3PK0A

Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
GSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPESLDAIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pk0A00
1VM6A 3TWOA 3VTFA 4CMIB 2NU7A 2I67A 4BMNA 5CDGA 3H5AA 4DPLA 4I1IA 1SB8A 1MB4A 4LMRA 1DXYA 2O3JA 2D0IA 3GVPA 3R0IA 1KY4A 1U7HA 2IZZA 4DL9A 5DOVA 3TL3A 4E32A 2ZB3A 5L51A 1ZCJA 1I2ZA 1KVQA 3GN1A 3DHYA 4YPOA 1E1LA 4XIJA 2AA3A 2IZ0A 2V6MA 4FFLA 2JCYA 1B7GO 3FSRA 3MTJA 3WWZA 3M2PA 3AI2A 5AXDA 4RDHA 1MG0A 3WLEA 3C7CB 1HSZA 4BKRA 1A4IA 4FOOA 4HX5A 1PJ4A 1FF9A 4ZA2A 1EEHA 3GPIA 1SEPA 1GU7A 1YBMA 2W2KB 1ULSA 3AUUA 4FFNA 4CMGA 3RASA 2C29D 4BMVA 1E5LA 1PWZA 2C54A 4W7HA 1PS9A 4BNVA 5EERA 4FC6A 1Y8RA 3HB5X 4BQRA 3IKTA 4MP8A 3DBRB 3WG9A 1KC1A 1B15A 4XD2A 5EN4A 2FPIA 3I52A 4CM9D 1DJQA 1ZSVA 1XHLA 2FSSA 5H83A 3TDKA 4BB6A 4E5YA 4AJ1A 4B8ZA 1SO8A 2GDZA 4TRNA 4FW8A 4TROA 8LDHA 2PZKA 3UAGA 4GI2A 2WYUA 1E6WA 3DZFA 1HZZA 1EQ2A 1YS4A 3L9WA 1L1FA 3JD0A 1FMCA 4IQ0A 1ISMA 1PR3A 2IXBA 2BGKA 1ZK4A 1H6DA 3IP3A 4FD3A 7MDHA 5KWEA 3E8XA 4Y98A 1ISJA 3GRPA 1R0KA 2Z95A 2B4QA 2XXBA 3R3JA 4JBGA 4DREA 3KOUA 2I5PO 3PQFA 1E3EA 1CF2O 1RJWA 4BOYA 2EWMA 4PLZA 2HQ1A 1EQUA 2Y66A 3JQ7B 5L40A 2ZB7A 3HZZA 2PFGA 4OAQA 4GX0A 1I36A 2YV2A 4CV1A 3SC4A 3ZWYA 4BHTA 4HWKA 4XA8A 4MPDA 4EEZA 1E1KA 2JD2A 5EINA 4R3WA 3BMNA 4JJGA 4RF2A 5JY1A 5TF4A 4FN4A 1K6IA 2NV6A 3P2OA 2D8AA 1EK6A 1KEWA 1N7GA 1OI7A 1HEUA 3EGOA 2J3JA 3IP1A 2Y67A 4NBVA 3DHNA 2NVUA 2EHDA 3IMFA 1MXFA 2IEDA 5DULA 3ZU3A 1EVYA 1ZBQA 3GOHA 1BVUA 3MJCA 4KZPA 1Y8QB 4AJIA 1N5DA 3ITDA 1J4AA 2DM6A 4CLOA 4UEKA 3GMDA 4KDEA 3PJFA 4YJHA 2GPTA 2HUNA 1UXIA 3ENNA 3W6ZA 3ZWNA 3V2GA 4MVJI 4CQMD 5TRTA 1YL7A 3D4NA 1JTVA 4YJGA 1PJBA 4JCOA 4RO0A 4GWGA 3C85A 1Z75A 4ROSA 1L7EA 4CR7A 1FDSA 1CJCA 5L7TA 4L4SA 1HDYA 4OKIA 4P22A 3DAPA 3MJVA 1NAIA 1UZLA 3BYZA 1GFSA 1NP3A 1DAOA 1R0SA 5CPFA 3DZGA 1WDLA 2Q50A 2OO5A 5TNXA 4OOFA 4ZGWA 1S6YA 4LCEA 1W6UA 2XPCA 2QYSA 1DRVA 3E6AA 2X6TA 2X5OA 3MWDB 3C1TA 5A9TA 4PLTA 5G0UA 2XOXA 2CZCA 2D59A 4J4BA 4YVFA 2WDZA 1CETA 1M66A 2V6GA 4YRAA 1UR5A 3HDHA 1PQUA 4CMBA 4UVDA 5HS6A 5BNTA 1J6UA 2FP4A 5BQFA 5KVVA 4R5MA 4TRJA 1IOLA 4HFRA 4R16A 3TOZA 4BO9A 1MX3A 2AXQA 3WX0A 1VLLA 1XSEA 3DBRA 3HFSA 1Q2XA 4CM3A 2VUTA 2DBVO 4EDFA 1HE5A 2TMGA 2RH8A 4K26A 5T5QA 4LW8A 4DIFA 2PNFA 3Q0EA 1R6DA 3CTMA 1BW9B 4ND2A 5F21A 2GLXA 4JBIA 4PLWA 3TNLA 1LI4A 3D0OA 2J3HA 2R00C 4J6FA 4LMPA 3RFTA 2JD1A 3I3OA 1YBVA 1PX0A 3WICA 4CUKA 2JFGA 2P68A 4RVDA 5G4LA 3HDQA 4RVFA 4G2NA 3I9MA 1P33A 3GVCA 4B7UA 3DOOA 4L0QA 3QVTA 5JSFA 1GAEO 4M1QA 5JMWA 5EMHA 4R68A 2CF5A 1PQPA 2JD0A 2B5WA 2PV7A 4A03A 1ZW1A 2VT2A 3GNQA 2ZTMA 3PZRA 1XIVA 3S55A 4IDDA 4JGBA 2PGLA 4JP3A 5DF1A 2I99A 4FDAA 5DCUA 4CUJA 5B4TA 4Z0PA 1T2AA 3E5MA 1HYGA 2VOJA 2B4TO 3R6DA 1PIWA 4A7PA 1UZNA 2GN8A 3STHA 3IL2A 4YCAA 2UDPA 3TPCA 2A4KA 3GG9A 4WLEA 1GUZA 4G5HA 4QSMA 1NPTO 3WSVA 3LLVA 4Q3CA 2QIOA 3HDJA 1AXGA 1E7WA 4R54A 4BNLA 5KKAA 2H1SA 1E3SA 1WWKA 5DBGA 4ZQEA 5TSDA 3ROPA 3RUEA 1YL6A 4ND3A 2IXAA 1FDWA 2OFPA 1I2CA 1PZGA 4RVGA 1D3AA 2DLDA 4XQEA 1UUFA 2VHVA 3CMMA 2GCGA 1GR0A 2FWMX 2FN7A 4D7AA 5A03A 1YBAA 2HMWA 5BNIA 2YQ5A 1H2HA 3F9IA 4AJ2A 1XU9A 1E7SA 2Q2QA 5AXBA 5A3VA 4E0BA 2VWGA 1XYGA 2X58A 3WR5A 4J7XA 3TF5A 1HE3A 1X1TA 2WD8A 2YQ4A 3E82A 4MINA 3TOXA 4F6CA 4JX8A 3GT0A 3KYDA 3OIDA 4TKLA 2VWPA 4YT2A 1YB4A 4L74A 1Y7TA 2A35A 3JTMA 1QYWA 4DTIA 2FRDA 2ILTA 2LDXA 3SJ7A 3INTA 5L4NA 3ZWVA 3G3EA 3SJUA 1GD1O 3VKVA 3WNQA 4J4TA 1IPEA 1DDOA 3I9KA 3OJEA 2RH4A 1QYDA 3TZQA 3NV9A 3JQFC 5FYDA 3B1KA 1YDEA 1JW9B 1CYDA 5JAZA 1I3MA 2OL4A 4J7UA 4II3A 2NTJA 1YONA 5EQFA 4BKOA 4D44A 1IULA 5JCJD 2J5RA 4GX5A 3RUDA 2CVQA 1I2BA 1AHHA 4IXTA 4AICA 1UAYA 4OOEA 2PD6A 5CP8A 1SMKA 3ROQA 5KVCA 2BFMA 4WKGA 5JCXA 2UAGA 1DC6A 3ZV3A 1LDEA 3W4IA 2FPPA 4R1UA 4CMHA 4RZHA 4EJ6A 1YE3A 5B4VA 2X0JA 4B4VA 2NSDA 1VI2A 3ZH2A 2P9GA 3KYBA 1SOVA 4Z3DA 1K2WA 1NAHA 1VJ1A 5KIAA 1LXCA 2QQ5A 4GLOA 4IPTA 4E12A 1FJHA 4IMRA 4GPD1 4YYZA 4YRDA 3WOHA 1P74A 3GZNB 5I9NA 2QW8A 2B83A 3OJFA 2P5YA 3AUAA 3BZUA 3ONDA 2YV1A 4LRSB 3KYCA 1ZKMA 3OICA 3I4FA 3PZBA 5JBIA 3QWAA 3Q3CA 2CD9A 3SVTA 3GUYA 3AUSA 2PKQO 3AY3A 3NDRA 1YVEI 5A1TA 5AQ1A 2C5EA 3AOEA 3OH8A 4E2ZA 3S2FA 4MVJP 1LQUA 3IJPA 3OIGA 4RL6A 3BMCA 3H2ZA 5CPBA 4DQUA 1WP4A 3FTNA 2FY8A 4J9VA 4DWVA 5F1KA 4IS3A 1NVMB 4W7IA 4L76A 3PHIA 5TGDA 4BNYA 1LRLA 5AXCA 4Z0HO 1CWUA 1A27A 1EK5A 3Q9NA 1GPDG 1QYCA 3Q6IA 5KTKA 2EGHA 4GWKA 5GMOA 5IN5A 4BNGA 3H9QA 4DIOA 1BDBA 4KQXA 1H9BA 4PLVA 3RBXA 1E3LA 4R3NA 1I0ZA 4JNKA 4NBRA 3LK7A 3KM0A 4IBOA 1EZ4A 1A7AA 4AJKA 1K3TA 1YGYA 3NT2A 4R1NA 3W8DA 2O4UX 4ND5A 4BNJA 1WXDA 4XRGA 2DKNA 3OA0A 1QXSA 2HMVA 2PK3A 2W2LA 4NH4A 4EJ0A 3DBLB 4O63O 3E18A 4CQMA 2X9NA 5AOVA 3K2EA 3C3XA 4IJKA 2VYNA 1IHXA 4J1NA 1YKFA 3JQ9A 3PYMA 4KP7A 1H94A 1YQXA 3SBOA 4ALKA 5HWSA 5F1OA 1JKFA 4ONEA 1Y1PA 1Z45A 2CFCA 4KMSA 3G1TA 3HN7A 1VC2A 3AW9A 3VH4A 1UXKA 4ALNA 2J8ZA 5CDUA 4P38A 3MOIA 3UFXA 1B8VA 1I33A 4Y6SA 4DXHA 3B1FA 1KEPA 1T4BA 3KHUA 4XDYA 3RWBA 3KUXA 2VCYA 3ADPA 5TT1A 3BA1A 1IL0A 4XCVA 5GZ1A 1U3TA 2JFHA 3DONA 