3PK0A

Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
GSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGPITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVLPESLDAIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 92
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pk0A00
1VKNA 2NV6A 5CPFA 4YRAA 5TIIA 1K6XA 1XG5A 1NVMB 3FSRA 4J9UE 3HWRA 4IDAA 5GMOA 3B20A 2EJWA 4IJKA 1B2LA 1UZLA 3ASVA 2GPTA 2X0JA 1NASA 4TMFA 4BKUA 4IDGA 5JAQA 3AY3A 4PRLA 1VJ0A 1RPNA 4CV3A 5DF1A 2P2SA 1H94A 2B0JA 1LX6A 2C5EA 1ZK0A 1P45A 1V35A 5G0WA 3QE3A 4DRYA 3NDJA 4RVUA 1L7EA 4MVJA 4XZ3A 1F17A 1P1KA 1RYDA 2X9NA 3RBXA 2I76A 3VPXA 2Y1EA 1ZEMA 3RD5A 3V2HA 2ZTVA 4UREA 4BMSA 4C7JA 4H3VA 1CYDA 4M8SA 2V6FA 1DDOA 3PJDA 2JD0A 2OBYA 4BQPA 1H5QA 4E6PA 4NK4A 4RVSA 4YJGB 4WCFC 4Z0HO 2O4UX 4FOOA 4GMFA 1H6DA 3JQ9C 3U4CA 5TT1A 3D7LA 3TZHA 5IDQA 1KY4A 4B3IA 2W90A 2ZIZA 3INRA 4J3FA 5F1OA 2Y0DA 2VYNA 3AOGA 4EUFA 3ADOA 5HTOA 4E2WA 1EVIA 3E9MA 1YE3A 1VSUA 1GEGA 3H2SA 4R16A 5C37A 4F6CA 4BNVA 2VWQA 4BO6A 3MCVA 1XCBA 4NU6A 4Q3AA 4PLVA 1G1AA 4BIIA 1MV8A 2C54A 1UP6A 1U5AA 1YQDA 4OJNA 4A27A 1LJ8A 2YV3A 5ICMA 4KUGA 3GHYA 2GZ1A 4MIOA 5DP2A 1HZZA 1UH5A 1U4SA 1WDLA 3PEFA 5FF9A 1LLUA 4AJ1A 4N5LA 6LDHA 4YCAA 2X1HA 2X23A 4PLPA 5IZCC 1IULA 1LBEA 1VJTA 2CUKA 3F46A 4IPTA 3AI2A 3NTQA 1R66A 2VZ0A 1Z75A 4CM9D 1RM0A 3ENKA 2NQTA 4BO4A 1H6CA 5J23A 3GY0A 4KZPA 5IJZA 4QECA 1DJNA 3L9WA 1O89A 3NGXA 1T2FA 2B4QA 9LDBA 2JHGA 3ICCA 2YQ4A 3IC5A 3QVOA 4Q3CA 1C0LA 4FQ8A 1LC0A 1PGQA 5EQFA 4PG6A 1KC1A 2HK7A 4CM4A 4UAGA 1EUZA 1J4AA 3MWDB 1QRRA 1X7DA 3LQFA 5H83A 1KOLA 4S1VA 2NNLD 1QV6A 2YHIB 5A3VA 3GG2A 4OAQA 3UAGA 4HV4A 5HM8A 3GUYA 2X86A 3PFWO 5BSGA 4DGSA 1CWUA 2I5PO 1U7TA 1DRVA 3JYLA 1I3LA 1E7YA 2Z1MA 4JNKA 4AL4A 1SC6A 3GFGA 4Y6RA 2FPGA 1SEPA 4EDFA 1B7GO 3FRJA 1BHSA 2GN4A 1CJCA 1D3AA 1QORA 4HNGA 1BSVA 4PLCA 3UFXA 1D8AA 5DBIA 1XHLA 2UUOA 5JE8A 4WOKA 4Z6KA 1K6IA 2YZ7A 1MC5A 3LK7A 3GEGA 4A0SA 3EK2A 4BV8A 1Q7CA 1R16A 1YGYA 5JS6A 2X5OA 1CF2O 4BKRA 2YFHA 3SJUA 2OMEA 3QJ5A 1YB5A 4FC7A 4U6QA 4I1IA 2RIRA 1O9BA 1BDMA 1ZMOA 3Q11A 1ZBQA 4GSLA 1AXGA 3PWZA 3OHSX 4NFYA 3ROKA 3FF4A 4BO3A 5CDYA 3JTMA 1N2SA 2EGHA 4B8WA 4BO1A 1PJQA 2CNBA 4PVCA 5CDGA 1PJBA 2J6IA 3ICPA 2QHXA 4E3ZA 3SJ7A 1U1IA 4LN1A 2C0CA 3AK4A 1OI7A 4DQVA 2NTVA 4GAEA 5A02A 1P1FA 1LDGA 4FDAA 3ZDFA 1HL3A 4LRTB 1YRLA 2Q49A 1UDAA 4YT8A 3U4DA 3IKTA 4E30A 3U4HA 1HWYA 4D0SA 1T4DA 4O63O 4UVIA 4II3A 4HX5A 1VL8A 4F3YA 1PX0A 9LDTA 4EEZA 2YJZA 4XR9A 1O6ZA 2EGGA 2VHWA 4CQMD 5EL0A 2AEMA 4Q3NA 2P4HX 2Q50A 3DZGA 3OM9A 2DU8A 4L75A 2J5RA 2ZATA 2J3IA 2VT3A 2QRKA 5IF3A 4JBIA 4GGPA 5G4LA 1HLPA 1LRKA 4BNYA 1H0KA 2GN6A 3AI1A 5TSDA 1HKUA 1A7AA 2D59A 3P2YA 3D1LA 5DOZA 3RFVA 3WWYA 1EMDA 4Q3BA 4ALMA 2X0RA 3ZZNA 3DZJA 1J5PA 5DT9A 4LVCA 3KRTA 1B16A 2Q45A 5C5IA 1IPFA 2HSDA 1LSUA 3ASUA 3ZV3A 1MFPA 1AN9A 2ZB7A 3TZ6A 3RC1A 2WEKA 4BS9A 2UYYA 1PIWA 4J1SA 2IYPA 3WNQA 3Q0EA 4FFRA 5CG1A 4AJEA 3H7AA 3Q9NA 3N74A 2XPCA 3EUWA 4QO7A 3ANMA 1Y5MA 2W98A 3O9ZA 3F4BA 1M67A 4BB5A 3AJRA 1KC3A 5KVCA 4CQMB 3ZWVA 3RAJA 1VSVA 3U09A 5EQDA 4ZQFA 1ONOA 1Q7BA 1QYVA 1Y7TA 1NQ5A 2DTDA 3E03A 2AHRA 3DFUA 1DRUA 1E6UA 2XXBA 3CEAA 4DREA 3VZPA 3H4VA 1KEUA 5HRUA 3ENNA 1WAMA 1X7HA 4XD2A 1LC3A 1NWHA 5CDTA 4HKTA 4D3DA 3I3OA 1IZ0A 3GVIA 1UXIA 3AW9A 1BW9A 1Y1PA 2WMDA 3JQ9A 4IDEA 4GMGA 4LVUA 1YL6A 4BGIA 3ZWMA 4KQXA 3UCEA 5JFOA 4NZ9A 2P91A 1C0PA 1RYEA 1FDSA 3AI3A 2PWZA 3GAZA 3R0IA 1ZW1A 4HXYA 2HMWA 4HNHA 1RJWA 3GLQA 4YJGA 4NJMB 1C1XB 2YDXA 1UP4A 4U5QA 3GGOA 4XR4A 4RVHA 1EBUA 4I9NA 5F5LA 4R41A 2EP7A 2C7GA 1M66A 1GQYA 4XQGA 3CZRA 3ZW8A 3DZKA 3GDFA 3I6IA 4RDHA 4D44A 5I9NA 2BI8A 3WXBA 4RZIA 4J0EA 1A9ZA 2HO5A 3IQDB 4BNUA 3WQRA 1DIGA 5LCXA 4CLHA 2W4QA 2X5JO 3ON5A 1XQ1A 2PKQP 4DC0A 1A5ZA 2GLXA 5DN9A 4DLAA 1NR7A 1UZMA 2BRUA 3DBHB 2JD1A 2Y66A 4TZTA 5AXCA 3QWIA 3B6ZA 1VC2A 4J9VA 3UW3A 3I4CA 2PD6A 4ZQBA 3V2GA 4P22A 4EJMA 2FR8A 1E1LA 4J2HA 3CIFA 2X0IA 4LCJA 5G0UA 3T4EA 1FMCA 1T2EA 3OQ6A 1DLIA 3OJ0A 1GADO 3HN7A 1GUFA 1NX6A 3MTJA 4JROA 3UH1A 4GX1A 4Z9YA 2P5YA 4AJNA 4CLRA 4KOAA 2OO5A 3A9WA 3GMDA 1HE5A 3QVWA 1E77A 5TLSA 3WJ7A 4BNHA 1DHTA 2CVQA 5F21A 3G49A 4W9NC 3UCFA 3JQCA 1HSOA 3BMNB 4WNIA 4AICA 2W2KA 1G6KA 8LDHA 2PKRA 1BXGA 3K31A 2J3HA 2AQ8A 1M6WA 3PYLA 