3PK0A

Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
GSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPESLDAIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Oxidoreductase
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pk0A00
3LC7O 2A4KA 3A28A 2B83A 2AW5A 3BMNA 3P2YA 2O3JA 1YL6A 2E4AA 5IDYA 3S2EA 1OZAA 4BO8A 5U1PA 4UREA 3L6OO 5I8ZA 2PD3A 5AXBA 4RVDA 3RFVA 4YJHA 4TRNA 3WQRA 1DDOA 1PR3A 3WGIA 3WSVA 1UXJA 1Y8RB 3GVIA 2GN6A 1HDYA 3PYLA 4ZRNA 4K9DA 4W7HA 3JQ6A 4H3VA 1HT0A 3PK0A 4W7IA 4R16A 5B12A 3F46A 2C2YA 4IJUA 4BNJA 3DZGA 1YL5A 3FR8A 3BHJA 3WYCA 1GU7A 1ZXLA 1TB4A 4XRGA 5K0ZA 2JAPA 3D3WA 5TT1A 5BSGA 1E3WB 4Z9YA 1ZK0A 1WLYA 5CFZA 4CR6A 4LSMA 1LDEA 3NTRA 5KJFA 4XCVA 1Z45A 3R1IA 4EUEA 4FN4A 5ICMA 1F17A 3Q3CA 5AXCA 1WZIA 5C7IO 4NZ9A 3VPFA 4K6FA 2I9PA 2ZB3A 3OBBA 4WPGA 1RJWA 3DOCA 4OM8A 4TRJA 4BNVA 1BGVA 3GDOA 3VTFA 3DBRB 1O89A 3HFSA 2YY7A 1KC1A 3H4VA 4OGWA 5GMOA 3S8MA 2CF5A 1PGQA 1T2DA 3PFFA 5DN9A 4WCFA 3FPCA 3U4IA 3HSKA 2FMUA 4RPHA 5A1TA 3OJOA 4FW8A 4HUJA 4P4LA 4JJIA 4BMSA 2YHUA 2DBRA 1R15A 3IKVA 4YAEA 1P44A 3FNEA 3E18A 1C0IA 1ZW1A 2O3UA 3JSAA 4Y6SA 2FPIA 5IAAA 2W4QA 4IPTA 1PX0A 1ZZEA 3ANLA 4BNLA 3DZBA 4J9VA 5CP8A 4YJFA 5A03A 4OL9A 2FN7A 2P2SA 1TT5B 3B70A 1QR6A 3HQ4O 3ROKA 3RU9A 3PFWO 4II3A 1C3VA 4A10A 1M6WA 2J3HA 4RGBA 2O3TA 1LJ8A 4BV8A 1K5HA 4YDRA 2R00C 5HA5A 1I2CA 4XRRA 1IY8A 3O26A 3FNHA 3LC1O 2C7GA 1WWKA 4OQZA 1E3SA 3ZV4A 1ZK3A 4E30A 4W9NC 5KJ6A 4OSPA 3ZWBA 4BHTA 4J0EA 3VHRA 1GUZA 1N1GA 3G1UA 4KMSA 3OQBA 4DWVA 4B7UA 3PTZA 1D1SA 4DXHA 5F21A 4BO9A 4BNHA 1XLTA 5I8WA 4KQWA 2PY6A 1B2LA 4YT4A 3WGOA 1DAOA 2VUSA 1HYHA 2VYND 4DYDA 5JDCA 2AQKA 4RVGA 2ZIZA 4BNKA 1YRLA 2C54A 1NAIA 4RPJA 3U4HA 4UEKA 3WGGA 1IZ9A 5KKAA 3H65A 1NHGA 4CM7A 5C7OO 3QLJA 1F06A 1NVTA 3NDIA 5EPOA 3UCEA 1NAHA 4ALJA 1B3BA 3GVHA 5H81A 4CL3A 2B0JA 3PWKA 4CQMB 4IDEA 3JQBC 1T2FA 1LDNA 1NWCA 4CQLB 3VZPA 4YT8A 3ST7A 1WPQA 1QLJA 2YV1A 4JQCA 4KUGA 4XX0A 4AJHA 2OBNA 4E5PA 1R0LA 2JCYA 3Q11A 1NX6A 3G79A 2B37A 2ZKLA 3H3FA 5DNAA 2EHDA 2QZZA 3VZSA 1ZSYA 4RVSA 1R12A 3GRKA 5AXDA 4IZIA 3F4BA 4KDFA 4GX5A 5L9AA 4IIVA 1E3JA 4XYBA 2QX7A 1MFPA 5G4KA 3NT2A 5ENDA 1GZ4A 3F1KA 3L07A 5A05A 3WGTA 5C3MA 4W6ZA 3AJRA 3WLEA 3K5PA 2EF1A 2DBVO 4NFSA 4G65A 3A14A 5EIOA 1XWFA 3UUWA 3VZRA 3LQFA 5KVSA 3HDQA 4DUPA 3EW7A 1E1KA 1Y1PA 4ZQBA 1PJQA 3IKTA 4PLFA 5A02A 1LDMA 1ZK2A 1A7AA 3ZWAA 2E49A 4BL5A 3IS3A 4CQMD 2GCGA 1PSDA 1NHWA 2HLPA 3RBVA 3VOSA 1YJ8A 3S55A 4O1MA 4CUZA 1IB6A 2ZCUA 1UR5A 2YZ7A 3GMSA 1W6UA 2QQ5A 2PR2A 1SMKA 1RM0A 2WD8A 3L77A 3WGYA 4GGOA 1M2WA 4YXFA 5KVVA 3FPLA 4Q3DA 2NNLD 3KLPX 5T64A 4L76A 3I9JA 4FJ1A 4GPD1 1P1KA 4IIUA 3ZWPA 4MP6A 1B3RA 5EL0A 4QEDA 5JDIA 4UVIA 3CKYA 4PZDA 4XGNA 1GY8A 3JQAA 2IXAA 3AUUA 1O5IA 9LDBA 3A4VA 4HY3A 3CPSA 2ZK7A 3ONEA 1SEVA 3VH1A 2DTDA 3ORFA 3OF2A 3PHIA 1JVBA 5BSEA 4CMEA 3GNSA 1OMOA 4TRMA 3KSDO 4R5MA 2Q1UA 2EKQA 2IZ0A 4KQXA 3RKRA 4BVAA 1ISGA 4BOYA 2UVDA 3HJAA 3AK4A 5JSFA 4CM4A 1CEQA 5IXSA 1IE3A 4PIVA 1HEUA 2EG9A 5IG2A 2P9EA 1ZSNA 2B69A 1JU9A 2G82A 3KB6A 4QECA 3CMMA 3B1JA 1EUDA 1E7RA 2OMEA 3I9LA 2HMUA 4RLSA 1I36A 2PA3A 2B36A 2VRBA 3DC2A 1W4ZA 2BI7A 3I1JA 2G5CA 4LSWA 5COQA 1Y5RA 5KJ1A 3QVSA 2C20A 2Q2VA 4AJJA 2SCUA 4BNMA 1XR3A 1BW9A 4DBVO 5KTKA 3EC7A 4WLFA 1C0KA 1K6JA 1YWGO 3JYQA 4M89A 2JCXA 3PGJA 2Q1WA 4TZTA 3A1NA 1U3UA 1YBAA 3QHAA 3FCOA 4IQ8A 4IQ0A 1ZJZA 1KYQA 2Y0CA 4TZKA 3E1KA 3QJ5A 4DIOA 5F5LA 4FFPA 1R0SA 3DTYA 4FOSA 4S3MA 1LA2A 4PRLA 1V3TA 4RZHA 3TRIA 4UEOA 2G0TA 5G0TA 4XQEA 4NBUA 3S2IA 2PZLA 3HN7A 5U9CA 3ADPA 4UUPA 4D7AA 3IJRA 3GH3A 4INAA 3UCFA 4GGPA 5DCWA 2NQ8A 2WE7A 3WTBA 5K6AC 5KVCA 1ADGA 1BDBA 4MVJM 4QO7A 1PGOA 1ZMOA 2AG5A 4WOJA 1YONA 3GVXA 1Y6JA 4PG4A 3U9LA 2IE0A 3OQ1A 3NT5A 2YHIB 4CLOB 2DAPA 2DKNA 2PLAA 3R3JA 1NASA 4NPCA 1KS9A 2GO1A 1V6AA 1U28A 1Y8QA 1BG6A 3K6JA 5CAEA 4D41A 4YBZA 4NR0A 4JGBA 3GVPA 4U0JA 3FI9A 3H5NA 2DFDA 5TX7A 1OBFO 1P9LA 3PVZA 1WNTA 1EZ4A 2ZB4A 4KZPA 3WJAA 4U0KA 1JAXA 3ASVA 2HU2A 2X5KO 5IZCA 3GRPA 1B26A 3KRTA 2VQ3A 1FF9A 2NVUA 5A3JA 1A72A 1PJLA 3ANMA 4E4YA 3U5TA 2Z1MA 2Q3EA 3SX2A 5HM8A 4I9UA 2Y66A 3G1TA 1EVZA 4J1TA 3DZJA 1ZCJA 1P33A 4GLOA 4XB1A 3U4CA 4EI2A 1PWZA 5JXWA 4NFYA 2G17A 4B79A 4BNYA 3NT4A 4P4NA 3PZBA 1MC4A 2VZ0A 3KYDB 3ROPA 3UH1A 1CETA 3V1UA 1FDSA 4UVGA 1H93A 1PEDA 3CINA 5JY1A 1ADCA 3I4CA 1N9GB 2IODA 4BGUA 1SOVA 4RF4A 1YDEA 3PPIA 1DC4A 3QE3A 3JYOA 1PZFA 4GI2A 4M55A 4GMFA 4JX8A 1LDGA 2RHCA 5I7EA 4L4SA 4L73A 2BH9A 3JQ7B 2BGMA 4CR7A 4ZGWA 3KBOA 4BGVA 4WUVA 3ZNOA 1DFIA 2GN9A 1EBUA 1X15A 2WMDA 2PGDA 5BQFA 1I3MA 2C0CA 1WZEA 3TFOA 1XHLA 3AY3A 1E7SA 3GNTA 5BT9A 3ZU2A 4ZN6A 1GEEA 2NU9A 2O3RA 4J4HA 1F0YA 1PS0A 2Y93A 3Q2KA 3K96A 3BA1A 5LDGA 2DPHA 4MVJG 1DC3A 3FTPA 4DPKA 1C1DA 3TNLA 3L6DA 4WECA 5FI3A 1UZMA 2H63A 1U3WA 2VHZA 4JBGA 2GZ3A 5ADHA 4E5MA 2Q49A 1SB9A 4LGVA 5TLSA 2XXBA 1DLJA 1B8UA 2JD0A 3WWYA 1Q7CA 5HWSA 3UCXA 4R54A 1KY5A 3LK7A 3K8ZA 1EVYA 4AG3A 5JW6A 4DREA 3ETDA 4Y9DA 1X7DA 3BIOA 2OXIA 4RPKA 1PJ3A 4R1NA 4Q3CA 5CPFA 1KY4A 3QWAA 3GHHA 3SLGA 3T4XA 1E7YA 4N5MA 1DIAA 4FJ0A 3C1OA 3ZDFA 