3PK0A

Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
GSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPESLDAIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pk0A00
3UFXA 4DPMA 3OICA 2E49A 1V0JA 4L76A 4ZHSA 2CDBA 1NXQA 4JQCA 1M6WA 3F4BA 5ENVA 5KJ1A 3KETA 3ITDA 3CE6A 1I2CA 3WG9A 5EMHA 5GZ6A 1LLQA 1ZXBA 4EEXA 3DO5A 3VZRA 3PQDA 1WZIA 4UUPA 4Q3CA 2BHLA 3ASVA 2DBRA 4JX8A 3IKTA 1X7GA 1Y5RA 2GF2A 3BTSA 4J1SA 3WWYA 3RC2A 5JW6A 3OSUA 3SXPA 1ULSA 1XQ1A 3NX4A 1RJWA 4OXKA 5IZ4A 1ZUD1 2ZJ0A 5KVCA 2I65A 4LCEA 4M55A 1LDYA 1HDCA 4CV0A 3V1UA 1K89A 5T8KA 5B4TA 3SVTA 2ZTLA 4BO3A 5T6BA 3RSHA 4MKRA 3GFGA 1LLCA 2PR2A 2R00C 4IZIA 3JQAB 2HMTA 1E1KA 5FEUA 4MJLA 1Y1PA 5IN4A 1FF9A 4ZQGA 3E03A 3PGXA 4HUJA 5JFOA 3QRWA 3BHJA 2Q1TA 1U3VA 3L07A 3P2YA 2BH9A 3W1VA 2QYTA 4ALIA 2O4CA 5G0TA 1ZSYA 1DIAA 3QWBA 4F3YA 5I8WA 4J2HA 4LSWA 4B3IA 3HADA 1EMDA 1IPFA 3GGGA 3S2GA 4J7XA 1QSGA 1OAAA 1LLDA 4TKMA 4KWIA 4YAJA 3JQBC 2HRBA 3DTTA 5BSFA 3R6DA 3JQDA 1T2FA 4P8RA 3UF0A 1NP3A 4Q3DA 3WBBA 3O03A 2DU8A 8ADHA 1LDEA 4HFRA 4FSHA 4UVEA 1LQTA 2GR9A 3AY7A 3QWIA 4FOSA 4PG5A 4YAKA 4MP6A 3QY9A 2NVUB 5IXSA 5G4KB 2JAHA 1YBAA 2Z5LA 3NGXA 2J3IA 3GVXA 3LK7A 4MP8A 4Z3DA 1E6WA 1X1EA 2ZK7A 2NWQA 2JD1A 4G65A 2Q1SA 4P4NA 1RM4A 2WM3A 3LC1O 1I3KA 3OQ6A 2J5KA 5L4LA 1NPTO 2BFAA 2GN8A 1YJ8A 5HS4A 1FMCA 4OXYA 1YDEA 4ZQHA 2VUTA 1HDOA 1XA0A 1PSDA 4YVFA 3LF1A 1GYRA 1ZK2A 3VPGA 3FD8A 1ZKMA 2ZB8A 1RM5A 5L95A 4M89A 4E6PA 2ZTVA 4RF4A 1ZK1A 2Z1NA 4IJWA 1NPDA 1WZEA 2YJZA 3ZV3A 3JD2A 5IZCA 2GZ1A 1B8UA 4IXWA 2Y1DA 3D5TA 4BNZA 1LU9A 1MXFA 1JVBA 1VSVA 1Y9AA 4MO2A 3NT4A 3H5NA 1NM5A 2CF5A 4NPCA 4GX1A 4GQAA 1I3NA 5KVSA 4EUFA 1O0SA 4DIBA 1CETA 4L4SA 1MP0A 2GLXA 2NVBA 4A73A 1VLLA 3QQPA 4PG7A 2UV8A 3VVCA 4YQYA 3BMCA 4C4OA 1KVRA 3DBLA 3GH3A 3VKVA 4ONEA 7MDHA 1Y8QB 1CWUA 4R1SA 2O2YA 4B7XA 3WSWA 3PP8A 4WE3A 4BL5A 3KYDA 3OA0A 4A03A 4BIIA 4CMCA 2IEDA 2O7SA 1VL8A 3FSRA 2VUSA 1ENOA 1HDGO 1ADGA 5EPOA 3UAGA 3V1TC 5K0ZA 3PZBA 1VRWA 4ZD6A 1MX3A 2E82A 1Y7TA 1P9LA 3JV7A 4O6VA 1EVZA 3HQ4O 3TZKA 3D4PA 1T2CA 4XB2A 5DBFA 3ZDFA 3GPIA 3U4HA 1HDYA 1BRMA 1HEUA 3HE3A 4A0SA 4O1MA 4GX5A 1GDHA 4EJMA 1E1MA 4L0QA 1BDMA 4XRRA 4BKOA 2X0RA 4IUYA 3UCXA 5U1PA 3ZWBA 5B12A 1OFGA 3OEWA 4J91A 4XKJA 1GZ4A 4XJTA 5JDCC 3TFOA 4OIMA 5F1OA 4IQ0A 2PY6A 1Q7BA 4FFRA 3QW2A 3VPFA 3AU8A 3JYPA 3RIHA 4FGWA 4XRGA 3TZ6A 2H63A 4UREA 3TSCA 3RJ5A 4AJ4A 3HFGA 4FC7A 5TSDA 1SOVA 4HX5A 2P9CA 1NHWA 3ZNPA 2AW5A 4PLGA 3OJOA 1DPGA 3S2EA 2W98A 3JQGA 3U3XA 1EQUA 1CJCA 2HMVA 5FYDA 4C7KA 2HLPA 4PCVA 4NU6A 3JYLA 5BNFA 3TZQA 4OXNA 3B6ZA 1E3IA 2DFVA 3ZWCA 3IL2A 3KTDA 4EBFA 3S8MA 3DL2A 1PWXA 3MEQA 4DBVO 3K31A 5JAQA 4INAA 2JFGA 2VHZA 2X4GA 3LYLA 5A9TA 3M1AA 3ROPA 4GMGA 3NT5A 1ZJZA 5HM8A 3OFSA 2FR0A 2YV3A 4KUEA 4MIEA 2J3JA 1GEGA 1HETA 3JQAA 3BHMA 3H9GA 5HS6A 3AFNA 3A4VA 2EKLA 1DFHA 1YVEI 3NEPX 3D7LA 4XJSA 3HB5X 2P5YA 2BELA 3JQEA 1F14A 3PFWO 4DC1A 4E2XA 1DAOA 1QRRA 2P68A 4EUHA 5L7WA 4Q9NA 4HY3A 3ZI0A 4AJ1A 2VWGA 4WECA 1A9YA 2CDCA 1ZZEA 2IODA 4QSMA 5DBIA 5AXCA 3M1LA 5AOVA 4YJFB 1Q0HA 4Y6PA 4XZ3A 2FWMX 5HWSA 1I0ZA 2JCVA 3PJGA 2PFGA 1P77A 1BW9B 1P0CA 1Y8RA 2E4AA 2V65A 3FWNA 4RZHA 4CMKA 4URFA 4FPXA 1IUKA 5LC1A 3QJ5A 4FN4A 2NVUA 3L9WA 1EQ2A 5G4KA 4E0BA 4OSPA 3AU9A 3I9KA 3M6IA 3WGOA 2GO1A 4NU5A 4RF5A 4KUHA 4Q3EA 4NBWA 5F21A 3I9NA 3WJ7A 1LDNA 4RPJA 1IYZA 2CVZA 4J4HA 1A7KA 4EJ0A 3SBOA 2OXIA 5JY6A 1HTBA 1YQXA 3UHAA 3RFXA 4AJKA 1YL5A 1XR3A 1E7SA 2W4QA 4YWJA 4IDBA 1M2WA 1JU9A 3NDIA 3JYOA 2JHFA 1L7EA 4P4GA 2YDYA 5COQA 5L4NA 4DREA 4D0RA 4I5GA 4ROSA 4I5EA 1IHYA 1DC5A 1UDAA 4NR0A 4BHTA 4YRBA 3KZVA 3E9QA 1I2ZA 1GYPA 2O2SA 2VHXA 4WKGA 1HSZA 4NZ9A 3RD5A 4JJIA 3QA9A 4RGBA 5IDXA 1EBUA 1NQAO 1NWCA 3JQ8B 2OP1A 3DHYA 4R1NA 1B16A 3U4DA 3PZRA 4UUOA 1I3MA 2W2KB 4KUGA 1L7DA 1PR3A 1AXGA 5EJ2A 4Z0TA 3ZWYA 3CKYA 1Y8QA 1ZMTA 2PKQO 3GRKA 3RAJA 4CMAA 2C5AA 5C7OO 4GSKA 5MGBA 1F0YA 3E82A 1GPDG 2VWQA 3DMTA 3WFJA 3T7CA 5DT9A 4ND4A 4E30A 4W4TA 3GHHA 1CERA 2B83A 3UGKA 3ANMA 1LRLA 1T2AA 1V35A 2I76A 4J6FA 3ZHYA 5L7TA 2PLAA 4IGFA 3I9JA 3CMMA 4OSOA 1Z7BA 3P7MA 2FOIA 3L77A 3IS3A 3LZ6A 4UVIA 2I67A 1R0KA 3X2FA 1KBZA 2Q49A 5IZCC 5G4LA 1XKQA 2D8AA 5JDIA 2FRDA 5EN4A 3VHRA 2TMGA 2Q4BA 3HG7A 3ITKA 3LT0A 1EK5A 3OIDA 1D8AA 2BKAA 1GY8A 5I7FA 3TL3A 5FI3A 2TMDA 3H5AA 3AM4A 5IDYA 2V6GA 1GV1A 1KEPA 6LDHA 4FJ2A 5TQVA 3N7UA 3ZV4A 1QYXA 2D59A 1G0NA 4YT2A 1H94A 2JD0A 4J9UE 1HT0A 1N7HA 1ZW1A 4RLHA 4K28A 2X58A 5JC1A 3W8EA 3HHPA 3ZHZA 1C14A 2UUOA 4B7CA 4YT4A 3KRTA 1J0XO 4H3VA 2X22A 1MG0A 4FW8A 1IB6A 3ZV6A 1WMBA 2GN9A 3ZU3A 3ETGA 4QX6A 4IDGA 4CMIB 2VT2A 3C85A 2PD4A 2I3AA 3WOHA 3IIEA 1VSUA 3FN4A 2X9NA 1ULUA 4II2A 3V2UA 2JFFA 3IOYA 2D5AA 1GL3A 1HE3A 1U3TA 1ISJA 2GZ3A 3T4XA 2EGGA 1MC4A 1XCBA 4MVJG 3WICA 4QQRA 2HDHA 3Q3CA 1DRWA 4YTEA 1ZK0A 4CM8B 1UJMA 1AXEA 4KWHA 3WGTA 3WIDA 3K5PA 2YFHA 3ROMA 3JD1A 2PTGA 3AK4A 5CDGA 2OORA 4TQGA 3C7AA 1BTOA 3EHEA 4WASA 2HUNA 4W7HA 1GUZA 4CMEA 4FFLA 4TRRA 2VYVD 4NK5A 3P5SA 2VHVA 4HBGA 3TWOA 4AVYA 5C7IO 1TA4A 5B4UA 5TC4A 4S3MA 3CIFA 3KYCB 2HAEA 4WPGA 3OJEA 4XCVA 3WQQA 