1LC3A 4MVJG 2Y0EA 3JD2A 3MJTA 4GVLA 4S3MA 4XYEA 4FB5A 1LJ8A 2EIHA 1Q7GA 3BAZA 4GH5A 3PEFA 3UF0A 2D3TA 1U28A 3TJRA 1DIGA 4WOJA 1UH5A 3DZBA 1Y5MA 4TZTA 2RHRA 2Y1FA 4NBTA 2UV8A 4GGPA 4XGKA 4MVJH 1D4FA 1O0SA 3R3SA 3RFVA 1DHTA 1IY8A 5KJCA 3DBHA 5HBRA 5G4KA 1OAAA 1FK8A 5TQVA 5TJHA 4EI2A 3DBLA 2BELA 3F47A 3ICPA 4B7XA 1UXJA 4RORA 4JJIA 3WTBA 4PZDA 1QORA 4WNIA 1R37A 2G82A 5G0WA 2CY0A 1XLTA 3IDSA 3B1JA 1HF3A 1M76A 2DPGA 2HO5A 4ZRNA 2A92A 1DEHA 1P45A 2AMFA 4J1TA 3VKUA 1F14A 4YAGA 3E9QA 3RSHA 2EGGA 4J0FA 2AG5A 2CSUA 1ZZEA 3ZV4A 1SOWA 1NR1A 4YBZA 1GDHA 4J1QA 1N9GA 1EUDA 4AVYA 1MC4A 1T1RA 3WQQA 3H9JA 1DSSG 5K6AA 4YT4A 4RCVA 1YJQA 5LC1A 4W82A 1U3WA 4LK3A 4TZKA 4DYVA 3ZWWA 1DIAA 2AW5A 3RD5A 1HT0A 1Q7CA 4OXNA 1F12A 4B4UA 2YDYA 1SZJG 3IJRA 2C82A 3DWFA 3ZWOA 4BO5A 2Q1UA 4R5HA 3ZWPA 2F1KA 2CNBA 4YQYA 1MG5A 3DEYX 1HXHA 3GEMA 3DTYA 4M87A 4BNIA 1I8TA 1KBZA 1MP0A 4PG7A 3DAGA 3VVBA 4CODB 1I3LA 1BXGA 4ALIA 3KO8A 4IGFA 4LCJA 5A05A 1IUKA 4H7PA 2VZ0A 1G6KA 2ZJ0A 3S2GA 1N7HA 3BTSA 1ISGA 1P0CA 1YO6A 4W9NC 2JL1A 1WPQA 4LISA 1LA2A 1ZXLA 3N7UA 5HS4A 1F06A 3H2SA 2VNSA 2Y1GA 5ILOA 3JQ6A 5I7FA 3OMLA 9LDBA 1DIBA 4D3FA 5GZ6A 1Z7BA 2ZQYA 2ZJ1A 2EXXA 3GC6A 2E82A 3BMOB 4JN6B 4DBVO 4PRKA 1ZNQO 3GAZA 4M8SA 4QXMA 1LLCA 5DZSA 2X8LA 1AHIA 2WYVA 3K2BA 1C0PA 3GDGA 1G0OA 1P1KA 4JQCA 3WSWA 4Z3KA 2NACA 3SX2A 5I8WA 5KVQA 3JQ9C 1GYRA 3DZHA 1HDXA 3RROA 1EDOA 2FPGA 1HDCA 2VRCA 3O26A 1H93A 4PG5A 4BNNA 1NPYA 3QA9A 1NQOA 3EZLA 2GERA 2Y1CA 1AE1A 5JDCA 1BDMA 4XGIA 3AWDA 2JKVA 1NQAO 3ONFA 1M6WA 4J1SA 3QE3A 2DTDA 3CH6A 3L07A 5JNLA 2GYYA 1VL6A 3ST7A 4D46A 5EIOA 3A28A 4O1MA 4YT8A 2OP1A 4J16A 1W4ZA 4Y6PA 1GV0A 1EVIA 3IKVA 3A14A 4NBWA 5TS3A 2FR0A 2Y0DA 3OQBA 3WGGA 5JAMA 4D3DA 5IF3A 4E4YA 4FGSA 4GX2A 4HNHA 3WMWA 4WLNA 3DOJA 4HKTA 1EUZA 1CRWG 3S2IA 2DT5A 4WLFA 5C5IA 3P7MA 1XU7A 1BRMA 4CMJA 1O8CA 3IS3A 1DFHA 5TLSA 1ADBA 4PVCA 1KVUA 2JAHA 3EK2A 4I5FA 5L7YA 1ZMTA 3U9LA 2HK9A 1YRLA 3UKOA 1ZIDA 4BNMA 4B7CA 2V6FA 2RCYA 4NFSA 3TFOA 3PQEA 1ADCA 1M6HA 1PGQA 1T2CA 3BMOA 1LLQA 4NJMB 5TJ9A 4NU5A 1H0KA 5BSFA 3GK3A 3MZ0A 4Z9YA 1PJTA 1V35A 4EW6A 4R69A 4YACA 3MTGA 5U1PA 1PJLA 1ENZA 2C20A 4IJUA 4AFNA 3JD3A 3GGOA 1WDKA 3MJSA 3IOYA 4KWHA 5KJEA 1DFIA 4YWJA 4XR9A 4PLGA 1C1XA 1NTOA 3EY4A 4C4OA 2YFQA 4ZHSA 4N54A 4L4XA 2QX7A 3EUWA 3NRCA 3I6QA 4RPKA 5DDIP 3RBZA 1C14A 2X0IA 4YJDA 3OEWA 4GQAA 3JQ8A 3D1LA 5KJ1A 4J3FA 3CSDA 3ZW9A 4CM4B 5A02A 4E21A 4BKQA 2B0JA 2I76A 5T67A 4FIZA 2EW8A 4FFPA 3C8MA 2F00A 2PGDA 1OFGA 4H15A 3MEQA 3FBTA 1MXHA 2P4HX 2NLOA 3F5QA 1OC2A 2GF2A 4RVHA 3LT0A 5CDYA 1W0CA 3B70A 3PGJA 1HE4A 4E5NA 1E6EA 4OQYA 3RKUA 5CEEA 1XQ6A 2X5KO 3H9UA 1RWBA 1JLLA 2NU9A 3GEGA 3CXRA 5HRUA 3G49A 1HZJA 1X1EA 3WGTA 3RAJA 4FGWA 1JN0A 1EMDA 2Y1DA 3EVTA 3TL2A 4YAKA 1MA0A 4CV3A 3ZHYA 1ADGA 5GZ3A 3VPGA 2Z1NA 1JAXA 5L53A 1P44A 5IZ4A 1PR9A 3GHYA 4BNFA 4LVCA 1ZSYA 3DFUA 2PD3A 1RYDA 4NIMA 1DLIA 3PVZA 4RPLA 3NDIA 1PGPA 3UICA 3D7LA 4DQXA 4E5MA 4TSKA 1VL0A 3MJEA 4Q3NA 2E48A 3H9EO 5I7VA 1SPXA 2QRKA 4FJ0A 1E3IA 3PDUA 1A72A 2EV9A 4LVUA 1YJ8A 1I5RA 1UXGA 2OBNA 3GA0A 4K6CA 5CDTA 4JXKA 4BGIA 5CG2A 2WD7A 3OFSA 4QEDA 4TVOA 1RM5A 1HDRA 2JAPA 3GFGA 3GZ4A 3QJ5A 4BNZA 2W98A 3EW7A 4M86A 3SLGA 1BWSA 1K5HA 4L73A 4Y6RA 4YXFA 5LDHA 1KVSA 4MIOA 4NJMA 2VHXA 1LLDA 4I9HA 3VTZA 3ZNPA 1V8BA 1NWHA 4KWIA 3VH1A 3GF4A 4YDRA 1ZO8A 2H9IA 5TC4A 3QW2A 4CR8A 3NJ4A 4EUHA 1NPDA 3ZWMA 2IRWA 3ANLA 1OBFO 5IN4A 1RYEA 4LRTB 4D3SA 2A94A 3P2YA 5HA5A 4XQCA 3VPSA 2I3GA 3LSYA 4AJPA 3V2HA 4OO3A 3T4EA 2X0RA 5A9SB 1PL7A 3WYBA 1V3UA 2X7HA 3JYQA 4KTTE 1WMBA 2P5UA 3RI3A 2J3IA 2CDBA 1Y8RB 1ZK0A 3WFIA 4CLRA 3VPHA 1KOLA 1PJQA 1N1EA 1I24A 1CDOA 1QYVA 4MP6A 1J0XO 1SC6A 1PSDA 1VKOA 5TIIA 5H81A 4L9RA 1U5CA 4D0SA 3QSGA 4DMMA 2OBYA 4MJLA 1E1MA 1EE9A 5ITVA 1Z6ZA 5BSEA 1IPFA 3E5RA 4RDIA 1JU9A 4BV8A 4WLUA 5K9ZA 2GUGA 4HFNA 4U6QA 1SCUA 4BNWA 4BO4A 4HADA 3H7AA 5G0TA 1F0YA 4FFMA 2P9CA 1U5AA 1Y9EA 4PCVA 5F1PA 1GTMA 3FNFA 1MC5A 1Y6JA 4ITUA 4HBGA 4XGNA 2HK7A 1GZ6A 4WJZA 4P8RA 4XWYA 1HTBA 1HDZA 4BNXA 2ZYGA 3N74A 5IG2A 3WXBA 2EKLA 2J3KA 2YJZA 2Y93A 4K1LA 5F5NA 1KETA 4WCFC 3T7EA 5G4KB 5ITWA 1RKXA 1LX6A 4UVHA 1QG6A 5B1YA 3X2FA 4KOAA 3QWBA 2DFVA 1R4MB 2WEKA 3PTZA 5L4LA 2O2SA 2NTVA 3AY7A 3LT1A 4J43A 4BO8A 3I23A 4WUVA 4WCFB 1PWXA 1PZFA 4GSLA 4NDNE 1I30A 3CIFA 1P1FA 3O8QB 3D5TA 3ANNA 2O3UA 4RF3A 3FTPA 5JAIA 1PTJA 1B8PA 1BGVA 5JY6A 2QZ9A 1O89A 2Y1EA 3I1JA 4IDAA 4PLFA 3R1IA 4ZU3A 3HDYA 2CVZA 3OQ6A 1HDGO 3A4VA 3V2UA 1GQ2A 3VVCA 1XG5A 2HLPA 4C7KA 3X2EA 5G2OA 4NFYA 2FMUA 4Y67A 3C7DB 2G1UA 2GASA 4MVJD 5G0SA 4XR4A 4OSPA 2EG9A 1QRRA 3UXYA 1U8XX 1GZ4A 4AJEA 4J9UE 3QQPA 4GMGA 4WLOA 4RVSA 1E92A 4K6FA 4OSOA 3OETA 1T2FA 4CQMB 1ISFA 2BI8A 3QWFA 4MKRA 4Q9NA 4ND4A 4BVAA 5EESA 1BVRA 2FOIA 3PHGA 2G5CA 3JD4A 1ISHA 2YY7A 4HUJA 2O2YA 1DJNA 3TZKA 3D5QA 2P91A 3ZU5A 1ZMOA 4M49A 5C7OO 5I9MA 4CM6A 3W4KA 1R12A 4G81A 3VZQA 2C0CA 3DZJA 2C07A 1YXMA 2VYVD 3I9LA 3JQCA 5T8KA 3AI3A 2NU6A 2OMEA 5JYEA 2AEJA 3RU7A 3ON5A 4OH1A 4E33A 4HP8A 5BT9A 1NHWA 4A27A 4FS3A 4D41A 1ZK2A 1B16A 4NPCA 1PZEA 2WE8A 5COQA 