1SPXA 1XELA 4Z0TA 3GPDG 5TJ9A 1IHXA 3DDNA 1U2DA 2PH3A 3ZNPA 2J5RA 3RVDA 3U4DA 1V8BA 4R51A 5CEEA 2YUTA 1ZBQA 2B4QA 1YJQA 1ZIDA 3M1LA 1SB8A 4WLVA 4CUKA 3KYCA 1QXSA 1PWXA 1TXGA 2AQIA 1YB4A 5BNTA 2PZJA 5JMPA 3IJPA 1LC3A 4CMEC 1QKIA 3HDHA 2FPGA 1ISHA 4B7CA 4YJGA 4UVDA 1OC2A 3Q0EA 4OXNA 3HN2A 2YQ5A 3D0OA 5FF9A 4HFNA 4M1QA 3W8DA 3DB2A 3WMWA 3ZV3A 3I9OA 1N1EA 4RF5A 3JD1A 4JJFA 3ZNQA 2Q2WA 2P9CA 2Y1FA 2BFPA 3T7EA 2UV8A 3WBFA 1ISFA 4BNTA 1VSUA 2O50A 1JWBB 1P45A 3IAHA 1P3DA 2FR0A 4R5HA 5A9SA 2BHLA 4JJGA 5KWEA 3RC7A 4IINA 2DU8A 4KDEA 4Q3NA 3DHYA 3EY4A 1ZUD1 1HF3A 3C7AA 4BV9A 4U7WA 5BSFA 1DEHA 2NU6A 4JROA 4PLWA 3B20A 4Y67A 4F6LA 1M66A 3L9XA 6ADHA 3X2EA 1HDXA 5DCUA 3LT4A 4GAEA 2FY8A 1N7HA 4YPOA 1P1RA 1J4AA 4E2YA 4RVUA 2OGUA 3HWRA 3MJEA 3DMTA 3CMCO 3K73O 3T4EA 3IQDB 5AQ1A 1H6AA 1WDMA 3KLMX 3GZ4A 5I7FA 1ZK1A 3CZMA 4IXWA 3GDGA 4TQGA 4CM8B 1O94A 4NK4A 3ITKA 4DVJA 3TZCA 1NPDA 1T1RA 3DOJA 5JS6A 3WYBA 2HMSA 5BNFA 1QYDA 4MIOA 2NADA 2HK7A 2GYYA 5T5QA 1P1IA 3MJVA 3FD8A 3BMQA 1ENYA 3VH2A 2I3GA 4J7UA 1IYZA 2VN8A 3H9EO 4IDFA 4BKRA 4W9NA 4WK6A 5B4UA 2HAEA 4WE3A 3TDKA 1YBMA 2CNBA 4DLLA 3DHEA 4CODB 5CDTA 2HDHA 1T4BA 1I32A 3W1VA 2JAHA 2Z5LA 4NIMA 1HE3A 4GKBA 4ID9A 4YRAA 3FR7A 5DBIA 3AWDA 1SZJG 1GAEO 2JL1A 2P4HX 2QG4A 2VYVA 2Q46A 4QTZA 4MVJD 2O4UX 1KBZA 3PQEA 1OFGA 1JDJA 5IXYA 4NU5A 1DIGA 3M2PA 4PFJA 4YEDA 4Z0PA 4CJXA 2NVWA 3WR5A 1RYDA 4RV9A 2AMFA 4BO0A 4IUYA 3NEPX 2BGKA 2X23A 4RVHA 1GL3A 1GADO 2VHYA 1CJCA 2VUTA 2C5AA 5IZCC 4EW6A 4WEOA 1DAPA 4Q39A 4HFMA 3KEQA 1EFLA 2RH4A 3D3WB 4FOOA 1YOVA 5THKA 4BS9A 1ENZA 3IP3A 3LT2A 1MXFA 4ALLA 2R2GA 5JAQA 4RO0A 3SJ7A 4NU6A 3GY0A 4M49A 4MPDA 3AOGA 1LQTA 3IUPA 2QIOA 3INTA 4WOKA 1XQ1A 4IDCA 4NH4A 3GG2A 4RPGA 4WASA 3UICA 1GR0A 2EW8A 3S2FA 1KVTA 2A94A 4KWIA 4KWHA 4I8XA 3M1AA 1V3VA 3WBBA 1IHYA 1NXQA 4KTTE 5AOVA 3QVTA 4FGWA 4WCFB 4J4BA 4E21A 3DEYX 1GYRA 2DT5A 1F14A 4BO5A 1PJTA 3I5MA 3RJ9A 5FWNA 3JQDA 2VWHA 3EMKA 4WLNA 4IS3A 4YACA 3GN2A 1CYDA 2BFMA 4QFDA 5LC1A 4XYLA 3QVWA 4K1LA 1CIVA 2WDZA 5IN4A 1HETA 4I5EA 1MC5A 3QQPA 4QSMA 1E7QA 3C85A 3E5RA 4M54A 4Y6PA 1UDCA 3RWBA 2GZ2A 5ER9A 3H9JA 3G17A 3KSZO 4L4RA 3JD3A 1K6XA 4WGGA 1ZSVA 4WNCA 3C8MA 5COAA 1I3NA 4N7RA 5JAZA 3JQ9C 5ILGA 1WW8A 2C5EA 3F4LA 4TKMA 5G0VA 1K0UA 3TJRA 2J8ZA 2O7SA 5U4QA 1QRRA 1YBVA 3ZI0A 4DC0A 4ALNA 3BZUA 4CMBA 4R1UA 2BKAA 4CLEA 4D43A 1U4OA 4GLLA 4BGEA 3PGXA 2ZTUA 3GLQA 1AGNA 1SOWA 4HADA 1A7KA 4TSKA 5TC4A 4FIZA 1G0NA 5JLAA 1QV6A 4AJ1A 2HJSA 4PLHA 2AA3A 2Y1CA 4IDDA 3TSCA 3PWZA 2GASA 2D5AA 2WYWA 3HFGA 1DIBA 3N7UA 3OA2A 3OEWA 1ADBA 1XQ6A 4EUHA 1HE5A 2H6EA 2JFGA 1I5RA 3K31A 4OQYA 3RU7A 5JMWA 2PNFA 4NBTA 3ZU3A 5EMHA 4RF3A 1T2AA 4ZQFA 1GPJA 1NTOA 1QV7A 2EXXA 5HS6A 2FSVA 1VE9A 2VHWA 3ZWWA 3FWNA 1XSEA 2X0NA 3ZHYA 3RUCA 5CEFA 1KEVA 3PRJA 5A9RA 3MJTA 3MJSA 1SEPA 3EYWA 5L45A 3RROA 4RORA 4BKQA 3P7MA 2UYYA 5CDUA 2YDXA 2Y0EA 3VAZA 5I7VA 4MKZA 4PN3A 3W6ZA 3LF1A 1H6BA 5GY7A 1ZEJA 5G0UA 3WJ7A 4FFMA 4OHUA 2YDYA 2Q1TA 4MP8A 1PQUA 4DIBA 5B1YA 3ROMA 3S2GA 3QIVA 4IMPA 3IDSA 4CM5A 3PHLA 2W2LA 3OJEA 4J3FA 2HQ1A 3MOIA 1KERA 2PD4A 3WGHA 4ND3A 3AFNA 1G1AA 2QYTA 3LSYA 4WLOA 4DPMA 3OEYA 4AICA 1PL7A 3JQCA 3VTZA 1YVEI 3BTSA 5L40A 1BDMA 3D4PA 1GV1A 2FR1A 3DMTC 1PGJA 5K6AA 1XA0A 3DBLA 4Q3EA 1GQYA 1CRWG 4A0SA 3U62A 3QWIA 3U0BA 1JA9A 4S1VA 4MVJI 4HBGA 1W8DA 4JBIA 4MKXA 3MWEB 1LSJA 1VL8A 3HE3A 2D0IA 3INGA 4ALIA 1NFFA 1BXGA 4FSHA 3Q1LA 2IYOA 5DDIP 5ILOA 4EBFA 2ZTLA 4MVJP 1ZKMA 3IUSA 2V6FA 1D4FA 2GPTA 3F5QA 3D5TA 2ZTVA 3LC2O 4LW8A 4O6VA 2OOSA 1V9LA 5TF4A 4XA8A 3L6EA 1CDOA 3PJDA 3R6DA 4J90A 5ER6A 4E5KA 1GCOA 3JQAB 1MG5A 4YRBA 1JKFA 1U5CA 4CMHA 1K89A 3WLFA 4BIIA 2A92A 1YQXA 1PQPA 3A06A 2C29D 1E3EA 1U8XX 3MWDB 5BSHA 2XAAA 4URFA 4DQVA 3PIDA 3KVOA 2PKQO 3VPGA 2WWRA 3OHSX 2YYYA 3AI1A 1VL0A 5FYDA 3STHA 2UUPA 5TRTA 1M76A 2O3SA 4JP2A 4FGSA 1ONOA 3DZKA 3GZNA 4LVCA 2Q4EA 4CLRB 2PV7A 5CPBA 4EGFA 3E48A 5HTOA 3FSRA 4CM4B 3OECA 4HNGA 4XB2A 1R4NA 4QQRA 3JQ8A 2WSBA 3GUCA 3DBHA 3I6QA 3OSUA 4YR9A 1N8KA 1Y8RA 1EVJA 4U5QA 4GX0A 4LN1A 4YYZA 4A27A 1XU7A 4A03A 4E31A 2JFHA 1IL0A 1LLUA 1MXHA 1W0CA 3RUFA 5L7YA 3JQAD 3GT0A 2OBYA 4AJOA 1E92A 1X14A 4I5GA 2PZMA 1GUFA 4MDHA 2VRCD 4ZJUA 3EZYA 4LRSB 5FEUA 3BHMA 4FFOA 1A27A 1PZGA 1R4MA 4Z3KA 1BW9B 1XG5A 4K28A 3JQGB 2D59A 1ADFA 3ABIA 3PHGA 1C1XA 1ZO8A 1H5QA 2VWGA 4XYEA 1U4SA 4AJIA 4A73A 1ONPA 4H7PA 2BMAA 2CD9A 4OOFA 3ZWOA 1V3UA 1E6EA 3SLKA 3ANNA 1YKFA 2VNAA 4J43A 4ZVVA 1EBFA 3DBRA 2DVMA 4AJ2A 1Z7BA 2DBZA 3FBTA 3OFSA 3WQSB 2EJVA 5HBRA 2IZ1A 2QZ9A 3PJFA 3VVCA 3GGOA 4DQUA 3RC9A 5JO9A 4YT5A 4BB6A 1QYVA 3OA0A 4BO1A 5JAIA 1NFRA 4I08A 3WIEA 4EJ6A 2X0IA 4R9SA 4JK3A 1RYEA 4ALKA 1E7MA 1KVUA 1FMCA 1NVGA 3HUDA 5EN4A 1A9ZA 1V35A 1X7GA 2C82A 4NJMB 2X6TA 4IXTA 2BGLA 2VYNA 3GOHA 1TT5A 1U3VA 4XKJA 3WNVA 1PZEA 4CV2A 1Y8QB 4JP3A 2IZZA 3VDQA 3HDYA 2Q2QA 3K9QO 4RDIA 2O3QA 2QHXA 5HS4A 2AEMA 1QYCA 4PLZA 4QX6A 5G2OA 1BVRA 3VH4A 4MKRA 2NU8A 2I6TA 1NM5A 2OP0A 4OIMA 3V8BA 2CZCA 4N54A 2IDZA 4UVEA 4RPLA 1VRWA 3M2TA 3OP4A 4D42A 4B3HA 1ISJA 4E0BA 5JCJA 4I5FA 4UULA 2NSDA 4ND1A 2NLOA 4DMLA 