3H9EO 2HK8A 4YBZA 4J2OA 3JQBA 4N5MA 4E2ZA 3S55A 4R5HA 3A1NA 4EI2A 1PL6A 3Q9UA 1EZ4A 4YJFA 2CMDA 1T1RA 1BHSA 2V6MA 1GADO 4GWGA 3JQ7A 5B4VA 2EHDA 2IYPA 4GVXA 3NT2A 4YT8A 4BGEA 4BS9A 2O23A 1BW9A 3UOGA 4WEOA 6ADHA 2DQ4A 1QMGA 2EWMA 1NR7A 2VUUA 3BMNB 1O94A 5CDTA 4LCJA 1E7RA 3M2TA 4AJOA 2O3RA 1R12A 3PYMA 3WMXA 1J4AA 3CINA 3TN7A 3E5RA 4JNKA 1K3TA 1UUFA 3RCBA 4ND5A 3KHUA 4EZBA 5L45A 1E1NA 1HE2A 4IJUA 4XGKA 2CD9A 4L75A 4R9RA 2H9IA 3CSDA 2A4KA 3CZMA 5DBGA 1UXKA 1WDMA 3UVEA 5DF1A 4PGFA 3ST7A 1ZEMA 3PHLA 3WGIA 5BQFA 2JCXA 2BMAA 3DZFA 3ZH2A 4UVGA 4YB8A 1DHRA 3A28A 3AM5A 3EZYA 1EE9A 5KKAA 1NX6A 4JP2A 1R0SA 4BMNA 2VZ8A 4FIZA 3VOSA 3L6OO 1JTVA 4KMSA 4L73A 3G1UA 3H3JA 2VNSA 4I5FA 2ZCUA 4R9SA 3HN2A 1NVGA 4BNUA 4GI2A 4J16A 1UZNA 1C1DB 4XX0A 3ULKA 3NGLA 4U5QA 1Q2XA 4NDNE 4YJHA 4EYEA 4J0FA 3OIGA 1S7CA 4DUPA 3DZJA 4ILKA 2VYVA 3B70A 3GK3A 2IZ0A 3UUWA 1H2HA 4J3FA 5HTOA 1A71A 4HNHA 3LLSA 4CR7A 1E5LA 4FR5A 4ZN6A 1VJ1A 3IJPA 1UZMA 1H6DA 2WTBA 4GGPA 1HF3A 3MZ0A 2W2KA 3KSUA 3HDQA 2BRUA 2R2GA 3OQBA 4J9VA 3T7EA 5JCJD 2WYVA 1MGOA 4RDIA 5FWNA 1F12A 2QRLA 2VWPA 1PU2A 2I3GA 2ZKLA 3GUCA 4IDAA 1WDKA 4I5DA 1X1TA 4JIGA 3WYCA 3K2EA 4E32A 3BTVA 4CMGA 3BXXA 2AA3A 3VDQA 5IFLA 2EERA 1E7WA 2B37A 1Y81A 2DTEA 3C1AA 3ZU4A 1GFSA 3DTYA 4WJZA 2J5RA 2B0JA 1VPDA 3GAFA 3DAPA 4M86A 3PLNA 3MJCA 2PH3A 2ZYAA 4R3NA 4IXTA 3CUKA 3UXYA 1WWKA 3H3FA 1KS9A 1PS8A 1U3UA 2BD0A 2Y1OA 3SX2A 3WNVA 4B4WA 1I8TA 4A10A 3DHEA 1DIBA 2Q3EA 3FTNA 2VT3A 4RVHA 1AUPA 2W90A 1MG5A 3AFMA 1F06A 2Q50A 3H5RA 4KQWA 3H4VA 1UP7A 4GBJA 2YV2A 1JKFA 1PZEA 2EJVA 3P2OA 2EIHA 3TNLA 2WDZA 3E48A 2ZATA 4P22A 3MWDB 4RZIA 3AI2A 2UUPA 1CQJA 3QP9A 4U8GA 4CUKA 1DLJA 4M87A 3FNHA 1PGOA 5L9AA 5I9LA 3DOCA 2GCGA 4QFCA 4BO7A 1KC1A 2Q2QA 1FDUA 2NTJA 1BXZA 3DAGA 5GY7A 1KY4A 3UCEA 1U7HA 3H2SA 1A72A 1E3WA 3EDMA 2AEJA 5AYVA 3COSA 4YJDA 5KNLA 1CF2O 4I08A 2DFDA 3KEOA 4UEJA 3WQSB 1YKFA 4IDEA 1IULA 2WD7B 2V6BA 3NDRA 3QE3A 5JXWA 1VKOA 3HZZA 5JDIC 1E6UA 3ROQA 5C3MA 2DBQA 5DCUA 1P3DA 4IPTA 1C0PA 3QWHA 4N5LA 5JCJA 1QG6A 1T1SA 4B79A 4BNVA 2EKPA 2GGSA 3BZUA 3OIFA 2YW9A 1QV6A 3ZN2A 2AE1A 1T24A 1DFGA 4BNIA 4EJ6A 2O3JA 4DBZA 1P0FA 2AG8A 2QRJA 4HXYA 4FJ1A 3DZIA 1WPQA 4Y98A 1DC3A 2YHUA 3OJLA 1RWBA 2Q45A 3KV3O 1A9ZA 2WEKA 1SNYA 3F6YA 1B8VA 2QZZA 4DMLA 1Q1NA 4BUCA 4D79A 5BNTA 4FFPA 4J0EA 2Y67A 2DBVO 4CQLB 4NBTA 4J1NA 4BNTA 1ZEJA 3GEGA 1LSJA 4CMBA 3I83A 3UH1A 2FSVA 4LMRA 1NPYA 1ISMA 1K6IA 1WVGA 5ITWA 1TLTA 3E5MA 4TSKA 3H9UA 1GEEA 1EK6A 3BMNA 3CPSA 2DPGA 5TJ9A 1N8KA 4O59O 1DIRA 4XGIA 4N18A 2AXQA 5IAAA 1V9LA 3ZV5A 4RO0A 2X5OA 2C20A 1UAYA 4CMEC 5JYDA 1YRLA 2CF6A 3WXBA 2P5UA 1YB5A 3WX0A 3PDJA 1L1FA 5A5EA 1Y5MA 3H65A 3KBOA 4TKLA 2OL4A 1ML3A 1V6AA 2P9GA 3BTUA 2OP0A 3O8QA 4ALKA 4N54A 5TT0A 3U62A 1GCOA 3GHYA 1ISHA 2CNBA 5TT1A 3DBHA 1PJ2A 4WLNA 2AQ8A 4J1TA 9LDTA 4XYLA 3FBGA 1LA2A 2W2LD 4XIJA 3ZCXA 4CLRB 1DBVO 1SMKA 3ZWAA 3GPDG 3G1TA 1V8BA 1A27A 3EVTA 2Y1EA 3W8DA 2P2SA 3NTOA 3PI7A 4CLHA 2FR8A 4CM9A 4BGIA 1ZFNA 4W99A 1S6YA 2VN8A 5JC8A 2OUIA 4RVFA 3OJFA 3S1LA 4AG3A 4FFOA 4K6CA 5AVOA 3RBXA 3B1FA 1PJTA 1V3TA 4JCOA 3W4IA 3ROKA 4C7JA 3HDHA 2C7GA 1DRVA 4CQMB 4IQ8A 1XDWA 4BO8A 2D1YA 3WR5A 2YUTA 3KLPX 4RVUA 3E8XA 3GAZA 4MVJH 1N7GA 4B8WA 2EV9A 3BMOA 1R66A 2HK9A 1UP4A 4MIOA 1PL8A 2X6TA 4CL8A 4XD2A 2RIRA 3TJRA 2XOXA 3IMFA 1ZNQO 3PVZA 2QQ5A 2RCYA 3UW3A 3TZCA 2SCUA 4XQ9A 4L9RA 3H7AA 4FFNA 1C0LA 1ENZA 4RPKA 3ZWOA 2FMUA 5L40A 4BGVA 1PJQA 2Z95A 2ZYDA 4E5MA 1E7YA 1PGPA 3W6UA 3MJTA 1YBMA 3VH1A 2FZEA 2D3TA 4CPDA 4YEDA 4LISA 4TVBA 2H6EA 1SPXA 4KTVE 4ESOA 2PKQP 1M66A 2VQ3A 1C1XA 3ETDA 1MLDA 4CR8A 2GASA 4WLUA 4NG5A 2BI7A 5IN5A 2Q4EA 2C0CA 1NR1A 3DOOA 4LW8A 2C07A 3MOGA 1KEUA 5CDUA 1H6AA 4AJLA 2X1HA 1YO6A 3Q2IA 1W6UA 1P1FA 4E3ZA 1JKIA 1SAYA 5IDWA 2X23A 3GR6A 1HRDA 1YQDA 3AY3A 3OH8A 4RF2A 2ZTUA 1SBYA 3JQAD 3KB6A 5L51A 5TX7A 1SB8A 4RV9A 4D7AA 4BNMA 2JL1A 1MV8A 1UDCA 2W2LA 1ONOA 4PZEA 3RUEA 1PJBA 1QYDA 4AJHA 1A4UA 2G0TA 1UR5A 4IINA 2P4HX 1TEHA 1GV0A 4IS2A 3KM0A 1P1JA 3IKVA 1BSVA 1OC2A 3EMKA 3N74A 3GG9A 1YL7A 2NTVA 3GF4A 3FNFA 4NJMB 3BHIA 4BNFA 5HBRA 3GNQA 1K6JA 3DEYX 4CLOB 5L53A 2WD7A 4E5KA 4II3A 3AOGA 3RFVA 2RHCA 1XLTA 3F9IA 3T4EA 3MCVA 3QWAA 1HDRA 3NTRA 5JAZA 2GD1O 1EBFA 4NI5A 2OGUA 4UULA 4FD3A 1C0KA 1E1LA 3MJEA 4DRYA 4DQVA 4XR4A 1KEVA 1B7GO 3OM9A 1TT5B 1NVMB 4IMRA 3KSZO 4LVUA 1X0VA 4OJNA 3TOXA 4CQMD 4G5HA 4O5OA 3H9JA 1M6HA 2OBNA 1SEVA 2BGKA 2NU6A 4M54A 4BNHA 4CMJA 2VCYA 5CDSA 2FR1A 4CODB 4WK6A 1Q0LA 3PWZA 1GQ2A 4IMPA 4R1UA 2CFCA 2ZYGA 5LCXA 3WQRA 4HFNA 3ZHBA 1U4SA 4PVDA 4J4TA 1HXHA 1RYDA 1LBEA 4PRKA 3FI9A 2HMUA 2Y68A 2UDPA 3C7CB 3PJEA 1LNQA 1DFIA 4FC6A 1NFFA 3Q0EA 3ONDA 1YH3A 3PPIA 3ZWNA 4JROA 4Q3NA 2F1KA 3GEMA 4Q3BA 1GUYA 3U49A 5EQFA 1YBVA 3FTPA 4CM4B 1PEDA 3RQSA 1Y9EA 1E6EA 3KUXA 1EUCA 1LSSA 1LEHA 1V3UA 3D4OA 2YDXA 5F5LA 4XEHA 4D42A 4U7WA 3U5TA 3RC9A 1SZJG 2PNFA 2QW8A 3RUIA 3LT2A 1Z6ZA 3DHNA 9LDBA 4OAQA 3JYNA 1LQUA 1UAGA 5ILGA 4BKUA 3WDSA 3AI1A 2CVOA 1E3SA 3RUDA 1KERA 3R3JA 2P4QA 1DB3A 3FPCA 3QHAA 1VC2A 1TB4A 4D3FA 4R41A 1GQQA 1PR9A 1BVRA 1KC3A 