R18A 3BWBA 4E70A 2WK1A 4OQDA 2BZGA 2VDWA 4C08A 3B89A 2B9EA 4Z2YA 2PXXA 4BY9E 4PCAA 4M37A 3EGEA 5F2KA 2OYRA 1NKVA 2FCAA 4V0RA 2PX2A 2XYVA 3FUWA 2QRVB 2AOXA 3KQVA 3I9FA 3EGIA 3DH0A 4K6MA 3MCTA 2ZWVA 4E2WA 4YV0A 5DWQA 3OCJA 1EG2A 4CKCA 1UWVA 1XVAA 2ORED 2QRVA 3C6KA 3FPGA 3FRIA 4IV8A 2NXJA 1D2CA 4HH4A 3EVZA 5DX0A 2P40A 4KW7A 2NXCA 2G8NA 4ER5A 2JHPA 2GPYA 5FCDA 3T7TA 3U81A 4BLUA 3NDJA 4EMSA 1F3LA 3G2OA 3DMFA 2EJUA 3GRUA 3LPMA 4OA5A 2YQZA 1ZGJA 3BXOA 5E9QA 3THRA 1U2ZA 4EKIA 4HTFB 1NW5A 3KPUA 4GQBA 3UJ8A 5JUWA 4PNEA 1NBIA 1SKMA 1IXKA 3A7DA 3KQYA 3NW9A 5BP7A 1VQ1A 1X1BA 2O05A 3A27A 3GGDA 3KKZA 3NVMB 4HTFA 1O9GA 1WXWA 1YZHA 3TR6A 2C7RA 2IBSA 3HTXA 1VBFA 1NW8A 1YUBA 3CJQA 4KRGA 4PGHA 3FYCA 2IFTA 4CXMA 3EEYA 4PONA 5DM4A 3TKYA 3NMUF 2XYQA 3ELDA 1KYWA 4ER3A 2HMYB 5ICGA 1ZG3A 3KQTA 2PY6A 3UJAA 4EVIA 1NV9A 5KQRA 2NP6A 3AWIA 5BXYA 1ZQ9A 3AXSA 2AOTB 4EKGA 2Z6UA 3FTCA 2YUIA 5K0EA 1FP1D 3JWIA 5DPMA 1EJ0A 3M6VA 4P7JA 2CMHA 2R3SA 2V7EA 2G72A 3BKXA 2B2CA 1KPHA 3ID6C 3X0DA 1ORHA 1WY7A 3O7WA 3OZTA 5K0JA 2PX4A 4XUDA 1FPQA 5K05A 2AOVA 2HTEA 4E32A 3FTDA 1JQEA 2R6ZA 9MHTA 3FUVA 2P3QA 2VZ9A 3EVEA 2FPOA 5CCXA 1SG9A 3B3JA 3SSNA 2IH4A 3CCFA 4YUVA 4RTKA 4QDKA 1NW7A 4XUEA 3HA7A 5ICEA 1M6EX 3GNLA 4EQZA 5EHGA 3ELYA 4XCXA 1NV8A 5HIKA 2ZBRA 2AZTA 2EG5A 2XVMA 3G2MA 3E8SA 4FR0A 1X1CA 1RJFA 2AN5A 3MERA 1NW6A 4C03A 3DXYA 2NYUA 3LDGA 1RI5A 5K09A 5DTRA 2YXEA 3OFJA 3A25A 4GBED 4P58A 5DTMA 3HCCA 2FK7A 4V0QA 1AV6A 4BLWA 2PWPA 3P2IA 5HIJA 1DL5A 1HNNA 2PJDA 3B3GA 5HIIA 3HA3A 1RJDA 5GM2A 3NWBA 5EMLA 5LQCA 1FJXA 2Z6QA 1VP3A 2I7CA 3KQPA 5DRTA 1JTFA 2ZWAA 4O29A 2UYQA 3VYWA 2HR1A 3FTEA 2ZFUA 3P2EA 4A6DA 2EJTA 1DUSA 1KR5A 5DM1A 3NVKI 3JWHA 3LHDA 2XVAA 3HCDA 5IKMA 5EOVA 3G89A 5EHIA 1SUIA 2IBTA 2XYRA 5K0LA 1JG3A 3TRKA 5JR3A 5EMJA 5G02A 2G70A 3R24A 4QVKA 1FP2A 1R00A 3UA3A 2P35A 4CKEA 3EEOA 2LD4A 5CVJA 2QM3A 3GWZA 1IM8A 1H1DA 3JWJA 5HFJA 3T0IA 4RTSA 3UBTA 5ICFA 1B42A 5FTWA 1EAMA 5IH3A 3DP7A 3E7PA 4QQNA 4DCGA 4PYNA 4PYOA 5FULA 4GOMD 2AN4A
chains in the Genus database with same CATH superfamily
3DOHA 1FLDA 3JYOA 4DDWA 1OE0A 1V0JA 3MBIA 3OQJA 4R2LA 5NLLA 4PVDA 3ZXSA 3LX4A 1ZZEA 3HZZA 3JQ8B 3COWA 3GDHA 1HLGA 1TM4E 1WRBA 3CUTA 3SBXA 4LF9B 3HWX1 2PBRA 2J4DA 3HYRA 1NBMD 1O5OA 3W3AA 3SYMA 3CRVA 4PYQA 3KR9A 1OAOC 3D5EA 2F1HA 2W2LA 2XHEA 1AQLA 4Q4LA 1IC6A 1N2ZA 1XMJA 2QTZA 5EMMA 5HCIA 3TIIA 5JNRA 5KWEA 1DIOB 3CC8A 4N3AA 4WGFA 1E89A 1WP4A 1MD9A 3SI7A 4BNNA 1EAYA 1C9NA 2CJWA 3EXIB 2REBA 1YZKA 1PLKA 3INNA 4WRRA 2ATVA 5JECA 2GK3A 5EUBA 3SLRA 1EGHA 1CTQA 3MT7A 1M0TA 1CQJB 2IU0A 5M7EA 2WA1A 4YAKA 1PKEA 1WPGA 2AE2A 3Q9SA 1ZIXA 1QCDA 4ZVVA 1YJ5A 2NSHA 4M6WB 3UC5A 1CY4A 3P27A 4DKJA 3QRWA 3K9GA 3H5LA 2QU7A 4G0ZA 1BX0A 3L49A 2XCTB 4HQOA 3HGTA 3NNNA 1TVMA 2XQVA 3AF6A 2ZE7A 3FM9A 1QH1B 1II0A 1BYIA 1N6OA 4FONA 5AI8A 5B1YA 4HNTA 1HQYE 2XWSA 1FIUA 1U6JA 1P5ZB 1U1GA 4AP5A 4LZZA 1IVSA 5DI3B 4TYNA 2O3SA 3HXPA 5SY4A 1N2XA 1U4SA 4WBXC 3TCNA 3V8PA 4YO7A 3GJ8A 3RHTA 3UK2A 3WKDA 2WIKA 1E1YA 4G4SO 3TZHA 2WY2D 3WLNA 3K9HA 1QOZA 2XB6A 4TV9F 5E7IA 4G9BA 3D8BA 3K73O 1PEDA 4H0NA 5DYYA 4YR7A 1Y9ZA 2WM8A 2AJBA 4ZANA 4CCAA 4NTZA 1M1NA 4UTOA 4YDSA 2ZXUA 3Q3EA 4ZAXA 1PS9A 4F96A 2EX4A 3S1SA 4AJ1A 4I14A 3FDFA 4HADA 1ORWA 5ECWA 2YHBA 1JFTA 2WD8A 2ZJBA 2WYHA 4LA4A 2CLHB 4XCVA 3WK9A 4C0XA 2P77A 4HNVA 2BGGA 3PYLA 4U9HS 5K0GA 1IUNA 5IJ9A 1MZPA 1KAMA 3C3JA 4UFOA 3NB0A 1DWOA 2Z57A 2NM0A 1JE1A 4R2HA 2M6KA 4I7EA 1HT0A 2ZJ0A 1YGPA 3NHPA 1IZ8A 3NC4A 4IFIA 1NUUA 2V5UA 5C0OE 4RVGA 2XI4A 4CLOB 1JW9B 3T7EA 3OEHA 2ZBPA 4AN0A 3UAWA 3WDKA 4HLQB 1OI7A 1XTIA 5IJZA 4KAFA 2OLKA 2D8MA 4EUHA 1NQAO 3NHLA 4J03A 1PBTA 1HA3A 3ND8A 2C7PA 1NOKA 4EO7A 2FN4A 4LMBA 2GH1A 3IGFA 3OTQA 3SD7A 4ZAFA 5CBPA 1JWAB 1SZDA 2Q5OA 4K05A 5CA1B 3GDOA 2WM3A 1ZSNA 1WXXA 3VKHA 2X8WA 1E3SA 4YASA 5H3LA 5LU9A 1T2NA 3S6JA 2IODA 2EDAA 4QO7A 4P4NA 4BBPA 4DLSA 1PR1A 1DKUA 1QOPB 4TGLA 1WQ4A 5FXMA 3O2QB 1VLQA 4DC1A 4BX8A 2O2DA 3MMXA 3IIEA 1Z4PX 1K0UA 4V0OA 2YWHA 4DEXA 1CIPA 3IHTA 3MILA 2VKTA 5BYBA 1RKQA 4EQ6B 4J6EA 1KORA 4YJDA 2SKDA 4R5MA 3BJEA 4MH0R 4B5LA 3FZYA 1RFLA 2HF9A 4TXNA 4NS4A 4OMFG 3KR2A 2DQ4A 5BW5A 1ZPDA 2RKBA 3ZWMA 3KHTA 4AXXA 4L22A 1RWVA 2ANCA 2NACA 2CCGA 4EG0A 1IK6A 4H18A 2QE7A 4RANA 3TFWA 3RYHA 1W85B 3X43A 1BC5A 1OHHA 4RVDA 3TVDA 4PO1A 1G1MA 4D8UA 1I33A 1ZVQA 2ZTLA 5GGXA 4HK4A 5FFMA 4Q66C 2H06A 1C8LA 4R7TA 1JEEA 5LDGA 