3P71T

Crystal structure of the complex of lcmt-1 and pp2a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
b'DENDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLSSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKEITY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine carboxyl methyltransferase 1
publication title The Structural Basis for Tight Control of PP2A Methylation and Function by LCMT-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/hydrolase
total genus 118
structure length 315
sequence length 315
ec nomenclature ec 2.1.1.233: [Phosphatase 2A protein]-leucine-carboxy methyltransferase.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF04072 LCM Leucine carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p71T00
4C05A 2OBFA 4C4AA 5EEHA 3KQOA 2FPOA 3A7DA 2B78A 2YXEA 3DULA 5GIOE 5GIPE 5CIYA 3BZBA 3MHTA 3UFBA 2IDKA 4EVIA 3UJ8A 2VZ9A 3FUTA 4GOLD 2CWWA 2V74B 1ZGJA 1FP1D 4OBXA 3SSNA 3UBTA 3TR6A 3HCAA 4GQBA 2AZTA 1KYWA 3B7PA 3THSA 3NVMB 3LBYA 3NJRA 3SSOA 3CGGA 4HTFB 4RX1A 5U4XA 3RW9A 2XVMA 4QQKA 4AZSA 3M4XA 2CMGA 3EEYA 3EMBA 4HGYA 3LL7A 2QM3A 1XCJA 4X41A 4R6WA 2XYQA 4MIKA 3ELDA 1IY9A 3SGLA 3SMQA 3BXOA 4KDCA 5HILA 4CTJA 5EKUA 1X19A 2IDJA 3JWGA 1INLA 1QANA 3BGIA 5ICEA 4YV1A 3FPJA 4P7JA 4E2WA 1BOOA 2PWPA 1IXKA 3EPPA 1ORIA 4R8SA 3P9IA 4YUZA 5FULA 3P2EA 2GB4A 3KQTA 5HZMA 5DRYA 7MHTA 3I64A 1NBHA 3DOUA 4PIMA 5EKXA 3TQSA 4EQZA 4YV0A 3P71T 2VDWA 2Y1XA 3BKXA 3D2LA 4LWOA 3AWIA 4E33A 2UYOA 4MHTA 2OYRA 4A6DA 3LECA 2QRVB 4CTKA 1PRYA 5EQJB 3VSEA 4K6MA 3ELWA 3CCFA 3M6VA 2PV0A 4CXMA 2R3SA 3OPNA 3UJDA 4QVKA 5FA5A 1O54A 5EHGA 5ICGA 2Y1WA 4FT4A 2G1PA 5FHRA 1M6YA 1P39A 5FWAA 1YFLA 2IIPA 5EIWA 3GJYA 5EMJA 4YUWA 5KQSA 1VP9A 3VC1A 3SX0A 3KHKA 2PXAA 3FPGA 3G8BA 1N7IA 1MHTA 3G2OA 3DMHA 4E2ZA 3BGDA 3HCCA 3A27A 4WVLA 4E2YA 2ZULA 5DRTA 3KQPA 1NW7A 3P9KA 5FQNA 2ZWVA 3JWJA 1AV6A 1VP3A 5EMMA 1JSZA 2NP6A 3ME5A 3I53A 3TKYA 2GAFA 2BZGA 3KQVA 4C04A 2A14A 4P7GA 4FP9A 3QOWA 1XDUA 1RJFA 1PJZA 5EOVA 5T6BA 1FP2A 3KKZA 5CVJA 1RJDA 4BP1A 2PX5A 5K8VA 3SR4A 4R8RA 1RI1A 3PB3A 3HCBA 2EX4A 5K0LA 2ESRA 1DUSA 1SUSA 1O9HA 2VS1A 4ZTBA 2DULA 5E2AA 1WG8A 4Y30A 5K0JA 4RTQA 3LDUA 3CKKA 3UZUA 3HVKA 2OXTA 4PYMA 3WSTA 2CKDA 5E1DA 5FHQA 5K01A 1G55A 5K0GA 3EGEA 2C7PA 4HGZA 1YF3A 2IBTA 3UJCA 5EGSA 4OBWA 2ZZNA 1WY7A 3HCFA 3UJAA 4PYNA 1X1DA 1FBNA 2B25A 5T67A 2ZZMA 4E31A 5C1IA 2GH1A 4LECA 1YUBA 3P9NA 3E8SA 3DLIA 3GXOA 3PFGA 5CUQA 3HVIA 4FGZA 2PXXA 1QZZA 1RI3A 2AVNA 3FRIA 1KPHA 3FRHA 2K4MA 3MERA 2P40A 3S68A 3RODA 4DKJA 1G38A 4QQNA 4F86A 1XJ5A 2O06A 3HCDA 3KQQA 4H0NA 4X63A 2P3QA 4PGHA 5DX0A 2PX2A 3B3GA 1R6AA 4EKGA 2N47A 1ZHFA 2P7HA 3HA3A 5CCXA 3T7TA 3OZTA 2WA1A 3R24A 1KP9A 3G2QA 4RVDA 3PTAA 1M6EX 4OA8A 1IM8A 1TPYA 3R0QA 5E1MA 4AZVA 4BLUA 4EMSA 4DA4A 2Z6AA 2AOVA 3LCUA 5KVAA 3U81A 4DZRA 3NVKI 4RVHA 4HC4A 1V39A 4PYIA 2BR3A 4AZWA 2P3OA 5DT2A 3DTNA 2C7OA 4YV2A 4OA5A 5K0CA 2ZZKA 3GWZA 1VBFA 3LBFA 5CVDA 5KQRA 4RV9A 3M6WA 5C0OE 2ONYA 1YB2A 4QPNA 3PLAE 3T7SA 4V0RA 2ADMA 1NW8A 3LPMA 3Q7EA 1NV8A 2VDVE 3ERCA 3V97A 1JSXA 3GNLA 4IV0A 5F2OA 4YMHA 1MJFA 5DXAA 4YUVA 1YZHA 3OU6A 3M6XA 2NXJA 3HP7A 4RWZA 2ZFUA 3O7WA 5EIFA 2YTZA 5D1HA 1HMYA 1XTPA 3VC2A 2I9KA 2PJDA 4BP3A 3I58A 3KPVA 4RVGA 2QY6A 2QE6A 3G88A 4GF5A 2H00A 1Y8CA 3LGAA 3NDIA 2PXCA 2AOWA 2ERCA 3MTEA 1L3BA 2E5WA 3O31A 3CVOA 5F2NA 3R6TA 4RTNA 2Z6UA 3FTDA 3ANXA 3GO4A 3PT9A 3HCEA 4RTLA 1U2ZA 3GIWA 1G8SA 3EVBA 3KR2A 1P1BA 3JWIA 3OFJA 3HEMA 5GM1A 2BH2A 5EZQA 3G2PA 3M33A 5E9WA 1EJ0A 4DF3A 1N2XA 4RVFA 4HTFA 4OQEA 3KQYA 4CKEA 4EKIA 3FPEA 3LDGA 2JG3A 1XXLA 4O29A 2PT6A 3TM4A 4BLWA 5LQUA 1KYZA 1UWVA 5K09A 4OQDA 1R00A 1ZGAA 5DTQA 2Z6QA 1SKMA 3P2KA 3BUSA 1VE3A 2B2CA 1JQ3A 3KQSA 4GOMD 3EEOA 5GM2A 2IGTA 1DL5A 2JHCA 1SUIA 3PFHA 2ZSUA 3TFWA 1KPIA 2IBSA 2AOUB 3EVAA 3PVCA 2ORED 3FYDA 4PIPA 1XVAA 1EG2A 5JR3A 1TW2A 4F85A 2UYHA 2AVDA 4Z2YA 1WS6A 2AOUA 3KQWA 1X1CA 3GRRA 4C03A 4PCAA 1L9KA 3EVCA 4HH4A 2QRVA 4E2XA 4HG2A 3TKAA 2YVLA 2HMYB 3MB5A 1XCLA 4FZVA 5DM0A 4MWZA 3UJ6A 3MTIA 2V7EA 1NKVA 3QOXA 3E7PA 3KPUA 2O0LA 4RTPA 3BGVA 3RIEA 1JG4A 1WZNA 2ONZA 4ISCA 2I62A 4PYOA 1M0EA 5EG5A 4MTLA 3UA4A 2YX1A 2AOXA 1RI5A 3OU2A 4ER0A 1RI2A 2UYQA 3M6UA 5LSAA 2C7QA 3MAGA 2HR1A 3LKZA 1R18A 3MCTA 1X1BA 5EHIA 3LDFA 3NDJA 2JJQA 2OPBA 3DMFA 5F2KA 4PYJA 4YUXA 4XUDA 5EPEA 1QAMA 4RSRA 3BT7A 5K0BA 4MQ4A 2JHPA 1HNNA 3CJTA 1KIAA 5GINE 3THRA 5BW5A 4LWPA 2PX8A 2EFJA 3SXJA 5BP7A 1JQEA 4NECA 1YFJA 2PGXA 1NW5A 1UFKA 1NT2A 2XYRA 3M70A 1L3IA 3K0BA 4E70A 1R74A 5DM4A 3FTFA 1Q0TA 2G8NA 5GOZA 1FJXA 2IPXA 4PWYA 3UA3A 2ZWAA 3FYCA 5K0NA 1VIDA 3FPFA 4U7PB 3HVJA 1NW6A 3P9CA 3T0IA 4DCGA 4IWNA 5M5BA 5D1NA 3KR0A 3TRKA 3DP7A 4BLVA 1YZ3A 2C7RA 1WXXA 5CVVA 3EVGA 3EVZA 2JH9A 5HIMA 5K0FA 4CKBA 5LR6A 4FS8A 1RJGA 2PKWA 1JTEA 1N7JA 1F3LA 1QAOA 5FADA 5FUBA 1T43A 4B17A 5BXYA 3K6RA 4PYLA 3OE5A 1EAMA 3P8ZA 3A25A 1VQ1A 1JTFA 2R6ZA 1QAQA 4P7KA 2P41A 2VP3A 2I7CA 1VLMA 3A26A 3G2MA 1G8AA 4PINA 5IKMA 2O57A 5DM2A 2O07A 2PY6A 3I9FA 4QPPA 3C3PA 3G7UA 3LKDA 3T7RA 4ATNA 2UZ4A 4QVGA 5ICFA 2IH5A 3FUVA 2AR0A 3E23A 1G60A 2HV9A 2OZVA 3DXXA 3ELUA 1ORHA 