2V6FA 2XAAA 2X0JA 1JVSA 1E3EA 2DVMA 3KEQA 2OO5A 1NAHA 4DTIA 3LT1A 3I9LA 4LK3A 5ILOA 5A02A 4H16A 5H81A 1LDGA 3I3OA 2B5WA 4KP7A 4F46A 3E1KA 3GDGA 4IY1A 5H83A 3OETA 5G0VA 3NRCA 4D46A 3ABIA 2NU9A 3TQHA 1XEAA 4MVJF 2PGDA 4R01A 4FS3A 2EG9A 2HK7A 3G79A 1E92A 4BNJA 4EDFA 4CQMA 2YHIB 5TS3A 5FFFA 3KO8A 3RVDA 3SJUA 2E48A 2O7QA 3ZWMA 3FWZA 5T67A 3RKRA 4YXFA 1B26A 4GX0A 1IE3A 1I10A 3LU1A 7ADHA 3AJRA 3HJAA 3CTMA 4MINA 3SEFA 2D0IA 3WFIA 1KEWA 1U4OA 3PHHA 1XU9A 5KJEA 1UH5A 4KDEA 4IDFA 4MVJE 2RAFA 3ZWVA 3WLFA 1H5QA 1ZSNA 3CMCO 3ZNNA 3RBZA 1N92A 5LDHA 3AUUA 3DMYA 4BO2A 2YFQA 4CLEA 4Z0PA 3IJRA 4JGBA 4TZKA 2HCTA 1AHHA 1R4MB 4JXKA 1UXIA 1F8GA 4XYEA 1DC6A 3ZGYA 4AFNA 1PS0A 3RWBA 1PQWA 2WSBA 3U9LA 3EC7A 1JKJA 4XR9A 2D4AA 2DLDA 2WE7A 3QVWA 4LMPA 1ADCA 3MJVA 5JPIA 4E2WA 3HWRA 2PGLA 4RJTA 2A9FA 2G5CA 5ES3A 1I33A 4Y6SA 3GNSA 5ADHA 2GNAA 3F1LA 2AE2A 1X7DA 2EP5A 2DUUA 3AUAA 4OQYA 5A04A 5C37A 5A03A 2CZCA 1C3VA 2C2XA 5JSFA 1XHLA 5L3ZA 1M75A 1YB4A 1CIVA 2GZ2A 4DVJA 4CV2A 1H2BA 4GAEA 4YRAA 4BNKA 3MTGA 4YDRA 4KDFA 1B8PA 2A94A 2DUWA 3JCZA 2Z1MA 3VZQA 1O89A 1Z73A 3KSDO 5F1KA 4B3HA 2CY0A 3OF2A 3SJ7A 3ZNOA 1NAIA 1OMOA 3F1KA 4CUJA 4RL6A 3VH4A 2POQX 1OBFO 1PJ3A 2IXAA 3QVTA 1I32A 2C5EA 4DL9A 3ZZNA 1B14A 1U7TA 3AWDA 3OMLA 1N9GB 1DJQA 1PGNA 3DWFA 1W4ZA 4M8SA 2VZ9A 4U0KA 3GZNB 5KJFA 1PL7A 1HLDA 3GUYA 4TROA 5COAA 4L4XA 4EEZA 1HLPA 2P9EA 1TT5A 5JS6A 3B1KA 4JP3A 3FHLA 2Q99A 3ONEA 1X15A 3VC7A 3PJFA 1DC4A 4PN3A 1Z82A 4R1TA 5KOIA 1R4NB 2G1UA 4JBIA 4Y8VA 2I6TA 4YAIA 3VTFA 3GGOA 3PHIA 2C54A 4ZA2A 1WP4A 4Z9FA 2OOSA 4QTZA 4ZVVA 3JD4A 4IZHA 3F5SA 3HFSA 5TF4A 4BV8A 4CV3A 3GA0A 1VJ0A 3LT4A 3H2ZA 1VL6A 4TZTA 2OFPA 1AN9A 4BNXA 3WGZA 1D4FA 5TGDA 4RORA 4AJNA 4MVJD 1NFRA 4RPGA 2QYSA 1Q0QA 4CMHA 5EERA 4J49A 1O5IA 1JDJA 1PQPA 4DYDA 2X0NA 3IUPA 3E6AA 3FCOA 4K6FA 1EE2A 1G0OA 3GOHA 1VKNA 4GKBA 1I36A 2BGMA 5HRUA 2Y0DA 3BAZA 3JQ6A 4RCVA 1LXCA 1HDXA 4YAGA 4QO8A 3ZWPA 2EW2A 1GU7A 1YOVB 2Y05A 3MTJA 1E7QA 1BWSA 1PZHA 3EYWA 1Y6JA 4NHEA 4XA8A 4BGUA 4GVLA 5B1YA 5JLAA 5U9CA 2C59A 4BQPA 2GSDA 4JBHA 2O3SA 3WJAA 1O95A 4DLAA 1MB4A 4GLLA 3ONFA 3QVSA 4MVJP 1CYDA 4UEOA 4UUMA 3IAHA 2PZJA 3LF2A 3WTBA 4AJ2A 4ZJUA 4GL4A 1P44A 5CPBA 4GSLA 4LRSB 3HDYA 1LTHR 4DLLA 2NV6A 2ZB7A 5A4DA 3WGQA 3WYEA 4BNWA 4XDZA 3AUTA 3ON5A 4R5MA 1LC0A 3NJ4A 1SCUA 5IJZA 4JN6B 3PQFA 2RH8A 2OHXA 2YV1A 3I5MA 3QWFA 3PYLA 3F46A 2C7VA 2WMDA 3PXXA 5AQ1A 5JMPA 1HSOA 3IDSA 4L8VA 4NBUA 3R1IA 1I2BA 1ZJYA 4WEQA 4F6CA 3IUSA 2O3QA 1TVEA 3HSKA 2AEMA 3D1LA 4IQGA 3F3SA 1ENYA 4OYRA 2HSDA 3JYQA 3DZHA 4XIYA 4IIUA 4WGGA 1E5QA 1B0AA 2HQ1A 4YAEA 1LLUA 4PLTA 2PD6A 1YE3A 2WYWA 2BI8A 4RF3A 3W8FA 5KIAA 3ANNA 4JJFA 5CHEA 3IC5A 3B20A 4KQXA 2PZLA 4MVJA 3RC7A 3NV9A 3RI3A 3ZHXA 3GFBA 2VOEA 3ANLA 3KXDA 1X13A 3FBTA 1XELA 4PZDA 3JQCA 2FHSA 2GRAA 4KOAA 3STHA 3L9XA 4G81A 3GVHA 3WLEA 1SOWA 4BO9A 1BG6A 2NQ8A 2G82A 1EVYA 4OKIA 3ZNQA 4QO7A 2B4RO 2DBZA 4RPHA 3JQ8A 2WE8A 1E3LA 1K5HA 1BXKA 5BSGA 1ZK4A 3WSVA 4U6QA 2JAPA 2EW8A 2H1SA 1GQYA 2IE0A 3MWEB 4B4VA 1EEHA 4W6ZA 5GZ1A 4HFMA 3INRA 3NYWA 2YYYA 1LC3A 3HB4X 1Z75A 1U8XX 3W6ZA 4IGEA 3QLJA 5A5FA 2VRCD 3NTQA 4DIFA 3AOEC 3O26A 1WNTA 2Y1GA 4PLWA 4LVCA 2BFPA 4IBOA 5CG2A 3EVNA 3TPCA 1BXGB 3V2GA 2IRWA 5G2OA 2J6IA 4FOOA 3HN7A 2AMFA 3OHSX 5I7EA 1YB1A 1H93A 1DO8A 5IG2A 4MKXA 1JWBB 1ZO8A 2IZ1A 1U2GA 3GVPA 4J43A 1HYGA 1V3VA 1P45A 5KTKA 1QV7A 3AI3A 4I9UA 4W7IA 4DPLA 4CM3A 2VNAA 3U4IA 3I9OA 4QEDA 3NUGA 4RQUA 1EUZA 5BR7A 2C2YA 3JQ9A 4FDAA 4ZQBA 4R68A 4Z0HO 1HZJA 4R51A 2WD8A 3GZNA 1P1RA 1MXHA 4FJ0A 4CM5A 3GG2A 1ADFA 1CDOA 4XDYA 1KVTA 3K9QO 4JLWA 4OO3A 1FDWA 1HE5A 5JYEA 3CH6A 3DB2A 1FDSA 3JQFC 5EQDA 1R4NA 1U8FO 4BB6A 1U3WA 4AJEA 5FI5A 3DR3A 1I30A 3TRIA 4IJKA 3EAGA 4CMIA 3DAFA 3F5QA 5DULA 3ENNA 2ZIZA 1UXGA 2X7HA 3KYDB 4B4OA 2NQTA 2RHRA 4EUEA 1PS9A 2PA3A 1EVJA 3I4FA 3DZGA 4JK3A 5AXAA 5G0WA 1H6BA 2EJWA 1JAYA 2XF8A 2O4UX 4L74A 5C5IA 2VZ0A 4B8ZA 1R0LA 5I9NA 4CM8A 1YONA 3OQ1A 4CM9D 4PLYA 1QYVA 3VZPA 5I9MA 4TVOA 5U4QA 1VI2A 2VRCA 3S2IA 2ZQZA 3A9WA 3EGOA 1VE9A 1F17A 5A05A 5KKCA 3WIEA 4IJVA 2HJRA 1P31A 3QVXA 5DNAA 3IP3A 3NDJA 1J5PA 4ND2A 2PK3A 3KYCA 2Q1WA 3PLRA 4YT5A 3VZSA 3ZWXA 2QHXA 5JO0A 2JHGA 1P33A 4WOKA 1PQUA 1Q7CA 4XQEA 2EEZA 1AE1A 1IZ0A 1YOVA 3PJDA 2ZJ1A 1ZH8A 4E33A 1T25A 4DQUA 4WCFB 5JY1A 5DOZA 4AL4A 4XQGA 3F47A 2YY7A 1XU7A 5A9RA 3PEFA 3BMQB 1D3AA 4D3DA 3CEAA 5JBIA 5CP8A 4GPD1 2E6UX 2ET6A 4Q3AA 2G17A 5THQA 3JQGB 4P38A 2O3TA 5I8ZA 4XWYA 3E18A 4NJOA 4BMSA 3EK2A 4ZICA 1O8CA 2JKVA 2A35A 3BYZA 4W9NC 5L7YA 2LDBA 3L0DA 2Q2WA 1D7OA 2C29D 2BLLA 3TF5A 2VRBA 1YQGA 4BNNA 1LUAA 3LQFA 4BO5A 4F6LA 1QKIA 2Y1CA 3L6DA 2YQ4A 1ZK3A 3HDJA 1KIFA 4NFHA 1WW8A 2CVQA 2IZZA 5GMOA 1H6CA 4ZGWA 2FPGA 1PTJA 5A06A 3GVCA 3FNGA 1UDBA 4QT0A 4BKQA 3RU7A 4PLZA 5KWEA 1DEHA 4RDHA 2ZTMA 1C1DA 2Q46A 1P1IA 2AHRA 4K26A 4MVJI 5K6AA 4UEKA 5K9ZA 1UXJA 2BGLA 5T64A 5L4SA 2HRZA 5ENDA 4D44A 1GZ3A 4WLOA 2PD3A 4R69A 2VTDA 3CZRA 3VPXA 3LDHA 2VHWA 1YJQA 1VM6A 4IS3A 4A26A 1Y8RB 1KVQA 3D4NA 5TNXA 4YPOA 2UVDA 4PFJA 8LDHA 3E9NA 1JN0A 4UVDA 1F8FA 1ZSVA 2HMWA 2RH4A 