3P71T

Crystal structure of the complex of lcmt-1 and pp2a
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
315
structure length
315
Chain Sequence
DENDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLSSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKEITY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine carboxyl methyltransferase 1
publication title The Structural Basis for Tight Control of PP2A Methylation and Function by LCMT-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/hydrolase
total genus 118
structure length 315
sequence length 315
ec nomenclature ec 2.1.1.233: [Phosphatase 2A protein]-leucine-carboxy methyltransferase.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF04072 LCM Leucine carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3p71T00
3ANXA 4BY9E 3K0BA 1VE3A 2ZWVA 3BXOA 3KPWA 3HNRA 3LPMA 4AZWA 5K0EA 3KQTA 3HCBA 1G6Q1 1DL5A 1EAMA 3TM4A 4ER6A 4YV2A 5ICEA 3TKYA 2ONYA 2PXCA 1FP1D 4RVFA 5K0LA 1KR5A 5E1BA 3JWJA 1NV8A 2CMHA 1AV6A 2UYOA 3SSOA 2G71A 3THRA 5K05A 4PIPA 5KYGA 3TPZA 4RTNA 4CTJA 3ID6C 2ZWAA 2K4MA 4P7FA 3F4KA 1KPIA 4BP3A 2O06A 3TM5A 2I6GA 2EG5A 1M6YA 2Z6QA 2V74B 1KPGA 2Q41A 3MAGA 4GBED 3PFHA 4LG1A 3B3JA 4WVLA 5D1HA 5E1OA 3M33A 4PGGA 5ICFA 2P3QA 2I7CA 4R6XA 3A27A 3TKAA 2NXNA 3OZRA 2NYUA 5HZMA 1ZGAA 5LQRA 2KW5A 1R00A 2C7RA 2Z6UA 2PX5A 2HV9A 1EIZA 1FBNA 3Q87B 5DRTA 2NP6A 1NT2A 2JJQA 3R6TA 2ZIEA 2PJDA 4M37A 2FHPA 4RTRA 3DMFA 1WXXA 2ZBQA 1RI3A 2PKWA 3A25A 3BZBA 3KQOA 3G5LA 2BM9A 3R24A 4AUKA 1ZHFA 2ADMA 3GCZA 3C6MA 2NXCA 4E32A 2AOWA 1O9GA 1QYRA 3LHDA 4F85A 1ZQ9A 4HSGA 2PT9A 3VC1A 4E33A 3A4TA 3EVAA 4M36A 1AQJA 3DOUA 1I9GA 2OBFA 2CL5A 2XYVA 5DM4A 5HIJA 3HCDA 1R8XA 3B5IA 3FUVA 1R18A 4GEKA 2IFTA 3OZTA 4BLWA 3G2QA 2P7IA 5HFJA 3G8BA 3CC8A 1BOOA 5DX0A 2EX4A 1JQ3A 1JQDA 3GRUA 3HEMA 2WA2A 1Z3CA 5E9WA 2IIPA 4XUDA 2I9KA 2EJUA 1TPYA 2P8JA 2XYRA 3BWMA 3JWHA 3OFKA 4V0QA 5GWXA 5CUQA 2YQZA 3PS9A 4X1OA 3SX0A 1U2ZA 1N7IA 3ELWA 4PCLA 2YXEA 1JG3A 3M6WA 1O54A 3T0IA 4EVIA 5FUBA 1Q0SA 3AXTA 2HMYB 1RI4A 3BGDA 4QQNA 4P7JA 5CCBA 3KR0A 3HA5A 4X63A 2AOUA 1QANA 3FYDA 5E9QA 3EVGA 2GA9A 3I5UA 3G5TA 5HILA 5BP7A 5LQJA 4PGHA 4EKIA 1UFKA 3DLIA 4X41A 4DKJA 4U7PB 4FGZA 3G89A 2VS1A 2IGTA 5DM1A 5FWAA 5FULA 4IWNA 4KDRA 1HNNA 3A7DA 5KQSA 3MTEA 1EQAA 2PT6A 3OE5A 4MIKA 2PY6A 1V39A 2ZLBA 3HA7A 4KIFA 3LDGA 5P8WA 4YV0A 3P9CA 5E2BA 5CCXA 1ORHA 1H1DA 3FUUA 1XCLA 5G02A 1EG2A 2HR1A 1P91A 4HG2A 2OYRA 3ER8A 3KPYA 3KQQA 3BKWA 4GOND 4RSRA 3UFBA 3UJ8A 4DF3A 1YFJA 1SKMA 2Y1XA 3MCZA 5FA5A 3T7RA 3U81A 2XVAA 1BC5A 2B2CA 2PX8A 2VDWA 5JUWA 3HVIA 3GRZA 1TW2A 4PCAA 4FSXA 2AOTA 3B3GA 4M38A 4C05A 3SXJA 1VBFA 2XYQA 4E2XA 1KHHA 4EKGA 5F2KA 1G38A 5FHRA 1QAMA 1EJ6A 3GGDA 3DXXA 3IHTA 5GP1A 3GNLA 1MJFA 1SG9A 1SVUA 3SSNA 3FTEA 4E2ZA 4H0NA 1R8YA 5DSTA 4DZRA 4RTKA 2N47A 1QAOA 3DLCA 3P2KA 1YFLA 1BHJA 2UZ4A 2FYTA 5GIPE 5BXYA 4DCMA 3LECA 2AZTA 2VZ9A 3H2BA 3HP7A 5CVUA 1T43A 3E8SA 2WA1A 4B17A 5EGSA 5EMMA 1RJGA 4YMHA 5K0CA 4RTSA 2Y1WA 3FPFA 3PX2A 2BR3A 4IV0A 2A14A 1PJZA 4KWCA 3A7EA 4PWYA 1X1CA 5CVDA 5EEHA 3UJ6A 4YV1A 4MHTA 3UJ7A 2AOXA 2ZBPA 5K0NA 5FWDA 4P58A 2B3TA 3EGVA 1P1BA 3P8ZA 4FSDA 3CVOA 2AN5A 4P7GA 4YUVA 5ERGB 5K03A 3G2MA 3R3HA 2FK7A 2ZVJA 2HTEA 4RTJA 2BR5A 3NVMB 2BR4A 3DR5A 2IBTA 1KYZA 4QDJA 1NW8A 3DTNA 4P7KA 3EPPA 2P35A 3LL7A 3B3FA 3KKZA 3NWEA 4FP9A 4PIMA 5T67A 3REOA 4EQZA 3ELYA 4Z2YA 5E8RA 2ESRA 1NW5A 5EHGA 3E7PA 3KQMA 3HTXA 4A6DA 1JSZA 1VLMA 4GOOD 4OA5A 3OE4A 2GH1A 3FRIA 4IV8A 5DXJA 3V8VA 2H1RA 3PFGA 5LSAA 2AOVA 2O57A 5F2NA 3LSTA 2PVCA 2YX1A 3B89A 2C7QA 4FZVA 1WY7A 3KPUA 4DA4A 3EVEA 4ZTBA 3MGGA 5DPMA 4RVGA 3BGVA 4MWZA 4K6MA 3M6XA 5EQJB 5T64A 1XDSA 4RV9A 4LWPA 3IYLW 1YF3A 5EMJA 3NVKI 1XCJA 3EEOA 2DULA 2YXDA 3FUWA 1INLA 4G56A 3P2EA 3X0DA 3RW9A 3MTIA 2QRVB 3EVBA 1JTEA 5FCDA 2CMGA 3GO4A 3P2IA 3DUWA 3EVCA 4HH4A 3SR4A 3P97A 2LD4A 1R74A 3FTDA 3EGEA 3ER9A 4PONA 4CKEA 2NP7A 3L8DA 1AF7A 1SQGA 1VL5A 3OU7A 1X1BA 5K01A 4PYJA 5KVAA 3HVHA 3NWBA 5EG5A 5GOZA 3AXSA 2P40A 4RTPA 2P3OA 1VQ1A 2AN4A 4QPNA 1PRYA 3MHTA 3MQ2A 3UA4A 1G55A 2R6ZA 2O05A 4GQBA 7MHTA 1M0EA 5ICCA 3OFJA 5E9JA 1ZKDA 3PLAE 1WG8A 2ZTHA 3HVKA 5H02A 4R6WA 4E70A 3LBFA 1XTPA 3T7SA 3V97A 2JHCA 2VDUE 1JSXA 3G8AA 4LWOA 1VP3A 1L3BA 4F84A 4CWAA 2JHAA 4FS8A 4A6EA 4CKCA 2YUIA 5LQUA 2JHPA 5K0BA 3ELDA 4X61A 3TRKA 5CD1A 1KYWA 3OU6A 3ELUA 4PYMA 3WSTA 5HOQA 3KPVA 1AQIA 2C7PA 3TR6A 5DM0A 1NKVA 5EIWA 5U4XA 4IKPA 3BT7A 3HCEA 4X60A 5EOVA 4RYLA 3A26A 2FK8A 1VIDA 3R0QA 1YZHA 4OQDA 2JH9A 1WS6A 2ORED 3EMDA 5EC8A 1KP9A 4DMGA 1KPHA 3OZSA 5B1SA 3DP7A 3SM3A 5DX1A 3DXYA 1FJXA 3EVDA 5EMLA 4OA8A 4RVDA 2B9EA 4RWZA 3NJRA 4WXHA 2G1PA 3HVJA 1RI2A 2GLUA 2OPBA 10MHA 2PX4A 4HRAA 2WK1A 5DTMA 1NBHA 4FT4A 5EZSA 4AZSA 3HM2A 3CJQA 4ER3A 2ZIGA 4RTLA 5E2AA 3MB5A 4C04A 3FRHA 2IH5A 3TLJA 2PSSA 5EMKA 3AWIA 4OQEA 3BWYA 5LQCA 1NW6A 5DTRA 2PWPA 2YR0A 5CVVA 4KIGA 3S68A 3KQPA 2IH2A 4ATNA 1VP9A 3I53A 3M6VA 3E23A 3QOXA 3C3YA 3CGGA 4DCGA 3FPJA 5DSXA 2XVMA 5HIIA 2B25A 4HGYA 2P3LA 3C3PA 4L7VA 5IKMA 3ERCA 2ZCJA 1D2HA 2UYCA 3NMUF 2QE6A 3UJBA 2AN3A 4AZVA 3AY0A 1X1DA 5DXAA 1G8SA 3TOSA 4KVZA 