3DEYX 4RF4A 5B4UA 2ZJ1A 5A5FA 1JU9A 5COQA 1HEUA 5EJ2A 3F3SA 2PGDA 1E3EA 1P33A 3FN4A 1EDOA 5L9AA 1TEHA 3GA0A 1I8TA 1YL7A 1BDBA 2D5CA 2OHXA 3DBLA 3I5MA 3I9JA 2VWHA 3G0OA 4YJFB 5TNXA 4E5PA 1WDMA 1A4IA 1CDOA 3PLRA 1ZJZA 1HE2A 1XU7A 4CLOA 4TSKA 2XOXA 4NIMA 4XRGA 1B14A 4OOFA 1R12A 1A71A 3O03A 3QP9A 4CM7A 4YT5A 3JQEA 3R3JA 3TF5A 3I4FA 3U4IA 2DVMA 3OBBA 3WG9A 4HADA 4BV9A 1IB6A 3ZHYA 4DMLA 3A28A 2SCUA 3FNEA 3ONEA 4CMBA 1DO8A 2FN7A 3TOZA 4GLLA 5CEFA 3T4XA 2H9IA 2PKQO 2BD0A 5DNAA 5ENVA 4PG4A 1OAAA 1P0FA 4PIVA 3O4RA 4E0BA 5GZ3A 3WQSB 4I08A 4K6FA 3TNLA 2XXJA 1CIVA 1HYGA 2QW8A 4L9RA 5A03A 4TRNA 3PXXA 1GUZA 5JY1A 2PZJA 1ZK3A 2E37A 4WCFB 5F5NA 1QYCA 4MKXA 3G17A 2OZPA 4BKPA 2UAGA 4ALJA 3GAFA 3PQEA 3TZQA 1P3DA 1ZVMA 4OHUA 4E32A 4KTVE 4YJDA 4YQYA 1JQBA 1B3BA 3GGGA 5K6AA 4B4UA 3ZHBA 2HMVA 4JBGA 3TQHA 3TRIA 4Y9DA 1T1SA 1B8VA 4TQGA 3DB2A 3OEYA 1T26A 3MTGA 4MKZA 2BGKA 1XDWA 3B1KA 2FMUA 4YAGA 1RM4A 3ZWAA 3AM5A 2WYVA 3AY7A 3V2UA 4ITUA 2QRLA 3GN2A 4J16A 4XYGA 1FK8A 2QIOA 4DLLA 4E5NA 2IZZA 4FGSA 1OZAA 4PZEA 4XQCA 4IZHA 3TL3A 2BF7A 4R54A 3ZNQA 3MJCA 1DAPA 1H9AA 4CM6A 2ET6A 5T5QA 3KEOA 1J0XO 1IHYA 3BXXA 2ZYAA 4YAEA 2P9EA 4M89A 5K9ZA 4A2CA 1ID1A 4DA9A 1JWBB 2VOEA 2DPGA 4IJWA 1E6EA 3NKLA 1ZSVA 1ZZEA 5FYDA 3UVEA 3RQSA 3DBHA 5CEJA 4E2ZA 1W4ZA 3OP4A 5C3MA 1ENZA 1ZK1A 2Q3EA 3VVBA 5C7OO 5A05A 2ZB8A 5A9TA 4EI2A 4NJOA 1UJMA 1LLQA 2EF1A 2JD2A 2DFDA 4Z9FA 3ORFA 5ICSA 4OXNA 2QX7A 2GZ2A 2OOSA 4HFNA 2CDCA 3DTTA 2OBNA 2O3QA 5ENDA 4CM1A 1PEDA 1ZCJA 4U8GA 4JQCA 1U3WA 1HDYA 3IOYA 1XEAA 3JYOA 1DC6A 1E7QA 1OFGA 1R4MA 2Q2WA 1K0UA 4BKOA 2FR0A 1LQTA 4FS3A 5AVOA 4A26A 1E3WB 3H9GA 4XRRA 2EWMA 1XLTA 4R1TA 1H6AA 4FBGA 1EEHA 2I99A 1HZJA 2J8ZA 3WYEA 3HNPA 2H5LA 1GCUA 2B4TO 1VKOA 4ZVVA 3T7CA 3PPIA 3V1TC 2VUUA 2PR2A 3MWEB 2GNAA 3GVPA 2ZCVA 3M1LA 3WTCA 2QYTA 4YVFA 2D8AA 3H6KA 2HKIA 1NXQA 2BGLA 3O8QB 2B35A 4ZRMA 1T25A 1E6WA 1UZNA 1HTBA 3GF4A 4OL9A 3PGJA 4E2YA 1Y5RA 1R6DA 2Y99A 2GR9A 3JQAA 3UUWA 1GDHA 2PA3A 2PZKA 2I65A 4W7HA 3RUDA 3KSZO 3E9QA 1PU2A 3JD1A 2JCXA 2Q1WA 1A4UA 3EVTA 1ZSYA 4FGWA 4CM8B 1NVGA 2YHIA 4Q39A 4R4JA 3L6DA 4O1MA 4D3SA 3GPIA 2D1YA 4J2OA 2HRZA 4BQRA 5F1KA 4PLWA 3QQPA 1ISFA 2VHYA 3PHJA 1I32A 1UXKA 2Z5LA 3ANLA 3KSDO 4W99A 1L7DA 1UR5A 4U0JA 5IN4A 5L4LA 3HQ4O 1LRJA 1K89A 5KWEA 4D3FA 4G5HA 1XWFA 3DOJA 2RHCA 1ARZA 5KNLA 2PK3A 2D2IA 4MVJE 1KBZA 2PD4A 2PH5A 3WR5A 5KJ1A 3WBBA 3C8MA 3R6DA 4EJ6A 1XU9A 3G1TA 5ER9A 3Q2KA 1GV0A 3JCZA 4BNFA 2HDHA 4K26A 2OXIA 5L7TA 4LMRA 2RBEA 4QSMA 4D79A 1KEVA 2GASA 4W7IA 5T6BA 1ONPA 3PVZA 1JAXA 4FR5A 1ULSA 1NPTO 2PGLA 3DOCA 3GNQA 1K5HA 4R1UA 5G0TA 4BNXA 1YKFA 4IGFA 1N7HA 2G0TA 3DOOA 3I1JA 1M2WA 5IZCA 3GEMA 3INTA 4RQUA 4XGIA 4GQAA 5IFLA 5JSFA 4CQLB 1H9BA 2Y67A 2IYOA 3GPDG 4J49A 3SVTA 3PRJA 2DUWA 4JP3A 1N9GA 5CFZA 1B8PA 1JVBA 3K8ZA 1ZH8A 4EUEA 1YOVB 3JQGA 3NAQA 1C1DB 3QWBA 1EDZA 5KJFA 3NEPX 4GX2A 3SEFA 1UXJA 5TF4A 2VCYA 3OICA 4E12A 5F3RA 4EW6A 1ZJYA 3V8BA 5I8WA 4H7PA 4CV2A 5JDCC 1Q7GA 5KJEA 2Y1GA 4A73A 5L4SA 2E82A 4MVJM 4MVJI 2YHUA 2O7QA 4BO0A 2X4GA 4GSKA 3OECA 1Y8RB 1CERA 4ZICA 3VDQA 2NWQA 4O6VA 2DUUA 2O50A 1ADCA 3A1NA 1LSSA 1YBAA 2O2SA 3HB4X 4CM5A 3VHRA 4RPKA 3TSCA 3CXRA 3WMWA 1PJCA 3GC6A 3VC7A 3EC7A 4GGOA 4L76A 3PDUA 3LC2O 4IBOA 4J0FA 4IJUA 4R68A 4C4OA 2F1KA 3M2PA 1PJ3A 1AHHA 2Q1TA 1I3KA 2FPIA 1RWBA 4XDZA 7MDHA 4CR8A 1NNUA 2I3AA 4MP8A 4LGVA 3INGA 1HDXA 5JAZA 4K1LA 2AQKA 1IOLA 1NQTA 2DTXA 4J1NA 4ND1A 1KY5A 3EVNA 4MO2A 1K3TA 5EIOA 3W8DA 1BWSA 1YO6A 1X0XA 3RKUA 1HDRA 2NVBA 3PZRA 5L7WA 1NFRA 3DZBA 2PZLA 5JNLA 3NV9A 1R0KA 1ISIA 4OSOA 2G5CA 2C7VA 4E5YA 3HG7A 5U1PA 3HB5X 2FSSA 5GZ1A 4Z9XA 3JYQA 4A5OA 2Y0CA 4EEXA 1GD1O 4PGFA 1ZXLA 4CL3A 1F8FA 4KDFA 5AQ1A 3B70A 4WKGA 2EKQA 3FI9A 3LLSA 5KIAA 3L6OO 4J91A 1VE9A 1ENOA 3CH6A 4WLVA 3QY9A 1LDYA 3ZHXA 1IY8A 3H3FA 3ADPA 5EINA 4A10A 5I7FA 4B8ZA 2DPHA 2IE0A 1PJSA 5A5EA 2E4AA 3UCXA 1YJQA 4JX8A 3JSAA 4UUOA 3AFMA 3JQAD 4G2NA 5B37A 3IIEA 1DIRA 3DC2A 3ZWPA 1MC4A 3JQBC 3DHYA 2VYVD 4O0LA 4B7XA 4E5KA 3W1VA 5DBFA 4L4SA 3KYDA 2AMFA 4OOEA 4FSHA 2VRCA 1H6BA 2OGUA 5ILOA 4GVXA 4FJ0A 2X58A 4HFMA 1U2DA 3GFBA 3SBOA 4OQZA 5A9RA 4ALIA 1H2BA 3I6QA 3ZHZA 1KVRA 1DRWA 4J7CA 1VLLA 2JAPA 5JO9A 5ILGA 2NU9A 2IEBA 1EK6A 3E6AA 4KTTE 1AHIA 1WZEA 4WOJA 3RUIA 4LRSB 4S3MA 