5CAEA 5A04A 5JCJA 4D43A 3RQSA 3U4HA 5DT9A 4CMKA 1Z73A 4Z6KA 3OBBA 4Q39A 1R4NB 4IJWA 2AQHA 2WWRA 2B36A 4IZIA 4AG3A 3O03A 1UP4A 3JCZA 3C24A 2PD4A 3CPSA 5U4QA 5IXYA 3KYDB 3V1YA 3DTTA 4N5MA 4WCFA 1PZHA 4NI5A 5T57A 4CM7A 4IS2A 1B14A 4WEOA 5ILGA 2HCTA 5COBA 2X86A 1XDWA 1PJCA 4XEHA 2D1YA 3SLKA 4HFJA 1P77A 3BMQA 3HHPA 1X15A 3PYXA 4X54A 2Q1TA 3KEOA 3TRIA 1I01A 3I5MA 2HK8A 3ASUA 2GN4A 3K9QO 3OP4A 1GCUA 2H63A 1D1TA 3BTVA 3TN7A 3OA2A 2VQ3A 4BO0A 2YV3A 4CMEA 1ONPA 3NTOA 2GRAA 1ZXBA 2EJWA 1XELA 3PYLA 3ROMA 2JCXA 2NVWA 5I9LA 4FSHA 1V3VA 2FR8A 1ZSNA 4ND1A 2G0TA 4DUPA 5JPIA 3ORFA 3ETDA 1KIFA 1R16A 4XYBA 4YB8A 5K0ZA 1U9JA 3ZHZA 2HSDA 4QT0A 4AJ4A 4ALLA 2Z5LA 4XB1A 2HU2A 6LDHA 3S1LA 2GNAA 4BGUA 4FPXA 5DNAA 4YT5A 5L4SA 2BH9A 3IQDB 1JKIA 2DQ4A 4E3ZA 3GHHA 4PGFA 4HNGA 4I9UA 1C0LA 4MIYA 5BSGA 2DAPA 3H3FA 3EAGA 2ZTUA 4FR5A 4TMFA 3DMTC 1K0UA 3JQFA 3RJ9A 3ETGA 1V3TA 1YB5A 3BHIA 4CJXA 5AVOA 4J2OA 4EEXA 5K6AC 4IQGA 1YDWA 4FJ2A 5C37A 3Q2KA 2FHSA 1EFKA 1GQQA 1ZH8A 3KLPX 4DPMA 3C1OA 1TB4A 3D3WA 3H5NA 1TLTA 2ZCUA 2ZYDA 4M55A 4FCCA 1SBYA 3F4LA 3L0DA 4YAEA 4OYRA 1D7OA 1W73A 4O5OA 3FNEA 4GKVA 4BO2A 4GBJA 1WZIA 2BFAA 1BTOA 1QV6A 1T26A 1ZK1A 2P2SA 2VRCD 3NTQA 4DQVA 2XF8A 4RPJA 4ZD6A 1ML3A 2X9VA 3AM4A 1B8UA 5ENDA 2DTXA 3K30A 3LU1A 4UREA 3QVWA 4U7WA 1UDAA 4YJFB 1TT7A 3DOCA 3OIFA 3VAZA 4B79A 1P9LA 5FI5A 5JO9A 4CM8B 3KYCB 3JQ8B 3FWNA 5ADHA 1E77A 4DC1A 1FDVA 3H9GA 3NEPX 4WGGA 2B69A 4IIUA 2YZ7A 1GZ3A 4GLLA 4KUHA 1HRDA 2UUPA 1F8GA 1F8FA 2VHZA 4CV2A 2E4AA 3PXXA 3JQAA 3EHEA 1N2SA 3GR6A 3ZHBA 1LRJA 3DDNA 3PHJA 5FFFA 1JWAB 3FD8A 1GEEA 4U0JA 5L45A 3KTDA 1XQ1A 1U1IA 2R2GA 3S8MA 2O23A 4XIYA 1LTHR 3W8EA 1QLJA 3K8ZA 2IYOA 4E5PA 4PZEA 1ARZA 4LN1A 2I3AA 3GY0A 1FXSA 1UDBA 2Q2WA 3U09A 4WCDA 4LSWA 4RPHA 3K31A 4F3YA 1A4UA 1ZUD1 1A9YA 1E5QA 1Q1NA 4E6PA 1UP7A 4H16A 2DBRA 3FF4A 1DLJA 3GVXA 1QLHA 3DAFA 1P0FA 2PY6A 3QVOA 1GQYA 3WTCA 3JYNA 4NNJA 3LT4A 3RFXA 4XKJA 1O5IA 2BGMA 3RC2A 1ZEJA 1N92A 1HWYA 1NXQA 3U5TA 4XQ9A 2WYWA 2VZ9A 2RHCA 4CM1A 3PQDA 4KQWA 3OJOA 3TZHA 3WWYA 2R00A 5CDSA 1UJMA 1ULUA 3GLQA 1KEUA 3OECA 4MKZA 3PLNA 3ZWXA 1Z74A 4UVEA 1YB1A 3GG2A 3ZWBA 2X0NA 1DHRA 3B6ZA 4TQGA 4DA9A 4YAIA 1U2DA 1R66A 1TXGA 4RLHA 1DRWA 5BR7A 1M67A 1JA9A 4QUKA 1XCBA 2POQX 4EUFA 1GYPA 4L75A 4XQGA 1E7QA 2DBZA 3KV3O 2PZJA 2BFPA 4BO7A 1AGNA 1ZEMA 3WQRA 1GV1A 4GAEA 5JC1A 1MLDA 1DBVO 2DTEA 4M89A 2X4GA 4RQTA 2BHLA 1CQIA 4OGWA 3HE3A 5L9AA 3V5NA 4B8WA 1UDCA 4B3IA 1T24A 4WECA 2VWHA 2DC1A 4R41A 3GN2A 3HG7A 4HY3A 1LU9A 4YA6A 4BMSA 2PH3A 1PJSA 3UOGA 2C5AA 3I6IA 2RIRA 3O4RA 3PDJA 3QWIA 2AEFA 5LCXA 3UH1A 4MP3A 3FWZA 3UN1A 1DRUA 1WVGA 4CR6A 4U5QA 4YJGB 1KC3A 3IIEA 2NQ8A 4EBFA 2FZWA 3ETEA 4IGEA 5G0VA 1SNYA 2DU8A 4YJHB 1JKJA 5H82A 5HM8A 2DBQA 1TVEA 3G1UA 4QFCA 4Q3DA 1X13A 3JQEA 1ENPA 3GNTA 1K89A 2Q1SA 2HRBA 2WE7A 3O9ZA 3K5PA 4Q3AA 4W6ZA 1PGNA 3VZRA 5A5FA 1IB6A 3DMTA 3PIIA 5TT0A 2P9EA 1PQWA 1B2LA 4RLSA 2Q3EA 4O6VA 1RM0A 2SCUA 1GEGA 3FBGA 5TX7A 3ZWCA 4C7JA 3INRA 2VRBA 3LQFA 3DB2A 1DFGA 4J90A 3GGPA 3AUTA 5L3ZA 2JCVA 4CM4A 4I8XA 1H6CA 5J23A 1G0NA 1P1JA 3UHAA 4A5OA 1DOHA 4MVJE 2VNAA 3K92A 2O3QA 2ZB4A 3MOGA 3CINA 3PPIA 3NGLA 3I9NA 3MJ4A 3KBOA 4TWRA 1VSUA 3INGA 4BQPA 4CMIA 1Q7BA 3JQAB 2Q4BA 4NHEA 1TEHA 4QTZA 1NNUA 2GR9A 1XWFA 1SB9A 1LUAA 4N5LA 4WASA 2C7GA 4IINA 4BKPA 2GZ1A 4NFHA 3WGYA 5MGBA 1KY5A 5MDHA 3U62A 1J5PA 4QO8A 3DL2A 5B12A 2CF6A 5IDWA 4A10A 1LDYA 1HSOA 4YR9A 1ZJZA 4WK6A 1Q0LA 3VDRA 5IDQA 2O3TA 1BSVA 1E7RA 4B3JA 4EITA 3WQSB 5I8ZA 5HTOA 2IYPA 2P4QA 3ICCA 4P4NA 4CMCA 1N8KA 5T8KC 4RF5A 1J49A 4XDZA 3A9WA 3GVHA 5A4DA 1LDNA 4N5NA 4OHUA 4EJMA 4UVGA 3CE6A 2GGSA 3K96A 2PTGA 3V1UA 3ADOA 2GSDA 3GMSA 2NM0A 4BL5A 4HXYA 1CIVA 3PGXA 2VYVA 3M6IA 2Y99A 4ZQBA 1R4NA 1K6JA 2VUSA 1HDOA 3VOSA 1QYXA 3COSA 2O7QA 3NYWA 1HYEA 4LGVA 3ZNOA 3BHJA 1T25A 3RUHA 1LSUA 2VTDA 4JBHA 3KVOA 1SEVA 3FR8A 4GGOA 1PJ2A 4UUMA 3GH3A 3ZU2A 2JHFA 4XJTA 4NG5A 5IZCA 3KXDA 4MIEA 4IIVA 1V0JA 2AQIA 4FJ1A 4YRBA 8ADHA 3M1AA 4AJOA 4IXWA 4NBUA 3F4BA 2VHWA 3JQDA 1LDBA 3NJ8A 2NWQA 1E0DA 3ANMA 3ZDFA 3ZU4A 4BGVA 5CG1A 2Y1OA 4DMLA 5EL0A 1XKQA 4PFJA 1SAYA 5ER6A 3WGHA 3KEQA 1MFPA 4F45A 3C7AA 2YHIB 3E1KA 3EYWA 5KVSA 3LC2O 4KDFA 3FI9A 4YQZA 2J5QA 1E3JA 2HMSA 4UAGA 3LF1A 1O9BA 3TZ6A 1PGOA 5JDIC 1NYTA 3BMQB 4EUEA 5LDGA 3E9NA 2FSVA 2QYTA 3BTUA 4UEOA 3HWRA 4J0EA 4O59O 3A06A 3RU9A 3UCXA 1T2DA 1TA4A 1VJTA 2Q49A 4TRMA 4YJFA 1GPJA 5L95A 3D4PA 5CEFA 1DIHA 5C3MA 3KSDO 1GCOA 3DFZA 4E31A 2W4QA 1E7YA 2YYYA 1ORRA 1U8FO 2OUIA 1O94A 3NGXA 5A06A 1KYQA 2HJRA 1OZAA 3DMYA 1YOVA 5C7IO 3JQGA 4FOSA 4E5KA 1EDZA 1Q0QA 4UULA 1DC5A 3ZZNA 4EZBA 3TFQA 2IODA 3F46A 1OMOA 3L6DA 5ICMA 2EW2A 3WYCA 3G0OA 5A9RA 1BG6A 3L6EA 4RZIA 3KETA 3UCEA 5EQDA 4Z9XA 3D4OA 1RPNA 5B37A 4BO1A 3M2TA 3NDJA 1AXEA 3NT5A 4Y9DA 1ZK3A 4ZVVA 2YFHA 2V7PA 3JSAA 4IUYA 4ALMA 1R15A 1FDUA 4J91A 4BS9A 3CMCO 5THQA 3NTRA 1NM5A 3Q9UA 5L7WA 4CLDA 2UVDA 4IDGA 5JDIA 3RVDA 4D45A 3G17A 3AU9A 4U6SA 3ULKA 2CMDA 2Z1MA 3QP9A 4D0RA 4MVJA 2YDXA 1S7CA 4BUCA 2B37A 3WIEA 2PWZA 5FI3A 3PK0A 2ZIZA 5DCYA 5JXWA 2GD1O 2VOEA 1M75A 3WB9A 