3PK0A

Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
b'GSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPESLDAIAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
molecule tags Oxidoreductase
source organism Mycobacterium smegmatis
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pk0A00
4CV2A 4Q39A 5DP2A 1ZK4A 3IS3A 4IMPA 1O0SA 4CUJA 1SZJG 3KEQA 5G0SA 4BL5A 1KVSA 1X15A 2WTBA 1N9GA 3O8QA 2BH9A 2GLXA 1VPDA 3FWNA 3KEOA 3JYLA 4BS9A 4IBOA 3AI3A 2YV1A 3HQ4O 5IDXA 4M1QA 1U3TA 2EJVA 2NQTA 4O0LA 1SMKA 5A03A 3PHHA 2BFOA 2OL4A 3TPCA 1GZ3A 1R4MB 3ONDA 4GPD1 4JROA 3UN1A 2GSDA 4RF5A 4D7AA 3KSUA 3RUEA 1DJNA 1ZSNA 2AEMA 4L75A 4FOSA 5I9NA 3E9NA 4BNKA 2AA3A 4E5PA 3HB4X 1BXZA 4J3FA 1LQTA 3S55A 1ZFNA 4ALIA 1I3MA 3TOZA 4EI2A 4URFA 3H9JA 3VPXA 4EEZA 2HSDA 3AUUA 1ISJA 2BF7A 2X0NA 1YH3A 1WP4A 1PTJA 2P5UA 4TRNA 3HSKA 3VDRA 4WCDA 4DQXA 5ENDA 2DUUA 4DPLA 3AU8A 5KJEA 1N7HA 2BFMA 2NVWA 2HK7A 1GUFA 1U2GA 3ENKA 4J1NA 4PVDA 4I5DA 4QECA 5DDIP 4O6VA 2VYVD 1N92A 2DTXA 3FPCA 1JTVA 3ITDA 4OM8A 2WEKA 1PWXA 3V1UA 1B3BA 3LU1A 3PWKA 3DHYA 4XB2A 4CMKA 2HMVA 3GUYA 3IMFA 3ONEA 3SVTA 1YQGA 3QV1A 2O3JA 2OUIA 5U4QA 3IUPA 3PHGA 2XXBA 3K6JA 3GHHA 4DLBA 1Y8RB 1DIHA 5JPIA 4IINA 5DF1A 3AJRA 4NI5A 4BQRA 5K0ZA 1WMAA 1XHLA 2H63A 2DAPA 3OH8A 4IDEA 3RC9A 1HT0A 3OICA 2FR8A 3KSZO 2VOJA 4YR9A 4RV9A 4JCOA 1SAYA 3FR7A 1BDBA 2VUUA 3K92A 4WEQA 3ZNQA 4YYZA 2ZTVA 1PJQA 4MKXA 4J6FA 1H6BA 3GVHA 4GVXA 4XX0A 1PWZA 1EVIA 1I32A 5TJHA 2PK3A 3NEPX 5L4LA 4HX5A 4FC7A 3BIOA 2GZ3A 1MFPA 2G1UA 4NPCA 4D3FA 1O8CA 4ILKA 6ADHA 1N1GA 4KTVE 5G4KB 1C14A 2I3AA 4RVUA 2B35A 4A0SA 4CM9D 1RM4A 3HWRA 1SOVA 5DCUA 1K6XA 1E6EA 4L4SA 5AXDA 4M54A 3MZ0A 2NU7A 4BNMA 1ZK0A 3WX0A 2W4QA 1ZSYA 4AJ1A 1MP0A 1Q0HA 3KYDB 4O5OA 3W8EA 1Y8QA 1ADGA 3WYCA 4BNFA 5KTKA 5IDYA 1GYPA 1NASA 3C7DB 5IXSA 1Y81A 3MJEA 1O9BA 3WYBA 5HTOA 4DPKA 5ER9A 3C1OA 4R1NA 2W2KA 1B7GO 2QRJA 3NV9A 4WNIA 3JQCA 4GGOA 5CFZA 5KKCA 1E6WA 2EV9A 4GLLA 2NUAA 3PGJA 3ADOA 3EHEA 1QMGA 1N8KA 4Z6KA 2IZZA 4CM9A 2YUTA 2G0TA 1JVSA 2NU9A 3AI1A 1P9LA 2XF8A 2OGUA 2HO5A 3GMSA 4OOFA 3TZ6A 4M87A 1IY8A 3FI9A 2R2GA 2JAPA 3NT4A 3DDNA 4FJ1A 1UXGA 1UJMA 2QZZA 3CUKA 2RIRA 4AJ4A 1TT5A 4DYVA 3QVXA 1HE5A 2VRCA 1JWBB 4FGSA 4FB5A 1NPTO 5THKA 4IDDA 1Y8RA 2YV3A 4WLUA 3H6KA 3PPIA 3FTPA 3QWAA 3PLNA 3I83A 4IDAA 4J1QA 5AVOA 2BLLA 2DPGA 1ZIDA 4ZHSA 5CDUA 2ZQZA 4UVDA 3A14A 5HWSA 3W4JA 1NHWA 1BXKA 4RVGA 4HFRA 5DBIA 4ZA2A 3H7AA 2Q3EA 5JXWA 1HYGA 5JE8A 4DUPA 5B4UA 1PGJA 3DAGA 3AY6A 3G17A 4ZQFA 1BW9B 1HWYA 5L51A 4MINA 5BNIA 3GN1A 3VKUA 3ANLA 2VYVA 1YL5A 3L4BA 1E7SA 3LT2A 2E49A 3H4VA 4CQLA 2CY0A 2VTDA 3RIHA 3PK0A 3RC1A 1U5AA 2EKQA 3ETGA 1DEHA 3OIDA 1WLYA 4MKZA 3JQDA 3DBVO 4YACA 1DFIA 4CLRA 1FF9A 3RFTA 4A10A 3TN7A 1LDYA 2VWGA 5T67A 3ZU5A 1UXIA 1KVQA 5H82A 2X58A 3KUXA 3VZPA 4GKVA 3TZHA 5EN4A 4CODB 2X86A 3TSCA 3UAGA 4R5HA 3M1AA 2PNFA 1ZK1A 3ZV6A 1PJ3A 5ILOA 3OSUA 1ZSVA 5TS3A 3ZCXA 1SBYA 1SOWA 3VPSA 1T25A 3W1VA 1KY4A 4N5LA 4JJIA 1LU9A 5ES3A 5KJCA 1B3RA 1CYDA 3TL2A 4F45A 3PI7A 4PRLA 1NP3A 3EZYA 2J6IA 4U8GA 3KYCA 3RQSA 4IJWA 4OYRA 3LQFA 2W98A 1ZZEA 4W82A 2UVDA 2I67A 1GEEA 3KYCB 4DBZA 3TZQA 4A26A 3JQ9C 4K28A 3WQSB 3LZ6A 5DBGA 3NX4A 2X9VA 3CXRA 1X0VA 4ZQBA 4ESOA 1T4BA 1W6UA 2GN6A 4GVLA 3LC2O 3IC5A 1U5CA 5ICSA 5FF9A 2PV7A 3M2PA 3I9LA 1E3LA 3H8VA 2PD6A 4AJPA 3L9XA 5DN9A 3DOOA 3HG7A 4ROSA 1LDEA 3ULKA 1VLLA 2VUTA 1GYRA 4NK4A 1E7QA 3SLGA 1QRRA 1YB4A 2I9PA 1BXGB 2B37A 3CKYA 2E6UX 5JS6A 1T2AA 1RM0A 2DPHA 5JDCC 4D3SA 4RPGA 1KEPA 3OHSX 1R0SA 1R15A 1WAMA 3EGOA 1ZVMA 3JQAB 5FI5A 3PFWO 1M66A 4Z0PA 4FJ2A 1FXSA 4OJNA 3AY7A 4ZD6A 1PZGA 2BHLA 4DWVA 2O3TA 3RI3A 3ETDA 1PJ2A 4OQZA 3WLFA 3G0OA 3L6DA 4NQZA 1T1SA 3JD2A 1K2WA 1LLCA 2DU8A 2GGSA 4NFHA 4J4BA 3ZU4A 1TVEA 4GWKA 5K6AA 2WWRA 2WYWA 2QHXA 4DREA 1N5DA 3SEFA 4E21A 3GFBA 3ZV4A 2WD7A 4UUNA 4B4VA 3C85A 1OBFO 1U8FO 4JN6B 4XB1A 4CQMD 3HDYA 4RQTA 5HS4A 2O3UA 1ULSA 4AJHA 1OC2A 2D5CA 2O48X 3AM5A 2ZB8A 3QSGA 4MIEA 3WSWA 5BT9A 4NBUA 2P91A 2QRLA 5TQVA 3GY0A 1LTHR 4NBWA 3LT4A 1YWGO 1LEHA 1SPXA 1A4UA 2HRBA 5JDIA 1B15A 1YBAA 4HNGA 3RUCA 4UAGA 1ENYA 2WYUA 4LGVA 5IN4A 1PZEA 3KYDA 4PLGA 4QFDA 3DBHA 2HMSA 2R6JA 2D2IA 2NTJA 4BO4A 4I5FA 1HDXA 4Y6RA 4CM4A 4CUZA 1A7AA 3H65A 4YJGA 3QVSA 2VHWA 4CQMA 5I8ZA 3QA9A 4HWKA 2YDXA 1RJWA 1T2EA 3M6IA 4PG7A 2P2SA 3DB2A 1QV7A 4PLPA 3DTTA 4R9RA 2GERA 4YJGB 3TRIA 3SC4A 4CQMB 4BO1A 2YW9A 5IJZA 2Y0EA 4XD2A 1MB4A 2F1KA 3M1LA 4IZIA 4JBHA 4BO8A 3VKVA 1H5QA 1D4FA 5T57A 1MXHA 1UUFA 3NDIA 3DXFA 3H5AA 3P7MA 4YJFA 2R00A 3DONA 1JU9A 4RORA 3FSRA 1KEVA 5BSEA 4Q3CA 1FDSA 1P33A 1SB8A 1V9LA 3F1LA 4NJMB 5C3MA 4BO9A 2QYSA 1XIVA 2VWPA 4IGEA 4DC0A 2Z1NA 2E48A 1GDHA 1E3IA 3NAQA 1KC1A 2D4AA 2IYOA 1P1HA 5IZCA 5L53A 5TT0A 3G1UA 5JO0A 1E3SA 5A9SA 2XXJA 4P4NA 5C37A 1ARZA 4PG8A 4IZHA 3JQGA 1BGVA 1I2CA 4KOAA 2Q1WA 2IE0A 3KHUA 2Q46A 1ZKMA 3R6DA 2C7GA 1I5RA 5B37A 5A9SB 1PEDA 1PJBA 2O3SA 3WGOA 4YA6A 2EXXA 1R4NA 1Z74A 3JQFC 3R1IA 1K6IA 3NYWA 1UP6A 1RYEA 4FGWA 4E0BA 1A72A 4XDZA 1JLLA 4R5MA 1NYTA 5JMWA 5JDCA 3HFGA 4YAJA 3ZW8A 4XQCA 3OJ0A 5G0TA 1TI7A 