2ZQZA 5A1TA 2EKLA 3WSVA 3ZV5A 3MZ0A 1DJQA 3JD0A 4ND2A 1P77A 1EBFA 2NU6A 3NT4A 2D0IA 2P4QA 5GY7A 2B83A 3S2FA 1SNYA 4QO8A 4XB2A 3ZCXA 4D7AA 1RM3A 2EIHA 3NTOA 4YDRA 4DVJA 1I30A 1P1HA 2HLPA 1JW9B 1V0JA 2RCYA 3ETDA 1V9LA 3F1LA 1N5DA 3W8EA 1ML3A 3K2EA 5JYDA 1IE3A 3DMYA 3O26A 2Y68A 2X22A 1KERA 3MOGA 3DAFA 5BSHA 4IMRA 3H9QA 4JCOA 5B4TA 4R9RA 2JFGA 4BNNA 2W8ZA 2EW8A 3PHLA 4TZKA 3H2ZA 3KV3O 4AJKA 2A92A 4PFJA 5EESA 3PJGA 1X14A 1N8KA 2GD1O 3OJOA 4DQXA 1Y8QB 4BOYA 4N5NA 3WB9A 2CVZA 2ZB3A 1MP0A 3IL2A 3E5RA 3KO8A 4MIYA 4CUZA 4MVJP 1I33A 3KOUA 2VOJA 3H3JA 3JV7A 1S6YA 1ZUD1 3ANNA 5JCJD 2DFVA 2FWMX 1B8UA 1YDEA 2JCYA 4D45A 3RROA 4CUKA 2FOIA 1J49A 2ZTLA 2ZTUA 1PS0A 3E48A 4CMCA 4TRRA 3TJRA 2IZ0A 3UN1A 3ZW9A 1X1TA 3QV1A 1B15A 5T67A 5B1YA 1SO8A 3JQ8A 3ULKA 3U62A 2ZK7A 1ADGA 4DIFA 3IUSA 2RHRA 3NX4A 4RF3A 2AEJA 2EXXA 1LNQA 3M2TA 4WCDA 4J90A 5B12A 1T24A 3I9MA 4FFLA 4RL6A 1R4NA 3ZV4A 4H16A 3U0BA 3LYLA 1PQPA 3OMLA 3F6YA 4HWKA 4AJ4A 5IDXA 1X1EA 4XGKA 4CMIB 4XGNA 1IYZA 4QXMA 1R0LA 3QVSA 2X7HA 5IDYA 1JAYA 4TRJA 2BKAA 3RBZA 4QFCA 4XWYA 1UUFA 2BFPA 5JCJA 5DZSA 5JCXA 2HMTA 3KSUA 1R15A 1NFFA 1B0AA 1H2HA 4I5EA 3ROMA 4NI5A 4PRKA 4WLNA 3V1UA 5I9LA 2IDZA 1XELA 3LT1A 3ZH2A 5L4NA 2JCVA 3GZNB 1JTVA 1MGOA 5HWSA 1ADBA 4MPDA 3WQQA 3KBOA 3OQBA 3WGYA 2D5AA 2AA3A 4BUCA 2ILTA 3DFZA 5DULA 1IUKA 3LVFO 2P9GA 2BFAA 2CDAA 1PZHA 2ZYGA 2V6MA 1ENYA 4P38A 4CMIA 4IY1A 1B26A 4RGBA 5JDIA 4JBHA 3DHEA 4FB5A 3ZNNA 4CV0A 4FJ2A 3BMCB 3S2EA 3QW2A 1UAGA 3TPCA 5CHEA 3I9OA 5HS6A 3W4IA 3RKRA 3W8FA 3EDMA 4BO7A 5I8ZA 3NJ8A 4BVAA 3QVXA 1BG6A 2CF5A 4UUPA 4PLFA 5LDHA 2YYYA 4NFHA 1Y81A 5TC4A 3WLEA 3JQFA 1C14A 3EY4A 4FIZA 3P5SA 3ROQA 1CRWG 1LLDA 3BZUA 4PLYA 2LDXA 4O5OA 3RWBA 5L40A 3PTZA 4JJGA 2EW2A 1NWCA 2C29D 4RQTA 4WLUA 2XAAA 4UULA 5BNIA 2JFFA 2TMGA 2O48X 3JD2A 3PHIA 5G4KB 4W9NA 4NH4A 2QQ5A 3PI7A 1NPDA 4Y6SA 3PP8A 5LC1A 4BNZA 5FEUA 1UP7A 3WFJA 3W6ZA 3HDQA 1ISMA 4HUJA 3JQGB 4JJIA 2IEDA 2VUTA 4U7WA 2VZ8A 4IQ0A 4NR0A 3CUKA 1PJTA 3D3EA 3WICA 4IINA 1OOEA 3CE6A 4Z3KA 4M1QA 2QG4A 3H9EO 4OMUA 4I9HA 4Q3DA 3VH4A 2GYYA 4TKMA 4CQLA 3AM3A 3MJTA 5DCWA 4C7KA 3C1TA 2ZTMA 5DOVA 1I2BA 2VRBA 2AW5A 3VKVA 1GQ2A 4FD3A 2O23A 2PV7A 3AU8A 1PJLA 2VQ3A 1DPGA 3BTOA 4FCCA 1YQGA 3LT4A 2POQX 3CINA 1AGNA 3AM4A 1QG6A 2NTNA 2VTEA 3BMOA 3K96A 3BMQA 5TT0A 4CL8A 2WSBA 3GMSA 1QYWA 1V6AA 5K0ZA 1NFQA 4YJHA 1HXHA 3F47A 1X0VA 4JIGA 3BTVA 3OJFA 3FPLA 3DL2A 3MJEA 4M49A 3HHPA 3VH1A 4FC6A 4LSWA 2B5VA 4TVOA 3TN7A 1P74A 3NTRA 1PTJA 3IP3A 1SB8A 3PIDA 1U4OA 1NP3A 1NTOA 1LXCA 1UDBA 4QX6A 1KEPA 1MXHA 1QLHA 2FP4A 3GK3A 4AJ2A 4NU5A 4RVDA 2O3RA 4GKBA 4IDCA 5CAEA 4ONEA 2NVUA 2VWGA 4RLSA 3KEQA 4MKRA 2AXQA 4DLBA 4OIMA 1LRLA 5F1PA 2FHSA 1U8FO 2EP5A 2H6EA 3WGQA 3FD8A 1PZEA 1KVTA 3Q9UA 1QV7A 1SMKA 2EERA 3HDYA 3AOEA 5JPIA 5CP8A 5JMPA 2H63A 3SC4A 1W0CA 3LSYA 1MUUA 4FJ1A 1W8DA 1ZXBA 3D5QA 2WWRA 3IJRA 2BLLA 5FWNA 4WEOA 2C82A 5THQA 1TT5A 5TGDA 3PGXA 1RKXA 4R5HA 5CDUA 1JLLA 2Q46A 1S7CA 3AUUA 1Z6ZA 4YXFA 2F00A 3BIOA 1DXYA 3ABIA 5ITVA 3V5NA 1E7WA 2C59A 2TMDA 3I9LA 3TFQA 5JXWA 2H1SA 2PH3A 3CMMA 2JKVA 1QSGA 2QZZA 4BB6A 2PLAA 4CMEA 3L4BC 1V3TA 1YXMA 4BGVA 2V6GA 1O94A 3OH8A 1DLJA 1QLJA 1ISGA 3W4KA 5H81A 3VH3A 3S55A 4GI2A 1HYHA 3LDHA 3A06A 3GDOA 3WGHA 1BGVA 3JYNA 1WVGA 2PNFA 1MG0A 3OSUA 1GEEA 3ZU5A 3U3XA 3WDSA 5GZ6A 3PWKA 3LU1A 5G2OA 1JKIA 4XB1A 3Q1LA 3RIHA 4RVFA 1PR3A 5IXSA 4MVJH 3LC7O 1I36A 3KHUA 2VRCD 4ZA2A 4I9UA 1M75A 4EYEA 1TT5B 4F45A 1YBVA 3WIEA 3D64A 4WASA 4JP2A 1NPYA 1PJ2A 4KP7A 4P4NA 3UICA 3E8XA 1WPQA 5IZ4A 3L07A 2V65A 1JKJA 4KWIA 5BNFA 1HDOA 2UVDA 4CMJA 3HJAA 3KVOA 4I8XA 2CMDA 2OUIA 2NM0A 4WUVA 2E6UX 3JQ8B 4ND4A 3D4PA 4CM3A 4PZCA 3F5QA 1MG5A 3ONDA 1E1KA 4FN4A 3WYBA 1OBFO 2E49A 1D7OA 3AUSA 1TT7A 4MJLA 3PLNA 4DBZA 4WEQA 4EBFA 1O8CA 4YB8A 4EJ0A 1SOWA 3PYXA 2GO1A 3DBRB 2GUGA 4UVDA 3RJ9A 2Q2QA 3BHJA 1O0SA 3E9NA 3WFIA 1PL6A 4ND3A 1NQAO 3TWOA 1MXFA 3WLFA 3KYCA 1UAYA 4II2A 5HS4A 5L7YA 1PL7A 3W4JA 2O2YA 2Y0EA 4J6FA 1YB1A 4E31A 1Y8QA 2V7PA 5TJHA 3RVDA 5T57A 3QVTA 1X7GA 1NVTA 4RV9A 3KYDB 3DZFA 4J43A 4NBRA 4AVYA 2G76A 3NGLA 4J4TA 1DBVO 1WMAA 5DP1A 5TQVA 2ZKLA 1DC3A 5JMWA 1LSOA 3NUGA 3LF1A 1I3NA 4XX0A 3ZWCA 5K6AC 2DBQA 3DAGA 1GYQA 2O3TA 3B1FA 2Y1CA 4ZQHA 1IZ9A 1NHGA 2FR1A 4JN6B 3MEQA 2WD8A 4IS3A 3ITKA 