4XUCA

Synthesis and evaluation of heterocyclic catechol mimics as inhibitors of catechol-o-methyltransferase (comt): structure with cmpd18 (1-(biphenyl-3-yl)-3-hydroxypyridin-4(1h)-one)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
218
structure length
218
Chain Sequence
NLLAGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Synthesis and Evaluation of Heterocyclic Catechol Mimics as Inhibitors of Catechol-O-methyltransferase (COMT).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 218
sequence length 218
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2015-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4xucA00
2AOTA 1RJEA 2PT9A 2PXAA 3FUVA 3NDJA 3PX3A 4BLUA 2G70A 2OBFA 3TLJA 3PS9A 1NW6A 4PGGA 5DXJA 5DM0A 2ONZA 1B42A 3E7PA 3FPJA 1SVUA 3F4KA 4FSDA 2XYVA 3BWYA 4R8SA 5ERGB 3EVAA 3VSEA 1VBFA 5KVAA 2H11A 3GWZA 2DULA 3KQPA 4RTPA 1IY9A 2AOXA 1N7IA 2NXJA 4OQDA 3THSA 1P1CA 3DXYA 3UJAA 3T7SA 4ER3A 5CUQA 1TPYA 3BWBA 3B7PA 4CTJA 5FA5A 2C7QA 3KU1A 2G8NA 5HZMA 2GB4A 1ORIA 3P9NA 3UJCA 1QAOA 1L3BA 2P41A 1XDZA 4WXHA 2ZTHA 3G2OA 4QVKA 3EGIA 3SXJA 4AUKA 5KQSA 2PXCA 5BW4A 3FUWA 2R3SA 2R6ZA 2YTZA 1EQAA 3DTNA 3DXXA 1FJXA 1FP1D 1X19A 4BLWA 1IXKA 3CC8A 3BGDA 3THRA 4MQ4A 5GIOE 4PYLA 1YB2A 5CVDA 4B17A 3E23A 3QV2A 3BT7A 5GWXA 2YXDA 2IH5A 3U81A 5C9ZA 5C1IA 5K8VA 2ORED 2P7HA 1DUSA 1SUSA 5JR3A 3BGIA 4P7FA 4U7PB 2I9KA 4O29A 4GOMD 5K0NA 1QAMA 2HMYB 3FPHA 3HEMA 2GH1A 1WY7A 3OU7A 5K0CA 1P39A 2O05A 1Y8CA 5ICFA 2ZFUA 4C06A 3LCVB 3OU2A 4FP9A 3I58A 4E70A 1XDSA 3G5TA 3T0IA 4RTOA 1YFLA 4BY9E 3BKXA 1V39A 2IDJA 3EVFA 4DA4A 2GLUA 3UFBA 5FA8A 3HNRA 1INLA 3P9CA 4KDRA 4E2YA 4G56A 4QPNA 2VZ9A 5EGSA 2IBTA 2AVDA 3LL7A 1JG1A 2IDKA 2UYOA 1SQFA 3IEIA 3SR4A 3G89A 4EMSA 4PCAA 5E1BA 4C07A 3C3PA 4LWOA 3M6XA 1KXZA 3QOXA 4PIPA 1XTPA 2YXEA 3HA7A 3M4XA 4F84A 2BM9A 3DMGA 2PXXA 4WVLA 5DRYA 4PYOA 1ORHA 2AOUA 2EX4A 3LECA 2ONYA 3CBGA 3SSOA 1NW7A 2Z6UA 1P91A 3B5IA 3GRUA 3BZBA 2PX2A 3KR2A 5F2NA 2PVCA 3A4TA 3I53A 1UIRA 3LHDA 3I9FA 5E1OA 1DL5A 2OB1A 5B1SA 2OXTA 5K05A 2NP7A 5CCBA 4CWAA 3BWMA 2P8JA 4GOLD 1M6YA 2OPBA 4HTFB 4PONA 3MAGA 5LSAA 3ELUA 2YR0A 2YQZA 2AVNA 3MERA 2Y1XA 1VQ1A 3P9KA 2C7RA 3UZUA 3KPVA 3TM4A 4UOEA 3GU3A 5E9JA 3HTXA 4OX9Y 1KR5A 1ZG3A 4OBXA 3M6WA 3OZRA 1KYZA 2ZVJA 2ZWVA 3C6KA 3FRIA 3PVCA 1I1NA 3C6MA 3EMDA 3TKAA 2ZBPA 2QM3A 4KDCA 1QZZA 2BM8A 1I4WA 5EEHA 2IP2A 3FPGA 4PYMA 5FQOA 2OB2A 5ICEA 2ZW9A 4PYJA 4YMHA 2IPXA 2BH2A 1XJ5A 1PRYA 2EFJA 3P97A 2ZBQA 4E33A 3NTVA 3KHKA 3R24A 3R0QA 3FTFA 1X1BA 2Z6QA 2P7IA 4YUZA 3S68A 4RTSA 1O9GA 4KWCA 2ZZKA 4AZSA 5ICCA 3MB5A 1WG8A 4Y30A 5E2BA 3V8VA 1ZQ9A 4XUDA 4MTLA 3O31A 3IYLW 4AX8A 3EGEA 3D2LA 2QRVB 4FSXA 2IGTA 3HA3A 1MJFA 2C7PA 3B89A 2IFTA 2P35A 3M70A 4IV8A 4X1OA 4M38A 3R3HA 1JG2A 2Y1WA 3DLCA 2UZ4A 3JWHA 4FT4A 4QTTB 4RTKA 4CKEA 8MHTA 1HNNA 4IWNA 3LKDA 1XDUA 3PFHA 3UJBA 5KQRA 1SUIA 3LSTA 4FGZA 2EJTA 1JG4A 3M6VA 2JH8A 2OY0A 5K0LA 5MHTA 1R74A 3SSNA 3FYCA 4C05A 5FUBA 4E2WA 4EKIA 3OZTA 4YUYA 2Q41A 2PBFA 4HG2A 1XXLA 3NJRA 4PYNA 3SX0A 3KPUA 1Z3CA 3LBYA 2E5WA 4GOND 4LECA 4R6WA 5EHGA 1ZGJA 2XYRA 5P8WA 3MCTA 5DT2A 3RW9A 3TPZA 1M0EA 1BKYA 4ER7A 3G8AA 3HVJA 2CMHA 3JWJA 4QQNA 5DPMA 5T64A 5CVJA 3TKYA 4EK9A 4C4AA 3EVDA 5CIYA 2UYQA 4Z2YA 1L3CA 5K0BA 5LQCA 5EQJB 3TM5A 4MWZA 5EMLA 4Y2HA 1G60A 3LCCA 1ZKDA 3SM3A 2IH2A 5T6BA 3EVBA 1TW3A 4GUAA 1D2HA 3G2QA 4AZTA 2EJUA 3HVKA 3RODA 3FTDA 2GPYA 4ER0A 2H1RA 4FS8A 4OBWA 2ZCJA 1EIZA 1FBNA 1JR4A 4QQKA 3BWCA 3T7RA 4KRGA 4E32A 1D2CA 2EG5A 2IIPA 2KW5A 3DXZA 2B25A 5K03A 4MIKA 3NW9A 4RX1A 4L7VA 1YF3A 3KPJA 3LDUA 3QOWA 2AS0A 3A7EA 3AY0A 2VDVE 3PFGA 1RJFA 1VP3A 4QVGA 1VPTA 5EZQA 2NP6A 3H2BA 2LD4A 5F2KA 4E2XA 3DUWA 5EHIA 1WXWA 2ZIFA 4RVHA 3Q7EA 4YV1A 1KPHA 1NBHA 2PT6A 3UA3A 5KYGA 3T7TA 3NVMB 1L1EA 2PV0A 2V7EA 3P2KA 3PB3A 3FPFA 5DM2A 4POOA 3G5LA 3EPPA 5LQJA 2IBSA 3P9IA 4QDJA 4PIMA 3EVGA 5GIPE 4RTMA 1VE3A 2O0LA 4YMGA 5K0FA 1G38A 5CVEA 5EPEA 1H1DA 2O57A 3HA5A 4JXJA 4RVGA 4M36A 2YX1A 1BC5A 5GOZA 2ZBRA 4C03A 2QYOA 2I62A 5E8RA 10MHA 2VDWA 1RJGA 4QPPA 3BXOA 1QAQA 5FHRA 3FTCA 3OPNA 4GF5A 4K6MA 5EKUA 5E9WA 1RI2A 2ESRA 3B3GA 4P7KA 2FK8A 3AXSA 4KIFA 3DH0A 4P7GA 3OFKA 3DMHA 1EJ0A 5FCDA 5M5BA 3KQMA 5FTWA 4ER6A 2H00A 1JQDA 2JHAA 2OYRA 2OZVA 1QYRA 1BOOA 1L3IA 4QDKA 4YV2A 4PYQA 1G6Q1 2N47A 5FWAA 3AJDA 4RVDA 4V0QA 3WSTA 2PGXA 3ANXA 5JUWA 3KPWA 5HFJA 3ER8A 2AOTB 5HIIA 3G88A 3NWBA 3A7DA 4ATNA 4DQ0A 3HP7A 4YV0A 2Z6AA 1G8AA 1R18A 4E2ZA 3HCEA 3HCFA 5LQAA 2ADMA 3C3YA 2PX4A 5K09A 3UJ9A 5DSXA 1X1DA 3AXTA 3VYWA 3GIWA 3DLIA 2AN5A 3GRZA 4EQZA 5EKXA 1EG2A 2IH4A 1T43A 3FRHA 3ID6C 3IHTA 2BR3A 4PWYA 2UYHA 3P71T 1NW8A 1YFJA 2GS9A 2ZLBA 3LGAA 3VC1A 3LDFA 2B78A 3KQWA 2ZULA 4KW7A 3KQSA 5E1DA 2CMGA 5EG5A 1HMYA 1YZHA 5EMJA 1KIAA 1P1BA 2NXEA 3MHTA 1XCLA 2CKDA 3E8SA 4AZVA 4BP1A 1SKMA 5DM4A 4V0RA 4DMGA 3P2EA 5FULA 3JWGA 2PX5A 3G2MA 4XUCA 5LQKA 3TRKA 4PYKA 1N7JA 5HIKA 9MHTA 3B3FA 5EMKA 1U2ZA 2BR5A 1AV6A 4LG1A 2JJQA 5BP7A 5CVVA 5DRTA 5LQNA 3GXOA 1R00A 3DR5A 3HVHA 3UWPA 5EMMA 1JSXA 3FUTA 1O54A 5DWQA 1FP2A 2P40A 4YUVA 3OU6A 1YUBA 3LDGA 1UWVA 1RI5A 1NW5A 2XBMA 2VS1A 4HRAA 