4A6EA 3LX8A 4EG5A 1PYOA 3TOCA 1Z6QA 7MHTA 2HN9A 3X3HA 1XA0A 3KZOA 4LDRA 4DRYA 1N8TA 4M1SA 4EATA 5ICSA 2XITA 5AM4A 2AN3A 2X0EA 4PZZA 1YRBA 2ZROA 3ASYA 1CEYA 3A1NA 2SECE 3IDZA 3WB0A 1QO9A 1YOVB 5DM2A 3QBJA 1X15A 1VIMA 3TGWA 4MDEA 4F92B 5DYTA 4WPGA 3C24A 5E0OA 3RU7A 1NIJA 3P0EA 4QFCA 3VO1A 3I42A 3AM5A 3QW2A 4CM7A 3RSCA 3TAHA 5JS6A 4BASA 1SBZA 1LPPA 3K5PA 2QTCA 4UHJA 4UM8B 2H4HA 4WFQA 4UCFA 5ED0A 2IHBA 2XB8A 5REQB 3UJBA 3O38A 1FNDA 4X1OA 2R1ZA 2GD6A 4OVKA 1YC5A 1Z0JA 4EFDA 3SAJA 4RY2A 1HO3A 3F9CA 4UEOA 2Y4OA 3RIXA 3P9KA 1DPFA 4GGPA 4OHYA 3P0HA 1X7ZB 1Q0HA 2VJOA 1L4GA 1FYXA 1Y4AE 4KUGA 4RAQA 3QEMB 4YRSA 5GIPE 2OCIA 3E3LA 4NPCA 4TTIA 1YULA 2V7BA 3RRMA 4DM3A 1Y8AA 2VPTA 1LS1A 3EASA 1JL3A 4CIAA 1OX4A 3GPBA 3INRA 1TZMA 2BAGA 4KLNA 5BN4A 4IO1A 1WXGA 2XBLA 1QR2A 4WZBB 1UK7A 2BBWA 1OH8A 4RAOA 2IS1A 2WHQA 2C9MA 4IF4A 3V7YA 1U7PA 2JHGA 3T9FA 2FPKA 1Y4UA 5E3HA 2BKLA 3CZ4A 4QREA 3E61A 1YF3A 2CN1A 3KM0A 3DZ8A 1OTXA 2HDOA 4NBUA 3ZV6A 4C20A 4MKRA 4JC0A 4MIEA 2W6IA 4JOBA 1YS6A 4G86A 4EKNB 2XD4A 1NBWB 3OIDA 4Q37A 4TT3A 5IZ4A 1I80A 2AE1A 2OBYA 3C98A 1KSGA 3S2UA 4EHKA 2WHYA 3KVYA 1J06A 5DWVA 4BJHB 3G9QA 4IQFA 1WV0A 1T35A 3FGZA 4HEQA 4S1WA 4MIOA 4WIAA 5GWXA 3SXUB 3PRHA 3HG7A 2YHIB 1L3BA 5AVSA 1UINA 3N2EA 4PLGA 3SZUA 1JPUA 1MQAA 4QEKA 3FW1A 1IHOA 1M2WA 4FZJA 3ZU2A 3W6OA 4YMHA 3VTZA 2ONZA 3KTOA 4TLLB 3V42A 1AXEA 3RVRA 4KKXB 2HZBA 1SC4A 3IHWA 3CVXA 3GRPA 1AX9A 1LVGA 1SCJA 2HWXA 3A1SA 1W48A 1NZDA 2O4CA 3Q7RA 4N0EA 4BN4A 4ZQEA 2Q3JA 3GLSA 3L7YA 2R4UA 3UF0A 5C7LO 4XWWA 1XAJA 1H05A 1RZ3A 2NU6A 2OV4A 4NBTA 3ROEA 4YPOA 5A1JA 1H85A 4AF8A 3EAQA 2FW1A 3LDFA 5EA2A 5JC8A 2Q2VA 1ZK2A 4B4DA 3H1EA 1VPLA 1F0KA 1OW3B 1ENYA 2NOAA 3MCWA 2L17A 4FQ5A 1UFRA 2W00A 3COZA 1N9ZA 2R68A 4ND8B 4IRXA 1VG0B 5K3BA 2GNAA 2B8EA 1MFZA 3T6KA 1WQ3A 4MOWA 5DHFA 3QVWA 3PE3A 3VKFA 4OLBA 2PBFA 3GFVA 2Y05A 2ZIXA 5JSQA 4CF5A 4I99A 4BX2A 1BW9A 1XU7A 5FTJA 4G1VA 4I55A 1FVXA 4RA6B 2COUA 5FUWA 1U1IA 1HMYA 3LSTA 3P20A 3RUCA 3FGOA 4B4KA 4XAQA 4TVKA 1MCZA 1VG1A 2XGSA 1RLUA 4IJQA 4M7WA 4RCZA 4ZD6A 5I7UA 5JZBA 4BE4A 5EZQA 2PUHA 3GCZA 3EXHA 3KLMX 5C4IA 5G4KB 2DFPA 4UBMA 4H7JA 1KKUA 3I28A 2CHQA 2C5SA 3LY9A 4D5GA 5KHLB 4DQDA 1I9CA 2H00A 3JY6A 2P9HA 2OQ2A 4F9TA 5IEBA 1PFVA 1LPNA 3PHJA 1XZAA 4P35A 1ST2A 2P5UA 2G5TA 4EVRA 3OWOA 5AM1A 3KDPA 1BEUB 4KPEC 2ZCVA 3DMRA 4NOKA 1T1IA 3B6IA 3A7EA 4LJSA 1SD5A 4M54A 1GADO 2PKEA 4DF3A 2EP5A 5BW4A 1IULA 3PWZA 4ZXPA 4E1VA 4E13A 4Z8XA 1FS6A 1Z7EA 1FYEA 3R6LA 1QHFA 4J0DA 4LN1A 4OGFA 1P9NA 1R4MA 3F8SA 4HUTA 3EZYA 4KQ2A 4QOIA 4YGXB 3LQQA 5L3VA 3HVRA 3Q8MA 3M6FA 4FMDF 3CRW1 1A8SA 5LYJF 3W5UA 4UHFA 4YIHA 1ZAYA 2D8AA 4QATA 2X22A 1NBOA 2P9GA 4OQYA 3GRCA 3T41A 5AIBA 1QRAA 4L4XA 4QUKA 3BEOA 1GPAA 2C7GA 4IIDA 2G71A 2HV9A 4RLFA 4ZZ0A 1YU9A 2PGDA 3KKMA 2ZIVB 3OMLA 1G98A 2A86A 2FMIA 2QT1A 2R6GA 3GEDA 3GJXC 3W1WA 2Y1WA 3CCBA 2E21A 4P2BA 2VL7A 3NDPA 4XLLA 1HC7A 1VM6A 3FZNA 3HUEA 1TO6A 5EZ5A 5F33A 4EZEA 4G85A 1NBHA 3AUSA 2H4WA 3LTEA 1QE0A 1X9GA 1XQ9A 1VLMA 1CUZA 2PHZA 3C45A 4H4CA 4X84A 121PA 2JCYA 1GQSA 3UGKA 3MRVA 5F7XA 4TQUS 3OE7A 3BWBA 3BRSA 5AUQA 4H1UA 3WJ2A 3R77A 3BWDD 4IP0A 3R5XA 1FQKA 1NFQA 2BHRA 1EFUA 1T4GA 1IJFA 3NFYA 4IL5A 3D64A 1BFKA 2PXXA 2GESA 3R76A 3S2FA 1Q2UA 1E2MA 2GBPA 2HBZA 4CL8A 1VDZA 1W0CA 4EA8A 1NFFA 3D3WB 4N9WA 3K4PA 4P22A 1XJWA 5JJKA 1R5JA 3FWKA 3A9VA 5JSUA 2R65A 3OCJA 3ZDDA 2WJZB 1CUXA 3C6KA 1YMQA 3DZBA 5DX0A 2NXJA 3L82B 3DE7X 5D01A 1M1YE 1IN5A 5EE1A 1IIBA 1JSRA 3VZPA 2JHPA 4X3PA 3T7TA 3VMFA 2A9QA 2VJQA 2FWJA 4FILA 4EA7A 5JAIA 2EJUA 5F76A 1PL7A 2XQGA 3BSSA 3BMNA 3OM1A 4NE2A 4EKIA 1A5ZA 1Z12A 1L8LA 3MJRA 1A5AB 3D6TB 3N59A 5MF6A 2C9ZA 2XCSB 2ZTVA 1DQNA 5G41A 4FFBB 1KDOA 3KQYA 1ZO8A 4DUPA 2LXNA 4XEHA 3GLFB 5EN4A 2DYKA 3B1JA 1KI6A 2NTNA 4GX0A 2WYOA 3PBKA 4W5RA 4O2AF 5AXAA 2UUCB 2DC1A 4PGHA 4E3ZA 3QE4A 3DE2X 4B3CA 3RNOA 2YN2A 3VR2D 2C1XA 2XZPA 1R0YA 3QVKA 2WTEA 4BNWA 2QG9A 4PRZA 2D06A 3RVBA 1IUKA 5FBVB 1BMFD 1P80A 2O8FB 1KFBB 1Q1EA 1U1CA 2R8YA 3MJTA 2RI1A 4LYJA 4YMVA 3FOZA 1NG9A 2PY6A 1DX6A 5F3DA 1BN7A 3UTCA 3KDSE 1OAAA 1GSAA 3I04A 1U2GC 4RBNA 1A7JA 1R12A 4C4ZA 4EKGA 1V7CA 4B3SB 4QYTA 1YUNA 4E6PA 5IX8A 1C2TA 1O77A 1FRZA 4OD0A 2WVJA 4N40A 4XQEA 4QXAA 1TC1A 1CRWG 2R1UA 4ITUA 4WACA 2AXPA 1L7NA 1JB1A 1N75A 3FCUB 3H8JA 2G9NA 3E0QA 3TW8A 3KZCA 3VZQA 1M2OA 2H0AA 3DFMA 4B0OA 3HRIA 2CVFA 4K2HA 3W6PA 4IIJF 3G5MA 3ZNPA 3ZIDA 