4W6ZA 5BR7A 4OKIA 5JLAA 1LDMA 3QIVA 3DTYA 3WX0A 2WE7A 3ST7A 1PWZA 4INAA 4AJOA 4CR6A 4NMHA 3NYWA 3NT5A 1GZ6A 1ZKMA 3DMTA 4IMPA 2HQ1A 1GPDG 1BXZA 2DBRA 5I7VA 1R37A 3DBVO 3K9QO 3ZU3A 5CEEA 2CVOA 3RFTA 3S2IA 4WJZA 1NHWA 1HSZA 1SAYA 5G4KA 5U9CA 3HADA 4R69A 4IS2A 1KVSA 3HFSA 1QMGA 3VTFA 1C0KA 5EPOA 2A94A 4GKVA 4NBTA 4YTEA 5DBGA 3WBFA 1PL8A 3ETEA 4PLTA 4WGGA 3CMCO 1V3UA 4HFJA 2J5KA 1YB4A 3VOSA 3AFNA 4XDYA 5G0VA 1P1JA 4P4LA 4R51A 4EITA 1GL3A 2X6TA 5TS3A 3IUPA 3K30A 4XIJA 3TL2A 1E0DA 1WLYA 1HDGO 4MP3A 2VYVA 2OORA 4TRMA 1GCOA 1N1GA 2PTGA 4GVLA 4NG5A 4XKJA 1FDUA 2W2LA 5DCUA 4YRDA 2C07A 2O3JA 4DC1A 3WGTA 1LA2A 4PG7A 3GHHA 3JQFC 2DC1A 1R4NB 4B4OA 5JY6A 3A4VA 4ZQEA 3SLKA 3P19A 3ZWWA 1SEVA 4E21A 4ROSA 3UXYA 1HE4A 3HUDA 5U4QA 1Q0QA 1GU7A 2AG8A 2IXBA 3V1YA 2Q4EA 3FWNA 3I83A 5JDCA 1I5RA 2QZ9A 2PGJA 3FR8A 1VRWA 3WTBA 2Z95A 4YACA 3IKVA 2X0NA 5KCZA 2VYND 3GOHA 3DWFA 5LDGA 5KTKA 3GZNA 3FHLA 3PK0A 3OF2A 5ER6A 3IS3A 4MP6A 3C7DB 2RAFA 3H5NA 1E3WA 3L77A 1DAOA 3SX2A 2VNAA 1P31A 4YJHB 1TA4A 4L74A 1GZ3A 2I9PA 1UDCA 3BMQB 1ISHA 2NACA 1B3RA 4K6CA 4IDDA 3HE3A 1FF9A 1ISJA 3S2GA 7ADHA 2BHLA 1DFIA 5TRTA 1LDEA 2BFMA 2BELA 2J3JA 4WK6A 2CZCA 3FNFA 4RJTA 3K2BA 5JC8A 5JO0A 1M76A 3C7AA 4R1SA 1E92A 1YS4A 4GWKA 4PG8A 3O38A 4GLOA 2NTJA 1R0SA 3BA1A 1GQQA 3ZGYA 4CLXA 3FCOA 4IIUA 1NM5A 1GV1A 2DLDA 2HU2A 4ZQGA 3F4LA 4QUKA 3S1LA 4KMSA 3QWAA 3GNSA 1GUYA 2FPPA 1FDVA 2DAPA 3MJ4A 3OJEA 5FFFA 2WYUA 4TWRA 1EVYA 3OQ1A 4UEOA 3JYPA 3ZWBA 1DOHA 2QRJA 2V6BA 1FDTA 1DHRA 5DDIP 4EGFA 4QTZA 4Y98A 4XYLA 3EW7A 4CLEA 1GZ4A 4I5GA 4ZD6A 5AXBA 4M55A 1E1MA 3COSA 2HJSA 4B7CA 4IZIA 3X2FA 4YRBA 5AYVA 4L8VA 3KYCB 1P44A 4RCVA 3GEDA 3GVXA 4IQ8A 1HF3A 4UEKA 3RUHA 5DCYA 1AUPA 4H15A 4NDNE 3LT2A 4GWGA 1WW8A 1N92A 1XQ6A 4UVGA 3WSWA 2YY7A 1DC4A 3EAGA 1IL0A 4CMAA 5L53A 1DC5A 2ZB4A 4BGUA 1K6JA 3AOEC 4J4BA 4TVBA 1BVRA 3GRPA 1EUCA 4NK5A 1IPEA 1NAHA 2VTDA 1Q0LA 4M54A 2VT2A 2WJPA 2AQHA 5T8KC 3RC2A 1MA0A 3S8MA 1G0NA 2WTBA 3R1IA 3LF2A 3RUEA 2XF8A 1EE9A 3VPHA 2C5AA 3IAHA 4YEDA 4DQUA 1E7SA 2FZWA 4PZDA 4IDBA 3BMCA 1EQUA 5AXDA 4YYZA 3RUAA 1SPXA 3ZNOA 1ZFNA 5C7IO 3ZU4A 2OFPA 1WDKA 3KLMX 3EYWA 4QFDA 3RASA 1ZK4A 2JJYA 4DL9A 3E82A 3CZMA 1LEHA 5JDIC 1IHXA 2AEFA 1Q1NA 3U49A 1W73A 1TVEA 4RPHA 4URFA 4A03A 3BAZA 2I3GA 3GQVA 3CPSA 3NDRA 3H5RA 4GBJA 4BKQA 3FR7A 4EUHA 3RU9A 1X13A 5A06A 3C1AA 3DDNA 3H9UA 4YR9A 2RH8A 4WLFA 2IODA 2IRWA 3H8VA 5L51A 3BMOB 1DIHA 5JC1A 5EN4A 4RVGA 3NJ4A 1E5LA 4Q3EA 4LMPA 4PLHA 2Z1NA 1T2AA 3I23A 5JW6A 2NVWA 3LT0A 4QEDA 2VHVA 4YJFA 1U2GA 8ADHA 5KVSA 4BMNA 1A72A 2Y1OA 4YA6A 3C7CB 4CPDA 5L45A 4A7PA 5KVVA 4KWHA 5JAIA 1BMDA 4YAJA 3PWSA 4MVJF 3WS7A 1QR6A 4RLHA 3A14A 1Q2XA 3FNGA 1KS9A 5TX7A 2X5KO 3AUTA 3C1OA 1I01A 2D3TA 1T2DA 3NT2A 2JHFA 3K92A 4J1QA 3PQFA 4RF2A 4NQZA 4CMGA 1F14A 4J7UA 1E3SA 4XYBA 4JJFA 3ZNPA 2E48A 1BTOA 2X9VA 1SZJG 4GX0A 5L3ZA 4BNGA 5JBIA 4WNCA 3T7EA 3QRWA 4OQYA 3BTSA 1E7MA 3DBRA 3F9IA 2P9CA 1XIVA 4IJVA 4WLOA 3K5PA 3U5TA 4XQEA 1F0YA 4AJIA 2Y1DA 2WDZA 3STHA 2J5QA 4X54A 3WOHA 3VPSA 1EK5A 1U28A 4IUYA 4AJPA 5HBRA 3PJEA 2AE1A 2Q1UA 4NBUA 3H65A 3OETA 2FRDA 3WJAA 4CODB 2HRBA 4RPJA 4CV1A 3ZWNA 1O95A 3VAZA 2R00A 1WXDA 3PZBA 1FJHA 1YONA 3GUCA 1JVSA 3RBVA 3QWFA 4HY3A 2VHZA 2Y05A 1FDWA 3ZN2A 3CSDA 4ZJUA 1P9LA 5KJCA 4DPKA 3ZWOA 2CSUA 1YH3A 1N7GA 3EZLA 4HFRA 1Z74A 2G1UA 1WP4A 3BHMA 1DSSG 3GR6A 2C2YA 3QLJA 3VZQA 3L9XA 4OKNA 2PD3A 4U0KA 1Y9EA 4K9DA 2YW9A 3F5SA 2AG5A 3QA9A 1ZK2A 2YV2A 1CQJA 3DZIA 2CFCA 4HP8A 3AUAA 3FBGA 1WWKA 1RM5A 2J3KA 4B7UA 4CMKA 2JFHA 2NU7A 3DMTC 2NLOA 1LQUA 1XYGA 3IMFA 3GT0A 3KTDA 1Y8RA 4DWVA 5IAAA 4JK3A 4F6LA 1HT0A 4M86A 4EZBA 4NJMA 4Y6PA 4B4WA 2CDBA 1NQOA 2FY8A 3FBTA 3C24A 2A35A 1PZFA 3PFFA 4ALKA 5KKCA 1P0CA 1CETA 3FTNA 4CMHA 3IJPA 3RUFA 4CMEC 4PLZA 1J6UA 1QKIA 4DBVO 3WMXA 3TZKA 1E7RA 1LU9A 1VL0A 1GY8A 1Z45A 1UXGA 4YQZA 5KVQA 2HUNA 2R2GA 3VZSA 4Z3DA 4IXWA 1NAIA 1W6UA 1M6HA 2FZEA 3B1JA 3CKYA 4B3HA 5KOIA 4R9SA 4O59O 5FI5A 2Q1SA 2BGMA 3G3EA 1OC4A 2NSDA 1YDWA 4Y67A 2VHXA 3DO5A 1TI7A 3HFGA 1G0OA 1XGKA 5A04A 1LDNA 3ROPA 2NVUB 2EKPA 4G65A 4OH1A 5IG2A 4LISA 1GTMA 1AXEA 4U6SA 1HRDA 1YVEI 3RUCA 1I0ZA 3IP1A 1PS8A 3K6JA 2DTEA 4W4TA 4RDIA 4RPGA 5IN5A 3RCBA 4F46A 4YT2A 2YUTA 3Q2IA 4XCVA 3QWHA 1VPDA 3K73O 1ZSNA 2IXAA 4NNJA 3DZHA 