2FRXA 5BXYA 1NKVA 2PX8A 2OKCA 1WS6A 3CGGA 5DM1A 1KHHA 1NT2A 4E30A 3OZSA 4CTKA 1TW2A 3EVCA 2F8LA 2YUIA 1JTFA 2CL5A 1RI4A 5FADA 4BP3A 4C04A 1AQJA 3GNLA 2V74B 4FT2A 1PJZA 5DTQA 4A6EA 2PLWA 2PSSA 4LWPA 3LKZA 3I5UA 3KQQA 3HCCA 4RTJA 3CJQA 1BHJA 3GJYA 4PCLA 7MHTA 5E2AA 2B3TA 2VDUE 4NECA 5GP1A 3CCFA 2ZZNA 1JG3A 2AOUB 2HNKA 3I64A 4RVFA 3MTEA 3HVIA 1UFKA 1I9GA 5BW5A 5EZSA 2A14A 4HTFA 3A25A 5EVJA 3KR0A 2NNWB 4HC4A 3EMBA 5K0EA 5IKMA 4RWZA 3TMAA 3A27A 4CKBA 2YXLA 2FCAA 1G8SA 4KIGA 3KQTA 2WK1A 3REOA 5FQNA 5CD1A 2BZGA 3TFWA 3HCDA 3RIEA 5DXAA 2P3LA 4GEKA 3ELYA 1R6AA 3UBTA 5DX8A 4PGHA 4ZTBA 1Q0TA 1O9HA 3SMQA 2DPMA 2PKWA 4R05A 3BUSA 1N2XA 1NW3A 3G8BA 2ZIGA 5E9QA 4M37A 5FWDA 3IV6A 4F85A 1D2GA 5IH3A 3HM2A 1KYWA 3A26A 4U7TB 4X63A 1AQIA 1EAMA 2XVAA 3CJRA 2G72A 5CCXA 1QANA 4DZRA 1L9KA 2AN3A 1YZ3A 3CVOA 5EIFA 1NV9A 1RJDA 5HIJA 4P58A 1NV8A 5DTMA 1NE2A 3C0KA 3OCJA 3DMFA 3MQ2A 1ZGAA 4M7RA 5DSTA 5HOQA 2ZIEA 3EVZA 4RSRA 3JWIA 4FZVA 2K4MA 2NYUA 4GQBA 2WA2A 4QTUB 2QRVA 3GRRA 5U4XA 2I7CA 1X1CA 2NXNA 2I6GA 1NBIA 3KKZA 4HGYA 4XUEA 4RTNA 3E05A 3K6RA 4R6XA 1VL5A 3BGVA 5HEKA 3PLAE 3P8ZA 4EKGA 1KPGA 3ELWA 2FHPA 3PX2A 5KS2A 4R8RA 5LR6A 1WZNA 2AN4A 4RTRA 4GC9A 4XCXA 3G7UA 5E8JA 4IV0A 3NMUF 4RV9A 5D1NA 4E31A 3FYDA 4OA8A 3UJDA 5K0JA 1WXXA 3DOUA 4HH4A 5T67A 4C08A 3ER9A 1VIDA 2PJDA 2XYQA 4ISCA 2JH9A 3MTIA 4RTQA 4HGZA 2HWKA 3M33A 2P1DA 3EGVA 2WA1A 3MGGA 3PT9A 5CM2Z 1MHTA 1JQ3A 4EVIA 5G02A 5K01A 5GM2A 4DCGA 2P3OA 2G1PA 3TR6A 3SVZA 3NVKI 3B3JA 1SQGA 4GC5A 5GINE 3LX6A 3ME5A 2O07A 3DP7A 5FHQA 5LQUA 1KP9A 4P7JA 4X61A 5CVUA 3GDHA 2JG3A 4CXMA 3UJ6A 1Q0SA 2B9EA 2GA9A 3LCUA 5F2OA 2AOVA 1DCTA 5D1HA 4A6DA 1G55A 5DTRA 1RI3A 5C0OE 3R6TA 1IM8A 1R8XA 2OO3A 1JTEA 1VLMA 1X1AA 3EVEA 3GO4A 2P3QA 1ZHFA 3NDIA 1OR8A 3KQVA 3LBFA 3TOSA 3UJ7A 1FPQA 3GGDA 3SSMA 5K0GA 5HIMA 4RTLA 3OE5A 1F38A 2PWYA 3FUXA 2FYTA 1XCJA 3FUUA 3BKWA 2HR1A 4RYLA 3KR9A 2ZZMA 3UA4A 3MCZA 2GAFA 4X60A 3NWEA 1R8YA 3GRYA 3R9XB 1SG9A 4FR0A 3FPEA 2XVMA 4F86A 3OE4A 3GRVA 4H0NA 4GBED 5E1MA 3ERCA 2NXCA 3L8DA 3ELDA 3K0BA 5HILA 1JQEA 2AOWA 1RI1A 5EC8A 4DCMA 4DM3A 3OFJA 1JSZA 5ICGA 3LPMA 3EEOA 4YUXA 4DF3A 4BLVA 2AR0A 1F3LA 3EEYA 3AWIA 2BR4A 2G71A 3CKKA 3O4FA 2HTEA 1M6EX 4CKCA 3HCBA 3SGLA 3O7WA 3VC2A 2UYCA 3GCZA 2O06A 4PYIA 4ER5A 1KPIA 2CWWA 2ERCA 2HV9A 2JHCA 2YVLA 5GM1A 5H02A 3KQOA 4X41A 1AF7A 5EOVA 2QY6A 4MHTA 4PNEA 3PTAA 2FPOA 2FK7A 3FZGA 1VP9A 3KQYA 1XVAA 1EJ6A 3KPYA 4OA5A 4PINA 3DULA 5EEGA 3KR1A 4YUWA 4DKJA 4GOOD 3Q87B 2B2CA 3V97A 3P2IA 2ZSUA 5EIWA 5DX0A 3CJTA 2PY6A 3M6UA 3TQSA 5DLYA 2VP3A 3G2PA 4IKPA 3FTEA 5LQRA 3ORHA 2AZTA 2JHPA 2PWPA 2QE6A 3HCAA 4HSGA 5DX1A 4OQEA 3X0DA 4KVZA 4AZWA 2C7OA 3UJ8A 2ZWAA
chains in the Genus database with same CATH superfamily
4UAVA 1CJSA 5CB4A 3F7MA 3G0IA 4L22A 5DP2A 3ZHBA 4EBBA 1W0JD 1U2QA 4N12A 1L5NA 2ZM5A 3ZJTA 4V03A 3ICWA 2BMJA 4WJKB 2WV7A 1SXJE 3G0GA 4L2IB 4HWRA 4FHZA 2NPFA 2XYVA 4B3FX 3VUEA 2EAUA 3G0BA 3P2MA 3IS3A 4BN5A 4N8DA 3ZD8A 4JIGA 3T61A 3PD0A 1KJZA 1AHNA 4Y6OA 4ZJUA 1U8AA 4IMJB 1BN7A 1BEEA 4PG4A 2XRMA 3KT6A 3NTQA 4K28A 1SOVA 1NI5A 2QQ0A 4N5LA 3T7SA 4YRZA 4AMGA 4H1UA 2NZJA 4GMGA 4XWWA 1BWPA 3LKVA 2LP4Y 1ORIA 3QXXA 1ZPDA 1JMVA 3IAFA 4RA9A 4YS6A 4EHBA 4QVKA 4AUKA 3EGIA 1ID8A 5F21A 1A4RA 3BIXA 1O5OA 1YZNA 1ZGGA 3P27A 4QWMA 5AM3A 3TLEA 3WYDA 3CVYA 3NTUA 1K4YA 3W9UA 4Q3KA 4WW0A 1PGJA 4CHGA 3SF8A 1YB2A 4FHDA 3GOQA 4I55A 4KIUA 1D6JA 4ZPJA 4Z54A 3WLMA 1PTJC 4JNKA 1KU6A 4TMTA 4E5YA 3ZWCA 3JAMA 2BL4A 3L92A 1ONBA 1E4VA 1YR6A 5JR3A 1EKXA 5GJWC 2RIPA 3T0FA 1FP4A 3G79A 1AGRA 5LDDC 3FPHA 3OQNA 2QA5A 2W6ZA 4E09A 2O05A 4R1QA 4TTRA 4URHA 4D81A 4M1MA 3TL6A 3ZXUB 3K3PA 4I14A 5DBGA 3A6JA 5A05A 2ZUFA 2QNRA 4CBVA 4G0PA 4BV2A 1AE1A 4KDRA 3VPBA 5FPPA 1CP2A 1CY2A 3GUYA 1G1MA 2CUZA 3H05A 1JG1A 3VHLB 1RKVA 3K0CC 1RRVA 2VT3A 3W34A 4PCAA 4I9NA 2P2SA 3WZLA 3LHSA 4LI3X 1TAHA 1EJBA 3S2GA 4F84A 1YNOA 4U2EA 1GPH1 1Q20A 4GH5A 4IHJB 2OP1A 2FGKA 2P2CA 2BEWB 4PYOA 3HN7A 3OSUA 1FY2A 4KXUA 4WOCA 2EWVA 1C30A 5ER9A 4HUTA 2IF2A 4YRLA 2OV4A 4GI7A 3KR2A 2JLRA 4W7IA 2QW0X 3VVBA 1ECFA 3A05A 4WZAB 3NONA 3EIQA 3RO7A 4F3NA 4MW2A 4H1WA 3KZOA 3NQ41 1U2DA 4ARZA 4R5MA 2Z95A 4LVOA 4XPZA 1I14A 4DMCA 4YRAA 3K9NA 3MAGA 3PNPA 4L02A 1BVUA 3NHMA 2ANBA 2Y1XA 2JLWA 4CODB 1ITZA 2C94A 2VHXA 1AKWA 4QFDA 4P22A 5A02A 2AMJA 5IARA 1LX6A 5FPKA 1K7FB 4LIPD 4OX9Y 2FP4A 1FNCA 2I55A 2QLJA 1EVEA 2R7LA 4WLVA 3VR6H 3VU9B 4KQKA 3LC2O 5IHPA 3LC7O 3EMDA 1IMOA 2M2IA 1CR6A 2EBUA 2PWZA 5ARDA 2A0KA 4GZ6A 3ZTYA 3BEOA 3OM8A 3SKXA 2FZLA 2X23A 3CUKA 4MQ6A 1D2NA 3GT3A 3JAKB 4NZ9A 5JY1A 3DG9A 3WK7A 1CUXA 4BX2A 1TVEA 5BSHA 3LUPA 1DNPA 1NURA 3O3MB 2YHIA 1NUQA 3O2NA 3R7AA 2BSXA 5DN6D 1KMNA 3ZXSA 3LM8A 3RF7A 1O9GA 2I6FA 4AZSA 4MULA 3ORFA 4IEFB 4JBYA 4RZ2A 4BCBA 4UU8A 5TV2A 7ABPA 1GILA 5IZCA 2OCPA 2Y0BA 5JZ9A 1NVVR 1IK6A 2R6HA 1PKXA 3QE2A 3DOJA 1JLMA 1XLVA 4V38A 4TXJA 3PRJA 3M70A 4N5DA 1GKYA 3AKCA 5CX1A 2VUUA 1NUAA 3DLCA 1I3LA 1Q2XA 4IX9A 1DWQA 1YRYE 5ELMA 4UDOA 1HE5A 1R4MA 1WKBA 2NVOA 3TOXA 2P9EA 2TSYB 3SI7A 3D1LA 5C8YF 8MHTA 3LY7A 3RRMA 3S6JA 1SQ6A 4IIUA 3PL5A 5A2QA 4ALNA 4DZTA 4GBMA 3WE7A 