1HZZA 4IJWA 3GAFA 2HMWA 3JTMA 4XIJA 4J1QA 1GUYA 3E9NA 4CLHA 1E0DA 1BMDA 1E5LA 4UUNA 1LI4A 2ZYGA 2YQ4A 1P0FA 5TGDA 1YQDA 3CZRA 5KVQA 1DFHA 3TZQA 1R6DA 3I9KA 4XDYA 1ISMA 3HNPA 4B7XA 3BTUA 4HKTA 4N18A 3GPIA 4C4OA 3C3XA 4FCCA 1EUZA 1HYGA 3TQHA 3NDJA 1KOLA 3W6UA 5DBGA 1UP7A 4CQLA 4P4GA 1E3IA 2I76A 4IJVA 3DHNA 2ZJ1A 2HRBA 2HRZA 4L4XA 3GFGA 4O0LA 1XEAA 1T24A 3ZWXA 1HDRA 3CUKA 3O8QA 2IEDA 3OJ0A 2GN8A 1ID1A 4U6SA 2X7HA 1EUCA 3CTMA 2HMVA 3I4FA 3HHPA 4A26A 1H9BA 3V1YA 4MIEA 2AQ8A 3ASUA 1Q1NA 1EE2A 1VI2A 1WXDA 5L95A 3ZHBA 5ENVA 2GR9A 1HE4A 4CM3A 4M87A 3NTQA 2EJWA 4CMCA 1KVQA 4G5HA 1NR1A 2OUIA 3MTGA 4D44A 1WVGA 3OQ6A 1LNQA 2JJYA 1P1FA 4M8SA 1E5QA 1S7CA 2J3IA 1BRMA 2A35A 4P8RA 4Q9NA 3ZWYA 2VNSA 5A04A 1E3LA 3PHJA 3PYMA 3RC2A 4R3WA 2C59A 5AVOA 3W4JA 3FWZA 2HO5A 3C1TA 1SBYA 2IXBA 1I01A 3ZWNA 4DLBA 1UXGA 3WQQA 1E1LA 1KVRA 2VOEA 1MA0A 3ENNA 4OXYA 1E7WA 4BO4A 4FB5A 3DR3A 1RM4A 1PZHA 2R6JA 3NJ8A 3TZHA 3NGXA 2FOIA 4J7CA 4Y6RA 1GQ2A 3PQFA 1O9BA 4AJEA 1WDLA 3JQFC 3KYCB 4OJNA 3RBXA 3W8FA 3X2FA 4YAKA 4PG5A 2Q1SA 5F1KA 1HLPA 4X54A 1ENPA 4CM6A 3AW9A 3GR6A 2CY0A 5ICSA 1QSGA 1UAGA 1GTMA 2J5KA 3NUGA 5GZ1A 3GC6A 1A4UA 5JY6A 1GYQA 1VJTA 1MUUA 1JW9B 3UXYA 3DAGA 3EVNA 2B35A 2Z1NA 3AUTA 2NQTA 2CUKA 3L4SO 4YQZA 4UUOA 1BWSA 4DBZA 1XIVA 4LCJA 1SCUA 4PRKA 4RQUA 3DMYA 2DC1A 1VKOA 4IDAA 4PLTA 1PL6A 1P77A 1L7DA 2OHXA 3CH6A 5A9SB 2W98A 1E6UA 3D4OA 3GUYA 3KOUA 3SJUA 4D3DA 3GDFA 4FQ8A 3VKUA 4YCAA 1ZH8A 1DRWA 2NTJA 1NPYA 2I3AA 5EINA 4J91A 3VH3A 3Q6IA 4BNXA 2CDCA 2JCVA 2VWQA 3QP9A 3O03A 5TS3A 3ZN2A 4KOAA 5L53A 3LU1A 5JPIA 5KKCA 4J49A 5IN5A 2ILTA 3BTVA 1TI7A 4CLXA 3VKVA 3PDUA 1Q0LA 4LCEA 3I23A 1ZVMA 1ONNA 1F12A 2X5OA 1JTVA 1DO8A 2BRUA 3HZZA 3KV3O 1DPGA 4BNZA 5EERA 4BKUA 5A9TA 2EKPA 5L7WA 2HKIA 4RLHA 5CDYA 3JQ9A 5T8KA 3DFZA 4GWGA 4DLAA 1D7OA 2X22A 3ZU4A 1H9AA 4BKPA 3I52A 3L0DA 4J16A 4KUEA 1IULA 1GD1O 1NQTA 2E6UX 2Q4BA 4M86A 3EDMA 4FPXA 4B4OA 1U3TA 1X1EA 4GH5A 4U6QA 2AE2A 3LLVA 3PEFA 2YJZA 3RSHA 4B8WA 2I65A 5T57A 1AUPA 4J6FA 3A9WA 3VVBA 1HSZA 2B5VA 3LYLA 3OIDA 1Q7GA 4CR8A 3PLNA 4JXKA 2I66A 1JN0A 1K6IA 4JCOA 4Y8VA 4EZBA 5CDGA 4CLOA 5KCZA 1Z74A 5DF1A 3H3JA 3UW3A 1E6WA 4CV0A 3DAPA 1NQ5A 2HMTA 1UZLA 2OP1A 2X9NA 4ZQGA 5EQDA 1GYPA 1MP0A 4Y98A 7MDHA 2FZWA 2NACA 2CVZA 4XEHA 3NX4A 4PVCA 4DRYA 4J2HA 1DC5A 5GZ6A 3VPHA 2V6BA 4B4WA 1XGKA 1T2CA 4D3SA 4A5OA 1EMDA 3KETA 1EK5A 2Q45A 1LSOA 1BVUA 2VCYA 1J49A 2UAGA 3AY7A 2BFAA 3O38A 4CM9A 2J5QA 1HSOA 2P68A 1NP3A 4O63O 3E03A 4KTVE 3BMCB 3MJCA 3RJ5A 4BUCA 3I83A 3OM9A 4GVXA 2J6IA 3C7DB 1M67A 2O2YA 2VYVD 1IPFA 2WYUA 1T2EA 2ZYDA 3NGLA 3DAFA 3ZWCA 1JWAB 4R9RA 3WGZA 4CMAA 8LDHA 1B7GO 4B8ZA 1VL6A 3KYDA 4XGIA 4GSKA 4B4UA 4PZEA 1PJSA 3SVTA 3GA0A 4FC6A 2GDZA 4XQ9A 4PG7A 1DOHA 4GWKA 4ND4A 3U09A 3I3OA 3IL2A 4LK3A 1DXYA 3RUEA 5A4DA 3BMOA 3OIFA 4E2WA 3LT0A 4EJMA 1J6UA 1B8VA 1VJ1A 3DWFA 4JLWA 5CHEA 2D1YA 5I9LA 1P0CA 3WYEA 3V2UA 4YAGA 3WNQA 4CL8A 2OL4A 1LLCA 2GF2A 2IYPA 8ADHA 2GLXA 4PLPA 1O0SA 5A5FA 3PYXA 2Y05A 4IBOA 4J1NA 3BMNB 3H8VA 3GEMA 3QW2A 2A9FA 5F3RA 1UP4A 2NUAA 1DSSG 3H5RA 1MGOA 2ZCVA 3DONA 1YL7A 3JCZA 1PJ2A 4G81A 4PZCA 2LDBA 2XF8A 1DIRA 3AU9A 4I9HA 5L4SA 3H9QA 2W2KA 1PGNA 1X1TA 4YJHB 5H83A 4XJTA 4E12A 1UUFA 1MV8A 5F5NA 5L4LA 4W82A 1FDWA 4YJDA 4CV1A 1DRUA 3PI7A 1GDHA 4YVFA 3QVOA 2AEFA 4D3FA 2WEKA 1FJHA 4DGSA 1M6HA 2BD0A 3VPSA 4XJSA 2H9IA 1KIFA 2WD7A 3KYBA 4RQTA 3COSA 2VZ9A 3DBVO 4TROA 3PJGA 1LX6A 3F1LA 4EEZA 2I5PO 1IUKA 1P74A 3ETEA 2H5LA 3GN1A 4YRDA 3TOXA 3K2BA 3ZCXA 2C2XA 4XR9A 2FSSA 1HWYA 3W4KA 1L7EA 4IGFA 5IDXA 1GZ3A 1GEGA 4PLYA 5A06A 3GQVA 1FDTA 1PQWA 2AE1A 3ENKA 1ZJYA 2NV6A 3WGQA 3WWZA 3PLRA 1AXGA 3P5SA 3ZH2A 1Y9EA 2E37A 3RASA 2CMDA 3LZ6A 1PGPA 1RPNA 3HDJA 3N74A 1FXSA 1YH3A 4K6CA 3RUAA 2TMDA 4CPDA 1KC3A 3FN4A 4J4TA 4JNKA 4O59O 1ISIA 1I2BA 1DJQA 3D1LA 3R3SA 4K26A 5JBIA 3RAJA 2X9VA 1QG6A 2P5YA 5EESA 4UVHA 4WLEA 1VSVA 1EVIA 3P2OA 1ULUA 4QFCA 4YJFB 1GPDG 3RC1A 3U49A 1HRDA 4IY1A 4DYVA 4BQPA 5K9ZA 1B0AA 2GGSA 4TWRA 4IQGA 3WOHA 1PS8A 1BXGB 3TZKA 4OKNA 5GZ3A 1EEHA 2GNAA 5T8KC 4G2NA 5B37A 3ZU5A 4YT2A 4CM1A 2PK3A 5TNXA 3QA9A 1HKUA 4BO6A 4BNWA 1LU9A 5DT9A 1PJ4A 2YFQA 3BAZA 5ES3A 1RWBA 1D8AA 2VT2A 2W2LD 1H6DA 3WXBA 2E48A 2FZEA 1NFQA 4AJLA 4B3IA 4HFRA 3O4RA 5MGBA 1K2WA 4R4JA 3VPXA 4BMNA 2P5UA 3MEQA 5JYEA 1NR7A 4BO7A 1P1JA 4EDFA 3CSDA 4XDZA 3KHUA 3ZW8A 2AQHA 3KSUA 2Y1OA 4ZU3A 3V2HA 3GZNB 3WIDA 2BI8A 1A5ZA 1ULSA 3G49A 4CUJA 2O2SA 3ZHZA 3ZGYA 1OI7A 3AFMA 9LDTA 1GZ6A 1R4NB 4XWYA 3JQ8B 3CIFA 4FBGA 3DBHB 1WAMA 5DULA 3Q9UA 1XYGA 4HNHA 4R1TA 3INRA 1UDBA 1ZEMA 3PWSA 3L4BC 4JIGA 4NG5A 3ZNNA 2UDPA 4IMRA 1I2ZA 2WM3A 3NDRA 1LRLA 5L7TA 4R68A 2DUUA 4EJ0A 2OO5A 1LLQA 3NJ4A 4QXMA 1ZNQO 4XD2A 5G4KB 5H82A 1R4MB 1SO8A 4FFNA 5LCXA 3RIHA 3E6AA 4YWJA 1QP8A 3LF2A 3PJEA 4R69A 1C1XB 3FRJA 5BNIA 2O48X 4YAIA 4RCVA 4TMFA 1CWUA 3JYPA 4PCVA 5JFOA 1U8FO 4MVJH 3AI3A 1HYEA 4YAJA 3GMDA 2HUNA 1DHTA 1Z6ZA 3FTNA 2RH8A 3U3XA 3G0OA 2EP5A 2PD6A 4ROSA 2I67A 5L4NA 3UKOA 3AM5A 3UOGA 2RHRA 1I0ZA 2F1KA 3FHLA 1W73A 3AOEA 4F6CA 3W4IA 2ET6A 4J9UE 3ZZNA 4RL6A 1PIWA 2WJPA 1AE1A 