2WK1A 3AJDA 3KR1A 4XUCA 4AUKA 4YUYA 1I1NA 5HOQA 2ZCJA 2BM8A 5EC8A 2ZBQA 2G70A 4DCMA 4PCLA 2ZLBA 2NYUA 1G6Q1 3GCZA 3GRVA 3ORHA 4RYLA 5FTWA 3CC8A 4ER7A 3NTVA 3IV6A 2JH8A 2IFTA 1KHHA 2HWKA 2BR5A 1EQAA 2QYOA 3UWPA 2XBMA 4XCXA 1JG2A 1KR5A 4GBED 3TOSA 3OFKA 3GRYA 5EEGA 3HTXA 4QTUB 3B3FA 3FZGA 3HA5A 2IH4A 1TW3A 3CBGA 5E9QA 4HRAA 2PT9A 3AXSA 3PS9A 4M37A 2P3LA 1XDZA 4GC9A 3SVZA 1BC5A 1WXWA 2PWYA 5T64A 1Z3CA 2EJTA 1AQJA 4C08A 1L3CA 2ZVJA 3BWMA 3HM2A 4AX8A 1SVUA 5GWXA 5LQKA 3LHDA 5DX8A 2AOTB 1ZQ9A 3KR9A 2YUIA 3MCZA 4P7FA 5LQNA 5K0EA 4V0QA 5DSXA 3KPWA 4RTMA 3BWYA 3MGGA 3TMAA 3BWCA 4XUEA 5DLYA 3BKWA 3FTCA 2XVAA 1R8XA 2NXCA 5FA8A 3GU3A 1SQGA 2OY0A 3L8DA 2O05A 5H02A 4ER5A 2F8LA 2H11A 3HVHA 2AN4A 3EVDA 3LX6A 3UJBA 2NP7A 2YXDA 2ZIGA 5HIKA 1EJ6A 2FK8A 3HNRA 5DM1A 9MHTA 4FSDA 3G8AA 5CVEA 5ICCA 1R8YA 4X61A 4E30A 1SQFA 5HIIA 3R3HA 5CCBA 4GC5A 4M7RA 3DH0A 3IEIA 2FYTA 3DUWA 5LQJA 2YR0A 4CKCA 3A4TA 3EGIA 2P8JA 2ZBRA 5DTRA 3I5UA 3JWHA 5E8RA 2GLUA 1H1DA 4GOOD 5IH3A 2GS9A 5KYGA 2IH2A 2AS0A 4ER6A 1NE2A 3PX3A 2LD4A 2CL5A 3OCJA 4KDRA 3FUXA 3VYWA 4RTKA 1I4WA 2PSSA 5DPMA 2PBFA 2G72A 2FHPA 4Y2HA 4X1OA 5HEKA 4UOEA 1P1CA 3AXTA 3AY0A 3ELYA 1KPGA 3EVFA 2XYVA 3IYLW 2ZIEA 3QV2A 2EJUA 2HNKA 3DXZA 4KWCA 3E05A 4M38A 2BR4A 5CD1A 3CJQA 2FCAA 1JR4A 2CMHA 2G71A 5P8WA 3TM5A 2GA9A 5E8JA 1ZKDA 1JG3A 1I9GA 3KQMA 2AN3A 5HFJA 2I6GA 4FSXA 2NNWB 4HSGA 1P91A 4POOA 3C6MA 3NMUF 3DR5A 4KVZA 1EIZA 1F38A 4RTRA 4WXHA 4QTTB 3TPZA 3SM3A 3G5LA 3SSMA 2YQZA 5K03A 4R05A 4QDKA 5EVJA 3NWBA 4PONA 1B42A 3PX2A 2BM9A 5LQRA 3Q87B 2Q41A 2IP2A 2YXLA 4GUAA 5DXJA 2ZW9A 5K05A 3DXYA 2UYCA 1NBIA 2PVCA 2FK7A 1QYRA 1X1AA 3EMDA 3EVEA 3EGVA 3GDHA 4P58A 5G02A 5FWDA 4KRGA 1VL5A 3H2BA 3B5IA 4OX9Y 4IV8A 2OO3A 1AF7A 3A7EA 2NXNA 3KPJA 5MHTA 1UIRA 4RTOA 3LCVB 4KIGA 3GRZA 1VPTA 2KW5A 3GGDA 3LSTA 2VDUE 1AQIA 4QDJA 1D2CA 4X60A 5FCDA 5GP1A 3BWBA 3P2IA 3X0DA 4DM3A 4IKPA 1NW3A 2FRXA 3B89A 4ER3A 3C0KA 5BW4A 3FTEA 3OZSA 5DX1A 10MHA 5E2BA 2AN5A 2PX4A 4BY9E 3NWEA 4GOND 2ZIFA 4JXJA 3REOA 3MQ2A 3G5TA 1KXZA 4M36A 2EG5A 3B3JA 5E1OA 4AZTA 4GEKA 2ZBPA 3HA7A 4FT2A 2B3TA 3O4FA 3ER9A 4R6XA 3DMGA 3NW9A 1OR8A 2OB1A 3LCCA 3UJ7A 1FPQA 2WA2A 2P1DA 4YMGA 4A6EA 4EK9A 3P97A 2NXEA 4RTJA 2ZTHA 3FPHA 5CM2Z 3ER8A 8MHTA 5HIJA 1BKYA 4RTSA 5EZSA 5LQAA 1XDSA 2PLWA 4PYQA 4E32A 1RJEA 1RI4A 3OE4A 4U7TB 4F84A 5DTMA 4DQ0A 3KU1A 3CJRA 1D2HA 5E1BA 3FUUA 5E9JA 5EMKA 5LQCA 1D2GA 3G89A 3F4KA 5KS2A 1ZG3A 3OU7A 2P7IA 2P35A 5ERGB 5FQOA 2HTEA 5B1SA 4C07A 3UJ9A 4CWAA 2GPYA 3TLJA 1JQDA 4G56A 3ID6C 5JUWA 4FR0A 1BHJA 3IHTA 1NV9A 1JG1A 3OZRA 3FUWA 4KIFA 4LG1A 2H1RA 4PNEA 2JHAA 4C06A 3V8VA 2OKCA 4PGGA 5C9ZA 2OB2A 2B9EA 2DPMA 1L1EA 1Q0SA 4PYKA 1O9GA 2AOTA 4KW7A 5EMLA 4DMGA 5DSTA 1DCTA 3DLCA 3GRUA 5CVUA 5DWQA 3R9XB 4L7VA 3C3YA 1SG9A 3C6KA 3KPYA
chains in the Genus database with same CATH superfamily
1EZ1A 5NULA 4D0SA 3AVQA 2J8ZA 3GYGA 4GX5A 4RPIA 3TNLA 4EG4A 3VJMA 1CYDA 5HVNA 3S2GA 3D7MA 1U6KA 4G84A 2R1VB 3BXFA 1BCRB 1Y9DA 2V74B 3KAQA 3KAPA 2ISSD 4BMDA 1UFQA 1IZ8A 4OAQA 4ND8A 1GRVA 4HGNA 3NJRA 1UWLA 1YTLA 2QUZA 3CGGA 1UBSB 3QWHA 2P6PA 4G1MB 3BCRA 4GGMX 2QD1A 4KN9S 2GJ9A 3M9XA 3EMBA 3P2MA 1DFIA 4X41A 5ANRB 4BP8A 5KOHB 2MMGA 5MN4A 2C96A 2NUTA 4F4JA 4RELA 5HILA 4ZZ2A 4LK3A 3BL6A 2FI1A 5JQGB 1G64A 5ICEA 3LHSA 3UMMA 3JQ8A 3V4FA 2A7QA 2CYBA 2PWPA 3EPPA 1NUPA 4FBLA 4M21A 2CZGA 3N8GA 2RGYA 3NBUA 1ANKA 4E09A 1JAXA 1NL3A 2XOXA 2DBQA 5F3WB 4FIZA 1YNOA 1H42A 1HYBA 3TE6A 1A50B 4EQZA 2ZJ3A 5LPNA 3KTAA 4BGIA 2PZFA 4DIFA 4WY2A 2O5RA 3VKVA 1KEKA 3ZBTA 2A5LA 3BOSA 3LECA 2C7BA 1GDDA 1OLUB 1Y6JA 4UM7A 3U4HA 5HK8A 2X58A 1U7UA 2XSZD 2WSSA 3D6VA 3OQIB 3EUWA 1ULUA 3L0SA 4QVKA 3B1ZA 3GJ3A 4ZA2A 1ZY2A 1E2FA 3ZWYA 3OWXA 2MYPA 2HA7A 1UJBA 2QR5A 4I14A 2G1PA 4OF4A 1DRVA 2C20A 4Q3NA 3AU9A 1JHAA 3PXUA 2G63A 3KYJB 4X90A 4ZQBA 3DBOB 3VMMA 4BU1A 2O8DA 3SVLA 5F52A 1I94B 2I7DA 4BVHA 3FPGA 5A4JA 5K2OA 1A9RA 1VTKA 1W93A 2O3QA 1PLLA 2XUOA 4ZVOA 3ZE2B 3DMHA 5EERA 1ZRSA 2XMRA 2IPNA 2XUJA 3GLIA 3KWJA 3D5QA 3Q5GA 1QG2A 3E9RA 4IIBA 4MWGA 1NW7A 4JQOA 2SKDA 1WCWA 2VYQA 2WIKA 4KXNA 4LDZA 4OJTA 4BN5A 4DXAA 3DWEX 5KWSA 2PJUA 2WSIA 4KSBA 1PZFA 3I53A 1HE4A 3L9WA 1NI4B 3TEMA 4LHVA 1U8FO 1ODTC 3DEIA 1RBMA 4ML3A 2YMLA 3CH5A 1AGRA 2VT6A 5JO9A 5T6BA 5EXPA 5J43A 1DDIA 2O1EA 4GZLA 4LHWA 2PGDA 2JBHA 4C0AC 3ZNOA 2XZLA 4S1VA 2ESRA 2ZS9A 2EV9A 1QYXA 2Q9BA 4U9HS 3ZLUA 1YDGA 1P72A 2ATEA 3R23A 3AFHA 1GTL1 4MI9A 2GBFA 3A1TA 2JIZA 1OYYA 1Z7GA 1G55A 5HZKA 3K0AB 5FTNA 1YR3A 2VF5X 2PL9A 2OO7A 5A5VA 3HEBA 4CNQA 4RPGA 4JQZA 4EJ6A 2HOQA 2O8NA 3ROQA 2VP4A 1ZOSA 5AKKA 2ZZMA 2IHZA 1Q0ZA 4B5LA 2RC5A 3CINA 2XXAB 3E8SA 1SVIA 1K2WA 2ICAA 3IJRA 5EHNA 3ZDRA 3FJOA 2QL7A 2ZRAA 3N74A 5LP6A 4W5OA 3ES9A 1QO9A 4FDLA 5JANA 1E2JA 1MDBA 1STOA 2CDCA 4BLTA 2RHDA 5H16A 1VHJA 4D3FA 5CLLA 3ASYA 2XMBA 3ANYB 1XJ5A 2O06A 2HSEA 3NHFA 2LNDA 4QDZA 4NU6A 1UFVA 3WKEA 1Y42X 3C41J 3U3ZA 3W5DA 1MQ9A 1PX2A 5ALSA 2JFXA 2MSLA 4P4SA 3IUYA 3PTAA 1M6EX 3DQQA 4NK4A 4DA4A 4NG5A 1Z68A 4Q3CA 3QVMA 3SFTA 2Z6AA 3LCUA 3DOEA 1XKLA 4MDYA 2HJ9A 1R7RA 2X4GA 3OUTA 4AZWA 2OZLB 3DAPA 3KUUA 4QO7A 1SUBA 4HO1X 2I54A 2IBMA 3GWGA 