1KJYA 1DOZA 1QDUA 2FZVA 4YUYA 5AI5A 1YKFA 3LGXA 4KFRA 1HUQA 3NVAA 4O0MA 3WR5A 4A2CA 2WJVA 5FO0A 1MORA 4QO7A 3UGQA 1WMAA 3ACDA 4S12A 4NCNA 5L95A 1BFDA 1M0EA 1DO0A 1I0IA 3QU2A 4J0DA 4EYSA 4QVIA 1ADCA 1VLHA 2A9VA 4NH0A 1NF8A 2GJ9A 5CDSA 4LXIA 2AMFA 1UOEA 5JIBA 1H8ED 2V7QA 1UPTA 1PFKA 1P0MA 2V45A 2W2QA 3HR4A 2W6CX 3OE7D 1M1YE 4IKEA 4MWZA 4UW9A 2OXIA 3UXEA 3LLUA 1TM5E 1Z12A 4UEJA 5G0VA 4JJFA 5B1YA 4O1IA 3HVKA 4M9SA 4RMGA 3TTXA 5EE0A 2VK1A 4PS0A 4ARIA 3DC7A 2OHVA 1O95A 3PDIA 4L9RA 4WX2B 3UTDA 3CWQA 4RFSB 4HUJA 4LY6A 3AEXA 3DXZA 1NMYA 1UJBA 1D3AA 5JAIA 5BWLA 1L7NA 3WA7A 5KYKA 4AT1A 3EGOA 5E6SB 1HL3A 1JZQA 3AIKA 3FSRA 1P1JA 3DAHA 3TN7A 4J0QA 1WPGA 1V1MB 5BSTA 4PX5A 3NM6B 3IEXA 4ZO8A 1SZPA 1ZAYA 5IT0A 1ZVVA 3K2EA 4ESVA 2OD2A 5AM2A 1C7ZA 3MTDA 3FBTA 2V7EA 1ABEA 4JUIA 2IWHA 1D5WA 5AJUA 1TD9A 2W22A 5JZBA 1HNXB 3H2JA 3K53A 4NSNA 1F20A 4NJMA 4OY3A 4ZREA 1G4AE 4GNKA 3IOEA 4RHEA 1AGPA 4HVCA 1E8DA 3K8QA 4GKJB 3TZBA 3ZWXA 2HXSA 4RTMA 4BEBA 1H8HD 3N1UA 3QYFA 1KQ3A 4YMGA 4Q3NA 4HFNA 5AO9A 5J4LA 3N05A 1E3LA 1YQTA 4HFMA 4G4IA 3PD1A 1I36A 2RI6A 3CXUA 4WT7A 3TCXB 2ZM6B 3FR8A 2I62A 3KXDA 1RP1A 4ARCA 4YIHA 4CTNA 2RG1A 3B3AA 3BD8A 3B82A 1GPKA 3WAGA 2ESRA 4ASUA 3CCBA 3ZIDA 4EGFA 3O1IC 1FIUA 4XQGA 4UU0A 5DTEA 2QR3A 5HF5A 2KBEA 5T8KC 2OYCA 3BF8A 5ESXA 5ELXA 1VJ5A 3ETNA 3B5JA 3RVOA 1AKYA 3EZFA 3QPWA 4QBGB 3GLHA 1OB5A 4Q9IA 3ANSA 3I01M 4V0QA 4WA7A 2F8MA 2HDOA 2GBPA 5LXTF 3ICOA 2ZVQX 4IDBA 4DYVA 2NYVA 3N8GA 5KYWA 4FNMA 1HE8B 4B4KA 2Z6AA 4E2ZA 2QX8A 3P0JA 3OOSA 1T26A 2PLAA 2EX1A 4I1IA 3LX4A 4QBTA 4RHTA 4TV9A 4KRXA 3EARA 3VHRA 1IM2A 4Y2YA 3DZBA 3U2QA 2CC2A 2WJPA 5EKXA 1NBEA 2CEKA 3AJAA 4D3XA 2V4UA 1FNDA 1XG5A 1GUBA 4RS4A 3UAGA 4B2YA 2C3PA 2QUBA 2RBGA 4K6FA 5J9FA 2FXIA 3LGAA 3H83A 4GZ5A 2NTYC 4OF4A 5B1HA 3GDOA 5EKDA 3SS8A 3IPRA 3G8CA 3EIXA 4FDAA 1ABFA 1GGKA 1GR1A 2DUMA 4AG3A 5AD1A 3IQHX 2DE0X 1KE2A 4DIOA 2AXPA 1C9EA 2A0FA 4B6FA 3M9LA 1ZD9A 4OKSA 4P31A 4EEXA 5I9IA 2WFLB 5MN6A 3RIXA 1EWRA 4Z7JA 1EX1A 2H4YA 3HPRA 3MLAA 2Z1MA 5EE1A 5I9BA 1E7MA 4PE5B 3MMZA 2B92A 2GI4A 1VJ0A 3CNBA 2ZSIA 4B45A 5DRTA 1Q1QA 2QP9X 3EH1A 1QHYA 3B6EA 2XNKA 3MQFA 2POCA 2PVPA 4XJSA 1OD6A 5DWQA 4RL4A 4HQLA 2KPOA 4YRIA 2FEWB 5KNBD 1XLTA 1E3EA 1BQ4A 2VS1A 5KCMA 4HRAA 3VR4D 1PNTA 1ZJ5A 3FFBA 4RMIA 1R9NA 4TUYF 5KOJA 4L0CA 4HLNA 3L6OO 1YHYA 3DEAA 4PR0A 1NT2A 3RU3A 4C7VA 2XHZA 4F12A 3HYNA 1LCIA 3K15A 1XZLA 1IY0A 2EKDA 2HKIA 4F11A 4G09A 3W8DA 3NNDA 1ENZA 4L0QA 1V3TA 1UT8A 2V74B 1PJZA 3FB1A 2OZLB 4LTMA 5IVKA 2IT1A 5L3QA 5C9ZA 1X14A 1XXHA 2XTJA 3Q2IA 4HDSB 4M6WB 4PG7A 2KM1A 2IV2X 5ALJA 4XX1A 3SU8A 2WHPA 1DC7A 1QK5A 1L7BA 2QVLA 2XUKA 5MN5A 1ISHA 4N3BA 1TD1A 3E0XA 5EWMB 4I6JA 5ALYA 4M9CA 2OORC 2IOFA 2QUKA 3GI1A 4TKZA 3CMMA 1L7VC 2BRUA 4MGEA 2ZJOA 3SPXA 4D9EA 5EESA 3FOFC 4MH0R 2RGGA 1QFYA 1YKSA 3TD6A 4M99A 5EJ9A 4P5EA 3AEUB 3MRVA 2H1VA 2PK3A 1COWD 1TMGE 2WK1A 3KQTA 3OCVA 3K6SA 1AZSC 4C0JA 3NI2A 2PEZA 4II7A 3Q6NA 4MARA 3ELYA 2FEMA 4K3UA 1C7EA 1M74A 1OMOA 5HKLA 4BLPA 4XYLA 5JMWA 3VNUA 1AJEA 5LOVA 1XD9A 4K9OA 3CWZA 2IL1A 4QIHA 2FMKA 1PEDA 1L5RA 2GUGA 1THTA 1V8BA 2RGYA 4QPDA 4C4RA 5B4UA 1J7JA 3TE6A 2CE7A 2PAFA 3RUFA 1QANA 3ET4A 4BUZA 3AVXA 4EG5A 2XWPA 4U5QA 4MITA 1QHSA 1GARA 5BVGB 1FDVA 2IX3A 3PRHA 3TRDA 3U1TA 3EVZA 1LRLA 3R5XA 2XQIA 3O83A 3RSCA 4JYZA 3JWIA 4TTIA 1PYDA 5IUKC 3A4VA 1SOUA 3UXYA 1XOIA 1DIOB 4Z49A 4H17A 3KKPA 3OLQA 4KUHA 4M49A 1DFIA 2Y4NA 3L4BC 3RARA 2HUPA 4C7OB 3E05A 2ZT6A 2ROQA 4EJSA 2QRZA 3EIHA 4LYYA 2XEDA 4MVWA 1OGYA 2Q3JA 2JGMA 3HXPA 3LW7A 3ANLA 3H6HA 1KI6B 1HTTA 2I5PO 4RXTA 2GZ1A 3N8DA 4M9RA 3TTTA 3QLEA 3KYDA 2FW6A 3RKSA 2CNBA 4WXMA 1YQUA 1RWKA 3QLJA 2IYWA 2XCLA 4HH4A 1ZOPA 4II3A 4CMJA 2ICAA 1ZL2A 4KWIA 4ACAA 4HGZA 2NO1A 5EZYF 3LT1A 3S28A 3TXXA 1C7FA 3QKUA 4Y6QA 2C54A 2BOVA 2WOJA 2ZDQA 3I6YA 3DE4X 3LO5A 5LMUB 4GS5A 5IT5A 3LPNA 1F7VA 3L04A 1CF2O 4L15A 5JAZA 2CNNA 3HU5A 4D0SA 3WX0A 5GINE 1IUOA 5BV8A 3D0RA 3WIVA 3U5ZB 4OI0A 1JJ7A 1K4MA 2EGHA 1QG0A 3FW1A 4P7JA 5E95A 4BJ1A 4D3ZA 1G2QA 1KWKA 3HN6A 1QVAA 1ZK1A 3UJ6A 1QB8A 2BEJA 2F48A 4M1OA 3RFCA 1FLDA 3DYBA 2BGTA 1UQTA 5DTRA 4NU6A 2VDRB 3SNKA 3RFUA 2VBFA 1IM8A 3OETA 3B1JA 5DNDA 2GAOA 3QUSA 1X1AA 3SC2B 1OR8A 2YXBA 4QQ8A 4US0R 5A4MS 3MJFA 4GW3A 5BN3B 4HGOA 2EIXA 1E1YA 3AP3A 3HNOA 1DCKA 4FX2A 3GLGE 5EUBA 1ZHOA 3HDHA 1Q7TA 3QU4A 2DQSA 4CQMB 4ESEA 1V5FA 3MCZA 3GDGA 3NOVA 3KUCA 4H4DA 3MELA 4X60A 1XVTA 3AL3A 4JODA 1GEEA 1S96A 2XQJA 2C2WA 4FR0A 1XMXA 3MSCA 3I52A 1GPWB 4JZYA 1MG5A 1E9DA 3L9WA 1YFZA 2XKBA 2X40A 3H1BA 3QF4B 4RK5A 2X1HA 4EO4A 1RQRA 5J4YA 2NWQA 5TRTA 2CHUA 4FCCA 4CCSA 4ZVRA 5JRJA 1T8SA 3W79A 3X1ZA 4DF3A 4EL0A 3DZKA 3WJ1A 3DUFA 4HAZA 5DSZA 4EAQA 4KMMA 1CIPA 3SEQA 1JECA 2Q5JA 1TO1E 4PTZA 2DY1A 1PDWA 1BU5A 1RQLA 4Q3LA 2YVLA 2OXEA 1PT7A 2OK8A 1G8HA 3N07A 1SULA 4XQEA 4GKAA 3A6FA 3MBIA 3RBZA 3HG7A 4WV3A 3R9KA 1PX2A 1FEZA 5P21A 2QBYA 1K88A 1N0UA 1Q1GA 3BMOB 1EUDA 4B8WA 3ZDAA 2BM0A 2GCOB 3CO5A 3DTYA 3BSWA 3RKRA 5EIWA 1SU7A 2D0IA 1FSFA 1Z68A 2DYKA 4QDUA 1EWVA 2P11A 4RPIA 5JAUA 2EFCB 1IEQA 4HSGA 4DV1B 1FXUA 1W59A 2KE5A 4NFYA 3O0DA 4UJ5A 3O94A 4N65A 1WVIA 3D0KA 4MUIA 4PSUA 