3DMHA 3KR2A 3UJCA 3NDJA 2P41A 5HEKA 4RTQA 5E1DA 4GC5A 4PYIA 4V0RA 2OO3A 5D1NA 3BUSA 1JG4A 3D2LA 3TMAA 5K8VA 1IXKA 3FPHA 2P7HA 3NDIA 3JWIA 2AVDA 3G2PA 4KW7A 2GPYA 3FPGA 1JTFA 3C6KA 2OB2A 3UZUA 3BWCA 3M70A 2YTZA 2QYOA 4OBWA 5GINE 3GRYA 3OCJA 3THSA 2QRVA 5K0FA 3FZGA 3JWGA 2IP2A 3QV2A 5DTQA 1FP2A 8MHTA 5LQKA 2VDVE 1BKYA 4CKBA 1YB2A 1X1AA 4E2WA 1KIAA 3SVZA 1YZ3A 1UIRA 2G72A 2P1DA 3T7TA 3PB3A 4GOMD 4PYKA 5HIMA 4CXMA 3O4FA 1I4WA 5F2OA 5DRYA 1EJ0A 2AOTB 5FQNA 3TQSA 1RJDA 2Z6AA 3LKZA 1L3IA 3GWZA 2FCAA 3NTVA 5K09A 3LKDA 4YUWA 1P39A 3EMBA 3CBGA 1SQFA 3RIEA 1XVAA 4FR0A 1F3LA 1WXWA 2JH8A 2ZW9A 4KRGA 2ZZKA 3VYWA 5LR6A 3UA3A 3CJRA 2IH4A 2B78A 4ISCA 1D2CA 2VP3A 4HTFB 3KPJA 3SMQA 3PTAA 5MHTA 1G60A 2HNKA 3OPNA 4RVHA 3RODA 4PINA 3AJDA 2H00A 2ZZMA 1D2GA 2O07A 3FUXA 4GC9A 2AR0A 3P9IA 3FYCA 4MQ4A 5FA8A 5C1IA 1N2XA 2GB4A 5T6BA 1WZNA 2OY0A 3EVZA 9MHTA 4BLVA 2BM8A 2OB1A 1G8AA 2NXJA 3E05A 2FRXA 2PV0A 2EFJA 4XUCA 2ZBRA 4C03A 3EEYA 1M6EX 5GM1A 1Q0TA 5CVJA 5E1MA 1XDZA 4POOA 1IM8A 2XBMA 1ZGJA 3PT9A 3CJTA 3KQYA 4QPPA 2I62A 3LBYA 3GIWA 4C06A 4E31A 3P9NA 1I1NA 4KDCA 1UWVA 4OBXA 2PWYA 1DUSA 4QDKA 4GOLD 3M6UA 2O0LA 2R3SA 1L3CA 2E5WA 4DM3A 1TW3A 4EMSA 3HCAA 1RI5A 4DQ0A 3O7WA 4AZTA 3ME5A 4UOEA 4Y30A 3HA3A 5ICGA 4PYQA 3CCFA 2AVNA 3B7PA 2JG3A 1NE2A 3KHKA 5K0GA 4RTOA 3SSMA 4OX9Y 2YXLA 3BKXA 2OZVA 5HIKA 5FTWA 2FPOA 5C0OE 2ZIFA 4O29A 2QM3A 4PYLA 1RJFA 5CIYA 4YUZA 3MCTA 4YMGA 3LCVB 5EPEA 5GIOE 5EKUA 2PXAA 4GF5A 5C9ZA 4E2YA 2UYQA 3O31A 4AX8A 2DPMA 5EEGA 5DM2A 2AS0A 4XCXA 3OU2A 1NV9A 4PYOA 4QVKA 5EIFA 3ORHA 3DXZA 3M4XA 4R05A 5LQNA 2IDJA 3LGAA 3UBTA 1DCTA 2ERCA 4HGZA 1NBIA 3PVCA 4JXJA 3HCCA 3FTFA 4QTTB 2PGXA 5EHIA 2C7OA 3PX3A 4XUEA 3GU3A 4R8SA 4Y2HA 2IPXA 4QQKA 3DULA 1N7JA 2F8LA 2ZSUA 3MERA 3UJ9A 2PXXA 3LCUA 3EVFA 5KS2A 3P9KA 1IY9A 1P1CA 1L1EA 5EZQA 2ZULA 4QVGA 5DWQA 4C08A 1JG2A 3FTCA 3TFWA 3G7UA 1SUIA 4M7RA 5KQRA 4U7TB 1RJEA 1NW7A 3KQWA 1X19A 3LDUA 5EVJA 2V7EA 2IBSA 1QAQA 4RX1A 5K0JA 3KR9A 4FT2A 1KXZA 4E30A 3R9XB 1O9HA 2CWWA 4R8RA 3C0KA 2GAFA 2HWKA 3HCFA 4NECA 3FUTA 3K6RA 1B42A 3LX6A 2NXEA 3QOWA 5BW4A 3DMGA 2QY6A 3KR1A 4PYNA 2PBFA 5IH3A 3GDHA 2EJTA 1ORIA 1QZZA 3BWBA 5DX8A 1L9KA 1YUBA 2AOUB 2YVLA 3KU1A 4MTLA 4F86A 3DH0A 2GS9A 2ONZA 1XXLA 2H11A 2ZFUA 4LECA 3BGIA 1R6AA 5FADA 2OXTA 5GM2A 3GJYA 3Q7EA 2CKDA 1Y8CA 5M5BA 4CTKA 1JR4A 3KQVA 3CKKA 2OKCA 3UJDA 1FPQA 3I58A 5DLYA 5JR3A 3IV6A 3UWPA 3GRRA 1RI1A 2G8NA 2PLWA 3NW9A 4HTFA 4C4AA 3LDFA 1OR8A 4ER0A 2NNWB 4ER7A 2BH2A 4YUXA 1VPTA 3SGLA 2ZZNA 4QTUB 4BLUA 2PX2A 4BP1A 3I64A 3GXOA 1JG1A 1ZG3A 5DT2A 1SUSA 5FQOA 2UYHA 1F38A 1XDUA 3UJAA 5EKXA 1MHTA 3FPEA 1JQEA 2IDKA 3GRVA 4C07A 4GUAA 2BZGA 3KQSA 4EK9A 4HC4A 2G70A 3P71T 1HMYA 1XJ5A 3IEIA 3G2OA 5CM2Z 3I9FA 5CVEA 3LCCA 4PNEA 5BW5A 4YUYA 5FHQA 1NW3A 4ER5A 3G88A 4RTMA 3EGIA 3VC2A 3VSEA 5LQAA 5E8JA
chains in the Genus database with same CATH superfamily
5JQGB 2HL6A 1T9KA 3EXG2 3KPWA 3P2JA 1C8LA 3WRWA 1QP7A 1G6Q1 1IIBA 3IAEA 3AIIA 5JAPA 2DBRA 2EW8A 3FN4A 5DKFA 1LGYA 1Z25A 5FAXA 1NV8A 3P96A 1TCCA 3O0DA 4GXTA 2FP4A 4AJOA 4BWGA 3M5DA 1M54A 4ICIA 1OX4B 4CMKA 3IIIA 3UAWA 2ICAA 5J43A 2OUIA 2XA2A 5F23A 1IPEA 2C7BA 3VPSA 3VR1A 2NU8A 4YCMA 3O1IC 4PG4A 4D4KA 1SXHA 1YQTA 2POCA 4KG7A 3ZX5A 4UD6A 4GBED 4I9NA 1JSCA 2CEAA 4EG4A 4K9KA 2FB9A 4B8ZA 4CDMA 1CS0A 2Q27A 2RGEA 2Z5LA 4RKEA 4CFZA 5JISA 3GR6A 3F73A 4A91A 5DHQA 2SHKA 2IODA 2QAIA 2KW5A 4JJFA 1Z26A 1VMEA 4KGDA 1HY3A 1XMJA 2PX5A 3T5CA 1XCPA 4B4OA 3R40A 2QK4A 3MAAC 1XFAA 3THOA 4RTRA 3GV0A 3KJXA 2C2MA 1G5QA 1M2OA 1R2QA 2HJ9A 2RAUA 4PSDA 1GUBA 4RE5A 3H9EO 4FKBA 3VPFA 5DP2A 4BVLA 3MT9A 2R7KA 3R0JA 4RA6B 5K51A 2X8WA 4QAQA 3H11B 4DLRA 1ZQ9A 1C9MA 2JRCA 2IKQA 2FETA 1IZ0A 1QC5A 3OOJA 1NW4A 4MVYA 4P33A 4RKRA 4S2EA 4F97A 5I48A 2GBLC 3C74A 3IV9A 2QTNA 4OI4A 4I50A 5T5QA 2EX4A 4TLCA 5HQJA 1OB5A 1Z3CA 3WWEA 1VKHA 5IS2A 3OHMA 1U65A 4XUDA 1HQYE 2P8JA 5AHWA 1M67A 2IP4A 2EL7A 4E11A 2YV2A 4JL8A 3AUSA 3G9QA 3U44B 3DMTC 3ELWA 3KEFA 1JFFB 2Q2NA 3RKRA 1O54A 4PE5B 1Q7CA 3AXTA 2JCSA 3WMWA 3L9XA 1P4JA 1RI4A 2JFQA 3L1VA 1Q7RA 3U4QB 4F1WA 3T3DA 5LYJF 5BSWA 1QANA 1NVMB 2FPPB 2PCJA 4YROA 4FFVA 2IZ0A 4R2KA 1YRWA 4RQAA 2QROA 3U80A 1P0QA 4E5YA 2RARA 4ENUA 2VP4A 2CV1A 4C30A 5C5IA 3EPKA 3RK1A 4Q3AA 3DTTA 3O75A 4DUYB 2RGCA 4J0QA 1RPAA 1SOUA 1Q2UA 2OYCA 1NJFA 1P80A 2A0FA 2HO4A 3IBCA 4PLTA 1Z5VA 3U60B 3SF0A 1Z4JA 1JFLA 3AR7A 3NNDA 2Q28A 3WDLA 1V5EA 3FUUA 4WDRA 3WWPA 2LIVA 3N39C 4WINA 4PX5A 1QV7A 4KO2S 2ZYRA 3ZZ0A 1LBEA 2YQ4A 1KXJA 4MCJA 4O4HF 3GPLA 4RENA 2JNWA 1E1KA 1XCMA 2JVIA 5BW8A 3KDSE 3QPWA 1M2EA 1AK9A 4KXVA 1UEJA 2AIRA 4PCAA 4HWRA 5GJCA 2I1QA 1KY4A 1UK8A 3NGLA 1KHHA 3LJKA 5JCPA 5FHRA 3JQEA 4F60A 1FTNA 2BHTA 3GGDA 1QU2A 5AD1A 4ENSA 1XNHA 2PZJA 1BWPA 1HTWA 3ZZTA 3DFUA 4CT0A 1RYFA 2E37A 1B23P 1R5OA 3DLCA 2VBGA 1IVSA 5KYXB 3QFSA 2Z2YA 4Q4AA 5ITZA 3HB5X 4DLBA 5KWJA 4B17A 3A6HA 3EC1A 1IBSA 4DCTA 4YMHA 5I5EA 1TADA 1YJXA 4MUXA 4PWYA 1EJBA 1CC1S 3VC7A 4YV1A 2QZJA 4OKSA 4MQ6A 1XZFA 1E1QA 1MFPA 2BT4A 2WM9B 4XW2A 1YRHA 5AI8A 3RR2A 4DM7A 4HEA6 3QMPA 4IHJB 1TU4A 1UJ4A 2R2AA 1VTKA 2OFOA 3T7JA 1NL3A 1ZOSA 4AG5A 3M7IA 4R8MA 3CVOA 2GRUA 