2O3UA 1F8GA 1ZNQO 1QXSA 6ADHA 2B69A 4AJHA 4ZHSA 4GPD1 1YL5A 3KETA 3QHAA 2I66A 4B4VA 3VVCA 2HMSA 3RJ5A 4WLEA 2OP0A 2NADA 3DBLB 3HN2A 4OO3A 3RI3A 4DTIA 5CG2A 4GL4A 4DXHA 4IGEA 4E5MA 4XYEA 3ONFA 4D41A 4R5MA 5COAA 2O3SA 1Y6JA 2GERA 5JAMA 2ZJ0A 5FI3A 3HDHA 4G81A 5I7EA 1BRMA 5T64A 2BMAA 2EG9A 2HJRA 3I9NA 2X9GA 2PFGA 3O8QA 1NYTA 2UDPA 1SBYA 1JKFA 1PJ4A 1TXGA 5ES3A 4ALLA 4E2XA 2W2LD 5BSEA 4IM7A 3GVHA 3I9KA 4TKLA 2R6JA 3OA2A 4IQGA 3P7MA 4FFNA 1E3LA 2UV8A 3FTPA 4BNWA 2X8LA 1DFHA 1C3VA 4D0RA 3MOIA 1NR1A 1Z73A 3GN1A 5CDSA 4BO9A 4DYDA 1GPJA 4XQ9A 2DBZA 4KUEA 5A4DA 4AG3A 4OSPA 3GZ4A 3IDSA 3PHHA 4FFMA 4CJXA 3HDJA 3ITDA 3GGPA 1U3VA 4UVHA 4N54A 1WZIA 2C20A 4MVJG 4PN3A 1YWGO 2CD9A 3GDGA 4NPCA 1HETA 1Z7BA 4L73A 4LSMA 3DONA 3R3SA 3VH2A 1JWAB 4ZGWA 4BL5A 3FPCA 4RF5A 2P68A 2VN8A 3F1KA 4TROA 2I67A 4E13A 1A27A 1PSDA 1I2CA 5AOVA 3L4SO 4CQMA 4N5MA 1ZMTA 5AXAA 2RH4A 3UKOA 3WGIA 4MDHA 4MIEA 1D4FA 1GYPA 2Q4BA 2DBVO 4AJLA 1A9YA 1U3TA 1U5CA 4KQWA 4UVEA 1FXSA 5MDHA 3RC7A 1DB3A 3DR3A 3NDIA 4OGWA 4BNIA 1YQXA 1HLDA 3G1UA 1E1NA 5I9MA 4YAIA 1F12A 1GYRA 3KYBA 4XJTA 4ND5A 1I2ZA 2B5WA 5JYEA 2AQIA 3P2OA 4J7XA 1HDZA 1KEWA 3JD4A 3PJFA 3FWZA 2CY0A 1V3VA 1C1XA 4QQRA 1V8BA 3FNHA 1U7HA 2G17A 2GN9A 4UEJA 3N58A 3D5TA 3LLVA 4E4YA 3OFSA 4M87A 5A9SA 5C7LO 3DHNA 4PVDA 4RORA 3RFXA 4LCEA 3PDJA 3WWZA 1TB4A 4YWJA 4UUMA 1LDBA 4CLOB 4B3JA 4OXYA 1ZIDA 1LSJA 4Z0PA 1EZ4A 2NQ8A 5COBA 2B4RO 4DYVA 2A9FA 3OEWA 3E1KA 2YDYA 2PY6A 2DQ4A 1GFSA 2EJVA 1UXHA 3JQAB 3UGKA 1D1SA 1HDCA 3DQPA 4J1TA 1LLCA 1PS9A 4YT4A 4BGEA 1EVJA 1SOVA 3WIDA 5B4VA 4Z0TA 4R01A 1PR9A 4Q9NA 3WGGA 3JQBA 1KVUA 3BMNA 2WM3A 4P8RA 3DAPA 4IXTA 4WCFA 1C0IA 2DT5A 3PIIA 2OP1A 3EGOA 1EE2A 1MLDA 1Z82A 1ONNA 1BVUA 1DEHA 1U8XX 4R3NA 4FFOA 3D4NA 2HK8A 3GNTA 4FOSA 4XEHA 5BNTA 4NHEA 3OA0A 1ULUA 2HMUA 1MFZA 5TJ9A 4D46A 3KB6A 4HBGA 4DPLA 1GAEO 3ZWXA 2HCTA 1YOVA 1AE1A 4WECA 3D0OA 1I24A 3G79A 4QT0A 1N9GB 1YJ8A 1P1IA 3E5MA 1XA0A 3L0DA 4E33A 2UUPA 1PGOA 4ZN6A 1D1TA 4R3WA 3C3XA 4L4RA 4KUHA 4NFSA 4ZRNA 4WPGA 2IZ1A 4GX5A 2ZYDA 3KLPX 5G0SA 5BQFA 3WYCA 1VJ1A 5THKA 4NBWA 5H82A 3RU7A 3JQDA 4JGBA 4XYMA 1X15A 1JA9A 1T1RA 1WMBA 2B37A 3KZVA 2OL4A 3SXPA 4R1NA 4BO8A 5I7SA 4JLWA 2YFQA 4XJSA 1XR3A 2JAHA 2QYSA 3CTMA 4RZHA 4ESOA 1BXGB 2NU8A 3I52A 4N18A 4D42A 1PZGA 2W2KB 3Q3CA 3ZWYA 5EERA 4K28A 4CM4B 3JQ6A 4BNLA 4CUJA 1JN0A 1DFGA 1P1RA 3KXDA 3SC6A 2HK9A 4AFNA 2HAEA 2GCGA 3MJSA 2WD7B 1E3IA 1QYDA 2I6TA 5T8KA 4BNTA 3AWDA 3WNVA 1QYXA 1MB4A 1XKQA 3D4OA 3C85A 3JD3A 5L95A 1I10A 2GSDA 4YBZA 4B79A 1CQIA 5CPBA 1LI4A 2DKNA 4BO5A 3WGZA 1KIFA 2LDBA 3AU9A 4UUNA 3HSKA 3W6UA 4AJJA 2ZQYA 1E3JA 2BH9A 4BMVA 2R00C 4ID9A 1T2CA 3LZ6A 4LK3A 4YAKA 1EVZA 1C1DA 1U3UA 1N1EA 1ENPA 3EHEA 4MVJD 1L1FA 3TDKA 4GH5A 3VKUA 4LW8A 1O5IA 2VWPA 5IDWA 1F06A 4CR7A 3GG9A 3KM0A 4FPXA 5HA5A 4YPOA 1SB9A 1BXKA 1YBMA 1PGPA 1EFLA 1DIBA 1PGNA 1EFKA 1HE3A 2WE8A 5IXYA 1I3MA 5A3JA 4BNJA 1HYEA 4L4XA 3VPFA 1MX3A 1T4BA 2O4CA 4DIBA 3KUXA 3BHIA 3EZYA 3GVCA 4P4GA 1ORRA 1XSEA 4J4HA 3RSHA 1OMOA 2O7SA 4BHTA 3OJLA 3OIGA 1Y9AA 4CLDA 3D3WA 4ALNA 3RC9A 5ADHA 3UF0A 1LUAA 4KDEA 3QSGA 3JQ7A 4OXKA 5A9SB 3OIFA 2CF6A 5BT9A 1VI2A 2VZ9A 3MJVA 4DUPA 2GRAA 3H9JA 3L4BA 4MINA 2NUAA 2JL1A 3E18A 3PYMA 2YQ5A 3VTZA 1LTHR 1OC2A 3JQ7B 4MOWA 4CM8A 4L0QA 2VUSA 2GZ3A 3OIDA 3UOGA 5BSFA 4NBVA 1SCUA 1KVQA 3D3WB 3U9LA 3TFOA 3WGOA 5ITWA 3GH3A 1BW9B 1PQWA 4OYRA 3ZI0A 3N7UA 2YV1A 4PCVA 2C2XA 2GDZA 2GN8A 1TLTA 2BFOA 3ZU2A 2G82A 4Y8VA 4FFPA 1K2WA 4BO2A 3BTUA 1DIAA 4W82A 4OM8A 4BNMA 1ZEJA 2EV9A 3H5AA 4IDFA 5KJ6A 4PLGA 2DM6A 4BNKA 2WYWA 2B36A 1ADFA 4I5DA 3TZCA 3PHGA 1EQ2A 2BI7A 3HZZA 2Y1FA 1EUDA 3PQDA 4JXKA 1E5QA 4RO0A 4WE3A 5EMHA 2Q99A 4DPMA 5MGBA 4ILKA 2EEZA 3VPGA 5KKAA 3UHAA 1KYQA 1PGJA 4ZU3A 2FSVA 4PG5A 1KETA 3NRCA 1VL6A 1ZO8A 2GGSA 1A7KA 1CEQA 4CLRB 1H93A 1U9JA 2ZCUA 4IIVA 2A4KA 3L6EA 1JDJA 3LC1O 3EMKA 2Q2VA 1QP8A 4DIOA 2VNSA 4N7RA 4CM9A 3ETGA 3M1AA 3DXFA 3VDRA 2GF2A 1GR0A 1PWXA 3AY6A 3X2EA 2PZMA 4XA8A 4D43A 3Q6IA 2EHDA 3VZRA 3ZV6A 2WD7A 1PQUA 2P5UA 1Z7EA 3SLGA 1Q0HA 4I5FA 4DMMA 1R4MB 3GRKA 1WNTA 2D4AA 3TOXA 2AE2A 4RPLA 4FW8A 3BYZA 1NBOA 2Y93A 1VM6A 4XIYA 3M6IA
chains in the Genus database with same CATH superfamily