3R8CA 2OHOA 2C97A 2JFHA 5D3MA 3QFSA 1JQKA 1P5HA 1Z7GA 1ZIOA 4QXRA 4HNUA 1JIVA 1XTQA 3JRWA 4ZT7A 1E1MA 2ZWIA 4HVTA 1VBFA 3I1IA 1Q57A 2DSTA 1VKRA 2JATA 4UM9D 1JE1A 1ZD2P 4L9AA 3RBAA 2ZOSA 3FDZB 3HCWA 4M22A 4HEA1 2EW8A 2X5NA 4ZT6A 1XZCA 4OI4A 5HZMA 1OGJA 1OH6A 3ZW9A 3CLRD 3DM5A 1IQPA 1L4BA 2P9GA 4GMFA 1KSJA 1QAOA 1WPQA 2FMIA 4HCJA 3UJCA 5DLEA 4WXHA 3HCPA 3WJ7A 3G2OA 4NENA 3W5JA 4OJYA 4IG4A 4K03A 4B6QA 2FCRA 2H1SA 2EJWA 3HL4A 2FG7C 4ZOQI 5EN4A 1IXKA 3DTTA 3FDIA 4F1JA 1ISFA 4JUDX 1V35A 2XVXA 5HKKD 2HA0A 2ZRAA 3NHYA 2O4CA 3OTWA 1MTOA 1YR7A 4HL6A 3ND8A 3ZGZA 1R9JA 1V9CA 2XCIA 1W96A 2JDID 3IQEA 4KQ9A 4RSHA 3PNOA 4UAUA 3SFZA 4L4SA 4YP6A 5INTA 3H11B 3WIEA 1O0CA 3ZDDA 5CEFA 2X8JA 1O7JA 2D4AA 4LF9B 2GVNA 1QOPB 3HUFA 3OU2A 4Z4QA 2WUWE 1EUCB 1XDSA 1YHZA 3DBIA 1OZ0A 2I65A 4LC9A 3HKEA 2OCIA 3QPBA 3W5HA 4AURA 5LMZA 2ZYWX 4DCTA 2AZ4A 3DAOA 3NATA 1WOYA 1R0WA 2HEIA 4WIAA 5G0UA 1V6CA 1PV4A 1K98A 1RYHA 2Q8QA 5FDFA 3NG1A 5LMCA 1K8XB 1PR0A 3N6RA 3D3WA 3QOXA 1QGED 3UK6A 3MWEB 1PF7E 2O2JA 3IXMA 4WVLA 4DCVA 1KI8A 5AW8A 1J42A 2YRFA 4YJHA 4BYGA 1F4LA 4OYYA 5J2UB 1SVLA 3DMNA 1CFZA 1PGNA 1U0SY 2MJLA 4HDNB 4HS9A 1PJQA 4RKEA 3J7AC 1O58A 1I2BA 3PC3A 3NEYA 3UB2A 5ALXA 1XMIA 4UHJA 1H94A 4NQZA 4E12A 5HHTA 4MCAA 3ZYCA 1T1JA 2QTBA 3N2LA 3VAZA 2WM8A 4BQFA 4DLAA 4EFNA 2P75A 4ZZ1A 1FYWA 1GR0A 4S1VA 5L3RA 2Q46A 2P8JA 2MSWA 4U4AA 5JLJA 1L4NA 2FEXA 4JK3A 3PVSA 1BW9B 4NEQA 2YQZA 1I3CA 1U3WA 3KDAA 5FFNA 5LP1A 3CHYA 1WCV1 2YJ5A 5JEEA 1ULHA 3ZHUA 3EXG1 4F5EA 3OHMA 2PMDA 3N87A 5EFZA 4EVSA 4ZDIA 5KWSA 2EL9A 3HHPA 3SIRA 4EF5A 4JX9A 4G0WA 1D2EA 2H2FA 2P68A 4ML3A 1F12A 3RQSA 3GPLA 3WB0A 3C3WA 3PVCA 1QE0A 3ASZA 1T9KA 4WK2B 2ZBPA 4CG3A 3IHLA 1M8FA 2BM8A 3L93A 2IP2A 3IMEA 2GZRA 4PYMA 5AKLA 5LB4A 3TQRA 4AC9A 3CLUD 3I62A 4F4UA 3BULA 4FFVA 4MLDA 1UXJA 4HQ0A 1RXSA 1N6OA 3K1AA 3BA1A 3AI2A 1LNQA 3BQMB 2XZDA 3A4YA 3WNZA 1GPMA 3EDCA 1GUDA 2BFCA 5K8IA 1TEVA 2GWHA 4L76A 3M5WA 2E4YA 4YREA 3CXRA 2AFIA 2X41A 4YRJA 4B81A 3VDXA 2H3HA 5JNRA 4P2GA 3OE1A 5CM8B 3WRXC 4CI9A 1J2TA 4BVBA 4WY8A 5IBQA 3T38A 4BO4A 3H4IA 4ON9A 5G4KB 6ABPA 4F2GA 3ZE2B 1Y8RA 1W6UA 2FX2A 3F71A 5ALGA 3THYB 4M38A 5HE9A 3FYSA 5IN4A 2VI5A 1OA0A 4FT4A 4QTTB 2DUWA 4FMCF 1YFJA 1XYYA 1C3LA 1J1ZA 5CPBA 4ZI7B 4CKEA 1N5RA 4GLFA 1JFFA 1NN0A 2DGDA 5JDIC 2Y4OA 2XE6A 3NKFA 1RRGA 3G1WA 1QK3A 3VYVA 2HL6A 3GEGA 4B6JA 5CB0A 2GD2A 4FS3A 1U7WA 1OBOA 4R0VA 2XWJI 1TTTA 2JGRA 3AOGA 5ESDA 1JU4A 2I2AA 4E2WA 3BXEA 2QX6A 2X4IA 1QB7A 1WW2A 3SX0A 4BPRA 2AIRA 2Q21A 1OKKA 4FWBA 3SMQA 4BMOB 2YRXA 2Z57A 4ZYXA 3MCTA 5DT2A 3HWX1 5TNXA 1L1FA 3TXAA 2HMVA 3VZQA 1BKYA 2BMWA 2C61A 4KKVA 4LZAA 4QSMA 3P0RA 5DPMA 4YC7A 3WG9A 1L7DA 2EOAA 1PSZA 2QUZA 3EVDA 3GB9A 3JD1A 4C4AA 1L3CA 1DRKA 3H1GA 2XAUA 4Q4CA 3TM5A 5CLIA 3Q5EA 4ND6A 4GXNA 3I04A 4U9HS 2I3BA 4A8PA 1E2DA 3D3QA 5C1BA 1N2CA 1DC8A 2QLNA 3HUTA 5IYZA 1B4DA 5K8TA 1OOEA 1CLEA 2P79A 4O02B 4K8RB 3L0SA 3URKA 2AXEA 1KZ9A 2ISCA 1W5EA 2FPKA 5K1ZA 3FPLA 1SXJD 3OX1A 4KRGA 5HNKA 1AXGA 3L77A 4J2HA 4BNHA 3R7DA 4H6XA 2FLVA 3GP3A 2A9OA 1T2CA 4G63A 3UF0A 4E1VA 4G4SP 3QHPA 3IH5A 1YF3A 1JP7A 1XPUA 3UYKA 1Z5UA 3H9JA 3AY0A 1TGYA 3CLSD 1RJFA 4MV1A 5EZQA 5I4CA 3FMGA 4P3YA 3T5GA 4C0HA 1PBNA 3NHSA 3OWOA 1K8YB 4OJKA 1UBKS 4ACBA 1K68A 2YFYA 3R9WA 3UA3A 3CUEF 3CGWA 2GK6A 1DU4A 5H83A 1PO7A 4FBGA 3NVMB 1K75A 1RHQA 1YC5A 2BEVA 2JGJA 3G1TA 4TLLB 3I32A 1GQFA 2CCJA 4K46A 3EDQA 4NRDA 3VOSA 1TQDA 2I4NA 3ETDA 4L28A 5BRAA 1JH9A 4EWLA 4FM9A 2WJHA 3KKKA 3N75A 3KOMA 2BT4A 2WF9A 1MW8X 4WOJA 2H16A 3M2PA 5LZ9A 2P77A 3QWAA 1CR1A 5C52B 4PC1A 3B1ZA 4TS9A 4TPKA 3W06A 3I4CA 2D1TA 4CCAA 4IQ4A 2A0XA 4E5SA 1FJHA 2XB2A 1ZRHA 2KLHA 2Q3BA 1IHPA 4NDZA 1T9HA 1VC2A 3V4SA 4XGKA 4EI9A 4S05A 3GLFA 2HXYA 4Q03A 2GBFA 3GRAA 4REOA 1F8GA 1Z4QA 3BXOA 3JYHA 2ACKA 3WWCA 4K6MA 2GM5A 3GVIA 5E9WA 2PJZA 3AXSA 3NKLA 1U8UA 3TWOA 3I9OA 1LW7A 1HZZA 4LRYA 1WXHA 2Q3MA 3AUJB 3DMHA 3FDXA 3AY3A 3EPKA 4ER6A 2UYGA 3OX2A 3BICA 3PEUA 4FFNA 2PU5A 5ECGC 2JJ2D 2R79A 4UM9B 1NP3A 1AB5A 1J2EA 1RIFA 2OKGA 2XMGA 2XUHA 4OHUA 4R41A 4L2IA 3ZY2A 3VPXA 2GCGA 5TPZD 1UKBA 1MB0A 4XIFA 1QRTA 3OEWA 1BS1A 1C1YA 3OLCX 2ZDHA 2JCVA 4YJFB 2VVTA 1G8AA 1G1AA 1N2OA 2C4UA 5A4FS 3HU1A 4JI1B 2E3JA 3LT2A 1QTQA 2EJVA 4M87A 4ZAYA 3ENWA 3ID6C 4YONB 4ABTA 1H3FA 2WF8A 3G1UA 4R9NA 2XR1A 2G83A 3U37A 1Q7EA 4C4YA 4FDLA 2H2DA 4FI3C 3NUQA 4P36A 2YW2A 4LYEA 1Z83A 3IUYA 3TLBA 1AHIA 1YB6A 1Z6PA 4B47A 3DWEX 3IMFA 5E1DA 1JPNA 2X3YA 1Z06A 5HJ7A 1KIAA 2UVPB 3AQ4A 3WYNA 4B73A 4X1IB 4Y1RB 5A9TA 3WB9A 3NHAA 3D7RA 2WAYA 2XIQA 3WVNA 4WBXC 3VX4A 4IIHA 2BP7B 4P3OA 5L7WA 2LPMA 3D7NA 4LDZA 2YUTA 2C8LA 5C3UA 3IULA 5EJ7A 4IH4A 5EMKA 3K9LA 1C9NA 2FAXA 2BN4A 3ROGA 3PUVA 4AUMA 4LXTA 3AZPA 4PLZA 2CJXA 1U2SA 3AYXB 3GGGA 3KG2A 1L4UA 5HK9A 2PO7A 3MUNA 5GJCA 4ECEA 3T3NA 4Q7MB 2R6CA 3HRIA 3ZEIA 1CZOA 3M6FA 2FQQA 2Z1NA 3ZCQA 2HCRA 1U5AA 3TMKA 5PGMA 1KOFA 1V3VA 3CNQS 3SBOA 3ZY4A 2JKYA 5LWHA 4NKRA 1XVVA 4MLPA 1J07A 1R88A 3EVCA 3T54A 5LQMA 4TKLA 3W8NA 2CL5A 1N0VC 1Z5VA 4TM7A 4WKCA 2BE7A 2JH3A 3CTPA 4IHJA 5DNAA 3WDMA 3OEED 2BEWA 4PSAA 1TCUA 3HXOA 3FOCA 1V7ZA 4OHOA 1FS6A 3M49A 4ZQEA 1OC2A 