3JYPA 2NVUA 1EVZA 5TSDA 5I7VA 5TRTA 2GF2A 4E32A 1JN0A 3C7CB 1LLDA 4PZDA 2Q50A 2IXAA 3GGGA 2BFAA 4BO5A 4RZHA 1QYVA 3D4NA 1ZJZA 3E8XA 3AUAA 3ZNOA 1KVTA 4W4TA 4DVJA 4CL3A 3B1KA 3KV3O 5CHEA 2CDAA 5ILGA 5TF4A 3GDFA 1GTMA 1NM5A 1SNYA 3HUDA 3AOGA 3I6QA 4P8RA 4XGIA 1WWKA 5FWNA 5F5NA 3MTGA 3PIDA 1C1DA 2AG8A 2VQ3A 2AG5A 1Y9EA 2GPTA 1FK8A 4CM4B 2IEBA 4FDAA 5DOVA 3LVFO 1TXGA 2Z5LA 1ZEMA 2GYYA 2VTEA 1H2BA 2ZIZA 3QWBA 4Q3AA 2Y66A 5JFOA 3EDMA 4PN3A 1WW8A 3B6ZA 1IL0A 1ZW1A 4RVDA 4NIMA 4WOKA 4CMGA 1UZNA 2YFQA 2O23A 3ABIA 3ZU3A 2AQKA 2WYVA 1QYXA 1M6WA 4WJZA 4Y98A 4QTZA 4DGSA 3RSHA 4GL4A 4GWGA 4BNXA 4Z0HO 1E1KA 3AM3A 4CV0A 3NTQA 3FCOA 5HRUA 3NT2A 4E33A 2HCTA 4FC6A 4QXMA 3ZW9A 1GL3A 4P22A 4P38A 4GLOA 3PJEA 4FFOA 3UXYA 3ZHXA 3DMTA 1SC6A 3RBXA 1NVGA 4BV9A 2WE7A 5COAA 1BTOA 2JCXA 1Z7BA 4ND1A 1ZNQO 2ZB4A 3JD4A 4LRTB 4R4JA 1MLDA 1YVEI 4BO0A 5L9AA 3IUSA 3CZMA 5I7SA 3RKUA 3RC2A 3AUTA 5BSHA 4NK5A 3TWOA 4HKTA 2X0IA 1OAAA 1XR3A 1V6AA 1XU7A 2YYYA 3KTDA 3NDRA 3QJ5A 3GVIA 1YS4A 4Q3EA 2VRBA 4UREA 5DT9A 3GRKA 5C5IA 1E7WA 2P4QA 4DL9A 1E7RA 2Q1UA 2B5VA 3PHIA 1VI2A 3B70A 4PLVA 2B69A 1F8FA 4FOOA 3Q11A 1UZMA 2DC1A 4YDRA 5F1KA 2YDYA 4HY3A 4H7PA 1V3VA 1LXCA 4UEOA 3WDSA 4YCAA 1KS9A 4DLAA 4J0EA 2IRWA 4R3WA 5KOIA 1AGNA 2FPPA 3GZNA 3AWDA 1JDJA 3TL3A 1WDKA 4A73A 4PIVA 3UKOA 2PH5A 3GT0A 4G81A 3F4LA 3ANMA 1XLTA 1EE9A 5DBFA 3SBOA 1P77A 1DSSG 3GAFA 3EMKA 1U7TA 3CZRA 4FCCA 2JAHA 4L4RA 2AQIA 1U3UA 1XEAA 5FI3A 1N2SA 1EQUA 3A4VA 1HETA 5JW6A 1RKXA 4XGNA 1H94A 5JLAA 2NTVA 5B4TA 3KLPX 2Y1CA 3A06A 1VJ0A 2C54A 5HS6A 1IHYA 3ZH2A 1H9AA 2RH8A 1PR9A 4NU6A 4Q3NA 3S1LA 4CMIB 2V6GA 4TMFA 1D3AA 2X5JO 1NXQA 2JFGA 3O8QB 4YRDA 1NFRA 3JQFA 2Z95A 3HJAA 2EIHA 3E82A 4J9UE 1E3WB 2BGMA 2JD2A 5JAQA 4XCVA 3UVEA 3FNHA 5CEEA 2X9NA 4JBIA 3COSA 4BOYA 4BNLA 1BVRA 2HK9A 3ZV5A 3ZWPA 2EGGA 2O2SA 2VT2A 3GVXA 1Z75A 2GRAA 2VZ0A 1VSVA 2X8LA 5AXBA 1I01A 1IHXA 4IJKA 3VTZA 2VRCD 4WK6A 5B12A 1TT7A 4HFNA 1PR3A 4FJ0A 2J3JA 3ROPA 5IFLA 3JYOA 3LF1A 3ZWMA 2PGDA 3N58A 1OZAA 2PTGA 1QKIA 3OBBA 4L76A 3T4EA 3UHAA 1F12A 2PKQO 3WR5A 5CDGA 5DP1A 3D4OA 3WYEA 4M86A 2Y05A 4L8VA 3GN2A 4R69A 3UICA 1CDOA 5CPFA 2AE2A 1HTBA 4YQZA 4ZQEA 2NSDA 3T7EA 3ZHZA 4B7XA 4DIFA 4XYBA 4ZJUA 2RHRA 2FSSA 4IS3A 1R0LA 4GGPA 4YBZA 3H3FA 1R4MA 2ILTA 3K96A 3OJLA 3PRJA 1W8DA 1C1XA 3DWFA 3KXDA 5L95A 3P19A 2PY6A 1CRWG 1XWFA 5TNXA 1D8AA 1C0KA 1LC3A 4WGGA 1ZK3A 1FDVA 4RPHA 1GU7A 1LLQA 3WNQA 1LA2A 4NBRA 3L4SO 4ZVVA 3ZWAA 4YJHB 4FD3A 1D7OA 3GF4A 4OKNA 2BGLA 1NQ5A 1R16A 3VVBA 4BKPA 1I10A 4RF4A 3RUHA 3V8BA 2GD1O 5JY6A 3E5RA 3NTOA 2OP1A 1GUZA 3MJCA 5JBIA 3ADPA 4DXHA 4XIYA 4CMEA 4PLYA 3O03A 2NADA 4M55A 1NPDA 3TZCA 1J6UA 3JD3A 1D1SA 4GSLA 2HK8A 2HKIA 4OH1A 2ZYGA 3DBRB 3VOSA 3ZWOA 5C7IO 3I9KA 1MXFA 5BR7A 5JYEA 1GV1A 1IYZA 4MVJM 4JBGA 4XJTA 5ENVA 3D5TA 3LT1A 1LI4A 4YT2A 3IAHA 5EIOA 4D46A 2QG4A 2EKPA 1P1RA 3P2YA 2DQ4A 1IB6A 4WLEA 2X6TA 1XG5A 1O6ZA 2HLPA 4R3NA 2P9EA 1FDUA 1P0CA 3WTCA 4D45A 4CMHA 1XDWA 5IXYA 2I65A 3PEFA 1HKUA 3OETA 4K9DA 3WWYA 1K0UA 4CMAA 4BB6A 1QORA 2EWMA 4IIVA 1E1MA 2J3KA 2UAGA 4DMMA 5LDHA 1H6AA 4J7CA 1U7HA 4R1UA 3CMMA 1T2FA 3GUCA 3W4IA 5KCZA 5JNLA 1GFSA 1DB3A 3JQBA 4BNIA 4JJFA 4YTEA 1LUAA 4KTTE 3FNGA 1LQUA 2IXBA 5IN5A 1YKFA 1NFQA 5KWEA 3RKRA 2X22A 3MJVA 3ROMA 3E1KA 3ETEA 4Y9DA 3DO5A 3OIFA 2HUNA 2JD0A 3FD8A 1JKFA 4WCFA 4A5OA 1F0YA 2AQ8A 4D41A 3WBBA 1EFKA 4TRJA 3VVCA 2O2YA 5AYVA 2P9CA 2DT5A 4TWRA 3CEAA 2ZYDA 1PQWA 3P5SA 4XR9A 4CM5A 1VJ1A 5I9MA 4PZCA 1F8GA 4IDFA 2OXIA 3DZIA 3M2TA 2W2KB 1DOHA 4RPLA 4LISA 4B8WA 4MVJD 2Q4EA 1LRLA 1CQIA 2GUGA 1HDGO 2OZPA 1Y6JA 3PVZA 3ROQA 3ZNNA 1B8UA 2B4QA 2EJWA 4U7WA 4NNJA 4OXNA 4YJHA 4PGFA 3ZWCA 4RLSA 5JCJA 5EJ2A 1PZHA 2NQ8A 1EFLA 2O4CA 4CMCA 2QX7A 4PCVA 4MDHA 1Y5RA 4L9RA 4GAEA 3L4BC 4Y6SA 3U4DA 4JGBA 3DZKA 3RJ9A 1QXSA 2CFCA 4EJ0A 3GZNB 5GY7A 1DIGA 4UUMA 4GQAA 3PZRA 5HM8A 3A9WA 4RVFA 2X1HA 3A28A 5COQA 5I7EA 1DIRA 1HRDA 1XA0A 4MVJA 4GKBA 5IAAA 4YAGA 5F21A 3RUDA 4IY1A 4EZBA 4EUFA 2RBEA 1YJQA 3E18A 4FN4A 3WXBA 2FPGA 3IJRA 5G0VA 4YPOA 4CL8A 4RJTA 2FP4A 2CSUA 2XPCA 5F5LA 3AY3A 4CLRB 1EUZA 1YRLA 4OOEA 5KVQA 2DLDA 4XYMA 4ZICA 3BHIA 5JCJD 2AEJA 5CDSA 3UFXA 2BKAA 1NQAO 4QO8A 2DTDA 2XAAA 2Q2WA 2ZATA 4QUKA 3LLVA 1UP4A 3OJOA 4R9SA 5DULA 3U4HA 4QFCA 4INAA 3DZJA 3D3EA 4JXKA 4E5YA 5JAZA 3S2GA 3RBVA 4GSKA 4XJSA 3U4IA 3FBTA 2GZ2A 2Q4BA 1JWAB 4GH5A 3H9QA 3OA2A 3PHLA 4YAEA 2EW8A 2H5LA 3O9ZA 3EW7A 3OM9A 3QLJA 5KJFA 4UVEA 3TZKA 5DCYA 2VHVA 3E9QA 3PGXA 1YL7A 4TZTA 3DC2A 1LDBA 3H9UA 2B36A 1L7EA 2BI7A 3EVTA 1YB1A 2J5RA 4DIBA 4AJEA 3HB5X 5MGBA 4ALJA 2CVQA 2HMWA 4ITUA 4J90A 1BDMA 4KDEA 4AJKA 3DBLB 1E5LA 2G5CA 3D5QA 2AEFA 5HBRA 3RVDA 5T8KC 1JA9A 4KUHA 1WDLA 4NDNE 4EGFA 2NV6A 4R1TA 1LJ8A 1PS8A 3F47A 4TVOA 3WGYA 3FHLA 3AW9A 4GX0A 1QR6A 3PLRA 3ZWBA 3V5NA 4RF2A 5KVSA 3VTFA 3MOIA 3TDKA 3I6IA 4IS2A 3R3SA 3WGZA 4D0SA 2DBZA 3VPHA 3ZU2A 5IDQA 4Z0TA 1IE3A 1S6YA 4E2ZA 3GVPA 1YDEA 3OIGA 2HJRA 4IDCA 2PWZA 3BXXA 4CLEA 1Y7TA 3VHRA 1JQBA 2C29D 3LLSA 3BTUA 3GFGA 1GV0A 5CEJA 1W4ZA 1EE2A 1YQDA 5F3RA 1YQXA 4PFJA 3OP4A 2HDHA 4O63O 2Y0DA 4NH4A 2ZKLA 