2D8AA 2ZZKA 3KZXA 4BNZA 4MQEB 1EP3B 1LZLA 2RH8A 3LBFA 4JUBA 2VF8A 3RU7A 2AR7A 4Y2JA 2H1HA 2JGRA 2FETA 4V03A 4V0RA 2YXNA 1FYXA 1NV8A 3OT1A 1IBRA 3IVAA 3V97A 4DQXA 2UU9B 3ERCA 2BHTA 1JYEA 2H0RA 5AW5A 8AT1A 4KOEC 2OENG 3D3EA 1H6BA 3H42B 4YMHA 5CBKA 3GLTA 4NH0A 1X7DA 1BE1A 1W5EA 5HKAA 4AKEA 2X4DA 2AL7A 4P81A 5ULLA 4BP3A 5AM5A 3UY4A 3KPVA 3TQRA 4IAOA 1EUDB 1VKZA 3Q15C 3RS2A 4GF5A 1PFQA 2BRUC 1A95A 2CE2X 2ERCA 3MJVA 3EK2A 4R69A 4FGLA 3VDQA 1J5XA 2OAEA 4GGPA 1ISGA 2F90A 4NP6A 1XVUA 2HZBA 2JLCA 4ZEWA 1C80A 2CJWB 3TTTA 2ZSEA 3RU2A 4ZI3A 4NK5A 3VDRA 4QX6A 3ZDBA 3GUUA 3F2VA 1D2RA 4LRYA 1KS9A 2J9FB 1KQNA 5ITVA 4DKXA 2BGIA 3FPEA 4R54A 3TW8B 3KX2A 4JOCA 2JKYA 1UBFA 1V47A 2BFDB 4MZDA 2HM7A 3C3CA 3CYFA 1P1FA 1SKMA 4NMLA 2MYTA 3LE8A 4KQIA 1H1LA 4B09A 1W87A 2QENA 1JT2A 4IEFB 4K86A 2QSZA 1I4DD 4R9NA 5CHEA 5IEBA 3PTZA 4E32A 4B3SB 3C8HA 5LFAA 4OQ4A 3RTBA 1F1JA 1ORTA 4K7JA 5TJHA 3T7CA 1QYIA 4ZAVA 3EIUA 2WJ4A 3Q7RA 4NEGA 1FZQA 1ND5A 2BISA 2O2SA 3FAZA 1E1DA 2Y8EA 4MCJA 2AOUA 2XF2A 3KQWA 1X1CA 1IOZA 4LDNA 4NYJQ 2HLHA 5FB3A 3E2PA 1V71A 1NLZA 1LU9A 3JD2A 1TAHA 1MV5A 1X1TA 1HT0A 5HYVA 2N46A 5CT6A 1NZDA 3LG2A 5IYZF 2INGX 3NG1A 4ENSA 5KDDA 2QZ9A 4M8IA 5DO9A 3UJ3X 3QPCA 3L7CA 3EISA 3GZTB 4MQBA 3I83A 2B4YA 1DQYA 4PS1A 4EHAA 1VL0A 1CQWA 1YC2A 2R5NA 2YX1A 4BMXA 1BQ4A 2P5YA 1RAHA 2AOXA 4B2YA 4JJ4A 1NPTO 1T2CA 3PUJA 6NULA 5LSAA 4AT1A 1PLKA 1R18A 3LKZA 5A4KA 1LBSA 1IATA 1HT1E 4JJ8A 4FQ5A 2I1LA 1GG2A 3JSXA 3C5EA 1B23P 1QSGA 4IS2A 3EXEA 1ZXXA 3DBHA 3KYCB 2F59A 3MWDA 4IUDS 3TKLA 5BSHA 5FPPA 3SXJA 4F1JA 5BP7A 2A2ZA 5FEUA 4X3PA 5A9RA 5IJ9B 1NT2A 4IIYA 2CXHA 3GOHA 4F6RA 4QM6A 1CY6A 3R3JA 4X5OA 3UK1A 3GP5A 3WLOA 1URPA 2M1ZA 1T0PA 3H4MA 1EZ4A 3UA3A 3CQ9A 4B17A 4CTJA 1KI6B 3EE6A 2Q5OA 2PUJA 1L5HB 2WMDA 3OG9A 2G5PA 4TTRA 1W96A 3SYMA 1FFEA 3FHTA 3W4KA 4XJSA 5HIMA 2E87A 2GNAA 2Q5HA 2VXBA 4TPKA 3OX2A 5K0FA 2DEUA 5LR6A 3N5KA 4WEQA 1O2DA 3G9QA 2IU3A 5T5QA 1JQ5A 1FNCA 1KQPA 2P9BA 1BE0A 2ZS7A 1VI6A 2PRJA 4F5WA 1YQEA 3OIVA 3VR2D 1MRZA 4W6QA 4Q7MB 3DF7A 3GV0A 3UCFA 1BEZA 1BS9A 3NEAA 2E1RA 1HYEA 5LOVB 4Y0AA 5K3BA 4I1UA 4J4HA 3ZZNA 2VJBA 3L49A 1JHDA 3HBJA 5HUHA 1T4GA 3LKDA 4LVOA 2ZJOA 3EDYA 4DANA 4Q3OA 2QW1A 5HKOA 3EGCA 4OOEA 1ORHA 1V26A 3KR1A 3F3YA 3NT2A 2C2ZA 4BGEA 2BM8A 2NO0A 4YCNA 4D41A 1FW6A 2G70A 4HEHA 2VPYA 2NYUA 3W6NA 2PT5A 1NWHA 3L06A 3CC8A 5LXTB 5FBLB 3AR4A 4RKEA 4C4RA 3W5UA 3Q0TA 5BSKA 1SZPA 4AJNA 3TL6A 5CURA 3UT0A 4FFDA 4Q00A 4A10A 2X23A 4E4YA 4FB5A 3N0VA 4YRGA 2ORIA 4D82A 4G36A 2C2OA 3L8MA 4NTZA 4EY8A 4BKQA 1PJQA 3IIJA 3KVVA 3H16A 3PWZA 2WE7A 1EDBA 1PQUA 4ZI7F 5JBIA 3N2GA 2PCLA 1U6JA 2QOEA 4X84A 4EUKA 1MRNA 3HM2A 1KZHA 5BWLA 3LQKA 4ITUA 1FQKA 1TT7A 2ECFA 3BIWA 4KO1S 2MU1A 4NBNA 4LKRA 4OY3A 5BV2P 3NBFA 3OMXA 2VC2B 2TMGA 1TJYA 3H05A 5JAIA 1KTIA 4ZVUA 4V0QA 4PZDA 5LYYA 1RM3A 1BRTA 4MW7A 4CBVA 2BCEA 4C22A 4KBGA 4LJAA 3G9XA 4AUNA 2FEWB 4HLUC 3OZAA 4RHEA 3D4IA 3L8DA 1A9XA 3DCYA 1SD1A 4BNJA 1JIVA 1RRVA 1EYZA 4G5XA 2WMOB 2YHUA 1CQJA 4JVOA 4TOIA 3NBZC 5KVSA 2R1TA 4KO8A 1NP6A 8LDHA 1R8YA 4CQMA 1SXJC 1XMPA 5A5GA 2P4SA 4XEHA 4IMPA 1C3OA 3DE1X 4QM7A 1WXQA 5KNCH 4GR5A 3PVZA 3MMPA 3B9PA 1A4UA 4D8YA 2GEDA 2YR0A 1K08A 4PPGA 4Q3EA 4YP6A 1UC9A 4A2PA 2VNIA 3QUSA 4M60A 3S2SA 1GP2A 4BKRA 2XYHA 4HF7A 4YALA 3WGUA 3AHJA 2I78A 2GLUA 3AR6A 1B2LA 4U6NA 1IK6A 3I34X 1T2EA 2X5JO 4JA2A 4GEGA 1E1QA 2C95A 3RVSA 3DNPA 2JCYA 4GBJA 4DIMA 4S1PA 4HWPA 1HZZC 3OH8A 4I3GA 5A5EA 3WDSA 2WI8A 2G5CA 3WV5A 2R6GA 2GZRA 3NHSA 4UHKA 5LMUB 2H2GA 2H1LA 4PPQA 2MR6A 3LP5A 2VK2A 1KXJA 3EVFA 4YDHB 1XJQA 3PYMA 1XK7A 4JK3A 2DWOA 3ZXXA 3OOHA 4YCAA 3TEFA 5A4DA 1W19A 3G9UA 3N39C 1WTAA 7REQA 5IN4A 1VE6A 1QYWA 1Z2PX 4TMYA 2C31A 1PQPA 2E55A 4G26A 5BN3A 4CV0A 1QYCA 2PRIA 3E7FA 5DHPA 2A9OA 2DM6A 2PLFA 1JHYA 3FGOA 2BCGY 3H5RA 3MLAA 4LHYA 2QDXA 4A03A 4KVZA 4ESHA 4QYIB 1E63A 4MAAA 4C1NA 1VMKA 5BV0A 4YJHA 2FN8A 1Y8RB 2FGJA 2ZVDA 5SZJA 2UUAB 2ZROA 5JFTA 1Z4IA 4Y6SA 2ZUWA 4JHLA 4HAYA 4GR4A 3K0FA 3RK1A 4IGAA 4JJGA 2Q41A 4BE4A 3R0VA 3WYNA 5HJ7A 4AZ0A 3EMDA 5HM8A 2CVFA 3OTHA 2EQBA 1Q7RA 5AOCA 1KE1A 3QA3E 1W4ZA 2YJ5A 1USIA 4MQ5A 4ZOLF 1RXYA 1E94E 3DVAB 3FR8A 4MX8A 2HW8A 3SIXA 2Q3HA 3ZD8A 1QK3A 2ASEA 3BE6A 4KHZA 5IZ4A 5EWJB 2AD1A 1LQUA 4OHBA 1CUAA 1ZOOA 3RVBA 4IFTA 4ZI2A 7ADHA 1QVZA 1GAXA 1SC4A 2FW1A 2CL0X 4PZZA 1XZKA 5BYKA 4BEJA 2WWFA 10MHA 1GA6A 4L4XA 4QICA 2XBMA 2XTZA 5BWBA 4N0QA 4V0ME 5HFAA 5TSDA 1PFVA 5ECWA 1DBWA 1WX1A 4IV5A 4M36A 2JFWA 5DGDA 3WZ2A 4F97A 4GEKA 3HY6A 4WN9B 1M3SA 2B3TA 2Y9MB 4IF4A 4YIKA 1ESMA 2J3QA 3PGXA 1E3JA 3U4DA 2G9UA 4ARCA 1B6GA 4N9WA 1T6BY 1FPQA 1LLUA 2NXEA 4R4JA 9GPBA 5C1PA 3G8YA 4FB4A 4DV3B 2PWAA 2FFRA 4TUYB 1BNCA 1Q83A 5J2TF 1DBQA 4K9NA 4F56A 1UK8A 1C3EA 2AI3A 3AUFA 1AGPA 4M8NE 4YASA 1DOZA 1FVHA 1SHUX 2BGNA 2ATCA 4ZCRA 4G0YA 1UAAA 3GX1A 1I2CA 1ZIYA 3E27A 5BUQA 1I6MA 3LUGA 2GXUA 4B3RB 2P35A 4XGKA 2PD6A 4OUDA 3QJGA 2RH9B 2QD3A 3NASA 3GPLA 4M9XA 5KJCA 1NV9A 1RJ9B 2IKSA 3THOA 1E3WA 3QXCA 4OXKA 3C3WA 3U26A 4G0VA 4MWTA 1IJBA 4FK8A 1OMOA 3P1JA 2XPCA 3L4EA 1REQB 1Y3FE 2C9ZA 4RM2A 2HMTA 2H3EA 1BE6A 4HLQB 4INAA 1U3GA 4NJMA 1P5HA 3HYRA 1NX6A 2CNOA 2YWDA 