2RCYA 1Q7BA 5DP2A 4CMIA 1ZXBA 1TT7A 4IJKA 2FRDA 5DOZA 2DTXA 6LDHA 2EEZA 4DPLA 1XCBA 3AI2A 2P4QA 2P9GA 5TJHA 4BNNA 4OYRA 2CDAA 2J3KA 3F9IA 4MOWA 5CG1A 2D5CA 1B15A 3KXDA 4UEJA 1ARZA 1Z82A 4XYGA 1Q0HA 2I99A 1PJCA 2D3TA 2X86A 3KUXA 4XQCA 1ORRA 3D5QA 3IMFA 3JQFA 2X8LA 4PVDA 1JKJA 1DB3A 3I9NA 4CMJA 2EIHA 4UAGA 3MTJA 4I5DA 4MIYA 3RD5A 3I6IA 3OICA 3W8EA 4J7XA 1HDZA 3K2EA 4L75A 4AVYA 1OOEA 4IM7A 3DFUA 3IOYA 2X0RA 4H15A 4OAQA 3AUSA 3ICPA 4MJLA 1FDUA 4OOEA 1IPEA 4MO2A 4OH1A 2HJRA 1I33A 4A7PA 1YGYA 3DO5A 3UN1A 3DQPA 4D0SA 4D45A 4HFJA 2X58A 4ALMA 4WNIA 5JAMA 1NVMB 5KOIA 3UHAA 3E9QA 3DZHA 4GSLA 1YB1A 2PTGA 2CFCA 1DJNA 2PWZA 3IC5A 1B8PA 3ULKA 3UVEA 3D64A 4Z0HO 4D79A 3QSGA 4A2CA 5CDSA 1PU2A 2G76A 4NFHA 3HB4X 1LC0A 1PTJA 1HDCA 5F1OA 1J5PA 1E3WA 5TSDA 1TA4A 5C7LO 1B16A 1AHIA 2NTNA 3RCBA 1U2GA 3CEAA 4Z3DA 2BLLA 3H2ZA 3N58A 3RUIA 4IS2A 3VDRA 1L1FA 2X9GA 3RUHA 4D46A 2JHFA 1Q2XA 3UFXA 3ZHXA 2DUWA 2EGGA 5JCJD 2NM0A 2PZKA 3JQEA 3O8QB 4E3ZA 3WDSA 3ZW9A 1UJMA 4EUFA 1IZ0A 1LBEA 3FNGA 4ND5A 4ND2A 3ETGA 4Q3AA 2WE8A 5I9MA 1JLLA 2F00A 1XDWA 2RAFA 2OZPA 2RIRA 5JCXA 1LXCA 3C24A 3ON5A 4C7JA 1EE9A 4OSOA 4OO3A 5C37A 2NVBA 2QRKA 3B1KA 1GQQA 3PXXA 2YV3A 2DFVA 1UP6A 1N5DA 3B6ZA 4B3JA 3GG9A 3RBZA 4YA6A 3ZV5A 4O5OA 3QWBA 1Z73A 4QO8A 1Z75A 5JE8A 4NK5A 3E5MA 3ICCA 2PFGA 5DBFA 4J2OA 1G6KA 1Y7TA 2DTEA 2AXQA 2PKRA 1I8TA 1BXKA 2PGJA 1BHSA 1N92A 1U7TA 1WMAA 1YE3A 1LTHR 1HLDA 2Y1EA 3MJ4A 4L74A 4WKGA 4TKLA 4PGFA 4CMGA 5JO0A 1P1HA 2AG8A 2CF6A 3CE6A 2BELA 2CVOA 2YFHA 1NYTA 3CXRA 4R01A 3ADOA 5DCYA 4ZICA 5THQA 2Q50A 4XR4A 4LMPA 3RKUA 3DZIA 2NVUB 3M6IA 5AXAA 3ROQA 2WTBA 3EZLA 1R37A 4ONEA 1NPTO 2VRCA 2V7PA 4BNFA 2W8ZA 4GBJA 4DMMA 1DBVO 2X4GA 2Y0DA 2VOJA 4NI5A 4DC1A 3UGKA 2X0JA 5L51A 3WTCA 1D3AA 4NDNE 3OETA 1E1MA 3WX0A 3NKLA 3WS7A 3SBOA 1YXMA 4CLRA 1AXEA 2EKLA 4DA9A 2EP7A 4QT0A 4P22A 2GN4A 2DLDA 2HSDA 5T6BA 1U9JA 4R1SA 4F45A 4CQMA 1Q0QA 1NBOA 1Z7EA 5G0SA 3IP1A 2VHVA 1F8GA 3V2GA 3GVCA 4R41A 2CDBA 3TL2A 4E5NA 2ZB8A 3JYNA 3QWHA 2FWMX 4ILKA 1TLTA 1QMGA 4GX2A 1I30A 1JQBA 1MLDA 1HL3A 3T7CA 1Y9AA 1LUAA 2DQ4A 4E33A 3ZWMA 3GK3A 1YB5A 1UDAA 1C14A 1AHHA 3JQGA 4P38A 1C1DB 3H9UA 3JD4A 1HE2A 1HZJA 1SAYA 2NU7A 1X13A 4W4TA 4DTIA 4OXKA 4WCFC 1YQGA 3B1FA 2B5WA 3AOEC 4XYMA 3WB9A 3DTTA 4TVBA 2HK9A 5TT0A 1E77A 1GV0A 4IGEA 3FF4A 1KEUA 4AL4A 3ZWVA 2VT3A 2FP4A 4IDBA 1YDWA 1CERA 1BSVA 2FR8A 3PDJA 2GD1O 3AY6A 4JBHA 5COBA 5BR7A 5KNLA 2VTEA 4EEXA 1SNYA 2QRLA 2RBEA 3EK2A 4F46A 4XIYA 2JHGA 2IEBA 1EK6A 1GFSA 4J1SA 2V65A 5LDHA 4NBRA 5TQVA 1H94A 2GSDA 3PZRA 4AJNA 1H0KA 1LSUA 1H6CA 4EITA 1DHRA 3BYZA 4AFNA 4NJMA 1LEHA 2O7QA 4YB8A 1R0KA 4NNJA 4ESOA 2VWPA 3C1AA 1HTBA 4NBWA 5HRUA 1N2SA 3JD2A 4YJGB 5T67A 5ITWA 3OH8A 3JYLA 4LMRA 4NBVA 3EUWA 3D3EA 4GVLA 4RJTA 1LSSA 3FNFA 1O6ZA 4CLDA 2GERA 3H2SA 4Z9XA 1PR9A 1X0VA 2B4RO 3KO8A 5A3VA 1S6YA 3RI3A 4FFRA 3MOGA 1V0JA 5L3ZA 1G0OA 5KJEA 5JDCC 3QRWA 4L9RA 3GF4A 3AM3A 3RFXA 4JN6B 3Q2IA 3LLSA 2J3JA 1A4IA 4GMGA 4OKIA 1AN9A 1NNUA 1UZNA 1ZMTA 1N7GA 4BNGA 2EV9A 3GFBA 4IZHA 2W90A 3PIIA 1I3KA 4LRTB 3I9MA 2NWQA 4HXYA 5F1PA 1NWHA 1RM5A 1EQUA 4PLCA 3BXXA 2HK8A 2QRJA 4ZD6A 1T4DA 1T26A 3TPCA 2Y1DA 1SC6A 1KEPA 1BXZA 2EWMA 3BMOB 2D4AA 1I10A 2Y68A 3H9GA 2DM6A 5TIIA 4FR5A 5CEJA 1R66A 1FDVA 1KETA 3V1TC 2YV2A 1YS4A 4CM9D 2CSUA 2JD2A 4BKOA 4DIFA 4ITUA 4XZ3A 5EJ2A 4E5YA 2BFOA 3BMQB 1VJ0A 2H1SA 3OJLA 2Y67A 2VZ8A 4ZRMA 1UAYA 1JAYA 4XQGA 4RVFA 3E9MA 2ZQZA 4PG8A 1JKIA 5IFLA 3TF5A 3TN7A 5B4TA 3G3EA 1FK8A 2BF7A 4KUHA 4E2XA 4E6PA 3F47A 3R0IA 2ZQYA 1UXIA 4DQXA 2W2KB 2LDXA 4LVUA 3OJFA 2WYVA 3WFJA 1QORA 4ZQHA 5JC8A 4FS3A 4BQRA 1JVSA 3PP8A 5DZSA 1RKXA 3ZV6A 1C0LA 1A71A 1EDOA 2ZB7A 4FC7A 1I24A 2DPGA 4MINA 2YHIA 2VUUA 4Q3BA 4AJKA 5JC1A 1WP4A 3BHIA 4NMHA 4Z9FA 2NTVA 1YO6A 2XPCA 1B14A 1VLLA 1TVEA 1DRVA 2VHXA 1VM6A 2WD7B 1MFZA 2Z95A 3FBGA 4GX1A 3WG9A 5JDIC 1J0XO 2GUGA 3L4BA 1YOVB 1U5AA 3H6KA 1GCUA 1X0XA 5IDWA 3DXFA 1P31A 1ENOA 1LLDA 3AUAA 3TOZA 5IDQA 5IJZA 2JFFA 4UUMA 4N5LA 3SEFA 1MX3A 4PLVA 1H2HA 3NRCA 3E82A 4R3NA 4GQAA 2IRWA 2Y99A 4BO3A 2ZATA 2P91A 4BB5A 3QV1A 4YQYA 1O95A 1EQ2A 1XU9A 4II2A 3SC4A 3OIGA 2UUOA 3WICA 1PL8A 4AJPA 2XXJA 4H16A 1O8CA 1Y81A 4D0RA 5IF3A 2HCTA 3GGPA 2CVQA 3UF0A 5DP1A 4FD3A 4WCDA 2PH5A 3QVXA 2YW9A 2V6MA 2GZ1A 4J0FA 3K30A 1T25A 3S1LA 4LISA 4YTEA 1N9GA 2PGLA 3DZFA 3ONDA 3O9ZA 4RF2A 3WMXA 1QLHA 3IIEA 1M75A 3KZVA 4L8VA 4AJ4A 1E1NA 1EDZA 2ZTMA 4Z6KA 1PJBA 2O23A 3F3SA 3NV9A 4I9NA 3TZ6A 4NQZA 3SC6A 1NQOA 3MZ0A 5I7SA 3RUDA 4MVJF 2GRAA 4ZQEA 3JQ7A 3WSWA 1CQJA 4I1IA 3ITDA 3KTDA 3EHEA 4MVJE 2OORA 4WEQA 3MCVA 4FFLA 1KEWA 2C7VA 1UH5A 4HX5A 1A9YA 3KM0A 4RDHA 3GEDA 3QY9A 5FFFA 3ONFA 1H2BA 1KVSA 7ADHA 4MP3A 5EQFA 1T1SA 3DOOA 1UXHA 4ZA2A 4BNUA 5ITVA 3VC7A 1WDKA 1U7HA 3HG7A 4E32A 1HDGO 3HADA 3QWFA 3UAGA 5JNLA 3VZQA 3GAZA 4BO2A 4HP8A 3GEGA 4N5NA 2Q99A 2QW8A 2R00A 4BNIA 4KP7A 1EFKA 3JV7A 3NYWA 3EAGA 4OMUA 1QYXA 1XKQA 3P19A 4NHEA 3RQSA 5B4VA 3H5AA 4NJOA 3AM4A 2X1HA 1OC4A 2AEJA 3EGOA 5DOVA 4RZIA 4PLGA 4BGIA 4C7KA 1DC6A 1K3TA 2JD1A 2ZJ0A 3E8XA 4BMVA 2D8AA 3OMLA 2VTDA 4E2ZA 3LVFO 