1EVJA 1M6HA 2P4HX 1GEGA 3QIVA 4FFNA 4XEHA 4B79A 2W2LD 4O59O 3ENNA 1DIAA 4XRGA 1P44A 1OFGA 6LDHA 4CPDA 3WOHA 1ZK2A 1ISFA 3MCVA 2X5KO 2DFDA 1K89A 3TQHA 1P74A 1HSZA 1SO8A 4CJXA 3DHEA 1P1JA 3L9WA 4QO7A 3JQAA 2GN9A 2ZJ1A 4HP8A 3LYLA 4QQRA 1TEHA 2PR2A 4KP7A 2NVUB 4J9VA 3DMYA 1A5ZA 2P5YA 1JAYA 4IDGA 4D43A 1O5IA 4Y67A 3VH2A 4DBVO 3KVOA 3OEWA 1J49A 2OMEA 1NQTA 2NACA 3A1NA 2G76A 4R51A 4E4YA 1UAYA 4MOWA 1PJSA 3BA1A 1X7GA 1XKQA 1BHSA 2EG9A 4WLOA 3SLKA 5I8WA 4EYEA 4IUYA 3W8DA 1NX6A 3TOXA 4OGWA 4OO3A 4UEKA 4YT4A 3UGKA 1AXEA 4NFYA 4BNWA 1U9JA 5TC4A 4PLFA 5G4LA 1B8PA 1DAPA 3F1KA 3CINA 4OSPA 1P3DA 3ZN2A 2QRKA 5JMPA 1Y9AA 5AOVA 1B8VA 2PH3A 3RFXA 5B1YA 4XDYA 1HE2A 1HLDA 4AICA 1NHGA 2JKVA 1ENZA 2X23A 4JJGA 3X2FA 4BGIA 1LBEA 2CD9A 3BZUA 3FPLA 3L6OO 4KQXA 1Z45A 2FMUA 1YOVB 3UOGA 4U6SA 1LSJA 3MOGA 1ZEJA 2EP7A 4ID9A 4ALNA 4E31A 1JAXA 1A4IA 4KWHA 4Z3DA 3WBFA 2YHUA 1ULUA 2J5QA 3I5MA 1HF3A 1I24A 4BB5A 1TA4A 1YJ8A 2I66A 2NLOA 4ZQHA 2V7PA 5BSFA 4BNUA 4CMJA 4UUOA 4FFRA 3WFIA 2WSBA 1TT5B 4CLHA 4YQYA 2DBRA 5A5FA 1MFZA 3QE3A 4RF3A 3H2ZA 2EKLA 2A92A 3GK3A 4BNNA 2Z1MA 3WNVA 4HNHA 1H6CA 2PFGA 2PZJA 4RDHA 4HFMA 3GGOA 3DZFA 3INGA 1UP7A 1QLHA 2AQHA 3RD5A 3CE6A 1T2CA 4Z3KA 3FWZA 4WPGA 5JDIC 1XSEA 3INTA 3GPIA 3PYLA 1DDOA 4QX6A 4NR0A 1JKJA 2HRZA 3GEDA 1W73A 3ZZNA 3D3WB 3BMQA 4J91A 4P4GA 3OF2A 4R41A 4RVHA 2Y99A 5FFFA 1ORRA 2O3QA 2OBNA 3AM4A 3JD0A 4YRBA 1G6KA 4PLHA 2AW5A 2Y68A 3BMOB 1YONA 4NBTA 1A27A 1ENPA 2F00A 3JQ6A 2OOSA 2X5OA 1ISIA 3QVWA 4DIOA 1BW9A 4DRYA 1VE9A 1PQUA 1PSDA 2LDXA 2UYYA 2Y1FA 4PZEA 3LC1O 4AL4A 4G65A 2EW2A 2CDCA 2WD7B 3F4BA 3PIIA 1UH5A 4E2YA 4BNHA 1NAHA 2YFHA 3ROKA 4CR7A 2VNAA 1T26A 5K6AC 4TRRA 4KUEA 4B7UA 4A7PA 2YJZA 4BQPA 1EMDA 1Q1NA 4R1SA 1NFFA 3GNSA 3NGLA 2CZCA 2V6BA 2VYND 3EAGA 3ZHBA 2EERA 2A9FA 3WTBA 3U3XA 4G2NA 4CM8B 4E3ZA 1HE3A 1I3KA 1P31A 3BTOA 2Q2VA 1K3TA 1VL8A 5T5QA 2QZ9A 4KZPA 3K2EA 4IM7A 3ZNPA 3WGQA 2JCYA 4AJLA 3QRWA 4WLFA 4B4UA 4I08A 3DBHB 5DNAA 1A7KA 4U0KA 4NJOA 4B8ZA 3HDQA 1ONPA 4UUPA 4CLXA 4EITA 1I2ZA 3HN7A 5KVCA 1RYDA 1PQPA 3PDJA 4Y6PA 3S2FA 4FFMA 1NR1A 4UVHA 5EQDA 5JO9A 4GMGA 3WGTA 4AJIA 5GZ3A 1UXKA 2DVMA 5EINA 3I9JA 1E3WA 1F06A 2BMAA 2BI8A 1HDCA 3DFZA 1FDWA 2PZLA 1Z82A 4TQGA 4R16A 1C0PA 4BHTA 3UCXA 5EESA 3IOYA 4KWIA 3D64A 5C7OO 1DAOA 1HDRA 3Q9UA 4LVUA 2OFPA 4N5MA 4YAIA 1V35A 2D59A 4GI2A 3QVOA 3O4RA 1U28A 4J1TA 1VKNA 3KRTA 4H3VA 4PLZA 2VWQA 1P1KA 4BO6A 4S3MA 1YGYA 1X0XA 4WLVA 4L74A 1BXGA 3IP3A 3SJUA 5A02A 2Q49A 3JQ8A 2IYPA 2A35A 3OJEA 5DOZA 4FSHA 5ICMA 3BMQB 4J2OA 2C0CA 3QQPA 1ENOA 3LF2A 2D3TA 4E5MA 1R6DA 3R0IA 3VDQA 4ZGWA 2HQ1A 3RCBA 2CUKA 4OKIA 2B0JA 3L0DA 1KOLA 3HFSA 1BRMA 3BAZA 3OJFA 5L4NA 1DFHA 4D3DA 2A4KA 1YBVA 3E6AA 5ITWA 4B3IA 3H3JA 1NNUA 1C1XB 4JK3A 5IG2A 1ZXBA 3F5QA 2B4RO 4HBGA 2IODA 3KETA 5A4DA 3Q3CA 1LSSA 3V2GA 3NDJA 3WJAA 4LCJA 4GX1A 2Y0CA 4KDFA 3V2HA 4PLCA 1BMDA 3PWSA 5A5EA 3BHJA 1EK6A 7ADHA 1ZMOA 1EZ4A 1MC5A 1EQ2A 4YVFA 1D1TA 2V6MA 5IZCC 1KEUA 5A3JA 4E13A 4AFNA 4HADA 4ZN6A 4A2CA 4RO0A 9LDBA 1H0KA 4J4HA 4EEXA 3GVCA 2J8ZA 1E3EA 4CR6A 3RAJA 5U1PA 4DLLA 5KKAA 5L7TA 4D0RA 4E12A 4B4WA 2VN8A 3DBRA 1G0NA 3ZHYA 4NU5A 4BNTA 4NG5A 4TRMA 5LDGA 3EK2A 1PJCA 2LDBA 2YY7A 3KSDO 1UDCA 3JD1A 1GZ4A 1GPJA 1XCBA 5GZ6A 3GG9A 1NVTA 2VYNA 4II2A 3N7UA 4EBFA 3E48A 1ADBA 2E82A 5TT1A 1YOVA 5IF3A 2QIOA 4R01A 4IJUA 2VZ9A 4MVJH 4CMIA 1HYEA 4N54A 4PG4A 1B14A 2H1SA 5G4KA 2O3RA 5I9LA 3ZWXA 2D1YA 4Q9NA 5AXCA 2ZCUA 3QY9A 1PZFA 4LMRA 2AE1A 2PGJA 4GX2A 5CPBA 3ANNA 3HDJA 3TJRA 2UUOA 1ISGA 4NBVA 2Y1EA 4RZIA 2FR1A 4I1IA 4TROA 2UV8A 2EHDA 5IZ4A 1AUPA 3UCEA 1PS9A 4CM6A 1DHRA 1UDBA 3MJTA 2P68A 4BGUA 3MTJA 3U5TA 4OMUA 3I9NA 1HDYA 2JJYA 4CLOA 2X0JA 5KIAA 1LRJA 1ID1A 3GNQA 1U3VA 2O4UX 1VL0A 4AG3A 1DLIA 4RPKA 2DM6A 3EVNA 4L4XA 1EEHA 2FSVA 2PLAA 3ITKA 5F1OA 3BMNB 4RDIA 1DRUA 1RM5A 4XQGA 1B0AA 4I8XA 3SJ7A 3RUIA 4XQEA 3PQDA 3K9QO 5BSGA 3ZWNA 3W6ZA 1VC2A 4MKRA 3E03A 3GC6A 4LVCA 3GDOA 3NJ4A 3WS7A 1VKOA 3FRJA 2Y93A 1NPYA 1HDZA 4WOJA 2CVZA 4RQUA 4P4LA 2C2YA 1KVRA 4RVSA 1YL6A 2JHGA 4EJMA 1E77A 1IUKA 3KYBA 3WB9A 2NTNA 1A9YA 1W0CA 5JY1A 4I9HA 3MWDB 4XRRA 2FRDA 1YXMA 3UH1A 3H9EO 3V2UA 4ZQGA 1CJCA 4I9NA 1CQJA 1XU9A 2H9IA 4WLNA 2IDZA 1GUYA 3NGXA 4KMSA 1AXGA 2BELA 3PJDA 3PYXA 1I0ZA 5ER6A 4BKRA 1WZEA 2ZCVA 4DA9A 1GY8A 1SEVA 1CEQA 3QHAA 3BHMA 3ZWYA 3SX2A 4XKJA 3INRA 2BD0A 4BUCA 4CV1A 3K2BA 1JKIA 3IQDB 5EL0A 1I33A 2CF5A 3SC6A 1T24A 3I9MA 1N9GB 4CQLB 1HZZA 2GO1A 1J4AA 4K1LA 4F6LA 1JW9B 4I5GA 3Q6IA 4EJ6A 3ZWVA 2ZTUA 1GQ2A 4F3YA 1LLUA 1WVGA 1XELA 3RBZA 3DHNA 4C4OA 4BIIA 1GADO 1T2DA 1ZO8A 2X9GA 4MIOA 1U8XX 1VM6A 4DYDA 4NZ9A 4F6CA 2ET6A 3V1TC 3I23A 5EERA 3Q9NA 2D0IA 2VHYA 3VH4A 4A03A 2VCYA 1U3WA 3H9GA 3K5PA 1R0KA 3VC7A 1H2HA 2QW8A 4BKQA 3HNPA 3I52A 1ZH8A 5A1TA 4ALMA 3E9MA 3UW3A 3R3JA 5B4VA 1U1IA 2D5AA 4L73A 4IGFA 5K9ZA 5CP8A 3VAZA 4J7XA 2RCYA 2ZYAA 2DBQA 2UDPA 1DC6A 1OMOA 1ZBQA 1ONOA 3JQAD 1HSOA 3RU7A 4WCFB 4DC1A 3Q1LA 1SCUA 1B26A 1E0DA 1KIFA 2C2XA 1VL6A 5LC1A 4AJ2A 3IKVA 1R37A 5BNTA 3I9OA 3PQEA 3ZGYA 3AFNA 4BKOA 2B4TO 3AU9A 1UXJA 1X1EA 3K73O 3F9IA 5GZ1A 4E5KA 