4O1IA 5JFGA 1QO7A 1YB5A 2VJPA 3PQEA 3KPYA 4RNDB 2CYAA 2VA9A 3PDIB 3SOPA 1G20E 4PLYA 1N0VC 2WR8A 3DE3X 1ILEA 1BTOA 1E6LA 2ZR8A 3COYA 4QPZA 3U3RA 4RDIA 2YC4C 2FW0A 3GJQA 5LB2A 3HCAA 1EFRD 2YWRA 4QBKA 3AF2A 1CUCA 1SQSA 4H4EA 4XYGA 4B3FX 2X1VA 1PZEA 3A32A 4G23A 4UNQA 5TQ0A 2GN0A 5C1OA 4ETIA 3H5LA 1GOTA 3ETLA 2RGRA 2JLSA 4CMEC 1YQ9A 1NY5A 1Z37A 3HC7A 3QMMA 4KDCA 3DYVA 3VYVA 3V42A 1TVCA 5LNK1 2MSNA 4QBGB 2QLJA 4QUGA 3VOAA 3A3YA 3FPJA 1CR6A 1Z6YA 3LQ1A 1ZNYA 5EKDA 4ZK6A 3GUZA 2BUAA 1V3VA 1V6CA 4JLNA 4ZD6A 3JQ7A 4ZYXA 3W5CA 2IVZA 3LYLA 4IX1A 4YRKA 4M22A 1N8TA 5CT9A 5AT1A 4M7OA 2J4CA 2XUGA 2YN2A 3TQSA 3L7NA 5JBNA 4LFCB 1SKUA 2PM8A 4ALJA 3AOGA 2ZRCA 2LBPA 2CGEA 2PFKA 4YJ2B 4CMIA 1H05A 1EDZA 4EG8A 4A6DA 1VLZA 3VC7A 3C7DB 3VU9A 3HKDB 3TLYA 4C6RA 2IEBA 4G97A 1P60A 1XB2A 2HJGA 2RJNA 2YH2A 5JAOA 1AKWA 3MAJA 2GM4A 5EE0A 1EEHA 3BBLA 1F2VA 1F3OA 2HJSA 2WJWA 3PUYA 4YJDA 1R9NA 2BZ1A 3FWNA 3TWOA 5CDTA 4BNUA 1LA2A 1OASA 2YZKA 4Q48A 1M2NA 1Q6YA 5TX7A 4BRWA 4LQLA 5JJKA 3RU9A 3TRIA 4AN1A 1DQZA 1LDNA 1SXHA 1TZCA 1PZHA 2OBBA 5EPUA 2F8TA 1RHQA 5KYWA 1AQUA 1PIWA 1Q14A 2LIVA 1G42A 1UDXA 4HEA1 1OWMA 3A9RA 4TMFA 3V80A 3WP1B 2CUZA 1E3DA 2CJPA 1AKUA 2YVAA 4CTOA 1I7QB 3OJWA 2RGBA 3VGJA 3K0KA 3ILSA 2GZ1A 3WA6A 1JSZA 1OXKB 2J3HA 2HXSA 2XHEA 1M6VB 2WFAA 2XLCA 2ZVPX 4RK1A 5FTLA 4O4HB 4XM1A 2PX5A 1FFXB 3I9MA 2Q49A 3B2QA 3ZX4A 2YJZA 1VIYA 1E9FA 4IVNA 3KBOA 3QELA 4N48A 1Z5VA 1ML4A 2DFNA 3KT3A 3CZMA 1SUSA 2OXFA 2ROQA 5K0LA 3R7SA 1OKKD 1VBMA 3B3QA 2I55A 4L8GA 4UASA 5I3ZA 4XCVA 1D6JA 4PYMA 5EMHA 5D5PA 2IYQA 4WOKA 5LQSA 3ZV4A 2P62A 2RHOA 4TV9F 2HFJA 2GD2A 3U2QA 2ZZNA 1WY7A 1T4DA 4OX9B 3A4MA 1TK3A 4RE6A 3NWJA 1SD5A 4IKEA 3P9NA 1UR5A 3JTEA 3Q12A 4RZUA 4XGIA 3W8NA 4F60A 4PC1A 5DHTA 5CXUA 1YH3A 1FXUA 3O8NA 1K4YA 4WZ6A 2AVNA 3NQ41 2NO7A 3DV0A 3QY0A 3OCZA 3KOYA 7MDHA 1YTUA 4IM7A 4MB6A 3RNLA 5JAUA 3KHUA 3MTDA 1M72A 1QIFA 1SNYA 2OQ2A 3KHSA 4HMQA 3C7CB 5G0SA 1EIWA 3HZOA 3WGLA 1WUKS 4ERXA 4EWLA 3RYCA 2KLHA 3V7WA 3LLMA 4JB0A 1AKYA 2AHRA 2F3QA 2DUUA 4CM4A 1OHHA 2E5FA 3MFQA 2X77A 4X24A 3SEFA 6GPBA 5DH9A 4W5HA 1V9LA 1ZO8A 5TS3A 1FLVA 1H3FA 3I76A 4S1OA 1GTJ1 1P1RA 1UDCA 2CUTA 5BR8B 1D9ZA 2ZRLA 5DCUA 3SIPA 4P0TA 3PYLA 2EYUA 1L7EA 1DRJA 2RHMA 3OP1A 5K0CA 2XITA 1IHUA 3KNZA 1VLHA 4RV9A 3W79A 3RADC 2QVYX 1J2RA 2R6AA 4D5GA 5A02A 1UPTA 1V1MB 1P9RA 3PLAE 3WHLA 2I7XA 2HD4A 4NXNB 3N70A 3B6EA 1A97A 1QIKA 1B14A 1Z7EA 5ECDA 4ZV7A 4AP5A 1HXHA 4R3UC 3W2IA 4B6QA 3SS8A 5FI1B 1KQOA 4ZANA 1SB9A 3QX9A 4J7XA 1DPGA 3K8OE 4TT3A 2SBTA 3PE3A 4M1KA 1JSCA 1UXGA 3AM1A 1BWQA 2P6NA 4Z8YA 2QS9A 3B6MA 4Q6BA 3PEVA 2SNIE 1OTYA 3D3JA 4YLGA 2HMVA 4CIXA 2RD2A 2BTEA 4OQQA 3Q98A 1CG6A 2BIFA 4JJ6A 3E53A 3OFND 2F8MA 3N87A 4Y9UA 4B6GA 2BH2A 3QVGA 4BQOA 1QO0D 1RWQA 1JYSA 4MLPA 4DWWA 4AYWA 1F4LA 2W2TA 4D9HA 1NM5A 1QTNA 1ZD5A 5I9IA 1TA9A 3A4VA 3RUDA 1XEWX 1Z6PA 2B9VA 4C30A 3QX8A 3TUIC 3U7RA 1A9ZA 1KWKA 4GQIA 3LL4A 2XQFA 4KUGA 1LBEA 3F9CA 3K4PA 2WSLA 2RI6A 3EEOA 5TS2A 3E4CA 2XAAA 1PFWA 1Q2UA 1JXQA 1W30A 5E6SB 2Q1YA 3U6KA 2I03A 4CKCB 1V5FA 2HA5A 4HAOA 2AHOA 4WA8A 1RDFA 3U4MA 1WLYA 2ADOA 1V5IA 5CLIA 2PJRA 2XR1A 4OU4A 1QRTA 1COZA 1PR4A 3P94A 3ZHYA 4Z4GA 1JKIA 1X7XA 4CJXA 5JRJA 3G2LA 3L46A 3AVPA 4YP1A 1V16A 2B21A 5DNWA 3SJZA 4WXEA 3UPDA 3QVJA 5BOSB 1S3SA 5DP2A 2KI5A 3IAM6 2WIAA 1QH8A 1XCLA 2FCRA 2QNRA 4HKTA 2POQX 3OQ1A 1VE1A 1NMYA 2GARA 3R40A 4MWZA 1WZUA 3PR3A 4Q1AA 4X1KB 1BCSB 1FA9A 1ORWA 3B5EA 3FHJA 4MYCA 3G2HA 4DEXA 2C9OA 1BG6A 5B64A 2UUBB 2G9ZA 2VI5A 1O6ZA 5ECYA 1JHOA 4AECA 3ZCTA 2AKEA 1Q17A 2AG0A 1M0EA 1K86A 4FOOA 1MGOA 5E7IA 1DTEA 1ATIA 2FWAA 1QIIA 2CB9A 2DLNA 1L5NA 4PAMA 1AKMA 3SLGA 4D79A 3KOOA 1JEYA 1C3XA 1F6BA 2J3EA 4H7FA 2I1WA 1OQAA 2IV2X 2I4TA 1SJ9A 2CHGA 1ZSNA 3QYAA 3OPVA 5E2IA 4UHJA 3QPWA 2XNSA 3RVDA 1KMHB 1T10A 1WP4A 3E4DA 4LWPA 3VX4A 4A8HA 4ENRA 1M5UA 2HPVA 2XEDA 1QKJA 4BASA 4BFLA 3I5MA 3USCS 3RYFB 4D3XA 2J3DA 4J9UE 1RKQA 4RA6B 3ORFA 5F33A 1GPJA 2IYTA 2WJPA 5TPZA 2PZAA 3HO6A 3FPFA 3V1TC 2CLKB 4G4SO 1N2IA 1V4VA 4S1TA 1EWVA 1AF4A 2JH9A 1GCUA 2Z5GA 2LCFA 4EEXA 1EGQA 1YR2A 4WEOA 5LYJA 4B3CA 3G6WA 4WNAA 1RWKA 4CMKA 4RKFA 3DE5X 5JAQA 1H6DA 2A9JA 4AUEA 5BYBA 1X8XA 4I9HA 5H3CA 2L17A 3CA8A 2W6OA 1G3IA 4IDNA 2P9EA 1YJCA 3CUWA 4H15A 3R77A 1MC1A 2Z30A 2VNSA 3T9DA 2JAXA 5LZ8A 1TZBA 2DPYA 4ZC8A 5EWMA 1W47A 2WAXA 3L5OA 4LJ5A 5LD2B 1JFVA 5KYXA 5DHUA 2ZS8A 4BTEA 4YYZA 4BNLA 3ZKAA 2AQIA 4D8TA 1YQUA 4EY7A 2CN1A 2FPMA 4WCDA 4NL4H 5CYOA 3ETNA 4LYYA 2P77A 3RSHA 4X0EA 1XMQB 4KVGA 5KTSA 4O5OA 2C8LA 3GRVA 4ER7A 2B94A 4G37A 4ZHQB 1WD7A 5L3SA 1MR3F 3H99A 1KHHA 2OBYA 3IKTA 1IONA 1U4SA 2X8AA 2HRBA 4U2FA 1SVMA 2C82A 4QQ8A 1V37A 5ALKA 1UK7A 3OX3A 2W2MA 1T2DA 3BFPA 5TPWA 2FR8A 4IHQA 1P1IA 1CY4A 2PT9A 4NQZA 3PGVA 4Z7JA 5IHXA 4XWTA 1WXWA 4U7HA 5J4YA 6LDHA 1JQKA 1DIRA 4MVWA 2RHLA 1UKYA 3BZUA 2O7SA 4FKBA 4ARUA 4OLHA 1XD8A 1IDOA 2VDOB 4F3TA 1NBOA 3TDNA 2X6TA 2X8JA 4LQCA 2QL6A 1YIAA 5THXA 4Q15A 3M1IA 5B12A 5KYUB 1TGVA 1XQ6A 3C1AA 3DR3A 3O8CA 4J0HA 1HOXA 3IAS6 1QOPB 3KT8A 4JYCA 1TT5A 4MI6A 4GRAA 2B69A 2J5BA 3NBMA 5JVDB 3W5JA 1U7PA 3GLHA 3WQSB 4CL3A 4L78A 2WHPB 2PAAA 3QUCA 2EDCA 5JAHA 1MIOB 