4YMIA 1KP3A 4YUVA 1XZKA 3DJYA 3VO8A 5JNSA 3VKWA 2X76A 4DZZA 3ZEIA 2AFHE 2X2PA 3AVQA 4A0GA 2GXAA 5AI5A 3GLFE 4BIMA 1U0LA 2EVWX 1IDN1 2R1VB 3COPA 4Y6SA 4GX2A 1XAHA 1CZLA 1WXFA 2ZJ4A 4FI3F 4ZRNA 5IDWA 1YSCA 3A3NA 5ICSA 5T67A 1TYZA 4HNVA 2HRQA 2YWCA 1ZU4A 5ALTA 1VCMA 4P82A 1VJ1A 3FWNA 2QW8A 3Q3CA 1MT0A 5TMBA 3RC2A 1JB9A 4I4TB 5KVVA 3QY0A 3NORA 3C3EA 5AW9A 3WBFA 5JVDF 4ODIA 2X8AA 3V8VA 1KWKA 2I80A 3C7KA 4WFKA 4TZ0A 1PNOA 1B26A 1VHJA 2ZXFA 3II6X 1G2OA 2R60A 4HEA1 4N3BA 4IYRA 3DYIA 4CFSA 4IDDA 3DE5X 2CSUA 1FDWA 4GM0A 4W4TA 3ZQ6A 2A1UA 1SBHA 3H9GA 2PKYX 1XCJA 1XNQB 3U17A 4NG4A 4D8UA 4ZK6A 2CLIB 1UKBA 5LZ9A 2VHVA 1H66A 1TQ4A 2ZI4A 5FCDA 3WIEA 3C1OA 3P2IA 4AS3A 2W7TA 1QNFA 3KB8A 5LA6F 2VP6A 4CG1A 1UK6A 1NXWA 3PGVA 4R9VA 4UQOA 1SQGA 3ZGVA 2GBGA 4PYJA 4RHYA 2ZROA 1PK9A 1ODCA 2BFBB 2WABA 2ECKA 2OXFA 4Q02A 3RIYA 3AXSA 3OQ6A 2P40A 1XNJA 3OM0A 1V4VA 2I03A 1G3IA 3F4LA 1ZJWA 2ZE7A 4YREA 3TL6A 3AJ8A 1LDEA 2QPOA 2JLZA 1OIWA 2Q5QA 1M7GA 2Q46A 4O2BF 4XTCS 3D4OA 3GJXC 5WRFA 1V25A 4R6WA 3ZVRA 4XVCA 1KOLA 2NACA 3ANSA 3BMNB 2P9QA 2BKLA 4LWOA 3JRWA 3ROGA 5JU6A 1HSOA 2A9FA 1L3BA 1YZVA 5JBNA 2PMEA 4Q4DA 1NLZA 4DNQA 4EA8A 3LCRA 2DUWA 1KEEA 1OXUA 2I6FA 4GQAA 3ZEAA 5AVWA 4X61A 4WNCA 1MGOA 5JLAA 3LYHA 3SLGA 5GZ1A 1OLOA 2XH8A 4ZPJA 3DWGA 4RV4A 5ALEA 3SLRA 1TVKB 4LJRA 3NTOA 1ST3A 3IP6A 1HRKA 5JQGF 1DJPA 3LHFA 1MC4A 1A82A 4EWLA 4U8HA 1YU6A 4U6SA 3VR0A 2ANBA 4CYMA 1T8PA 1CZUA 4ARVA 4AECA 3F8TA 1E1MA 4K1LA 4V2IA 2ENUA 3HC7A 4JGBA 2ZYGA 1ZIOA 3FNIA 1E6UA 2HNBA 2QXUA 4KO3S 3EPJA 4RJJA 4UTZA 3OKAA 2G83A 1TMGE 3TNLA 2QVYX 5EMLA 2GPNA 2C5AA 9GPBA 2EFHB 3BL6A 2J3IA 3ZKWA 1YC5A 3C70A 3R74A 2DOKA 2CFOA 2VF4X 4WXHA 3TB6A 3CVWA 4MQMA 2QX8A 1C3EA 1T9ZA 4DEVA 1PYGA 3N86A 1O94A 2AHOA 2EBFX 1XD2A 4K8OA 1NBHA 1U98A 2Z4TA 3GLGA 4RVSA 1GRQA 3ICEA 5EZYA 1Q17A 3V9AA 3FF4A 1E6WA 4JGGA 4TMFA 3DAYA 1YKGA 1CUYA 3ADOA 3HWX1 4OAQA 4OGFA 5E7MA 3MB5A 2FZEA 1GFWA 1XDGA 5JC1A 1M0SA 2J9FB 1Q0PA 2D7JA 3E1SA 2PLFA 2G6BA 3I3OA 5C5DA 4CTMA 3I9JA 3EXFB 1UXJA 3L0YA 4J7XA 1ZC4A 5AVUA 3IQEA 1VSTA 2FZ5A 3HVRA 5HUHA 3R7AA 1EE9A 1M1ZA 2AJTA 3LKVA 1I3KA 1HDEA 4D0GA 4D74A 2HA6A 1XCBA 1GN9A 2JBWA 3GXBA 4MYCA 5LL6P 2ZRKA 1QGZA 2WZBA 2XNDD 4HAVA 2QTFA 3C5HA 3IE0A 4NBKA 2A4MA 2UYCA 5A7FA 3NMUF 4HN4B 1JVSA 4FEYA 2ZB2A 4JJIA 1O03A 2RBGA 3ER6A 1T1EA 2ZCUA 4JJZA 4ZHSA 3VV3A 1XCGB 1JAHA 3DL0A 3Q8XB 4MR9A 4R1NA 3FD8A 3Q7SA 5JT1A 4Y1RB 1MB4A 3DC7A 3PQ3A 2HZ7A 4DYVA 1I3LA 2QP3A 2BGJA 2E7ZA 3EZFA 5BRJA 2VJNA 5D1NA 3EH1A 4PPNA 1EU1A 3G2KA 4QE3A 2VT3A 5IEJA 4DRYA 3AZQA 1Q5PA 4IAOA 4DHWA 1P2TA 1JALA 2P1RA 5JCJA 3RI3A 1OB2A 2CVFA 1D8TA 2BP7B 5TQ2A 3VDNB 1KEZA 1N1MA 4F5WA 4KI0A 2HA5A 1DAKA 3SEZA 1NNSA 2KHZA 3RLFA 3T4PA 2JLCA 5JSZB 4Y9DA 3THSA 1P3JA 4PG7A 4FMPA 1XZLA 4PFSA 2FG6C 3DUFA 4EY5A 1KE2A 3OAAD 5FUMA 4JVMA 1O0BA 4P0QB 2WIKA 1QHEA 1BMDA 3AIOA 3CX6A 5JARA 1QPBA 4W5RA 4OH1A 4IGKA 4UU8A 4PW0A 3GLUA 2G72A 4AULA 2HSGA 1TOAA 5BWCA 1E2GA 3IILA 2AOTB 2JLAA 3F3MA 4JFAA 3VA7A 1E2KA 2PUCA 3ETHA 4X00A 3GWZA 4AKEA 5AI4A 4WEOA 4DLVA 5AVXA 1V1JA 5K09A 13PKA 2HDNB 3PPIA 1W0CA 3F67A 1RM4A 4DIEA 2Z56A 3L06A 2WKPA 5L53A 4RVCA 3PC8C 4RL4A 4RNCA 1KI7A 5DFAA 4L02A 3G0DA 3VYWA 4AUNA 2IHVA 2H2DA 4M0DA 1ZX1A 4MV0A 4LYJA 4WTOA 2ODAA 3HDJA 4KYTA 1DBRA 2IZ1A 4EGAA 3TUZC 2J4CA 3SMQA 2VP2A 4OM8A 5H9VA 3GUUA 3DYBA 2Y66A 1JHVA 3QVXA 1J2YA 2QUBA 3B1XA 6AT1A 1N2CA 3P9IA 5C1IA 4OMUA 1A9QA 4J3NA 3L0OA 5AW1A 5EKTA 1KSGA 3EVZA 1H9CA 1OWNA 2FEXA 4IHJF 3QE9Y 1G8AA 2BRUA 2NXJA 2ZBDA 3OQJA 3VHRA 1OZFA 2PV0A 2VHQA 1FK8A 5EIBD 4OQPA 3FZYA 1R37A 2WHPA 4TXLA 3SC4A 4Q6BA 4KPFC 3HRHA 3GVPA 3GT4A 4XWGA 1ICEA 1C1XB 1A50B 3MD9A 2DKFA 3H84A 2H29A 4PRZA 3PT9A 1SBIA 3CJTA 3KSDO 4ZU6X 3P9NA 4X90A 4M1OA 5KQGA 1ZMTA 5DM70 3F78A 2EX1A 4TXMA 5A05A 1Z0JA 2J6CA 2WE8A 2XRFA 3IKJA 4I4TF 4DG9A 4UOEA 4G6ZA 3U7QA 4Y30A 2V6GA 3TS1A 3H5OA 1Z75A 4BQNA 3N8HA 1GRVA 2FCRA 2ACVA 1VE7A 4D97A 1KOGA 1PVOA 1CJKC 4OX9Y 4B7CA 1PD0A 3VPAA 1U3UA 4NJEB 2PH7A 2G04A 3JQ8A 5AKZA 5HBRA 2LP4Y 3UT5A 1AGYA 4BQPA 5DBOA 1AE1A 4CU2A 3BRSA 4RXTA 1GY8A 4GF5A 5BR1A 1ZESA 2ZSKA 3D8TA 1UJ5A 4OEHA 5DHSA 2AGVA 3BB1A 3QVKA 1HTBA 2UYQA 2EQAA 3SJZA 1KJ8A 3QPAA 1E66A 5B58C 2O2XA 2I6SA 3ENWA 3E3LA 3X2EA 4I55B 3RHFA 1RC1A 3WGJA 5BNZA 1RJ9A 3HACA 2NU7A 4CIWA 2FN3A 4ZXFA 4XTRA 4G36A 4UTRA 4K6CA 1D0VA 4WFQA 1T8RA 3R3VA 3O2SB 1J4AA 2GI4A 2OCIA 3DEZA 2DQZA 4A92A 1OSNA 5EHIA 3LF2A 2QX9A 2SICE 4NDNE 5IBQA 1DG9A 1DRKA 3RVOA 2X4LA 3EZXA 4QQKA 4OGWA 1MTOA 5JROA 2CNLA 4GZLA 4K3UA 3WAGA 2HDOA 2ZETA 2BSQA 5EZQA 1T1GA 5FOVA 2X9GA 4R01A 3TVDA 1NP7A 4R2WA 1AZLA 4A8JC 2I54A 1K8YB 1L4MA 1Z5PA 3KR9A 4RCZA 2RI0A 2VEOA 3LHIA 4KQGA 4A26A 2KLHA 4PZ9A 1CQWA 1EK1A 1L4FA 1YRBA 5DYWA 4F3NA 2SCUA 1E64A 2QL6A 2ZQZA 4HAUA 2QLMA 4PAGA 3RT7A 5ESWA 3S2SA 5L3SA 3AVUA 1CDOA 2JJ1D 3K05A 4OJKA 4WY8A 1GAXA 3K2EA 3HJHA 4KOAA 1R0KA 1RAAA 1USVA 2PMCA 3AM5A 2G76A 3B51X 3V33A 4Z9BA 2OBMA 1SB8A 1EA7A 2QX6A 3DCNA 1U7PA 4DM4A 5BSHA 2Z98A 3E9RA 5EI5A 4WLOA 2CVPA 1U0JA 3TX2A 4N7BA 1BFDA 4US1R 5IXYA 6REQA 4C78A 1Z4OA 3I30X 1PT5A 1XA4A 3GAAA 4TWRA 5B55A 2EV9A 4Q7KA 4Q7LA 1RI1A 5HS4A 5TQVA 3ODGA 1OI4A 