3OI7A 3Q72A 2IXGA 1UP7A 4OLHA 4I1UA 1OZFA 4NECA 2FTKE 1NXXA 1VCIA 3DB2A 3JYOA 1CJTC 3NHRA 4WZAA 1X1TA 1GL6A 3VPGA 3U44B 5HKAA 5KQLA 1PWYE 5BWOA 2ZXEA 4H7HA 3GZJA 4PX2A 1QF7A 4TSFA 3D8BA 4DNOA 1BWQA 4MUGA 4BFZA 2DECA 4XI9A 2QQEA 4DKXA 2IUTA 5DXAA 3O3OB 2Q4EA 1E3WB 3DHWC 3ETJA 1E6KA 1ESZA 1WE2A 3VU9A 1Q0TA 1DS6A 4YO7A 1Q74A 3NCTA 2ZPTX 1BD3A 4S1WA 2FE1A 2ZI5A 1JMYA 3FH0A 5IZ4A 3IO5A 2ODPA 2P9TA 1Y7IA 2A1TR 3KBBA 4YAWA 3CB4A 5AT1A 5FWDA 4GYWA 2CXUA 4A0GA 3N2GB 1Y9JA 4GLLA 1VMIA 2E82A 1NUHA 4BGUA 2LXNA 3FVRA 3GJ4A 3JAKA 4BV3A 4DHWA 5C7LO 1A8QA 1L9KA 1CX9B 1UMCB 2J4DA 4GSLA 3A6ZA 4HY3A 4DBLC 2H2WA 3H6KA 1DX6A 4Q7EA 3PWKA 3RAJA 4OUDB 4G4GA 1CRPA 3V8EA 3PC8C 3AEKB 4XEHA 4RY0A 4DN6A 5E6UB 4CUKA 3MS4A 2PT5A 3EZGA 3LY9A 2JLAA 4HQ6A 4E51A 2GXAA 3OSZA 1DCMA 4RZ3A 1OFUX 4W1PA 3OT5A 1V8ZA 3CZ9A 1MUUA 4U0JA 5DMHA 5B7GA 4RTNA 5ERYA 1NYTA 1PL6A 4DXAA 3N2IA 1SVIA 3O21A 4RULA 1TAUA 5L9AA 2OC4A 1XRPA 2AEJA 5FR1A 4X85A 2RKOA 2JIDA 2Y1FA 3A0RB 3KV3O 1D9XA 3PKJA 4PRZA 4E31A 5JMTA 3D8TA 4WK0B 3I23A 5EHZA 1I4DD 2REBA 2QN1A 2CFTA 3ABZA 3CF4A 4U2CA 4CDGA 4LXGA 3EGDB 2XYQA 2BDTA 1GNRA 4LI0A 4WZBE 3DV0B 1UEIA 2HWKA 2VXYA 3V34A 3V4RA 4H4CA 2XWQA 3RQIA 1JQ3A 1O6ZA 4YT5A 3K92A 5AM4A 3ZLTA 4RVNA 3QUAA 2VO1A 2P3OA 2VQEB 3DFZA 3E7FA 1DQZA 3CSSA 4YP9A 4PG6A 1B6RA 3ME5A 3TI9A 4OHXA 3GL9A 4GR9A 2V7XA 3DP7A 3EGXB 4MUMA 5CVUA 1Z4LA 4EW2A 1IBLB 4G3XA 1NY5A 1TFRA 3HO6A 4DIDA 4JJ4A 4OEHA 4W1SA 2BH9A 4X7RA 5F2OA 2EFGA 3DWGA 1SXJB 1O8BA 1MVNA 2B4YA 5D1HA 3GEHA 1SU6A 3LH5A 1REQB 4EG4A 1L5VA 1U4SA 1HE4A 1RI3A 1WLSA 1QP0A 4FUTA 5F12A 1TEHA 3FA2A 2GF2A 3FNRA 2GM4A 1ZHFA 3JW8A 2ZI3A 2AWOA 2J33A 2NO0A 3KQVA 3W4JA 5BNZA 3VO8A 3WLTA 5HIMA 4RFSA 2BY4A 3LA6A 5IN5A 1BDHA 1E77A 2H7CA 2FR0A 3VKWA 5E6SA 2AC2A 1TXGA 3CPJB 1AC5A 3ML1A 4RPLA 4EW6A 4CEHB 4IIJB 3TL3A 1A8UA 4BVLA 3QH4A 5HBRA 4KWTA 1V1MA 1EA5A 1XT6A 3N2KB 1XMQB 3OE4A 1OI4A 1ML3A 4CDMA 4CTMA 1U28C 4Q7KA 4EENA 3O2QB 4CCYB 4WERA 4XSHA 3URMA 1SVKA 1Z33A 3OFJA 1UAYA 3E9MA 3IA2A 3WHKA 1THGA 2Y2VA 4PLPA 1L4MA 2FEAA 3MAJA 1P77A 4AP6A 4EHJA 1F3LA 2BLLA 2H5JA 2X2PA 3D5TA 4M53A 3VR0A 2HTFA 3TD2A 3U40A 2VJPA 4BE9A 2PAAA 1E32A 4OXIA 2X42A 3MT0A 4O2AF 4Q1FA 1UXOA 1VL2A 1QJ4A 1JNYA 3BIFA 3LGSA 1H4VB 3K0EA 3R3UA 4MI3A 2O8VA 1ORDA 1U94A 2QJWA 2DCMA 4MJ7A 1W0JA 2Y9PB 3P94A 1TA4A 4RWEA 3I8SA 1E60A 3ICVA 2ZSUA 3VTAA 3F6SA 1DX9A 2BI8A 2BSAA 2OCDA 2PY6A 3CJTA 3MILA 1NVGA 1QFZA 4I50B 4E46A 4KZPA 2OBNA 3IDOA 1UODA 1DG9A 1L7OA 4L7QA 2WU3A 4OU5A 2QTAA 4KE9A 5BQOA 5L7TA 3DFFA 3DE3X 4FINA 2I8AA 3VISA 2FW9A 3DVQX 3CE6A 4G01B 1D04A 4Q4JB 1CR4A 4LJ6A 3OZXA 1CZLA 1JIKA 1N4AA 1B42A 3DDZX 4RK4A 2AYZA 1GSIA 1MOPA 1SBHA 4ZCLA 1W87A 3QFFA 1ZWLA 4EEKA 4DQKA 1PGPA 1IY9A 1XKXA 1ZK4A 3L40A 2GEJA 3THSA 1K7SN 2D8MA 4B6GA 4CUJA 4WLEA 4E88A 4EUFA 4PVDA 1E4OA 3TW8A 4R71A 2E1PA 2QMZA 1E66A 4L57A 2G8NA 2H6EA 4ZI2A 3FNHA 1N3YA 2LRHA 4NOJA 1XEXB 2M6KA 4IICA 3RRJA 5DK4A 3A9TA 2C7VA 1YVDA 4OKIA 1N5DA 4IVQA 4D7AA 2WFLA 2XOEA 1KVSA 4UUQA 3THRA 1YVPA 2J0SA 5JWRA 2CNWD 4AP5A 2A9KA 3DT6A 4YJ2B 2A9FA 5H4GA 3HR7A 3E3MA 4PZZA 1I6MA 1I8TA 2CB0A 1W4LA 5G0TA 3E3LA 3I5AA 3JSXA 2W2VA 4K6OA 3COVA 4BIIA 5K8VA 2FGJA 4P7FA 2ZE7A 4OQZA 1PK8A 1SCUB 3EIFA 1G16A 4J16A 1V5EA 1Z4NA 3K0AB 3FZNA 2J07A 3D6AA 3OU7A 1U8XX 1N2GA 4MLZA 2JFYA 3TJMA 4MQEB 1VBKA 2BHLA 4FP9A 2JHFA 4E70A 3FMFA 1J0BA 3DAYA 5JFGA 1RMTA 4QEDA 4QYXA 2IDJA 1QMPA 1P7PA 1VDZA 4RPGA 3UFBA 4G0OA 5B7PA 5ITZA 3I37X 1RLIA 1MNQA 2M9MA 3TNYA 2MT9A 2OZLA 3MCVA 3ZE8A 5LB2A 5IXSA 2K2QB 4JSTA 3V80A 2TRSB 4MVJE 3K73O 3V4OA 4HDSA 1UMBB 1KS9A 3DDUA 2VIIA 3L0BA 2I2XB 2O7QA 3Q6IA 4M6WA 4OREX 1UXIA 3H4TA 3ZHXA 1HEUA 5EWMA 1W44A 1X0XA 4JQCA 4JP8A 1ESEA 4NU8X 2O5EA 1OI3A 4LY9A 1JWLA 2PANA 3BIWA 3O3CA 3QMVA 1NRXA 3B6MA 4X6UA 4AXBA 1IVYA 1QONA 2NU8B 4F3YA 3PEWA 1U1IA 5A5VA 2IZ1A 5BT8A 2OORA 3L7YA 1PUJA 4WCFC 2WTEA 1ZOLA 4ALJA 3AEUA 2G7ZA 3OLYA 1FP7A 3BAFA 5EKTA 2KBFA 4GOLD 2ZB2A 3MTQA 1KXJA 4OG2A 5EQFA 4CMHA 1OB2A 4B3SB 2WIJA 2B2XA 4QARA 4A6PA 2RSLA 2YV1A 4KR9A 3ELUA 4WCFB 1JEOA 1V7QA 1JDJA 1VQ1A 3OQVA 1AGNA 3BPSA 3OTQA 5DLQC 5SY6A 1A2QA 2C4WA 1VSUA 1TCCA 2UUPA 4TL7A 3U4GA 4M1EA 2CLMB 5DN6A 2WYVA 3UTCA 3S2FA 4O08A 2GYVA 5D85A 2BYTA 3M82A 3RTGA 1OY1A 2LNDA 2B69A 2ZWVA 4NL4H 1G9SA 1OFGA 2N0SA 5AUNB 1GKLA 1JSCA 4J07A 2ZRQA 3AFOA 3FHJA 5DH9A 1DBWA 2Y1GA 2I0FA 2JCYA 2YJGA 4PYJA 5BVGA 3HLTA 5K6AC 3HYCA 4FGKA 1SK9A 1XJ5A 2XMZA 3TFOA 3EW7A 2F1RA 1WABA 3B9BA 1XF9A 2QT1A 4W5HA 4CT0A 3GZNB 1QTIA 1KNQA 3WAKA 1YS9A 4IDAA 1E2NA 3KT3A 8LDHA 1XQWA 2PL9A 3KOOA 4Y9DA 1MB3A 3GGCA 2GEFA 4KWCA 5A1JA 3P45A 3WRVA 1G20E 1L1RA 1TZ2A 1T3HA 1KJWA 4BFTA 3G2IA 5KYNA 2FWRA 4ZQHA 5T4FA 2Y1KA 1KI6A 1XCBA 2Z2YA 1QO0D 3ZBUA 3NHZA 2YY6A 2G17A 4BQRA 1QH1B 4HYQA 2B7LA 2OHGA 3TW0A 4DV6B 2ZE5A 3F9RA 3MNFA 1T91A 3JQAD 5CBPB 1BH2A 3RGWS 2CV1A 4HH1A 1KYXA 4LDJA 5CDUA 2HBRA 5AVTA 3TZEA 1PZXA 2B8EA 2R8RA 4RHCA 5IT4A 4KQ2A 4PQYA 1AZWA 5CFNA 4ENVA 2O2DA 1QUFA 1SUIA 3I6IA 2LVBA 4LMBA 4C0XA 1HE2A 1I13A 1H8EA 2AK2A 4N7BA 2Z08A 4RLFA 3OE7A 2COUA 1PL8A 2WR8A 2Z9CA 1FYFA 2VJDA 2CVFA 1PCXA 1WQ4A 5DLPA 2PX6A 3EBLA 5A7HA 