2GPAA 3T3NA 2AH5A 2B83A 3Q8MA 1R8XA 1D2AA 4DA9A 2C4UA 3U44B 2DUJA 4FBGA 2YINC 2DPXA 4LZAA 4RFVA 2C54A 3W6OA 4QECA 3ICCA 2ZIWB 3LDAA 3TLMA 4EY3A 3PEEA 4C7OA 4MQ6A 1C5KA 1E1RD 2ZIUB 1YDHA 4ND8B 2COUA 1ECFA 3ZW8A 9MHTA 5G0TA 2ZRFA 2JIOA 1T5OA 2O9JA 1I2DA 4MS4B 5BQFA 1E4EB 4EPVA 2X9GA 1T4BA 2VDMB 3KFLA 4W5QA 2GK6A 3GJ4A 4BV3A 4F9TA 1P1JA 1U9JA 3IEIA 3PD0A 1Z7WA 4PSAA 2CV1A 3D7SA 4PLHA 1O7JA 2Y1GA 4F06A 4XGNA 5CAEA 3C45A 1E79D 3SC2B 4AXBA 4FDAA 4AZ3A 3EXG1 3SS7X 4KX5A 3MOSA 1SVSA 1OZ0A 2BFMA 2BHLA 1TQ2A 2V9CA 5JS8A 1ISFA 1AUQA 2DKFA 3KTAB 4L6IA 4OKSA 4TRMA 5LDDC 1Q0LA 1Y48E 3DW3X 3VYWA 3L4KA 4R1NA 3R8XA 4O3MA 4K05A 3R3WA 3DMTC 3MPOA 1IM5A 3DDNA 4ZHQA 4JKOA 5T4BA 3SJ7A 1KOGA 2Q4OA 4WY5A 1FS4A 1M2OA 4Q3DA 4AQ7A 4UEKA 4M7WA 4CW7A 1MP0A 4KWCA 2X3YA 3HR8A 3LTEA 5JCJA 3PL5A 2CMHA 4A23A 1YC5A 2JFGA 4EB6A 4KNWA 1P7CA 2BW0A 1M34B 2Q5LA 1J24A 2FG7C 2OK8A 1NVFA 4WKOA 5JDCC 3GEDA 3KJQA 3A6EA 1O8BA 4WASA 1VLLA 3FYSA 5JDIA 1X7YA 1R0KA 1JHXA 5JZBA 5GPBA 1LK5A 3AJRA 5B58C 4WXHA 1LUAA 3I39X 4QTTB 5I7SA 3KC2A 5JECA 4CR7A 2XDQB 3G5LA 2YQZA 1BMTA 1NQXA 5T4EA 5KU1A 1LSOA 1SRQA 1Q1QA 5EVJA 4YONB 1RHUA 4OJQA 1NN5A 3LLSA 1FNDA 4Q34A 1LGYA 4MGYR 3R7BA 3DMNA 4YECA 3AUSA 4RA9B 2JCVA 1EA5A 2ZYVX 3K9CA 4XLLA 2IS1A 1ODLA 1IY2A 2BE7A 2CNBA 2RGCA 2VT7A 3EVEA 5AJZA 3F7MA 3DC7A 2X19A 3H2BA 4KRGA 4LHEA 3W2GA 4KFUA 2IYZA 3D6MA 3KPJA 2IUEA 2ZT8A 4GGOA 1YDWA 1CPYA 4WCFC 4Z9BA 2UAGA 4YP9A 4OYLA 3RCBA 4CLHA 5JEDA 1C8LA 1D2CA 2WAAA 3NAGA 1W5SA 5FOXA 1U7TA 5IAAA 4YCBA 3R4VA 1XU4A 5BW4A 3JD4A 2PQ0A 2JIRA 2VN8A 3LNCA 2DFLA 3FSJX 1GKLA 4JNKA 4URVR 4FMBB 1Y3BE 2GEFA 4LUCA 5ER9A 2OYCA 1GGNA 2E48A 2VF2A 3M6MD 3QKTA 4GUDA 4NESA 3RS5A 4ALIA 3OOJA 4P31A 1ATZA 4JZYA 3ER9A 3BAZA 5C7YA 4PBTA 4GOXA 3LV8A 4KMMA 1K7YA 3HHPA 1I5RA 1WQ3A 2ZB8A 1D4AA 2RJOA 3NEYA 4P4GA 1JB1A 4Z9YA 1BQ3A 1P7VA 2P1DA 3UXYA 4CQJA 8ADHA 1NATA 3P97A 1QBGA 5CH8A 4D8UA 1O96B 4EJFA 3LK7A 5C18A 3PPIA 2NPFA 1BKYA 4OL0A 4R84A 2HMAA 2HJRA 1Z2NX 5H4HA 2WWHA 5NLLA 3VPXA 1ONNA 4IRMA 4J76A 5KYYB 2PUTA 3F78A 1KK1A 2WKSA 4I50F 5AJUA 2GZ3A 4U9UA 3CSUA 2A1UA 3E9MA 2J0UB 3WRYC 1JFFB 1PHPA 4U63A 1W94A 1JA1A 1C30A 1SUPA 2HK8A 2PKQP 3MMNA 3ACCA 5BXQC 4G56A 5IYZA 4DW8A 1D0IA 1XA4A 3A6KA 5IVDA 3CWQA 3ZZTA 2I3GA 3CT6A 5BQPA 1DLIA 2HSZA 4LG1A 2CXUA 3M4ZA 2QB5A 2VRNA 4LDJA 4DLWA 1R0BA 4MR9B 3O1IC 1BMFD 1RMQA 4Y6GB 3LT4A 1CJVC 2XUPA 1O9GA 1ZLXA 1QLHA 3LYUA 4DV4B 3PXAA 4ZQIA 2QBYB 3I0ZA 4FVTA 1XZNA 4JLMA 4L4UA 1Q7TA 1LWNA 1AA6A 3NXSA 3VH3A 5BV8A 4TZ0A 4M0UA 1COWA 4ECAA 4M83A 2PXHA 3G5UA 3VR2A 3NLLA 4WESA 1MFPA 3ZU3A 5FPKA 1E2KA 3UFXA 3DNFA 3HWSA 1F8FA 3UWKA 4C0WA 1DAPA 1ZGJA 1FP1D 1Z9BA 1MIHA 3SSNA 1OX5A 4U2EA 4RLHA 4EI8A 1EFVA 4IJ6A 5DBEX 5GJCA 3AF1A 3WMRA 3NVMB 2D13A 1SCAA 3DLHA 5DBOA 3U5TA 4AZSA 6AT1A 5ITZA 2PUWA 1RXUA 4B4DA 3OZWA 2WM8A 4JEHA 3HU5A 1Q44A 3ICOA 3K94A 3AFIA 1QB8A 2P0YA 3PKJA 2F1JA 2IP4A 1TAUA 2EW1A 3SC4A 1EXNA 3PNPA 4LC9A 2QMQA 3AZPA 5FPSA 1BOOA 4CF4A 2F3SA 2PGJA 1UDBA 3OF3A 3CEMA 4J0DA 3CF2A 1F1BA 1HSZA 1V48A 1B74A 2FSUA 3LO5A 1SZJG 3IE2A 1JG7A 1X80B 4WACA 4AKGA 2FRDC 4P5EA 1TU3A 4E33A 1VMIA 4EHBA 3FNQA 1TF2A 5A3JA 3BJIC 2ZBFA 5DYYA 2EARA 1P7WA 5LIRA 2HYIC 4HZIA 2AFIE 1NJ5A 1PJAA 5HP4A 3LXMA 5AKZA 3ZDDA 1T2AA 3IT3A 3DVRX 1O54A 5BSEA 5HGXA 3I1JA 4Q7EA 3BCUA 1PS9A 1VG8A 2ZJBA 4JT4A 1P5JA 4K46A 4DIOA 3BF8A 1NC3A 3IP1A 1V41E 3S27A 5B7QA 3OLCX 4JP1A 1U1FA 1NVDA 4ABTA 2NYVA 1VJDA 3FWZA 3DE2X 1HQKA 1CQIB 4EY4A 1EB9A 4CMCA 4TYQA 1E6UA 4ZEOA 1EGAA 1NUTA 3NU1A 2WD7B 5AESA 2ZULA 1ZU5A 4IH1A 2BFBA 2C2WA 3RRJA 1Y9JA 3F71A 1OILA 3CRZA 1H2XA 3MWDB 4JJZA 5H3HA 5L6LB 4QDXA 4JYZA 2QX7A 1WULS 2IPLA 5ENVA 2CE7A 4KLRA 3DG9A 4ZI7A 3PHIA 1Z0ZA 4TQGA 1PKEA 2BFNA 3CW8X 3CZ9A 4IHJF 5DYIA 1XEFA 4LY3A 5K8VA 2IHYA 2PVPA 4PRZA 4R9RA 3VR1A 5JNLA 4WUTA 2Y1LA 4ZEXA 1UJMA 4C0SA 2E85A 1QGDA 2X2EA 3TNFA 3HGTA 3RASA 3TXAA 2BEVB 2BBTA 5BVGA 4DIUA 1K75A 3WLMA 2I2FA 5J2UB 2YFQA 3FOEC 1H5NA 1FDVA 3MFYA 4HGZA 3AHDA 2XDWA 5B55A 3U19A 2O8EB 3AI1A 1NWCA 3RT1A 4QZVA 3EJWA 5GGYA 2X5XA 3HCFA 1SHZA 3PC4A 1T9HA 1USVA 1GNRA 1X1DA 4UVIA 5I5EA 3JD1A 1FTSA 2FOIA 2KMLA 3IIEA 2XAUA 3O8QA 3TTXA 1YI8A 2ET6A 5CUQA 2WUWE 1WAMA 4KE8A 2P40A 3MB8A 4F6RB 2WZCA 3TXYA 2B0CA 3OQVA 3JASA 4Q3BA 1CP2A 5BR7A 5JMTA 4EENA 1UC8A 4I6GA 1IM2A 3TS1A 3WNBA 4A6PA 2RHHA 4UW9A 4MW0A 1FDOA 1ZBQA 3DTTA 3EWSA 4OMFG 4Q9HA 3SHQA 1ZITA 3LKBA 3KUCA 2Q2VA 2ZDQA 2VDQB 4L15A 4ZVTA 4EMSA 1E5LA 4B5KA 2OD9A 4R8VA 4XFDA 3U81A 4D4LA 2DSNA 1DAHA 1N2CE 2YNMA 4YGYA 2GYWA 2ORYA 2VR1A 3AHGA 3DTNA 5B58T 5LCXA 1B6TA 2BKVA 4ILKA 3PA6A 4YV2A 5LLDA 1T0BA 4O4LF 4IUBS 1XLWA 2HEGA 3ETJA 5EP4A 3T7EA 1QGZA 5KQRA 4Q7KA 1AVTA 5A06A 3USZA 4L02A 5JSHA 4PN7A 5J4KA 3B6KA 4RYDA 1CKEA 1ZD2P 4E31A 2Z57A 3FOAA 3RSSA 1N6NA 2EX1A 3M6XA 4B44A 2VP6A 4JWKA 1Q19A 1SG6A 3IXLA 3HPRA 4YJFB 2PJDA 2PS9A 4F9GA 4HN9A 2LKCA 2FMHA 2G28A 1M6NA 2Q7XA 3K8YA 4TVOA 5B1YA 1IZYA 2HNBA 1Y8CA 2QGNA 4NONA 3NDIA 5GTDA 3PNQA 1S0UA 3H83A 4U0KA 1NUHA 2IW1A 1A9XB 2Z4TA 5A7GA 4Q7JB 1U2ZA 1SCQA 4HDNB 4KP7A 1QFZA 4NOKA 4QPJC 4AP6A 3AEUA 5G4LA 5KREA 4WV3A 4HB0A 3F6SA 3SHOA 3EH2A 2BGRA 1IUKA 1WDKA 5DNAA 