2RHOA 2QA5A 3SGLA 4O5AA 2C4VA 3PWKA 3S2YA 5DEIA 4D26A 2WQZA 3ONFA 3SP1A 4TKLA 1T2NA 1XAGA 3SS8A 4YRCA 4BP1A 4ZEVA 3TTYA 3I64A 5ERXA 1LQ2A 1OXSC 3VTFA 4WCFB 3KLBA 5FQOA 3VDRA 4C22A 2X3YA 2ZYSA 3PVZA 2WE7A 5IKPA 1MHTA 4MEBA 1F8FA 4EK9A 4QG7A 2B0JA 1ZLYA 2DQSA 3USZA 4P8RA 1WY5A 2HA2A 2ZYAA 1MPTA 1TT5B 1I7LA 2ZJ3A 3Q8KA 3EULA 4UATA 3S99A 5C37A 2BEWA 5CFPA 3LYUA 5CM2Z 3N0TA 1RNLA 3IAS6 1FDSA 1X70A 2Q3JA 3KVRA 3LP8A 4RABA 1N4DA 2N1MA 2R85A 5AHKA 5F5NA 3ZHCA 4ER5A 1JIVA 2QUIA 2J5QA 3PQCA 5E8JA 4JNCA 3UEOA 2UUBB 4XPIB 4NAVA 1Z28A 4L5JA 1ZUHA 2WMYA 4UBLA 1FRQA 2W2OA 3NYWA 3DEYX 4C4SA 2E4AA 4ISBA 1KR5A 3TJRA 2CJFA 1YI8A 2ZRQA 3ZHVA 1A2BA 2QM8A 5HDQA 2ZJYA 1ISHA 5J40A 3ZJYA 1QF7A 1TA4A 4L76A 4QGGA 4YGYA 1G0NA 4A8PA 2HU5A 1O5OA 2A3NA 3QLVA 4GYWA 4IUBS 5FLYA 1E7WA 1KPIA 2FN8A 5KDLA 3U26A 4I1SA 3EFBA 3MJTA 2J41A 5LWHA 3BFKA 2C2WA 4P92A 2ECPA 4P4SB 2FFJA 2QT0A 3CR7A 4RGQA 3SE7A 3H0EA 3TDNA 2B8NA 4G5GA 1JIXA 3OM9A 4NR0A 3TNDA 2VDMB 3AESB 3HR7A 3PDIA 4L51A 4N1AA 1T8YA 3H0KA 1D1SA 1XHLA 1WEKA 4BHTA 2GBPA 1H42A 3HDYA 3IAS1 1R00A 5COAA 3UCXA 2RD2A 2IE8A 4R3WA 4J16C 1ZM7A 1CJMA 3ZBTA 2NP6A 4LJ5A 1N2EA 1KQOA 3F7OA 3PFFA 3CNQS 4RVNA 3TEFA 4GZ5A 1AKYA 3JALA 2P5TB 3UMRA 3L7YA 4RLQA 1E1LA 1EP1B 5FJJA 4BGIA 2PKQP 5JXGA 3KBBA 4RSMA 3WMEA 1FE8A 1KK2A 2OV8A 1AUQA 1QK5A 2AXPA 1I9GA 1QDLB 2CXHA 2NTYC 2OWEA 3P2YA 5DCUA 4ZU1X 1R8XA 1G291 1B7GO 1R18A 2C5SA 2CUTA 1V95A 2FWJA 2VH5R 3PC2A 3VAZA 3W6UA 1JDJA 2AJLI 4MUGA 2B1GA 1RXSA 3WQHA 5B2FA 2GAOA 2FZVA 2VXOA 2IIPA 3DWFA 1E99A 4LXIA 1NWHA 1QBGA 2XYGA 4IIVA 2A84A 2YQZA 2ZIZA 3UUFA 4BNKA 2ZBFA 3GGPA 1BXGB 1U2ZA 1G16A 3DBHA 3JQCA 1XEWX 3OQPA 5DN6A 3NYIA 5P21A 1J8DA 1GU7A 1N0IA 2GYYA 3EG5A 3D6TB 1U5BB 3H19A 3KDAA 3O1JC 4QOGA 1JMVA 4TKUA 1N5IA 3KKNA 5JDCC 1RPJA 5IC4A 4BJ6A 1PT8A 3QF4A 3OCZA 5BUQA 3F1LA 1SJ9A 1QMPA 4QUIA 2H9YA 4Q0MA 4HWKA 3I5UA 4F7DA 2VJPA 3ZBPA 4UJ5A 4P31A 3V2IA 4IILA 2Z30A 3KSBC 4X41A 1LI5A 4JUBA 1W46A 4ZV9A 4ES6A 2G7ZA 5CXUA 2OCYC 3RV3A 2O8CA 4LHSA 2ZU0C 1C14A 4U2BA 3OJCA 4MVWA 1YB1A 5HJEA 1ZM9A 3QLVC 4CGYA 3DJFA 5K8JB 2FUEA 3OA2A 3TW8A 2NO4A 3MWLA 5CCXA 1U0BB 1USIA 3AB3A 3HR4A 5KVQA 3KQQA 4DGQA 4RF4A 3UFBA 3E0XA 3HSSA 1JH9A 4YXWD 1PJAA 4Q9JA 1NQWA 1XK7A 4M7PA 3T5MA 3WHPA 4R9UC 2BEUA 2WFAA 2JGMA 3GRZA 3SQOA 1H8EA 4BO1A 2D1SA 3MVEA 1OXXK 2PO7A 4F8YA 2G9RA 1XGKA 1IC6A 3BK2A 3H1TA 2GKGA 4CCSA 3ND9A 4FE3A 1Y5MA 1KF0A 2PX3A 3VU3A 1PX0A 1AKMA 4YP9A 1A97A 1AUOA 1NUUA 3DA8A 3UUGA 2JAQA 2GN0A 4I9FA 1SVUA 3R0ZA 4K05A 3T9AA 5B4TA 1ZJ6A 4RVOA 4BTEA 5A9TA 3A9VA 3LIIA 2O0KA 3IB3A 1FRVA 3N5KA 1M34A 2IHNA 3HMQA 3ETEA 3SG0A 2H4HA 2V4ZA 3D8HA 3A4YA 1ZSYA 4QBFA 4V0ME 1NVGA 4XZ3A 3RPEA 2P9GA 1E3DA 2BM0A 5IDXA 3BCHA 1NDUA 4WKBA 1T6ZA 1JZTA 4I55F 3IAXA 4JSTA 1UFVA 4Y0AA 5FI5A 1A9TA 4PZAA 4UXHA 2R8RA 1Z16A 4Q3NA 2BGNA 1RWWA 2ZBPA 3RGWS 1Z73A 2FFQA 3ISJA 1CUGA 2PFGA 4Q4JB 3EGVA 4EPTA 3CWQA 4IIGA 2HIHA 3NM4A 5ERGB 2ZSHA 1L5VA 4HGRA 4GMXA 4NENB 4J07A 3EEFA 1PEAA 4H6VA 3FTNA 3K1JA 1SZJG 3DR5A 4EFKA 3FNHA 1FDRA 1PAUA 1K2WA 2XMPA 1PSDA 3DF7A 5TVGA 4WUTA 3NWEA 4EQZA 4QG3A 2Q6OA 2JK1A 3REOA 3ELYA 4CM8A 3SSNA 4FFRA 1X77A 3RG8A 2REXB 5H8WA 3IKLA 1CULC 2E82A 2KQUA 3V1TC 1IIRA 2IT1A 1AZTA 5CEFA 2P9TA 1U0NA 2VHCA 3NWOA 1ZRNA 2OGSA 1UP6A 3TFQA 3UBMA 2AX3A 4PRYA 1NG9A 2G88A 2VQFB 2R5FA 4YRKA 2XT0A 4MQUA 3NVDA 4R51A 4BNJA 4N3CA 2GHTA 1NMSA 1PJLA 3H65A 2PZKA 2DCMA 2Y1DA 1NVXQ 3QLUA 5FD8A 1KO4A 4INAA 5F9MA 2CSXA 2J4DA 1NJSA 2QRPA 3HO6A 1Z68A 3LQ1A 3N2EA 4DLYA 2V6BA 4DMCA 4HBZA 3PEVA 1CDZA 2ZEJA 3P2EA 3SXPA 4ZI7A 1VG1A 4EENA 3CM0A 1VYUA 1BA2A 1YOBA 2QAGA 1VPEA 1LLCA 1CTQA 3ETJA 4M0KA 3RVNA 3ER9A 5D2CA 1W2HA 2ZI3A 4Q7EA 2JA2A 5C53B 1AF7A 2D7DA 2W2NA 1X1BA 2X2EA 4DL9A 4X45A 1YR6A 2H9AA 4C6HA 1TTHA 5HQ3B 1PZNA 5I47A 2EDAA 4D9CA 5TLSA 4RTPA 2P5YA 2GD1O 4B7AA 1G55A 4N47A 3TG2A 4CN9A 2HYIC 2EWVA 2GARA 3MMZA 3MSCA 2R8YA 3OFJA 4KN8A 4BNHA 5KSZA 3L4JA 2WYHA 3N75A 1U8XX 2ZRFA 3A1VA 4YRQA 1TAGA 4ZQGA 3S2ZA 5A4AA 3WK8A 5D7BA 4EIWA 2ATXA 2VSOA 1EKXA 3NWPA 2I4OA 3H2YA 2JHAA 2WKWA 2VWGA 3I01M 1PUXA 2B1JA 1E0SA 1OFVA 221PA 1PJ2A 4L9AA 5CHEA 3MMPA 1SR8A 3WSTA 3T1NA 4QOHA 4DYDA 5JXIA 2VRCD 3NM6B 1G0OA 1ZGGA 3P32A 2R8ZA 3QSGA 3TR6A 3BAFA 3IE1A 4R40A 5U4XA 3J7AC 3ZDYB 1L4UA 1UBUS 1RKUA 2O7QA 5H68A 1Q7GA 1ULUA 4BNNA 1V26A 1L7QA 4DAOA 2C2BA 4J8PA 1JQAA 1RVV1 2DFTA 3CS3A 3DZKA 3EDCA 1WS6A 2AN1A 3EMDA 4MXDA 1TA9A 4P98A 5H81A 3CF4A 4LY9A 4AURA 2HXYA 3P0EA 2FOLA 3U7IA 4KI7A 1C50A 2AEEA 1FMCA 2J4FA 3HY6A 3SYRA 3GA5A 4I08A 1C9DB 4NS4A 5EUQB 5IMBA 3TLXA 3JZFA 1AH2A 4ID9A 2FRVA 4ZT7A 3TIGA 4C0KA 2ADFA 1MO4A 1BMFA 1ZVKA 2CLMB 2ZIAA 3BMOA 3F6PA 3G9XA 5JCOA 2NT3A 1Z4QA 5BRNA 5E3HA 4B31A 2ZJ7A 4LZWA 1HH4A 1FXWF 4HDKB 1JV2B 3RVBA 3N3BC 1OWOA 3ZVNA 1RHJA 3MLAA 2O1SA 4YQZA 2OV1A 4QXOA 2Z2KA 1DT3A 2VF2A 3OT1A 1F7VA 1E2BA 5EE5B 4BBAA 1D4AA 1OROA 4ARIA 1U2EA 3IXQA 3L84A 1EUDA 2GYUA 3N2GB 1Q77A 1XA3A 2VPXA 3DOCA 3ST7A 5TGZA 2PWPA 1O6FA 3H87A 2IU4A 4J0DA 1PS0A 1RE0A 4TTVA 4ADSG 3GFBA 5BURA 2GBFA 4MV6A 4GVXA 1OAAA 1Y1LA 4W82A 2DVMA 1CLUA 1EP2B 1CR6A 1L5RA 1NVAA 2XDWA 3K0CA 3M2PA 2G1UA 3OZEA 3PFCA 4KO1S 2AN3A 4N4AA 