4GL2A 4OM8A 1IHXA 1GPYA 1SM4A 1EM8B 4FKMA 5C4GB 3RTDA 3EX7C 1QZXA 2AJBA 3AVPA 1MLDA 2Q3LA 4HJRA 4CM9A 4EF4A 3DLTA 2IYAA 2JA2A 3S5UA 1HORA 1M72A 2RJOA 3SZLA 2HPHA 3AKYA 4BMXA 4ZO7A 4E6PA 9ATCA 2L82A 2LDBA 4JYBA 3AVTA 2J4FA 2Q5IA 3SC2A 4D45A 1HR0B 2DR2A 1L4HA 3E4DA 1Q3HA 2R85A 4D0LB 5BN3A 2KJQA 2WTAA 3RROA 1ZK0A 2WHEA 1WP9A 3NBXX 1MENA 1PE0A 2D7JA 1JR4A 2ZB8A 3DWFA 3E1GA 5D7NA 3CNLA 3WLSA 4CQMA 4DPMA 3ZW8A 2IIPA 2ZIWB 2ZJ3A 3HBAA 3E18A 2O50A 5BQPA 4GAEA 4I1PA 1E9SA 3GELA 4O5AA 1G9TA 4XGRA 5LIRA 1RHJA 3B52X 3QF4A 2Q3DA 1GG2A 2X1MA 2ZJ0A 3B1VA 3ZXIA 4QVGA 3GLIB 2V55B 2Z8ZA 1H8HA 1Y1SA 2FZ5A 4DDVA 5FOXA 3QVOA 2ZIFA 3AEYA 4DLLA 4YV1A 5CXQA 3ZH2A 4BXOB 2YV2A 4Q1AA 4M1WA 5I8ZA 4KFUA 4YROA 3VC7A 4X8MA 3UOWA 1GZ3A 3EGCA 1IWBB 2PIDA 4BC1A 5JHHB 2NZUG 2NTJA 3GD7A 1YVUA 2J0VA 2FW1A 3E9YA 2RHOA 3PEFA 2IE8A 2JFUA 3CMCO 1LDEA 2J9XB 2VQSA 3R3VA 5DM2A 4S1PA 3F6RA 2D2FA 1KBOA 2QRGA 3IHKA 1WM1A 1FFCA 1IPHA 1SC3A 5IXYA 4CQLB 4CKCB 4XGNA 2ZVDA 1B0PA 3GLVA 1XZAA 4D4MA 5KNCA 3PSAA 1ND5A 3DJYA 4RGYA 4YQZA 3BMOA 2H5LA 1Z2NX 1ZOOA 4RJJA 5D7BA 5ALKA 2GCOA 1TZCA 5ES4B 3W3AD 2CSXA 1YE8A 3CURA 2X19A 1YCHA 2ZYSA 1KY5A 1JA1A 3B2NA 2TECE 4YJ3F 3SQDA 1UKCA 2A6PA 4LFAB 1V16B 3LK7A 4MS3B 1QV6A 1RI2A 2ACWA 1NYLA 4IM7A 4J1QA 3WIBA 4E3ZA 4CF7A 3RSLA 4GOKA 1AUQA 3LUGA 3M0EA 4LISA 2XXBA 4H1TA 5DYTA 3U5TA 4KCGA 3TAHA 1JPVA 1WL8A 3EOBI 1DDIA 2CW5A 1QTRA 2AJ8A 2GN0A 4ENRA 5FWAA 1E5LA 1KP2A 3D8NA 4FEYA 1L0BA 4CDNA 1NLMA 1E5XA 4E3WA 3LQ4A 4UFPA 5IXJA 2Q6OA 3A7DA 2QGZA 1VYHA 3BRQA 1KORA 3UFXB 4MUFA 1B2RA 2HOQA 2HPVA 4YLEA 3I42A 3U9LA 4EW3A 1XP8A 1WW8A 2BFDB 1DXHA 2I7VA 2YASA 2I78A 2ZREA 3FDZA 3O9MA 5B1EA 5K5EA 3H7AA 3K1YA 3GRZA 1J21A 4TQ9A 2Z0MA 3PU6A 3LBHA 5G2OA 1UH5A 3IIKA 4D42A 5BXQC 2LE0A 2Z5VA 2X76A 4PLCA 2BR3A 4RYDA 2DQKA 2B1QA 5KHAA 1ESDA 2ZULA 4QYWA 3KQSA 4X7PA 2CMGA 4KNWA 5B57C 5A3QA 4OIMA 5D84A 1X9HA 2WQZA 1GITA 4W1QA 3HP4A 4V0RA 1EFAA 2VTDA 4EHAA 5KNBA 5JZSA 1MABB 1N2EA 2BGIA 2PX5A 4IV5A 5EPEA 3VR4A 1CCWA 1HRDA 1VLJA 3QI2A 4M1YA 3PDHA 5C5EA 3KUUA 3HEBA 1E3IA 2PIAA 3B3FA 2GLTA 5FA6A 1A9PA 3VDQA 1I7SB 2F1IA 3H11A 1AV6A 3MAAC 1TA0A 1NRIA 2V59A 1IRIA 1N9GB 4O6VA 1BX0A 5KHLB 4IX1A 1EUCA 1LSOA 3TX2A 4I5IA 1KEWA 4GSKA 3LDGA 1X8LA 3QQPA 2YZMA 3P52A 1PQ4A 4NFLA 4ESOA 2A0YA 1EK5A 2QTTA 2JFPA 1RXEA 1JILA 2PX8A 3PA6A 1N2SA 3L8GA 2Y05A 3C3XA 4NF2A 3BXFA 5TARA 3RYHB 4E30A 1E2PA 2XLCA 4CTKA 1XEFA 1DWOA 5CB8A 4LN1A 5HPYB 3LCJA 3BTSA 4QG7A 5F3DA 1M7BA 4X9XA 3MWEA 4DY4A 1CRWG 2P5YA 2W37A 1VE5A 5J2UA 3RR2A 5BN4B 4MCIA 4HDNA 1CF9A 5DB4A 3QFRA 1G21B 2DHQA 3HZOA 3ONVA 3WGMA 3OTOB 4ALIA 1R6XA 1VCMA 2ZJ4A 4J91A 5C46F 2PKCA 5CG1A 2SKEA 1F8YA 1Z2PX 2ZAMA 2A14A 1VKOA 3TTWA 2I1WA 2PH5A 3RJ5A 2PS0A 3Q12A 2QJTA 1BW9A 4ZIRB 2IELA 1DIAA 2QAGC 4EHDA 5J47A 3C14C 4IMPA 3COWA 1UK9A 4A4DA 2EDCA 2Y1CA 3CUUA 2D1YA 3LC0A 2XMDA 3R7FA 2P3LA 3H7IA 4ZQCB 5TX7A 3C98A 4YR7A 4Z1OA 5AK5A 5BR8B 4DIEA 4KQEA 3DBVO 1O9HA 3MGAA 2A3RA 2WWHA 3ET5A 4FQ5A 4GYKA 4BV9A 1PJ8A 3U4CA 3UB3A 2R8OA 1D8AA 3FCYA 5DI3B 5KC9A 3GZTB 1NULA 1NFFA 2WTUA 1F48A 1AQIA 1EAMA 4GICA 3ZGXA 4EDFA 2XWSA 3CWCA 4BNYA 1ZUD1 4A23A 4FOPA 2C7BA 3BH7A 3WIUA 1B2LA 2DOKA 4MIEA 4M7RA 4AY3A 5D01A 4H59A 1F8UA 2M1XA 3PDUA 3FVWA 1MVOA 3JQAB 4W8GA 1XTSA 2RHBA 1UC5B 1BKDR 2NYUA 1HFWA 4L1KA 3KELA 3F67A 4ZCRA 5ADUS 5BORA 2VNAA 5JS7A 4JJKA 5G4KA 3OFSA 3T12A 2B8JA 4K2AA 1W46A 1P9LA 4XTCS 3THYA 1Y6GA 3K6RA 2CJFA 4FB5A 3WLNA 3P20A 3UUEA 4ZI7A 3CKLA 3O92A 1DMSA 1CETA 2IEIA 2QTLA 2CD7A 2RAVA 3RB8A 2J0QA 3MT8A 4C4SA 5K0JA 4F2HA 1U7HA 1XRRA 2EF1A 2VT7A 3E3AA 4ISCA 2A0WA 4KXYA 2EFHB 3KYJB 4IIYA 5EZYB 3ZNPA 4BWVA 1MHTA 3RFFA 3I5MA 1LH0A 1VMDA 4PX9A 3RRNA 4E5NA 4DRYA 3CF2A 5KJ6A 4EDHA 1FL9A 2HI0A 2Y0EA 4MMXB 3RU2A 3PXGA 2DBZA 2RDMA 2YICA 3V4PB 5BW8A 4AM8A 2FMHA 3AHFA 3Q15C 4FPXA 5IRCD 4PBTA 3SZ3A 3GDHA 3BTOA 3OPYI 1PLLA 2HQ1A 3QG1A 4HX2A 1PDOA 1CZNA 1GSOA 1VE7A 2GR9A 2AOVA 1WPRA 4TTQA 1NKTA 2YWEA 3ZV4A 1H1LB 2WILA 2WTBA 2YHUA 1KF0A 1KEZA 3QWFA 4J7CA 1ULTA 3MYYA 4KLAA 5FAXA 2GF0A 3TRIA 1ZM2A 2VYND 2RGDA 3EDYA 1C0PA 4WHMA 3T41A 1BG6A 3OE5A 4HRVA 1R0BA 4RTLA 4PTYA 4LJAA 1GNTA 2NADA 5CJJA 1QHHB 1YULA 2IHVA 4KUGA 3ENQA 1YRLA 2PYDA 3EEIA 4KO8A 1GAWA 5AXBA 5B6PA 5CFQA 4OU4A 2E4ZA 2PSDA 3QEOA 1D09A 3WY9A 3ZNNA 4AWXA 3I6BA 1KFEB 2J0UB 4WKPA 1G8JA 3GBVA 3PHIA 1PNQA 2JLYA 1UT6A 5AHOA 3C7KA 3VZPA 2OXCA 1FBTA 2ZBDA 1EZ4A 1RQXA 2WSLA 5CNIA 3WHIA 3PHHA 4XM0A 3TDMA 1LZLA 1XJQA 3P9XA 4H9GA 5AKJA 4YUXA 5EJMA 2O0KA 1NVEA 2AR0A 1NR7A 1PEAA 1E2UA 1MR3F 3D4NA 3EEYA 4URXR 1NXQA 1Z0AA 1ZFNA 3ITDA 2XUDA 1L7RA 4I3FA 1WX1A 1NLYA 5IHXA 4IVRA 4BFLA 2PGJA 4OO3A 1TIKA 2D59A 1OXVA 4W8HA 3SR3A 2AB0A 2V5VA 4OGKA 5EOVA 3U39A 1ZN8A 4RJ2A 1E2JA 1NMQA 2FPOA 2GEBA 5LU8A 3RYFB 1Z8HA 1GGNA 3GJTA 3UAYA 3WXMA 2XD4A 3KR1A 4BLSA 5L6MB 4R1OA 1NGSA 1TF7A 3FD8A 2QUJA 3FIJA 5M7EA 1W5AA 2NZXA 1QG2A 4A16A 4LAFA 3RV4A 4HWTA 3W5UA 2AZTA 3HE3A 5H3LA 4YUAA 1IXRC 4D9IA 4JOCA 4BX3A 5B4TA 1HDRA 3A4IA 3DMTC 3H5TA 3PF8A 4JJEA 4EG6A 4FCWA 3DBLB 4DCUA 4UUPA 3RWBA 2BGNA 4ZMBA 2FUKA 2Y68A 1GL9B 2ZWAA 5EL0A 4EHKA 1ZMRA 2JD1A 3CH5A 4G25A 5I01A 3U7HB 