4EYEA 3I83A 3DQPA 3AFNA 4JK3A 5EPOA 4QO7A 1E1NA 2EKPA 4NJOA 4OXKA 1BXKA 4DRYA 3HADA 2BF7A 2YHUA 3UUWA 5AYVA 1JDJA 3L4BA 2OGUA 3OHSX 2VTEA 3ABIA 3RUFA 3HNPA 4KUEA 1LBEA 2E6UX 1T2EA 3L77A 2JHGA 3GUCA 2EKQA 4BIIA 5A3JA 4NQZA 3FPLA 1K6XA 1YQGA 1EUCA 3AM3A 3ZNQA 1YQDA 2DFDA 1AUPA 4XZ3A 3O8QA 3JQBC 1LSOA 4Z0TA 4ZQGA 4XB2A 1E3WA 2IDZA 1HL3A 3FPCA 3PFWO 3KRTA 3GVIA 4IJVA 3OEYA 3EMKA 3DXFA 1PJ3A 4HFMA 1R4MA 3U4IA 3PP8A 2AQ8A 1C1DA 2DUUA 2Q46A 4BNUA 1IE3A 1PGJA 5AXAA 3CEAA 3F1KA 1M2WA 3KZVA 4QFDA 5KNLA 3BXXA 4G65A 2IEBA 2PR2A 2ET6A 3RJ5A 3VPFA 1XR3A 4ZJUA 2QHXA 1LDGA 1LRKA 3SC6A 3WGQA 4GSKA 1DIRA 4BNKA 4PG6A 3QRWA 2PZMA 2GN9A 5ES3A 4FFOA 5CHEA 3G79A 3FNGA 4PLYA 3OF2A 3GNSA 1ZVMA 3T4XA 1B3BA 4I9NA 2HRZA 3CKYA 4WOKA 3PIDA 5T6BA 3FCOA 3H4VA 2XXJA 4EGFA 2HKIA 1EBFA 2I9PA 3TSCA 3WDSA 4WLVA 1BMDA 3UW3A 5JYDA 4NMHA 3EDMA 4CL3A 2O48X 3ONEA 1NVTA 3U0BA 2J6IA 5KJFA 1WZEA 2I65A 6ADHA 1VSVA 3AU8A 1NFRA 5T64A 4GX1A 3PRJA 2HJSA 4IM7A 2AEMA 4R51A 2VHYA 4CM9A 4OIMA 5BNFA 5IJZA 4P4LA 3I4CA 4A73A 5JS6A 1RM4A 2NQTA 4MO2A 1HKUA 4BV9A 2CDCA 2EF1A 3HUDA 5IFLA 1D1SA 5FEUA 1L7DA 1LSSA 4ZQHA 3AI1A 1VL8A 5IZCC 1B26A 4XJSA 1TT5B 4W9NA 3JYOA 4ESOA 2TMDA 1EVZA 4J7CA 3ZV5A 4ZQFA 4CLEA 3ITKA 4IZHA 2I6TA 2AG8A 1NFFA 2GZ3A 1BHSA 4NU6A 2QRLA 2O3SA 3RUAA 1NHGA 3EZYA 3OM9A 3VZSA 3WGZA 4PN3A 3W4JA 1NX6A 2ZB8A 1B0AA 1PS0A 4TKMA 3U3XA 2GO1A 1JQBA 1ONOA 4CLXA 1HYHA 1QV7A 1GUYA 3VH3A 3LT2A 4J2HA 1MGOA 2PKQP 2C59A 2C2YA 2D5CA 3RUIA 5I7SA 5JE8A 3F5SA 3JYPA 1P31A 4XYGA 4BKUA 2HMTA 1C1XB 2QRJA 4F46A 2BLLA 3NKLA 4UUNA 3WFJA 2BD0A 2C7VA 1JWBB 3D3EA 4AJHA 4KUGA 2BFOA 2BI7A 3RKRA 5IDYA 2PKRA 4MVJF 5JLAA 3GRKA 1EE2A 4R4JA 3VZPA 4DBZA 1U4SA 4XRRA 4GMFA 2X23A 4O0LA 1E7MA 1JVSA 1XGKA 3RUCA 4E2YA 1IZ9A 1X7HA 3ASVA 3NAQA 4CV0A 3GDFA 3I9JA 5FWNA 4N18A 2Y0CA 1LQTA 4UVIA 2PGJA 5COAA 2HMUA 3FNHA 3RC7A 1LEHA 3CZMA 5JMPA 4ZICA 3W8FA 2PZLA 1DC4A 1H2BA 3BHMA 2Q45A 2QZZA 4K9DA 1LDMA 3QV1A 4CQLA 3CUKA 1PS8A 3GFBA 3C1AA 4WEQA 4E13A 3WBBA 1Y8QA 2WMDA 2ZKLA 4XYMA 1DB3A 3JYLA 1X7GA 1VJ0A 1KVTA 2IZ1A 4F6LA 2BKAA 3PHHA 2V65A 4B3HA 4ILKA 4Q3EA 3ZW8A 1NVGA 4A0SA 3HJAA 3WLFA 1DAPA 5A9SA 1HE2A 3E9MA 3B20A 3VDQA 1I3KA 1BXZA 4HV4A 1BW9A 5JW6A 3BIOA 1GYQA 3SEFA 5DN9A 1KERA 1ID1A 2HDHA 1D8AA 3PLRA 3TQHA 4DYDA 3AOGA 5A5EA 2CVOA 4B4OA 4PVDA 1PL6A 3PJGA 1WAMA 3PJDA 3WGOA 4PLPA 3MWEB 1I3NA 2H6EA 4NR0A 1ONNA 4AJJA 3SXPA 2O4CA 3OJLA 2X9GA 2JJYA 2EEZA 2NTNA 2EERA 3VHRA 2IE0A 4FC7A 3IUSA 5KCZA 2GN6A 3WYEA 5DBIA 4LSMA 1VKNA 1QSGA 3GDOA 4RV9A 1EVJA 3AOEC 1FDTA 2WD7B 3V8BA 3LF2A 5IXSA 3HB4X 3OSUA 2EP5A 4RGBA 4U8GA 5JAQA 2VWQA 2BRUA 4QECA 3QY9A 3K6JA 3D64A 2LDBA 1YWGO 3ENKA 3AFMA 3HSKA 3KB6A 4OMUA 2OOSA 2O7SA 1CEQA 1NWCA 5I7EA 4JP2A 2NU8A 2B4RO 3RC1A 3IAHA 3UVEA 1VE9A 1X7DA 1JAYA 3QVXA 1WDMA 5KJ6A 3NT4A 3WJ7A 4J49A 1H6BA 3E03A 3EVNA 4CLOB 4RJTA 4B4WA 1U3UA 1EFLA 3WNVA 3W6UA 1HLDA 2XAAA 1VRWA 5IDXA 2B5VA 2I66A 3ZWAA 3PWKA 5JO0A 3EC7A 4KTVE 1CQJA 2RAFA 3AJRA 4IDEA 1F17A 1ISIA 2OZPA 3PJEA 3UCFA 1IYZA 4UUOA 4PRLA 4CQLB 1O95A 1LC0A 3BMNB 1UXHA 1PL8A 3ZV6A 4D42A 2NVUB 3WMXA 1QP8A 3DR3A 2QG4A 3QWHA 3W1VA 4A2CA 1MFZA 4DLBA 3TZCA 1NBOA 4R01A 5DP1A 3LC7O 3LDHA 3HN2A 1QR6A 1GUFA 1Q0HA 3H65A 2UYYA 1NASA 4WPGA 3H8VA 4M54A 1DO8A 2E37A 1P1IA 4RF4A 2G17A 2G76A 1IZ0A 1IHYA 2O3RA 3PWSA 2AE2A 2FZEA 3RCBA 2NUAA 3JQ7A 2NNLD 1H9AA 2NVBA 1DPGA 3AY6A 4GVXA 2A9FA 1QKIA 4I08A 4ZN6A 3Q2IA 2WJPA 1MV8A 4MVJM 2W90A 1ADFA 1NFQA 4OXYA 2CUKA 4DVJA 1AN9A 2WM3A 2WTBA 3LC1O 4CM5A 3HQ4O 2PH5A 2DVMA 1BXGB 1PU2A 2FR1A 1A7KA 2D4AA 4OJNA 5DP2A 4CM8A 1JVBA 4GL4A 4PG8A 3GGGA 4XX0A 1R0LA 3ZNNA 9LDTA 4BGEA 3JQBA 3UGKA 4I5GA 2Q4EA 2W8ZA 4R9RA 1MUUA 3DZIA 4AJLA 4E2WA 1WNTA 4CL8A 1TI7A 2RBEA 4NK5A 4OM8A 3AK4A 3QVSA 3VPXA 1TT5A 1XEAA 1U3VA 4JLWA 4RVUA 3LVFO 2PLAA 1LNQA 2AQKA 4E2XA 1E3WB 3ZI0A 3GPDG 1C0KA 1LSJA 3FR7A 4MOWA 4TVBA 1A5ZA 4WE3A 3BTOA 3NX4A 3Q1LA 2X5JO 4BB5A 2ZTVA 2WSBA 3JQAD 4NZ9A 3AM5A 1H5QA 3PHLA 4H3VA 3D3WB 3K73O 2W2KA 3QIVA 4IY1A 1WW8A 3OQ1A 2Q99A 4DGSA 2UUOA 3JD1A 4DC0A 1EBUA 5KKCA 3ZGYA 3PWZA 1U4OA 4NK4A 1UAGA 3LZ6A 2X1HA 4UEJA 1NR7A 4MKXA 4PIVA 4CMEC 3ZN2A 1I32A 4BNTA 4N7RA 4PZCA 3RIHA 5CEJA 4Q3BA 1GADO 3GAFA 4W99A 1O6ZA 4D79A 1OC4A 1X14A 4GKBA 5ICSA 1H6AA 3PI7A 3M1LA 4I5EA 4AJNA 4E30A 3FN4A 2Y68A 4QX6A 2DPHA 3DHEA 3U4CA 1XA0A 1Z7EA 5JDCC 2C2XA 1CERA 4IQ8A 5CFZA 1A9ZA 2VUUA 4CUZA 4L4RA 1UP6A 3V1TC 4YAJA 1C1DB 1X0VA 4S1VA 3H5RA 3RC9A 1HETA 4BO6A 1C0IA 2PA3A 4CMAA 2VN8A 2VZ8A 2ZK7A 2YW9A 2ZYAA 3P5SA 5FF9A 5F3RA 3IUPA 2VYND 1NQTA 2Q2VA 4K28A 3VC7A 3NUGA 1KEVA 1YOVB 2O50A 2BMAA 2B35A 1U2GA 3L6OO 1WMAA 1UZMA 5GY7A 3F1LA 4ID9A 3OJ0A 4I5DA 1N1GA 3WJAA 1T1SA 1QMGA 3DC2A 4JJFA 2OXIA 3WIDA 2E49A 4OQZA 3F3SA 1P1HA 2D5AA 4IDCA 3A1NA 5U9CA 2VT3A 3RBVA 3E48A 4FBGA 4DIBA 3L4BC 1I10A 2GZ2A 1N9GB 2EJVA 4BNHA 1Z82A 4JROA 1W8DA 3KSZO 2D2IA 3LLSA 5ER9A 3T7CA 5JC8A 3P19A 3DO5A 4XYLA 4URFA 5DBFA 4ZRMA 3GEDA 1E6UA 4RPGA 1U7TA 3L9XA 3DZKA 4WNCA 5F5LA 4JIGA 5THKA 4BO3A 2ZQZA 1VPDA 2X22A 4MDHA 3U49A 3QLJA 1Y5RA 4Y8VA 5IAAA 3PFFA 4Z9FA 