1N5DA 2Y0EA 4CM7A 4GMFA 1GCUA 3GMSA 4Y67A 1O9BA 4EW6A 4QXMA 4K9DA 3C24A 2UAGA 5CFZA 3TOZA 4AJIA 3FF4A 5EIOA 4HV4A 4L4RA 1BXGA 4MIYA 1JQBA 3WMWA 2NM0A 2C82A 3P19A 3JD3A 2NTNA 4TRMA 5ICSA 1PZGA 1U5AA 1I5RA 4YR9A 2QIOA 2VWHA 3ETEA 1U5CA 1A5ZA 3K96A 5ER6A 2EF1A 1B2LA 1OZAA 4IM7A 1EVIA 3PWKA 4NFYA 5GZ3A 3K73O 3C1OA 4U6SA 3VPSA 3TDKA 3G0OA 3SC4A 1MUUA 5CG1A 3QV1A 3DXFA 1RKXA 5IXYA 3OJ0A 1NASA 3QVOA 3I1JA 1D1TA 1NVTA 1TXGA 3VH2A 2HO5A 5CAEA 1SB9A 3PHJA 1FDVA 4E12A 1IL0A 1DDOA 1I3LA 2JJYA 5ICMA 2X9VA 2PKRA 3ASUA 1I24A 5DP2A 5A1TA 4FQ8A 1OOEA 3OBBA 1KVSA 1P1KA 4U0JA 4A27A 4H15A 2J3HA 5AXDA 4NNJA 4E21A 2I99A 4XYMA 3NAQA 3GN2A 3EY4A 5BSHA 2B4TO 3AY6A 4F45A 1W73A 1G6KA 5JAIA 3BTOA 3JSAA 3ZW8A 1KVUA 5DCWA 2DPHA 5F3RA 1T2EA 3RUAA 1ONPA 1E77A 3Q11A 3RC1A 4O63O 2NU8A 3ICCA 2NADA 3I6QA 2DC1A 3IQDB 3L4BA 1EFLA 1DJNA 4PVCA 1UP6A 4HFJA 1FXSA 3GN1A 1NFQA 4PG8A 4ID9A 4IIVA 1NHGA 2JCYA 3L6EA 3DFZA 2NUAA 3JQ9C 4O0LA 1WXDA 1DXYA 1FJHA 1HL3A 1N1GA 2PV7A 2VHYA 3O9ZA 1RM3A 1P74A 5T5QA 5EL0A 5G0SA 1GUFA 5LDGA 4IDDA 4ALNA 3GC6A 2GN6A 3RJ9A 1IY8A 2FP4A 1PWZA 3DC2A 4BNYA 2IEBA 3ENKA 5COBA 4CQLA 1MFPA 3R3SA 1QLJA 4WCFA 2HJSA 2B69A 3EUWA 4HNGA 4E4YA 3BMQA 3G49A 1HKUA 1NQOA 3QIVA 1ISFA 3G3EA 4PIVA 1M76A 4OGWA 1NQTA 3EW7A 2AQHA 2NVWA 3PFFA 5G0UA 1CRWG 3H6KA 4YYZA 4G2NA 3RBVA 1ORRA 4YA6A 3VAZA 2GN4A 4LGVA 3ZU5A 1ISIA 4ALLA 3WWZA 2NACA 1XIVA 2AEFA 3I23A 3GMDA 2FN7A 1ZMOA 3WS7A 5ER9A 5CEJA 5F1PA 4EITA 4HKTA 4RVDA 4R4JA 4LN1A 1R37A 2GDZA 3RUCA 1SC6A 4Z9XA 4R3WA 5BT9A 1W8DA 4BNGA 5A3JA 1AHIA 5DOVA 2FSSA 4M49A 3D3WB 1RYEA 1LRKA 1G1AA 1X0XA 4ZQEA 4BKRA 1LRJA 2GUGA 3PTZA 2Q1UA 4CLRA 4DMMA 3DZBA 3K30A 4JJGA 1X7HA 1ZIDA 1EFKA 1K6XA 1QXSA 3OEYA 2ZB4A 3ADOA 2B4QA 4QFDA 4RVGA 5JAMA 3GT0A 3GVIA 3VH3A 4NBVA 1DLIA 4RPLA 3FR8A 4K1LA 5KJ6A 4JBGA 3N58A 3JQ7B 2NNLD 4J90A 1FDTA 4QECA 3WTCA 4N5NA 1LSOA 4E5NA 1LDBA 3Q2KA 4OL9A 1I01A 1HWYA 3HUDA 4BO6A 3DDNA 1O6ZA 2I5PO 2PWZA 3AOEA 4RVSA 3VDRA 4Q39A 1Z74A 3C8MA 1JW9B 5TRTA 1PJCA 1AGNA 2ILTA 2DM6A 1J49A 4YJGB 3U09A 4NIMA 4AJJA 5T8KC 4UVHA 1B3RA 1ISGA 3DFUA 1BDBA 1DHTA 1OC4A 4BQRA 5CDYA 3RFTA 2X5JO 1PJLA 3OA2A 4YQZA 3DONA 4XGNA 2ZB3A 4TRNA 1U2DA 3WNQA 2AG5A 3KYBA 2YZ7A 1DIHA 4CV1A 1NQ5A 4XQCA 5T57A 3WGYA 3PQEA 2AQIA 4HP8A 4ITUA 1ARZA 2QRKA 4D3SA 1A4IA 1GYQA 1QLHA 4HADA 5K6AC 1T26A 3QSGA 2JFHA 1HZZA 1E7MA 1LX6A 3AUSA 5DZSA 1H9AA 4BB5A 2BFMA 3RKUA 4MPDA 5DDIP 3KLMX 4XB1A 1WAMA 3WB9A 1PJSA 1RPNA 1JWAB 4OMUA 1QR6A 1XGKA 2X5KO 1U9JA 4D45A 4YJHB 2B36A 1JAXA 3JQFA 4BOYA 5JMWA 3VTZA 2VYND 1MFZA 4HWKA 3OP4A 4CLDA 2HMSA 3GNTA 4CL3A 1SEPA 3WYBA 1GD1O 3B1JA 1A7AA 4OOEA 5A9SB 1K2WA 2XXBA 4FFMA 1NBOA 1N2SA 3F4LA 4W82A 3O4RA 1GR0A 4E13A 2BF7A 5C7LO 2H5LA 1H9BA 1CEQA 2V7PA 4NJMA 4MP3A 2PH5A 2B5VA 4J1QA 3UICA 1N1EA 2HU2A 5JNLA 2Y1FA 3BA1A 4CLOA 2BFOA 3V2HA 4NMHA 4ND1A 4BO4A 4QUKA 4E5PA 4A2CA 3JD0A 2F00A 4PG6A 5TLSA 1IHXA 1DRUA 2I66A 4NQZA 4OKNA 3RROA 1SO8A 4DIOA 4S1VA 4J7UA 3PIDA 5DCYA 3X2EA 4AICA 4WUVA 3GRPA 5CEFA 1U1IA 1YWGO 2EKQA 2GPTA 3FRJA 1R16A 4I9HA 3DBRB 4ND3A 1QORA 2DTDA 3GEDA 4DWVA 4OM8A 4Y6RA 1KYQA 1ID1A 4I8XA 2CUKA 4N7RA 5DN9A 1YXMA 1X14A 3IP1A 4CLXA 4E31A 3PGJA 2X0IA 4IDCA 4PLPA 3SLKA 1FK8A 4BO0A 4CM6A 4DYVA 2E37A 2Y0CA 3FPLA 2EP7A 1ZXLA 4GH5A 4R54A 1KOLA 1IOLA 2FY8A 1T4DA 4R16A 2HKIA 1OI7A 4P4LA 3A06A 1UZLA 2CDAA 2PGJA 4CJXA 4MOWA 3I9MA 1HYEA 3V8BA 1WLYA 3NKLA 2X86A 5KVVA 4EGFA 1GTMA 3D64A 3DZKA 3GY0A 3C1TA 3INTA 4TRJA 4ZU3A 1GAEO 4NH4A 3LVFO 5JE8A 2Y66A 3PYXA 1LDMA 3RASA 1PGQA 1R6DA 1BVUA 4TWRA 2DT5A 3PRJA 3TZHA 4CM4A 5I7SA 2VYNA 1YDWA 1Z45A 4W9NA 1E3WB 3L4BC 1M67A 4M1QA 4GGOA 3C3XA 3K2BA 3PDUA 3R0IA 4KTTE 2RBEA 2D2IA 2NLOA 4E2YA 4D0SA 1DSSG 3KOUA 3CXRA 2WWRA 2NU7A 5IF3A 2ZQYA 2P91A 2PZMA 1PZFA 3H8VA 2R00A 4WLVA 3ZU2A 5TIIA 3MOIA 4J4BA 3LSYA 4ZQFA 1W0CA 2J5QA 4H7PA 5EINA 2NSDA 2J8ZA 3PIIA 4CM1A 2OZPA 4A7PA 1PGJA 1ZCJA 2XXJA 4WOJA 3D3WA 1UXHA 3ADPA 4LRTB 3W4KA 1YL6A 4DQXA 4Z9YA 3FR7A 3SC6A 3JTMA 4UUNA 4DLBA 4DA9A 1Z7EA 1HE4A 2UYYA 1HDZA 2QX7A 4WLFA 4WCFC 2VTEA 2FPPA 4NK4A 4BO1A 2WYUA 3ZW9A 4WNCA 3Q6IA 3LLVA 1E3JA 1JLLA 2D5CA 2EGHA 1YS4A 2W8ZA 3V1YA 3ORFA 4DPKA 5MDHA 1JA9A 2R6JA 3GDOA 2J3KA 1DAPA 3INGA 5F5NA 1NTOA 3PHGA 2QZ9A 4E5YA 3RUHA 1RM0A 2YHIA 2ZCVA 4OOFA 3WBFA 4GLOA 1LI4A 5DP1A 2YQ5A 5A3VA 2G76A 3D3EA 5B37A 1XWFA 1ZBQA 3VVBA 3PWSA 3UN1A 1ADBA 2O3UA 3TL2A 4CR6A 4YJGA 3S2FA 1E0DA 5TJHA 1IZ9A 1H0KA 3TFQA 5HA5A 2DAPA 4PLVA 4ZRNA 2Q2VA 3I4CA 1TT7A 3UKOA 4YCAA 5CEEA 1Q7GA 4KZPA 2X8LA 1NNUA 1ENPA 1YGYA 4PRLA 4Y9DA 5BSEA 5IDQA 1EUDA 1WDLA 4ZRMA 4BV9A 2OMEA 3H9QA 5EESA 4BVAA 3LC2O 3O8QB 4FBGA 3ZWWA 4B7UA 1QYWA 1QYCA 1KY5A 3MJ4A 3DBHB 1R4MA 1GPJA 2XPCA 4YRDA 3O38A 2EXXA 3D0OA 5THKA 2IDZA 1EDOA 1KETA 3SLGA 2JD2A 3K8ZA 1NYTA 3LC7O 5CPFA 4NBRA 4OH1A 4RLSA 4GKVA 3UCFA 4Z3KA 3C7DB 1MA0A 4UAGA 1QP8A 4PG4A 5AXBA 2LDXA 3FNEA 2DTXA 3V5NA 4NFSA 4BNLA 5I7VA 2VOJA 4GWKA 4I9NA 1PJ4A 3PK0A 3Q1LA 3DBVO 1LSUA 1U28A 5KCZA 5JO9A 1GZ6A 2Y93A 3GLQA 1IPEA 4WNIA 5A9SA 1BMDA 4DGSA 3BMOB 1C0IA 2Y99A 4BMVA 3VPHA 4FGSA 3A14A 5FF9A 