1R8SA 1QHNA 4X1IA 1E6CA 4GP9A 2M2IA 4PPYA 1I2BA 4QJ5A 1XRJA 4I1OA 4EHFA 3TG8A 4WFKA 4RENA 2VQ3A 4YRTA 5HIKA 1EFCA 3MJDA 3KVRA 3N2GB 1E58A 3E8SA 4ARAA 1JN0A 3DV0A 2E5FA 5KWJA 2MMGA 5BV8A 1P61B 2JC3A 4J8PA 2J0VA 3LYLA 2BOVA 1X94A 4OLHA 1X7XB 1PDWA 1SA0B 1T8RA 3T5MA 2X40A 5DTRA 4DM7A 4F60A 4YAUA 1TAQA 2YVUA 3IVCA 3EMKA 3I2KA 1J21A 5HRAA 3ZWOA 4OHBA 1N6LA 2C54A 4LOAA 3D8NA 1YR3A 2PWPA 3IAM1 2IHUA 2VP5A 2IIBA 3JWEA 1PHPA 4RPIA 1AQYA 1Q19A 3I8XA 4PHHA 3N70A 3DFIA 4OY3A 2JAQA 4URZR 2OD9A 3KQPA 2OXEA 5FWYA 5TVGA 3ZEAA 2GNPA 4Y9RA 4WX2B 2PGLA 4NMHA 1YHZA 2G6BA 1YDFA 2I76A 4X7RA 3TSYA 3QX7A 2XVAA 5IKMA 2H9IA 3TQOA 5I5EA 4MI1A 4CF3A 3VTKA 4BRSA 1JMKC 1XZIA 3FWNA 5K3OA 1P8JA 4CN9A 4EF4A 1BE6A 3U62A 3OEED 4UEQA 2D0DA 1EZ4A 3D6AA 5CJ2A 5CB8A 3ZBPA 2E49A 1DFIA 3CN7A 1T3HA 3C3XA 1KS2A 2GOYA 4OGKA 1EWKA 3UBTA 4A0SA 5AJWA 2P90A 2XA2A 3Q1LA 4JC5A 2R2GA 4WUVA 2GCIA 3C3KA 3FNHA 1UK6A 3L7MA 5CFRA 4AY3A 5HDBB 2ZR9A 1KJYA 4I2VA 4Q02A 4R1LA 3U6BA 1DKMA 4JFAA 1NWHA 4HLNA 4PSAA 5FWNA 1YTUA 1AKUA 1K86A 3T12A 2BCGY 1QC5A 1EHYA 1A5SB 4WFJA 5HF8A 2P91A 4Y2PA 3O75A 2RGGA 5EHNA 5EZYB 2NUTA 4O4IF 2EGGA 4D3YA 1L9KA 3L04A 2VT6A 3L8ZA 2OM6A 4LYEA 1BKDR 1MVLA 4JYBA 2BFWA 1N6IA 2IOFA 4QWMA 2FUCA 2UYOA 1ODLA 2WJ4A 2V7QD 3BTUA 3DNMA 3PFHA 4M36A 4PHCA 3WG9A 3WNVA 4YH1A 4Q9HA 3Q0IA 2XRFA 2ZITA 2QZSA 1SVSA 3TNFA 1OU4A 4UMFA 1KO1A 2O4UX 3I4LA 2BUAA 4JROA 4Z4EA 3OJFA 3QYPA 4LSMA 2GN4A 2J7PA 4WECA 3WLJA 1XJ5A 4A8JA 3G1WA 1FFXA 4BMNA 2O54A 3ESDA 3OU2A 1J0AA 1M2JA 1I4EB 1TQ6A 1VP9A 2ID9A 2WPDA 4Q1VA 4Z7JA 2YWRA 2IUUA 1XLWA 3PEYA 3KV3O 3DR3A 4GT1A 1IPEA 1GIAA 1MB9A 2Z9CA 1GL9B 1DI0A 5AP9A 2ZIAA 3CH4B 3JPYA 5KTSA 4BMZA 1HEUA 2Q6OA 1U3DA 2VP3A 4YCDA 2X5XA 2YC4C 5DXJA 5IS2A 1GVNB 3K8ZA 5J2UF 1LY1A 4KBYA 2RAPA 1V16B 2VNIA 1KPGA 2YW9A 1CE8A 5JXWA 1WUHS 2EX1A 2LCQA 4LVOA 3DTVD 3WYNA 4OH7A 1G2PA 3B51X 3J81A 1DBPA 2WD9A 4KQMA 5D3QA 1UBCA 1IN6A 1HSZA 4B3XA 1Z29A 5FLXA 4ZVSA 1VSVA 3FCOA 2G9UA 5HOQA 1DGQA 4MKIA 4HAOA 4CTKA 4ERXA 5CEJA 1OB5A 4XEUA 1JQJC 2D13A 4Z9YA 5LA6A 1TQDA 4M98A 2X42A 5DLYA 3FPLA 5DYIA 3V2GA 5JROA 1P0QA 3NQ41 5COQA 1VIYA 2C0PA 5K01A 3D7KA 1EE2A 2PGXA 2ZI4A 2ONCA 4PSCA 4V2IA 1X42A 2VDLB 2WJJA 3AYZB 9LDBA 1UBJS 1XWWA 2Y1CA 4KIGA 5A7GA 4EARA 2QR2A 2Q8QA 4LGCA 5KTPA 4PBTA 1RWXA 3MSCA 3ZWBA 5MHTA 1I3OA 4ITVA 2CXOA 3NHZA 2I62A 1NKSA 1K6MA 4KDRA 5CM2Z 2NUAB 2D5IA 3M6WA 4HLUC 4JV5B 2A5FA 2VFAA 4XYEA 2BFCB 4R7GA 5E7MA 4JEMA 1RADA 3L84A 1XDZA 5ALHA 3WSWA 1XP8A 1XRLA 3SYNA 1YT5A 4QAJA 4EAQA 3Q2IA 1OV4A 3EYWA 2QBYA 3OQIB 1G6OA 1H4SA 1I32A 1R7RA 2CK3D 3B2EA 1XDSA 3GJQA 4OO3A 1KJJA 5AI4A 3T3GA 2PSJA 3OZFA 1CLEA 1OPXA 2AYXA 4V3CA 2VG8A 2QTRA 3TLGA 1RLIA 2PIAA 2IYZA 5FLYA 2J09A 4A7PA 3GRRA 5FOQA 1NM5C 3A9WA 2QRGA 2ZB3A 1YQGA 4Q1DA 4OIMA 4TVSA 2Z8YA 2MMCA 1EFLA 1U3VA 2IEZA 3DP9A 2WF6A 4U7GA 5K0TA 3LG2A 3FUTA 4DPLA 2I55A 3GRYA 3IIMA 3L6UA 5HF6A 4X90A 2XOKD 3OPYI 5A5DA 1BWPA 1X14A 2MHCA 4PFQA 1FMLA 2Z2IA 2O1XA 2AC7A 2ZVDA 4MK4A 4BKPA 3HE3A 1YZ3A 3LWBA 5JW6A 1BH2A 1GD1O 3MS7A 5FLKA 3ZIAD 2JEOA 1TM5E 3KJGA 5SV2A 3SFVA 3UUEA 2GWHA 1T5DX 2H5JA 4OGWA 4LPKA 4RQTA 4TUYF 3ORFA 4WFIA 1Z0KA 1KH3A 5SZHB 1YH3A 2D1FA 3IA2A 4Q5IA 3SDSA 3ZZMA 1Q1NA 2JGAA 3Q12A 3LW8A 2EEPA 4C7MA 5JLAA 3DQZA 1I1OA 4EVQA 4PS0A 1E0AA 3BT7A 2WDZA 3K0AB 2JLCA 2I1QA 2GAOA 4GFDA 2A6PA 4K1LA 4ZCQA 4N0PA 1GGHA 1BA2A 1MJFA 2PFGA 4C4XA 1S2IA 2LZ0A 2QD1A 3Q2OA 4GLBA 2CNKA 3NXKA 2A33A 4CIXA 3P19A 1RKBA 1FCJA 2W0SA 5ALYA 2Q3FA 4B4OA 1JB9A 1Z38A 3F97A 2Z5LA 3LXUX 2OV1A 3NJ4A 4N01A 2BL4A 4Z0NA 3NYQA 3NALA 4NBVA 3N74A 3DFKA 3NZEA 3OOYA 3IB6A 4PLPA 4O4HA 2DJIA 3VJMA 2GBIA 1Q74A 2OQRA 2QR3A 3QUBA 3OI7A 5C7YA 2ODAA 4N39A 1F6BA 3SJ7A 5D85A 4JMLA 4B79A 2N3ZA 4UTRA 3M9WA 2WYWA 4RDHA 2F00A 4XOIA 2FGJA 4YAGA 3TGPA 3CG0A 4F6RB 3AF1A 2EJCA 3CRZA 3VDQA 4KXXA 1V6AA 4HVCA 2HC9A 4FOTA 5AKJA 1VBNA 3I64A 4YAWA 5AW5A 4DVJA 4CI9A 1Y8CA 1DAOA 4MUGA 1JDZA 2B1JA 5K8UA 5EP3A 5IT4A 5IM4F 3CZAA 5B1DA 1K63A 3SMVA 3AGQA 3SIRA 1I2MA 2PT6A 2ZJ2A 3SQDA 5KTRA 2ATXA 5EIHA 1GY8A 4FIZA 3PWKA 1VL5A 4P36A 3HJGA 3ST7A 5C5DA 3W7BA 1GZVA 5FBZA 2IW3A 1ZJ6A 2KS6A 3MFQA 1COZA 5B1SA 3ZJ4A 4CEHB 1FU7A 2VYND 3CUVA 1VHJA 5JSKA 2P1DA 5HYVA 1TQHA 1CUBA 2ZDHA 2ANBA 1ML3A 1UM8A 1JA9A 3NBQA 1IDN1 1ECJA 4W9NC 1P7YA 1N2SA 4UMDA 1R9JA 5KNLA 3TCKA 5AWFC 1Y1PA 1L5VA 4I9FA 1GL6A 3JWGA 3QHPA 5SY6A 2CJYA 4I4NA 5DX1A 4E14A 4EL0A 1M5TA 1KWKA 