3WMGA 2J1LA 3E27A 2VNSA 4OLAA 1ESCA 4JIMA 1CDDA 3I09A 3MT8A 3Q6IA 1Z7EA 2ZIXA 5JBQA 2I7DA 2I4NA 4AY5A 5HEKA 4AS1A 1XCOA 4Y2XA 1EFKA 5I51A 3O91A 5K3CA 1WKBA 3EUEA 4JYMA 3SF8B 2Y0DA 1P2DA 5HNKA 1X3SA 3BUSA 3EXG1 4QPDA 2PSFA 1FQWA 1K6MA 1G8FA 2WR8A 5D7NA 1S3IA 3VI4B 4C2BA 4Z8YA 1X7YB 1U3WA 1U2GC 3O4RA 4ITRC 3ASUA 1JHZA 1H69A 3FPAA 2AVDA 3K4QA 3KKPA 3ONEA 4KW7A 5C7IO 2V0GA 2O19A 1VKZA 4YRNA 3M70A 1ILWA 2YTZA 1EGMB 4HDNA 4ZI2A 1U7OA 2J87A 3EBOA 3ZD9A 4AZ3B 5KNCA 1FS4A 3WIVA 1WXHA 2I8CA 3AVPA 2Q2QA 3FNRA 1K5HA 2EHDA 2FVXA 2OHVA 8MHTA 4DA6A 4ZJUA 2WUVA 3V9PA 4J43A 3MELA 2NTJA 1A88A 1JJ7A 1KIAA 5FBKA 2FR8C 5B3JC 2DWQA 3MINB 3JD4A 1Q14A 2VQ3A 4GOMD 3L41A 4J2OA 1HTTA 2BTEA 1P0IA 4LI3X 3FTPA 2Z6AA 1SXJB 3LKZA 1H2ZA 4MVJG 1AMOA 2EDCA 5MGNA 5T41A 1JJVA 5AI6A 2QUKA 1EWKA 3CA8A 3N0RA 4IXNA 1NN5A 1PIWA 4FB4A 1JHPA 2NO9A 4TT3D 1E2PA 1WXWA 1I2ZA 2ZQ5A 5LBUA 4XVUA 4KQ9A 3BICA 4Y9TA 1UWKA 4XH9B 4V02A 4HNHA 5IBRA 1DIAA 4N03A 4NYIQ 1P18A 2C5BA 2F90A 5LU9A 3DEJA 2ZR7A 1NUPA 1MH1A 3UO8B 1G3QA 5MHTA 4GUDA 4HF7A 3HB7A 4HQOA 1MCZA 4PZPA 3LFTA 3RODA 5EJAA 4W5HA 4S2UA 2I66A 1PLJA 5F78A 5KNDH 1P4AA 4K6KA 3RS4A 1N2IA 2JFPA 2XCQA 1N2OA 4PLPA 4BMNA 4DBZA 1N2XA 2GB4A 3K0CC 2CZGA 3L7NA 3QE4A 5A6SB 1TK3A 1VKOA 3HA2A 9MHTA 4RF3A 3K9GA 5KX5B 2BM8A 2OB1A 1PR5A 4IXWA 4Y2PA 2X7JA 3T0GA 2O3QA 3OX1A 1XMOB 4B3GA 1I3CA 1EPUA 1E2LA 4R54A 2Z5FA 3UAOA 3NVAA 2AFHA 2Q4DA 1IK6A 3M4JA 1F3OA 1Q0TA 1RWKA 4DV7B 2OZLA 3S70A 2XXBA 4BQIA 4IZHA 2TECE 4PWZA 3KTAA 4GSKA 2W2QA 1RQGA 1DUSA 2A1TS 3OLCX 4UBJA 5KKAA 3SQNA 2G09A 1PZGA 1TZBA 2FDCA 4KTVE 2X8JA 3O0TA 4KQ1A 5U4QA 4UE2A 4UHEA 1R6BX 4CODB 3UAXA 1Z0AA 2O2JA 4EO7A 4B7UA 3QX3A 9ATCA 4QJ4A 3ZU6A 3F71A 3D7MA 3MTQA 2NO0A 2WTMA 4Z3DA 1LA2A 2HOQA 2P3SA 1S01A 1Z6TA 4E88A 2C07A 3LLMA 5JCXA 4PYLA 1ZHHA 2BUBA 3UATA 3LCVB 1E7RA 5TY0A 3RKSA 3K0AB 4BNDA 1M7HA 5FR1A 4EYQA 3MQ4A 3W8NA 4ZYVA 5CDFE 1PCXA 4IHKA 2DHDA 4C3OB 1GT6A 2YWJA 2IBMA 4Y2QA 2HN9A 3C5VA 3CX4A 1QZTA 1SVOA 5B37A 4IMRA 4AI6A 3D7KA 4W5JA 2ZYVX 3OPXA 4GECA 1MA0A 5E6UB 1SBQA 4FN5A 4QTTB 3RRMA 1WUTA 2AF3C 2JBAA 2PGXA 3UK2A 2A5JA 3GU3A 2CCGA 2P9FA 1GFZA 4QC2A 4K9DA 1EAYA 3W6OA 5IYZA 3VYUB 3FDFA 3UMVA 3VHXA 2ZT8A 2H2WA 4DPMA 2FW9A 1JG2A 1H8HA 1SUIA 2OGUA 4M7RA 5LOVA 2H0RA 4FFOA 3GAFA 2DWCA 3F3KA 1Z47A 4XB6B 5A2GA 1J22A 2B94A 1GO2A 1ZYUA 1Q7TA 3L4BA 4MK4A 1IEWA 1XEXA 3R9XB 2QTRA 4I19A 4KZKA 4OP3A 2FU5C 2GCGA 1A5ZA 3ITNA 2OBXA 3K92A 3LX6A 4JC5A 4KFCA 3DMGA 1QQTA 3KR1A 3ZBUA 1FLNA 3VMMA 1W4BA 3A70A 3EE6A 1QZZA 3IQDB 1BS9A 1FSSA 2AOUB 1TLFA 4PSCA 4YQFA 4M3NA 3JVUA 2DT5A 1QE5A 2HHLA 1EFVA 4LECA 1R6AA 2ATVA 3KOMA 1O8CA 1B0AA 2H31A 3PHGA 5EHXA 2OK7A 5KNDA 1NJ5A 1AMNA 3L1HA 4KO4S 4UOZA 1DBQA 2GVNA 4P0PB 2HJSA 3KQVA 3LCJA 5CNIA 2XMRA 7YASA 1B16A 4FMDB 2HCFA 5LKAA 4M9ZA 4AG3A 4KYUA 3U6KA 4JJ7A 5BMVB 1JMKC 2DLCX 1T8SA 2XGSA 2OHFA 4CM5A 2V8BA 1FFDA 1LF5A 3HXPA 3EDYA 5AKEA 5B3AA 4AY2A 1CXZA 3R3UA 2A57A 3LMKA 2PJRA 2DR3A 4JJAA 4UD2A 5DV9A 5LYJA 3CLVA 3WKBA 1U2RA 3LI2A 1ZG3A 2GA8A 1OA0A 2Y1KA 2OFFA 3D9QX 3HABA 2VTEA 3GBVA 5KAMA 2AJCA 4ACBA 2HXSA 4UMDA 4BKPA 5JPDA 5I9TA 2IU0A 4AL4A 2M98A 3CZ5A 3PF8A 5TPWB 1CQZA 2FUKA 2C7VA 3CR3C 4WOCA 1TI7A 1BCRA 4HUQB 1NURA 2ZIVB 2R1TA 3B8EA 1OFIA 3I2GA 4EFNA 2AUMA 2D0DA 1E1QD 1Y63A 5A03A 1NBME 1NRJB 2FH5B 2C2YA 4U4AA 4AYXA 5KMGB 1GGKA 4O4HA 1L7NA 3BGOS 1RQ2A 3NFYA 2D62A 1DC4A 2B1RA 4COKA 5K2OA 3A4MA 3LY7A 5C8YA 1PNQA 2CMHA 2N0SA 1F5NA 4Z53A 4RTNA 4LHZA 5BQPA 4QECA 3L4BC 1RLMA 2PGDA 1TJPB 1CY0A 2X0FA 3P9YA 5L3VA 1UAYA 4KN5A 1KPGA 3HLKA 1DWQA 1SC9A 1ZN2A 1X8KA 4AP5A 1MB9A 5BSMA 4B71A 5LQDA 1ISSA 5AW7A 5FO0A 3VH1A 3FHLA 5C1OA 2WTEA 5ALXA 3F3SA 3NYRA 1AVTA 4MA4A 1ZGAA 4M8IA 4TM8A 4N3AA 2NUAB 3IQFA 4D8YA 2HV9A 1FBNA 2B3DA 3MIZA 4FBLA 3R6TA 1YL6A 3V32A 3NT4A 1R0SA 5F98A 4OHFA 3KQOA 3V1MA 1IUKA 1X7GA 2ADMA 2WYWA 3BXFA 3LW7A 3O8QA 2NXCA 2VDRB 2COKA 2HKIA 4MS3A 3PSAA 1ZCBA 2H57A 5DIZA 4CMJA 1N9GB 3DOUA 4OYLA 5D5QA 4FGUA 4RACA 2IFTA 3OZTA 3A37A 5B3LA 3D1LA 1BOOA 5BV2P 1GYRA 4K8RB 2QUZA 1ZGBA 4P3XA 3TRIA 4LZZA 1GZ4A 4FYVA 3ZE8A 2I2DA 2Y77A 5CB0A 2VKQA 2LW7A 5JVDA 4ZOLB 2CHEA 4Y1GA 1F12A 3QV1A 1Z7GA 4IJUA 3JQPA 2VZEA 3PCXA 2FQWA 4DDTA 4BWVA 3IUYA 4RM3A 2DYKA 1RWMA 1FLAA 2WB2A 2ZR8A 4PBTA 2R5NA 4TXNA 1L8OA 1GIAA 1AKEA 1Z2PX 3NHUA 5BN4B 1JAZA 4ZGBA 2ORVA 2UU9B 5F77A 4LTMA 5KOJB 5KX5F 3GLVA 1GR0A 1KFKB 4JLAA 4II3A 2J09A 4RM2A 2AD1A 4MVJM 4BJHB 2ZRIA 3SZUA 4EKNB 4BO6A 4ND1A 1AZWA 1PL7A 3F46A 2IHUA 2W6PA 5DH9A 1VL2A 1BQ4A 1E8DA 4M55A 5DSZA 3BFJA 4M1SA 2YCLA 4OKNA 5LA6A 1C4OA 1N36B 2FSUA 1GQSA 1W88A 3LQFA 4URHA 3RROA 5C80A 1XN4A 4FW9A 3UH0A 4CIXA 4LDJA 4X66B 1TD9A 3BSYA 5DYTA 4UM7A 2O6LA 1TZMA 2XITA 4XIJA 2V5AA 4HRYA 4TWJA 4JI5B 2ZI7A 3CLUD 1A1VA 4RVUA 5D3ZA 3HO8A 1MUUA 4O2BA 2RH4A 4YT2A 5F2KA 4H18A 3CXRA 1NHGA 4WXRA 5THXA 3LBAA 5K3BA 3AY7A 5C81A 1O94D 2IEZA 3U7HB 1UBCA 1CT9A 2XOKA 3X1XA 2UZ4A 4N48A 3ZY4A 2XQKA 4LHEA 3EQ8A 3H97A 4PZDA 1EFUA 4UEKA 2QN1A 3T3GA 5JSFA 2XQJA 3L4SO 2NU6A 3NIDB 4ZKDA 4F5ZA 3TFOA 2R8XA 4CMIB 1ZOIA 1PZEA 4FI3C 2V8OA 2J46A 5EEHA 1B8NA 2ZVQX 4UNSA 3WGMA 5I9NA 2XKAA 3OI7A 2RGUA 5IJAA 1K1EA 4FR2A 4BGUA 