1ONNA 4PLHA 1T2DA 4WLEA 2AQKA 1HYHA 1DOHA 2GERA 1LJ8A 4D43A 2I9PA 4DC0A 2DKNA 3BIOA 4X54A 1PIWA 2B35A 3WGGA 3DQPA 4Z6KA 3EZLA 4LSMA 5JCXA 2FPIA 3AM3A 4PLFA 3W4JA 3K6JA 1XQ6A 4YACA 3ICPA 2X9GA 2FZWA 4ALMA 4AJPA 1T4BA 4WCDA 1P1HA 4ALJA 3U4CA 1D1SA 1N9GA 3DBRA 4PLCA 5J23A 3AW9A 3KVOA 1B15A 5BNIA 1C1XB 4BKPA 2PZKA 5JDCA 5H82A 4A5OA 3GZ4A 1J6UA 3RU9A 1EDZA 3BMCB 3DBLB 3MJSA 4RQTA 3I6IA 1R15A 4MVJM 1CQIA 3G17A 2WJPA 3NJ8A 2A92A 1XYGA 4FB5A 3L4SO 3M2PA 4TMFA 3HNPA 2QG4A 3VKUA 1VL0A 3I52A 4OHUA 4B3JA 3DOJA 4CUZA 4D41A 1TI7A 3DMTC 1MC5A 2O50A 4OQZA 3GDFA 4XYBA 1VJTA 1XG5A 3Q9NA 3D5QA 4MDHA 4J7CA 5KJCA 4MKZA 4FCCA 3RUFA 2OBYA 2IXBA 3GQVA 3U0BA 5KVQA 4DXHA 1DIGA 3E9MA 2GYYA 3K92A 4GX2A 5ITVA 3GGPA 1K0UA 2O48X 2IYOA 1B3BA 1WMAA 4PZCA 1PX0A 3OECA 1XSEA 4I1IA 1BGVA 4B4UA 4XYGA 2CSUA 1ZVMA 3WGHA 1NWHA
chains in the Genus database with same CATH superfamily
1THZA 3AIMA 1TYAE 2E49A 3BF8A 4L76A 4TUYA 2XYPA 1NXQA 4AZ0A 3IV6A 4K9SA 1K7YA 2O8NA 3KETA 2I71A 5DXJA 5FNVA 4YUXA 3QX3A 2GVNA 2JI7A 1PFYA 4NCBA 2YIJA 5GZ6A 4IL5A 3WYGA 3TSAA 1YFJA 4ZEXA 1ZXBA 2XVMA 3PNSA 4EEXA 3BULA 1C7EA 3DO5A 5JS7A 3VZRA 4Q4DA 4YNBA 4M37A 4PX3A 4DV5B 2DBRA 3WZLA 1ODSA 2OBMA 5JANA 3IKTA 4CCWA 4MB0A 2GF2A 4N48A 3OQMA 3MXOA 3NHYA 5CYOA 3OSUA 3ILXA 1E1QA 1LFAA 5HKOA 1P9OA 1UJBA 1X87A 3NX4A 4B7ZA 1RJWA 1WB4A 4EX7A 1MC1A 4CN8A 3CVWA 4A8JA 3LVQE 4M0DA 4TS4A 5FPYA 5BWNA 1EA5A 2UXDB 4HWSA 1PBNA 1K89A 1GZDA 1YI1A 3O74A 3OLYA 5BSRA 4RZQA 3BWMA 5EJ5A 1MX5A 1Z4IA 2J1LA 5AM3A 1AUXA 2OAEA 5KOHA 1EIZA 1TEVA 3NH6A 2ZSFA 3GFGA 3VKWA 2PR2A 1Z0IA 2WIKA 1SOAA 1P4RA 1GGVA 3ZDYB 1J07A 2GBFA 2RAUA 4MJLA 1AUOA 3WBJA 3UAXA 1JZQA 2LKCA 5LD2C 3QRWA 3WK5A 1O97C 2AC4A 2FMIA 1KQFA 3LXRA 4BCCA 5K3EA 1WXWA 8GPBA 2O4CA 3IX7A 4XWWA 2PS0A 2ZUFA 3AGQA 4JS0A 4F3YA 4W5QA 4RA9A 3JALB 1GNVA 1XVUA 2FE4A 2VAPA 3EPKA 1IPFA 3GGGA 1FFDA 1QSGA 5ALMA 3H5WA 2CMFA 2XZTA 3IIJA 4TKMA 5I7AA 4L95C 4YAJA 3G82C 5I9TA 3RLFA 4YCNA 4BN5A 1G5QA 1ATIA 3JQDA 2OAGA 3NOOA 2OILA 4P8RA 2G9QA 2WKPA 1LDEA 3OZIA 5FQOA 3VU9B 3MCTA 2QRUA 5JZSA 1YR9A 3BD7A 2XBLA 1HNZB 4AG3A 3NBKA 3MVEA 2YL2A 4Q05A 1N6PA 1PSWA 5BN5B 4YAKA 5AVQA 2JGRA 3I2IA 4BVKA 4EG7A 1XZNA 2XKBA 3T1VA 3UG7A 1U3DA 2V7QD 3LK7A 3MRVA 4MP8A 4XWOA 1BGWA 4P5PA 4CLOA 5F77A 3AVYA 1X1EA 3WO0A 2ZK7A 2MOKA 4G65A 2Q1SA 4U3JA 3SOPA 4D9MA 1JFSA 2UKDA 4P4NA 3L93A 3DGFC 4M0MA 5JRJA 2NAPA 2Q5FA 4MR7A 4OSEA 2WJGA 2LD4A 5BR1A 3TKAA 2J5KA 3PGLA 1NPTO 4QUJA 5BYKA 2GN8A 1YJ8A 4Y1RB 5GVRA 3CNLA 4OXYA 4ZQHA 2HQSA 5K0TA 1HDOA 1F1JA 1PSDA 1CUDA 3LF1A 2YJ5A 3TRHA 3RVOA 1FX0A 4ENVA 2XUFA 4RYDA 2VH2A 5TPWA 1YKSA 3DFFA 3SP1A 3LK6A 4KXLA 4TQAA 4CNQA 2WJ3A 1RM5A 2FSFA 5L95A 1OB2A 4N76A 2WMNB 4XDHA 1T4GA 1ZK1A 2Z1NA 4IJWA 1FP1D 1DKOA 1JHYA 3UJ8A 3GBVA 3PNVA 2RHDA 3RSQA 1THGA 4BMXA 1O57A 3UBMA 5JLJA 2P90A 5H4GA 1K68A 1MXFA 1G59A 1VSVA 1Y9AA 4ZPXA 2EX0A 1A96A 1Q3KA 2F3UA 3H5NA 1OBVA 4ZQCB 3ZEAA 4BKMA 1PSZA 1I3NA 4EUFA 3L0BA 5IJ9B 2IS2A 5LQCA 3HBNA 4HTFB 3OOJA 2XDWA 2K2QB 2NVBA 4A73A 1DS6A 1JDTA 1VLLA 3B2QA 4Q4CA 2AOWA 1RLJA 4EPVA 2IPXA 3ESZA 3B2EA 4TKZA 1XNJA 1ZNZA 3VKVA 3IBFA 7MDHA 3HCOA 1U28C 2HBYA 3WSWA 4WE3A 3STYA 4BL5A 2WILA 1U7WA 2DUMA 4N82A 3DBOB 2P8SA 5T4FA 3HBJA 2GB4A 4AXBA 1FLVA 2H3EA 1K7XB 1J2JA 2O06A 2XMQA 2ZU6A 3UAGA 3V1TC 4CIDA 2I80A 2G08A 5K0ZA 5CR9A 1TM5E 3HDGA 2XGJA 2CXQA 2WNIA 5KUTA 2WYOA 1OWPA 3ZU6A 5B6IA 4WOBA 4ZD6A 4YUYA 2EEPA 2A9QA 4IKEA 3UOAB 2JIRA 1Y6FA 3LUBA 3SBEA 1EVZA 3RIGA 5C7YA 1VG0B 3HQ4O 5LQMA 2JI4A 1M33A 1T2CA 4XB2A 1JMYA 5DBFA 4G1CA 4PAMA 1HDYA 2R8BA 3EXFB 1Q77A 2D54A 2WAXA 3HE3A 4KIJA 2XCLA 2ZVJA 4A0SA 3RH0A 1V4VA 2IUTA 3TNDA 5JS8A 2JIQA 1GDHA 3EIHA 3O3CA 5CD1A 4YRJA 4HN2A 1YMVA 4IX1A 2VDVE 2X0RA 4KGZA 4OMDA 4UNPA 4XRRA 4BP3A 4F97A 2G4CA 3EPPA 2FW9A 2IW3A 1OFGA 1W4LA 3OEWA 5JDCC 5JZBA 8MHTA 3TFOA 4OIMA 3ZY2A 5F1OA 4IQ0A 3RAFC 2CL6X 5H59A 4FFRA 2NSJA 3RS0A 3VPFA 2VJQA 3AU8A 2VJAA 4QWWA 5IBRA 4XRGA 4HPXB 4UREA 2AUMA 2REQB 5IC6A 3IEXA 3UMBA 4ZI2A 2JEZA 1P81A 4FC7A 1WUKS 2WJIA 5AJYA 4KH1A 3MAJA 3IUJA 4RTRA 1U94A 3G7UA 3ZDBA 1RC0A 1WZNA 3ZJUA 4AP6A 4RK7A 2AWOA 2FZ5A 4BVLA 1I9CA 3D6UA 4GOKA 3OJOA 2GX6A 2O7NA 4PLGA 3HYNA 5ERXA 5HQ3A 3S2EA 1OKKD 5HM6A 3G02A 4HC4A 1H5UA 4OD0A 5ECWA 3U3XA 1MBZA 1EQUA 3RKSA 2BEVB 1X74A 3LP6A 3CGWA 3OE4A 3NHKA 1RZRD 4DA7A 3HUTA 2C4NA 3TZQA 1MVLA 4F9FA 4EB6B 1GZUA 4OXNA 3B6ZA 5E7QA 1E3IA 1CSEE 3TG2A 2SNIE 3N7AA 4L9AA 1L4MA 3H5VA 3WB1A 2QNIA 3MEQA 4DBVO 2XYRA 3CRQA 4A9AA 4MYSA 5BV1A 1FFEA 3O47A 2B99A 5JAQA 3THXB 2JFGA 3LYLA 1E62A 3MWKA 4RELA 4W1RA 1N2CB 4GMGA 4D9NA 1N2CE 3F0TA 3OFSA 2P67A 4UFNA 3V4FA 5KOJB 4DRXB 5EJAA 3VR4H 4D96A 2XEXA 4PHHA 3DBIA 2V7UA 1GEGA 3IBGA 3JQAA 3R6WA 3LPCA 1J23A 1QO7A 3NAZA 2BFDA 4H4CA 5MN5A 1BC5A 4EX6A 1MNAA 4PNZA 4YMUA 2IJGX 5AI4A 2FYTA 1F14A 2G71A 2O0JA 3PFWO 5GAJA 4DC1A 4F6RA 2YJGA 2QQFA 1IXSB 3TI9A 5FBQB 3KDPA 3R7BA 4AJ1A 3RTAA 5DFAA 2IOHA 1P75A 4BLVA 1A9YA 1W9HA 1Z4MA 3KZCA 2V1XA 4HMPA 3PNPA 4QSMA 5DBIA 4D4GA 2ZJZA 4Z4EA 2GBIA 3QVJA 2EYQA 2QLTA 3BQNB 4L4YA 5AOVA 3IMGA 2V55B 1OT3A 