3DTVB 5H82A 3NIWA 3OA0A 1OWOA 3CUUA 1VCMA 4CQLB 3TM5A 2O7QA 5JI3E 1E5TA 3GLGB 1P9LA 1WM1A 2GCOA 3AFOA 4G5OA 4N3CA 2QRMA 4B32A 5CYOA 4FCCA 1S2OA 2VOJA 3OC6A 2AZMA 2DLDA 4GM0A 2A94A 1SB8A 2KHZA 3GNTA 4UDXX 1XN1A 5TS3A 1S02A 1DARA 1RI2A 4MVJG 1RWPA 1DV2A 4BVGA 2G4VA 1I6KA 1V95A 3A10A 2ZBGA 1U31A 3U9SA 5F1KA 1ACMA 1E7QA 1SHLA 4CG3A 3TXYA 3U0BA 3M6XA 4M87A 1YE8A 1GYRA 2AH5A 2IYQA 4PN7A 4ZMSA 1YA4A 3FETA 4CBVA 4E31A 1TD9A 3UV7A 1ZJYA 5MDHA 1A2OA 1QORA 3R7NA 3UAOA 2IYEA 5FTMA 3UG6A 3AM1A 5AICA 2CB0A 1Q0SA 2WP8J 1CG6A 3AUTA 1L5FA 3C1TA 3EY9A 1QYIA 1PG2A 4TX1A 1JHPA 4KVZA 5AVVA 2QV0A 4DNQA 2I9KA 1FUIA 2BE9A 3DLIA 1YC2A 2GBLA 1KAQA 1YJAA 3W5BA 1NSFA 1YDMA 3NATA 3QNUA 2BR4A 4GMXA 1QPGA 1ONPA 1WUTA 3SGLA 5B58C 4YQEA 3W5VA 2BM8A 4GL2A 4TV8F 1C3OA 1OFIA 2DR3A 4MA0A 4HOYA 4QHSA 4UATA 1G4HA 4ZRDA 4GEKA 5JCJA 4C1BA 4K3UA 5BV0A 1PWZA 1LZLA 3V4LA 1YK1A 4YMTA 5IKEA 1B15A 3PPIA 3JQPA 2IEDA 2Z8XA 1ULHA 2D54A 4MV6A 3ENQA 1N2CA 1G2OA 3QNWA 1K4MA 4IOMA 2FSFA 2IEIA 4NDAA 2BGTA 1PR5A 2FPSA 2BSXA 1N2IA 3NUZA 1D04A 2H2GA 1NNUA 1VMIA 2JAHA 4LVCA 4LJ8A 4P6VF 2A0WA 1L4FA 3PI6A 1X38A 3R3XA 5D8DA 3RAEC 1JNYA 1XFAA 4M7RA 1FU8A 1NWCA 5DM0A 4M0UA 3SJUA 1QLJA 1XF1A 3B2NA 3QI2A 5BYJA 2PWAA 1NOJA 4DAEA 3CPSA 1Z4IA 3CURA 2MSKA 3A9TA 5CFOA 3SC2B 3PVZA 5KVAA 4Q3CA 4BO6A 1HYGA 3R6TA 1W4LA 3HY4A 2VDJA 1H0KA 3UVEA 5IP5A 3U1TA 1D03A 2DR2A 1Q14A 1C3XA 1T26A 4R8KA 3L4EA 1TM1E 1V39A 1ZGAA 1LBHA 3VR6H 2YKGA 2CKDA 5DN9A 3QNMA 2NU9A 1O08A 3NRCA 4LDAA 4LCBA 2FX2A 3PC4A 4MI9A 4X0EA 1A8PA 4XR4A 1PR6A 4YJGB 3X1WA 4PF1A 5A3QA 5C8VA 4Y18A 1P5RA 3COJA 4EVIA 2Y27A 4LF6B 4BKRA 1WPQA 5EJ9A 3AF2A 4A6PA 1M2VB 1J1UA 3EVBA 2IPNA 1U02A 1UBSB 1KI9A 5FFNA 5J63A 2D7DA 3USES 2H3EA 3PRJA 1HX7A 2QN2A 2B34A 5A71A 1L8QA 4FCVA 4ZT2A 3MJHA 4WK6A 1U2TA 1F7UA 1FP4A 3QUQA 4OGGA 5F73A 3HHEA 2R5WA 2H2HA 2O2CA 5AVRA 5AOCA 3KVVA 1ADBA 4ALKA 3QSYA 1OUMA 2DLNA 1TO2E 3K2EA 1F2UB 1VL0A 2X0KA 4UPVA 3HABA 4YPFA 3UWSA 2PAFA 4D9JA 1JECA 1QHSA 5F23A 2WAAA 3NPAA 2ZYVX 4TWRA 2NMVA 2PKQO 2QTMA 3BXHA 1Z6GA 1VXOA 1Q5PA 1RM0A 2R5NA 1D4FA 3E5RA 4OUDA 3UY4A 5TIIA 1PLJA 1XG5A 2PGOA 4NFLA 2CVZA 2JFUA 4LSWA 1GUYA 2EKLA 2GJ4A 1XPOA 3TLBA 2HRBA 1S7GA 3R5TA 5EUQB 4QYSA 1FJ2A 2F62A 4BQPA 1UXGA 4M1EA 3C4JA 3FPCA 2NXCA 5KDDA 2ISCA 2O8VA 2HNAA 3MOSA 4FYWA 3CW2A 2JI9A 3KZXA 2AXEA 4R9SA 3IDOA 3BE8A 1Q7RA 4CR7A 4OA5A 2OZKA 3BXOA 1AKQA 3VU1A 1H2XA 3KE8A 3BXFA 4PY2A 621PA 5EIEA 1OFGA 2HIMA 1QWOA 2ZRAA 3BERA 3UJ8A 2Z5GA 3BMQA 4NKRA 2C3MA 4YC7A 3ZHUA 2WMOB 3IAHA 3QGMA 1DBSA 3QIAA 2FFAA 4UQOA 3WB9A 2MYTA 3I2FA 2O05A 3A27A 4H7EA 4UJ3A 2AMYA 5CNKA 5TPZA 4YROA 2A58A 1QO0D 4UTPA 4JBIA 3GYGA 1I30A 4FFRA 3GJ0A 2I7XA 3ZVNA 1Z4OA 5GONA 5BXQC 1T0UA 2PUFA 3FIJA 4LRQA 2RE8A 1JHOA 1Z07A 3D1VA 2J3HA 4QDZA 4DC0A 4AO8A 2FDCA 3C6ZA 3QK7A 4GXRA 5FI0B 1WBBA 1OZ0A 3PGKA 4ONEA 1AGXA 5CNJA 5GTDA 2XRZA 3ETJA 1GPUA 3UB4A 2V5AA 3MG9A 4E21A 4OL9A 4R41A 4ZHQB 5AK6A 1P2UA 3E1GA 1QQ6A 3VYTB 1K9SA 4M86A 4EABA 1FF9A 5DPMA 5F52A 1Z0AA 1T9GS 3LVRE 2B2CA 3ACDA 3FVTA 4POAA 1R9GA 4I6GA 1WDKA 2FF7A 1X7HA 2ZRIA 4NZNA 2D1SA 2ZJ7A 5I7EA 2JLSA 1XL0A 2H92A 3GCDA 5JDCC 1JFFA 1MO5A 1UEIA 3D3EA 4B44A 1ATZA 3UPUA 3L0SA 4GM4A 2IXFA 4JKIA 3RRNA 1KHTA 4U8HA 4B33A 1IOWA 4HRYA 1GTSA 1DU4A 3C1OA 2WV9A 1QHGA 3V4FA 4CV2A 3A32A 3ND6A 3PD7A 4EQZA 2DHDA 2C58A 3EAGA 3ENNA 2BEVA 4HSEA 2G63A 2MSEB 2X9LA 1ZN7A 1A0OA 1HE2A 2VDNB 3CYFA 3MXTA 3QFTA 2O1SA 3WMFA 2XVMA 4QAQA 1QIGA 2J8ZA 3V2UA 1DO8A 4TLCA 1ZVMA 2GPNA 2V3WA 1EHCA 3FDJA 4HAUA 3STUA 4QYIA 4EF6A 4ESHA 1X7YB 5JRZA 2RD2A 4GWGA 3UHOA 2YZGA 5HFNA 4GBED 4BU0A 4JVOA 3PFCA 3VFDA 2JFHA 4DDHA 1TNDA 1DRUA 2OPHA 3TTXA 1QQBA 2ZYTX 3IOYA 1PL0A 3P2IA 6Q21A 1P74A 4TLBA 4I50F 1Q11A 4U5XA 4Y2QA 2JW5A 3T4EA 3NDBB 3HJRA 5B64A 4DY4A 2R47A 7REQA 4HGQA 4B7UA 2ZBFA 1U0LA 1ZHHA 3GYBA 1PR2A 2EKBA 2V4ZA 3N7UA 1I2AA 3FGNA 1IPHA 3A37A 4G37A 2AFHB 4MGZR 1HYBA 4K6OA 4KXFB 2QQ5A 1EFVB 1NUAA 4M1KA 5KYUA 3ZGOA 2I99A 5LZ9A 1SULA 1N5OX 1Z17A 2PQMA 1C7IA 3JQAD 5EYPB 4A36A 2CEKA 4Z4CA 2I2XB 4CIYA 4OQQA 4TWAA 4D9HA 3L6DA 4LC0A 1SUEA 1JHAA 2HGSA 1U2QA 2FOXA 4N12A 4AL4A 4BVFA 4BCBA 2BKAA 3A8TA 1EGVB 1FP2A 4GL4A 3ZDQA 2LD4A 4AG6A 1C7RA 1GFSA 1E5DA 1K98A 1JR6A 3IAUA 3MB8A 4ND7A 4Y2XA 5EWLB 4DLKA 4Z1MD 5JZSA 4X3CA 4PZ0A 1CF2O 2G4CA 3HWRA 1GFWA 2CDAA 3OP1A 5EJGA 1P1HA 2HCTA 4PYOA 4CTMA 5KOJB 3OQVA 2AN4A 4PRKA 4U9IS 3TI7A 4YRGA 4LK3A 