4EHNA 2NGRA 4LJ9A 2PT6A 3L0YA 4J7CA 4QGGA 4RIEA 4PRYA 1UWVA 5K09A 5ENZA 3ZGZA 1M2JA 3P2KA 1K4MA 2E3JA 3BUSA 1VE3A 4M8LA 3A04A 4ND1A 4QG7A 4ZOLA 1TEHA 5BN1A 4NNJA 5KOYA 4RGBA 4YXWD 1DL5A 4WCFB 1DC6A 2HB6A 1KPIA 5HZGA 3QU9A 4G0QA 3GCDA 4A6XA 3FYDA 1Q57A 1B1AA 3CVJA 1RRGA 2IL1A 4JQSA 3DBIA 5I01A 1V8BA 1M1UA 1XNHA 5AKIA 2XGMA 4R98A 1ZVVA 1JFRA 1J21A 2ADFA 2YRXA 2I2XB 4RD3A 5F21A 3ZNQA 4HH4A 4ZCPA 1A8SA 3D64A 1TQ4A 4NWIA 1D3AA 2FZGA 3PI7A 2UZ0A 5F4ZA 4Q18A 1U2TA 2JD1A 5FUXA 4OLAA 1XSEA 2VJCA 4F1KA 4YO7A 1EVZA 3RWMB 5LDHA 4J16A 7REQB 1C7FA 3UYKA 3TRJA 1V4NA 3OTGA 3BSWA 3MPUA 3KOUA 5DMHA 5KAPA 3ECCA 2XBLA 4D45A 2ZUDA 4HUQA 2OOKA 4PU0A 4RW0A 4ER0A 1PG0A 1TI7A 2YRFA 1B4DA 1OVMA 1YI1A 4QPCA 5FUYA 3M2PA 4QVIA 3TQFA 2WWTA 1C3VA 3BB3A 3Q9SA 4Y1RA 1R37A 1C81A 1SZDA 2RHCA 3DAGA 1EUCA 4G86A 1XWWA 5CITA 4CL2A 2BFCA 2KWIA 2PX8A 1WVIA 3ISJA 3CR3C 3D2AA 2QP4A 3Q3IA 3R75A 1I33A 2P1RA 4AMBA 1GT91 4G4JA 3Q88A 3CNBA 2CCJA 3AEKB 4ACAA 2PNFA 1X14A 1YS7A 5GOZA 4UNRA 1NVKA 1KO7A 2XCUA 4N7BA 3T0IA 3VZBA 5AI4A 3HXLA 3ZDQA 3KJFA 3B48A 4X95A 3D6JA 3TRKA 4B0PA 3DP7A 3WLAA 1YZ3A 3KQLA 4DG9A 4FYJA 5PGMA 4D44A 4Q05A 1N5JA 2RKBA 4C5BA 1E2IA 5E95A 5PNTA 1WMEA 1Z6XA 3HLTA 4X9XA 4PR0A 3M4YA 5DM70 1DELA 3CF4A 1QAOA 3CF0A 3LUJA 1SB8A 4RZQA 2QN8A 3ZR4B 1U3WA 1KEZA 1A5AB 4M54A 2DLDA 1MC8A 4WOPA 2HBQA 1BROA 3K0HA 2ILTA 5B37A 3S3TA 4Y2YA 1P7ZA 1NRWA 1THGA 1WMFA 1K7EB 4I08A 4IQGA 3I2JA 4REQB 2QTTA 1QAQA 3OO0A 1JAZA 4NS4A 1NBWB 4X97A 3RBVA 3VH2A 2QTVB 3ZY2A 1BDIA 2X8BA 2IIBA 3CVWA 2GNOA 2DETA 3A6FA 2VDNB 3T95A 1AM4D 1CF2O 4MUFA 3DVQX 3NUGA 2UZ4A 3T99A 4EA7A 4RFSB 1I4TD 2Z95A 4AUKA 3D3QA 1UCFA 4I3FA 1I1NA 1G0OA 2ZIXB 2R7MA 2CXRA 4Q9KA 2VAMA 2ZLBA 1SG0A 1AMUA 4S1WA 4XYEA 4WKGA 3V8NA 4UAGA 2G40A 1UXOA 2BR5A 5C2JB 2DBRA 3OBBA 3AL2A 3PDJA 4UUOA 1CUHA 4YLYA 1G3MA 2VATA 4HVLA 1XI2A 1H2RS 2BLNA 3FZGA 5EE5B 2V97A 2X0KA 3OLZA 2QPTA 2IVFA 4QQFA 4OUDB 1TYZA 3PS9A 4DY4A 3MQFA 2YJGA 1XDZA 4FHGA 1W0JA 3A9UA 2ARKA 2FEKA 2GDZA 1E3WB 2FWIA 4KTVE 1H0HA 5T64A 4ZTZB 4LFAB 2XYGA 4AULA 4C08A 2C5LA 2VDPB 4QNRA 1I4OA 1J90A 2ATIA 1JB9A 3GUVA 3LW7A 3EZNA 3WA7A 4YCDA 1JVSA 2X3FA 4B84A 4AJJA 1T9KA 2FEMA 4W7SA 4HAUA 1A72A 1AU9A 4PPNA 5K3FB 1UBOS 4LBVA 1GPMA 2E18A 1E8NA 1QFJA 2R00A 2VYFA 3AY3A 1FRQA 1QFSA 3GPDG 4G8DA 5BN5B 4AW9A 2AC2A 5C7LO 1QF6A 3K09A 5CLGA 2VIIA 4ND2A 2NXCA 5TXGA 4F96A 1L6RA 2PBRA 3RC8A 1Q11A 4IG9A 3EUEA 2OY0A 3QLUC 4YFYA 2O05A 4ER5A 4DV6B 3IL2A 4JGGA 5DFAA 3LFTA 1H3NA 2V6MA 2ZI4A 3CMMA 3UJBA 1U3TA 2LDBA 4CM8B 5JHGB 1S2GA 2OAQ1 1GY8A 3DZBA 4PAOA 3LZ6A 1U1EA 1Y7IA 1D5WA 2FQYA 3FKJA 4CGZA 3LMKA 3LI2A 1HWYA 3IO3A 4X8LA 4PV7A 3MLBA 4F6CA 4RZSA 3M5DA 1CIVA 2V7WA 1XAGA 3OUZA 2ZBRA 3VO1A 3K32A 1XLUA 4TV9A 3ZW7A 1U28C 3F2IA 2X22A 1DMSA 4B3XA 5EI5A 4DJEC 3DAOA 1UOQA 3CW9A 1PG5A 1UJNA 5D3MA 4YRBA 5K0ZA 1AJEA 5GJWC 4X66B 1FNMA 4CMIB 2AYYA 2I6TA 4XDZA 3GJTA 2E4AA 3KKPA 4N5LA 1S3IA 3QBDA 1YHYA 1H4TA 3KAJA 2AI1A 1Y3DE 4FE4A 3BGSA 3HN7A 2ES4A 3MSCA 4PS0A 4PYOA 4A26A 1TMYA 3NBAA 3EQ8A 4M38A 2VG8A 1R6DA 5FNVA 4C2AA 2BR4A 1H22A 2A5YB 2HQ1A 2NT3A 2X13A 3L0OA 4G8JA 1K92A 2XRMA 1J20A 1EVJA 2RIPA 3JZIA 4RORA 1MRSA 4UHCA 5P8WA 3STXA 2XADA 4KQEA 4LF7B 1T9GS 2HSGA 3A1NA 4BNMA 4FSXA 3LFHA 4LSGA 2Z43A 2CY0A 2GQ0A 1OH7A 1P1HA 4MJ7A 5FO0A 3C6MA 4E1VA 1AUVA 3GGSA 4X7MA 4BJ6A 1KYVA 1LSUA 2OQVA 1PUXA 2CK3A 2G09A 1HX7A 3TPZA 1K5DA 1Z13A 2I3DA 2VYNA 2VHCA 4R05A 5ALTA 2GK4A 2VUTA 4TS9A 1W88A 3KZCA 4MJLA 3W4JA 2I1QA 3P4XA 1GEEA 1YVEI 3E5NA 2H7YA 3PX2A 2PU7A 4QBTA 3GMIA 3GAMA 1Q2XA 1Z0DA 4ZREA 2C59A 2R68A 3UT5A 2UYCA 3TFQA 3VR6H 3D3WA 1E58A 3O21A 1XZMA 2HIGA 4R2LA 2QUKA 1DI0A 1JDVA 1OI7A 2XUHA 3ESRA 4OK5A 1P5ZB 3PQ5A 4OHOA 5CNJA 1HKUA 4AMYA 2OO3A 1AF7A 4HSEA 1P45A 1P4JA 4C4SA 2WHYA 1UIRA 2QZ4A 4KIGA 2ZJAA 5FCDA 4L5IA 1U8UA 4KI0A 3BWBA 4WZAA 2ACVA 1MGPA 3S29A 2HQRA 1S1CA 1XIVA 2FSFA 3HCRA 3W34A 4DAEA 1N32B 1UP4A 5IAJA 2VRCA 2E82A 5ESXA 1KE2A 2DVMA 3RRZA 1VL6A 2WVJA 1JKMA 1T25A 2XNHA 3OPYA 4QQRA 5EYPA 4MGIR 4BWGA 1XD2B 4Q24A 2P2ZA 2B5VA 2XE4A 3TVTA 4TYYA 2HDWA 3RV3A 1GYRA 1SPBS 3VHLB 3WOVA 2O2EA 1N2ZA 1SU8A 3DV0B 4ZOCA 5HRAA 1TEZA 3RF7A 2HUNA 1MUUA 1RYZA 3ECAA 4HWTA 1JE0A 4C01A 5BWCA 1Y5LA 2O3RA 2H17A 1GXSB 1AMOA 2BC9A 3EA4A 4HPJB 4BMSA 2L18A 5GONB 4CIYA 4QRDA 4WJLA 1FTYA 4P4NA 1XDSA 5A4AA 3MS7A 2PLWA 3NTXA 2OC9A 4JX8A 4QYMA 1UANA 5TF4A 2B35A 4XRGA 4MV4A 1Z29A 2R7LA 3RT7A 2WV9A 3D7KA 3RYIA 3PHCA 4A8JA 4IFBA 1S3FA 1MTOA 3IJEB 3G89A 2F2TA 1KO1A 3A6LA 3IAXA 4HVAA 1K63A 1N4DA 3K9QO 3M49A 4JQYA 1EUQA 4JKIA 1FTNA 3MT8A 2Y0PA 2CV2A 1L5GB 2C3PA 3M5WA 2GPYA 2W2PA 3UJ9A 3ZCSA 4OHCA 4C07A 5KQMA 4QWWA 2XCSB 3IHTA 1VHTA 4KJZA 1NE7A 3K30A 3OO1A 3JALB 4RCZA 1BN6A 2CLIB 1YL7A 1S9DA 3KB1A 5C9ZA 4B85A 2HU7A 1Q0SA 1DQSA 4PYKA 1QRSA 2H9YA 4PTZA 2ZYUX 3TUZC 2CSXA 4Y6LA 4LVCA 2Q46A 4DMGA 1EK1A 1OH6A 5L45A 4MCIA 5JR3A 4L4YA 3W9YA 2F64A 4GM1A 1KEEB 4K9PA 5L51A 4Y1EA 3KQOA 1JDSA 4KQWA 5H4GA 1JU3A 3BZBA 4OJKA 4XLTA 2IDKA 4CCAA 1QR2A 3MHTA 1IY0A 1FQJA 3WBFA 2FSHA 5JNRA 3V5NA 3FDZB 3PJRA 2JLVA 3DJYA 3KLMX 2PL5A 4IIVA 5G0UA 4DDVA 5EJ9A 2BGUA 3ST7A 2OV8A 5A2QA 1JJFA 3V1YA 1P3DA 