2JVKA 1XZ8A 4P58A 1G3UA 2AFIA 3JQ9A 5ESDA 5C32A 5ADHA 3IVXA 3ROEA 1IL0A 1Y9ZA 4FHGA 1KYXA 1OX4A 4I5FA 5EAIA 3WY9A 2FK7A 1UR5A 2Z5VA 3CWZA 1K5PA 3EXAA 2BR4A 3SHFA 2PRKA 2L17A 4KXXA 3WOVA 4MDFA 3B3FA 4C0AC 3U19A 3UK1A 3QMVA 4ZOAA 5CB8A 3FOEC 4JZYA 5HR5A 5SZHB 1P1IA 4EY4A 1AO3A 2JI8A 2JI6A 2XT6A 3P0RA 4Q24A 3WADA 5MF6A 2BYTA 3QU5A 1RBZA 4HGOA 3LE8A 1GILA 3FRIA 4OSOA 5DHPA 2C96A 2Z08A 2AOVA 4B32A 1FF9A 5JCJD 3WGQA 4IUYA 3ZU4A 3GNQA 4RA6A 3ILSA 5LP1A 3ZE2B 1N7GA 3GI1A 1DXHA 3H11A 2ZB7A 2Q5HA 3MGGA 4OQNA 5I7AA 4AU1A 3QFRA 5K6TA 1F14A 3UHAA 4AO7A 1FTYA 3LWDA 4RV9A 4CT5A 4R8KA 2YASA 1BCSB 1I33A 2MINA 3Q15C 4B83A 1YDFA 1IJKA 1DS6A 1VG8A 2X7HA 2FF5A 4ZI3A 1J2JA 1HR0B 3QXGA 4ESVA 2CW5A 3EWSA 1A5SB 1CF9A 2EBHX 3ZH9B 4FFBB 3OCUA 4FMDF 2X0EA 2J32A 4BZQA 4UE3S 1U0OC 3DT8A 4AJ4A 2YWRA 5BMVF 1EZZA 4H4DA 3U44A 4X8OA 2IV2X 1JFFA 4EPVA 1Y5RA 2HSWA 4MHOA 4Q9NA 2RONA 4QHYA 1C8BA 5KHAA 3ZCXA 3G8YA 4CDRA 3VU0A 3U4QA 5A2QA 1P5FA 3WMRA 3QBVA 1VQ1A 3D64A 4D5GA 4F71A 1VHTA 2P6PA 1ZR4A 4N3GA 1TIKA 3D8BA 4K86A 3SYTA 4F04A 3IDQA 4L8VA 1RZRA 4EAAA 3IIMA 2OCBA 1GA6A 1TZ2A 5E9JA 1KFCB 1MF7A 4TWAA 1I24A 1OVMA 2JCVA 4BCCA 4BQSA 3TSAA 1WG8A 1U2DA 3AEYA 4C1BA 2ETXA 5A5GA 2BMAA 1SY7A 1YK1A 2JCXA 1IZYA 2JHCA 1OGYA 2DTDA 3OF3A 4IH4A 3PXXA 2C99A 2ACWA 3DW3X 3IBSA 2GRJA 2JLRA 2YYSA 1JDBB 4WOPA 4AQ7A 4OQ4A 3RKUA 4ZMBA 1OGIA 4ROSA 3GT0A 2CJYA 4IOKA 5G2OA 3ZGLA 2QW0X 4HCJA 1HDXA 1YZLA 1CS4C 1G41A 1QO0A 4BB5A 5JTTA 1N1GA 3AO0B 4RESA 1NSYA 2HZBA 1SXJE 4Z4GA 5HTOA 621PA 4UAGA 4RZIA 1XRJA 2A5YB 1YZHA 1JKXA 1K2VN 1E1YA 1YHYA 2HD4A 2QRKA 5FI0B 5ILQA 3UAZA 3RRNA 1ENYA 1GQRA 3S8EA 4A15A 1KPHA 1VSQA 5B1SA 1JA1A 3DP7A 3UHJA 1C1DA 1CY6A 4K46A 4LTNA 5DX1A 5CIQA 1QGAA 2ORIA 3N58A 2X58A 5C31A 1D6NA 1UBSB 4DLLA 3I1JA 4BLPA 3VPHA 3CUVA 2G1PA 1EVZA 3L82B 4E33A 4L8WB 1NJ6A 5I7OA 2Q49A 3ZLVA 5KYXA 3VNAA 1A04A 4HRAA 4C7MA 4DTIA 2J3DA 1UOPA 2APJA 1A9OA 3QP9A 3WLSA 2IF2A 1CDEA 3UUWA 2YYYA 3FWPA 4RPJA 1A9XB 2NUBA 3WAKA 1MTZA 1ODFA 1C3OB 1SELA 1IU9A 1BYIA 3CE6A 4IHJA 1ZA2A 1MEOA 2YZNA 3DCJA 4R9NA 3IC5A 1JRLA 3HFGA 1XPUA 2V9CA 5C8VA 3S68A 4KIGA 3EMVA 3MHTA 3OLVA 2LIPA 3PJEA 3ILYA 1IRXA 3E23A 2PEYA 4HDAA 121PA 3WGGA 4E5SA 3C14C 4W63A 3IRUA 2R1VA 2RJNA 5IN4A 5LIRA 1K6JA 3HWRA 1FRZA 2KI5A 4MRSA 1HNWB 1JI3A 4HFRA 4FDMA 2H17A 4JLWA 5EXTA 4YFVA 5DXAA 3T35A 1KETA 2PFKA 4QYWA 3R76A 4COOA 1S6YA 4I4TA 2XJ9A 1U2DC 3CRMA 3RDPA 1HLDA 3SN6A 1LPOA 3EC2A 1IVNA 1NGSA 3EQ7A 4Q4HA 4ZOLF 5FT9A 4D6PA 5JYCA 2CFCA 3DBOB 1A9SA 3VR3A 2PSHA 3PYLA 4MINA 3WBBA 4QOSA 4B3SB 3SZ3A 3GLHB 4LDAA 5JRJA 1G5FA 2WNIA 5F2NA 1EFTA 3HJFA 5AKYA 4R98A 6LDHA 1LW6E 5F3WB 2X86A 1RSZA 2XD9A 1E59A 2Q1TA 4I7EA 1LVUA 5F1OA 3RBVA 2OAEA 1RAHA 2OQRA 4GI1A 1G8YA 4PC2A 4Q4CA 3BAZA 5DBGA 1PGOA 2IEDA 3G1UA 3ZK8A 3F7TA 3EY9A 2UXBB 1RRKA 4LY3A 3QVTA 4MZXA 4BX0A 3EAFA 1LNZA 1K3UB 3KBOA 1WD5A 3O6VA 2EGHA 4WZBA 1BKYA 4HO1X 3LWZA 5T4HA 3H2HA 2XF8A 3QXHA 2E4WA 2JZOA 4LYDA 3R5TA 1T3SA 4DXDA 2TYSB 3VU9B 4IDHA 4H7DA 2OBNA 4FPXA 4LE1A 4Z1MA 2YMMA 2IK8A 4FQ7A 4IYJA 3STWA 3HBMA 4EVQA 4QL3A 5JDIC 1T1IA 1P39A 3FTQA 2VYNA 1OBHA 2NZ2A 5REQB 4NV3A 2O1XA 2H9IA 3L7LA 3BMNA 1ZLXA 4FOLA 4JXXA 5GQSA 1V1RB 3K5HA 3ZZMA 4WV3A 4YAGA 3CJRA 2W4QA 1TJNA 2CMFA 2HHHB 4MUFA 1D2CA 1ONNA 2EZ4A 1DXOA 2VR1A 2WHXA 1P73A 2JFGA 3A14A 1UINA 1A5BB 5BWMA 3WYCA 3GN2A 3E5MA 4CKXA 1TVKA 1WULS 1G4UR 4V0MA 3TGWA 3P2MA 3UC9A 3MT0A 3K4HA 3ZWOA 4BNXA 1HG1A 4D4IA 3AF6A 1EE2A 3GP3A 4TMXA 3DV0B 3IPLA 5DF1A 4EVSA 2JD0A 1E6LA 1J99A 1O2DA 5DOVA 1UANA 3CQ9A 4JOQA 3WLKX 4DLNA 1DVRA 1ZISA 4M53A 4B2IA 1WCWA 1DQPA 5ALMA 5FJIA 2DEUA 1Z8NA 1HK7A 5IULC 2GZAA 3LRTA 2PVPA 3NWJA 1ORDA 2I4MA 3AUKA 3FWHA 5HFNA 4DT1A 2NSYA 5E1MA 1YCDA 1XDZA 3KKQA 2LVBA 2VPQA 2YWHA 3DEHA 5AVVA 2VAVA 4G5HA 3LUFA 2B6HA 4LN1A 1BVRA 4W1RA 3DM5A 5EQTA 2CJPA 4KQ2A 3DZJA 3PNKA 1K63A 5H80A 3TQHA 4AZTA 1Z37A 4NCJA 2J9FA 2ZJ5A 2K7FA 4L6IA 4B44A 3HZOA 3IEXA 1OMOA 3P7MA 1ZI6A 2NVWA 4EDHA 5I7RA 2COEA 1TFUA 1KSFX 1ZJJA 5HIKA 1ESMA 2XBUA 1JG7A 3BFPA 2RIRA 3V34A 4DMUB 1V43A 3AERB 3QFTA 4W5QA 3KXPA 2Z8XA 3PV0A 5EPEA 3D2CA 2O7NA 1QFJA 4Z7QB 4E2YA 2IIQA 1I4DD 4JUFA 1JDSA 1XTKA 4CKWB 5FI3A 4RPIA 4YJKA 3T1HB 5AK0A 4WOBA 2FX5A 4Q18A 5BPFA 1BEUB 1OXMA 3CY6A 5B1YA 4YCSA 4Y1RA 2V58A 1G3RA 2IZ7A 1EP9A 1NIPA 1G59A 2NM0A 2R9VA 3ECAA 2PQ6A 1MOZA 5KSOA 1MQSA 4MGKR 1Z62A 1BN7A 1XXHB 2P2CA 2XTNA 1VBNA 3BX1A 3L7DA 4IFBA 1CW2B 1OFTA 3M34A 2OXEA 1JMYA 2C7OA 4PG6A 2K2QB 1BD3A 4QQRA 4E4YA 1GP2A 3VH2A 1Y48E 2BP7A 2WU8A 3PGXA 2RI6A 1Z5GA 1YAHA 3NBMA 3TLEA 4TMVA 2RE8A 4HNAB 2POQX 3B1VA 1IY9A 2J9RA 1EBUA 2DBVO 4HEQA 1BQEA 2O59A 3AM3A 3S1AB 1XRMA 2QGFA 2WSYB 3BEDA 5DN6D 3CTPA 4MYTA 3IPCA 3U9SA 1JDVA 1N6HA 1QQ7A 3H04A 4CQLB 3CF6R 4G5FA 4N9QA 2J3MA 4ZAVA 1LWOA 2AFRA 1XVLA 4JR2A 2QXYA 4MV5A 1NX6A 2X2FA 5IH3A 1K7SN 5INTA 4KPUB 1L9KA 2YVLA 3W4JA 3G5MA 3T1YB 2O2YA 4FOSA 5EVCA 4AG6A 4B1FA 4G97A 4NCIA 3AGQA 4FGKA 4JELA 4NU5A 4PV7A 4TTIA 4XR4A 4O4LB 4RK1A 3LRXA 1Z36A 3D0KA 2BGWA 1RXWA 3KHSA 1FNNA 4WQMA 5IAOA 4TQAA 1UT8A 1POXA 1C7FA 4ZEXA 1ZBQA 1GKLA 2DPHA 4E5DA 2B36A 4XX0B 1U2PA 3LC1O 1SUFA 3FVQA 1A4RA 5KYKA 1VJ5A 2X6RA 