1B14A 4NDZA 2XNDD 4G25A 4DUGA 1Z8HA 2GXQA 3DXXA 4PO8A 4BQNA 1OD6A 3CX7A 4BO3A 3BREA 1PK8A 1CYEA 4D4JA 1YL7A 5K3FB 3GN1A 1P77A 1C41A 4BGEA 1P2GA 1LJLA 3NM5A 3RVOA 2VAXA 2C4NA 4GKJB 1CIJA 4FQ7A 3LGXA 2P0AA 4L50A 1QCCA 3N28A 1YKSA 2FQXA 2O20A 1DBVO 1K66A 4HX5A 2B4KA 4HS4A 4LZLA 1V37A 2CWWA 5DJ5A 4GG1A 2WU3A 2BFEA 2BFBB 3AY3A 2M1ZA 2OZPA 4XI9A 1Z4LA 1SCUA 3IJEB 1THZA 1XKXA 4G0MA 1E2EA 1FDTA 2QR5A 4WZAB 3GU3A 1NHGA 5KMGB 1GU0A 4I19A 4LXHA 5LXTB 1XQ6A 4DT1A 4JLPA 1JKMA 1SURA 1VLVA 3LBHA 3FSGD 4G8BA 4UHDA 1UMDB 5EVJA 4KLCA 2GQ0A 3TXXA 1P4RA 1CFZA 1RC0A 4LTNA 4CMHA 4ZYWA 1KXJA 2QXYA 4RHXA 3LCCA 2HQRA 2C59A 4C7BA 2C7QA 1IUPA 1CU1A 1YR6A 2BLNA 2AG6A 4J94A 4NENA 3ZUGA 4D99A 4BQEA 5JXHA 2OQVA 5C53B 3HHPA 4NOLA 3BB1A 4QTYA 3WV5A 2HUPA 3IC5A 3LXMA 1ZJZA 1G16A 4UE2A 3WP0A 1QO7A 4AZWA 2DULA 3E18A 4F11A 3BN3A 1Y7LA 3C5WP 4ZPXA 3REFA 5C18A 2OV2A 1N7JA 2RGEA 2FSPA 3EEIA 4TQ9A 4R98A 2FMTA 1MT3A 4OV6B 2PFSA 3I9NA 1ZRHA 4G1BA 1V48A 4ETNA 3K9QO 4L0QA 2JFOA 3FFTA 4MW0A 3V6LA 1YRQA 5K0ZA 1Y5MA 1WSAA 3GVPA 3SK0A 4K46A 4CMKA 4ARSA 1ODFA 1E1CA 1WCIA 3B1XA 3FVQA 4Q3OA 4LJLA 4Q4HA 1V1RB 2V3CC 2GYUA 3UCFA 2QENA 4ARUA 1P1BA 4CLRA 5IABA 2O6LA 3C97A 2W2KA 3QITA 4N1AA 1RXIA 1XTPA 4MB0A 2GF0A 2Q9AA 3N39C 4N5DA 1R3DA 4OATA 1L4BA 1RHJA 1HDRA 1O96B 1JS1X 2ROQA 4YJHA 4ER7A 2CL6X 4FE3A 4HY3A 2COKA 3ZN2A 1POWA 5DBHX 1GPYA 1MO4A 4A0HA 4XW2A 1CJBA 3D8TA 1QE3A 3L43A 5CJJA 2O5CA 1N8NA 3T9DA 3BJRA 2EFYA 4Q9NA 3GRKA 5TMBA 1XLVA 2EBHX 2X41A 2XMDA 3OCWA 4GPIB 4W8OA 1QP4A 3AHIA 3GFOA 4M1ZA 1NJ6A 2B82A 4BWGA 1FFCA 2IH5A 4WKPA 4FZRA 1SU6A 4GICA 3BHJA 1L5WA 3FUUA 1L5MA 2RFLA 4MCAA 4UCQA 2PX3A 1XF9A 3E9CA 3EAFA 2W4QA 2GEBA 4XDHA 3OPYA 3D2CA 4UHKA 4BFZA 4PG5A 4CFZA 1PX0A 1GG5A 2P5TB 2EZ8A 3KTAA 1C8BA 1WF6A 4CWAA 3KKKA 3LCJA 2ZRMA 1GPJA 1CRLA 5EINA 5K0CA 2EFCB 2DFLA 4I6EA 4G24A 1I01A 3T1NA 2VZLA 1PT5A 3THOA 4DR7B 4FWIB 2EZ9A 1YJ8A 1NKTA 3CZPA 4EJSA 4ETIA 4LX0A 2F59A 1E94E 2FWAA 3KLOA 1JLLB 2FI1A 2FLKA 2RAFA 4KQEA 4NZ9A 3FVWA 4U4AA 3T1TA 2CDBA 1T3GA 3BHIA 4AP6A 3ADKA 4JYZA 2ODPA 1UZAA 2VR1A 1DQYA 2JBAA 4P3PA 2W6OA 3JAWA 4TL7A 2QP3A 5FWDA 5FBKA 4M9SA 5B3JC 3IURA 3KQWA 3JQAB 3ZH2A 3TVYA 4JA2A 3D8UA 4NXNB 5JVDF 1U7WA 1YNOA 3PNBA 4RXTA 5FKJA 1ZLXA 5TGZA 1WB5A 2VRCD 1R2QA 2AUTA 2HU5A 2PRKA 4MVCA 4PC7A 5LB2A 1CVRA 3K05A 3MOIA 1W94A 2GS9A 3C8MA 4BLOA 3PQEA 2OZLB 2BEUB 1DEXA 1HE5A 4B2IA 5HM8A 2I1WA 4ARVA 3D3NA 5CLGA 3V7WA 5ECDA 2CUNA 3SSMA 3UJ7A 1NJ2A 2A3NA 1HK7A 3DDUA 3SZOA 4ZIRB 4XPZA 4LNHA 4DV1B 4ZA2A 3ZXIA 2K2WA 4YCBA 4HYYA 5JCPA 3HCFA 3ZGVA 1BQEA 2DBRA 1G5PA 4EYEA 4BVKA 1B7GO 2ZULA 4XD2A 1UT5A 3D6UA 3KOUA 3DZKA 4TV9B 1T9ZA 1XXHE 3NCTA 2A0XA 1Y8ZA 2G17A 1O94A 1G5FA 1ZM2A 3GZ4A 1ZGCA 5DHQA 4GGOA 3VR1A 3VO8A 3SHFA 2DSNA 4ZOAA 3RS9A 1PE0A 3UO8B 3QBEA 3G9XA 3OMWA 1YE3A 3TQQA 1F2TB 4URVR 3ABOB 4GYJA 3HP7A 1Y3BE 3HDYA 3J81k 1EFRD 4PLTA 4R7ZA 5DLEA 1OAKA 4TM7A 2WIBA 4FHFA 2PKCA 4WY2A 5JXGA 1CC1S 3ZY3A 1P91A 1PFUA 1HH4A 4QPJC 3RQIA 3WYAA 3RKUA 2FSUA 5TT0A 4Z2AA 3NHMA 1HT2E 1WCYA 2QRJA 4MI6A 3VJRA 3N8NA 4ID9A 4L4RA 1ZCBA 4QQRA 4GC5A 2QIOA 2RAUA 4RHFA 1S9HA 1T2AA 2VDVE 1MAVA 4RK1A 4RZ3A 5B7QA 3CF0A 2QX8A 4F3TA 2O0HA 5HM6A 1VJGA 1ZC4A 1AO3A 2JDIA 2OO7A 1V45E 3K1JA 2ENUA 1MO6A 4FKMA 3BSYA 4C3ZA 3IJRA 2C20A 4BO2A 1GLVA 1WL8A 3MM4A 6REQA 4Z9AA 2FLWA 5K1ZA 2PSDA 2ZYSA 3N05A 5EGSA 5T8KA 3FTNA 3WISA 2OHOA 2QMEA 1KTIA 5H02A 4BPRA 1AMNA 3JZMA 1FZQA 2QAGC 4CQMD 1ZLYA 5IBRA 4F21A 5U4QA 4PPGA 3BHNA 1R4AA 1ZDMA 1BAPA 3C6QA 4XB6B 2HBQA 4OSOA 3UUGA 1LNSA 5F35A 1MIOA 1HFEL 4IGAA 2AR9A 3IESA 3DC7A 3HVHA 2Z30A 3DOEA 4L8VA 4PRLA 1KZHA 3TRHA 4C3OB 2H2IA 4C7OA 2CLFB 2ZJ3A 4EZIA 1U3UA 2C92A 2Y1FA 2HU7A 2NSJA 3E8XA 5DMXA 3I76A 4ZEWA 2W6CX 5HE9A 4QNRA 5CVTA 3IT0A 3FHOA 4LV8B 4QXQA 1OKKA 1M6VA 1AZTA 3INGA 3FD8A 3E22B 3QJ5A 1PJLA 1DFHA 3AESB 2R62A 1Z37A 2WWIA 4ZGWA 3MQ4A 1APBA 3OT1A 1G9XA 4N41A 4OOEA 1U2DC 1HKHA 1UCFA 3V9PA 2YX1A 5EZSA 3G2IA 1T2VA 1OH6A 2BKEA 1M76A 3HUUA 1XO1A 4DYDA 4C4AA 5BWCA 3TLYA 1XZDA 4BUJA 3I53A 2CNWD 2QV7A 4O5AA 5DTQA 5JXIA 3WGKA 4K28A 1YZFA 3T7JA 9LDTA 3HADA 2H57A 3FKQA 5ERYA 4JJKA 3FZGA 3RT1A 1YNSA 2XSZD 1CUAA 4C0BA 3ROQA 1I6WA 4L27A 4YLYA 4K9SA 3MRXA 2OLJA 4DWJA 4P98A 3FJ1A 5ALKA 4A91A 5JYCA 4Q93A 1Y3HA 4TVOA 4OX9Y 1KMQA 1Q0TA 16PKA 5TF0A 1KP9A 3BPSA 3TJRA 2WAOA 5ESXA 1ZWLA 4HGPA 3P2KA 1UUFA 3B36A 3NLLA 1DDIA 2BFMA 4JI7B 1A2KC 1CZKA 2G83A 