3UKJA 3KD3A 5C80A 3HM2A 4BLPA 2FWMX 2G4LA 3EC1A 5LA6F 1YQQA 3WK8A 1X8LA 5HWSA 1DG1G 1I0ZA 1N2OA 1AS2A 3PJGA 2PFGA 2B2CA 4KPFC 3ZCUA 4LY9A 3RDPA 2I62A 1BW9B 1P0CA 3M3DA 2WD9A 3E35A 5K8CA 4D9GA 2E1PA 5IUJC 4MRPA 4R31A 1P3Y1 1HT2E 4C5BA 4FN4A 1Q0RA 1XB2A 2NVUA 3I1YA 1EQ2A 2ZJFA 4H7JA 4JYMA 1XQYA 2ARKA 1T3GA 2GA8A 2X9QA 2ZJ4A 2X2EA 3B52X 2IY7A 3HLKA 3I9KA 2FI1A 4RF5A 3VOTA 1PFUA 1W76A 2CE7A 2CXTA 4Q3EA 3QLUA 4NBWA 1J97A 2BJWA 1NXVA 3WJ7A 1IM5A 2G8NA 1SUFA 4LX8A 4D74A 3THXA 1LDNA 3TKLA 3WGMA 1CY0A 4KPUA 2ZRGA 3GLVA 2BM8A 2XNKA 3BH7A 4MYTA 5JY6A 1HTBA 4AZ3B 1I5EA 3LFUA 2QMZA 4Q03A 4YXWA 3UHAA 3UIEA 3VNAA 2PBLA 1XR3A 5MHTA 1QPBA 1QWSA 3CVOA 5BN4A 2C1EA 2JVKA 4YWJA 1SOMA 1JU9A 1X7YB 4EG5A 4MA4A 4RQAA 4JQZA 2JHFA 4DCNA 2VDWB 3TX6A 3UB4A 4YMGA 1FP2A 3BH0A 1EFTA 3N6XA 4I5GA 3M4NA 4ROSA 3ZXYA 3Q87B 2FQ1A 1IHYA 1UDAA 2PMCA 2QR2A 2ZAIA 3IILA 2XI4A 1VIVA 4NR0A 4BHTA 4CKBA 2OFFA 2ZAOA 1UK7A 5JJ5A 4POAA 3GWZA 3KZVA 4EARA 1XDZA 1I2ZA 1IBRA 2VHXA 2IYTA 3KP1A 3IR7A 3VR5A 4KI0A 5EWMA 5H3CA 1CY7A 2ECKA 4DGQA 1A7JA 3QA9A 4N3BA 1LZLA 3COZA 4R8LA 2C5HA 4OHRA 1NQAO 2D5LA 2YBDA 5GIPE 2QI9F 3B6IA 1TW3A 4R1NA 1KK3A 4G56A 3VNQA 5IT9A 3R5JA 4KAFA 3PZRA 2DY0A 3HNRA 1ITZA 4WK2B 1DARA 1DAHA 3KPJA 4LJ6A 1SKBA 2WWIA 5AI5A 3AV0B 1GFZA 1Y8QA 1ZMTA 2PKQO 4OHMA 1VA5A 4WOPA 4ZXPA 3RAJA 1SUIA 4EY3A 1DXOA 5C7OO 4DUZB 1W581 3FF1A 3R0ZA 4HMOA 2DHDA 1F0NA 2FA9A 3WHIA 3ZOZA 3P4YA 1YB6A 3NIWA 4C2AA 4TKVB 2ERYA 4OUDB 4W4TA 3GHHA 2PN1A 4ATNA 2P9HA 1CERA 2Q9CA 2XBUA 4D4MA 1LRLA 5CYGA 5AVXA 3D6FA 2J07A 3O8OA 3OTOB 2G0NA 1V35A 4J6FA 4G23A 5K45A 1EAYA 2PLAA 2PH7A 4IGFA 3I9JA 2O0HA 1B6SA 2Z2IA 4BLWA 5LOVA 1Z7BA 4O08A 4WHMA 2I6UA 4C5AA 4QLOA 1XTTA 2XV1A 3ZBTA 2X3FA 4DMKA 3FTQA 2I67A 1KZ4A 2IOYA 2GJ9A 3DF9A 4QGAA 5IUNC 3QNWA 4CEIA 5JDIA 1D0VA 1XAIA 1L7AA 1XRLA 2FZCA 3STTA 3UFBA 1RZUA 5JJBA 3LWZA 1C41A 4YO7A 1QP0A 4H08A 1ESNA 1GSIA 1E1RD 3ITKA 2AFHB 4H6VA 3MMNA 3MUFA 4KMMA 1D8AA 4AY6A 1ZM2A 1GY8A 3R77A 3ZX4A 2AFHE 3D3KA 1L5HA 1SVMA 4ZVSA 5BPFA 5FI3A 1CJVC 5TVGA 1UM8A 2V6GA 3MM4A 3DWGA 2QE7D 3SJZA 5E7IA 1XF1A 3N7UA 5TQVA 5J2TB 2D59A 1G0NA 5EXSA 4F11A 5IJXA 1L5ZA 4X6XA 3BORA 3DXZA 3L84A 2X58A 5DHAA 5JC1A 3TLCA 2ID4A 2ZRLA 3P8ZA 4NCHA 2UUOA 3SX0A 3UANA 5IKPA 5BURA 4OI1A 3MUEA 3WIBA 4YT4A 1BNCA 2QG9A 1UMKA 1II8B 3LYUA 4UDOA 3QYAA 1B93A 1T4MA 3FOAA 4N40A 3TRJA 2VTKA 3ETGA 2PYIA 1RI5A 3VU0A 2HIAA 4NF2A 3D6HA 4ZAYA 3GRYA 3O8CA 1ZM7A 1I1HA 2VT2A 3C85A 4U02A 1RABA 1ZI9A 4JENA 5JU6A 4TT8A 2C3PA 5LDDC 3HACA 3LMKA 4DLUA 2JFFA 4II2A 4WESB 3SNHA 1N2HA 1BVHA 1DAFA 3T4XA 5KSZA 1X94A 3BGVA 1LY1A 1N75A 1XCBA 3Q3GE 3CRZA 2AXEA 4QQRA 4NVRA 3DGEC 2B34A 2OCGA 2ZE7A 1ODLA 3Q3CA 4FD2A 4Q16A 3FCXA 1RRPA 4CM8B 4QLAA 2GAIA 3FRHA 3K5PA 3ICOA 4PEVA 3ROMA 4INOA 4DSNA 5CDGA 2JFWA 2FUG1 1UM9B 1W0JA 2C4VA 3NC1C 1CJMA 4TMKA 1BTOA 2IV2X 3SSNA 3CUYA 2P5SA 3B7PA 4WASA 1LF0A 2CNOA 4CMEA 1E58A 2F9FA 2GPAA 4FFLA 3C6QA 2NMVA 1RWXA 2VYVD 1XYVA 3PGKA 3UK6A 3ELDA 3SX4A 1CLEA 4EMBA 2WB2A 4UTRA 1XP5A 1M2OB 1M1NB 4DM3A 2HAEA 4FLMA 3OJEA 4XCVA 4YBZA 3DCJA 3EYAA 4J2OA 4MH0R 4ER7A 2J6BA 4K88A 2QN7A 5ALHA 3S55A 4E2ZA 4EI2A 4CG2A 3JATB 1VMDA 3L0ZA 4YJFA 2EDAA 1G2OA 3C16C 1T1RA 2EFHB 4UDNA 4RTNA 1GOTA 1GADO 4C0SA 1AZLA 4G6ZA 4NXNB 1REQB 3IQFA 1H22A 4LY0A 2O23A 3AMVA 1IM8A 3ND5A 5DIZA 1Q7TA 1XZMA 4N0MA 2F4VB 2G80A 1KEEB 5A4AA 3VNVA 3DLPX 4AYTA 1QMGA 4A91A 4NCXA 2VUUA 4B83A 2XB4A 3I32A 3K0AA 5CDTA 1XMXA 4LCJA 3M2TA 4EYOA 4EYSA 1G38A 1PN3A 3AEUB 1PE0A 2XTMA 3I58A 1VI6A 3TN7A 3E5RA 3CLUD 1K3TA 2XMZA 2JIBA 4DJAA 4ND5A 4IMJB 2A4MA 1CUEA 3MPOA 1X1SA 2RHHA 4D5EA 3TLKA 1WHTB 3G9XA 1E2LA 1HE2A 4XGKA 1TK9A 1BU8A 4L75A 5EZYB 4DM7A 1EI9A 4E5UA 3CZMA 4KLAA 5DBGA 1WDMA 3UVEA 3ZHVA 1HX7A 3K1AB 1U0LA 3ST7A 1WQ4A 1JFFA 1QVWA 3MUOA 4ZOBA 3R0VA 2I6FA 2JCXA 2QXTA 1KF0A 3ZIDA 5TQ2A 2OCKA 3ZH2A 2E3JA 4UVGA 5GV7A 1DXQA 4DSTA 3I12A 5J5CA 4F2DA 2WUFA 4B80A 4L4UA 1NX6A 4FEEA 2XLBA 1E5VA 1X9GA 4BMNA 3T3MB 1A1SA 5JHHB 2VZ8A 2VYQA 3VOSA 4C0KA 5EWLA 3I3SR 4Y1EA 2FPGB 4CW7A 4HWRA 1BN6A 3EEBA 4X94A 4KMSA 4L73A 3KWLA 2B8WA 2QZJA 1OX5A 3H3JA 4ZO4A 1XMPA 1SVUA 1W9MA 3D6MA 2BP7A 2V3CC 2WJJA 1KYXA 3ULKA 1SKQA 4RTPA 3BEOA 3B36A 5HGXA 1QE3A 5KX5F 3H4TA 1JWLA 3DZJA 1H0RA 1YSCA 3B70A 1CDZA 4G4JA 2IZ0A 4KDRA 3UUWA 4B6OA 1A71A 3HYLA 1NL3A 5B2ZA 1K5GA 4OBWA 5EMMA 4CR7A 1YBHA 1HH4A 2ON6A 3G2PA 3AIKA 5E2IA 2DQYA 4Z51A 4IHJA 1HF3A 5JIBA 3MZ0A 4MYCA 1KI4A 2IYYA 3HDQA 3KSUA 4J9VA 1F3OA 4Y6LA 5DHPA 3IH5A 1I4TD 4JJKA 4JLJA 3KQWA 1T5TA 5JSQA 3SJCA 1VXOA 4V2UA 2EWVA 2VYFA 1IBKB 2VCEA 1M2VA 3G2OA 3FDZA 1G8YA 1WDKA 2E0IA 3OFNA 4DV3B 1X1TA 3QKSB 2FEPA 5I9SA 4M1EA 1CC1S 3FGOA 1I6MA 1SHZA 3QFSA 3BXXA 3FPKA 2EERA 1E7WA 2HHAA 1ZESA 3PXEA 1ZH6A 4NYMR 2J41A 3VBCA 2XODA 3C1AA 3OZVA 1SVOA 5DH9A 3G9UA 2J5RA 3D8UA 4RY0A 3KVYA 3D8HA 2O2EA 3P45A 4I2VA 1N9KA 1X1CA 4F1KA 4TLMB 3PLNA 1LVUA 1GSAA 2ZYAA 3DYBA 4IXTA 5EP3A 3K0HA 1NW3A 5IAGA 3TZEA 2FJPA 2Y1OA 3BE4A 3BE8A 1QOPB 4QD3A 5K4HA 4MI1A 3KZKA 5IYZB 2WOJA 5EEHA 4A10A 4BXOA 4MDFA 3CXUA 1IWOA 1AA9A 3T99A 1MG5A 