1MORA 3TMKA 5CPFA 1OB2A 1FTGA 2ZJ6A 1VGVA 3TLEA 5JZSA 2Y2UA 2H1RA 1U0GA 1E69A 3BJMA 4J9UE 2QX8A 4GLJA 4LZAA 1R5NA 2GPBA 1XTVA 2EJWA 1S8AA 3ASVA 4Q3OA 1NASA 2HZBA 3RT7A 4BKUA 1U9IC 5BURA 1E4EA 2R7NA 1X87A 1MOSA 3IOMA 4C30A 1KA9H 1RPNA 1KJNA 2W2OA 1A8UA 2GTPA 2C78A 2G5TA 4NPAA 4WSOA 4ZK6A 2ZRPA 5AJXA 4EIWA 4RGYA 1ZK0A 4LHVA 2O8EB 4BGDA 1MW9X 2QW1A 3E70C 2HIGA 2DOKA 4K9LA 1P1KA 3L02A 3FWYA 4U6NA 1JNXX 5JYBA 2Y1EA 4BBAA 4I55A 1YE5A 4BMSA 3TM4A 3JPWA 1X1DA 3KR9A 4H3VA 4M8SA 1DDOA 1CUYA 3PJDA 1SD2A 4BQPA 3L0PA 5ICEA 1PK7A 4E6PA 5J2TB 4RTOA 4PGAA 4WCFC 2ZBPA 4PF1A 1AX9A 1JE1A 2O4UX 1JQAA 4FOOA 4MMXB 5K3OA 3D7LA 1EXMA 3TZHA 3TDMA 1CP3A 2GCOB 2Y8EA 2MU1A 4B3IA 5F73A 4H6WA 1AA6A 1XO1A 3N8KA 3SYTA 2CLMB 1S9DA 4GC5A 4PX9A 2I2AA 1ULZA 2AEEA 4ZT6A 1YIDA 4C87A 3G7UA 2XX3A 4N76A 5FBKA 1VSUA 4P92A 2AOWA 3H2SA 16PKA 1M33A 2JC3A 1M1ZA 1SHLA 1M1XB 4KGXA 4WZBB 4Q9KA 5C37A 2BTEA 1EUDB 4RZ2A 2JLZA 4HQOA 3W2FA 3U17A 4BIIA 4M99A 2IYTA 4HUQB 2VQDA 4OJNA 3V4LA 4L0DA 4H4EA 4PNHA 4HL6A 4UOQA 3HU5A 1X8XA 3AFOA 1DKLA 3KJGA 5J5VA 1DOAA 1T8TA 1WDLA 2DFTA 3NBYC 3CB2A 1CRZA 4X7RA 3TLXA 4A6DA 4CG2A 4EGJA 6LDHA 2C9CA 2X1HA 2PUVA 4PLPA 3TE6A 3OJWA 2CUKA 3ZCPA 2R66A 3EXHA 3NTQA 2AMLA 5AJTA 1C2YA 4C05A 3CJTA 1W36B 1YR6A 1ZA2A 3ENKA 1NY5A 5J23A 4F4DA 2C98A 3DLPX 4KPUB 1DJNA 5GONA 3G9UA 2C2MA 2AN4A 4MI1A 4UZSA 1O89A 4LDRA 3V33A 3ZDRA 3QEMB 3ICCA 1XXHB 1L9KA 4PQEA 4RK7A 2NZ2A 1C0LA 1FLVA 4I1RA 1UC4B 1LC0A 1DMRA 3IO3A 3LXRA 3NAMA 5EQFA 1KC1A 3OPVA 4D9FA 2CJWB 2DGDA 1USWA 3K1AA 4XM2A 4YRPA 3K5WA 5SICE 1X7DA 1X7XA 2NXJA 1OXKB 5A3VA 2EG5A 2CWDA 4WA8A 1ZD5A 4Z8YA 5HKAA 2X86A 1TVMA 3K0CC 2ZGVA 5BSGA 5JNUA 3AIKA 2I5PO 2H4FA 2VR1A 3OPYB 5AW3A 2OECA 1BE6A 1E7YA 2O52A 4KBYA 4WOCA 1LB1B 3TCKA 3WJ2A 3L6UA 4V02A 4TL7A 3FCXA 4Y6RA 2FTKE 4EDFA 4X8MA 3H6HA 1VJ5A 1AGPA 1FNDA 2JGFA 2GN4A 3FRJA 3KSMA 1QORA 3OEED 1VRVA 1ZNWA 2XHEA 5JZ9A 3ORQA 4FKBA 2XRFA 4TTQA 1YUBA 4LECA 4YRMA 1J2JA 1OKKA 2IH5A 3SPXA 1MC5A 1RC0A 1XKLA 4L2IB 4BV8A 1QFSA 5J5AA 5JS6A 4G26A 1SBTA 1B6GA 1KMHA 5DU2A 1CNMA 2WOOA 1CF2O 2IEGA 3ANXA 3U2QA 4HOYA 4JY7A 1AMUA 2VDUE 2J6HA 2OMEA 3QJ5A 5A0FA 3AINA 5DLQC 3IEUA 1RPJA 4U6QA 2I1LA 4FYVA 5JASA 1GNVA 3EN0A 3QPUA 3PVSA 1D0VA 4ZAXA 1FYDA 1F4LA 2Q8PA 1BAPA 1YK1A 2QR5A 4GSLA 1BS2A 3GRZA 4NFYA 4ZODA 2IV7A 3ROKA 1ORDA 3ZD6A 3FF4A 4BO3A 4I4CA 3W04A 5CDYA 1DQRA 3D2AA 3RG2A 2O8FA 2XUKA 3QI2A 3TCNA 4KBGA 2VT6A 4KRFA 5CDGA 3Q15C 3VPDA 1VQ1A 5MN6A 1JZTA 1E1QD 2J6IA 3QTLA 2QT0A 1E61A 2NSHA 3LYAA 3Q98A 3SJ7A 1CUHA 5DI3B 3WLPA 3OESA 3EXEB 4WFQA 2CHEA 4EYKA 3AK4A 1L4UA 4RD3A 4GAEA 3W7VA 3KZ1E 4DQVA 4ZI2A 4E1VA 1JDPA 1KY3A 1LDGA 4A91A 5A6SA 1HL3A 1NV8A 3FKSA 4LRTB 1VI6A 2J32A 4YT8A 2ATEA 5C8YB 3CCFA 5EYPA 1WPGA 4S0XA 1HWYA 3BWCA 4KXWA 3VX4A 4ZXPA 2X8JA 3GFPA 1A9QA 1QGOA 1T4DA 3LUCA 2GXUA 4O63O 2OYRA 1KK2A 2ZDHA 1VJGA 4PS0A 4MQBA 1FX0A 2HGSA 1EBBA 4I14A 3N3BC 4OI2A 4TMZA 3PKZA 5EJEA 1GKLA 1ORHA 5A7HA 3L92A 1E3DA 3QYPA 2C83A 3OU6A 2IX3A 2YJZA 3F4KA 4OLFA 4XR9A 3KKOA 2H2FA 1Q1EA 2HSWA 3Q8XB 4OQFA 3LHSA 2H7CA 3WZMA 5HUHA 4IXMA 2K7FA 2AFIE 2BFFB 3GIDA 4GP9A 4H18A 2J5RA 2ZATA 2OZKA 3BH7A 2C3MA 4J0DA 4GGPA 4EKDA 1HLPA 3ANTA 4ZMSA 1XJ0A 3HDTA 2YVKA 1YHYA 5DOZA 1EWTA 3AJAA 3MLEA 1KE1A 5LFAA 5M7EA 4RK4A 1VE6A 2Q2NA 4MQUA 3RW9A 4CQJA 2EL9A 4MUBA 4ZHQF 3B8HA 4KXVA 4QZVA 5CXUA 2FP3A 4K03A 3VYVA 1N2CE 2CJWA 3C2QA 3IBTA 4LVCA 5AK6A 2BHRA 3KRTA 1QIMA 5KYYB 1PWEA 1FYXA 2GBGA 2JH8A 4JB0A 1NJ8A 1XB2A 2JJ1A 5FV7A 1GG9A 1N77A 4OGKA 1MFPA 1AN9A 2ZB7A 5D8DA 4DFDA 4M76B 1CK4A 5ILQA 5KYUA 2Z3VA 4JEMA 3ZBTA 4BS9A 1N2OA 3VQTA 5EHZA 4J1SA 2XR1A 2IYPA 2QTLA 3GCGA 3T35A 2OKGA 1KHHA 3T3PB 4P6VF 5KTSA 4AJEA 5DHUA 4LDJA 1TMGE 4KXUA 3ANMA 3W3ZB 3DEAA 1KXJA 4X90A 5LP6B 2H51A 3FWKA 2P4UA 2TRSB 1KDYA 4KR6A 3COWA 3MCUA 3IQEA 4BB5A 4DJTA 5KVCA 1D04A 5JNWA 1YU6A 2NO6A 3ACDA 1Q91A 4HUQA 4ZQFA 4DR3B 1IMOA 1ONOA 5JAOA 1V5FA 2FQ1A 5AIAA 1Y7TA 3E03A 3PQ4A 4GPIB 2WY2D 3DFUA 3GYBA 2DECA 3CEAA 3HWSA 4DREA 4WRRA 5SY9A 3PUVA 3ZXXA 1I4DD 1CFJA 3ENNA 1CSEE 4PZZA 3CR3C 3RRFA 2HJ9A 4TKUA 4D3DA 4KGVA 1IZ0A 5D84A 2OV2A 5DIFA 3U13A 2O0MA 1UXIA 3KHTA 4M60A 4RLFA 3SDZA 1DUVG 3UB4A 2WMDA 4LVUA 621PA 4GMGA 1YL6A 4HN2A 4NZNA 2OE2A 4UFPA 5CX4A 2VDNB 4KQXA 1Q0RA 1CQIB 2YJ6A 4X97A 3VJLA 2X41A 1C0PA 3SZMA 1FDSA 1MPXA 4HDKB 2QTAA 3W5AA 3R3XA 