3LQ4A 1P72A 1ZCAA 1HRDA 1FVFA 1H8ED 2FPIB 1RYZA 1FOEB 4C7VA 1I0IA 3RANA 5FA6A 2UXDB 3NU1A 3GEIA 1AK2A 5KJ1A 2VUIB 4EB0A 1X6VA 1SWWA 2J8ZA 3RTCA 4DBLE 1YTUA 4AY6A 1BMTA 3UXMA 3FCXA 1SKYB 5ARDA 3B6MA 4PCUA 2IDKA 2WFZA 4HQRA 3DV9A 1LPBB 3NHLA 2PNFA 1HMYA 1C41A 1XJ5A 1D1TA 1XVIA 4O02B 1WU8A 3AI3A 1C1XA 4HB2A 2R86A 1QYIA 3IX7A 1H94A 2OLEA 1BDIA 3ABQB 3NBQA 3U1TA 5IASA 1RQXA 3MJVA 2MOKA 2WAAA 2BMDA 3V6MA 3TE6A 4MRMB 5TX7A 1VE3A 1ZL2A 2W6IA 1T2CA 3CRNA 4ER6A 3AX6A 2RGGA 1XNGA 1TLTA 3ND7A 3GEMA 1NQUA 5CT9A 3TKYA 2CV2A 5TV2A 5E1BA 3K7EA 1PTJA 4ZOCA 5EZ6B 3KB6A 3RYIB 3X2FA 4JLUA 4NV1A 4R5HA 2QG4A 4PIPA 3HRKA 2C00A 1U1DA 2H7XA 3ESQA 4P3NA 4RMJA 2HADA 1MU0A 3NGXA 2YJZA 3NTUA 3Q98A 4LGMA 1NMZA 4UVDA 4D98A 1JB1A 4B6QA 3TF5A 2XECA 2P3QA 2A9OA 1GKIA 3EUWA 3MWGA 4L2IA 4LJ9A 3WP1B 4N0PA 1HQCA 2CFIA 3NKFA 1V6CA 2QX4A 1B15A 2R2GA 4I8XA 2P65A 1OBOA 4I55A 2C7RA 4BFSA 2Z6UA 3U40A 1E6CA 3VVMA 5HRCA 2YXBA 4TL6A 3HFRA 5FEMA 3SI7A 4CUJA 4Q1AA 3DMFA 2E4ZA 5JMWA 1ZS9A 1EH5A 1Y4DE 2PKWA 2GN9A 3BZBA 1VJCA 2DH6A 3DMRA 1ZHFA 3A3PA 3DVAB 3AEQB 4KFUA 4RF2A 1D0SA 2VHZA 4YK7A 3H3JA 5IVDA 3GUCA 2ES4A 1KDPA 1OYYA 3PQ6A 4HSGA 4CEHB 5AKGA 1BYUA 4HLUC 1XQ9A 3BQ9A 3F74A 5GZ3A 1GGNA 3TPCA 4DV2B 3A31A 1VI2A 3B5IA 2AG1A 1H3FA 1KI2A 3D6NB 3DEFA 3G2QA 4Q48A 1NULA 3FAZA 5HFJA 5GVSA 1GPBA 1P9RA 3CUWA 3HEMA 3L7MA 4TL9A 1ZW6A 2XMGA 2D1QA 3D7LA 4ANFA 3QIAA 2OYSA 4FYKA 1MB0A 1ISPA 4KOEC 3UKDA 1IN1A 1WCIA 1NONA 2KBFA 3DVRX 1ZUWA 4F12A 3M6WA 2KE5A 1JG6A 1G1AA 3K15A 2X1MA 3AFOA 3DF9A 3PZRA 3V5NA 2OO5C 2IEYA 2JGEA 3RSLA 4ZZ2A 5C34B 3VBEA 4WD3A 2G4VA 3WKAA 2QV0A 1XTUA 1CQXA 1J9ZA 1KOFA 3EASA 4H1HA 4MWGA 2ZTVA 2DQKA 4OO3A 3FJYA 4P2BA 3PENA 2VS1A 1GLNA 1BG6A 4HDMB 4URWR 2HJRA 2DY0A 5BNIA 3WK4A 1PTJC 3C4VA 5FWXA 3IT3A 1AGXA 1PNTA 3CLTD 5LUAA 3H9BA 1CHNA 2JCBA 3QUBA 2DTXA 2C04A 5P8WA 1QGOA 4BVHA 5E2BA 4B79A 5G02A 3ZD7A 1QV9A 3BZWA 1Z0FA 1CP3A 1A4UA 1VB5A 3PKZA 4RSRA 3AR2A 1T2AA 3UJ8A 3WLPA 2Q6VA 1YFJA 2HA0A 3LUPA 5JUWA 2PX8A 4CNQA 1DCFA 1RZVA 3WK5A 1TW2A 4M49A 1QLHA 3PXAA 4FSXA 1NJGA 3BYZA 1CUZA 5K2MA 1WPRA 4EZIA 4W6ZA 1A7AA 1BMFD 1UDAA 4NATA 3DD1A 1A5AB 4LV8B 3ADKA 2A86A 3EXEA 4L15A 1X1TA 1T24A 4E2ZA 3NRBA 5K99A 3QU4A 1WQ3A 4O0MA 2PK3A 3F4BA 1EUZA 1OKKA 4HJXA 1LNQA 1NI4B 2WW8A 5CVUA 1V8OA 2WA1A 2CFRA 3V42A 4I9HA 2C29D 1TYDE 4CIBA 4WKCA 1UPCA 2YZ7A 4XPIA 4I3HA 2MYPA 3JASB 3VOBA 4D8WA 1QFZA 2Z1MA 4CKZA 3UJ7A 4MHTA 4RYDA 2QGNA 3IXMA 4M0UA 2A4KA 3X1ZA 3INGA 4NONA 2ZS8A 4EJ6A 3TBKA 4BGDA 4ZEMA 3NXKA 3GCWA 4EHHA 4LUCA 2JAWA 4ZYLA 2CF5A 3HL4A 2R6FA 4RTJA 2BR5A 3C15C 5DLDA 3DB2A 4MKRA 3EJ6A 1FCJA 3PFIA 1N9KA 3P4YA 4P4SA 4FOOA 4R5MA 5HIAA 4K2AA 1Y6GA 1UL1X 4IQ0A 2GASA 3QVMA 4FP9A 1CRLA 4U2GA 3SC6A 5ITVA 3RC8A 4Z9XA 3BXHA 1SBZA 1FXWA 1K27A 5JAQA 4P83A 3MS7A 4KE8A 4YDSA 3M9LA 1W7AA 1Z88A 4OKIA 2ZAMA 3OE4A 4IV8A 2OKGA 4G09A 2QT9A 3P5BA 1HDGO 1JFVA 2P4UA 1WVIA 4A7PA 2H4WA 3O4IA 1V47A 4YRTA 1J00A 2GCOB 5DGIA 5AQEA 1L5NA 2R25B 1YB4A 1WY7A 5HKBA 3RASA 3SEQA 4PSAA 4EI9A 1E5XA 1D4ZA 4WXMA 3PC7A 1DQYA 4M0PA 3NUZA 2WTBA 5HF8A 3KB1A 1E5QA 5KNCD 3WG9A 2GEJA 4UMVA 4O4LF 2DULA 1TYAE 2LZ0A 1CR0A 2W42A 1NUHA 1PHRA 3GP8A 1G64A 2H4YA 1YR8A 2X3FA 4WCFC 1EG7A 1O97D 2CMGA 3IA2A 2HREA 3SBEA 2IIBA 4IWXA 1WV1A 4YAUA 2AEMA 4PY2A 1BXGA 1P6UA 3TEMA 1KGDA 1VHQA 3GLHE 1LK7A 4RIFA 4C89A 5EG5A 1U5BA 2EC5A 2C8LA 4KKXB 4CMEA 2TS1A 4EYSA 3ZN2A 1EWTA 3TH5A 4B6SA 4QRIA 4C5CA 4FILA 3D4BA 3PLAE 3IR5A 5JS8A 4ZT6A 2ZTHA 4CTNA 1QIEA 2ODTX 3HE3A 3NI2A 3HKDB 1HI9A 2OILA 3GQVA 3KSAC 3B9PA 1GG5A 2Q8QA 4NK5A 3MUOA 2O8BB 2O4CA 5LBIA 1OAKA 1EVQA 2QORA 3PXUA 4EW3A 4WA8A 5C8ZA 5D5HA 5K0BA 2EP5A 2HIMA 3QA9A 4RADA 1KYWA 4KUHA 5DO9A 2VEDA 3GGCA 4BO8A 3EEQA 3AB8A 3KOXA 3KJZA 3OF5A 1KI9A 2FOXA 3NAMA 5K3EA 1E20A 5EIWA 4ZZ3A 2PGNA 4JQOA 1YZQA 1RPTA 4FQ8A 2DKOA 3K32A 1BMQA 4OQDA 1RCFA 3CZ4A 3OX4A 5ALSA 2BMFA 2WKRA 3G5UA 5E7QA 4DV0B 4KE9A 1FS5A 3VVLA 2V0NA 2O8FB 3H9UA 2WD7B 3ADPA 2C2GA 3RYTC 4IRUB 4OA8A 3GMIA 4RVDA 1GWNA 2I3GA 4G9EA 2WG2A 2B7BA 4M60A 4AKSA 3UMFA 1BXKA 3RHTA 1QQ6A 2XCTB 3BREA 2K5UA 4Q3EA 4QLAA 4RA9B 2BCGY 2H5JA 2PL9A 1KKLA 2WMNB 3PF9A 3PHIA 1WUHS 4H3VA 2EZTA 4GNRA 1LKZA 2IUSA 2QSYA 4PS0A 1UPUA 4AZVA 4WZ6A 1C0LA 1DNPA 1IN8A 2WLTA 4LGCA 1QV6A 3BDIA 4CIYA 5HUJA 5U1PA 4HWGA 5GAJA 3HDQA 4Q4JA 5CX1B 1CR1A 2HK6A 1O58A 1W93A 4AAYA 4NENA 2IYYA 5KU7A 5IWAB 3N9IA 3SFTA 1VLHA 1P2VA 2VNKA 2O3RA 4DCGA 1A72A 2XVMA 5HIIA 4HTAA 5JD3A 3H2GA 1B8UA 3COYA 2FN9A 5FEUA 3SBXA 4BKMA 1BS1A 4CE6A 1AZSC 4OK5A 1S5PA 2JAOA 1S8NA 4L5YA 4CLEA 4ZGGA 5BYKA 1Y37A 3MOIA 1JVNA 1LXCA 5IUKC 2DXIA 1QG0A 2AQ8A 1Z06A 3RS3A 2QD1A 2ZZMA 1JG4A 1M6NA 2O0HA 4DCNA 2AFVA 2XGOA 3ELBA 1IG0A 3RLIA 3V1NA 2X5KO 1D1QA 1XWFA 2CMKA 2WPNA 2EP8A 1H8HD 1KC3A 3OEWA 3QLTA 4OGLA 4TMWA 3LNTA 4Z4FA 1R9GA 3QVGB 4EJMA 4UW9A 2VT7A 1G20E 3ANYB 2VPTA 4BJ1A 1PZHA 4D9NA 3WWDA 4YRFA 4DMKA 5K0FA 2QNRA 3ZU2A 3I37X 2P6RA 3ZLJA 3C4QA 3U61B 1V8ZA 4YRMA 5J23A 1EGVB 3OKCA 2NQTA 3R5HA 1E92A 1NBEA 3L8HA 3PBKA 2D6FA 3W7VA 2P1DA 1XXHE 2FY8A 3IP3A 3LPCA 4NEGA 2W6JA 3RG2A 3T7TA 1R9NA 5HQ3A 5KNDD 3TQSA 1AQYA 3GJ5A 2BGIA 3M1IA 3UFXB 3WL3A 2H1HA 1R4MB 3IURA 