4N5HX 2WKRA 3EJ6A 3V32A 4BEVA 4C0QC 3AZQA 1GITA 4E46A 1OT3A 2J5KA 4MW4A 1DO0A 1G98A 3OIWA 4UBJA 1M8PA 1DC5A 1HQDA 3PUKA 5JSUA 2VXCA 3E58A 3PUZA 4CNBA 1AZWA 5AIAA 4DGQA 3BGIA 4LJ8A 4YV1A 1O58A 2P91A 3GZNB 3SPXA 4LV5B 1QZUA 2BMWA 3IAFA 1ADBA 2XH8A 3W8FA 1L7BA 4QUEA 3P2EA 4PXAA 4LJKA 1OBCA 4WTOA 2B1GA 3MJSA 4MW6A 1UXJA 1NBHA 1DT5A 4PX5A 1CIJA 1XN1A 3BKXA 2O4CA 3GVXA 1GPAA 3IR6A 1XWIA 3DCJA 4WADA 5L3QB 5BWMA 4GL4A 5F9MA 4BVAA 1XHEA 4MOWA 3T4PA 5JH7F 2FMTA 1LJ8A 1X7WB 4YLEA 1EFKA 1RYMA 4TSKA 4X3CA 4AJKA 4ZOBA 1AH2A 1P31A 1RHKA 1UEXC 3G0DA 4Z3KA 3MRVA 1ORDA 4CM7A 3PDCA 3BA1A 2OXIA 3A6JA 4LSZA 4YUWA 5KQSA 4ZU1X 3L7IA 4JWTA 3ZVRA 2GM3A 3VU0A 4HMOA 4ZN6A 1TRKA 3FHOA 1WHSA 1X77A 3TZHA 4DR4B 4URUR 3AM5A 4XPIB 1BW9B 2R65A 3M83A 3FKSD 3AU8A 3HCCA 3BL8A 3MT7A 4N0EA 3ESXA 1OF1A 1W1IA 3P9KA 3LCMA 4LCJA 5CGZA 1AV6A 2HSDA 2G3YA 3DOJA 2NP6A 2GK3A 4J03A 4AKHA 1U0BB 4FS3A 3KELA 2HJWA 4BP1A 4MR7B 3ZE8A 4F5DA 1HE1C 4AF8A 4C7MA 1CIPA 2PFGA 1DDGA 1WA5A 2A30A 2ABWA 2EX4A 3HCBA 4KXQA 2B6NA 4U5XA 4WXPA 1UBMS 4OHZA 4GL2A 1T3SA 1JEAA 1NVTA 2P9FA 4OGWA 3EZFA 4RTQA 2WOJA 4XLZA 1GPWB 3V9AA 4LRTB 5B6PA 1PNRA 2C4NA 1ZJ5A 2QAGA 5K01A 2IZ6A 3ND8A 3QUBA 3G68A 1G1AA 4JUCA 1UJCA 2PQ6A 5EP2A 4Z51A 3MWEA 4ZDKA 2W8ZA 2HZ7A 2YOHA 3THYB 3MMXA 3C4JA 5EJ2A 4DJDC 3QE9Y 4G1EB 5EIXA 1W4BA 1GO2A 2EKBA 5ESDA 3SZLA 5BRJA 2C4TA 3NFRA 1J1ZA 1RPJA 4LECA 4RENA 4S2EA 4FWBA 3A11A 4KCGA 3UUWA 3B1YA 5JADA 1H8EA 3GJ6A 2AZ4A 3R6DA 1QPBA 2LTAA 2ZQYA 1LS1A 1YFKA 2QAJA 1WSWA 4GPZA 3RODA 3UG7A 4DBLE 4R2KA 1J22A 4CG0A 2P3QA 3B3GA 4TV8F 1TX4B 1GU1A 3PRHA 3ND6A 5DK6A 3DKKA 5JSZB 3GT3A 3ZCPA 4CCYB 5FV4A 2YASA 4LWZA 1USUA 2GEBA 3KKKA 1WPRA 3CLKA 3JVVA 3PWTA 4J2OA 4UCWA 4UUMA 5A71A 5AVZA 1JKXA 2H1VA 2RH5A 2QRMA 4CMAA 2C7OA 4UAJA 1BXZA 3ONFA 1BAPA 1UXKA 4LZJA 3N8NA 4OA5A 4QASA 4RCYA 3WRXC 3AF0A 2WU3A 1CF9A 2UKDA 2QN3A 2Y0DA 4MWOA 4R0VA 3H6HA 5JJIA 1ZGZA 2Z1NA 4RK6A 4X71A 1TAGA 4K6GA 4BZZA 4QOEA 2OUIA 2X8JB 2F7SA 2HAEA 4YUVA 3CSSA 1N6HA 5EZYB 1ZI9A 2GSDA 1XJCA 2ZYSA 3I2GA 4NBRA 1LS6A 5K45A 2IX3A 2QG6A 3D7RA 4Q1VA 4RK0A 5FUWA 4RVGA 2PUFA 3FGNA 1ZM4A 3G88A 1QJ4A 4UNNA 3OKFA 1XUOA 4DLSA 3VNVA 3L41A 1MEJA 1TYDE 2E5WA 2J3LA 3R6TA 1RM5A 1W6UA 1Z75A 1ZEMA 1D4ZA 2CJYA 1KSFX 1T36A 1C8BA 3BHJA 3GIWA 4Y6OA 1P1BA 2IITA 1UJ5A 1P8JA 1T1RA 3HEMA 4CE6A 1H4SA 2EFHB 3L4BC 1B26A 3M33A 4O8CA 1A8HA 4HH0A 4EKIA 3REFA 3BHMA 2ECPA 4OD0A 2G76A 3KFXA 2D54A 1QIDA 1D2EA 1PT9A 1JQ3A 3BD8A 3D8NA 3KYDA 3MINA 5GAJA 4F3YA 3AINA 3PIDA 4DEVA 3WE7A 1W6RA 2JHCA 2O7RA 3P45A 3QFFA 4RABA 5CAEB 2X86A 2FPPA 3O3MB 3TIGA 2NO5A 3GFOA 4RCVA 3WZLA 3DEZA 4Y7DA 1EFDN 3VPHA 2XI4A 2R25B 4K9SA 4RHUA 3IV7A 1H93A 1CCWA 3F6CA 4Y6QA 1J0AA 5H7XA 2JNWA 3RO7A 2H5EA 4G24A 2DG2A 4MB0A 4Y6PA 2PKRA 4M1WA 2J7KA 4OP1A 1L9KA 3OC6A 2HHCA 2ZT7A 4MKIA 4WLFA 4E2XA 1CEYA 4LJRA 1G8YA 2B4TO 5DM0A 1YB6A 1EQUA 1E3TA 2JGIA 1U2DC 2WQ6A 121PA 4D25A 1QOZA 2NN3C 2QTRA 1JS1X 4O4JA 2IXGA 2R79A 4ISCA 1ISHA 1W25A 3AW8A 1H23A 3DL2A 3QFRA 3W04A 2RG7A 4MTLA 1K06A 1OT5A 2WYOA 2X4LA 3PQ8A 1E20A 1IQUA 4L8VA 1RYYA 1RI5A 1WABA 3DOCA 2C7QA 3MOGA 5B57C 1E5DA 1UBNA 4R1UA 4TKUA 5E6UA 1E9AA 2HR1A 2ZWOA 1X8LA 4I50A 1X7YB 3B38A 1N5DA 3DMFA 3EVTA 1KJZA 3F7TA 4L8FA 5CYPA 3D8HA 4BUZA 4QKQA 1NBMA 2B3DA 4MQ4A 2WV7A 1Y4AE 1FVOA 4Q4HB 1HT2E 2ZB7A 1RAIA 3AJ8A 1G4UR 1XRNA 2R6R1 4BB9A 4NECA 6REQB 5ALMA 1GU7A 5INTA 3Q3HA 3NAZA 1Z12A 4NDNE 4MUYA 2RGGA 1G5IA 2H07A 4NJEB 5IAKA 4CU5A 1E77A 1NTRA 5DM4A 3ZYZA 2PVSA 3UG6A 4EYGA 2ZWAA 5EE3A 3QOFA 1KVSA 2V4ZA 2V7BA 3UATA 1L4YA 3EDCA 3ZZMA 2NUAA 4EUSA 5KYNA 3Q6IA 3IHKA 3OJ0A 3AVUA 3I0NA 1FXWF 2QMOA 4JLAA 4M87A 1YMVA 5EJGA 2H5JA 3NKVA 1J56A 1RT9A 4MKHA 2A33A 1KJQA 2G4LA 4L3VA 4WFIA 3UWDA 4JT2A 2J0EA 3GN2A 1F7VA 5HSGA 4HV4A 4C87A 2B36A 3A2MA 3K3PA 1P9OA 3OE5A 5JQGF 1VE5A 3AYXB 5CEEA 1XEXA 3SE0A 2PD4A 1M2WA 1AK2A 1VQ1A 4D97A 1DTWB 5TMEA 1FDRA 1KGDA 1Z5OA 1I3LA 3VYRB 4Z7NB 1T2UA 2DFKB 3MJDA 3U48A 2D1TA 2WKQA 1NVVR 2Q3JA 2BMDA 4XIIA 2P11A 4ZXPA 4GWLA 2HGSA 3H11A 3VDXA 5KWIA 3IE1A 2VNJA 2WK1A 2ZUBA 1ZMTA 5C1DA 1TD1A 1PAUA 2QXTA 2B8NA 1CZHA 3H2GA 3AFOA 1WM1A 3WICA 4NZYA 5AVKA 3U1VA 4EIWA 3M1YA 4TYNA 3H5AA 2Y0EA 2RHWA 1T6ZA 1Z08A 1F4PA 2P3SA 1NQWA 4JR2A 4N03A 3UTCA 1R66A 5T3UA 2C99A 1WCYA 2BMEA 1K8XB 1TM4E 2Q29A 1TOAA 2ECQA 3VR4H 1QTIA 5I51A 1N4AA 2IH4A 2JJ2D 3O4RA 5LMZA 2BFEB 1SBQA 2EC5A 2Q62A 4NHOA 3UXMA 1NDHA 3MTBA 2WHQA 3QKSB 4WX2B 4P5PA 4X1IA 3PPVA 4CT4B 5KNBH 5JE8A 3C98A 4OBBA 4YREA 3R5TA 2H48A 4BVGA 4CM3A 3TFOA 3FAKA 2IW3A 3BXPA 1NN3A 2GF9A 3KR9A 4LI3X 3DEAA 1NJFA 1QU2A 3E1KA 5ALRA 3AEYA 3KEGA 3MCZA 1DOHA 1I2AA 1U3CA 5C8XA 3AIIA 4LYGA 1M8FA 3SIRA 3TW6A 2J9XB 3JCZA 2V7QD 1C50A 2FDCA 3A36A 5BNWA 2PUDA 4WESB 1VSVA 4HJXA 2X41A 5DGTA 3A6PC 4R8KA 2JFBA 3LF1A 1XOIA 4FYMA 4KQ1A 3GU3A 3AL3A 2ZT5A 3E5MA 1EFVB 1O95A 3EVDA 4IHJA 1XYGA 4F9EA 3TOVA 1Y6ZA 3FNEA 5HIKA 3MJHA 3HNRA 3GP3A 3T1NA 1PK7A 2J85A 2C9YA 5ITZB 3G3EA 3P9PA 1VMAA 3LRXA 3BH6A 3QVWA 4Y9SA 1LSSA 1Z5ZA 5AD1A 2P65A 3GFGA 3IBYA 4ZODA 4DQKA 1GRRA 1V1RA 3LY8A 5EJAA 4HNSA 2VYVA 4IIUA 5FNZA 1TKAA 3DZJA 5CM9C 1P0QA 4QFBA 4W99A 4F5EA 2AFIB 3EXIA 3UC9A 4UVHA 