5CT6A 1KR2A 4MWBA 4V2UA 3LPCA 4PYNA 3GWGA 3VJRA 3P9PA 5CT8A 2D5LA 2QRNA 4S1PA 2YDXA 5EPUA 4G07A 1O54A 2QMZA 1IWPB 4A0RA 2EZ9A 4NEQA 1SFRA 1M66A 1GQYA 1HLGA 2C7GA 1ZP6A 2AZDA 4EL0A 1KYXA 1PEAA 2GK7A 4PHCA 2O8EA 4D44A 2BI8A 1Q20A 2RBKA 1GFWA 1XTZA 4IIGA 1OHHD 1N5RA 5LCXA 2X5JO 2YHBA 1DS6A 3ON5A 4DY6A 4Q66C 4G56A 2QKYA 1IY9A 1M6YA 1PYDA 3RSSA 1SU6A 4DC0A 1GN8A 1TVKB 3AHJA 5DLDA 4OHMA 5HFAA 4RS4A 4YASA 5DRYA 2JD1A 5AJZA 3O7WA 2D3WA 1MJHA 1QANA 2VEOA 2FJUA 4MDYA 2Z8YM 3BEDA 5AXCA 2HXSA 3IIJA 3B6ZA 3OPYA 1VC2A 4G23A 3RC8A 3UW3A 3CLRC 4F4UA 1E1RD 1IFXA 3U7GA 4D02A 4P22A 1Z6YA 3S29A 4EB8A 4EJMA 3LXUX 3GRUA 4YUVA 4F86A 4TTRA 3AKYA 3EC2A 3R9KA 4ZO6A 2ZUSA 2IP4A 4GM1A 1CDZA 4KV7A 2P1RA 4ES6A 4MA4A 2X0IA 3EEFA 1QIHA 1NRXA 1AGXA 1FMCA 1HLFA 2H7YA 4WZBE 3KTFA 4JP5A 1X19A 4A1FA 1JB1A 1GADO 1R74A 1O03A 3HN7A 1GUDA 3ROTA 5CGQB 3OQHA 2G09A 4JROA 3IDZA 3TBFA 4B31A 1Z5GA 4Z9YA 3DCYA 2PS3A 2ZYHA 3Q7IA 3WAJA 1E18A 5JSZA 3K2IA 5G3ZA 2A57A 2FFJA 4TT3D 4U7HA 4TYQA 4BRSA 3A05A 3VAYA 2HFJA 3SQDA 5A6VA 3LTEA 4N5DA 1X1RA 4LKRA 3WJ7A 3EBPA 2BW0A 3G49A 3O90A 2E5FA 1SVIA 1HSOA 3ESAA 5JCOC 2W2KA 3ORHA 1QF9A 1G6KA 1NI5A 1T5BA 1M9NA 4IIXA 4PSCA 8LDHA 2ACVA 3FTDA 4LV8B 2PMKA 4G2TA 4HH1A 4CU2A 2G6TA 1NOIA 3DEYX 1K4KA 3MTBA 1J8QA 4O4HF 2RK6A 3N86A 4I66A 4MKGA 1S7GA 1PK9A 1VB3A 2MR5A 2QPOA 4NYJR 2E4XA 4REQB 5CR9A 5HQJA 3F3SA 1L4YA 2X19A 3QVVA 4FQ5A 4FILA 1U04A 3DOIA 3G9QA 3R2JA 4IRXA 4P7JA 2Q5JA 4PAMA 4XB6B 2CT8A 2BSQA 3BJRA 3EGIA 1YOBA 3FN4A 5CYPA 5EIAA 5IVHA 3K1JA 4QJIA 5ESRA 1QRAA 2ORED 3STVA 2IT1A 3NG1A 1MVLA 4BJ1A 1YL7A 2ZIEA 3EDOA 3ITNA 4WXEA 3K09C 4A6EA 1GHTA 1WOMA 3I5MA 4IV8A 5BV1A 5K8UA 3LVBA 4BLWA 1E64A 2XCLA 4AN1A 2CE7A 2QSZA 3FGNA 3PLRA 3UG7A 1M8PA 4JMLA 4CLOA 1W7AA 1FTNA 2B2CA 2FX3A 2XOXA 3I1YA 3NVAA 5GQSA 3FUCA 4MYTA 1VLVA 4OV6B 3VGPA 5KYKA 4OOFA 5C4IA 2QDKA 3VR0A 3A26A 5J2TA 4O4HA 3P0JA 1FUEA 3M6LA 4YT5A 5JZBA 2WFLA 2MT9A 4QTUB 4O4HB 4PR0A 4Q7QA 1MQ8B 1Q1BA 3JRXA 4MCIA 2SCUA 3BXEA 1MHTA 1XA3A 3OMWA 5FWYB 3PC8C 1OGYA 4EKIA 4KHZA 5CEFA 3T9CA 5HF9A 3R74A 5AVVA 1IK6A 1P9WA 4NV3A 2PKQO 1GOTA 2PE5A 1P0FA 4RWEA 3OZDA 1OZHA 2N47A 1HYGA 3F7NA 1V47A 3ZBUA 4TRNA 3ZZUA 5A03A 4Q15A 6GPBA 1OJ7A 1ZK3A 5AW2A 1ZWLA 4YJ2F 5F5NA 1QYCA 3RVMA 1CUDA 1OBVA 4BKPA 3ZCQA 4NDZA 3TZQA 3PQEA 4HYEA 3I2IA 3MB8A 4E32A 2C2BA 1G9TA 2ZBQA 4DNPA 1SOAA 1AKTA 3EQ7A 1PZNA 3EG5A 2L82A 3AP1A 2V9ZA 4R7TA 3RT9A 4DCSA 5MFPA 1U9YA 4B4UA 1OI3A 3H4IA 4OXQA 5C51B 2HMVA 4QG7A 3TQHA 1MZVA 4Y9DA 4YP0A 1XNGA 1KHTA 1B8VA 1Y4ZA 2PSFA 2M6RA 4D9HA 3OEYA 5BV2P 3MTGA 2WUEA 2BGKA 3EXFB 4LJKA 3KNZA 3Q9SA 3ZTYA 2FMUA 1DUSA 3F6PA 4A6XA 4FOTA 1G8JA 4LBWA 1AQLA 2XCSB 1TZBA 2I2FA 4FFDA 2QP3A 2WYVA 1RT9A 3WADA 4L78A 1R9GA 4J16A 1NXXA 1Z33A 3GN2A 3GP5A 1GXSB 3KAKA 1L6RA 1TJ3A 3THWB 4JUAA 3M6UA 1Q50A 1RJ9B 1KWKA 1OZAA 3TLBA 2BR5A 2IUYA 3F2VA 3TL3A 4HTAA 2FE1A 1AS3A 4JDUA 2C04A 4K86A 2Z09A 1X38A 1HUQA 1DADA 2ZJOA 5B3KA 5HIKA 1U1CA 5T5QA 5H9WA 1XZFA 4QNMA 4NOMA 1JEJA 5LJIA 3C3WA 2OESA 4EVSA 4L15A 2P9EA 4M89A 5K9ZA 2XMZA 3KS9A 4A2CA 2BZGA 3HSYA 1FLNA 2GVZC 4JC0A 4O2AB 4Y1FA 3QXCA 1M2JA 4B2YA 3EVGA 4CEJA 2BDUA 1JWBB 1JBQA 1TAGA 1CS0A 4PX2A 1C7QA 2FK7A 2NU8B 1O97D 2L2QA 3O4HA 3UMRA 2CSXA 3UNXA 1G291 5E9AA 3RQSA 3M1IA 5KU7A 4DE5A 3SJBA 5B7PA 4CHTA 4E2ZA 3N70A 5HKBA 2O0HA 3QOXA 1IIRA 2Q3EA 4AP6A 3OHMA 5C7OO 1FMJA 2GXAA 3FX2A 1KZ6A 5A9TA 5LL6P 1HT2E 2YVQA 3AUFA 4NF2A 4DC9A 1EDBA 1EHCA 2ASEA 2JD2A 1V71A 2CBXA 3DLIA 4G8CA 1RZRA 1WEKA 1WCYA 2EHJA 4X1KB 3UT6A 2GZ2A 4HATA 5ICFA 1SK9A 5KNCH 4CG1A 3G85A 3DTTA 3DTNA 2XQJA 1G20A 1G7CA 4H6VA 2O3QA 4BLQA 5FP0A 4HDRB 4K46A 1XI2A 1JHOA 3T3MB 3IOYA 2LVBA 1DC6A 2PTHA 3O8LA 3LLCA 4G9BA 1K0UA 2IUUA 4BKOA 4S2EA 4UFOA 4YAOA 4X8HA 1M34E 4A26A 5T7BA 4QOIA 1XLTA 2YXNA 2RH9B 3DMGA 5FB3A 3CPHA 4RKFA 1EEHA 1PT9A 3DJYA 2I99A 1A8PA 4D96A 2BHSA 5AVWA 3O4FA 1GCUA 4QRDA 1HURA 2M9MA 4I3HA 5BOSA 1CF9A 4Y2XA 1EIZA 4PRZA 2GCPA 1G60A 3PPIA 4PINA 3RS2A 4C7MA 2A33A 2PR2A 3MWEB 4HAYA 1PE0A 1IXYA 1HT3A 2GNAA 3FHJA 5BSVA 4WBNF 2HL6A 4P08A 4LYAA 5FRDA 5KNBA 3PHBE 2XCTB 3WTCA 3M1LA 2P9ZA 3A8TA 1QFYA 1S3GA 3EGDA 2V7BA 5AHRA 2OR3A 3J7AC 1BCRB 1E9VA 1FFCA 1GAQA 2Q3LA 4PYQA 5C31A 3V1MA 3O8QB 4LY0A 2BE7A 2JBWA 3C87A 3LQYA 2B35A 3PF9A 2PSEA 