4MP3A 1PGPA 4J4TA 3BTVA 1PGOA 2C5AA 2GCGA 3DZHA 5IDWA 1QG6A 2PD3A 4RGBA 3JQ9A 1E1LA 2V65A 4WEOA 3DOCA 3OQBA 4XWYA 3HHPA 3AOEA 5F1PA 1QV6A 2B83A 4I5EA 3PQFA 5EQFA 2IEDA 5EPOA 1DJQA 3KM0A 4LN1A 4YEDA 5JC1A 2JFHA 1EBUA 4LRSB 1PU2A 2SCUA 3B20A 5TX7A 3S2IA 4D42A 2Y1DA 3UCFA 1YB5A 5KJ1A 1ZMTA 1I3NA 4LSMA 2GZ1A 1R66A 4PLWA 2NNLD 2I6TA 2NVBA 1PL7A 4BNVA 4MIYA 1H93A 2PA3A 2Q1TA 3PZBA 4BNJA 2HAEA 2X4GA 2VNSA 4FBGA 4KQWA 5ADHA 3C3XA 1ZCJA 1MX3A 3C7AA 1VRWA 2Q45A 3BMCB 4ND4A 4TZKA 3WGGA 4W7HA 1R12A 3SXPA 4ND2A 4XQ9A 3JYNA 5GMOA 3G3EA 1G1AA 8LDHA 5JAIA 4QT0A 3BMCA 1YBMA 4J0FA 4B7CA 5L45A 4N7RA 1E3JA 2WDZA 3GAZA 3I4CA 3ONFA 5JC8A 1WDMA 1PJLA 4ND3A 4S1VA 4EUHA 1HL3A 4FS3A 2FOIA 2GN4A 3UF0A 1KY5A 2I99A 3G49A 1XYGA 3I1JA 1I30A 3PYMA 5JYDA 3D1LA 1OOEA 1I8TA 3VZSA 2X7HA 4KUGA 3DAPA 3AK4A 5BQFA 1KEWA 4GBJA 1A9ZA 2VHZA 4EW6A 1Q7CA 4M89A 4Z9YA 1ZXLA 4OL9A 1O94A 1PL6A 2DFVA 4D79A 3E5MA 1U4OA 2FR0A 2GNAA 4DPMA 1Z7EA 1WZIA 3D0OA 3PWZA 2VOEA 2WJPA 4XA8A 1IOLA 2GN8A 3GZ4A 3H5NA 4U0JA 5KVVA 1H6DA 1HZJA 4OAQA 1RPNA 3VPFA 4AJNA 1GZ6A 5U9CA 3KLMX 3CPSA 3IJPA 4RLHA 7MDHA 3MJ4A 3HADA 1GCOA 1UXHA 3CH6A 4EUEA 1X7DA 5CDYA 4IQ0A 3H5RA 1C0LA 3LK7A 4EDFA 1IULA 1P45A 4W6ZA 5T64A 2E4AA 4UVGA 1P0FA 4YJFB 3IL2A 4D44A 4C7JA 4HV4A 5THQA 2C7VA 4R68A 3N74A 1GD1O 1KC3A 3GQVA 3OFSA 3Q0EA 1ISHA 3HZZA 5L7WA 1S7CA 5A3VA 3OA0A 4BO7A 1KYQA 4QEDA 4MVJG 2Q99A 2VUSA 3GNTA 3NKLA 1NVMB 4E2XA 4K6CA 5DZSA 1SB9A 2AMFA 2EF1A 3HE3A 3ICCA 3NT5A 2PD4A 3EY4A 4YWJA 2IZ1A 1ISMA 2RH4A 4B3JA 5A9TA 1I2BA 3GPDG 2PKRA 3U62A 2PGLA 1N1EA 3JQGB 4JLWA 4E30A 3ZI0A 3GOHA 4IQGA 3MWEB 1C3VA 1N7GA 1K5HA 1ZJYA 1YDWA 4BNZA 4PG6A 1Z73A 3L77A 4OXKA 1DPGA 3EZLA 5FEUA 2Y1OA 3GDGA 4II3A 2ZB3A 2W2LA 3LT0A 2I3GA 4H16A 2DBVO 1LC0A 4BGEA 2VT3A 5T8KA 3U09A 1AN9A 5COBA 3V1YA 4XZ3A 3P2OA 1Q7BA 4OQYA 2J3HA 1MC4A 1TB4A 4BGVA 2NWQA 3AOEC 4IIUA 3WIEA 2WD8A 2BRUA 2GDZA 2X0RA 4I9UA 4Q3BA 4JP2A 5CAEA 3S8MA 1HLPA 3FN4A 3DQPA 4CLDA 1T4DA 1J0XO 3HN2A 2IZ0A 5TIIA 1DHTA 5G0WA 1WXDA 4U5QA 3GLQA 3AI2A 2J5KA 3CIFA 4HFJA 1KBZA 4UVIA 4BMSA 1DC4A 3JQEA 1DXYA 1T1RA 5AQ1A 3QWFA 5ITVA 1NR7A 4J7UA 5G2OA 4O1MA 5CG1A 3NJ8A 5JCXA 3TNLA 1DC3A 1XGKA 3KO8A 5EMHA 1GCUA 4IMRA 1U2DA 2A94A 4H15A 2NU8A 4GMFA 5A9RA 2OP0A 3PTZA 2RAFA 1IZ9A 4K26A 4RPJA 3U4CA 3F46A 4MPDA 4MVJI 1M75A 3O38A 1Q0LA 1BSVA 3KOUA 3PDUA 4YJDA 1NTOA 1OC4A 4N5NA 3NTRA 5A04A 1DFGA 1MG5A 4PRKA 3GRPA 1ONNA 3L07A 4YXFA 3C24A 1Z6ZA 2OBYA 3D3WA 1F17A 3VH1A 5TJ9A 3QVTA 1EBFA 4WECA 2Y1GA 2AHRA 4W7IA 1DC5A 2GR9A 3AFMA 4J2HA 4F46A 2JL1A 4FW8A 3RWBA 3U9LA 3WJ7A 1GQQA 1NWHA 3U49A 3WQRA 3OEYA 5MDHA 5AXAA 3QP9A 4WASA 2HU2A 4Z9FA 3W8FA 1UZLA 2V6FA 3ST7A 1LDNA 3EUWA 1FJHA 1M76A 1YE3A 9LDTA 1UDAA 2R00C 1GPDG 4WUVA 5A05A 4XYEA 3WMWA 2YHIB 2YQ4A 4FFPA 4LK3A 2YV2A 4CUKA 3B1JA 3O26A 2QQ5A 2G82A 3EC7A 1L1FA 5TLSA 3H2SA 1QYDA 3C1TA 3FNEA 4M8SA 2E37A 1MUUA 3PJGA 3WGHA 1DRVA 5L4SA 4BNGA 3DTYA 5C7LO 1Q0QA 4W99A 4XYGA 3WICA 2EEZA 2JFFA 1MA0A 4J43A 4MVJE 5L7YA 4CM8A 1X13A 5L40A 3K31A 2GASA 3BMOA 4M49A 4ZRMA 1H9BA 2WMDA 4BO2A 2PKQP 3FR8A 2YQ5A 3ORFA 1QYCA 4L0QA 2W8ZA 4NHEA 4FFLA 1X1TA 3CMCO 3KZVA 3MEQA 3DZGA 3K30A 3Q2KA 2HJSA 4XR4A 4BO3A 2JCVA 3T4XA 3PP8A 3W6UA 2I5PO 4CR8A 3MJSA 2CDBA 2OHXA 3X2EA 3GMDA 1WPQA 1CETA 2YZ7A 4FR5A 4E5NA 3DOJA 2EP5A 4PG5A 1V0JA 1BWSA 1LSUA 2VWHA 1Y5MA 1E1NA 5J23A 2BFPA 2Q1SA 2W90A 1JVBA 2FZEA 3DBLA 4MP8A 4XIJA 5T6BA 2PZMA 3WSVA 3ZV3A 4AJOA 1K6JA 3RROA 3GR6A 2CVOA 1AE1A 1HXHA 2JHFA 3IP1A 1VJTA 1EUCA 1X7HA 1Y1PA 4JNKA 2FHSA 5H83A 1KVUA 4A27A 1O89A 2POQX 4BV8A 1WMBA 3IKTA 3JV7A 3ASUA 2FPIA 3I4FA 4FIZA 1XQ6A 5I7FA 1LNQA 3JQ7A 2ZQYA 4YT8A 5KNLA 4Z9XA 2C5EA 3WWZA 1XQ1A 3T7CA 1LX6A 4Q3DA 3C8MA 1F14A 3JQ7B 3WMXA 4J1SA 1BVUA 4ALLA 4UULA 2AXQA 4TKMA 1L7DA 3BYZA 3GH3A 1UAGA 4OIMA 5FYDA 1FMCA 4BMVA 1A71A 1PS0A 4YRAA 3GA0A 5BNFA 4MO2A 5CG2A 2EGHA 2RHCA 3DFUA 4QSMA 3GGPA 1UR5A 4B4OA 5KJ6A 2CNBA 3I3OA 3TF5A 5CEFA 2B5WA 1ADFA 1DIBA 4MP6A 3F6YA 4CLOB 1U4SA 1CIVA 3VZRA 3ZDFA 2YHIA 4PVCA 4HUJA 4NJMA 3L6EA 3U0BA 3WG9A 1B2LA 1M67A 1WNTA 2J3IA 1EVYA 1E7MA 3JQBC 1LRKA 1GR0A 3BMNA 2CF6A 3STHA 1CF2O 4LMPA 3WFJA 2C07A 1E7YA 1MV8A 1E5QA 5H81A 4E2WA 4G5HA 2ZTLA 3PFFA 5A06A 2BGKA 2HMUA 1Q2XA 2H6EA 3GHYA 4DQUA 1GYQA 1KERA 1R4NB 4W9NA 1DBVO 4JQCA 4K6FA 5CDTA 1HYHA 1V3UA 4AVYA 3FBGA 1V3TA 1NBOA 3TFQA 3RU9A 1LDGA 1QSGA 4WKGA 4OHUA 3K8ZA 3OECA 3DMTC 3OQ1A 1FDTA 2Y67A 4MJLA 2FN7A 3QWIA 3QWHA 4UEJA 4X54A 3FF4A 4IDBA 1PGQA 1HEUA 2O7QA 5HA5A 4LCEA 3WIDA 3W4KA 1AHIA 4XGKA 4J49A 4ZU3A 2ZTMA 4J16A 3D4PA 4MVJP 1QP8A 3G79A 1MG0A 3LSYA 1EK5A 4YAKA 4ONEA 3ON5A 3DZBA 3VPGA 1NWCA 3G1TA 3BTSA 4PLTA 3OMLA 1B16A 1EDOA 2C82A 1OI7A 3F5SA 4N18A 1P1FA 4FPXA 1IPEA 5DCWA 3GEGA 1GQYA 1VSUA 1KETA 1PJTA 1I3LA 3OQ6A 4JX8A 3WLEA 1EDZA 2C20A 3PJFA 3RUAA 3S2EA 3F3SA 4JIGA 3VH3A 3RUFA 4FQ8A 2WE8A 4HXYA 4CV3A 1Y8QB 4DMLA 1ZUD1 3GEMA 3RFVA 2XOXA 4BMNA 2JD1A 4IPTA 1CWUA 1P1IA 3JTMA 2P9GA 2OO5A 2UUPA 4WE3A 1PL8A 3PXXA 5L3ZA 1E6UA 1SEPA 2FZWA 1AHHA 3CTMA 3JQ8B 3B1FA 4JP3A 4NMHA 4BVAA 1HDOA 2O50A 3Q2IA 3JSAA 3VZQA 4IXTA 1O95A 