4QNMA 4L5JA 4YJFA 3LIIA 4ZMRA 2ZRFA 3L8YA 3H0KA 4L3OA 4YQFA 5KTRA 1FRQA 2PUGA 1K6MA 3G2KA 1MFPA 2E9SA 2FFQA 2PZEA 4YRBA 2PR7A 3SXPA 4YRKA 4W9NA 3MG9A 1NVVQ 2B61A 2NXJA 3UGKA 1ICEA 2JEZA 2QNIA 2CFSA 5BYAA 2OGTA 1EJ2A 1UZMA 3YASA 3ZWAA 3ZS9A 2FPRA 3AHCA 2XCUA 1DC5A 4OXYA 3AT1A 3OJEA 4RCVA 4DG8A 4G0YA 2XZLA 2YC4C 2JDIA 2UVPA 4PN3A 5LNK6 3KL4A 4X1IA 1L3BA 4Y1RA 4CF4A 5G1NA 1L7XA 1H2AS 2X0KA 2PUJA 4K0KB 1IG0A 1D7AA 1RYYA 2HZBA 4Q3OA 5HM8A 5JXIA 2BP7A 3S8EA 4LDQA 2R6ZA 1I7DA 1FJXA 5CYFA 3I1YA 5KUTA 2JIPA 3E82A 4QYMA 2EJBA 2V6FA 4PNHA 5TEVA 4M9UA 1TRHA 4MYTA 1QGUB 3UOGA 3TIIA 1F2UB 2QMYA 2OXFA 1S7CA 1AKTA 2QE7D 2QTWB 2P7HA 4JBXA 4JI3B 1TUGA 3WL7A 1PJ4A 1STOA 4R0MA 1YNSA 3HDVA 3E3NA 1P39A 5K45A 1TT7A 1Y8CA 3H42B 3H65A 3RABA 3WRYC 2FUG6 3ZD6A 5UKDA 1IZ0A 1SG0A 2RD2A 4M98A 5D5PA 4ZDKA 4BY9E 1RKBA 4I4TB 4DA4A 1LDYA 2NQTA 5FYQA 3W2FA 3HV0A 2R00C 3RVSA 1DLJA 1XYVA 2ZR7A 3QEJA 1MEJA 3WV5A 5EFOA 4A3SA 4GWGA 3T1NA 2O0HA 4H31A 1VI5A 5F5NA 4TRRA 4UCXA 1P4AA 1RACA 2PBLA 4MVJI 3U4DA 3ZTTA 1PFGA 2QU7A 3LFTA 2BM9A 2GEUA 5KNDH 2BF4A 4UNIA 5H0IA 2AF4C 2DRIA 2QL9A 4CL3A 2B6NA 2GJKA 4BKQA 3U44A 3UQZA 2PX2A 5JNVA 5HKBA 3EDRA 2F59A 2HMWA 3I53A 4UE3S 1WLYA 1YQDA 3IB3A 1RHKA 4FX5A 4CWAA 4E5MA 2GAAA 3PP8A 5C37A 3WLPA 4UMVA 1WMBA 2IDMA 5AVQA 3OMXA 5FBKA 1C3XA 1E3WA 5FTMA 1EFHA 1FNBA 3GCDA 2G09A 2GM9A 4YK7A 5CB4F 1Y81A 1T5LA 2UYYA 3D5QA 3ONWA 4JLAA 4RK6A 4XVHA 3E53A 3HXTA 5ECDA 2C3MA 4MI6A 4F60A 2GNOA 1IJKA 3B6JA 4IMRA 3V1TC 1FYEA 3KSUA 3N2GA 1IDN1 5JT1A 4OYHA 4R1TA 3C87A 2ZVJA 2Q4BA 3EZNA 1I6WA 4Z5XA 1UK8A 1UMCA 4KDCA 3MS7A 1I4WA 1ZS9A 4JIMA 2ISQA 2IS4A 2GN8A 2VXCA 3KLNA 4OUDA 3ENZA 5HUJA 1BROA 2BUBA 1DEXA 2WAMA 3AEKA 4TRNA 2WIDA 5E6UA 4MOWA 4KNVA 1DEOA 1NQXA 3FCSB 1LRKA 4E22A 3U6BA 3HGMA 3HBLA 1BHQ1 2GILA 3PC8A 1GPBA 1OREA 3FZQA 1XEWY 4R40A 5I7AA 4EVQA 5J43A 2PZFA 3TH5A 1D0IA 2J9ZB 2ZUTA 5KWJA 2DPLA 1ZJZA 1ZM7A 2JFNA 2OLJA 2QJFA 3C41J 3D43A 1A98A 4G6ZA 4OD0A 3FTQA 2IGTA 1T29A 4ALMA 3B89A 5AXAA 3A6EA 3IODA 4IV8A 4GP7A 5IAKA 4D9GA 4GXTA 1JG2A 1AQNA 2Q6KA 5BNTA 1ES9A 3DDWA 2XQKA 3B3QA 4FMCB 4I4NA 1VRVA 1SVSA 2RKBA 3EGDA 4UHEA 4AWBA 4DIKA 3DV0A 3NWPA 3F5FA 3L0OA 3P9PA 4MI9A 4B43A 5IUJC 3QIAA 1XDUA 2AMYA 3M5PA 2RG7A 4UDYX 1FNSA 2EJTA 2WTXA 3A6LA 2JH8A 4BKRA 3LO8A 3VR6A 3PGLA 1NN5A 1JYFA 1X1EA 3O9VA 1X6VA 3KKEA 4CV3A 4KO3S 3V8NA 3EGXA 4UBJA 5SZIA 1EHIA 3UXMA 1GIAA 4JOBA 1NJSA 3IEVA 4JT9A 3LUJA 2BGGA 1HQYE 4IR7A 3RLIA 4L4XA 1SD2A 1DAKA 5G40A 1W0CA 3EQ2A 1I3KA 3QLUC 3CLVA 1E4EB 1SXJA 3WB1A 4DV5B 1V48A 1N6HA 1REQA 1C8LA 1T2UA 2ADFA 2NO4A 2W2LD 4JYCA 4A5SA 4S2EA 1K4KA 1N2JA 3TLMA 4L8LA 4CUZA 5LZ7A 1MEEA 5DXFA 5COAA 5F7OA 5FAKA 4AZ3B 1HQCA 5A06A 5L4SA 1E62A 4NX2A 3AETB 4P84A 4Q3AA 1CDEA 4WL0A 1ZJYA 4GX0A 2O3JA 3B2EA 3FTDA 2OXRA 2QB5A 4CEHA 1WXGA 2WM3A 3IDZA 4U00A 3BK2A 4IIJA 2CHFA 1XP5A 3W3ZB 2FFJA 1W94A 1AM4D 2C1EA 3WK8A 5C5CA 3R5FA 1FYVA 2G82A 3FGOA 3N2KA 2IWRA 3KJHA 2FPSA 2IHYA 2Y66A 5BO5A 2HA6A 5D6NA 3N7TA 5IC5A 4CCYA 2RHCA 3U19A 3DAGA 3DNFA 1Q84A 3BERA 5C7IO 2L0XA 4HADA 1UDCA 2OL4A 5EHIA 1WXWA 3DLPX 2F3SA 2ZT8A 2R6DA 1EHCA 1T0HB 3BE5A 4G2TA 5GAJA 9ABPA 5I9MA 3BSYA 4FYXA 2VNKA 3T7TA 3WKBA 2Z8XA 1FDIA 3AL0C 4F7WA 4AY2A 3F6CA 4YCJA 5H68A 1DUIA 2OGZA 4IJMA 1KO7A 3BMXA 2HA2A 4BBJA 3M89A 4J3FA 1A8SA 3G5LA 4RXMA 4YRQA 4Q9HA 1JFRA 5EUCA 3ZIAA 4F4HA 1EUQA 2OCYC 2O2EA 2ZJ8A 1LI4A 3T3DA 3RC1A 2FHSA 2QV7A 3NO4A 2QTVB 5JJCA 1GG5A 2JJ2A 1I33A 4EMBA 1DKRA 2ASEA 1AIPA 2R44A 2XBUA 5KTMA 5TPZA 3S2IA 3ZI7A 2GZ2A 4FZ5A 4I50A 4QPPA 1KRXA 4M7OA 5JJKA 3X44A 4PLHA 4JLMA 1IG3A 1KJIA 3EWNA 1DTSA 1WF6A 1W2HA 3EASA 5CM9C 1YQ9A 1TK9A 4A2QA 3K71B 3BHJA 3KQMA 3I45A 4TMYA 3WJ2A 2ATVA 1V7PC 2JHAA 3I2GA 1U2GC 2FSPA 1L3IA 3C3KA 3DQPA 4MHOA 4Q4JA 3RUPA 3EIEA 3O2SB 1E18A 2XKAA 5IAJA 3NIBA 2ES4A 4Y2GA 1EXWA 1BJTA 1JEAA 5GV7A 4ZYTA 1OI2A 1W7AA 3U7EB 3VV3A 3ZPXA 2AOTB 1RKXA 2FKAA 1VGQA 2IEZA 2ARKA 3EEBA 3N8NA 1P4GA 5AW0A 1ODTC 1D9ZA 4YV0A 4INAA 4AFNA 3NRBA 3OIFA 1UBHS 2C9YA 5FX2A 4JGBA 1R6UA 1ZXLA 2PRIA 3SQLA 3UJ9A 5DSXA 1JJBA 3F7TA 4G1FA 1JEQB 2DY0A 4EQZA 5BMVF 3FOZA 4B7AA 3EYWA 2YIDA 2BJVA 3F5QA 4ITRC 2L19A 4R3WA 1PS9A 4MKRA 1JBQA 1XEXA 3C5CA 1EWTA 1OLXB 4NE7A 3IAAA 2XT9A 2BUCA 5K3OA 3T8YA 5A4KA 4C78A 4S04A 1JU3A 2AG5A 3LBAA 5FEMA 4D25A 3QRWA 2I34A 4NZPA 3OM0A 4M1QA 4ZI5A 2CKDA 1E7SA 2C5LA 3P2EA 4BJ3A 2FFAA 2H63A 1O0SA 4HLUC 1TQ6A 5KSZA 5C5IA 1JIIA 4YJ2A 3ZU2A 5F5XA 5CA0F 1W36D 4EI8A 4A8JB 3BB4A 3AOEA 2G88A 1SCUA 2WKQA 1H0SA 4YP7A 3REQA 3K0AA 2C2YA 4ID9A 4LG1A 5BP7A 4LC0A 1P80A 4BO2A 1KDTA 2SECE 3HVHA 3Q3EA 4MQEA 4NOMA 4F9TA 2J59A 5JATA 2WJIA 4X8HA 3LUCA 1BCSB 1TM3E 3B20A 3HDYA 4FFWA 4IL5A 4KAXA 4MX8A 2GKOA 5A6SB 5BSEA 3OX3A 3PGXA 4RE6A 3WV4A 1NUPA 3H16A 4IP0A 3WLFA 2XBMA 5IP5A 2FRXA 5BXYA 5HFAA 3BB1A 4YRDA 1OWMA 1WHSB 1KHHA 3MWGA 3VI4B 5JNTA 3WWEA 4A15A 2V03A 1UMBA 4L8YA 4KXWA 4HB2A 2OWEA 4KRYA 3BHNA 3FNGA 5BOVA 5AHWA 4NHOA 2I2CA 1T0JB 3IAS1 2R8EA 2ZT5A 1TTQB 1GTZA 5JRZA 3I5UA 5JYDA 3W9BA 2BMFA 4DFDA 2B4TO 4X6LA 1E2BA 2NU8A 2E4XA 3RAGA 1X87A 4ZC8A 2O5CA 4S2UA 4EUKA 1PS0A 2CV2A 3R4CA 4I5FA 2HNKA 5DKFA 3VU8A 821PA 