2WZBA 3H5RA 1J0CA 2J31A 2HF2A 2B8TA 5EVCA 3RLIA 1CR6A 4AYWA 1SD1A 1JEDA 3PUYA 4LXYA 4B6EA 3SKVA 3OQPA 1PZEA 1THMA 1P72A 2HLHA 5K0CA 2DJIA 3TNLA 2EIHA 1P7VA 4D0NA 2XF2A 2YJ4A 4EUKA 1KU6A 1C9MA 2ZWPA 2C8LA 2QTTA 4P98A 3AI2A 4RZIA 1E8NA 4S1OA 5DSTA 1F2DA 4CEHA 3B2NA 3VSEA 3QP9A 2H1CA 4U8GA 5HJEA 1DLJA 3L2OB 4M87A 1PGOA 4NDZA 3V8NA 4LXGA 2H65A 4F9GA 5I9LA 1CS0B 2DEUA 2GKSA 4EFNA 2GCGA 2XUAA 1F51E 1KC1A 2DWUA 2Q2QA 3IDFA 4KYIB 1YHNA 4TYPA 4JI4B 3GD5A 1KY4A 3QELA 2PMWB 2C92A 2QD4A 3EZFA 1NN5A 3H2SA 1Y82A 1ZIXA 2EFJA 1XHEA 3R5FA 2PZFA 3COSA 1ULTA 1YB2A 4HDAA 3EZ6A 4I08A 1HGXA 4V0KA 4JU8A 5CGQB 4YJDA 3WQSB 1T5DX 4KBYA 3RREA 1S1CA 2QUHA 1T0UA 1JUDA 3T5TA 1QRAA 1WO8A 3MJRA 1FRNA 1DT5A 1WXXA 4GKKB 1KJZA 3KJZA 5HNKA 1I0LA 2OCXA 2ZIEA 3G23A 5JCJA 1FCJA 2EKPA 2HEIA 4BNVA 1JHQA 2OKGA 1PZNA 1U90A 1UT5A 2A14A 4E2FA 1ZLXA 3N86A 4EJ6A 2BY4A 4GNRA 1XMOB 1Z8FA 2QRJA 4ZI3A 2QVXX 1KDTA 4HXYA 4UM9B 2XVAA 3VKGA 3WZMA 5HGJA 2GK6A 2VBCA 3D8TA 3OE7D 3ZI4A 3F7TA 2YHUA 1ZH0A 4YYEA 5L3SB 4S1TA 1SVIA 3OJLA 4QXOA 1RWBA 2ORVA 1N4AA 2ORYA 3SYMA 3OZDA 1A9ZA 3ZGLA 4Q66C 1XTRA 1TTTA 1PEKE 4DMLA 1T9AA 2CJWA 2AS0A 4BUCA 4F3RA 1KTIA 3GP5A 2FP4B 4FFPA 4J0EA 5B1SA 4GZLA 5LUAA 2O19A 4Q24A 1EFHA 1P8AA 2YZNA 4LNUA 5CVCA 4NZNA 1XMVA 3LUFA 4LYDA 4BNTA 3EXHB 2XH8A 3KKEA 3RS2A 1JLRA 3P4UA 4KE8A 2RB5A 2ZANA 3OP1A 4CMBA 3K4HA 1H5NA 3DAYA 4E7OA 2FSVA 2JLRA 3I2GA 3CGGA 4MUHA 3UHOA 4AUMA 3AB3A 1WVGA 1TLTA 1NLUA 1KE1A 4K6GA 3F6PA 3L6RA 4Y9RA 4CRWB 3HJNA 3M5CA 4DXAA 3LWBA 3OM1A 1GQSA 2HA7A 3RT9A 2W6OA 1M1UA 5DISB 4N18A 4L7QA 2WTNA 2YIMA 3LX8A 3OZEA 3UC5A 3N6RA 1GSOA 3IUBA 2Z43A 3REQB 2QLNA 4AKHA 2OOKA 1DTWB 4BE4A 3CJQA 5JYDA 3DCIA 1Z4OA 2DX7A 3ZCPA 1YB5A 1Y5MA 2NO6A 4JLKA 2CXPA 1E9SA 1KZ9A 1Y8AA 3PFHA 4KSCA 4BU1A 3BTUA 4ALKA 5CVTA 3BPSA 5TT0A 2Z2XA 3WMEA 3O90A 4P1ZA 4O5AA 1JG6A 1MB0A 3DA8A 1TM3E 4RFSA 1ISHA 4X93A 4G0XA 1XN4A 2HMAA 1PJ2A 4Z3OA 2AQ8A 2IF0A 2QYOA 2H85A 5F2OA 3UWPA 5KNBD 4B3RB 1Y4UA 2OXEA 4LJSA 4XIJA 4CLRB 5KDLA 4HLCA 3PICA 2WKRA 2VTBA 1QU2A 4M2LA 1II0A 1D0IA 3G1TA 1V8BA 1A27A 1JYEA 4HLUC 4D9KA 3PB3A 5CA1B 1T5LA 1RJGA 2QRQA 2ISCA 2E4ZA 4W99A 5CBPB 5JC8A 2OUIA 2GWHA 4GF5A 4G2TA 3I1IA 5BV8A 3HYRA 4K6CA 1O94C 1DQPA 2F7SA 2C5BA 2C3MA 4DV4B 3AWIA 1V3TA 4JCOA 5A0VA 4JI7B 1XCMA 2AN4A 3B38A 2R5FA 3DMHA 3ROKA 3UN1A 2G67A 1DRVA 4CQMB 1BO6A 3CUTA 1CUIA 2PGIA 1J1UA 2FCAA 2XW6A 5K2MA 2YUTA 1OYWA 3F96A 3F4KA 3PNLA 4IILA 4YECA 3P4XA 2HK9A 4LGYA 1UP4A 1YR6A 1SUEA 4FGZA 4MIOA 5IT4A 3HEMA 1PL8A 1RPAA 4K86A 5C18A 2GM4A 3BGDA 4RJIA 3IMFA 3MB5A 3A7DA 1FQJA 2QQ5A 3T41A 1G66A 2ZRBA 4FINA 4IUDS 2RCYA 4FFVA 2PKYX 3ZD6A 3TZCA 5CLFA 2KM1A 4XQ9A 1Q14A 2P1ZA 2IIVA 2GDJA 3JZFA 4BGVA 5ARBA 4E5MA 5DGDA 5JJIA 1PGPA 2C9DA 3OWXA 5KTTA 1NVWQ 3MQ2A 3VH1A 2FZEA 2D3TA 4MKHA 3KQNA 2JLYA 4TWZA 1C9YA 1N3LA 4CCSA 5KYVA 1XDDA 3LECA 4QGSA 3TGPA 2PKQP 4HQ6A 3ZBPA 2VQ3A 2P3LA 3C3JA 2JASA 1OIVA 2X0FA 2IS1A 1MLDA 2OC4A 4YCLA 2AZ4A 3ER8A 4DEVA 1YGPA 1ZRSA 3AF4A 2HJ9A 1KH1A 1XZCA 2PLWA 1JKJB 2NZVG 1H6AA 3E27A 1MEEA 2X1HA 5BNWA 5JRZA 3H04A 3KAJA 1W6UA 1P1FA 2AJLI 1VBKA 1XBTA 4E3ZA 3FFTA 4JL6A 1V1MA 4NBNA 3GLUA 3TJMA 4H0FA 1SAYA 1Y98A 5FWYB 5IDWA 5I47A 1YQDA 3OH8A 5FA6A 2CV1A 1QQTA 1G8FA 1AGYA 1SBYA 1ZD3A 3KB6A 5TX7A 5IKMA 4RV9A 3SSMA 2QDXA 2DCMA 4O4IB 4ZTUB 1UDCA 1XC7A 2P78A 2PL9A 1JDPA 4D8XA 4OP2A 2P6UA 1QYDA 2YHSA 3ANYB 3FSGD 4ZYXA 1W87A 1A4UA 1Z56C 1NN0A 1UR5A 2VSYA 2ZR7A 3QZUA 4HVTA 4B6FA 4HZUB 1GV0A 4NMLA 3ET4A 3HDTA 2QUBA 4CCYB 4R7GA 3IKVA 1BSVA 1KFEB 3EMKA 3N74A 5H4HA 1WV1A 4MS3A 1U6JA 2AV6A 2W9XA 2XYHA 1AKVA 3FNFA 2EGUA 3N1UA 4NWIA 4V0ME 5JVDF 1E98A 4PR3A 4L1KA 5B1EA 3UJ6A 1U3GA 1EG7A 1K6JA 2IKSA 3JQRA 2E21A 3O8LA 4FKMA 4WRRA 3TVTA 4IFTA 4N5HX 4U2BA 5E6SB 3ZQKA 4UNIA 3U31A 5B55A 3N7TA 2GXSA 3NOVA 2P40A 1XLTA 3E7PA 3DG9A 4M1OA 5E8JA 5D3KA 1RE1A 1SPBS 1UBKS 5E6UB 2GD1O 3GB9A 4BUJA 1TVKA 2QMQA 4FD3A 4RENA 1XRSB 1C7ZA 1V48A 1Y4ZA 2Y1XA 2PUCA 4ZVUA 2V54A 1ZJ4A 2A5GA 4KN8A 4N7JA 4X1OA 1RMQA 1J25A 2ISSD 3IVRA 5AOAA 5KHAA 3K0CC 5REQA 4EHNA 3MRTA 4NPAA 4FNOA 3RWMB 1DELA 2ZUDA 1W0KD 4OJMX 4MQFA 1W94A 4IP0A 2CMHA 3CZPA 4MUGA 5F64A 4G5HA 1Z08A 1GPUA 1M6HA 2PT9A 3PEYA 2BGKA 3HXTA 2WJWA 2VCYA 1JX6A 2FR1A 3GYGA 1ECPA 3OIWA 2D3WA 4JYCA 5EYPB 1N25A 2F64A 5FHRA 4CODB 1RXWA 4QU8A 2XNHA 2QL5A 4H4DA 1GQ2A 2ZRKA 4LVNA 4LDAA 2YWFA 1KMCA 5LCXA 3NRBA 1G4HA 1GNRA 1U02A 4HFNA 1UZUA 3NYRA 4PVDA 5LUBA 4DLVA 4PC1A 3LXXA 3OQJA 1DBIA 4E7PA 2JJ2D 4XCQA 2HB6A 1S2LA 2HMUA 1SRQA 4JEMA 2AJDA 1OJ7A 2ZIAA 3NM5A 2X3YA 1U80A 3DDHA 3M9LA 3IIIA 3Q0EA 4MKGA 5CNMA 3F98A 1KIMA 4JYBA 2GZMA 2FOLA 3FMOB 4TSFA 2F1KA 2G9NA 3GEMA 1H9CA 5AVYA 1NF3A 1SHTX 5DNDA 1T43A 2XD4A 2E4WA 5IX8A 5CCXA 4O2AF 3RQSA 3LUKA 1G63A 4QAJA 1QHYA 4PC2A 4RKQA 2XQGA 1FXWF 1E6EA 1IEQA 1ZN9A 3KUXA 1LSSA 2ZTHA 1QRDA 3R41A 1LEHA 2GQ0A 4H2DA 4OGLA 1K9SA 2QPOA 4LMAA 3FPEA 3G5LA 4MO9A 3TAXA 2XZLA 1WUHS 3V7UA 4D42A 1QHGA 1NXSA 3RC9A 2AN1A 2QW8A 4WSOA 1GPLA 1Z6ZA 1RU3A 2BFFA 3DHNA 3KDSE 3JALA 9LDBA 1PWHA 4HH0A 3BWVA 3ZIAA 2PUJA 3JYNA 2VJDA 2WF5A 4UU1A 