2YUTA 1Y81A 3QHAA 4YEDA 3KLMX 1P3DA 4YTEA 3ROKA 4P4GA 4CLHA 4UUPA 3IC5A 4FFRA 3ZHXA 2HAEA 4PLHA 3DBHB 3WBFA 3Q11A 1A71A 3L4SO 4R1TA 3JV7A 5B4UA 5DCWA 4PLCA 7ADHA 2OHXA 1ENOA 3U4DA 4IMPA 3GQVA 3CZRA 4R1SA 3JQGB 1T4DA 3H3JA 2Q1WA 4R9SA 2V6BA 2ZCVA 3DBVO 1HLPA 2JFFA 4DLLA 1YH3A 1KVRA 1ENYA 4CLRB 3O38A 1Y9AA 4QQRA 4OKNA 4AL4A 2NADA 2H5LA 2EP7A 1P1RA 1C3VA 3LYLA 4L8VA 4W4TA 3F6YA 4ALJA 1YL5A 1DC3A 4FQ8A 1GL3A 3WGIA 4OL9A 2OORA 1V6AA 1ZFNA 3H6KA 2BGLA 1ZJYA 1WLYA 1RM3A 3BMCB 4IDBA 4TRRA 2ZATA 5BSHA 4DPKA 1NQ5A 1OOEA 4II2A 1GY8A 3GZNA 3KSUA 4J4HA 2ZTLA 3I9OA 3MCVA 4PG4A 1G1AA 3ZCXA 4DLAA 2CDAA 3FHLA 2YHIA 1V9LA 1PEDA 4INAA 2AHRA 2OP0A 4CPDA 5EJ2A 2W2LD 1B3RA 4A26A 3HFGA 5ENVA 3N58A 2Y05A 3FRJA 3VH2A 5C7LO 2R6JA 4U0KA 4RQUA 3WS7A 4IDFA 1X0XA 2J5KA 3S2EA 5KOIA 2DUWA 1KS9A 5DOZA 1LLUA 2AE1A 5JFOA
chains in the Genus database with same CATH superfamily
1TIBA 5HM8A 2CB9A 4O4JA 2NU7A 1FFXB 4G1BA 5CDGA 4P36A 1M1XB 3ZE9A 1O9GA 4OFZA 1E62A 3QKUA 1MB4A 1WF6A 1SQGA 4B31A 1JHMA 3L7AA 3FE2A 2FN9A 1OX6A 2PYDA 1KXZA 1Z8DA 2AKYA 3NHZA 4KQ1A 1SVWA 2CVFA 3N8HA 4QOGA 1EWRA 4DL9A 2ZB3A 4HB4A 2YZMA 2WRZA 1KVQA 1TFUA 3BWBA 3NORA 3QFHA 2R3SA 3BH7A 3NW9A 4Q93A 4QUEA 4IGKA 4UMVA 5CB4A 2SNIE 2POCA 2IZ0A 4FFLA 3ER9A 4PX2A 4U9UA 3TBKA 1GAWA 4Y3UA 3ZV7A 4MKHA 1OPXA 3CO5A 3R7SA 4CI9A 2HHCA 5K0BA 4IYRA 3BCUA 5CA1F 3WLEA 2CVPA 1UJBA 4K40A 3V4RA 4BKRA 4RD2A 4B6JA 1E9EA 2D5IA 2CJPA 4FOOA 4POAA 4DWOA 1IBRA 4ENTA 1SCKA 5ALGA 3LXUX 1S8NA 2J31A 3GPIA 3FDIA 3WB2A 4EHLA 4QJ3A 3CRZA 3RIXA 3PSAA 1YBMA 4UTRA 1QNFA 2YHSA 3SYMA 1ULSA 1ZJ4A 4C20A 4KV9A 4L95C 4FFNA 4TYYA 5HFJA 3R7BA 3RASA 2C29D 3EPJA 3ZD7A 2VQ6A 5EIAA 1E5LA 3W5IA 2JIZA 5HTKA 2PX4A 4R9UC 1JSCA 2AVDA 2VDNB 4TS3A 5IVHA 3BT7A 4FT4A 3EVBA 3Q9SA 2CYCA 1FYWA 3EXIB 4WN9A 3D81A 3S5JA 2DECA 1KC1A 3AI7A 2FPIA 3DGEC 1HQKA 1C8VB 3AP3A 5LJLA 5B1DA 4B3HA 3LV8A 4BWVA 2QM7A 4ZOLA 3BWMA 3ED5A 2HB6A 2GDZA 3CLTC 4LCBA 2A78A 1F2TB 1GTVA 3HCPA 4TROA 4DA0A 3VI3B 3O4HA 4EAAA 3ZE6A 1R10A 2I8CA 4LHVA 4Y6LA 4Z2AA 4AO8A 3EOAI 5E2IA 3FTCA 1CQIB 1XNQB 4HVLA 1EQ2A 3W90A 3KFLA 4NCJA 4IMJB 2Q4RA 1Z56C 3PRYA 1V96A 1UBUS 1PR3A 4AWXA 3LHIA 4FVTA 2TYSB 1ZK4A 4I2NA 4MULA 1XMSA 3AEKB 7MDHA 5DO9A 5KWEA 1Y4AE 1K66A 3GRPA 3NJRA 3DOIA 4X41A 3ZE2B 1PCXA 3UJPA 3NXKA 4RHCA 1WSWA 2O0JA 3T7KA 1JPJA 4ENPA 5FNVB 4KQ2A 1G55A 3HZRA 5IK2A 1CFJA 3JRWA 1Q74A 3V4PB 1Z37A 2DMRA 3T5GA 5IFKA 2H4JA 4BOYA 3DAHA 4PLZA 1EQUA 3KJXA 3JQ7B 1V1RB 5A3SA 4ZMBA 5L40A 1Z29A 1U7OA 3OCXA 1KQPA 3GELA 3WKBA 2HIGA 2CYAA 5T7BA 4QT4A 2NYRA 4OTZA 2Q6IA 5EINA 5CB4F 4JJGA 1I7PA 4N8SA 1RLUA 2BTQA 4XIIA 1TEZA 5B6JA 2I22A 2NV6A 4DARA 4LF5B 4OF4A 1JKJB 4X1IA 2J3JA 2ZBGA 1A5TA 5DMXA 5DSXA 4C3OB 3AIOA 4GOXA 2K2QB 3IMFA 2VP4A 3QMVA 4Y9RA 5JRDS 1V5EA 2IZOA 4I5IA 3QX3A 3IFSA 1XCMA 2AGVA 5J58A 4CLOA 1DV1A 4RTJA 3A4NA 3GMDA 2UU9B 3PJFA 3P9PA 3HR8A 4GM4A 5AW5A 1CSEE 1IBLB 3MM4A 1RD4A 3DL0A 4P53A 4C6RA 3D4NA 4DV3B 5JH7A 4YJGA 1B76A 2GF9A 4I8DA 2P8JA 4JCOA 1BCSB 3C85A 5EUMA 3HY3A 1JEYA 4IH4A 5H70A 4Z49A 1SU7A 2WKRA 621PA 4WINA 4CR7A 2QRVA 4L4SA 5E0KB 5GADl 3GFSA 1C9EA 4JHLA 1R5BA 2I7XA 1FP6A 3DAPA 4KAAA 5FOWA 1NAIA 2Q8QA 4F92B 2O1WA 2Z4RA 3CH5A 1Z5PA 3BYZA 3K0AB 5J59A 3U44B 1ODCA 2A0WA 2XGMA 1GFSA 3UV7A 1R0SA 2QNBA 3H4TA 1T1IA 4HYYA 4BEJA 5IS2A 3WMRA 4Q7JB 2Q50A 3QXHA 2UYGA 2PMKA 4Q19A 5TNXA 3K05A 1S6YA 4LCEA 4O33A 1J8DA 2IY8A 2XUPA 2ENWA 5JUWA 2G70A 4UUBA 3E6AA 1U0TA 1R5OA 4D4IA 5TQJA 4EELA 2D59A 1R3UA 1T2VA 4MIKA 1V43A 3V4ZA 1KTVA 1WZNA 3TOVA 3ZX4A 3K0AA 2ZS7A 3NBZC 1I6KA 1BDJA 5BWOA 1GL6A 4CMBA 3P20A 4DS3A 2Z0MA 5HS6A 2H5JA 1ADYA 5BQFA 4D9MA 3VKGA 1X2BA 1IOLA 4TRJA 4BO9A 4GR9A 5KNBH 4YP1A 2QRPA 4GRDA 1IOZA 3SYKA 4ZKDA 2Y3IA 5B7NA 1GZ5A 4KGVA 3DBRA 1HUQA 2EFGA 2E5FA 2VUTA 1ZONA 2XUFA 1XL1A 4QASA 3WL8A 2DBVO 3WLPA 4D02A 4Z1MA 4F3NA 5FV4A 1QFXA 2RH8A 3ILVA 4S12A 3N6RA 1F0NA 3N6XA 1AO0A 1JIKA 4OHWA 1XCOA 3GXBA 4N0EA 1DARA 1R6DA 3CTMA 4EDHA 2O2GA 5DWVA 2GLXA 4JBIA 3NV7A 4PLWA 1T5LA 3FMIA 1FSFA 2OV1A 3ER8A 2J3HA 3ZZ0A 3HACA 3AVYA 1L5OA 2H4FA 3HABA 1YBVA 5KU1A 1RSZA 2DCUA 1EGQA 2E4YA 3CLUC 4GOLD 2AUTA 2X42A 4LZPA 2WMNB 1PD1A 3W5UA 1IK6A 3C8UA 3WICA 2F67A 2HL6A 3SS9X 3HDQA 4G2NA 3I9MA 1JG4A 3DOOA 3MOSA 3R7LA 1TZBA 1M7HA 4IG4A 1PQPA 4XX1A 1LV7A 2OBMA 1TECE 2GCIA 3HA3A 2P9JA 2WOOA 2VDUE 3F5MA 3GNQA 3MSCA 3EF0A 3PZRA 5AMXA 3QZUA 1M10A 4G5OA 2EKDA 2PGLA 4LJLA 4YRJA 5BMOA 1C4XA 1JDPA 1JXMA 2DULA 2GEBA 1PQ4A 2V7UA 1TE2A 3ND8A 2B99A 2XMSA 4UU1A 1W581 1JE0A 2J9FA 5SICE 3AVQA 5CDFE 2IUEA 3FVQA 3M6MD 2PO5A 3NBUA 1PIWA 4JLBA 4A7PA 4ZTUB 3K7EA 5IKMA 4OUDB 4AWAA 2ZR7A 3IL2A 1GPLA 3L1HA 1Y37A 2LP4Y 2REOA 3KS9A 4FKZA 4WACA 5FTKA 5A2GA 3FWKA 3SICE 4D8TA 2QNRA 1ORTA 3K0CC 1LNSA 1JG6A 3HCFA 2WT8A 2BCGY 4I4LA 4Q3CA 2QTLA 2I4MA 2QU7A 3G7NA 1V1MB 1UBHS 4X7MA 4XM2A 4JJAA 5AVUA 3ROPA 3PC3A 4ZAGA 1LK7A 4ZQEA 2C83A 3AEYA 4NS1A 4LDAA 1CR4A 1PZGA 1SC9A 3PKZA 4FKBA 1D3AA 3DDOA 1JILA 3WE7A 1YDHA 1QE5A 1VKHA 3PE3A 2OEPA 1KSJA 1OB5A 3PXAA 1M33A 2WWIA 3W2EA 2GCGA 1S4QA 3MAGA 4P7FA 4D7AA 1BMFD 1TUBA 2G06A 