3BBLA 1GTRA 3ETLA 4J1TC 4I4TA 1CNMA 1D07A 4IIYA 1V7QA 2A30A 2HNKA 1USUA 4M0FA 3PK0A 1R8QA 2GPTA 1IG0A 3GEBA 1P6QA 4TL6A 3P97A 2P4SA 2QYTA 3RKSA 4F84A 2B3DA 4WKCA 5LUAA 2J6BA 1VIDA 5I9MA 1ZEJA 3AG5A 1M6YA 1EXMA 3R9XB 1UDBA 1WHTB 3FCCA 2G06A 1E62A 1YRYE 4MVJM 1KH1A 4RTPA 1SXJC 2GA9A 1ZCZA 4FEEA 5ADWA 1E9BA 1OVMA 2H54A 4A15A 1ISHA 4LNAA 4ZQIA 2J3QA 1N9KA 4PAGA 1F8UA 2VP0A 5ER9A 2XEXA 3IHLA 1KFKB 3UUWA 4XM2A 4E30A 3GVXA 1QJ4A 4ZV7A 5TJHA 4NG4A 2XBUA 3OZVA 1CQIB 3VDXA 1Z4JA 1KFJB 2QL5A 2YQ5A 4BV9A 3KWLA 3K9CA 1PS8A 2F1IA 2E5LB 2BFDA 1PJQA 2H07A 3NT4A 3S7ZA 2ECOA 2BZGA 2E87A 1FDSA 3FSRA 1T9AA 1Z5ZA 2VK1A 4C08A 3K31A 4LFCB 5L8VA 2BBSA 2B0JA 2UUBB 5IM5A 2AMLA 2Z2JA 1JTVA 1YHNA 2P2ZA 2XRMA 4V0RA 3JQ7B 2YBDA 2DX7A 3I8OA 1LF5A 5T57A 1MQSA 3OF5A 5TPWA 1EUQA 3AVVA 3VKGA 4J6FA 1PVVA 1JAHA 3N3AC 2P9JA 3RU9A 3V1NA 5MN6A 1N5JA 3WK4A 3NOVA 3PHCA 4GR9A 1E2GA 3K3PA 4QULA 4N76A 2D5LA 4H6WA 4U7WA 1Y0BA 2X5NA 3H5RA 1ZVKA 1IQRA 1ZM9A 3NR2A 3AINA 3KX2A 1OPRA 3M9XA 3ITEA 3KCQA 2OYCA 3CZQA 2E48A 2GN2A 5FCDA 3O8OA 4DLBA 3H11A 5ED4A 4Q48A 1M1YA 4G4GA 3WC4A 1XJ0A 3HYSA 4QL3A 4KZPA 3REGA 1COWD 3TDNA 4Q0MA 3T4UA 3LS2A 1GZ5A 1VHTA 1WKBA 3BULA 4JC4A 3HZHA 1VL6A 2ENWA 1IXKA 3BRQA 3HPRA 4C4PA 3UHJA 5KYWB 4WWHA 3QE2A 5KTNA 4HTFA 2WWGA 4LOJA 2HQBA 1P4GA 2NPIA 4GUDA 4JFRA 1YJXA 3NMUF 1TE2A 2B94A 2VATA 3C8HA 3D7NA 3QLVA 5JS2A 2XOXA 1USWA 2BI7A 1UKEA 3H18A 4LJAA 3VZCA 4DJAA 2DT8A 1TU3A 4PLCA 2AKEA 4CQMB 2WT9A 4H1VA 2FN8A 4I1RA 1BSVA 3IO5A 4Z9FA 1EEHA 1KMNA 2INGX 3TIGA 1GNSA 3C3CA 1VHQA 4H7KA 1U9ZA 1CIVA 1WZEA 1XFDA 3LA8A 3BKXA 4M60A 4MPPA 4WKBA 1YZLA 3T3EA 4UDOA 3LSYA 3RYFB 1DOAA 4MICA 4YALA 1Z5WA 5IXJA 1IXYA 5EVCA 4IDPA 2HK8A 3BIJA 1SKQA 1BVRA 2YIDA 3E35A 4HFMA 4G67A 1JIKA 2F3PA 4ICIA 4MHOA 4U0KA 1K6JA 1OZAA 5BSUA 2FFJA 4EL5A 3UKJA 2WTUA 1F8FA 1LC0A 2OA0A 2DBQA 2EW2A 5JDIA 1ZOIA 4WDQA 2VBGA 3GZJA 4FMDB 4KQCA 3H8VA 4ZRMA 5LYJB 3HN6A 4XIJA 2GWRA 1JRLA 4PAQA 1A9QA 4E4YA 2FOLA 2VYVA 1E3JA 2GGSA 1QH0A 4QC2A 4PPQA 4W7SA 3U3ZA 3FWZA 3KNZA 1W7AA 1ADFA 1TA0A 1MRNA 2E4AA 4D4HA 1NW6A 4QJBA 1H4TA 4HFNA 4DYVA 2OWDA 1S1MA 4LJYA 2P4HX 4BMVA 3IPCA 2C0QA 4JGBA 3NTUA 3AVWA 2F1RA 3HCCA 4QECA 3W8NA 3NEJA 1Y7HA 1R1DA 4PNPA 1WVGA 3GB9A 3ROTA 1N6PA 4PLFA 2X0IA 1N57A 1KZ9A 1RJDA 1KK2A 3FYUB 3NWBA 4CMAA 4EYKA 1XA3A 4ENUA 4ZCTA 3SVLA 2I80A 2JFFA 2OO5C 4FZ3A 2QF7A 4B71A 2QTAA 2W70A 4A8TA 4UNNA 2XEDA 1KR5A 1KBOA 4RFSB 2DXIA 3LHDA 2R44A 1YB4A 2XYGA 4E7OA 1XBTA 4RA9A 4ACBA 3E48A 1PIWA 3IAAA 4W9RA 4CKEB 1IOLA 1O6GA 2GRJA 1F8GA 1G9SA 1Z0FA 4G4IA 4RNCA 5LFAA 4DUYB 3DO8A 1M6HA 4QSHA 2W2VA 5CGQB 4BB9A 1AT1A 5JPDA 4AUNA 5BN1A 4K88A 3GH1A 4H6VA 5DK4A 4DADA 1FVOA 3WMGA 4M0MA 2HPVA 2NQ2C 1SCIA 1GN9A 3NBKA 4ALJA 2J6IA 1W5TA 2V59A 4IG4A 2Y0DA 1QF6A 1OZHA 2VXCA 5CJPA 4INJA 4WKNA 1ZH8A 4K0KB 2J30A 5F51A 2JH9A 4R3UC 2ZUEA 4Z1OA 1J07A 3FROA 4TPKA 5AW3A 2VNKA 1H4QA 3ZCRA 5L3ZA 4QJ3A 2UZ4A 1G9TA 1CUHA 3KE9A 1BGVA 3NXSA 2I2CA 2W93A 3IO3A 4FFVA 3ZJVA 1Z6YA 5EFZA 4QDTA 2I66A 2OHGA 5EIFA 4FLFA 2RI6A 2VRNA 3RSHA 5JNWA 3ZH9B 5ARBA 1RSZA 2O7RA 5IULC 3ONVA 1QK5A 2Q2QA 4LYYA 1FBTA 1RQNA 1HXHA 3ES9A 3GGCA 5CLQA 3RPEA 4YCSA 4MAAA 3ZDZB 1Z7BA 3FGPA 4Z9XA 4L75A 4I4LA 5IJ0B 1RQRA 2PANA 2B4TO 3CEPB 5AUNB 2J45A 2D1RA 1RFGE 2FZEA 3ITNA 4IW3B 4R1MA 1IL0A 2L19A 1MDFA 5HKLA 1Q84A 1N8SA 2QN6A 2VP9A 1QXSA 2HLHA 4KXQA 4YP1A 3TH5A 2JB9A 4HDNB 1BMTA 4HGOA 3V7UA 1RCUA 1W93A 1HG1A 5EKDA 2Y93A 3AIIA 2ZS9A 3DUFA 1DCMA 3L92A 3NX4A 4KXVA 2HIAA 4YJ3F 1QAOA 3KHKA 4RLHA 5TF4A 5KKCA 3PDIA 5C4GB 3L8DA 1M1UA 4IIJB 4O2BF 1TYCA 2DSTA 1UP7A 3N2YA 2QVGA 4BVJA 4IXDA 4PWYA 5BQ5A 1GLGA 1VZ3A 4UU7A 5M2QA 5T3UA 4QEDA 1YR9A 4FEAA 3W2TA 5T3YA 4JI5B 3N2NA 3SSAA 1T4DA 2ATIA 3NJ8A 1J8MF 1PD1A 2WNSA 2ZRHA 4PX3A 5AOVA 3H9JA 4Y0AA 3ZEIA 5CX1A 3PNVA 3WR5A 3HKBA 4AQ7A 2QSYA 2XF2A 3PXCX 3ZHRA 3IPXA 1YA8A 3QELA 5I9SA 3IUJA 1YS7A 4WXPA 4DE5A 5IMSA 2GMWA 4N5NA 3T15A 4KJZA 5DLDA 4AS1A 4RPLA 5E6RB 4BMDA 5B6PA 4DCSA 1XJQA 3IUMA 4PIPA 1K4YA 2GDJA 2Q45A 4DW8A 2I6UA 3FAKA 1XI2A 1ZK1A 1ZM3A 3WGGA 1EX1A 5L95A 3DKPA 2OYSA 1G0NA 3KU4A 4I08A 5FUYA 1EVLA 4BRUA 1NRWA 1EWQA 4O4JA 3U4HA 2I34A 4B80A 2O8NA 1NUPA 4GOLD 3RR2A 5B2EA 3AFGA 3G0IA 1R0SA 3UEOA 5KTKA 3HVJA 3Q5DA 3ZGZA 5C8YF 1SQ6A 2CMKA 3IKLA 4OHOA 4PWZA 2YNMA 3NAMA 5CVCA 1WB6A 4FYHA 2UU9B 3STYA 1ZUWA 1UDRA 1BHJA 4XXHA 3NH9A 1IK4A 3MGCA 1CUCA 1YOBA 3D1LA 4ZU6X 3P32A 4P5DA 