4AMUA 3EWIA 4BC0A 3WYFA 4LC1A 3HNPA 4I2VA 2OCLA 4YT8A 4KLCA 1RXIA 1KERA 1SELA 2TMYA 5BN4B 1KDYA 1KAEA 1VECA 2IYPA 4LISA 3KXDA 5DPMA 4FUQA 2G77B 3TLGA 2FEAA 3NBXX 2YN4A 5HF6A 3CUEF 2QPLA 3LYHA 3TOZA 4Y2PA 1RAFA 2AMLA 1T4CB 1C7QA 1XMIA 3GARA 3K9BA 4MPDA 3E9DA 1LRKA 3CZQA 2XYVA 4NFHA 4WFQA 5ALUA 4FJ2A 3S2YA 4ZFNA 2PRYA 1W85A 2FCAA 1QHNA 2OV3A 2YQ5A 1GGMA 4QUHA 3IV9A 2G04A 5CM8B 1OH5A 5C52B 1EVEA 1JNYA 2Q1SA 3TGWA 4F91B 2F9FA 1MJGA 4M9SA 3FOBA 3NYRA 3M4JA 4CG2A 3NBQA 3PQDA 1YD7A 2FEXA 3DR5A 3KVRA 1F38A 4J90A 2QTFA 4PFJA 1GKUB 5CYFA 3ZWKA 4J0KA 1L5SA 4RD2A 3SM3A 2GX6A 2NQ8A 3G5AA 3B1FA 3U1TA 2JLBA 1U0TA 4D3YA 1ZCJA 4FILA 2WTMA 2H4HA 4O4LA 2OCIA 3RJTA 4URZR 3Q40A 4YJ3B 4ZQEA 2YXLA 1FMTA 3ZGNA 1PR2A 1CFJA 3KKEA 1I1QB 4MCAA 1QWSA 2HI0A 1ZMOA 2OECA 4P1ZA 3E5HA 4Q01A 3PEYA 1GKYA 1GAWA 1U5AA 1XA3A 4HUTA 2O3TA 3N75A 4FZJA 1M2VA 2JLZA 1RP7A 3A28A 3UC5A 4D0RA 4B1FA 2W8BB 2GHRA 1OXTA 5LA6A 2KJQA 4DWOA 4QFDA 5TF0A 3N7TA 4E12A 4LF5B 1LRLA 4LJLA 5EN4A 3X0DA 5LIPA 2YKGA 1NVXQ 4LMAA 3EPHA 4Q39A 1EX7A 1H65A 4WIAA 3MVEA 3OZSA 4UUAA 4XUGB 4BAZA 4D02A 3AR8A 4BY9E 3UXHA 2C1EA 3VZDA 4ON9A 5B3JA 1Z5UA 5BSVA 4ETMA 1SBNE 4N12A 5IDYA 4FT2A 2F48A 5IU6A 3IO5A 3DBVO 2QSUA 2O59A 3JZAA 2J9RA 3D6TB 5CG2A 3QEJA 1TZKA 2YXPX 4J0QA 4OHMA 1N2CB 5CM2Z 4DIBA 2NSYA 1O5TA 1WB6A 2XSZA 3BRWD 4GWGA 2Z2XA 5DWDA 3H3JA 5B7PA 1FDTA 3PI6A 3OE4A 1E99A 1IYZA 4F84A 2PJZA 2VT2A 3QW2A 4BB5A 5J47A 3CE6A 4LMPA 5KOJB 3V4PB 1Y6GA 2PMFA 2ZYDA 2WJGA 3B12A 3GB9A 1PVOA 2NG1A 3KB2A 1DRKA 2YOGA 4B6OA 1RKUA 1IU9A 3P0JA 4IUCS 4MW9A 4PANA 2ODEA 2HTEA 3IBGA 4U39A 3CR8A 3DHVA 1Y4DE 2XA1A 4TWRA 2GERA 4YPFA 4DDKA 4ZIRA 3ETHA 4HFJA 2D3WA 5IM4F 3NRJA 3HYCA 3GC6A 3OZRA 4XIYA 5GOTA 3R0XA 4D9EA 3OOEA 4KTTE 3MRTA 4PNEA 2DHRA 4YHHB 3K2BA 4YJGA 2B0JA 3UMYA 4Q66C 4CU2A 3OCVA 4EG1A 1P0CA 2P30A 1R4NB 2ZI3A 4BDSA 5LP6C 3V2IA 3TZCA 1J06A 1TM3E 1JAIA 2WAYA 3L82B 3CRMA 1PTKA 1GRCA 3M7IA 1D4FA 2VTBA 4XIGS 2FOXA 5BSMA 1EE2A 4DY6A 4Q4JA 5DN9A 1PN3A 4DVGA 1Y7TA 2DR2A 3T3GA 2Y27A 3N6XA 5KKNB 3LY7A 4N49A 1CE8A 1U8CB 4RGVA 5BR4A 1IY8A 4GQBA 4DSOA 1N7GA 1NNEA 3B7PA 3NRBA 5JW6A 3IE0A 1MAWA 5AM0A 3SSOA 1A7JA 2CLSA 2G82A 3HUUA 1DX9A 3PR1A 1SVNA 3MUOA 2QGZA 5K51A 1G9XA 2PYZA 4MIKA 2FE1A 2BEJA 2OMEA 4KAXA 1W73A 5AUNB 3ABQB 2IDJA 1N2HA 1OD6A 1PEDA 3V7FA 3INNA 4NNPA 1X87A 2RMKA 5GY7A 1SCNE 3LAWA 3P9IA 4TRNA 4LI0A 2CHEA 2GUWA 5M2QA 4N41A 2PX0A 2PKCA 3I64A 2ZBVA 3SBOA 3X1XA 2ID9A 2CVOA 3CKMA 4F21A 2NU6B 2UYOA 3EQZA 3P0EA 5LXTF 1M2FA 3CF6R 2MSCB 2O7NA 3REQB 5EQJB 3WLTA 1SHJA 1T4MA 2OFPA 3B1KA 2E0IA 5EPOA 2PV0A 3TJZA 2R3SA 2Q5QA 3GFBA 1O97C 4KPEC 2HTFA 1E7MA 2VF7A 4G25A 4XJVA 2FWPA 3QNUA 1N2GA 1UKVY 3H5NA 3KUDA 4QGBA 5EXEA 1M0WA 2BFFA 3H86A 3V4OA 3B36A 1P39A 4PGFA 3OPQA 5EE9A 2IZ5A 3O38A 1PJCA 1F6WA 4O5AA 5E7MA 2KQUA 3JARB 4DOMA 1UXIA 2AK3A 2PXAA 3DPIA 4BQSA 4AL4A 3CPHA 3AGPA 4EABA 5JXWA 4Y1RB 1N5MA 1Q1ZA 3T7AA 1W59A 1CUJA 1ZONA 2G9QA 1EUCB 2O2XA 3QYFA 4FZRA 3K1JA 1C7IA 1OLOA 1ONBA 4CKWA 2BFCB 4NVRA 2AEJA 5HG0A 1Z5GA 3ME5A 1JHUA 4HDAA 3IB6A 3P9QA 3QHAA 2Q4RA 5EIOA 3S40A 4B8ZA 2FWNA 4E14A 3ASVA 1UADA 2UVPA 3D8RA 2O14A 3EAGA 3X44A 1JG6A 2WG2A 4Q7LA 5L6MB 2VDKB 1ML3A 4XOIA 1DEAA 2QRPA 4HGRA 4WCVA 1DUSA 4QTZA 3G0IA 4HRXA 1MOSA 3E03A 4J0GA 1NSYA 1BFKA 2OXRA 2D1SA 3ETEA 1ZZGA 4JGIA 2P2DA 4JP5A 4QNMA 3VO9A 3PJDA 5C46F 2OXTA 4DV1B 4UU0A 4HNAB 2AG6A 2HA3A 1YF3A 4R83A 4OMCA 1XRMA 1BFDA 2AIRA 2O0HA 3V8PA 1LX7A 3IDSA 1FC0A 2QYHA 3L0PA 1OI4A 1JBKA 4KC0A 2B25A 3TQQA 3RK4A 3HN6A 1U81A 4DRXA 4D6PA 1OPRA 1ZINA 1OB5A 4P34A 2FE4A 2B30A 3F9IA 4P6VF 5JS2A 3I42A 3AF6A 3MGKA 4CT0A 4CLRA 2B4AA 2ZJ4A 4R2MA 3ANLA 3EGDB 4DZTA 1C1DA 3ENNA 2A3NA 3FRIA 3MCUA 3MERA 5F76A 2OGUA 1G38A 3BCHA 2IUFA 3HJUA 2D5LA 4OUKX 4X63A 1CJKC 1QHGA 5LZ4A 4W9MC 5DX0A 2QQFA 1G1MA 1L1RA 3RTGA 3VNBA 1IZ9A 4FPXA 2CBGA 2P7HA 4PG6A 3B1VA 1HI9A 3OQ6A 4TMVA 5CCDA 5EKTA 3VNRA 3G2QA 4RVDA 1XV5A 4CEHA 1EXWA 1BXRA 1JILA 3LTNC 1RLMA 3R0QA 4EECA 5JD4A 3NI2A 4A1OA 4J4TA 1K4KA 2AE2A 3QENA 5D6NA 3UJPA 4OATA 1O94D 2D1YA 3C1OA 3G0BA 3NORA 2QD5A 3A31A 1P81A 3ZVKA 2V0GA 3OPMA 1PSZA 3COVA 2Z3ZA 3PRJA 2XRYA 4MVJH 4GBGA 3OJEA 5ED4A 3I6BA 5IN5A 1U1DA 3DZCA 5D87A 5I4CA 5CH5A 3VBEA 5G3YA 4AMZA 1U65A 3CEJA 5CJJA 4J1SA 4DB2A 1DWQA 3OAAA 4LW8A 1KRWA 4CL8A 2H57A 3GT4A 4WLEA 2AMYA 1FP6A 2FJPA 1DKOA 3AB3A 2GSWA 4RMNA 4W63A 4YBZA 1GA4A 1QH0A 4TWBA 5EIFA 1UMDB 1EI9A 4B7UA 1GDHA 3HR7A 4KFTA 2B8EA 4NX2A 2C2HA 1K6XA 3GLHE 4P33A 4TL8A 4ZV9A 4ESEA 4UTVA 4ZYYA 1FFAA 1KZ9A 2YYYA 4IDDA 3S2EA 3R0JA 1SULA 3ZWNA 1JDUA 1KP2A 1KQ3A 1M7BA 3MTEA 5AI5A 4DBLC 4NY1A 1PNTA 2WM2A 4HX2A 3ZVMA 1Z0KA 3E22B 4TLAA 4AQYB 1ZS9A 2FPUA 3N28A 1R50A 5ISMA 4JYBA 1SBTA 2H1WA 2PZMA 5EP1A 1QZ3A 2ZPTX 5GM1A 2EFDB 1YV9A 1NQ5A 4AUMA 3MIIA 1YHNA 1IPFA 2WWWA 3FTPA 1EJ0A 4LMRA 3R1IA 3U3XA 4OQEA 4DF3A 1AKQA 3E9QA 3TTWA 1I01A 4OLBA 1U02A 1AZSC 2D8MA 4O29A 2A3RA 2VPZA 1AY0A 3K0EA 4IBOA 2QE7D 3KEMA 4M6WA 3TM4A 4Z4IA 3JYPA 2BOVA 2ZG6A 2B2CA 5I5GA 5THKA 3L9XA 4BO1A 5TMPA 3NNDA 1UT5A 5L3VA 2V58A 4KO4S 4RPHA 5K3SA 1HDCA 2IWRA 3U56A 3TFWA 1J00A 3PLRA 2XE7A 4FGWA 4IEEA 3H8JA 1RWBA 2FMFA 3CZAA <