3TVYA 1Z0AA 3KT6A 1UAGA 4DR7B 5ALOA 2QRVB 5A5VA 3AI1A 5CRIA 3SLRA 2H3HA 3IUEA 3R3JA 2HR1A 1JMVA 4MRAA 3WFZA 3I76A 3QUTA 3EJWA 4IR7A 1NU6A 3ZHCA 1U0TA 4DG8A 5J63A 2VHCA 5JOQA 3BCSA 1GQQA 3FCSB 1GTJ1 4ZYYA 1U7XA 2HA0A 2JF0A 3H13A 4XM0A 3KEQA 2WLTA 5DI3B 3D2BA 1T8PA 5IT0A 5BN5A 1PNRA 4N01A 1Y7LA 1RYHA 1HK7A 5K0NA 1LDGA 1WCIB 5J40A 6PFKA 3VA7A 4IY1A 3WL4A 1Z0FA 1NKSA 2B78A 5EIBC 3NRCA 4G5FA 1V5IA 1U7OA 2NU9A 2PGDA 4PYKA 2EG9A 3B5IA 3GFFA 3STXA 4CE6A 2KMLA 5BQPA 3RS4A 2ZSUA 4Y6OA 4BNJA 3LM8A 2YZ2A 1SC9A 4N47A 3W9SA 5TS3A 2D6FA 2D0DA 1EU1A 4KE9A 4F5WA 3G0BA 2A30A 2NYAA 3SJUA 2E48A 3ZWMA 1X3SA 4BLRA 1L4GA 4F4DA 1TCCA 3E0XA 3RKRA 3EZ9A 4YXFA 4YV2A 2IS6A 2XUHA 3R0JA 2BSQA 2GILA 3SIXA 1B26A 5EQJB 4EQ6A 1I10A 3LU1A 4GR4A 3AJRA 1OHHD 2BKLA 3GP8A 2C7QA 3RQIA 1S8NA 2WG0A 3QYFA 2WT9A 2MINB 4OL0A 4O8ZA 1WCXA 1NA5A 3DW1X 4F96A 1XT6A 2FSHA 3L7IA 4KDEA 1VHJA 2RAFA 5DX8A 3JRNA 4G24A 4IJ6A 3ZWVA 3ILYA 3QBTA 1QH8B 2J85A 2K87A 3FMPB 2R11A 2JFXA 1SKAA 1N92A 4AMYA 3AUUA 4BO2A 4MULA 2PL1A 3ZQ4A 1SFRA 3P1JA 1JXMA 5AHXA 1ZN7A 1JFRA 3AHDA 3OZCA 4IV8A 4PO9A 3CLRC 3IPLA 1X38A 3WRVA 5IJ9A 2EZ9A 4JXKA 3QV2A 1UXIA 4XYEA 3ZGYA 4AFNA 2IH4A 2Y8EA 1NUUA 1TCBA 1UDXA 4AKIA 2WSBA 3U9LA 1IBSA 4NYJR 1O7JA 4JP5A 1HTWA 3QBDA 4PO3X 5KNCD 4IEEA 4UQLA 3NIBA 3O95A 2D4AA 3BGWA 4C0HA 2YZGA 3QVWA 2X3UA 4F3CA 3EG5A 5JPIA 3W77A 3L7MA 5BSUA 3GT4A 2CXRA 5DM4A 2PGLA 2JBWA 3G89A 4NBKA 2G5CA 4K6HA 4OFXA 1I33A 2Q3DA 4Y6SA 4XSGA 2VPPA 4YRZA 3CLHA 4C07A 621PA 1ODCA 4P7KA 5C5CA 1HORA 1MU0A 1R88A 4OQYA 2Q3JA 5I9IA 1Y6RA 1C50A 2VYCA 3HP1A 4FYVA 5A03A 1SCKA 2H18A 3MK31 3VR6A 4NE9A 3EEOA 2XDQA 4R2KA 3T6KA 1NJ5A 4QRIA 3ANSA 1M75A 1CIVA 2GZ2A 2BE9A 5HRAA 1JQEA 4CV2A 3ESRA 1Z6AA 1VE6A 4GAEA 1HYBA 4YRTA 3BCRA 1ZHHA 4H4EA 4HAIA 5DRTA 3D0RA 3VYRB 2P6RA 1GPH1 4G89A 3QUSA 4YAOA 4X71A 1B8PA 3LUCA 4TM8A 1KK1A 3DOFA 1N4DA 1O95D 4PQRA 3SJ7A 4DM4A 1NAIA 1OMOA 4WIAA 4RL6A 5JTUA 3VH4A 4XUDA 3VR2D 1RP1A 3H9CA 2YWRA 3T7SA 2IXAA 3ORRA 1I32A 4GVPA 1E0AA 5ALIA 4DL9A 2P6PA 3OMLA 1NI3A 2I91A 3FCYA 4JUFA 4OB8A 1W4ZA 2VZ9A 4U0KA 5KJFA 4JH0A 1PFQA 2AWNA 3WISA 2REQA 4TROA 4UJ3A 5BVHA 1YR3A 4L4XA 4EEZA 4GYWA 2AFRA 4A4DA 3G88A 3E70C 1IWBB 3B1KA 3HJCA 4JP3A 3NHZA 4K03A 1WSBA 1U3CA 1DC4A 3J80A 5KOIA 1HQCA 3P2KA 2G1UA 4KO8A 1TUGA 1PZMA 2I6TA 1RP7A 4QOSA 4RM3A 1R64A 4S2EA 4QTXA 2C54A 1MB3A 4U7DA 4Z9FA 1VCNA 2OOSA 4G0VA 4UCQA 3RABA 4BJ5A 1Z9BA 2ECQA 4NZPA 1E1DA 1CQIB 2PCJA 3ZWDA 2HJVA 2BEVA 4ZZIA 1RMYA 5LJLA 1LWOA 2CXHA 3O21A 3B7GA 1ANKA 2WR8A 4N54A 3TEFA 1UAAA 4BWGA 2NYUA 1AB5A 4BZPA 3S28A 5JH7F 3KQYA 2A88A 2ZIVB 3A05A 3H2ZA 2MU1A 4ND7A 5BORA 2XD9A 2VSQA 3A04A 3QUQA 1KDZA 2GN0A 1Y1QA 1H05A 4PPNA 4UXHA 3WGZA 1MAVA 4RORA 1CRQA 3O7MA 3WYNA 1V5GA 2JI8A 3USZA 2GCEA 5KNDH 1MQ9A 2QYSA 3LV8A 1DQYA 1PNOA 4CMHA 2QNBA 4BYMA 2AZMA 2QSYA 1JDJA 5GWXA 1Z5NA 2ZRJA 4NENB 4XSHA 4X62B 3E6AA 2ORWA 4RY8A 4DRXA 1KQOA 3FCOA 1SQ6A 2DH6A 4K6FA 3T7RA 1XCGB 1HA3A 4LXXA 1G0OA 2EL7A 1VKNA 4GKBA 1KJ9A 3LBHA 3K5WA 3BG5A 3AFGA 1ZM9A 5PNTA 3A36A 4CKEB 5ADVA 3CUVA 3E7XA 3HY3A 4HAWA 2Q5OA 5B3KA 5JZMA 1EM8A 2XCOA 4LC1A 4ZCQA 3E5NA 4F2HA 4Y0VA 2HQOA 2BUBA 3EGEA 4HWOA 1QH1A 3RAPR 3ZWPA 3UJ9A 3TSOA 3PVCA 4UUQA 1FMFA 1DO2A 1WF6A 5DVZA 5F2EA 1Z3IX 4I55F 2A6PA 5FT9A 3R6TA 1BWSA 1B41A 4BGUA 5B1YA 4YRIA 4AT1A 3LQQA 2C59A 5U9CA 1ZUHA 4HLUA 1HOXA 1BHJA 2GXUA 3PF8A 2GUWA 3M33A 3COYA 1CYDA 4UEOA 3EXHC 3FPAA 4G5XA 2GN2A 4EF4A 4ZJUA 3UMCA 1I4WA 3F6CA 3UZUA 3OCXA 3EMDA 4BTEA 3QF4B 2HF9A 4YMLA 1OSNA 1XTJA 3C4VA 3WI7A 1I5OA 4KG7A 3ON5A 4TQUS 4EPXA 2ZQ5A 1LC0A 3N2NA 2YOGA 1JHRA 4U8HA 5IJZA 1NXOA 1OXTA 1T9DA 4MITA 3L8ZA 4MUMA 5BY2A 4FZRA 2YQZA 3F46A 3HVUA 2C7VA 1NNEA 3PXXA 1HSOA 4JMPA 4L8VA 4AZSA 1YDFA 3IR6A 2O3QA 2XYQA 4ZKDA 1L5GB 2AEMA 1RWKA 2PXXA 1XZHA 4IQGA 3HBFA 1ENYA 4UZEA 1PR6A 3DZHA 3RK4A 1BIFA 1R74A 2WI8A 1NJ8A 2JH9A 2Q6TA 4IIUA 3HWWA 4EI8A 1LI7A 3V8PA 1Z6GA 1X7YA 2I2CA 2WYWA 4UZSA 1OGJA 4RF3A 4R9VA 4WUTA 3ANNA 3PDCA 4AWBA 5KIAA 3AKCA 5IBCA 5FLEX 2HW8A 3B20A 2ODWA 2JAUA 4MVJA 3NV9A 2RC6A 5FLXA 3ANLA 3IOCA 3SFVA 3W5AA 1X13A 1OQAA 1UOQA 1XELA 4PCLA 4Z2AA 2GRAA 4KAJA 3ZZUA 1TYBE 5JXGA 3AUKA 2Z4SA 2XT9A 4GNKA 1NU8A 2WYIA 4MZDA 8ABPA 1QANA 5HIJA 3WRXC 3ZNQA 2G82A 2J08A 2VDNB 3GJYA 2X40A 3MA0A 4HQKA 4RPHA 4YFYA 1O5TA 2VUHB 1NJGA 1K5HA 2XVYA 1ORVA 1PK9A 2VJPA 4LYHA 1ZK4A 4BNDB 4MDYA 2IBTA 3R3HA 5DGHA 1YDMA 1NRWA 3EC2A 4F5DA 1B1AA 3KXLA 1SUPA 3KZMA 5JS1A 2JK0A 1CNMA 1JEOA 4MV4A 1ZU5A 2WVAA 3ZYZA 1XMSA 4U9HS 2OG2A 1U8ZA 1Y80A 2QU7A 3W6ZA 3HRIA 2CHGA 3O2NA 2CLMB 4M6WB 4PLWA 3A6HA 1CY6A 4OUDA 2XRMA 4TKVA 5CG2A 3Q7EA 4CFSA 5G2OA 4RTMA 2J6IA 2FWNA 5HF5A 3OHSX 2DH5A 5IUKC 1YB1A 2BMFA 2TECE 3PHCA 4IHQA 5E8RA 1H93A 3WK4A 5BOVA 1FDRA 4D9HA 5TE9A 1J5XA 4TM7A 1MCZA 2ZS7A 3UJHA 4DY6A 5AI6A 3PUHA 1L7NA 4UASA 5CFPA 3FRIA 4RSMA 5I4IA 1KAOA 5SYMA 4PZZA 1ZO8A 2IZ1A 5I45A 2GK7A 4DLWA 3MW8A 6REQB 3EBOA 3AVXA 2QTZA 3SHVA 4TL9A 5KTKA 1QV7A 1DCKA 1KY2A 2ZRMA 3QHPA 4IEIA 1JV2B 3QMPA 2QUZA 3B3AA 3H87A 1F0PA 1H2WA 2B25A 1E2BA 2VNAA 3CYFA 2HSZA 3OEEA 4QEDA 2PUEA