1EUDA 2C59A 3ZWWA 3RASA 4ND5A 4WNCA 8ADHA 4B3HA 2TMGA 4GX5A 3NUGA 3WQQA 1MGOA 4BNYA 4ALKA 4LW8A 3DAFA 2Q2QA 2ZK7A 1ADCA 2TMDA 3AUSA 4LSWA 3GG2A 4R54A 3KBOA 4DTIA 4RCVA 2I76A 5G0UA 4YB8A 1J5PA 2WM3A 4OSOA 1NAIA 3FTNA 3ICPA 4IJVA 1YO6A 4ZRNA 2G17A 4TVBA 2CMDA 1BG6A 3NRCA 4DQVA 1IZ0A 2FWMX 3RJ5A 1C0IA 1QYWA 4YT5A 4OXYA 1RM3A 3IIEA 4TSKA 2ZJ0A 2DKNA 3HDHA 5TGDA 4IQ8A 3CSDA 3KB6A 4MVJF 1TLTA 2D8AA 4IXWA 1GAEO 1PGNA 2O7SA 2ZB7A 4U6QA 1DLJA 1IPFA 3RC7A 4CM1A 1PIWA 5LCXA 3DL2A 1V8BA 4CMEC 1NQOA 1PX0A 1QLJA 5JAMA 3C1AA 4CM3A 3TFOA 2QYTA 4XYLA 1DRWA 3ASVA 4C7KA 1M2WA 3LDHA 2NM0A 3JCZA 4NFSA 3WGIA 1C1DB 1LDMA 2FY8A 4WCFC 3DR3A 5JSFA 1Q7GA 4Y8VA 4BKUA 2PZKA 2DTEA 1HE4A 4CM7A 3UUWA 1LSOA 1E92A 1CERA 1ML3A 2NU6A 3JYQA 1I36A 2DUWA 3EYWA 4AJJA 3PHJA 2VZ8A 4W9NC 1PJ4A 1DO8A 1RWBA 4CMBA 3IDSA 3D7LA 2VHXA 1X14A 1G0OA 4RL6A 2OORA 4TKLA 3FNFA 3QW2A 4E6PA 3LC7O 3DEYX 2HMTA
chains in the Genus database with same CATH superfamily
4CKEB 3OZRA 4HAZA 4Q39A 3IRUA 2BGNA 3RYIB 1Y82A 2C4VA 1M74A 5CB8A 4JL8A 3EG9A 1B42A 4IMPA 1O0SA 4OJTA 1S3IA 1RPJA 2JLQA 4LHVA 1M0EA 3G5TA 1UCFA 1Z4NA 4RU1A 1XEWY 3OUZA 4RLQA 3WL3A 4PIMA 1WABA 3VA7A 3G0DA 3OIVA 4EHLA 5LQNA 1PUXA 2PE5A 3KEFA 4DV5B 4TV9B 3FWNA 3KEOA 2AZDA 3JYLA 4QXRA 4X7MA 5BN5B 5A62A 4WSOA 5IYZA 3KC2A 2YV1A 3S0JA 2H07A 1PHRA 1KBOA 2GHRA 3RRMA 1K1EA 3ZXIA 2Z0MA 1JG3A 4N9QA 5GIPE 4HDKA 3H5IA 3LA8A 1GZ3A 3QMVA 4JROA 3UN1A 1JHQA 1TU3A 4RF5A 4RMGA 4OJKA 2CJFA 3RUEA 3C6MA 4UNQA 3ER9A 3VMFA 1KXJA 4GEKA 4BRZA 1OZFA 1RS0A 2BEVA 4Y0VA 2R47A 3V1NA 2EBUA 2FEAA 4L75A 5AVJA 3IP9A 1KFEB 4HWSA 2IDKA 5FQOA 5GPBA 3UWSA 5I9NA 4KREA 2Q3MA 3P9YA 1WXGA 3WRYC 2FE1A 1BXZA 2YWEA 3WB0A 4P6VF 1NJ1A 3O73A 4OQEA 4FP9A 3NOVA 1DNPA 1Z08A 2LE0A 2XNDA 3GRVA 4BECA 3COPA 4KRGA 3H9JA 1N0HA 4X1IA 1JQDA 1T9BA 2IXDA 3AUUA 3FKSA 3SNKA 3ZHTA 2GA9A 5FKJA 3SSMA 2I0FA 5AUPB 1DTWB 1A2QA 4ZI3A 5CFOA 4LJSA 1QHHA 2POCA 3A37A 1Y98A 3PX2A 5G1PA 4QG7A 4IDPA 5DHRA 4FGUA 4YRKA 3IQIX 3SM9A 1NMYA 4O6VA 4ASUD 2GKGA 5HGJA 5KAPA 2XADA 1G7SA 2IIBA 1JTVA 3FYSA 2V5UA 1FMFA 1KO8A 4XB2A 3WL6A 3PWKA 1ZHOA 1YJCA 2XR1A 1NW4A 3KDAA 3T12A 1SU8A 3SMQA 4R2XA 2WAOA 3IAM6 4NVRA 1MT3A 1EVEA 5J4VA 3NHJA 3PHGA 1SBHA 2HU8A 2YV4A 3ZI4A 3QVLA 1N25A 1ZM2A 2OD7A 2QQGA 1OKKA 5JH7B 1LBSA 3VBEA 2A1TS 1RQ7A 1L7RA 1XZKA 2RK3A 3DDWA 3M9LA 3N2KB 4NI5A 4NENA 4PPQA 1XHLA 2H63A 3OH8A 2P1ZA 4TS3A 4FT4A 3AB8A 4JP5A 5KNCH 1YZUA 3HI6A 1VL1A 4RY2A 5AKZA 3WGLA 4CG1A 2HQOA 4CTMA 1FOEB 2UKDA 4LBYA 4WEQA 3K92A 1J2RA 4R2KA 5H3CA 1MBZA 1Q17A 2AI3A 3GNLA 4GZ5A 3VOBA 2F1HA 1NQUA 4DCUA 1RR6A 4J6FA 2JIRA 1DAEA 2OV8A 1H6BA 3K0AB 3MTBA 3QFTA 2R2AA 4XX0A 1CT9A 1IM5A 1PWZA 1B0ZA 1EVIA 1THTA 2IYUA 2ZJBA 2ZR0A 3B6IA 3GJ6A 3NEPX 4FC7A 3BIOA 4HX5A 4Q7MB 2GZ3A 2X77A 2JARA 4MUEA 1BNCA 4US0R 6ADHA 1BU5A 2O19A 1C14A 1KYTA 2I3AA 5DNCA 4CM9D 1IN5A 4MI6A 4AIRA 3AWIA 2RHJA 5AHWA 1DQPA 5AXDA 2WW8A 4IIJB 5DN6A 3WGNA 2HCFA 2Z8ZA 1F4LA 3GBPA 4MUGA 5EMMA 3WX0A 1YS1X 2RHDA 1V1JA 5DW0A 1GUDA 2G1JA 4B3RB 3T7AA 1EWYA 4PAOA 4LVOA 2A5GA 3F8WA 1GYPA 5DHFA 4L2IA 3C7DB 3GQBB 2I3ZA 3MJEA 4GOKA 2O8CB 4H1TA 4L3VA 3C1OA 4P5DA 1OLXA 3PCTA 4UUQA 3K53A 2W2KA 5JXHA 1URPA 2JB9A 2R6CA 1B7GO 2V58A 2QRJA 4W5WA 5AJVB 4DG5A 3TXXA 3OTHA 4BEBA 1XRSB 3H42B 2BUAA 3KPJA 4FYKA 1SGWA 3DLHA 2NVOA 4JI8B 2P9BA 4TLBA 4M9SA 4D99A 4ZI7B 2BEKA 1QMGA 2HIHA 4P93A 3EUAA 5C31A 3IHTA 5DNUA 4Z6KA 1CY6A 1R8QA 3CBGA 3EISA 2C5SA 4WKCA 3S5UA 3U7RA 5KBYA 4PZYA 1V37A 1DVRA 2YUTA 4X1IB 3OX2A 3ZH9B 3OP1A 1JVSA 2NU9A 5B3LA 4WKOA 1FXWA 1G20E 3GMSA 3FGOA 4ZO4A 1LGYA 3EDYA 3TZ6A 4EMBA 1TNDA 3WRWA 4LY6A 4TPKA 1N5RA 1C50A 1PFQA 1HQCA 3LDUA 4QDTA 1Z0JA 4ZPJA 1W5EA 3NT4A 1X3SA 1Z13A 1N9ZA 1LNZA 1Z3CA 1UXGA 3DDNA 3NNDA 4FJ1A 1BS1A 3CUKA 1SURA 3THWA 2VT7A 3IT2A 2ZRNA 4QGHA 4XD7D 4AJ4A 4R7GA 2REBA 1BO6A 3KJXA 3OE7D 4DYVA 2WZDA 3TXYA 2VHEA 4LRUA 1FA9A 3WY9A 3CUWA 3MPOA 1JWBB 1P61B 3T0GA 4IEEA 2HF7A 2ALJA 2QRVA 4QEZA 4OEHA 2C1ZA 2YYSA 5KQSA 4X65B 1NT4A 2BPOA 4F12A 1ODIA 4L9WA 1Z07A 5TB5A 3SHWA 1T0BA 2BFEB 2H08A 3UK6A 4X8HA 2EFGA 1JUDA 4NEQA 5LZ2A 1H8HD 4RETA 1ESEA 2O14A 2PX3A 3OLVA 3BSFA 2FQWA 4IDAA 3WGJA 2C3OA 2P41A 5EKXA 4HT3B 3AHIA 4F3RA 1ZIDA 5HWSA 2XIJA 4OGKA 3I6YA 4RVGA 3K9BA 5G3ZA 2MMCA 2XDYA 1Q1ZA 3PNMA 4R8LA 1E4EA 1K2VN 5D51S 2Q3EA 1ZNYA 4L5CA 1HYGA 3ZS9A 5BVGB 3EH2A 4LDNA 4DUPA 4TTIA 2I4MA 3NW9A 4XM2A 4D0NA 2AKAB 3AY6A 3GPCA 2JGDB 4LMBA 4EKGA 4S04A 4ZQFA 2IHNA 1HWYA 1VCNA 1SKUA 1E4OA 3MLEA 1AJEA 5DGXA 1O1YA 3ZDBA 3ANLA 4G0NA 1YL5A 3TQRA 3LT2A 3MGKA 5A4KA 1QH8A 1JSZA 4LC9A 4B31A 5JARA 1S2GA 2EKQA 3F2VA 2P2ZA 1GJRA 1UBSB 2GPNA 3ETGA 3R7NA 1U8ZA 1SHJA 2BLNA 2PX6A 3IEXA 1WLYA 3OIDA 4MKZA 1NY5A 1AKVA 3B9QA 1C81A 4J3JA 4CLRA 2NYVA 3RFTA 1II0A 1QH1B 3QU9A 3MNFA 4DIDA 3X44A 4AN0A 1T0HB 2X58A 1WV1A 2Q1XA 3AJ8A 4P92A 3NHFA 5EN4A 3P97A 4Q47A 3VR1A 1HG0A 1SOUA 1P3JA 2X86A 3FPKA 3TSCA 1ZK1A 5H7XA 4FEGA 4O1HA 3ZV6A 4B48A 4JMLA 3IBYA 1KSJA 5ILOA 1ZSVA 2IYTA 4JR2A 4N5IX 4WZAA 4C4RA 1FRZA 3G8AA 5F98A 1SBYA 3HKBB 2FZVA 2HT1A 4TS4A 1ZR2A 5DM4A 1H1LA 1S2MA 4HS4A 4ZAFA 4JJIA 5AQEA 