2CV0A 3QE2A 3FSEA 4KNVA 5A03A 5DBEX 2YQ5A 2UZ4A 2RI1A 3NDBB 2Q2QA 4EWLA 1QB7A 1L5QA 2VWGA 4TLAA 3S8EA 4TV9A 2ZRLA 2X58A 1EFPA 2OHOA 4MWBA 2G80A 4BE7B 2J3QA 4YV7A 5JANA 3X0DA 1OV4A 4MINA 2EYUA 4NARA 4RTQA 2BCJQ 4KR0A 5EZQA 4WWHA 1THZA 4Q7QA 1PJZA 1ZVJA 2VWPA 3GO4A 2BFFA 1RPZA 4HN4B 3T9DA 4B74A 4DLYA 1WY5A 3GPLA 3JTMA 2QN3A 1ZGZA 4DTIA 4PBSA 1FLNA 4MR8B 2L0XA 5T6MA 4GF5A 2H3HA 1D0IA 1OQAA 1L4GA 4L15A 2P4SA 3SJUA 5AVWA 5KSOA 5JCOC 4J4TA 5BRAA 2RH4A 4PHFA 4OVKA 3E35A 3JQFC 2NXWA 3NV9A 4WZAE 5FPPA 1EBBA 1JW9B 1DE0A 4M6WA 5BT8A 3IAUA 4J7UA 5HW0A 3RVBA 1U6JA 2A9KA 3HXPA 5EQFA 4EKNB 1A9XA 4B5LA 2XVXA 4LA4A 1ZD1A 2OAGA 2YV4A 4WBNA 4B2IA 4R2WA 2AZTA 3ADKA 1OVMA 4KQHA 2CVQA 2WB4A 1J1IA 1I2BA 5CB4B 1T34A 2JJ1A 1UAYA 1XCGB 2Z9CA 4OOEA 4YR7A 5A7FA 5C80A 1SMKA 3ROQA 4UBNA 5KVCA 4WKGA 3VR2A 4B44A 4FW9A 5IJ9B 2OVFA 1QIFA 3THXB 1AA9A 2CWWA 2VDWB 4OQMA 2V4ZA 3PT5A 4TT3D 1KP3A 3SKVA 1WXEA 2WBLC 5B4VA 2NSDA 2G4LA 1PV2A 1VI2A 2JCGA 10MHA 3V8PA 1RXEA 2PZ8A 2BMDA 5F7XA 1K2WA 1MJNA 1R0RE 1YS7A 2IGTA 2PUTA 1FJHA 1SCJA 2J3MA 4YN3A 3WOHA 3D5EA 4RENA 1XLTC 3FDZB 2QUBA 4XCQA 1SBTA 5K3CA 3ZVRA 2PBZA 4LZLA 3OICA 2R8OA 5JBIA 1RBMA 3Q0IA 4ATNA 1YR7A 5CGQB 3Q3CA 2IW1A 1DUVG 3CT4A 3SVTA 3AM1A 5IJAA 2VXOA 3AY3A 3NKFA 2AF4C 4LWOA 5CUQA 4D9BA 1IXRC 1ECFA 1YVEI 1RQRA 2A57A 4UFOA 2J9GA 2WNIA 4MVJP 3SZGA 4QG3A 2HA4A 2VH5R 3WHIA 2EL7A 3OIGA 4Z86A 1F9EA 2NO6A 3H2ZA 1DBRA 2QX8A 4IIJB 2B94A 2QL7A 3S8YA 2BMEA 2Q7OE 5M29A 1E1CB 3I5UA 3CR8A 1OKKD 4LV6A 2QTTA 3PC8C 3KKNA 3LQ2A 4O4LA 2XE4A 3WWOA 5K6TA 2MSKA 1A96A 1OFHA 1QLWA 2YXPX 3CSSA 4W7IA 5FYQA 1SD1A 3ASYA 2BW0A 1QQTA 4TYNA 5FAKA 2V7QD 3K0EA 1SZCA 4JBYA 3ZS9A 5HKKD 1TQHA 4Q48A 1V95A 4Z0HO 3JWEA 2XY4A 3FPHA 1QYCA 2BE9A 3BIFA 3ENWA 1N0HA 4ZCSA 1NNI1 5LMCA 2ACKA 1W29A 1ZCZA 1P19A 2HRRA 2QTCA 3FGZA 3QYPA 2RIPA 3U17A 4KQXA 4WTOA 4DIUA 1JAHA 2CLOB 3U3ZA 3GRYA 4PLVA 2VP5A 3E3LA 3FTDA 1ST3A 3KQYA 1ZHFA 2YIDA 1SXPA 4NBRA 3UC5A 3QNUA 5B7GA 2I7VA 1DWPA 1KBQA 5FBVB 1Z0KA 4HDKA 2RGAA 4HLDA 1M2KA 1T9AA 1OHHA 3HLYA 1KJZA 1RXWA 4R1NA 5E1BA 1H2RS 3P0EA 2O4UX 1WXDA 3OA0A 4TQAA 2W2LA 2PT5A 3L6RA 3LKVA 2ZRMA 4GECA 3QOFA 5E7IA 1NYQA 2X9NA 5HE8A 4YREA 4CQMA 4UM5A 4C05A 3EARA 5FUVA 1KO7A 3UWOA 3C3XA 5DX0A 2NXNA 4TKZA 5D5HA 2QD5A 2QUHA 4BFVA 4MKFA 4ALKA 3SBOA 4MQFA 2ZIAA 1I1HA 4KU4A 4US2R 5LKAA 4PTZA 2LKDA 3USZA 2CFCA 3IE2A 1VC2A 3H1EA 1WB6A 2Q8PA 3RJZA 1KWGA 3H1TA 4X1YB 2WUWE 3EQ6A 2BMWA 1VYTA 4YCSA 1E89A 4B3TB 4DXHA 1KEPA 1SG0A 1U65A 2AFIB 2B9VA 4C06A 4H4EA 2AYYA 5CNIA 5ERXA 3RWBA 3KUXA 2UZ1A 4WOBA 4MCIA 5TT1A 1OWMA 3PDIB 4KIWA 3T3NA 2JFHA 2UZ3A 2CBZA 4KO2S 3RSOA 1IMOA 3SDZA 3JD2A 4FB5A 4GVLA 4V0RA 2M1ZA 1J1UA 1LJ8A 2EIHA 1Q7GA 2CJWB 5GV8A 2ZIXA 3VGJA 2VIIA 4ZAVA 4YJ2F 4GH5A 3W5HA 3UF0A 1N7JA 2HWKA 5CT9A 4CCWA 4OBXA 1L3BA 4WOJA 3IERA 1CUXA 1UH5A 2ZWMA 4KXVA 5FTJA 4J6EA 4LECA 4LWQA 2WG2A 1CZRA 4GGPA 4NBTA 1K8XB 3H19A 4B76A 4LRWA 4JUIA 4RPCA 1YK1A 1P2FA 4CT5A 1PE0A 2VDKB 3A4LA 3EFEA 1M6NA 3RFVA 1DHTA 3QVUA 1LTQA 2XBLA 1SA0B 4BLTA 2YJNA 1XTVA 1GQSA 3L8YA 3WGNA 4MHTA 4P34A 5G4KA 3C3JA 4HF7A 4BB9A 3G2IA 4LWZA 4OY3A 4QGGA 4CYMA 1SZPA 3NI2A 1TQ8A 3RWMB 5AK4A 1P1BA 2FVYA 3FKSA 4L4UA 2QLTA 4RORA 4MS3A 4LJ7A 4ZXPA 1NW7A 2B8TA 5FUQA 3ZEIA 3FWHA 5BO5A 4YUXA 3TECE 4HDKB 4XAQA 3KUKA 5FBRB 3LCVB 2Q27A 2HO5A 4PX3A 2WK1A 3BL8A 1DKQA 2ORIA 2AMFA 3N07A 4ZRNA 4LBVA 8ABPA 1JYSA 2H8GA 2DB3A 3H0CA 2ZAIA 2W37A 3NHLA 3ISJA 5KYXB 4DE5A 1C3OA 2HC9A 2QTZA 4I4NA 1OVGA 4YAGA 3A1WA 4FDTA 3AETB 4NEHB 4NYMQ 4BYMA 5AW3A 3VYTB 5CXSA 2G6BA 3GIWA 1M1ZA 3ZV4A 3TLMA 3AL0C 2HCJB 1QK3A 4QWMA 4YBZA 3DW3X 3MAAC 1K1EA 4YIHA 1N9GA 2PZEA 4HN9A 1XNHA 3ODGA 4L0DA 4UKDA 1X7WA 1F60A 3PPWA 4ECAA 4C0XA 2A7QA 1AC5A 2ZAGA 4C1BA 1YJQA 5LC1A 1U0FA 2ETXA 3ZY4A 1SXJE 3ZWWA 4AY2A 1GG2A 1BHJA 1HT0A 1KF0A 1LGYA 2IX9A 3IR7A 1C4WA 4OXNA 3M83A 1PT5A 2HSGA 4IXNA 4G9GA 3TQFA 4Z5XA 3R7FA 2OWEA 5CX1B 3SFVA 3OX2A 4Z8YA 3IJRA 3DWEX 3EGCA 2QL5A 4Y6OA 5HGJA 3X1JA 3IESA 4PGGA 3X1DA 4CFZA 1PF7E 5DN6D 1L4YA 4BO5A 3E9DA 2QDKA 5DGDA 3P9NA 1MO5A 1PFGA 2CNBA 1MG5A 3HYNA 5KYWA 4UTNA 1TU0A 1N3YA 3IE0A 3QVLA 4PG7A 1MP0A 2ZIFA 4RJLA 1OY1A 4X20A 1QTNA 3LOUA 5ALZA 3V8NA 2FPUA 3VVBA 3KO8A 2ZG6A 4ZOCA 2AJLI 2JLRA 4X6YA 3HCCA 4K2HA 4H7PA 2QAGB 2VZ0A 2X8BA 3S2GA 1ZICA 3L7NA 2Z5VA 1C9MA 3Q7QA 5KCMA 2JL1A 2BDUA 1XNJA 1ZXLA 3N7UA 5E6UB 5HS4A 1F06A 1F4LA 2VNSA 3H2SA 3ZNPA 3HBFA 2Y1GA 1FBTA 4DSOA 1KMHB 3EZ7A 4W5WA 4XCXA 3R9IA 4BFTA 4MPJA 1KFEB 3LUAA 1Y3IA 1N36B 4AY5A 3EVZA 1SVUA 3FETA 3GAZA 4M8SA 1ZRSA 1PR1A 1KI3A 2OB1A 1W0KA 1VSQA 2P4UA 2YIMA 4GBMA 4RGYA 2NXJA 1AIPA 5AOBA 2YRFA 4JQCA 4MYSA 1CS0B 1Z4KA 1PP4A 1KSGA 3WSWA 4WBNB 5BN3B 5LOVF 4U9IS 2ZCJA 2I3DA 4UBKA 1KK0A 3JQ9C 3DZHA 4E07A 1HDXA 1UANA 3GAAA 3GJ4A 1EDOA 221PA 3OZXA 1SELA 4Y2GA 3IPYA 4B0PA 3LT5A 4JR2A 3ZJTA 2GERA 2Y1CA 2FQXA 1AKYA 1AE1A 1CD5A 5JDCA 2WJVA 3SWWA 5KYKA 4DR4B 2ZWAA 3LZDA 2IE8A 2I6UA 2JKVA 3K72B 3M1YA 5ELLA 3VR6A 4PC7A 1TYCA 1VJDA 1ZOOA 1Y89A 1BEEA 1UJNA 1M6WA 2FPWA 3X1WA 3NTUA 2DTDA 2IYUA 1CQJB 2CNKA 4WFJA 5JNLA 2GYYA 