3V5NA 2FHSA 4WJZA 5I9NA 3TWOA 1MB4A 2G1UA 3F6YA 4CV3A 5A5EA 5J23A 4WLUA 1VC2A 2QYSA 2ZYAA 4QUKA 1D1TA 3SXPA 3AU8A 3RFTA 3BTOA 2JKVA 3GNQA 1VPDA 5KJCA 3L9WA 4CMKA 2X5JO 1TEHA 4TVOA 4U8GA 4W99A 4EYEA 2EW2A 1C0PA 1LRJA 3JQBA 1DLIA 3TFQA 2TMGA 4B4VA 5JYDA 1UXKA 1RM3A 4HV4A 2O4CA 4XGKA 4L0QA 2V6GA 3PHHA 3PQDA 4TRRA 5AYVA 1VKNA 3LT1A 5KIAA 3D7LA 2C07A 1R16A 1LDYA 1OAAA 5C5IA 3NAQA 1WMBA 1DIHA 1CQIA 4FJ2A 3LDHA 1HXHA 3BMCA 3KEOA 1CF2O 1Y5MA 1DFGA 1ZFNA 2EGHA 3EVTA 5G0WA 1NQAO 3H7AA 1IOLA 3TL3A 3DBLB 2OFPA 3F5SA 2POQX 4GL4A 2B4TO 4IDGA 3GGGA 4F3YA 3DL2A 1PS9A 2D2IA 1I3LA 1X7HA 3Q9NA 2FPPA 4E13A 5FI5A 1HDOA 2XOXA 3NTOA 2AHRA 4CMIB 5MDHA 3WFIA 1LQUA 3HB5X 3C7CB 4HWKA 4PG6A 4FDAA 1BTOA 1MG0A 4CM8A 3JD0A 1ML3A 4ZHSA 5IZ4A 1QYWA 4MVJA 1ZK4A 4GKVA 1LDBA 3D4NA 5CG2A 1F8FA 1U1IA 4DL9A 2EERA 3GHYA 2E82A 3K92A 2DBQA 2PKQP 2Y1GA 1LRKA 5G4LA
chains in the Genus database with same CATH superfamily
2FJPA 2AT1A 1TTPB 2AW5A 4BDSA 1JKJB 3BMNA 4D6XA 3W5HA 5TQJA 3QU2A 1H1TA 4YGXB 1D6NA 2YV4A 2E4AA 2OYCA 3NM4A 2K4MA 3I72A 1XRQA 3KQKA 1FRZA 5U1PA 3R23A 3BH7A 3IVCA 1G7CA 3L6OO 5H68A 5I8ZA 3RRMA 2H2AA 3FWKA 2XYGA 2Z8YA 3KS9A 1Q0ZA 2JGRA 2IYNA 3AX6A 4F71A 2M6LA 3QMPA 4YJHA 4HAUA 5CVCA 1DDOA 2CCKA 2PQ2A 2H07A 3HU5A 3T1QA 4W1QA 3FDJA 4BFXA 1VI5A 4BZWA 5J40A 3EUFA 2DGDA 1HDYA 3R0VA 2BC9A 4EMSA 4LZZA 3OE5A 4W7HA 3THYA 3NMUF 5BSUA 3AH8A 2B61A 4YRFA 1W4CA 1XRJA 1A04A 1OV4A 4R16A 1P91A 2NP6A 1L4HA 1VPTA 1I9GA 2C2YA 1E0JA 4IJUA 2LZ0A 4ZPXA 2YJNA 3DZGA 5E6SA 5BWCA 1HT2E 3FR8A 3WYCA 4FLFA 1AUVA 3TUIC 2DE0X 1CEEA 1PEKE 2IUSA 3PPXA 4NMXB 2YXDA 2HN9A 3KQNA 2R7AA 5H80A 5DBHX 1NMSA 3ELDA 4DQ0A 3MUNA 2Z4RA 3PICA 1LDEA 1US8A 4LSMA 3PS9A 4EUEA 1XDZA 1KHTA 2A1IA 1F17A 1W9HA 2GZHA 4F3NA 5C7IO 3DDCA 3VPFA 1BKDR 3T5MA 1LFAA 3VSEA 3OBBA 2GPWA 3A9UA 1UK7A 1T1IA 2RJ3A 2WUFA 1G5PA 1UC8A 4WDQA 5SYMA 4IOMA 3WRVA 5IPFA 4YP1A 1BGVA 1DKUA 2AHOA 3E2PA 4LK2A 4PIMA 3G6WA 1D8TA 3HFSA 1DAMA 2XI4A 3I64A 1P7WA 1PLKA 1E98A 2EJCA 4XDGA 1D4AA 2NZUG 3H5IA 1AURA 1NI4B 2ISSD 4AWXA 3K5WA 1GGEA 1MPXA 5AKIA 2EBHX 3SN6A 3W5CA 1QF6A 3QG5A 1RW4A 1M8FA 2GBLA 5F23A 3E0QA 3C14C 4GR9A 4IGAA 5ALFA 5K6RA 1HK7A 5ICFA 4OHCA 4C4SA 4MQMA 4WZAB 3AVXA 2GFQA 2XB4A 2O3UA 1S9DA 1WA5A 2FPIA 2O0MA 1X19A 2VCEA 4KSBA 4UHKA 4Y6SA 1SXGA 4CT5A 1PSZA 2BFWA 1O97D 3ANLA 3LP8A 1X3SA 1XKLA 4JUBA 3ZW7A 2ZI3A 2C94A 5CP8A 3TQSA 4YJFA 4ENQA 3EH2A 3PUIA 1FXWF 2QUJA 4G5YA 3ROKA 3EB9A 1L8LA 1QR6A 3EXG2 1T29A 2JEOA 2XV1A 3DH0A 3RU9A 1TAUA 3IAAA 4I7EA 2FW8A 3PT5A 4A10A 1SUAA 5AVWA 1M74A 2BI4A 2VIIA 1CUZA 2CVPA 1HBJA 1ZOIA 4YJ3A 5D86A 3EAFA 1QPZA 1LJ8A 5CLGA 3ANTA 5LZ7A 3YASA 4BV8A 5J4KA 5K99A 4FX2A 2JEYA 2WTMA 5LUAA 2OK7A 3P0JA 1F7VA 2YVKA 4XRRA 1IY8A 4DNXA 3NP7A 4LRXA 4RJLA 1JPJA 1FU4A 3ECAA 4NBKA 1XA3A 3LC1O 2C7GA 3R20A 1E6MA 2C31A 1P3Y1 3Q7RA 3DE1X 3ZV4A 4EG0A 3AFIA 4W9NC 4P3XA 5KJ6A 2PQMA 1CRQA 4MVYA 3EISA 4WXMA 4J0EA 3V4PB 3VHRA 1N1GA 4ZGGA 5BURA 4DWVA 3A6JA 2IS1A 3VOTA 2F1OA 2D1QA 2JI8A 2Q9BA 2RMKA 5DNEA 5JD4A 5F21A 3A6KA 1EVLA 1FTGA 2ID4A 3GQBB 1RSZA 4B5LA 1SH7A 3UYKA 4KQEA 5EXSA 2MR6A 5U4XA 2LWIA 3BGIA 1GSIA 2AQKA 3K9NA 3TAUA 5C8ZA 4TTQA 4BNKA 1YRLA 4RPJA 1HT3A 1YVPA 4RSRA 4RY2A 3HBFA 1IZ9A 3SNHA 5KKAA 3KSMA 4FT2A 3KQUA 3KKOA 1M1UA 3Q0TA 4NBNA 3V2IA 4ZZ2A 1NVTA 2R1TA 1JALA 1A88A 4ALJA 4DV0B 1DOAA 4JEMA 3L7IA 5H81A 4LQDA 4RELA 1SVSA 3QTBA 4TV9A 3A6PC 3JQBC 1T2FA 4QDTA 3DL4A 1V4BA 2I0FA 3GFQA 4K0RA 5CLQA 4AJHA 3LQYA 1A3CA 4RIEA 2ZRIA 3GIDA 2RB4A 1D07A 5DV9A 1NX6A 3G7NA 3G79A 3LFHA 3FCSB 3TTTA 3UANA 2QYHA 3HA2A 2JBHA 1EP1B 5DNAA 1BWPA 4F06A 3QVGA 1GZ5A 1XK6A 4EKYA 2HB6A 1R12A 4I6GA 1OFHA 3F4BA 2IVFA 2OWDA 4IZIA 4N8SA 1L1QA 1J8QA 1R0RE 1KTVA 4XYBA 3ZBQA 3NT2A 4DT1B 3DMHA 4QHSA 3TB4A 3U7EB 4B6JA 4ZYTA 1JFTA 3WRXA 3IR5A 3L6CA 3Q7EA 3WL6A 2QAJA 3K5PA 2EF1A 3WJ2A 5IUNC 1WMFA 4G65A 3KLBA 2X1LA 5EIOA 1XWFA 3BQ9A 3TE6A 4LI0A 3LQFA 4GUDA 3P96A 4A9AA 4AB1A 2QTHA 3HZHA 5EMJA 4X6YA 4DUPA 3FSGA 3EW7A 1N7JA 1MOPA 4FE3A 1XYYA 3S3TA 5DHUA 4ZQBA 4AN4A 4QJBA 1D5CA 5ECYA 5H7XA 2IU3A 2W58A 2Z5FA 1NXOA 1LDMA 2QT1A 2JLAA 2W71A 1FX0A 4S1WA 3T1VA 1GILA 3BRSA 3QBDA 5ETJA 1GZDA 1GKLA 1ZGJA 1XJCA 1II8A 2FEKA 2WFLA 1NRIA 2VHUA 1UFOA 1PW7A 4ZCPA 3H0KA 4DR1B 4CQNA 4PYIA 5TARA 4O1MA 4ARZA 3CJTA 4XASA 2ZCUA 4KXMA 3GMSA 4GRDA 2AXPA 5C8YB 3B52X 3PC8A 2PR2A 2QPOA 1SMKA 1B4DA 3L77A 3WGYA 2V7QA 4GGOA 1M2WA 3AI7A 4U7FA 5ED0A 4AO7A 3R3UA 5KVVA 3FWPA 1N5OX 4Q3DA 2HPAA 5IAGA 4AMZA 4L76A 2BM9A 3EGDA 3I9JA 4FJ1A 4G2TA 1K66A 3T6KA 1QQ7A 2J3QA 4KQJA 3SEAA 3LGXA 3WMEA 1RFLA 1O87A 4GG1A 3T9FA 4QEDA 3Q40A 5JDIA 4UVIA 3ZGVA 4XGNA 4LY3A 5DRYA 1F0KA 2H7XA 4WTOA 4CKBA 9LDBA 2ENWA 5LM3A 2YY5A 3UYLA 4PX2A 3A4VA 1IEQA 4HY3A 1UJ5A 1KARA 1U2TA 2HT1A 1PZMA 1XAJA 1QO0A 1F9AA 1ODIA 2OGWA 2Z2ZA 3ONEA 4W8HA 5TPZD 3RG8A 1WXXA 3SCZA 3VH1A 1BROA 2PAAA 4K1XA 4PSAA 4V1CB 5KNCA 4HMPA 1NGSA 3T4PA 5I7RA 5BSEA 1RWOA 3N1UA 3RSSA 4CMEA 2ZU6A 1XE3A 4OYYA 4ND8B 4EHJA 4YMSA 3F6SA 4X3OA 4DG9A 4ENSA 4KQXA 2YWRA 3W5DA 4GPAA 5F2NA 1XTUA 1XNHA 2VPIA 3AKYA 1ZM7A 3PUZA 4F93B 5IXSA 1FE8A 