1OXUA 3TL2A 3WYGA 5KJCA 2WAYA 3CUSA 3KEGA 5KYYA 1XZNA 1Z9BA 4H1UA 2FMHA 3C6BA 4KXUA 3FUCA 2GM4A 2ZDGA 4XEUA 3CVXA 3EZYA 2REOA 4WTOA 5ALVA 2O2HA 3HNOA 1JFTA 3BRWD 1XXLA 2PHZA 4PBSA 3WKBA 4DMKA 2W98A 1ZXXA 1ZZEA 2DWUA 3HWWA 2Q5OA 3OCZA 2DPLA 3TLKA 4YJ2A 4TKZA 2Q8NA 1UOEA 1T4CB 2E5WA 3H5WA 3O83A 5FR2A 3TZQA 3JQ9C 2F4NA 2WG1A 4K28A 2Z4RA 2HZBA 4QYMA 2X0EA 1RQNA 3NX4A 2X9VA 2PMFA 1X0VA 2WU8A 4ZQBA 1W6UA 3O1HB 4NC9A 2EDAA 3NPMA 3G7NA 2CXOA 1U5CA 4D6XA 3QITA 4G41A 3R5FA 1YMQA 5EEGA 2CJWA 4YC7A 1L5MA 2PD6A 4AJPA 5DN9A 4XTRA 1TD1A 2KLBA 4R9NA 3L0BA 5JU6A 1VLLA 1KYVA 2VUTA 1GYRA 3T3NA 1Q20A 1S3GA 4BZXA 5DHSA 1XFDA 1BXGB 2B37A 3CKYA 1N6OA 4DMRA 2DQSA 4Y30A 1T2AA 3BRQA 1OX4A 1KEPA 3OHSX 3BAFA 4CIXA 5KTPA 1DX4A 1MZPA 2XGGA 4HGYA 3MWKA 1C4OA 1OBVA 5I4IA 1E6LA 4UXJA 1G42A 2V96A 4KWCA 1XFAA 3DMPA 3K0EA 1C0EA 1V45E 5H9VA 2JJ1D 4KGZA 4OJNA 4V0OA 1XPRA 2BMWA 3GRZA 4UPEA 2F8MA 1TMGE 2XOKD 5AHXA 4KO3S 4PR3A 1A9OA 2O9JA 3G0OA 4NQZA 1QOQB 1T1SA 2OC4A 5ICCA 4MW2A 2FVXA 4TX1A 4KFSA 1IM8A 3UCEA 1LLCA 2DU8A 2GGSA 3EODA 3I9FA 4JB3A 3RSOA 1W94A 1BD4A 4TQAA 4A5SA 1BH2A 1IVNA 4IUCS 4UEQA 2C3YA 3MWGA 4E21A 2QE7D 4LYJA 4NOLA 3WDLA 2FMKA 4HQFA 1T9KA 3WDKA 4B4VA 3S4YA 5LNK6 2WUFA 4IH9A 3F6CA 2AGVA 1NUTA 2QVXX 4JOQA 2PPLA 4QDXA 4QU0A 4FUQA 1OBFO 5EWLB 4XB1A 4U3JA 4EUEA 2JAOA 1EFPA 4NL4H 5HDBB 4O4HA 5HS4A 3BXZA 1EK2A 2I2WA 1JU4A 3GJ5A 3V6LA 1OC2A 2O48X 2R6GA 2Z8XA 3GJYA 4MRNA 4WXMA 2ZB8A 1SXIA 3L7CA 4MIEA 4GE0A 3WKCA 1GVHA 4NBUA 3SC3A 2QRLA 2XDQA 5TQVA 3GY0A 4NBWA 5KOJB 1LEHA 3ZDYB 1YQUA 2Y8EA 1M72A 4FZ3A 5BN1A 4EATA 1BE6A 3UANA 1B15A 1YBAA 3O93A 2N1BA 2F59A 5IM5A 1KSHA 2VK4A 3QFHA 2HA3A 3L7IA 5IJ0A 3EIQA 3CF6R 2UVQA 1GU0A 2VYFA 2X8WA 4TMZA 4D6YA 3ZJTA 3URKA 4QFDA 1E6MA 4YMWA 2D2IA 4NICA 4FYYA 4X3OA 4RD4A 4Q00A 3GQBA 2UZ1B 3HCRA 2B82A 2VHWA 3QVSA 4PX3A 4YJGA 4JYPA 4CTOA 4J2TA 3ZQJA 4HWKA 1FNNA 1GZ5A 1IRXA 2VAWA 3CJTA 3MLBA 2O2EA 2WA1A 3ADCA 2FW0A 2PN1A 1QV7A 2P9ZA 3DTTA 4PLPA 3ZTWA 2HPHA 4GI7A 1E66A 1XJQA 4IF6A 2JI8A 4KQKA 4HLUC 2FI1A 1QTIA 3KUDA 4L6IA 2YRXA 1R0CA 1HTTA 4UATA 3S81A 2NN3C 1JEJA 3LW8A 3EFOB 1H5QA 1UWCA 1D4FA 1PV1A 5T57A 3TI9A 3S40A 1XQ9A 3EYAA 4UZFA 1RKBA 4UD6A 3BOSA 4KACA 2IKQA 1IZ8A 1ECBA 1AZTA 1EAMA 3A4YA 5IVHA 2I6FA 1MH1A 4UE2A 1V9LA 3DDCA 1FMJA 3HZOA 2PZBA 3M6AA 4YMSA 2QRZA 4IGEA 4BO9A 4A8JC 3KJIA 4DC0A 3G2QA 4LQDA 4B81A 1TTHA 1USWA 3ZIUA 5HHTA 1E3IA 2C5FA 3DEJA 5F77A 3RSGA 2ZRGA 3PT9A 3GJ3A 2X2EA 2CK3D 3URMA 4YXWD 1O87A 2PGIA 4GXQA 4DRXA 1B73A 1OPRA 5EAIA 5JO0A 5KOYA 5A0VA 5A9SA 1NXOA 5C37A 1ARZA 1IIBA 1M10A 4IZHA 3JQGA 3C3BA 3IXMA 4KODA 4NESA 2OXTA 2AV6A 1CUEA 1JH9A 4YV7A 4V0KA 2MYTA 1UFOA 2Q46A 2C7GA 1B8NA 5JVDB 5B37A 1XMPA 1AB6A 1UBGA 3MWEA 5CTAA 4Q9AA 3A1CA 7YASA 3WGOA 2NO6A 4YA6A 1QTNA 1N78A 1NYRA 3NYWA 4GBMA 4X8LA 3BEDA 3ANTA 4QPZA 4B84A 1XAGA 2FSHA 4BVBA 1IK4A 2IF2A 1OAKA 1RYEA 2PEYA 2QT0A 3HCEA 3ORHA 4FGWA 2BBSA 4FWBA 4PWYA 1PNTA 3THRA 4AURA 2OD9A 3E0QA 4RTRA 4UDNA 2A5JA 2VF8A 5JMWA 3T9AA 1A9XA 3H8JA 4R71A 3HFGA 3LCVB 3M83A 4OHYA 1GKKA 3QMMA 3L8ZA 4RUKA 4MLDA 4XXHA 4OI1A 4DDVA 5ES4B 1XB2A 5JNVA 2I7TA 1TIBA 2NVUA 2H4HA 2PBZA 3NHMA 5IS2A 2WKQA 4BAZA 1EVZA 2FMIA 2VDQB 4B34A 4BDSA 3LKBA 4OFBA 2JKYA 3B13B 3OU6A 3R7AA 3W7BA 2JAXA 3JAKA 4KXLA 3N86A 3W7VA 3RNOA 4UJ5A 3VM6A 1KFJB 3BE4A 1GILA 1BFDA 1R9NA 4BO5A 3THXB 4RZHA 3GROA 4RH3A 1OAOC 3D4NA 1DWQA 4BFWA 5KOJA 3G13A 4HTFA 4IOLA 4MSUA 5LQRA 1KVTA 2I1QA 4DVJA 4MYCA 4AIIA 2CDAA 1GG8A 5F9HA 3ZHRA 1RHMA 1E0SA 2QAJA 1ZU5A 2IP4A 4FHDA 4XGIA 2AS0A 4ZTUB 5J2UF 3KU1A 3TM5A 5IBQA 3BJMA 4GKAA 5I4KA 1BFKA 3MJFA 2B2NA 2CXRA 2GPTA 3MWDA 3R7FA 1CEXA 1C7IA 1JG2A 2ZREA 1F2UB 4RA6A 5BRAA 4IUDS 4BB9A 2RHHA 5JHHB 4A4DA 1H2BA 2FPLA 2OV2A 2C3PA 3F3MA 1IH8A 3IJEB 3DL0A 3L8DA 1R9JA 1ZW1A 3TQFA 5IMSA 1EHCA 5JJBA 1H1LB 1QJCA 5KVAA 4PZ0A 3OFKA 2ZRIA 1XTQA 2DZDA 4CMGA 2PDAA 2M98A 2O23A 3HA7A 2YXEA 1DX9A 5ITZB 2EJTA 4ARZA 4TKUA 5K0CA 3ZU3A 2J6CA 2WYVA 1MRZA 4W5QA 1XF9A 2OBMA 5CLGA 3TCKA 1PFYA 4BNXA 1X6VA 4Z0HO 2FEXA 4B0PA 2PRYA 2YWRA 2A58A 3AM3A 5TR9A 2W37A 4CV0A 3FCOA 1RRVA 4DCOA 4NPAA 3LT5A 1F3LA 3A2MA 3DLPX 3NT2A 2BDTA 3U1VA 4E33A 1ECCA 3IR5A 5LZ8A 4F06A 2C83A 2QPAA 2XNKA 1GRCA 4P22A 1TF7A 3VV3A 2YFYA 4ZAXA 3HB7A 3AV3A 3ZHXA 3W8NA 3P0FA 3RR2A 1UKZA 2WE7A 5CGZA 1DL5A 4L6AA 4LRTB 5EHQA 2WFMA 3IODA 5LP6F 2PR7A 2VP0A 3CSSA 2XA9A 4HYYA 3LUCA 4Q18A 2VBCA 3CZMA 3W2EA 3W5HA 4BDTA 1ODKA 5I7SA 4UHCA 3RC2A 5C53B 3ZTTA 4O33A 5PNTA 5BSHA 4LF8B 3DV2A 1K0FA 5LKAA 3TWOA 2J33A 4HKTA 1Z2DA 3UMMA 2I7VA 4WBXC 5EIBC 1V6AA 1KJQA 1Y34E 3NDRA 4LRQA 4NZZA 2OFFA 1YS4A 4ARAA 2VRBA 4EG1A 3ICQB 2P6PA 5KTSA 4LXIA 3GRKA 3EQ9A 4FGZA 5C5IA 4DL9A 4QXAA 3MMSA 2PUAA 2Q1UA 4ZVLA 4YAWA 3NBQA 3VZBA 4K6GA 3B70A 1NDQA 1HDEA 1MEEA 1QO0A 3NEAA 4FOOA 4FYJA 4GHWA 1RAIA 4H7PA 4B6EA 1XDBA 4AO6A 1V3VA 2ZJ5A 4JWKA 3FOZA 2O7RA 3B82A 1XPOA 4DLAA 4RABA 1OXSC 1X94A 2W2TA 4IWYA 4QREA 3PGVA 2WNIA 5IJ0B 3AWDA 4EYOA 3TL3A 3RVLA 4A73A 4B6SA 2HREA 4EPYA 3BGVA 3L8YA 4Z8YA 1CQPA 4YREA 2PH5A 2RKWA 3D7RA 2FGKA 1OXMA 4F92B 5TEVA 1VYUA 1EE9A 5HZKA 2FWAA 