1P0PA 1VL6A 2C78A 4UZSA 5EIOA 2YS7A 4O1MA 1RMTA 3KKOA 3WJ1A 4FYIA 4J16A 4Y6PA 2AI3A 1VMDA 4OFXA 2INGX 3NO4A 2VHTA 1GV0A 1EVIA 1FFCA 3IQIX 4NBWA 5DI9A 3RTEA 3C3MA 5CFQA 1WIWA 3SNHA 3OTOB 3EIHA 3D8HA 2Q0XA 4D3DA 1QH8A 2GPBA 2JFQA 4F6RA 5IF3A 3WDKA 4LZAA 2VNHA 5IX8A 4OK5A 3Q3EA 1E79A 1EUZA 1B1CA 1H0SA 3ETLA 7REQB 5TPZA 1IM2A 1M9NA 5DH9A 1XU7A 3VDXA 4CMJA 1O8CA 1IJFA 2VKTA 4M1OA 1KVUA 4EW1A 4BRZA 2HLDA 1X80B 5JEDA 4TXLA 1N6KA 1Z5WA 2F3QA 1YRLA 1ZIDA 5ED4A 2IPMA 2WINI 3WLSA 4NFSA 4MV7A 2AW3A 2PSSA 3OD1A 5DW0A 5IHPA 4HAOA 1T2CA 3BMOA 3OZCA 1GDTA 4JU8A 1V7ZA 2VDPB 2D7DA 1OILA 1WJGA 2GBLC 3MZ0A 3DDZX 4PICA 1PJTA 1V35A 3EGVA 4E2FA 4EW6A 3T5CA 5BPHA 5BUQA 2P4EA 1JNXX 1VCMA 3GJ8A 2CW5A 2G36A 1JS1X 1THMA 1TYDE 1WDKA 3MJSA 2BEKA 5KJEA 4EW2A 1DFIA 2GKOA 4XR9A 2WICA 4M36A 1U3FA 1C1XA 2ZROA 1HFJA 2F1HA 3R75A 1A1VA 2JFOA 2NUAB 2ZBRA 4L4XA 2Q0SA 2QX7A 4N54A 3SHOA 2QWXA 1YQQA 1AKWA 3C3PA 3DUFA 3QLVA 3RBZA 4L02A 13PKA 3KOXA 4P7BA 1O6CA 3V4FA 4N5HX 4E21A 3GZJA 2C2MA 3I6ZA 5D3MA 3IP5A 4L3WA 2G6TA 3UJNA 4HQFA 4H15A 1QM5A 1EYZA 3EBPA 3FBTA 4FGUA 1MXHA 3PFIA 4C7BA 3CRMA 3SX0A 4E5UA 1OC2A 4RVHA 2OA0A 2WC1A 3CLKA 3B70A 4I81A 2OZLB 2P27A 4KXQA 1SXGA 2D7CA 3D6NB 4NBNA 4F21A 2DT8A 2I6GA 3PGJA 2II6A 3VR5H 5BR1A 4BVHA 1Z0ZA 3AL2A 1PV4A 5F3WB 1LKZA 4CI0B 1EI9A 2VDLB 2IF0A 1USKA 2X5KO 1N4AA 1O6BA 4JB8A 4GKAA 1ZMBA 1RTKA 4D8UA 2OV2A 2Z6UA 3DE7X 1WABA 1CVLA 1GAJA 1OFVA 1J0BA 1EMDA 1ZCFA 2Y1DA 4Q18A 1FXWF 2HU8A 3ZY6A 3IR6A 4G56A 1B2RA 3TBHA 4CV3A 4YAKA 3QVJA 2ZVDA 1AKEA 5GZ3A 5IH3A 5FPTA 5KZMB 4MRNA 4UOQA 1UBGA 1FJXA 3LCUA 4W5OA 3GHYA 3M6AA 2EAUA 4DABA 2ZANA 1CE8B 3DFUA 4HX9A 4QYSA 2PD3A 3BMXA 4ZVUA 3OT4A 4JYCA 4RPLA 3ZHOA 1PGPA 1UBLS 4Y2YA 3UICA 3ND6A 3N75A 3C5HA 1MZVA 3BILA 3EXEB 3WVNA 1OH8A 2E48A 4MV1A 2B1QA 2GTIA 4WOPA 1BFKA 5CJJA 3R5KA 3ORYA 4S35A 4P58A 1MPTA 2EV9A 5FA5A 4NYJR 3A27A 3GA0A 2HPAA 3A6EA 1VBFA 4Y2VA 2OQIA 2WSLA 1AA6A 1SKYE 2A0FA 3P9IA 5DHFA 4BGIA 1YMUA 1FTQA 1UOEA 1GSOA 2LCIA 2ZOSA 3OFSA 5CG2A 4BNZA 1GUAA 2W98A 3C3WA 1UKCA 4FYHA 2B8NA 1K5HA 2PNJA 2PFKA 1OIVA 3H8SA 1F1BA 1KVSA 1LLDA 4G6ZA 4I9HA 3K53A 1IM8A 1V8BA 3VTZA 4URYR 4KBGA 3IPLA 5AH0A 3R7NA 3VH1A 3LP8A 4HEHA 2YX1A 4YDRA 3WISA 5KB3A 3IEVA 2PMCA 2FRVA 1MNQA 2X5NA 3QW2A 5TC4A 1KY2A 4W1PA 1RAFA 4R2LA 4DAEA 5DBOA 3U39A 1MABA 5FO0A 3TIGA 4EUHA 2ZZNA 2DY1A 4MJXA 3ZWMA 2PRSA 3KOYA 1EX6A 3ANLA 5AD1A 1SXHA 5T4EA 5IN4A 4KPEC 3P2YA 3BD9A 3LCCA 4KLAA 2GETA 2H0QA 4CETA 3IQEA 3N3AC 1N6RA 2BSAA 5ELXA 3DNMA 4JD5A 1BWRA 4DZRA 4H08A 1NOJA 1XZJA 1VG8A 2OG2A 1SM4A 3WYBA 1V3UA 2B4YA 2NT4A 1T3HA 2X7HA 4KTTE 4RLQA 2RGUA 2I2DA 4PQFA 2HDOA 3KX2A 2P0EA 4K81B 4KXUA 4DLTA 3LDUA 1WULS 4HQKA 4QFMA 1K4MA 2IOQA 2JASA 5A6SB 2C58A 4BP9A 2LIVA 4FZVA 1KOLA 1PJQA 4F2HA 1QYVA 4YONB 1K97A 1O57A 3UKDA 2AOWA 1XF1A 1PSDA 3LUJA 2N9UA 3HKBB 5H81A 5TIIA 4D0SA 3G0DA 3D6AA 3WYFA 1TD1A 3QQ5A 1BYIA 4PX9A 4MJLA 2R7KA 2CHGA 1QDLB 4CBVA 1Z6ZA 4CU5A 1EFUA 4XI9A 5BSEA 1IPFA 1FSZA 3TMAA 3DLBA 1O1YA 2E1RA 3CUVA 4Y7CA 5FT9A 3OURA 1R74A 4LXQA 4H18A 1DAGA 4PTYA 5J40A 5K4AA 1JU9A 4UCWA 3MJHA 3W5CA 2GUGA 4HFNA 4U6QA 1SCUA 4V2UA 2VJKA 2KYRA 4BNWA 4BO4A 3H97A 1CW2B 1FFBA 2Y1XA 5G0TA 1F0YA 2N75A 2GEJA 4FFMA 1E8DA 2ZM6B 2V7QA 1AT1A 3J81k 4YECA 3OCWA 2M6KA 1KAEA 1U5AA 1P60A 1Y9EA 4IKPA 4UPVA 3UFBA 4P32A 1GG9A 2NIPA 4DCTA 4URXR 3PFBA 1ZJ6A 1L4LA 2Q7XA 2EYQA 4HBGA 1PJRA 1GZ6A 2CWDA 3AESB 4JQSA 2LNDA 3QX8A 4MVYA 1O7JA 4WJZA 3X1XA 4BVBA 3OLWA 1SJ9A 2PDAA 4XWYA 3NAGA 2GAIA 5G02A 4J0DA 2V96A 4F97A 3IKJA 5IG2A 4WFQA 2J07A 2J3KA 1E64A 3S3TA 4JKIA 2B7BA 2MINA 1KETA 5IAKA 1U1EA 4MPTA 3OZSA 1GILA 1G5QA 1RKXA 5JJLA 2ECKA 4UVHA 1QG6A 4FM9A 5B1YA 1AK1A 4KOAA 3QWBA 2DFVA 1R4MB 2WEKA 3VKWA 4F9EA 5JNRA 1K98A 5L4LA 1KPIA 3UPTA 5F33A 4HMOA 3J7TA 2NTVA 2GO7A 4Y9TA 1NTRA 1ORWA 4RANA 5FPSA 4BO8A 5CMLA 5JZOA 2GDJA 2H11A 1EK2A 3H9CA 4L9AA 2A14A 1JZQA 3D5TA 3ANNA 4RF3A 1L5WA 3KDAA 1KP2A 3T99A 4JT4A 4JMPA 5IMBA 1BGVA 3CB4A 3UJ8A 5ERGB 2GAAA 2QZ9A 1DEXA 2G7ZA 3ECCA 2WF8A 3I1JA 3L2OB 4JB3A 1SHTX 1FFDA 2C3MA 3BEDA 3LKBA 1NI3A 3HDYA 3H04A 3AVPA 1HDGO 2YL2A 3HJRA 1GQ2A 3I34X 4V24A 3NYRA 4MI9A 1JQEA 1R5JA 2QTHA 2HLPA 4C7KA 3CLSD 3B7WA 4I1RA 1MO3A 2Q5IA 1TD9A 4D4KA 4HWTA 1RRVA 1XJWA 4EHHA 5AOCA 2GZRA 2GASA 3GNLA 1QVZA 3DD5A 4XR4A 2WHPA 4DCPA 3IIKA 1QRRA 3ELWA 1BWPA 1NJFA 3EEIA 4PO3X 5THXA 4DVGA 5FPYA 3VR2D 4WDRA 4AJEA 3FCAA 3L82B 1HKHA 1UK8A 1XRNA 3QQPA 3ZIDA 1QWSA 4J76A 1E92A 4H17A 1S2MA 4X92A 4Q9NA 1WXIA 1TC2A 4LE0A 3ZIAA 1IVSA 5JJ5A 1G20A 3UK6A 4EQ6B 4EA7A 4E11A 1ZN7A 1R5NA 4HS4A 4ZCQA 3FPJA 1JSZA 1JQAA 3JD4A 3SC2A 1ORDA 3ZBPA 1DJNA 1R3DA 4N9QA 5CXQA 3D5QA 4HVCA 3CIOA 3HRKA 4M49A 5C7OO 4ZXFA 2F1IA 3AHEA 1YZFA 4B80A 5LYJF 1ODIA 4K3UA 4RS4A 1UMBB 3GQBA 1VL1A 5EIBD 3LX6A 1M8FA 3DZJA 4QU9A 2VL7A 4C6TB 5KQMA 1YXMA 3D1VA 4WL0A 3EMDA 5ALFA 3KOMA 5T8KA 3DM9B 4JP1A 4D9NA 1J8FA 1JDBC 1ZWLA 5JYEA 3PKIA 1ZMXA 5F51A 2ADOA 4G4IA 4TZ0A 3FDXA 1P81A 1SVKA 2VNKA 2W22A 2FK8A 2K6GA 2HHJA 3VOTA 4BB0A 4C14A 4ETWA 2LVBA 2QRQA 1D6SA 1JXOA 2I03A 4KI0A 4OHZA 1XCJA 4HGOA 