4QDZA 4HFJA 3CWCA 1CZNA 3ZPXA 4NXNB 4L3OA 2BC9A 3FVRA 4RHXA 3KQUA 5F7ZA 3UANA 5LR6A 3C85A 1X15A 4CF6A 1ONPA 3I2HA 2D2EA 5AK4A 4C20A 2YVQA 4JJKA 2YHBA 3GJZA 2C1EA 3WNVA 1IB0A 2BBTA 3KFVA 1OHHA 2PEZA 2HNKA 4BUZA 1TKBA 2I33A 1G5TA 1U3VA 4NI5A 4Q3LA 3W9YA 1UDRA 1D2GA 2H65A 2IY8A 3R44A 4BPRA 4DQKA 2XDYA 2ECOA 4MQ4A 5AKLA 1TMYA 3WB1A 4XWOA 4JI4B 3GFOA 2J0SA 1SVWA 1V5IA 5TVKA 1Y1QA 4FK8A 2ZS7A 4P93A 1N1EA 2WQ7A 4U1RA 5BYBA 4Z0PA 1H1LA 1KVSA 2ZWMA 5HCIA 2Z57A 5H3CA 3G68A 3U4HA 1QE3A 1QOPB 5EIHA 1GPUA 3EGXA 2I62A 3C4JA 4MCIA 4YRGA 1WP9A 3M5PA 4FD3A 3EIOA 4OQZA 4QDKA 2QBYA 5KNBA 2R3SA 5JQWA 3ICQB 1T4MA 1QJ4A 2Z8YA 3AF4A 4HDKA 4NBUA 5AKHA 2XMDA 1DAPA 1QIHA 1LJLA 2QTWB 3G9ZA 3I04A 3WKDA 1F9AA 2JC3A 2O8NA 1SKYE 4E12A 3B7PA 4RY2A 4CKYA 3OIYA 1EFDN 4PC3A 3N2GA 3W6PA 1R4NA 1PFGA 2JFWA 5I7UA 3OPYA 2FPOA 1QH1B 2WV7A 1AXGA 3DO8A 2WSSA 3KLPX 3MJSA 4A0QA 2X14A 1S3SA 4HQKA 2ZTSA 4LSGA 2NX2A 2C54A 3M6AA 5AJUA 5CIYA 1Z07A 4JYBA 3B1WA 4YUZA 2Z3WA 5EKUA 1A2KC 3AILA 4O59O 3KOWA 3QLJA 4R2JA 5EJ7A 5GJBA 1A8QA 2ZM5A 1F60A 1NXOA 1J33A 4XR9A 2Q2VA 3JYLA 2FEKA 2O5VA 4PXAA 1LVHA 3C6BA 1L1QA 2WZQA 1DJMA 4OIFA 1WCYA 4RMIA 1HYQA 1Y9JA 4MGYR 4CI9A 2HQRA 3EQ6A 3GK3A 4D82A 2A9JA 1ZD2P 3C45A 1ZINA 1DJNA 1I14A 2G8LA 1FVOA 4PSVA 2XB8A 1JEOA 2W6NA 1BDJA 1PF7E 3HCCA 4G9BA 4RJLA 4OYRA 4Q9IA 1PGJA 2ECFA 2F8SA 4KLNA 1E61A 1MC1A 1FFXA 3GVHA 1YQXA 3PX3A 2R87A 4O2AF 5LP6C 3RCBA 5HPYB 1PR0A 5KB3A 1LK0A 2F1KA 1NRXA 3QMWA 1XT6A 4ERXA 3P9KA 1GYPA 1W48A 4QVGA 3R8XA 1VMKA 1ZM2A 3BCSA 4Y2TA 4WBNA 3AP1A 1SWVA 1QHYA 2YC2C 1HLFA 2R00A 3AQIA 3L77A 3OZ7A 4RFSB 4RX1A 4KITB 4XDYA 2W2KB 4XVHA 3BBLA 3FNEA 4QFDA 2HWKA 4J49A 2O7SA 1J1UA 5LD2B 3B53X 3MINA 1NE7A 1V2GA 3UY4A 2ECQA 2FKNA 3ZCTA 3EK2A 4DSUA 1BGWA 3A1NA 3VNQA 2GSWA 2H85A 5JAUA 3N0WA 4J1NA 1KYVA 2PH5A 2EJBA 2QNIA 1XXLA 2RK4A 2BSAA 3EMKA 5K6AA 3CUTA 5DBIA 3OJWA 4FNMA 1AA6A 1T6YA 4B33A 3HP4A 2J0QA 3KSZO 2O2SA 4YB8A 2WM2A 3VKUA 1BN6A 2BTOA 5EXXA 5IBCA 2HH9A 2MMGA 2MSCB 1WWKA 1J0BA 3N8KA 4GP9A 1RYDA 1L7MA 1OR8A 4BO0A 1ZSNA 1JECA 4CLOB 2CLSA 3EGDB 2J3LA 3RTBA 1RQNA 1ISRA 1G17A 4BNMA 1VXOA 4FHEA 5ITSA 1I6WA 5I9SA 1TUEA 2X0JA 5EP2A 3MCAA 3ENZA 3Q10A 4N6OA 2ZUWA 1XRSB 4WZAB 3F98A 5KX5A 4FJ0A 4U63A 2OK8A 3A0RB 2EZ9A 4G4SO 5HKLA 3FPEA 3W2EA 4BRWA 2HJWA 3ITKA 3K16A 2XOKD 1DDIA 4C07A 1DHTA 1U9YA 2NOAA 2V7WA 3BA1A 5JWHA 4BMYA 3P71T 4EFLA 3KZKA 4LV6A 2W2PA 5AW3A 1RTKA 2VXBA 2BKEA 4ZT3A 3PC3A 3JZAA 4ZRMA 2Z4SA 5GPBA 5B5SA 1TD1A 4NEQA 4LGYA 3KSRA 4WK0B 5FHQA 1YIAA 3AHEA 1JHQA 2I8LA 1J25A 3WZMA 5LQAA 2ZS9A 1QIIA 4LRTB 3UJBA 2ZWVA 4W9NA 2YW9A 3HDGA 5T8KA 4MW9A 1GOTA 4DDKA 1DL5A 1G8MA 3QVJA 4NE2A 1WPQA 2VF5X 4NH0A 1T5IA 2MR5A 1TEZA 4YMUA 1MEEA 4P80A 5THQA 4M86A 2FFRA 4Y18A 3T4XA 1GPH1 1E5VA 1Z2DA 3KYDA 4BFTA 1LQTA 2CGEA 2Y8EA 4C7JA 1U80A 3KT6A 3THRA 2WJ4A 4JODA 2R00C 4IR7A 5KYGA 3AL3A 3CZQA 5KC9A 2ANCA 1IEQA 2G5PA 2K4MA 4IS2A 4WBSA 3L02A 4NNOA 4OHCA 5KAPA 1RQ7A 1FP4B 4FFMA 1M6YA 3L9WA 1TJ5A 1LV7A 2Q41A 4GLLA 4ZVNA 4YCLA 2HNAA 1NVFA 1JJAA 4LRWA 1L7BA 2PKXA 1RADA 2HPZA 2E49A 2QZSA 2YYAA 3HXLA 4HDRB 2XKKA 1SXJC 4P4TA 5IDQA 1E18A 2BMVA 2NYUA 2D4HA 1RFGE 1FZQA 2JGNA 4MB0A 1H5UA 2PL1A 3F49S 3W79A 3W2GA 3PR2B 1JLLB 3B36A 2AXQA 2OORA 2IA5A 4RPGA 4ZC8A 5KEIA 1F7UA 2QSUA 5CW2A 2ZBQA 1K7CA 1JIJA 1UC5B 1HZZA 2VF7A 4ZTZB 5E6UA 4ESEA 4JU9A 2D5CA 2FWMX 2VL7A 3QOYA 4QDXA 3LP6A 2CL0X 3GRPA 3LK7A 1E5TA 3EIEA 1NWCA 2WU3A 1EWVA 2CCJA 2F8MA 2PS0A 3HZHA 4G5YA 5EJFA 4KBYA 5ETJA 4KPYA 1LPSA 5DDIP 4DR3B 4OLHA 2P7IA 2VOEA 3AJRA 3KHTA 3A1EA 3A6KA 2GEBA 1E8NA 3ACCA 1JDTA 2DJIA 2J3QA 5L4SA 1PS9A 4NHEA 3AF0A 1B0UA 1B0PA 1WNFA 1NVDA 1XEFA 3SX0A 3WYEA 2IYEA 2B7CA 1ODJA 5LUBA 3QQ5A 2FSIA 2O0JA 4D0NA 1T25A 4EVIA 5I45A 1RZRD 3SMVA 4PN7A 1JU4A 4LZAA 4CEJB 1KTVA 4BRSA 5JAZA 1OF1A 5JMTA 1PW7A 5BMOA 1YB5A 7GPBA 5B2EA 5AI0A 2AOUA 1ZITA 5ED0A 2XJ4A 3EA0A 1W1WA 1B6TA 1MQ8B 1K06A 5LQJA 4K0KB 1USGA 3CH4B 4JBGA 4W9NC 2P2ZA 1QWOA 5ALQA 1A7UA 1EXMA 4U7PB 3QVUA 5FORA 5T8KC 3IP9A 4XWAA 1QU3A 4RANA 5E38A 1Q20A 1A8PA 4QWWA 1LZKA 1OD6A 3MTEA 2NSLA 4XYGA 3VO2A 2QQGA 4NCBA 1NASA 1QB8A 3NHWA 5BMVA 1QO0D 3UJNA 5PNTA 3V48A 2OHXA 4YV0A 2RI1A 4OJYA 2AEFA 3L6EA 3WYGA 1TUIA 1XQYA 3C3CA 2BMWA 3ZHXA 2CWDA 3LC2O 4JX8A 5ENDA 2A9QA 3T7RA 1SKMA 4Q9DA 3HZZA 1N0UA 4U2KA 3RVMA 1W2GA 3ZDZB 4BU0A 1V6SA 1VM6A 2A1IA 2IYSA 4EKGA 3PNSA 1VBFA 2HLDA 3G23A 1QDUA 2XQGA 1U04A 5LWQA 2MCFA 4DSOA 1QYCA 4BCBA 2OORC 4XGIA 4GKJB 3E4CA 3QBDA 1YRQA 1VFPA 3JU3A 2DPLA 3AQ4A 2V7TA 1AKWA 4QODA 1IBKB 4O8ZA 3IH5A 2Q21A 1YRAA 4INOA 3VPDA 3F5SA 5JNRA 1O4VA 1OT5A 3OZBA 3PD1A 2XDQB 4S1TA 1GN8A 5KMGA 2JJ2A 3TAHA 3KLOA 4QUGA 5EHQA 3ZWKA 2GMWA 3A6FA 5D3QA 2AR7A 4AJIA 3OJFA 1DGQA 1YIDA 2VBIA 2CXQA 2W8ZA 2DHQA 3G2MA 2NZUG 3MWDB 3LXUX 5AOBA 1E7SA 1DAHA 4GO1A 3TMKA 1KYZA 3WIUA 4Q7JB 4Z4CA 1YJ5A 2P35A 3IP8A 4K3VA 2C95A 3CLRC 4FCWA 4OLFA 1TLLA 4D46A 3EHDA 4G01B 1M1XB 3T1TA 2NUAA 3MRVA 3VV2A 5FL7A 3VR3D 1VYVA 3V80A 3T7IA 3CLSC 1M74A 4N12A 1E79A 1XG5A 2DFPA 3AR5A 4GOOD 2AMVA 4JVLA 4JKIA 2GH1A 3JV7A 4X0EA 2FI1A 3L2OB 1RHKA 1EUYA 2AN9A 1S8OA 1GXSB 2AR9A 4MWZA 1W29A 3B78A 4FZ3A 4MYRA 1DADA 5IVIA 1COZA