5BW5A 5DMHA 1W88A 1XZGA 2J32A 2Y0PA 1COZA 1U6KA 4GOLD 2O1XA 2CVFA 1B74A 1AMOA 4BP8A 1MKYA 4K9QA 2HW8A 1K6MA 1NJFA 3QIAA 2XYPA 4RS3A 2AQIA 4DV4B 3MWJA 1P2SA 4MWOA 3HKDA 5A4IS 3RU3A 1UWVA 5FI3A 1QZZA 3H2YA 4JJ6A 2I6SA 3QPUA 3CZ9A 4DR5B 2ZRCA 5JLAA 2X7XA 3QPBA 5B4TA 3AH8A 3KT3A 1H9AA 3P2EA 4NU6A 5I4BA 3YASA 4DQXA 3ANXA 3GWZA 1UJ6A 3RK0A 1H22A 5FTNA 2OV1A 3G8BA 3O8QB 6Q21A 1RHRA 4YMUA 5DISB 3WO1A 1LNSA 1PYGA 3PUJA 2GEBA 3I73A 4X20B 4I4LA 3LUFA 3UVEA 3FNHA 2HQBA 5C34B 2IIVA 3COSA 3DXYA 3ZVLA 4RJLA 4JITA 1BVRA 1LBIA 1U2ZA 3ZK9A 2JIBA 3MB5A 5BYKA 2MSKA 3VO9A 3WZMA 4OLAA 4NY1A 1UDRA 1VSVA 1FB5A 2OVFA 2X8LA 3W34A 5HKBA 2FPMA 1ZAKA 2VRCD 2JHCA 4WK6A 2ATEA 4HFNA 5ICFA 5FDFA 1PNRA 1KQFA 4PSCA 2C4NA 1EB9A 1EXMA 1MC1A 2QT1A 2QD4A 3QA3E 4LBZA 5DSTA 5IFLA 5C52B 3U5ZB 4WA7A 4M98A 1YZYA 1QC5B 4U2FA 2RSLA 4L76A 1LPPA 1N9KA 5CDGA 5GP1A 3D4OA 4FZ5A 5JS2A 3LG2A 1WXQA 3TJMA 2BHRA 2Y05A 2Q1YA 1EXVA 3O8CA 3ELYA 1Y6FA 2VLBA 3UICA 5E6UA 3BWMA 5CPFA 4YQZA 2CXSA 4WN3A 3T7EA 3ZHZA 2PUCA 4TYWA 2O8EA 1GPMA 4ZCRA 4XYBA 3ILYA 1W7AA 4Q6WA 1TFRA 1P5FA 3GEEA 1AF4A 1B43A 3WZ2A 1K86A 2F67A 4OBWA 3RHZA 3K96A 1QQ6A 3O8RA 4MWEA 2G1PA 4DV6B 1Z5PA 4E46A 1H85A 5EEHA 5AFSA 2WIFA 2PY6A 3C8HA 3CLUD 2A9VA 2VJOA 1N5OX 5TNXA 1D8AA 4H31A 1E5XA 3T5DA 1LJUA 2YV5A 2CSXA 3PBKA 4A2WA 3SQXA 3DXZA 2JLUA 1FDVA 1OX6A 5HIAA 2YS7A 3QYFA 5LQJA 3NMUF 3GI1A 1NN1A 3WNQA 2ZRLA 5AKXA 4OB7A 1CUYA 3ZWAA 3OAAA 3RRBA 4AYXA 1A5SB 3FOEC 2HHJA 4QU8A 5IUNC 4OKNA 2Q2NA 2SICE 5DJ5A 5KKNB 5LXTB 4GRDA 1FX0A 4ZO8A 5F3DA 3K4HA 4RF4A 3V8BA 2GD1O 5AHRA 5BYAA 5JY6A 1W49A 2RC6A 3NTOA 2ZRHA 1JQAA 3KTAB 3BILA 1GUZA 1OFUA 4ZCLA 3MJCA 1OLUB 2ADOA 1EWKA 4D02A 4B76A 3AQ4A 2NADA 5CVJA 1XMIA 5LUAA 1SCJA 2GTPA 3JD3A 1NURA 2OHVA 2Q07A 4MHOA 4YP0A 5EJIA 2ADFA 3DP9A 1ULAA 2HK8A 2HKIA 2PRIA 2ZYGA 2WVGA 1VBMA 1UODA 1GFZA 4U9UA 1GCIA 3I9KA 5E3IA 2QYHA 5HEKA 2HOQA 4MVJM 3WAKA 5JAHA 1IBKB 2C2MA 4S05A 2Q7XA 5CVUA 4GEGA 2CDNA 4Y7CA 5DI9A 3D0QA 4RD2A 4BQSA 2ZJ4A 4YT2A 4GLFA 3LP6A 3IAHA 1ZJ6A 1DJLA 1OT3A 1P7PA 2A3NA 2EKPA 3UTDA 3WYAA 2P77A 4AQYB 2QL5A 3E2IA 4R3NA 4P36A 2P3QA 2P9EA 3RHSA 2E5LB 4DARA 1US8B 2XSZA 2MINB 4K9DA 3N2IA 3A6ZA 5ADUS 3QX7A 1UBTS 4QDOA 5BVHB 3ZJVA 1TW2A 4IIVA 1AQNA 3GDHA 4OUDA 2I2FA 4YQFA 1PN3A 2J3KA 3KZNA 4PZ9A 3QVUA 4QRIA 4C0QC 1VECA 4DMMA 2YWDA 2ZULA 8GPBA 4XPZA 5G02A 5L4LA 3T8YA 5LDHA 3AVUA 1LVGA 4R1UA 1YC5A 5AIAA 3OIWA 3GEBA 2C94A 5AUOB 1B6TA 2DLCX 5JNLA 1P0QA 1GFSA 4RJJA 1UMCA 3JQBA 4CKZA 5IN5A 2D2XA 1A5AB 2G8LA 4KTTE 4KQCA 1NFQA 1N0IA 4J6EA 2C9MA 1Y4DE 2X22A 4DUYB 2FWIA 3UHPA 2IL1A 4KR0A 4O4JB 1XK7A 5JJKA 4IZOA 3J7TA 2VL7A 3DO5A 3MXTA 3K72B 2BMVA 1LH0A 1S2OA 1G8AA 2AD1A 3HUTA 3ISJA 3SHOA 1PDOA 3SBDA 4A5OA 2X5NA 4E94A 5P21A 4BS9A 4WINA 2DT5A 4JJKA 5JADA 2JGEA 4HQOA 4YJ2B 1ONBA 5KWVA 4IDFA 1II8B 3JSXA 1MORA 2PCLA 1DOHA 3KYJB 2FW8A 2IYRA 2YHAA 1GCAA 4LISA 2C7BA 3QNUA 2ZANA 1VXOA 2CV0A 2AJBA 3TAHA 2DULA 2KMLA 3UWKA 5D5PA 3QVKA 1U3DA 4OX9B 4YR7A 4ARVA 3ZNNA 5I51A 2CJWB 2B4QA 1L6IA 3DF7A 3DLCA 5HILA 4NNJA 1DBSA 4HPWA 4Z7QB 4TWJA 3ZWCA 3FFWA 4BZWA 1DCKA 4YGXB 3DUFB 5D7NA 5EJ2A 2NQ8A 1EFLA 2W83A 1Z6YA 2BMDA 4X66B 4CMCA 4KMMA 3TRFA 2GAFA 4ETIA 5BN4B 3CW2A 1TZKA 3DCIA 3L4BC 3L7AA 4IH4A 4QRDA 3DZKA 1OXKB 4Y6SA 2I4NA 1JA0A 3DEIA 4MKFA 2RH9B 3MVEA 5EC8A 4TS9A 1E9BA 1VMIA 1RC0A 2C8VA 2X1HA 4RVFA 1ISSA 3EDOA 3NVDA 3OZGA 2QROA 5I7EA 1BS9A 1DIRA 1GR1A 3O95A 4DUGD 4KXQA 4MVJA 4N41A 5LSAA 4IY1A 2WJVA 4UDXX 1T8SA 3L1VA 5AOAA 2NPFA 3CN9A 3GLHE 2IVFA 3E18A 2E1PA 3D0RA 4FN4A 1CRQA 3WXBA 1V8ZA 2ZRPA 3CJRA 1R3DA 2C00A 3AP1A 2VH2A 3IQZA 3ME5A 3C48A 3PCRB 3QKUA 2XDAA 4HMPA 4LTMA 5CXXA 1LJLA 3C3DA 3QLVC 3R6GA 2CSUA 2XPCA 1G21B 5EIHA 2ZS9A 4OOEA 5AJYA 3RO7A 2DLDA 1SXGA 1YS6A 4L28A 4LDAA 3TW4A 1P39A 4JBWA 1WDTA 3DCJA 4XWOA 4ZICA 1OGJA 2AEJA 1LF0A 5CB6A 2CHUA 2E4WA 3NNNA 3UFXA 2MINA 4EO9A 4QO8A 2XAAA 3R9XA 2ZATA 3UPDA 1TLLA 2YN4A 1WBJB 4R9SA 1PNOA 4KXXA 5FPHA 2FW6A 1KOJA 3U4HA 3M4ZA 1GQSA 2XRMA 1NVVR 3PCXA 4E5YA 3W2GA 4I4TF 4GR9A 2Y9MB 3BWXA 4O4LA 5E4JA 3U48A 3QOFA 3GO4A 4N6OA 2F90A 2TECE 3EEFA 2H5LA 4BGDA 4B82A 5LWHA 1MHTA 4MDFA 4QICA 3MUNA 5EKTA 3LOQA 4Q1BA 4UVEA 5B1IA 4F3TA 1G8HA 1NT2A 1DKNA 1YHNA 5DCYA 1IEVA 4HDMA 5YASA 2INGX 3D6FA 1YL7A 5JBQA 3EVAA 3OFJA 2O05A 4EX7A 1FXWF 4DMGA 1U2EA 3Q7EA 1CU1A 2J5RA 3FZEA 3SE0A 2Q4DA 3HB5X 2C7OA 2CVQA 4K9NA 2FHPA 3NHPA 4QPCA 4ITUA 4KDEA 4JA0A 1VDZA 3D5QA 1IK6A 5T8KC 4RZUA 3D54D 3V97A 4RPIA 2XLCA 3HA3A 4EUKA 1S9HA 2D74A 2CNWA 1PS8A 3F47A 4Y1RB 4B74A 2ZBRA 1JFLA 3R7SA 1QMPA 4Y3UA 1KU0A 3PLRA 5REQB 3V5NA 4RF2A 1G8YA 5IDQA 3R3SA 2AN3A 1RWWA 3ZU2A 1BQ4A 5DI3A 4DA7A 3R3UA 3PQCA 2UYCA 2JJMA 5A2QA 3R09A 4M1EA 3AF3A 3F5DA 1NMQA 4I7EA 3I32A 3LO5A 2WG2A 4R1MA 5FJJA 1YDEA 3UJ8A 3QVJA 3SICE 4P9NA 4REQB 2JVIA 2B20A 2P9TA 4IDCA 2HSZA 4QNNA 5J1TB 2X4IA 3O8BA 3VHRA 1Q83A 4ZIRB 4RY0A 3IUYA 1IBLB 1G8MA 3QXCA 4M0UA 2FPKA 2YY5A 2ZJOA 1EE2A 4X91A 5F3RA 2PRJA 4PFJA 4O63O 5I5EA 1C4XA 2G0AA 2VAXA 5T3UA 1G9SA 3DL7A 4D1YA 5CYGA 5KNCD 1EVJA 2P4HX 4TMXA 4XEHA 2ZB2A 1TD9A 3U3JA 4QOHA 1PK9A 1B0UA 