1C9KA 3OY2A 3RSSA 2P6OA 2QW0X 4ANFA 4TMWA 1EXWA 5EQJB 3OO0A 5JCJA 4D43A 5JAMA 2SKEA 5DT9A 1RYHA 4CMKA 1KORA 1S8OA 3RUPA 5MGNA 1OKKA 2YWCA 3Q3JB 2PSDA 1HMPA 1YA8A 4M9SA 2VP0A 4YJ3A 3CPHA 1NONA 1JSXA 1M34E 2YOGA 2QK4A 4DCCA 1JJIA 3FYUA 4MUIA 4UE3S 2W83A 4RFVA 4TKVA 3KYDB 1PQYA 4ZK2A 3FMGA 4N5MA 4E30A 3HWX1 3MBIA 3OP1A 4O4HB 3T9AA 6AT1A 5T57A 1B14A 4WEOA 4XSVA 5COBA 1GPKA 2ACEA 1YS2X 4AB1A 2NNWB 3N8IA 4HFJA 1QDUA 1W8IA 5LYJB 4EGQA 1DX4A 2OWDA 4JGGA 3BMQA 4REQA 4X54A 3PYXA 3T6KA 9MHTA 3D3QA 3KEOA 2DKFA 3RVKA 1I01A 3I5MA 2GM4A 1XUOA 3ASUA 2HBQA 4IF6A 2IYQA 4RTKA 3N0WA 1A50B 3K9QO 4FWIB 4KXWA 1L4UA 2YQZA 2QZSA 3BTVA 3OA2A 2VQ3A 4H7HA 5FJIA 1ISPA 2GRAA 2EJWA 2Y1KA 1RWVA 3AQ4A 2NVWA 2FLVA 1MX5A 4G0MA 1ZOPA 2FR8A 1DPFA 2EOAA 2LR0A 4DIEA 3U4QA 3CUEF 2CL0X 3ORFA 3ETDA 4EA6A 4HNUA 4JB0A 2HSDA 2CLIB 2H1CA 4JX9A 4QT0A 4AJ4A 2Z5LA 4ALLA 5BSVA 2HU2A 6LDHA 5AVRA 2QF7A 3N8KA 4AS3A 4JJ8A 3LWDA 4Z3OA 3ZPXA 1H22A 1EK1A 1IJKA 1N6HA 3SP1A 1UMDB 3O4IA 4JLNA 1C0LA 5BSGA 3EAGA 2YXDA 2ZTUA 3FYHA 4P6VF 5C4IA 3JQFA 1CLEA 3B3GA 3ETGA 3K35A 5LA6A 3IUYA 4WRRA 1IQ0A 2YBDA 3A9RA 1YDWA 4FJ2A 1M8PA 1KIAA 1GQQA 1A98A 1ZH8A 2V7TA 3KLPX 5F7OA 1T4MA 4TUYA 3LUKA 1TB4A 3H5NA 3G2HA 3OOYA 4MB0A 1H3FA 1OR8A 2ZYDA 3MB8A 4FCCA 1KARA 3L0DA 4H3SA 4TXNA 3UB2A 5CBKA 3LFHA 5LPNA 1Y7PA 2JIQA 2BAGA 1W85B 1RHKA 3FNEA 2RB4A 1QRDA 4ETMA 3RNOA 5FWXA 3DLTA 1EP2B 4YXWA 2BFAA 2ZJFA 5FL7D 4A5SA 3HKEA 1FYEA 1XA3A 2P2SA 5DLDA 1P6UA 1VHLA 3CTPA 2FDXA 1RLMA 4F1JA 2JFUA 2FG7C 4HAIA 3TEJA 4ZD6A 5LIRA 1ML3A 4WXEA 4H9GA 3EZGA 4HN2A 3VMFA 2QRMA 1AB6A 2J0EA 1SIWA 2G7MC 3WOVA 1JBEA 2XXAB 1IWPB 4LOIA 1DCTA 4LXGA 4JOSA 5GJBA 4Y1RA 3WAJA 4URUR 1Y6QA 3RC8A 5H8WA 4K7JA 4B79A 3GDHA 1P9LA 1WSBA 3BAFA 5EMNA 3UWPA 1UC9A 1M34A 4DJDC 4ARUA 1VE6A 3DMFA 5A4JA 2ZRIA 3FWPA 4ENVA 4FDLA 3HEBA 2RHDA 4WGGA 4EJSB 2MSNA 2B69A 5LLDA 1YJ5A 1NA5A 4ZU1X 5HXAA 3E58A 2RBKA 5AVTA 5EWJB 3HGTA 2WTUA 1F8FA 1ZVKA 5TPZD 5EIEA 1BZYA 3MCUA 3GR6A 1Z5VA 2TECE 1C50A 4LYGA 5HZHA 5DI3B 1VPWA 1MJGM 3QPDA 3C87A 1IZZA 5DNWA 3KTDA 3UMFA 3L84A 4II7A 4D6YA 2Z2JA 2B1RA 1GJRA 1VB5A 2O23A 3GH1A 1LTHR 1Z5GA 2Q5EA 3I09A 3W8EA 1G8GA 1P9OA 2IYOA 4E5PA 1Z6TA 3K4QA 3L79A 1W49A 1P17A 3NTVA 4TWAA 3WQHA 3AFGA 4GEGA 5BVHB 1FXSA 2Q2WA 4G41A 1RRKA 2O8FA 3ETHA 5KINB 4G8DA 4I1UA 4ITVA 4RPHA 3WLIA 3VU9B 2Z6AA 3A4YA 1A9YA 1J8MF 5EJ7A 5E3IA 4M1SA 3A9CA 2WT9A 2QB5A 3FF4A 1DLJA 3GVXA 1QLHA 3OQHA 4P4TA 5EP2A 2OYRA 4A16A 2PY6A 2WB2A 1CE8A 1X6VA 1TJ3A 1ZXXA 2RC5A 4MB2A 3W2HA 1ESEA 2H07A 4BFLA 2R7MA 4KK3A 3JYNA 3JX9A 4CNBA 3OZWA 1MA3A 4ZC8A 2FK7A 4RU1A 4HVAA 4IQFA 4XKJA 1VIMA 2AV6A 1O5IA 3E7WA 1FTYA 3RC2A 3OLYA 4FNMA 1NXQA 1PR0A 5DEOA 2R8YA 2Y71A 3U5TA 5KTSA 16PKA 1G8AA 2ZW9A 3PQDA 2BV3A 5EHIA 4CTNA 4GOMD 1MOQA 3TQCA 3FCSB 2XQKA 3DSRA 4HQLA 5CK5A 4G89A 1UJMA 4QRIA 3E2IA 2RKBA 4BP1A 3WLTA 4CDGA 1KS2A 5JAPA 3OECA 2Q6LA 2Z08A 3K1ZA 4UEQA 1E2LA 2L18A 3GG2A 1DOAA 3A8TA 1PNQA 4PZUA 3RRBA 2P6PA 2IIQA 2IY7A 4L3VA 4MKIA 3AKDA 3KPYA 1KE1A 2P30A 2OO3A 3EDOA 1DO0A 2IYWA 2NXCA 3T3DA 3NBQA 6PFKA 1XCBA 4G4JA 1GIAA 3A1TA 4L75A 4O4LF 4XQGA 1MAUA 2DBZA 2OM2A 3HYSA 3ILXA 1F2UA 2CNDA 2QVYX 1WXGA 2NPIA 1AGNA 2VS1A 4TVSA 1OV6A 3C6YA 2BKXA 5BURA 1D07A 1DBVO 1TA0A 1KH2A 2CHFA 3GT4A 4ND6A 1JR4A 3R77A 4ZU6X 3N0XA 1EG2A 2W6IA 3FYCA 1V47A 1K4YA 4KBYA 1Y4SA 1EX7A 4DDTA 2JJ8A 3CY6A 4OPMA 5EMKA 2I87A 5HIIA 1BJKA 4HY3A 1LU9A 1J25A 2J7KA 4BMSA 2A1UA 1RU3A 3RVMA 2R8EA 2VDOB 2RIRA 3I6IA 4FFSA 2EJCA 1MOPA 2V55B 1ULZA 3UH1A 4EL5A 4HNAB 5G40A 2IU0A 1WVGA 1HQYE 3G59A 4Y2HA 4ZO8A 4RSRA 1KC3A 4KVGA 4U7HA 4NZMA 3C6MA 3HR4A 3LXMA 3QLUA 4EBFA 1PWYE 2FZWA 5TXGA 2DU8A 1JKJA 4X1IB 3RIGA 1NMXA 1NUPA 3ZK7A 4AI6A 2GJ8A 5HBGA 1TVEA 1UPTA 2XNDA 3A1VA 4PZAA 3C14C 3OM8A 1TUIA 3V7WA 1ENPA 3GNTA 4GP7A 5EJ4A 4BNDB 2BTQB 1ONBA 3LO8A 3O9ZA 2BLNA 3K5PA 4LYHA 4W6ZA 1PGNA 2COKA 3I42A 4TTJA 3U7JA 1IB6A 3C7TA 3PIIA 5IEBA 2P9EA 4N7MA 1S3SA 1B2LA 5KAPA 2AJDA 2OXRA 4RLSA 4MA4A 3AEQB 2QE7A 4C7JA 4RK1A 3JS5A 3INRA 1XXHA 2IYRA 5EUCA 3FLEA 3AINA 3DB2A 2ZKIA 4OA8A 4YMVA 4RM2A 4CM4A 2OAEA 3KLOA 2OTCA 4UXJA 1H6CA 3KAPA 1P1JA 2CN1A 1DCKA 2P1ZA 1ANKA 1AGRA 3NWOA 4N12A 2YKGA 3H8JA 2ISCA 4CKEA 4C0QC 4JOBA 1D1QA 1JJFA 2YWBA 1XAIA 2QVCA 3INGA 3NC4A 4O25A 4EY3A 1CIJA 1Q7BA 3N2ZB 4U7FA 2Q4BA 2X6RA 1TEHA 3QFRA 1DKOA 1NNUA 3OUUA 3R2JA 1ZI6A 4JSYA 4WXYB 3V6MA 1JR6A 1SB9A 3F78A 4MO9A 2C7BA 2P78A 5E8JA 3QKRA 4Q00A 3BJZA 1QPGA 1V11B 4WASA 4BKPA 1RXVA 4NULA 4ENRA 3WMGA 2V9CA 2ZYIA 4U2GA 5MGBA 1NXPA 4N0DA 1KY5A 3U62A 2VSXA 3ME5A 3DL2A 3K9BA 4DZZA 3IAXA 3G2JA 4BBJA 1KP9A 1XWIA 2B25A 3U26A 1RXSA 1N9KA 5CH3A 1INLA 3K5IA 3TTXA 4WK6A 3PD1A 2WF7A 1COZA 1O4WA 2O3TA 1BSVA 2IOYA 3R3VA 3TOXA 1HYQA 421PA 3K9LA 3RW9A 4D80A 3BJMA 2XDWA 4Z7NB 1TYZA 5GINE 2R2AA 4L72A 3V7FA 4EITA 3FOEC 4QGSA 2PCJA 2ZYHA 4J8PA 1W4RA 3ICCA 4L4YA 4P4NA 1N2CB 2CXXA 5B1SA 1TK3A 4E4TA 1FJGB 3R20A 1AUVA 1M72A 1WHTA 1FJ2A 2JBAB 3A2KA 4YH1A 1GUDA 1NE2A 5C8YF 4IIXA 5AIAA 3GIDA 3GVHA 4FHFA 1LDNA 4GR5A 4LQ4A 4U8HA 4XSGA 2DPLA 1N2EA 2VKQA 5D86A 1QC5A 2Q9UA <