4ARUA 2ZYHA 1IE3A 1QFSA 2QK4A 3ZS8A 2A0FA 4PIVA 3T3MB 2EBFX 3K70B 2MYNA 2PYDA 1MABA 1JU9A 3SYKA 3WFZA 2QZPA 3KB6A 4TTJA 5IM4A 4FINA 3NFRA 3N9IA 4B0PA 1Z47A 1WUJS 5DHPA 1XP8A 2FSVC 5NLLA 5ALSA 3NKVA 3HWX1 4H7KA 1XFDA 3C3JA 3KBBA 4XARA 4BFLA 2GFHA 3EFOA 1I36A 1S5PA 2PA3A 5FTJA 1GA6A 1ZOLA 2VF4X 2B36A 2QPTA 4MS3B 3VNVA 1NATA 3DC2A 3DMRA 2ARKA 1W4ZA 4G56A 3I1JA 4YCBA 5BP7A 4MW9A 1S3IA 2MINA 5F64A 1Y1TA 3WMRA 5AVJA 4HGYA 5KJ1A 1Y5RA 3C48A 1SBNE 1J07A 1G2QA 2C20A 5FOVA 1NLFA 3C98A 4MTLA 1HTTA 2XITA 1OYVA 4R0VA 3G13A 1AKTA 5IT4A 4R8SA 2GUWA 4UXIA 3WK4A 1VIMA 3DD5A 2MSLA 1SZPA 3GARA 1N9ZA 4TZTA 3UO8B 4WNYA 3GPBA 2YIDA 1ZJZA 1SD2A 2EX1A 1U9ZA 2HZBA 4TZKA 4AY5A 4DIOA 1P3JA 1R0SA 1RXYA 4R2XA 3CF2A 4MUMA 2EZTA 3TRIA 4G67A 3HR4A 4QQ8A 8AT1A 4H4CA 1YCGA 3DV9A 3S2IA 4XQEA 1Q0SA 4UNQA 5LXTF 3EWAA 1UMKA 4WXHA 1JLKA 5U9CA 4HMOA 2CLCX 3HY3A 3IJRA 4JLMA 1QRUA 2XXAB 1MEEA 5DCWA 5CHYA 5K6AC 4CIBA 4G8DA 1ADGA 1CZNA 4YV1A 1ORTA 3WLPA 5FL7D 4WFKA 4LE0A 3TEFA 1I80A 1PGOA 1ZMOA 2AG5A 2ZPTX 2VEDA 3AY0A 4F86A 1V7QA 3BL8A 3ADDA 2QT9A 1V7CA 5KOJB 3I04M 2AJTA 3C87A 1NF3A 1SD5A 2IE0A 1ZLYA 3OQ1A 4IXDA 1VPEA 3RYFB 5BNWA 2QL9A 2IPAB 1Z15A 2CFTA 1OBCA 2YHIB 3F7OA 4KPGA 4A8PA 1TU3A 2DAPA 2PLAA 1F2VA 5GGXA 2XWSA 5KX5F 3AVWA 1Z0UA 2FUG1 3O91A 4EY3A 1BMFD 1IVNA 1YJBA 2G28A 1Y8QA 3CX7A 3K8YA 3KQLA 1SVNA 3K6JA 3OCUA 4OP2A 4W6QA 5CAEA 3TGWA 1PNTA 2XIJA 1MH9A 2ILVA 4Y0VA 4KRFA 1KYXA 1MO5A 4NR0A 4R7TA 3EE6A 4JGBA 3K9FC 2Z8YM 3L7AA 3QK7A 4U0JA 5JU6A 1OBFO 5B3AA 4KFSA 2C61A 3W5UA 1PBTA 2IOFA 2M1ZA 1TVCA 1EZ4A 4ZI7F 2ZB4A 3L84A 4U0KA 4BEVA 5T4HA 1JAXA 1KI4A 2GRUA 1ULHA 2X5KO 1Z2DA 2HSEA 2XGMA 1ZNYA 1Q95A 3KRTA 1GGKA 3HCAA 2NVUA 4NYMQ 4RESA 2HYIC 2CHGA 4E4YA 1U0NA 2XRYA 2GAJA 2OOKA 2D54A 3BORA 2Q3EA 4GPBA 1MX5A 4N3GA 4Q1DA 4V0ME 1E3DA 4UFPA 5FOTA 1L4KA 4DBLC 1ESCA 1EVZA 3E1GA 3KKQA 3TIXB 4TZ0A 2A30A 3FHCB 3GCDA 2WJ3A 1PWZA 4G8BA 1WTCA 1GLNA 2FWPA 2QR2A 2G17A 5AM1A 3VPDA 3TLCA 2NO4A 2FF5A 2GJ4A 4QBHA 4C89A 4Z7NB 4DOMA 3UH1A 2Q9UA 4D8UA 1WCYA 1FDSA 3ACBA 3ROXA 2FUG6 3HYRA 5AVUA 2BEWB 4AY3A 5JY1A 2GA8A 4L6IA 1N9GB 2IODA 5ENZA 1PYGA 1YDEA 3PPIA 4B6FA 4ETMA 3WYAA 2PZBA 3N53A 4PC7A 3A6ZA 3LUAA 3WNBA 1C7QA 2XCLA 5H3LA 4M46A 1KAHA 1R5OA 3BIXA 4L73A 4LQCA 3MWJA 2DB3A 3TAHA 4B9AA 4DJTA 2IPLA 4HDRB 4U7TB 2BH9A 2WHPA 3K8QA 2BGMA 2RSLA 4E15A 2X3FA 3HKCA 2JGFA 1DFIA 2QW0X 1U0JA 1UBOS 3FMPB 5BQFA 4PR0A 3RT1A 1TLFA 2JFUA 4K7JA 4F9TA 3SNKA 1N5MA 1TKAA 3LPMA 3ZU2A 2VDOB 1GEEA 1O95D 2NU9A 2O3RA 4J4HA 2E4XA 1P4JA 3Q2KA 4QXPA 5FLKA 2G70A 3SMVA 5WRFA 4BUJA 3K0AA 4YV2A 2GKSA 1KPIA 4MVJG 4Z1MD 2WMNB 2WVJA 1FL9A 1DC3A 4DPKA 4EA6A 1C1DA 1LVUA 4QYTA 5D00A 3K4PA 2G9QA 5JVDB 4BQQA 3A0UA 3HL4A 1IM5A 4OI2A 1G20E 4J7AA 5FNVF 4CCYB 3OEED 3WVNA 3CZCA 1JRLA 4KGXA 4MR8B 5KVAA 5IRCD 1T6YA 1IN4A 3LL7A 5TLSA 5K05A 1PHPA 4Z3OA 1DLJA 4XUDA 3U17A 2JD0A 2WTNA 4K5QA 1SZDA 2Z3WA 4C0HA 3OQNA 3EPPA 3OUTA 1RJEA 1IG3A 4AG3A 2BR3A 3HUFA 2AN9A 4Y9DA 2AKYA 2WIAA 1PJ3A 1XF9A 2PZGA 4YS6A 8ATCA 1YMQA 4K40A 1PT9A 2BM0A 2EIXA 4INPA 3IUNA 4FJ0A 1RLUA 1QGAA 1V39A 2VJYA 2W2MA 3C1OA 5C81A 3AUJB 3OM8A 1IHXA 1VECA 2ORED 1U2DA 2PH3A 4MW4A 2F1HA 4FI3F 5EGSA 4Q3KA 2YUTA 1RDFA 2J9GA 2B4QA 1SB8A 1NE2A 1UC5B 1GG8A 2YHSA 3DO8A 3FLMA 1I7QB 2BISA 1I4LD 1VPLA 5EZYA 4B6SA 4BX9A 1PWXA 2I87A 4YRJA 4XCXA 4AM8A 1SXHA 3G8DA 3ABSB 3P5BA 1Z39A 1PJAA 1LC3A 4CMEC 3HDHA 4DXDA 4BQIA 4B7CA 5J5CA 1I9CA 1R74A 4Y3UA 3ESZA 3HWWA 2YVUA 1EK2A 2A9PA 3AF5A 4EPYA 1Z2PX 4ZZ0A 1SC4A 2IUFA 4HQFA 5C3MA 3NI2A 2FUCA 1N1EA 4G5SA 4XAQA 4V0SA 4RF5A 1CTQA 3T7DA 4JXZA 1E0KA 2H08A 2Q2WA 1HZZC 2Y1FA 3L79A 4A92A 3T7EA 2P35A 1VHJA 1VSUA 3ZVMA 2Q28A 4FYMA 5A9SA 1KMHB 2P3LA 1DTSA 2SKEA 2ID8A 3CGGA 3VR1A 1Q17A 2D2VA 3P4UA 2GHIA 4ZT4A 1GA1A 4TT3D 4UTRA 4EGQA 4ZKDA 3EQZA 2EF0A 3N0RA 3W6NA 1HF3A 1IEVA 1RZRD 3R7BA 1NSFA 3DZDA 5E2AA 5BYBA 1U3DA 1T9AA 2AC4A 2NU6A 3HZOA 5K7SA 4HRAA 4Y67A 2QJWA 1VPWA 3AERA 4FONA 3ETLA 4C0WA 5LQJA 3EGCA 3OKAA 1ORWA 4OGGA 5K20A 5HK8A 4IKPA 4PE5B 1JQ5A 1TQ2A 2I7CA 3QVKA 2ZTSA 2FY8A 5GV7A 1V96A 2I4IA 4LOLA 3RVMA 3ABQB 4YPOA 4CFYA 2HJWA 5BW5A 2OGUA 4NECA 4ZEMA 1BH6A 3CMCO 3DMTA 3EVAA 3K73O 3QVUA 3VU9B 5CA0F 3IQDB 1B42A 3PX3A 3QX7A 2I8AA 2YY6A 5I7FA 3THWA 3C6MA 4IXWA 3LYUA 3GDGA 3LXRA 4S35A 4RJIA 4TQGA 4JI1B 4RHFA 1N6IA 2FN9A 4NK4A 1T36B 4UJ5A 1WSBA 1NPDA 3LK6A 3IILA 3O8RA 3S70A 4ZXPA 3D7KA 2ZDQA 5A4JA 4CEIA 1JQAA 3UJAA 3O3NB 3SSNA 2YTZA 3GRZA 3ZLVA 2FDCA 1QYDA 2C2HA 4G0PA 2FWBA 1BEUB 3AEYA 4PR3A 1KP9A 2NADA 1CZRA 1Y6FA 1P1IA 4QUJA 2EEPA 1E1QD 3AMVA 4HGPA 1JILA 2KLBA 2OLKA 4TX1A 3BMQA 4QYMA 4NCAA 1BZYA 3RDPA 3KHKA 1ACMA 2I3GA 4S0XA 4J7UA 3UKJA 3OPVA 2J30A 2VN8A 3H9EO 3EQ8A 4IDFA 4BKRA 1TZBA 1GQSA 2NZ8A 3LQ4A 4WE3A 4LFBB 2ATEA 1A9PA 2CNBA 2CHUA 2KLHA 4BBZA 1GZ7A 4DLLA 4CODB 2XEDA 3O2QB 1TRHA 2GOYA 4OQ4A 5AW7A 4CGZA 3C6QA 2JAHA 1LKZA 3HB1A 2CMFA 3ELBA 3I5UA 4YRAA 5AUNB 1QWSA 1QH1B 2QPAA 3AWDA 3WADA 2P4HX 2JL1A 4PO9A 4D4IA 1SJ9A 1W19A 2KYRA 4MVJD 1KBZA 3PQEA 5B1HA 3V8EA 5C1OA 4NU5A 4Z0PA 4CJXA 2OB1A 5IAOA 1P0PA 2G1PA 2I4RA 1X87A 3NEPX 