2HRQA 2WIAA 2JAWA 3HVIA 1USWA 3U0BA 1MA3A 1QIKA 4G86A 1KZ4A 3TQOA 3DGEC 5K99A 4LPSA 5CXXA 1G0NA 3ETCA 3L49A 1JPJA 3JD2A 5FB3A 2FJPA 4WCFA 1HZJA 1YACA 2GJAA 2OEPA 2VDOB 3C48A 1MQ8B 1GRQA 1T13A 4KO1S 1W9HA 3KHTA 2B8NA 4MA5A 5ENZA 1PL0A 4HWSA 3ONDA 1T2FA 1MQAA 4J0KA 7GPBA 1YQEA 1F8XA 2BD0A 1VL6A 1ORTA 1RQNA 1XK6A 2W0MA 1ZO8A 1DHRA 3GFRA 1ENOA 1SCIA 5JFTA 4NV1A 3C24A 3LQKA 1M9NA 3OPVA 4TV9F 1RHUA 2WJJA 4LKRA 1A9SA 4R7TA 1EDBA 4LJ4A 4AY4A 3MT7A 1CUAA 1JRLA 1QZTA 1WMFA 5KOHB 1SC9A 1LJUA 1E64A 2JANA 2PNFA 4O1HA 2F1HA 2JFXA 2BCGY 1M0TA 2X6RA 3D7MA 3GZNA 1NV9A 4DDUA 4EYQA 3OJWA 3C5VA 5DTMA 5TMDA 3GT7A 1FK8A 2P6OA 2G1JA 1SQ0A 4IF4A 3Q0EA 3ZV3A 1L5MA 3ICCA 3TX6A 3HJFA 4K9DA 4M89A 2DWQA 4TYPA 5JVDF 2DWUA 1SBIA 5BW6B 2F1JA 1I4EB 3O8BA 2ONKA 1JSRA 2DPHA 3CINA 3IRVA 4PHTA 5JCJA 4EA7A 4MQFB 4ZZIA 2XX3A 2ZGVA 4XCQA 1W4BA 2V7PA 1JKJB 1QH1A 4MWBA 3X1XA 3A2KA 1PT6A 2BFBB 2JBHA 2NM0A 2ATXA 1MB4A 1VL5A 3BGVA 5CBPA 4X1YB 4D46A 3PJRA 3KWLA 1PJTA 3UKOA 1EM6A 4R9SA 3KSMA 3RS2A 2X13A 4EPRA 1V9LA 2EXXA 2XUAA 3AI1A 3E9ZA 4TM8A 5FTJA 5BNWA 4XLZA 1SHJA 3IPCA 4L95C 4M88A 3HUUA 1FU4A 3MS2A 2IS1A 1QYWA 1GFSA 2BELA 2DH5A 3GQVA 3M33A 4DCNA 1EVKA 5A0TA 1LSSA 4DLTA 2ZS9A 2CEAA 3Q88A 3WYGA 1EM8A 2W83A 4CLRB 1KBQA 2PA0A 3TEJA 3IT3A 1CNMA 2J32A 3H0CA 4RHXA 5K3CA 1RJ9B 2CXXA 1E5VA 1TLFA 1EK6A 1Z0DA 2ETVA 5AFSA 4OGGA 4MA0A 2YHAA 2H4FA 2ZROA 5TQ2B 1KP9A 3FHOA 1W1WA 3UC5A 3W2TA 5IH7A 4H7PA 4LC1A 3LRXA 1C14A 5AVVA 2FN3A 4L6CA 2H65A 4BFSA 2XUGA 3ZUPA 3KSZO 3LX8A 3M34A 2Q49A 4O4HF 3VTKA 3GLHE 2D06A 4TV8F 5E2IA 1PJBA 4CL0A 1Z0JA 3JV7A 3MWKA 2AZMA 1CEXA 4MCHA 3EISA 4I6GA 4BUCA 1GG8A 4UTVA 3HKCB 3LBFA 3FXAA 1PI3A 1NXSA 3IOCA 2J3KA 4RS3A 1GPJA 3BL8A 4EFLA 3NOOA 3OCZA 1XCJA 3KR9A 5HGJA 5BOSB 3L43A 1T8YA 3JARB 3M5DA 4F56A 1Z88A 5CNJA 3WTBA 3GLIA 1ID1A 2P4SA 3RC2A 4C3OB 3GRVA 4C89A 4BXOA 3FCAA 1UMKA 2CHGA 4QZVA 2QPTA 2HJRA 1Z08A 1PT5A 3K5WA 5KPJA 3GPCA 1FDOA 4LGCA 1S2LA 5GZ1A 3EEOA 1PW7A 2QZ9A 1DG3A 1WPXA 5EHXA 2G71A 1A2KC 1UFQA 2J9YB 2Q1TA 4Z86A 3SHWA 4CQLA 4CKCA 4PHGA 1ZNYA 2VLIA 1CD5A 1XN1A 1T3TA 3A9VA 4YJDA 3VC2A 1YJ5A 1K3TA 1E9AA 4O2AB 4RSGA 1K89A 2JD0A 1UFVA 3TNDA 3C70A 3LG2A 4XVUA 1CUHA 2R87A 4R8MA 1GDHA 3EA0A 4A0RA 2EHJA 3OKCA 2YINC 3UWSA 2C4VA 1E6UA 1WNTA 1JKIA 2H4WA 2WVJA 2X3UA 4INOA 3I0ZA 1V16A 4MS3A 5AUOB 4CU2A 3DFUA 1M2EA 4UARA 2OK7A 2PCJA 3UHJA 1XRJA 2QD1A 1B0AA 3L0PA 2HJGA 4KQMA 4ZARA 4EJFA 1C3OB 3J80A 3W2IA 3A1FA 3FCOA 4PLFA 3L4KA 2H5EA 2REQB 5E0KB 1YIDA 3M3HA 4JNCA 5CT9A 3L8ZA 3ONFA 2ZYIA 4FGLA 4UMDA 1EK2A 3L1VA 3RVLA 1RJEA 1SKUA 2J30A 2QL6A 3HBNA 3UFXA 1I4TD 2XT0A 2FX5A 3L8HA 3M7IA 3SQOA 5LBIA 3MVEA 4AJOA 1W0KD 1J0XO 1SHLA 1O77A 2BFDA 4OBBA 3M3DA 3SE7A 1ZICA 2JVKA 5IKPA 1YR3A 4HYEA 4YTEA 3WI7A 4DSZA 4KQCA 4AX4A 2AD1A 2M1ZA 1NXPA 5HE8A 1L7PA 4JU9A 2CNWA 3SOPA 3DXYA 3UJAA 3CZMA 1POXA 1BRTA 3RK1A 2YH2A 2FFBA 3F90A 4D9MA 2Q4RA 3HB1A 4H77A 1BQ3A 4C3VA 5JCZA 2F9FA 3MLBA 3TXYA 3K9FC 4QJIA 2Q7XA 5D5QA 1MABA 3F5SA 4J0EA 3KSBC 1S3FA 3KK0A 1SO8A 5FD8A 1KY2A 1IM5A 3V00A 5CAEB 8ATCA 4MNTA 3SFVA 3HZZA 5FI5A 2EP5A 1DAPA 2JGLA 1RRFA 2O8EB 4OXQA 1ZVJA 1QYDA 1DP4A 4M1ZA 2N1BA 1TM4E 3BFKA 1QYIA 1M1XB 2GPJA 4PICA 3S44A 1NJGA 1N7GA 1N9GA 3ABRB 3R41A 5A7FA 2C4NA 1G6KA 1H85A 4ZV9A 1OUMA 4PAOA 1QIEA 2CUNA 5GGXA 3MFQA 5K0NA 4M8IA 2PPVA 4QUJA 3EQ8A 3MFYA 2QRNA 3NHLA 5HM6A 1GRNA 3HDTA 2J08A 4E2FA 1EVQA 1S3GA 3R74A 2J41A 4OLAA 4TZ6A 1N25A 2ECKA 3RYHA 2YXPX 3PC7A 3PJFA 3IMCA 4PRYA 1PJ3A 4K5QA 4XVCA 1H0KA 5KTPA 4CMAA 3RTBA 1K5PA 2BV3A 4LF6B 3G0CA 1ACMA 2V6IA 3T9CA 2VOEA 3EUAA 4XARA 4GLJA 5DYNA 4DY6A 4EGSA 2HX1A 5DEIA 4IWXA 5BN4A 4WFJA 4XWKA 4AF8A 1G21A 3ZLUA 3EF1A 4HLQB 3T1YB 4ENTA 3GH3A 2PXXA 4I2VA 2EERA 3LECA 2CFCA 3W5DA 1GVHA 2ONYA 3DE7X 3ISVA 4BNUA 5JD6A 1MJGM 1ISGA 2XCRB 3WOVA 1BDJA 2PVCA 1ZHHA 4ZIRA 1U80A 3LHDA 1RAGA 2I03A 4K05A 621PA 3H5OA 1J9GA 1W5SA 1UBOS 3PVZA 1EVJA 1RAFA 4HNRA 3GA5A 3KOXA 4KYIB 1E5TA 1EFPB 5I7OA 2TMKA 4BECA 3CX7A 1B26A 3AV3A 3MERA 1KI3A 3R0ZA 3PI7A 5J2TB 4EUNA 4JUAA 4YDRA 3M8KA 5H5JA 3LCMA 3NT5A 4L72A 5DI3A 4ZGGA 3HTXA 4WESB 3WK5A 1CHNA 2VQ6A 2G07A 3G7NA 1X74A 1B15A 3QEMB 3RSFA 1R8SA 2X0IA 2XNJA 3PE3A 2QM3A 2X86A 3PQ2A 4DR6B 5FQOA 1QO0A 6PFKA 2QKYA 3B70A 1SIOA 4N0EA 1MX3A 4OH7A 2Z09A 1XFAA 1XZMA 2ZRNA 1UPXA 4XUGB 4DA7A 2KSQA 3D6UA 4OX9B 2PO5A 3ESYA 3NAQA 1JDBC 2Q3EA 3IVCA 1IZ9A 2ILTA 3JQAA 1LBTA 4Q05A 4X64B 2LTAA 1TA9A 2EKBA 4OJMX 4G0UA 2DMRA 3F74A 4IJ6A 4ZCTA 5I3ZA 3RRXA 3PXXA 2J3JA 3ENVA 4MR7B 1JDBB 5CFRA 4N5MA 1QIGA 3IDFA 2X0FA 4D1YA 2V0CA 4PHFA 4IGIA 1ZD5A 4JL5A 3GAZA 2C99A 4PO8A 2MSLA 3A58B 5DWVA 1C0LA 3T3GA 1EDDA 4ZAXA 1OU4A 1BJRE 3FX2A 4H18A 3EOZA 3RNOA 2J1LA 4NBRA 1JJFA 3I9NA 5KNDD 1CQPA 1ONSA 3CFYA 5EZYA 3MWFA 4AAYA 1SXGA 2VJAA 5JZOA 1IC6A 4TL9A 5KQRA 2YBEA 4AG6A 1RLOA 1HGXA 3I61A 1XTZA 3L6BA 4J49A 5K0LA 3BG5A 3I76A 4OL0A 1XNHA 2I8LA 3SSNA 1HYHA 1R4AA 1W2WB 4BO8A 3NV7A 1QIDA 2CLIB 4IDOA 3NJRA 2YFQA 3FCEA 4PGFA 4PYNA 4ZVUA 3B1FA 3CVWA 1HI9A 3C6YA 4NHEA 5AKEA 1XE3A 4H7FA 2HT1A 3VR1A 5EZ6B 4BVAA 1H1LA 3QF7A 1S89A 2HH9A 1RYEA 4O4JB 3AJEA 4JWKA 1AU9A 1IY1A 4AS1A 4X44A 2OBLA <