2JK1A 3ENNA 1DIAA 3AUKA 1P44A 2YJ3A 4JL5A 1SC9A 4JAVC 4LBVA 4MEBA 2ES4A 1ODSA 1ZK2A 1R5BA 4JEIA 4ZO6A 1JZSA 1BX3A 2X5KO 1P74A 2OCDA 3K9HA 2EZUA 1YCGA 3DHEA 2X1LA 3FG9A 4JU8A 4L0DA 5JJCA 1UEXC 2EAUA 4U2BA 5I3CA 3C8UA 5JZSA 2IYYA 3Q3GE 2QR2A 1UMBA 3EB9A 1IAVA 2PR2A 1O08A 4WY2A 3RVKA 1XTVA 1M8JA 5JROA 2NXJA 3J81A 4XSVA 1A5ZA 2AX4A 2W4IA 1XT6A 2X3FA 4G8BA 4JOBA 4PO1A 2NPOA 3KL4A 3RT1A 4BBZA 4D43A 4DSUA 3E9CA 2YHSA 3CVVA 5D3QA 4EHBA 3FFXA 4ZVKA 1NQTA 1KR2A 1RRFA 3A1NA 4MH0R 4OB8A 3T6KA 4MOWA 6AT1A 3LBYA 1EA5A 2XAUA 1IDN1 1X7GA 4BE7B 1G63A 5ADWA 1EWQA 2XVYA 2EG9A 5I8WA 1EH5A 1J9GA 2GXUA 3DOEA 3NIWA 4AZ3A 3FFTA 4QG3A 5E9AA 3ICVA 4D9MA 4F2HA 2BKEA 3P2KA 2P79A 5BR1A 3SZGA 3HXKA 3MPUA 4NQRA 3DPIA 4JR0A 4C01A 4ZV4A 1Y9JA 4WK2B 5DTRA 3PX7A 3HU2A 1U9JA 3QOWA 4D97A 1EP9A 2J31A 4M1YA 1B8PA 3FGZA 2ZS7A 2GVZC 2Y1KA 1FRQA 2DWOA 3B7WA 3O31A 5FV7A 1P3DA 4EECA 5GTDA 5KOHA 1F2DA 1WXEA 5AOVA 1Z5OA 3H04A 4DCCA 2UYOA 3N3BC 2SKDA 2R25B 1IJKA 3P2JA 4AICA 2PRKA 4Q4AA 5GJCA 4BGIA 5FLKA 3BZUA 1W5AA 1T9DA 3CCFA 3D02A 5K5EA 1NP7A 2PU7A 4C0SA 1GGHA 5AT1A 1LSJA 1Z38A 3JWPA 3MOGA 3F0TA 3N5KA 1G5TA 1YIAA 3ETLA 1JAXA 1JLRA 1KI6A 3I1FA 1CNEA 5KS2A 4Z3DA 1M2VB 2HGSA 3WBFA 1W0JA 2R6FA 2WU0A 1HF3A 3E8MA 3VPBA 1I24A 3I2IA 1TA4A 1N6HA 3GP5A 5BOSA 3DD5A 4I4CA 5HIJA 4EW2A 5BSFA 1L5VA 4FFRA 2ZZNA 2BZGA 4DQ0A 1H2WA 1V1MB 4ZZ2A 1E1CA 1S0UA 4Q7QA 1EFUA 1CF9A 4B46A 4ER6A 2W58A 4RDXA 1EFRD 1NBAA 4TXJA 3B1WA 4MPJA 2Q8QA 1NZFA 2RARA 4Q0MA 3V32A 3QJYA 4F5YA 4DV7B 2QVLA 4CM8B 4RDHA 4MRAA 3GGOA 3ITEA 1U7PA 3MGAA 5IJXA 4OHMA 3RD5A 1ZN2A 3FWZA 2IVZA 2WJJA 3INTA 4R6XA 3GPIA 4BTEA 4Z3KA 4JYZA 2XLBA 3P32A 4YP9A 3C98A 1M34A 2ZYHA 4QX6A 5L6LB 4RKEA 4XPIA 1U0LA 2Q0XA 3MYYA 4PBRA 1UZUA 3U39A 3ZZNA 4EHNA 4YMGA 3SC2B 4J91A 4LHXA 4WCVA 3WKAA 2B1RA 3M34A 5K0SA 2BONA 1KAHA 1F38A 1EM8A 1ORRA 3AM4A 2GK6A 5LIPA 3GFTA 2FJUA 1RKQA 5G3YA 2JIPA 3LP8A 1JBEA 2W00A 5DM60 2Y68A 3RYFB 3JQ6A 1N1DA 2X5OA 3RU2A 4C0AC 1BW9A 3D8BA 3BB1A 1OJ7A 3K94A 4KX3A 5L3RA 1PQUA 2UYYA 3EZ9A 1JQEA 2FV8A 3OOWA 1CTQA 1YDFA 4PXAA 4Z49A 5JAPA 3P1JA 1QG0A 1CVIA 3PIIA 5ARBA 3MTEA 4CIVA 3QKRA 4OHOA 1MJFA 2HMYB 4E1BA 3RYHA 3BXEA 4CR7A 1UANA 2VNAA 4AZ3B 3U19A 2BDUA 2VQDA 3PTLA 4A7PA 2AMJA 3UBTA 1BEEA 2GN2A 5HZGA 4DLKA 2BFNA 3RTGA 3CZAA 4YPVA 5WRFA 5AW6A 5AW7A 5AKHA 5BPFA 2Q3BA 4MUFA 5ALQA 2CZCA 3EVBA 4WXHA 4JJ8A 1SKAA 1QGOA 2BIFA 4PXYA 1B4DA 1G5QA 2IH2A 1SM4A 3H5TA 2EERA 3EX7C 2A9FA 1EIWA 3FVRA 3KPVA 2EJUA 1PYOA 4BAGA 2ECPA 4G2NA 4S1WA 2A9KA 1HE3A 3L1UA 3LCJA 4NWIA 5FPTA 1FL9A 1LF5A 3VR6A 2Q2VA 1VL8A 2H2WA 2R8RA 1C7QA 5T5QA 3K2EA 3UHOA 3ZNPA 5BSVA 3LGSA 5DV9A 2JCYA 4YCSA 2CMKA 3UJ3X 4MWZA 4QYIB 4AJLA 4EPRA 4JI3B 3G2NA 4FGJA 4B4UA 4G3XA 2BR3A 4I08A 4XOIA 3OFND 3HCCA 3LXXA 5HIMA 4BP9A 3OTOB 4HDMB 3SYLA 4UHHA 3EQ8A 4A16A 2FWPA 4B8ZA 1A8QA 3HDQA 4UUPA 1U65A 4RK6A 1I2ZA 4AP9A 1ZVQA 1RYDA 1PQPA 2GCEA 3GT3A 3N2NA 3DHVA 3PDJA 5EHGA 1CUDA 2JBAB 3O3NB 3S2FA 1DEKA 1NN5A 2WK1A 4MQMA 2M2IA 3WGKA 4AJIA 5GZ3A 5JEEA 3HLYA 1KGDA 1G3QA 2ZYUX 3DTVB 3L46A 1F06A 2JJ2A 3DFZA 1ORTA 3QVMA 1OLSB 4TQGA 4URUR 4WX2B 5FAXA 2VRNA 3TQSA 4H35A 2OBLA 3LBIA 5JCOA 2V7TA 3UCXA 3BXFA 3IOYA 3QMPA 4K86A 2AEEA 4KWIA 4OA5A 5K2MA 3RHTA 5LL6P 3U31A 2XCIA 4GWLA 2IW3A 2OYCA 4YAIA 2VHQA 4IYJA 2OC9A 3ZHCA 5KWSA 5KDLA 1R5JA 3ZLUA 1Y3HA 5K99A 1C3EA 4A0RA 1TCUA 1VKNA 4H3VA 2E4UA 5DI3B 1G7CA 5AVVA 1YK1A 1KARA 1U6JA 4S3MA 5H4GA 5CA0F 4F4CA 2M6RA 1U7WA 4OIFA 1BXGA 2X0DA 2RGAA 3RVRA 4AWAA 2JGAA 1ZLYA 5CDFA 3MTQA 4REQA 2Q49A 3OJEA 3SJUA 2A35A 1CJSA 3PDHA 1CJBA 3NR2A 1AGXA 1TUGA 4HG2A 3A9UA 4KVZA 3SHQA 4MYUA 5J9FA 1QNLA 1A2BA 4KQHA 4DMHA 4IICA 3TRKA 4ZGWA 1BJTA 3WO0A 1SPBS 2WLTA 3P45A 4JI0B 1TU0A 5AKGA 5KSZA 1VHJA 2XVZA 2I2AA 3OJFA 4QJBA 4U6NA 2WQ7A 2DSNA 5CLQA 1VYTA 2A4KA 3BH6A 3GUZA 3E6AA 4FM9A 2BYTA 2X3UA 4WXRA 3H3JA 1T29A 3T3GA 4Y2RA 3BGWA 4PU0A 3IIIA 3F5QA 4O3FA 2B4RO 1R0YA 3Q3CA 3W0LB 3V2GA 4O2BB 3NDJA 4FBLA 3QVGB 3KPYA 4QBFA 3BHJA 3BXPA 4LA4A 3K09C 1XX6A 3NAMA 1TOAA 4EARA 1MC5A 4PXSA 4XSGA 4YVFA 4YLEA 5SY9A 3FJ1A 2QQEA 2ZAYA 4U7JA 2V6MA 1QQ7A 3AR9A 4C7OB 3V9AA 4K6HA 1I4OA 5JZBA 4BFVA 4YJ3B 1Q57A 4AFNA 4NE2A 2HWYA 4ZN6A 3HH8A 4J4HA 4EEXA 1PZMA 2ZVJA 3GVCA 3VVLA 2C78A 4C03A 1CC1S 2ZE7A 2O8DA 5E2IA 2HLDD 4B32A 1Z2CA 2YVKA 5FNVF 4KITB 1VDMA 5J43A 2J9XB 2NSYA 3E58A 1NIJA 4UNIA 4IHJF 4DLLA 5LP6C 1NI3A 1VMEA 4E12A 3J81k 4LJ9A 1U2DC 5IULC 2GXAA 2J5XA 1DP4A 3ZJYA 3AVYA 4NG5A 4K3VA 4MQLA 1S9DA 2QMQA 3O84A 2LZ0A 1N77A 2PMCA 1XWIA 2BVNA 4O3MA 1PHPA 1W9MA 2OPHA 1YZKA 2HRRA 2J6BA 3K9NA 3ZX4A 1Q7RA 1CV2A 2G63A 2JFVA 3G59A 4B87A 4ZYLA 2H11A 2I6XA 2VYNA 2YICA 2G5GX 3GMTA 1O4WA 1PJRA 1E96A 3GBSA 2F48A 4DJDC 1JT9A 4MW5A 1CY2A 5LU9A 5TT1A 5IF3A 5C7YA 4R01A 4IJUA 4C1NA 4V1CA 2HRCA 5DTMA 1HTWA 1IDOA 4BFLA 3LCUA 3AL0C 5KNBD 3NV7A 3EPHA 3TSZA 2PLRA 5G4KA 1NQXA 3AIMA 5I9LA 3BRSA 2HXGA 2ZWOA 3MHPA 4KAJA 3QPAA 3HWX1 3PG5A 2PNJA 4DM3A 3QY9A 4WBNB 4I0WB 1GDTA 1OZGA 1P2DA 2WT9A 5C46F 4B3GA 1YRAA 3ESXA 2F3SA 2Y1EA 1R9GA 2WIKA 1VA5A 4I1IA 3UFBA 2BISA 3QE4A 2X3YA 1FS6A 3I2GA 4CM6A 1CE8B