1ZDMA 2BGKA 4IUYA 4X1KB 5CB8A 1QP4A 5E6SB 3AM1A 1GADO 4LYDA 1CJCA 3NC0C 1GSAA 4EW6A 4N7BA 3TUZC 2OAQ1 3KEQA 1EFLA 3RT9A 3BXOA 4FOOA 1OCEA 2OG1A 1ZICA 1OVGA 2A4MA 3IMKA 4P5EA 4CKXA 5BUQA 1US8B 2KBEA 2PSFA 3LT2A 5G40A 4A4DA 1QIHA 3I6YA 2DQSA 3TKYA 2QD5A 1TK9A 4Y2SA 5ALPA 3HP7A 4KN8A 1XZKA 4LG1A 4ZGBA 2WILA 3EVZA 4RADA 3NTXA 3KVVA 3O3MB 3PUXA 3IUPA 5ALDA 2DUNA 4F1KA 3ESBA 1RADA 4I9GA 4NH4A 2E5LB 1J97A 2EW8A 3S2FA 2A94A 4KWHA 4O4JA 1QIFA 1V3VA 2IHBA 3H04A 3L8FA 4OXIA 5DBEX 3CN7A 3VHQA 4F9FA 1ZY2A 2NSHA 1JDPA 2ZJYA 2JA2A 3UIEA 2NSJA 2DWPA 3PRYA 1AX9A 3DEYX 2FN3A 2HXYA 3QXXA 2DT5A 1F14A 1NQWA 1PJTA 2AI1A 5FWNA 1V1RA 5DKFA 4JLVA 1KQFA 3N5CA 2IGTA 3SKVA 1GL6A 4IS3A 3N7TA 3VJMA 2BFMA 1PVOA 1E3MA 2IKSA 3FBWA 4XYLA 5LD2B 3BT7A 1EM8B 4M0UA 1KO7A 3EDRA 3GRAA 3R3VA 5CBKA 5I5GA 1XRPA 4PC6A 3BSYA 2AYYA 2C0PA 4R81A 1UFKA 4CCAA 1UDCA 4BLPA 1I1QB 2PGOA 2QUIA 4N8DA 4L5CA 1XROA 5LYJA 3OZXA 2W2OA 1SVMA 4I4NA 3EGIA 4D9JA 4IRMA 1T4CA 4S1NA 4GFDA 4HAYA 1K6XA 2K7ZA 4L4RA 5D6OA 5JAZA 3IEVA 1ZIOA 4YJ3B 3CEHA 5DO9A 3HBNA 5ILGA 1R5NA 1WW8A 1AQIA 2C5EA 3R09A 3U16A 1ZL2A 1E94E 3F4LA 4TKMA 2CNNA 1K0UA 1OBOA 3TJRA 2O7SA 2Z98A 5U4QA 4KOEC 3RT7A 3ZI0A 5LA6F 2BKAA 2IOQA 4CLEA 5KQMA 2JIBA 2W11A 3NS7A 3PGXA 3MCWA 1CE8A 4FFBB 1M10A 1GT6A 2F3QA 5C32A 2QN7A 5DLYA 1SOWA 4HADA 3RW9A 3QPUA 4LHXA 4X61A 1QB7A 1KO8A 2C2OA 1W4RA 2YNMC 4Y6QA 4BAGA 4E14A 3IUQA 4LF4B 4FIZA 1G0NA 3K0CA 4I6JA 3F8WA 3KJNA 4PLHA 4G4SP 4IDDA 4RHTA 5D7NA 3OUZA 1DI0A 2D5AA 2YR0A 3OA2A 1UPUA 3OTHA 1N6OA 1WHTA 2AZTA 2IS6A 5KYNA 3EA0A 4EG4A 2JFGA 3NORA 1E4VA 2DUJA 3K31A 4N3BA 5GJBA 3N8HA 2WOJA 3D2BA 3X1JA 3ZU3A 2Z58A 4URYR 3SC2B 3KOWA 5EMHA 4CKWA 2XDYA 2QTAA 3OFJA 4RF3A 5ISMA 4RH3A 1NTOA 2R1TB 2PH1A 3OFVA 3S29A 2XVYA 1L7BA 1R7RA 4BY9E 2VHWA 4G1FA 1W2GA 2AFVA 2OD7A 1U1GA 1XSEA 1WZUA 2EKDA 3CRMA 1A5BB 3ET5A 1K8ZB 4JELA 4RHCA 4F4JA 3A37A 1KEVA 5CEFA 3PRJA 5A9RA 5EP3A 3W0LB 2RHWA 2W5UA 4KLZA 2DFPA 3UA4A 5JWHA 3RROA 2TS1A 3PTLA 5AKHA 4RORA 1DQYA 4DNPA 4XCQA 5J4LA 1H8ED 4QPNA 1JE0A 3L0CA 3QVGB 2YDXA 2XSZA 2IOFK 5DM1A 3W6ZA 4YRSA 2Z2KA 5LMCA 5GY7A 1EIWA 1NXVA 3GA7A 3UNXA 5JS8A 3Q3HA 4FFMA 4OHUA 2HIHA 2ZIAA 4GDMA 5JD3A 2HNKA 2F9MA 3NO4A 2Q41A 3S2GA 5AKJA 4YO8A 4DLKA 3PHLA 2JJ2D 4MVCA 2O2DA 1N6RA 4R9UC 1G1AA 2PJDA 2QYTA 4WLOA 3OEYA 2O2HA 4HOYA 1PL7A 2PUHA 3VTZA 2K5UA 3UT6A 1CIPA 1J7JA 1BDMA 1X7XB 1K6MA 2H2FA 3ELWA 4HNRA 5JSKA 1HUQA 3KL4A 3DMTC 1FX0B 4CKEA 5IUJC 2A88A 1XA0A 3F3KA 4E51A 3SY8A 3U62A 4O2BB 4ARZB 1K8XB 4PZZA 3TX6A 1J1ZA 1MO2A 4HBGA 1LSJA 1NJFA 1VL8A 3HE3A 2XGGA 3VBCA 2Y4OA 2XUZA 2I7DA 1U99A 4IILA 5IT0A 5LYYA 5ILOA 4X71A 2ZTLA 2YXPX 1ZKMA 4IRUB 4MVJP 1VCNA 4ZCQA 2H5IA 1C3OA 4EHHA 1A5SB 3ROGA 3B5IA 2ZTVA 3I6MA 3EGDB 2J09A 3DEKA 3LC2O 2O06A 4H27A 4B2PA 4IVNA 1SKYB 2PU5A 5TF4A 1PYOA 4ATNA 1WJGA 4DLUA 1CDOA 3R6DA 3PE4A 4JAVC 3C70A 5ER6A 1Y1LA 2WU0A 2WUDA 1QNFA 3WK8A 4D9GA 5GTDA 4CKBB 4QGSA 1MG5A 1XPOA 4YRBA 3V55A 2C9YA 4F91B 3BD7A 5J59A 5AVVA 1FJGB 1K89A 1NVXQ 2V74B 1B1AA 2A92A 3QSYA 3H3XA 1PQPA 3A06A 2C29D 3KXKA 3MWDB 2N1BA 2YJ4A 2O6HA 3DMPA 1JR2A 2NX2A 3REQB 2JS7A 3PIDA 4DCMA 4DQVA 5K51A 4DLSA 2YYYA 3ZTYA 5FYDA 3STHA 5C1DA 5E9AA 3EXG1 1KU0A 1T15A 4NEGA 5TRTA 1M76A 2O3SA 2OHHA 4FKBA 1LV7A 1ONOA 1EDEA 2QRNA 2QF7A 2XGOA 2VSQA 3GZNA 4FGSA 2R6AA 1P4SA 5CNKA 3ZU6A 4B74A 1CS0B 4ZEVA 4EGFA 1DNPA 2DEUA 1J22A 3BA6A 3FSRA 2OD9A 1DADA 3THRA 4JI0B 1XX6A 4HNGA 3AYXB 1R4NA 2UVPB 4FNGA 1L5RA 4MV5A 3VU3A 3DBHA 3OSUA 4TYQA 3G5AA 3DQQA 4U5QA 4QLOA 1MABB 3MS4A 3IOEA 1JA0A 5CK4A 4MB6A 3ND7A 4GX0A 4A27A 3SYTA 4MV1A 3AB3A 3ZZMA 2JFHA 1MXHA 1W0CA 3WMGA 3U7GA 3RUFA 1YK0A 2OMKA 1TEZA 3GT0A 4FEYA 5CIQA 1FS6A 2H4JA 1X14A 3HJRA 1UOQA 2PZMA 2VPYA 5F7XA 1GUFA 4MDHA 4ZJUA 1WDWB 4CNBA 1NSYA 2NQ2C 3NJRA 4WZBA 3FFWA 2WF5A 4FFOA 5JZVA 1PZGA 4AK9A 1CF9A 1P60A 1XG5A 2GPAA 5GJWC 2GD0A 4GPIB 1AK9A 3SG0A 1QMPA 3IBGA 1ADFA 3QE4A 4TYNA 1ZO8A 2WKSA 1YR7A 3BK7A 2NU7B 2Q21A 1IOVA 5AM2A 5KTTA 2F3RA 4R2HA 5J47A 1BQ4A 3L8MA 3VDNB 5BWMA 1XZBA 4IW3B 2EC5A 2Z2IA 1ONPA 2V3WA 1SCAA 1Y1QA 1J2YA 3FHOA 1CDEA 1V3UA 2ADOA 2Z8XA 2J1LA 3KE9A 2VNAA 2V0GA 3EMDA 4HZGA 3CX6A 3TUJC 4Q18A 4AF8A 4MLPA 2DWUA 4AJ2A 3KZCA 3WQSB 3TAXA 3VVCA 3PJFA 2XMZA 2XZLA 3A27A 3K1TA 3U4QB 4DQUA 2A2ZA 2XHEA 1VLJA 4AN1A 1PDOA 1WD7A 2NPFA 3STYA 4BB6A 5IK2A 2EQ5A 4RY9A 4BO1A 3RUPA 1T8PA 3CF4A 3RFUA 3WIOA 1L8XA 1GIAA 1NSTA 1NFRA 3W2GA 1VJDA 4I08A 1SVKA 2X0IA 4EJ6A 1GJRA 1RYMA 2EX4A 4ALKA 3OHPA 1NOJA 5EN4A 1X7GA 3CPJB 4YDQA 1VMKA 4YECA 3SFVA 5D51S 1C8VB 2WUVA 1JEQA 3LIIA 2V4UA 2OHFA 4KPYA 1GPBA 5LKAA 2R8EA 1Y8QB 4ZOCA 2Q7OE 3VZDA 2I1VB 3A4YA 4TYWA 4PS0A 3HDYA 2PV0A 2Z8ZA 5CAEB 3PUVA 4YRKA 4JENA 2C1ZA 5G2OA 4IHKA 1BVRA 1FIUA 3PIRA 4LJ5A 3FPJA 4YIHA 2W6NA 1JIKA 4PF1A 2C5GA 4PGMA 3R7AA 2I2FA 4KQGA 3RFFA 4BGDA 1L7QA 1XAIA 1P9NA 2GBCA 4OIMA 3PNYA 3USES 4MWZA 3CQ9A 1C8BA 4PYMA 2B98A 2IDZA 3UA3A 1VRWA 3LY9A 5FWDA 2VPQA 1QHIA 5LOVA 1OA1A 4FK8A 1GZVA 4YO7A 4D8VA 4B3HA 1ISJA 4E0BA 2IYRA 2QRVA 3MGCA 3R3ZA 1X94A 1YJXA 4TLMB 5JCJA 2GF9A 4P98A 4UNNA 1V71A 1KTIA 2NSDA 2P77A 