1TJ4A 2VSYA 3RF6A 1NATA 2QTLA 3O74A 1D5CA 2DFNA 4Y0NA 3V3TA 4CI0B 1MH1A 1V1MB 1Q22A 2NTJA 4KMOA 2OSBA 4JXKA 4Q47A 4WVLA 2QPAA 5HS4A 4MW7A 2R5FA 3VO2A 1FXWA 5DGTA 4YRRA 1KJWA 1XX6A 3ZXYA 3PUIA 3TUIC 1ORIA 1JPJA 1M7HA 1H8HD 1K08A 2FY8A 1J9ZA 1ZD8A 4CM4B 3JYLA 4KFSA 5JPCA 1SG6A 4LDPA 3AR5A 1ISMA 1N0UA 4HWRA 4O4IB 3RABA 3PHIA 3UAYA 1WTAA 4D45A 3HU3A 3K5IA 4MUKA 1LDNA 1YACA 4P84A 2F55A 2ZUSA 4AWAA 5CW2A 1FYFA 1N6RA 1W0KD 4TMFA 1EXDA 2A84A 4L8YA 2F8SA 1W19A 4AG5A 1M8JA 4ZO8A 3PGVA 4IJUA 5E9JA 1SU7A 3LP8A 3D2LA 3MN1A 1JEAA 4LF4B 5EJIA 3DFUA 2Q0QA 1N1MA 2O1EA 3PR2B 4HTAA 4R4JA 3SM3A 2OFPA 2IDJA 2PLWA 5JO0A 4DAOA 5HOEA 3A11A 3L41A 1C8KA 1PQ4A 3V34A 1VSUA 1ZNQO 1IB0A 2FQYA 3AM3A 2F1JA 2AF3C 3QA3E 3P45A 4S1VA 4ZAYA 2FR8C 2QSZA 1BGXT 3U31A 2QZJA 1YQ9A 4YRFA 2JGFA 5J2UB 2JVKA 1B73A 2G9QA 1NQTA 3FFWA 4G5QA 3W04A 3MGAA 2O8CB 2AKAB 3CISA 4JEIA 4UAGA 4JXJA 1QFJA 2BFFA 1R50A 2ZJZA 1XNRB 4DL9A 1A1SA 3EXEA 5IT0A 1KS9A 4CM8A 2X8AA 2CYBA 2O7SA 4H6XA 1QTNA 3RD5A 3QU5A 2CXRA 2OTCA 2B6NA 2ZBDA 2XT0A 3IEXA 4OBWA 3O1IC 3IHKA 4Q6BA 5BN5B 2NZWA 3I37X 3RBZA 1AUPA 2AG5A 3FYTA 4WBSA 2CLDX 1AURA 4WZAE 3ZPXA 2OD7A 4POOA 1RAFA 1CDOA 3B5EA 1CQJA 1ETUA 3DMGA 1QRDA 1SGWA 3H86A 4J29A 4KBGA 4TSRA 3GH3A 2IT1A 1QZZA 4LZWA 2XCRB 2JLZA 1EZZA 1ZD3A 1UKVY 2B37A 3MJFA 1A2BA 3WWZA 2AGVA 4M6WA 4B3RB 3L46A 1N0IA 1RMYA 2QZ4A 1AK2A 2AYZA 1XTUA 2C1ZA 3AL3A 3QHAA 3W05A 4B75A 5JJ5A 3OSZA 2QD2A 4WN9B 2Q6LA 2Y92A 3RTEA 5BVHB 3KYCB 2GJKA 3QUCA 4BNHA 2X9QA 3UAGA 1K3UB 3GGSA 3LW7A 1QH1A 1O0CA 1U9IA 3V2HA 1XQVA 9ATCA 4QTTB 2IV7A 1XZQA 5T6BA 1VFPA 2VS1A 4J2TA 4LWOA 5DI3A 3DR5A 3V8VA 3EVGA 3C5EA 5HZMA 2JANA 4AX4A 4KXMA 1IN7A 3AVQA 3SZLA 4Z99A 1DIRA 5AI6A 1DJNA 1ZVJA 2CL0X 3PC6A 1G8GA 1BE0A 1Q0LA 2YV3A 2CGEA 5J5AA 4M38A 3PICA 3B12A 3R3ZA 4Y2RA 4ASUD 1LFDB 2C3PA 4JL6A 4PTLA 3HZOA 4CMEC 1WA5A 4F56A 2CMGA 1NMEA 1SVLA 4QT0A 4MS3A 4TQGA 3REQB 5JADA 1PVOA 3E2IA 1JPVA 3ONDA 2ZS8A 4ENTA 2V0GA 2C2GA 2O9JA 5GP1A 5LQRA 3LDAA 4JLAA 4XD7D 5E1DA 4ARCA 1MNAA 1E5VA 1L4UA 1LNQA 2BMJA 4CV0A 4DR2B 2HA7A 1BCRA 4TUYB 2V4UA 4F2PA 3O92A 1LV8A 1G291 1MABB 3A1UA 2OBXA 4MUJA 5GZ3A 3EC2A 3WLIA 3I6MA 4B4UA 1SC9A 4YP9A 4U5QA 4M9CA 2I4MA 4RTJA 1BXRB 1RJEA 1SRQA 3DV9A 3CH7A 3HWSA 3VBEA 1P60A 1U81A 5LCXA 2BH2A 1KRWA 4KQ9A 5ITZB 2IPAB 3JTMA 1EUCB 4R1NA 2DWQA 2AFIE 5H4HA 2DPMA 1G20B 1V5IA 4CL0A 1OTHA 5AVTA 5LMCA 1Z34A 1C3EA 3JD4A 2R25B 1UADA 1SZCA 3P2JA 3VGPA 2GUGA 3W5HA 1V8ZA 2HFJA 1SU8A 2FPLA 1P62B 3PA6A 2P9BA 5CA1A 2V03A 3MINA 5JYBA 1SBTA 5DHPA 2V9ZA 1OFUX 2O14A 2VDUE 3VR5D 2IQ5A 1VJ0A 2P5YA 3JVIA 3Q4GA 3CTPA 4C4OA 5B36A 5BVGB 3PLAE 5ISMA 3HJFA 2NN3C 2BV3A 3OPQA 2J3KA 5JCOA 2Q27A 1C9EA 2Q6IA 3QOXA 4RIFA 6CHYA 2UYHA 1W47A 4R71A 3WYCA 1G8FA 1NC3A 4JU8A 4HZUA 1K8YB 2QX9A 1E69A 3QM1A 4EENA 1E6EA 1TF5A 3UZUA 5L6LB 1NX6A 1EJ2A 2OL4A 1B8PA 1RXYA 4MV8A 5I9TA 1B8OA 3ZCQA 3TMYA 1MXHA 2FB9A 3TOXA 2Z09A 2QXTA 3FNRA 4JHLA 4EQ6A 3QFFA 4BVLA 4NESA 4L5BA 1PO7A 3H1GA 1ZN2A 4NJEB 1QP7A 3NBYC 1RYZA 4Q00A 3BRCA 4LYAA 4RSRA 1SNYA 3DWFA 4D9KA 2X0JA 5LMZA 4AZVA 2H4YA 3JRXA 5CA0F 3QUTA 4R9VA 1E0KA 3JATB 1W44A 2R7LA 1AK9A 2HGZA 4A6XA 1QMGA 4BNVA 1ZEMA 1ADGA 3QE0A 3H5VA 4H3SA 4RTMA 4C21A 1YB2A 2P79A 1W5FA 2QX4A 4TOIA 3PXBA 2MTBA 1ABEA 3BJZA 3DXFA 4TN1A 3LX5A 4X45A 5TR9A 4WK0B 4B74A 3DAGA 2YS7A 1W30A 3KSZO 2EJWA 3NVDA 1Y6QA 1BEZA 5LN1A 1QQTA 3DUWA 3HLKA 4Q03A 5IAGA 2BI8A 3M1IA 1HOXA 1WW3A 2C98A 1ZD2P 4QM7A 2OVFA 4XYMA 3E9YA 3EH1A 3ZDRA 1YI8A 3EXAA 2QUZA 4UHBA 2VQSA 4ZJZA 1DQZA 2J5QA 2JRCA 3EIEA 1ZWKA 3PXDA 4Q4DA 1YOVA 3LPDA 5F21A 4KWEA 4RF2A 3DBIA 4YMSA 3ND5A 1SHZA 2QX6A 5KYVA 5DB4A 4DJEC 2ZE5A 1Z5NA 5HF9A 2FEOA 3TRFA 3Q85A 1KYYA 4DANA 1DJLA 1YBHA 2YOFA 2PSHA 3I23A 4B2LA 4PCAA 4HUQB 2OKGA 1IBLB 5F2KA 3O9MA 4DCPA 1EDEA 5FEMA 4OOFA 4YYEA 3HM9A 2BTQB 2G36A 1GG9A 1N6HA 4L08A 4WZ6A 1BZYA 1TC2A 5I7HA 5IHXA 4XWYA 1X7ZA 3ASZA 4OFZA 3UIEA 1FX1A 3QEMA 2OM2A 3S44A 1IHYA 1XMPA 1JMYA 2BSQA 1H0RA 1WO8A 5KJ1A 3TXAA 3OUZA 4BB5A 3UHFA 1NY6A 2Y99A 1CUVA 4HDKB 5MFPA 1YVDA 3NH6A 2JLAA 4IXTA 4UULA 3U81A 3INTA 1UJ4A 2QPLA 2ORWA 2VHQA 1B0ZA 1J2UA 3LHIA 3HNOA 5CM9C 2VA9A 1M6WA 1ADCA 4NAVA 3TOZA 4DFDA 4IIHA 4MULA 1DJPA 4B6JA 2GD0A 3DBLB 3GFTA 2I03A 4PFKA 4TV8B 3FMOB 4LDQA 5BNWA 3EPLA 4ACAA 1X1BA 2OMKA 5AKHA 3EHDA 1AU9A 4QTXA 4R8MA 4IGIA 3O4RA 1IAVA 1NW8A 4DV2B 1BQ4A 4V1CB 2QMHA 5DM4A 1Q1AA 2VOEA 2WTMA 3ZE2B 3WE7A 1DXQA 