2NLOA 3FVVA 1E96A 4C7BA 1Y0BA 5NULA 5K0JA 1Z6QA 1LD3A 2ZUWA 3V34A 1M2GA 4J03A 2GJSA 2PQ6A 1C41A 3ZJ5A 5FNZA 3R7NA 4J94A 5CA1A 4FVTA 2QVXX 2EBUA 3MTDA 2CXTA 1HE8B 2QR3A 3TZQA 2GEFA 2BGNA 5EJ8A 2PXXA 1QVAA 5JRDS 4KE9A 4GW3A 2WPDD 2FE1A 4N18A 2Q9CA 3V1KA 2G77B 4Y2VA 3OMXA 1WBJB 2JFWA 5IUKC 3NDJA 4G5RA 1EFUA 3U7QA 2ZI9A 5DBGA 5A1JA 3VSAA 5BN1A 4P4GA 4PTLA 1DAEA 2WHPB 1M8PA 1J8YF 2DFKB 4IJVA 3DM5A 3HKCB 4QU9A 4DJDC 2H5JA 1E2JA 2HLHA 2HRBA 5AI0A 4ER5A 2HF9A 4G1BA 3WNDA 1AQNA 2HA4A 4BQFA 4ZCIA 1F6BA 2FMHA 5CNJA 4DRXA 3NHYA 4UCQA 3LD9A 3PITA 3PHBE 2NUBA 2RHOA 3KKKA 4KBYA 4ME6A 4MCAA 5LIRA 5I7UA 1Z5ZA 3K0AB 4B34A 5K3EA 2HMVA 4D1YA 2GM3A 4MVWA 1LV8A 1RZ3A 5DM70 4LS3A 4A26A 1KQ3A 2Q6LA 1T9ZA 2AQ8A 3VVLA 3TTYA 1AGPA 3T8YA 4M87A 2BJHA 1ISSA 3K20A 2IK8A 4DWWA 3JWJA 1HOTA 3L7CA 5HUJA 2PANA 1SBZA 1NR1A 1DWQA 2OUIA 2YN0A 2VDQB 4F9GA 1Q6ZA 1WVGA 1X1DA 3JVDA 3OQ6A 4F6RA 2OFFA 4EW2A 1JGTA 4I1UA 2A67A 2FQWA 2P4EA 2JJYA 4KPUA 2VDPB 1YQ9A 2J3IA 1BRMA 3ZWYA 4Q9NA 3IAM1 4DSUA 1C0EA 1QNLA 3GRCA 3MBIA 1JKMA 1HY3A 521PA 3PHJA 3L04A 3PYMA 1GAXA 2W2PA 3E1SA 2C59A 2XYVA 2QDXA 3FWZA 1BJKA 4LFCB 3SBDA 3KC2A 3AHCA 1CFJA 4WI1A 1SBYA 3IODA 1QDLB 1FBNA 4D5GA 1OH7A 3N28A 1UXGA 4FDMA 1GZHB 7YASA 5IULC 2R8PA 1KVRA 2CBXA 5G3ZA 2CEKA 3ENNA 1E7WA 4BO4A 1WABA 2BCJQ 3KJEA 3PQFA 3ZOKA 3ROFA 2L82A 5EZYB 3KPWA 3O2JA 4GZ6A 4M9SA 5DM0A 1OXMA 5F1KA 1TAHA 3OT1A 3FXAA 1KRHA 1NONA 1WMSA 3L1KA 4K3UA 3SWWA 1WZNA 3EOAI 1EGQA 2OG2A 3AW9A 3C8UA 2CY0A 4M1TA 4PFSA 4QWMA 3CLKA 5LB2A 4A0FA 1UAGA 1GTMA 2J5KA 1KP3A 4ARBA 2X15A 3GC6A 2FAXA 4ZU1X 4EYQA 1Z8DA 4G9BA 4RXUA 4UW9A 3DDUA 1TAGA 4C1NA 1JW9B 2B3TA 3DAGA 2OXCA 2QRZA 5AKKA 1U6IA 3L43A 4X94A 4AZ3A 3L93A 2G88A 2YMPA 3IGFA 3IAM6 1PJZA 1YIAA 1BWSA 4GYJA 5GWXA 4O5AA 1XIVA 3OG9A 4LCJA 4REQA 3U60B 1DCFA 1WU7A 2Y8EA 2X8BA 4RQUA 3DMYA 5H3CA 3V3TA 3LJKA 5H5JA 1LH0A 2Q0HA 2B1IA 1GG5A 1PL6A 2QROA 2ZLBA 4JLSA 4RE5A 1VL5A 4DKXA 5A9SB 2WQ6A 1BC5A 3U7RA 1V2GA 2PSJA 3SJUA 4D3DA 3VKUA 3L0ZA 4FQ8A 1D2EA 1ZH8A 1XTVA 1YA8A 3AEKA 1DRWA 1R50A 3QHQA 3PUHA 4G37A 2I3AA 3AHGA 2VTBB 4OY3A 1DT3A 5EIBD 3BF8A 3VH3A 2FFBA 2H1CA 4CG1A 1E62A 1O97C 2H4WA 4HLUC 4EY8A 4R7ZA 1ZH0A 1PFUA 2FCRA 3A1TA 3SSOA 3VR6D 3W5VA 4BNDA 4J07A 1ZWKA 5SICE 3P4YA 2UUBB 3GRRA 2DSNA 3DMGA 1VKJA 4K9PA 4MI9A 3M1IA 5FL7A 2PUEA 2EZ9A 3NOOA 3G5TA 1ZUNA 2PXCA 4K6GA 2PWAA 2JH8A 3O3OB 1TJ4A 1SUFA 2B20A 4W8OA 3LHSA 4PTZA 3BH6A 3HLKA 1RLJA 1PP4A 4R83A 1JTVA 1DJLA 1E59A 2HBQA 4Y1GA 3NBZC 3HZZA 3THWB 1CZLA 2Q3HA 3FUCA 4WN3A 4BNZA 1M73E 3G8BA 1CDZA 5EERA 2BFDB 1CUYA 3ZXIA 4FQ7A 4IZOA 4I14A 1QIGA 1VJRA 3IQIX 5L7WA 5CH8A 2Q3DA 1RXWA 1BMFA 3I05A 1ZD1A 2WYHA 2C9DA 2R7MA 2HA0A 3DFZA 3HP4A 4GWGA 1UDXA 4IWXA 4IIEA 4A0RA 3TSAA 1PQYA 3QOXA 4HAZA 4H1WA 4RD3A 2B4YA 3CRZA 1RCTE 2NZYA 4TZ6A 1XCMA 2IUYA 3I52A 4J16A 2O8VA 1GD1O 3RK1A 2PUDA 1AK2A 1F2TA 1JP7A 2OVBA 2QLBA 3H1TA 5C18A 5HDQA 2GK6A 4ARIA 2GKOA 2HWWA 3MSXA 5IEBA 4FM9A 4B31A 3ASZA 2B8TA 4AI6A 2H00A 2H1RA 1LWOA 2ZVJA 3P0HA 1Q84A 3FMFA 2V59A 1HURA 2XNJA 2Y1WA 2G36A 3LLVA 4X64B 4D56A 1OILA 2YJZA 2OFXA 3K5IA 4Z9AA 4B8WA 5T57A 3LY7A 4IIXA 1R0XA 3MCZA 4J6FA 4RJ2A 1RLOA 2QAIA 2I8LA 3A9WA 2B5VA 3LYLA 4BDTA 2Z1DA 1Q1QA 1M2VA 3U6BA 2YZMA 3MAGA 1TZMA 3OIDA 1Q7GA 3HSYA 2E85A 4U9HS 5JATA 2O7NA 2J3LA 3KT8A 3QEMB 4K0KB 1OVMA 4JCOA 4Y8VA 4CLOA 5KCZA 5JUWA 1AKMA 4B73A 3IQEA 1V16A 3H3JA 5DF1A 2QX9A 5KOYA 3FCEA 2YWCA 5BSMA 4BJ6A 3S1AA 2VDNB 4EABA 5A6SA 3EXIB 4RM2A 1T3TA 4DJJA 1DC5A 1Y3BE 4MNTA 5GZ6A 1H66A 5BV1A 2YIJA 2V6BA 1Q0RA 3IURA 3CBGA 3IUJA 4R8LA 3ZDZB 3UK1A 1EMDA 5DPMA 1RXSA 4MWDA 2A7XA 3RYHA 2Q45A 1LSOA 3GA5A 4PHGA 1Y7HA 4D0LB 3E7WA 1OYWA 3HNOA 3ORQA 1CU1A 4B44A 3AY7A 4CM9A 2FE4A 1HSOA 5L6MB 1ZCFA 4OBBA 3NQ41 1H65A 3E03A 4KTVE 1WL8A 1B76A 1N8TA 3BMCB 4M8KA 2EDAA 3B5EA 3K1ZA 3OM9A 4BB9A 4GVXA 2J6IA 3EZ9A 5IYZA 3KSRA 4ER7A 4TYPA 1WXWA 3A04A 4WZ6A 4Z1MA 3JRWA 2WYUA 2ZYDA 4ARVA 1Q11A 4PAOA 1A8HA 1Z26A 1P5RA 2X14A 1RWPA 1QX4A 1VL6A 2FQXA 3IH5A 4B8ZA 3TTXA 1E18A 2QBYA 4OFXA 1NBME 3OEEA 3GIWA 3QEJA 1PG5A 3LW7A 4MV7A 4P7FA 1ECFA 2ACWA 3JARA 1SY7A 1XZPA 2XAUA 2XUHA 4XQ9A 1UBFA 5AD1A 2NNWB 2LE0A 2OQIA 2AYXA 1DXYA 2HSGA 1YS6A 3OIFA 3OJWA 4HH0A 1YIDA 2J9FA 5C52B 4MPRA 4WINA 1DP4A 2ZSIA 3OC0A 4FE7A 2VK8A 2Y92A 3CB4A 3MIZA 5CYOA 5ECGC 1RYNA 1R5JA 2HV9A 2NXNA 2V9ZA 821PA 4YAGA 2G1AA 1HMYA 3O4JA 4CW7A 1OWLA 5LYJB 1XRRA 4NNOA 4QOIA 3A32A 2IYPA 2AGVA 3ED5A 4IQFA 3G88A 2GLXA 1NL3A 3B2QA 4I66A 8ADHA 5K4AA 1OREA 3PWTA 1HKHA 4IF6A 2PGIA 2IW1A 2JJ1D 4C88A 1G7SA 3GEMA 5CJ2A 3HV2A 5F3RA 5KEIA 1UP4A 3A3KA 1DSSG 1LFDB 1MGOA 1Y5NA 4G24A 4UZEA 1EXMA 1PJ2A 3LX6A 2PN1A 3LRPA 1QFJA 2XF8A 3QYFA 3PD0A 2HIMA 3AU9A 4TV8A 5HNKA 2P27A 1CE8B 4FOPA 4PHCA 2O8DA 3H9QA 3TLGB 3ZGOA 1G8FA 3UC5A 5H83A 2WZQA 4XJTA 4E12A 1RQNA 3KEFA 1MV8A 3QTTA 4KKVA 4A23A 1PT7A 5IH7A 2F43A 1S8AA 4YJDA 4AIIA 2YICA 3L1HA 3OLWA 4DA6A 3ZXXA 3PI7A 1GDHA 2WD9A 2VP4A 4BRSA 4NG4A 3MGAA 3QVOA 2P3QA 2DLCX 3L7NA 1P4HA 1OXVA 5IW8A 4DGSA 2GXSA 3ILSA 3OF5A 4I3GA 4QPZA 4EG6A 4FFWA 5BN5B 2W2QA 2ZI4A 4Y1FA 1W44A 1JQ