3SXUA 3X1XA 3VH4A 1G6HA 5IYZF 1O95A 1QGAA 2D1QA 3DAHA 1SUPA 2OORA 1B16A 4Q7MB 5DLPA 5BSHA 2MSDB 2I4NA 1E6LA 5PNTA 1W25A 1YBMA 5D6NA 3BZWA 3UJAA 2YWEA 5G1PA 1SPBS 4FB5A 5AVXA 1R88A 5FPHA 3WLHA 4ES6A 1SBHA 2VUIB 2HRDA 5F7JA 3EJWA 1AUOA 4HNQA 3CVVA 1ISIA 2I2BA 3AY7A 2JGKA 3MGKA 4RADA 3H87A 4DLYA 4YRIA 4M9RA 3HUDA 5FLEX 3NM6B 3UJ3X 2UUPA 2VDPB 2YJ3A 2HLDA 2PX4A 1PJBA 1Z7WA 2YJGA 5GVSA 1V4NA 2YH2A 4I9UA 2IOYA 5FPQA 2NWQA 2ECFA 3RWMB 4MLCA 3NDRA 5A6SB 4AKHA 1T0PA 4QU5A 1MJHA 3FUVA 1Y8QB 1I4OA 2FPOA 4D74A 3T3OA 1PDOA 4QTZA 3BK2A 2W2PA 3F98A 4PBSA 3ONWA 3ET5A 3OFVA 4M9ZA 1GYQA 2OXRA 4ND8A 3PKJA 4M8LA 4D92A 2ZIZA 1Q44A 4G5HA 1EBFA 1OXTA 1SKAA 2Q21A 2ZYIA 4O2RA 4OAPA 2GAAA 4Y7CA 4I3FA 5HJ2A 2RJNA 2I78A 1WU7A 1F48A 2V97A 3K1TA 4RA6A 2CFCA 2RHMA 3L6EA 4JQSA 4QUIA 3QW4B 4PGFA 1U2GA 2QZZA 5ABPA 1L5YA 3DBHB 3MS4A 4NCKA 3NNSA 3A6LA 3THXB 2NZ8A 1UBKS 2FK7A 3LOQA 3N6XA 3F5QA 5G4KA 3VO9A 4XJTA 3R75A 3DVLA 4BLWA 1HV8A 2GX6A 4E5YA 4DC9A 3ZJTA 5IASA 3HA3A 1BJTA 3ZG6A 4E88A 5A7HA 1Z47A 1HSOA 1SEVA 5EXTA 1KZ1A 4LW8A 4ZI7F 5LKRA 4ERNA 1NBAA 3ER6A 3GV0A 3PE6A 3MCAA 4KODA 4QPCA 4WERA 5ENZA 2YBEA 3T9EA 4DARA 1A4RA 2Q3LA 1E98A 2A0FA 2F1KA 1H1TA 4FHCA 1MJGM 2QWXA 2XJ4A 1FXUA 2ZUVA 4MRMB 3DMYA 1XE3A 4ISBA 1SRRA 4M83A 5EMJA 1KRXA 2REOA 5EJ7A 3ZCSA 2L0XA 1CUUA 4AD8A 3N53A 1OF1A 1Z6AA 3T4PA 4BS9A 4DRXB 3VDNB 5JHGB 4O0MA 1W34A 2NTEA 1TAHA 4JB2A 2DPGA 1M34B 3DT6A 2OHJA 2BHSA 3WAKA 4F8EA 1QZXA 1L4NA 5J4LA 5FULA 1N0HA 5FUXA 4IQ0A 5E8JA 4C6HA 1I7LA 5JPIA 5ERXA 1TO1E 3AKYA 1S9DA 3EZ6A 4M4SA 3RFVA 3L07A 4RK5A 4F3NA 3HL4A 2FPRA 2HA2A 3TPCA 3RTDA 5DDIP 3T1OA 4D9NA 4OJYA 3FB4A 3QLTA 5G0VA 1MV8A 2X77A 1Y6ZA 2KX7A 4RK0A 1FYVA 3RUEA 4XRGA 4RVFA 4RO0A 3N9IA 4IINA 1J8QA 3EOBI 1YGYA 3KT3A 3GA5A 4MZXA 4TLMB 1T4CB 1DTWB 3TOSA 4B3IA 2ZS7A 3ZI4A 5FUQA 5IVHA 2J9FA 1V8FA 4M46A 3UWDA 3C48A 1B8UA 1E9FA 3IKJA 4CM9D 4QOHA 1PQPA 4WEQA 4U7JA 2JIDA 3SEFA 2XQIA 2CUKA 4ZVPA 4LXGA 4C0LA 4H1TA 2W6ZA 5IBPA 3A6JA 3ZDFA 1CDEA 1CNEA 5CVEA 4E2YA 4NAHA 1B3RA 4F1JA 2H52A 2ZIGA 3MUEA 4JT4A 1Q20A 1QHIA 3PHBE 4MUNA 4R9NA 3L02A 3T9CA 1XCBA 4WBNA 5BQ3A 3SHQA 2FN3A 1ZY2A 1BVUA 1NXPA 2R7MA 3A3PA 3CWZA 1SIBE 3KEMA 4EY5A 5KDLA 1QZ3A 8LDHA 3CF6R 4MWEA 3A0UA 1C0LA 4CCSA 2GEUA 2J0SA 2VHTA 4F85A 3RSZA 1EXWA 3KEQA 4OP2A 1BFDA 1K89A 2HCFA 1AE1A 1TT7A 4FFBA 3RS4A 5A9SA 4JT9A 2AWNA 2N9UA 4RHCA 3AVTA 3FUCA 4HDMB 4PSVA 1NMSA 2M6RA 3R4VA 1I0LA 2RGNA 3HUFA 2CMFA 3ILHA 4TKLA 3VX3A 4YCLA 1DCKA 3LYAA 4HS9A 4XUCA 4C30A 3G2PA 3ESCA 4KJXA 1QVZA 4QZVA 1V8DA 3H9QA 3MT0A 4RY9A 4MMYB 1N25A 2OBMA 4A10A 4ETMA 2J4FA 3K72B 5EWMB 3UMGA 1XROA 2PA3A 3W7VA 1DUVG 4NBSA 3TKLA 5KQSA 1EJ6A 4NCXA 1OBHA 2AW3A 5ALLA 3ADCA 4E12A 1MEJA 3C87A 4MW9A 4RW0A 2GZMA 3IBFA 1GR0A 3A06A 5EJ2A 4P5EA 3KKNA 1F1BA 2JFQA 4I50B 4RTQA 1CZNA 5AW7A 4PG8A 3C3DA 2V45A 3JQGB 3NRBA 1VJTA 3IB3A 2FSVA 4G2TA 1OLXA 2ONJA 1QFZA 1NJ1A 3LIIA 5SYMA 3ZE9A 4FOSA 2VAPA 3QZUA 1NDUA 1UBOS 4A3SA 3WHKA 3EXHC 3TL2A 3AHCA 1J7KA 4ND4A 2UXCB 2IS2A 3PX7A 5BUZA 4B47A 3AGPA 4PZLA 5FRDA 3H42B 3L0BA 3WWYA 1UFKA 5EIBC 4CKXA 2JKYA 5JSFA 2UUAB 1CUYA 4CR6A 3QVVA 3PRKE 3N2GA 4C3VA 2ZSDA 1CHDA 5JD5A 4A0RA 1BQ3A 4YGYA 1UBMS 2IUFA 1FRFS 4MROA 3NTXA 4JN6B 4JKYA 3MWDA 5E3JA 2P7HA 1X7XA 2H51A 5LWHA 2FHPA 2VSFA 3WL4A 2WB4A 1R6VA 5DNAA 4OAQA 3K5HA 2HMTA 1VRWA 5KYXA 5F5NA 4HC4A 3EDYA 4UQLA 2C4WA 1ND6A 1U65A 3HLYA 5TJ9A 1G60A 4EPVA 1EK1A 3K2BA 1DKNA 2FUNB 3QI7A 1HETA 5KWVA 1KDRA 1YXMA 2ZP1A 1UKCA 1RRKA 4MARA 4Y1FA 4ZOLF 5C4MA 1N7IA 1X9HA 2I4OA 2O2EA 2B92A 2DKNA 2C9BA 3EODA 3EQZA 3LT2A 4KBFA 4MGYR 1JQ3A 3HL0A 2WHPB 721PA 3GO4A 4CMGA 4G1UC 1K7XB 4XIIA 1T6BY 1JSZA 3NHBA 1NM5A 3H0EA 4DIMA 1O0SA 3V48A 4MYSA 2XX3A 3WOHA 4GDFA 1AZSC 1QWSA 2UVQA 3OZ7A 1G59A 3L5OA 4EUSA 1OGIA 1XPJA 5ADVA 1XEWY 3CGGA 4PC2A 1DO0A 1CVLA 4D9MA 1N7HA 2EQ5A 4WADA 4TS1A 3T5DA 3LX6A 1WVMA 2BEWB 3K2QA 5DHSA 3CX4A 3VC2A 1BXZA 1U7HA 1LRLA 2RGCA 5GOZA 2EFDB 2ON6A 3R3JA 3MPUA 2Y0EA 4YK7A 2H4JA 5AJVB 5GM1A 4JXZA 3HA5A 4NV0A 5G1NA 1E1QD 4X00A 3VR3D 1KEUA 3OLXA 1GGNA 1LB1B 1U8XX 4YRDA 2JJ8A 1PFGA 2AUNA 2R1TB 1FLVA 4E1AA 5EZYA 4R3WA 4X24A 4OMUA 1HFWA 5B7NA 1XGKA 4Q1FA 1ZH6A 2GR9A 3LUDA 2VNSA 2VPWA 1VCHA 1HMPA 1RI3A 4ATNA 2COEA 1YBFA 3C2QA 3P7MA 3IAEA 1TT5B 2C2YA 1RAEA 2ZWOA 3AONB 4S3MA 3U3JA 4OSEA 5HKAA 1XXHA 5GJBA 3U4GA 1JQLB 2H9YA 4KO4S 1JHYA 3HACA 4IEIA 2P8JA 4KRXA 3RASA 4JU9A 1PS0A 1L4LA