1E6WA 4ZJYA 3S27A 3UMGA 3Q6NA 2OCBA 3GF4A 4OL9A 1O6GA 1RLIA 4M7PA 1BFUA 1EB8A 1N2GA 2W2MA 3JQAA 3GLKA 4R1OA 3UUWA 3LHIA 1DWPA 4F1JA 721PA 4MROA 4D0GA 3W3AD 2I65A 1BJKA 4HN4B 1M1YE 2IP1A 4ER0A 1ZMXA 4GLFA 1Y6ZA 2JRLA 4ETWA 1PU2A 3JD1A 3HI6A 2R5WA 1NW6A 2VATA 2XBUA 3UV6A 1W46A 3DXXA 3AIOA 1NVGA 4R4JA 4YLGA 5G1NA 3TSOA 3F71A 4GPBA 3QFTA 4QBFA 4DR1B 4J2OA 2XDWA 2J07A 3G13A 2X0EA 5I9SA 1G7SA 2A5LA 2VHYA 4FX5A 5KHLB 2V4UA 2G5GX 4RADA 3TTVA 4GYJA 1UJ4A 4HAXA 4RMJA 1TIPA 5IN4A 5KWEA 4OHXA 3FUWA 2RHCA 5KNLA 1X9GA 1N4DA 4Z5XA 3R6DA 4ZVRA 1WXQA 1U98A 1UC8A 1MVOA 2IDMA 3L93A 5TVKA 1CLUA 1VYVA 4AY4A 5HFJA 5HJ7A 5JD6A 3MLAA 4O2LA 1BEEA 3FLEA 1JAXA 2PGLA 1NPTO 1I6MA 2X0DA 2YZMA 3CVOA 2H0AA 1L5HB 4LNAA 3AHFA 3PB3A 2H2GA 4DB2A 4R1UA 5ALRA 5G0TA 2IVZA 1FRFS 5F2KA 1EJBA 1HM5A 1P2FA 5DBHX 2ECKA 2FA9A 2QOEA 1ZGBA 1MX1A 3TK1A 3FSGD 3I1JA 3F67A 3GEMA 4RQUA 4EHDA 4GQAA 4PE5B 3VR5H 1RMTA 4KYIB 4UAVA 4G5RA 5LOVF 2PEYA 1GPKA 4J49A 4N8EA 2YWCA 3M5CA 4FTWA 3SVTA 3O6VA 4Q4JB 5C8YA 1EFDN 2VT7A 2Z5VA 1N9GA 3LBIA 4W5RA 3ZDBA 1B8PA 2WG0A 4EUEA 1XT6A 4ZYWA 3KJZA 1YOVB 2JARA 3BZWA 2DHCA 1C9JA 4JUCA 3G0BA 4IQ4A 1HI9A 5CTAA 3UXEA 1KI8A 4HLUC 2ATCA 2JHPA 3NEPX 4GX2A 1X86B 1UXJA 2QV0A 2VCYA 2PBZA 3LY5A 4HTFB 3SEFA 1ZJYA 5I8WA 4H7PA 1BEUB 2NO0A 5AHXA 3U7EB 3VSAA 1A2KC 4LCBA 1PP4A 3O1HB 2AJLI 5JDCC 3STWA 1PUXA 2G8LA 2FZ4A 4NG4A 5E4YA 2DUJA 1J24A 4ENTA 1YZVA 3HRHA 2XY4A 2YYZA 2YV5A 4DV1B 4L8YA 3AR6A 4BO0A 2X4GA 4HB0A 1CUWA 3WWPA 4GSKA 3YASA 1SWWA 2BEUA 5EHXA 4ZICA 2A6PA 1FP7A 1U0BB 5IJ0B 3C6MA 3RSCA 3ZD8A 1EFAA 1G4AE 1E94E 1ZM7A 3PNQA 1EPUA 2DUUA 1GQFA 4EAQA 4R8KA 1J8DA 1IH8A 4F06A 2BEKA 1LSSA 4ZP1A 1E1RA 2IHZA 3NTVA 1CIJA 2X2PA 1PTKA 3X1DA 5NLLA 4NOLA 5B7NA 3C97A 2O05A 3GOQA 5BW8A 4GGOA 1E59A 4L76A 3RS3A 3LC2O 4WHMA 2QR3A 1QE3A 4W63A 1VJCA 3WFZA 5JXHA 1ZGAA 2RHMA 4HQ0A 5AVTA 1NOKA 4WY2A 4Q48A 3ZE1B 1M8FA 1MIHA 1QK4A 2Q1TA 1A04A 2ZI6A 3B9BA 1I3KA 2BTOA 2NPIA 4LQ4A 4LYYA 4MS4A 2BTQB 1AUOA 4E88A 1RWBA 3N05A 2I54A 4XDZA 1G18A 3SHTA 4ZAFA 2I3AA 5HF8A 3INGA 3KOYA 2JNWA 2N1BA 1N8TA 1NXTA 1M8GA 2W2NA 2AQKA 1R3DA 2VYFA 4QYMA 5C5DA 1NQTA 1NNSA 1EVLA 6YASA 4J1NA 4MV5A 1J56A 1QYIA 2ENWA 3EVNA 4GRIA 4HWSA 3TG8A 4MWCA 1X0XA 1HDRA 2YWJA 2A84A 3BDIA 3OOYA 4BNDA 4ZCRA 1KI1A 4K8OA 3DZBA 2Y9PB 3L2OB 1WL8A 1LK5A 4WKNA 1B43A 1YB7A 4J0IA 3C14C 2C7VA 5IM5A 3UATA 3C6XA 3HG7A 3ZKWA 5GZ1A 4G67A 3NS7A 3EVZA 2OCAA 2H5JA 2QL6A 3JYQA 1V1JA 4RKEA 1JH8A 3O92A 1LCIA 1THZA 3P4XA 1K98A 2AUNA 3F5DA 3IMEA 2FCAA 5IK2A 4CL3A 1F8FA 2XUGA 2WP8J 3AY0A 3DKVA 1CUVA 1V96A 1EXNA 3B70A 4H60A 4WKGA 4ZYVA 2QK4A 4J91A 5HM6A 1VE9A 2KSQA 4MA0A 1ENOA 1BD4A 4EVIA 2E9SA 5K99A 3C5VA 4EHNA 4RMHA 4Y9RA 3PITA 2AFRA 3ZK7A 4A10A 3WC4A 5I7FA 2CLKB 2DPHA 2BONA 3NXSA 5IT9A 1Z7WA 1P61B 1MU0A 1FUUA 2ZZKA 4M0UA 4Z8XA 5BWBA 3K94A 4JX8A 1KFKB 3JSAA 4DLKA 4UUOA 4G2NA 3HM2A 4LYJA 5B37A 4X7PA 3QF7A 5C4MA 1OQAA 4E5KA 4G25A 1NULA 2WIKA 4L4SA 5DBFA 3MA0A 1IB0A 2JIZD 2AMFA 2UYHA 3AHHA 4FBLA 1QF7A 4GVXA 3WAGA 3GFBA 3WGNA 2BT4A 2CXSA 5T3UA 2K2WA 2GCOA 4MEAA 1L5LA 1A1SA 4R05A 2I9KA 1KVRA 3Q12A 5FUVA 3ROGA 2XCIA 4J7CA 3R7AA 3RSQA 2H5IA 3NHJA 2RHLA 1Q0UA 4UDOA 5ECGC 5JJIA 2OC9A 4LYHA 3TQCA 2FZVA 5IAOA 1PT7A 3E6AA 2AWOA 4KTTE 4J94A 1DTSA 1N5IA 1O2DA 4KK4A 4Z9AA 2R65A 1HG1A 1I7LA 1VJDA 3MSCA 3B7WA 3PX3A 2F7SA 4LRSB 5CX1A 3UMJA 3PUWA 4PC2A 3W0LB 1K4MA 2RGCA 5CFNA 1SUAA 2EKLA 5JIBA 4KDCA 1FE8A 1DJQA 3JD0A 4ND2A 1IJKA 1P77A 4CF5A 1XDSA 2ZIGA 2NU6A 2YVUA 5GY7A 1PCXA 4F8YA 2PUDA 5FYQA 4RZ3A 4D7AA 1CT9A 2EIHA 5E4TA 4MLDA 5JXIA 1I30A 5C81A 2HLPA 4RM3A 3S8YA 5ARBA 3FDXA 3L49A 2HWUA 5G41A 5EHGA 1JDZA 4NYIQ 2NV2B 2WMYA 1ML3A 1J8VA 1NBHA 3K2EA 3TE7A 5C5EA 5B1DA 2NQ2C 2X22A 2Y68A 1KERA 1UFQA 1VGRA 3MOGA 3LP6A 4XWWA 1PWHA 3H1BA 4XARA 3H9QA 1IJFA 4S24A 3OKFA 4BNNA 3SX4A 2IBTA 2EW8A 2OHFA 1X7YA 2JHAA 4WBNA 1C9YA 2XMDA 2ODAA 3MERA 2R5FA 4NBSA 4OP1A 4RQBA 4U4AA 3W8RA 5I7AA 2IHUA 4HK4A 3I2YX 4I99A 4ZAGA 1SXJD 3ZY3A 4V39A 3A04A 1H69A 3ESRA 4BOYA 4H1TA 4JDPA 1CJMA 4M1YA 3ZE2B 4H7EA 1GPNA 2OHOA 1C3OB 5FBZA 4EOGA 1MP0A 1JIXA 2XZPA 5JD5A 1QQBA 1E9SA 1Z2AA 4FOPA 3ZJVA 4A36A 1C80A 4KEAA 4CUZA 4YP7A 5KNDH 4MVJP 4BYMA 1XCLA 1JWLA 3IHWA 1S6YA 1ZUD1 3MWLA 4H17A 2IXEA 2FWMX 5GAJA 2ZP1A 1EESA 1XRPA 3U7HB 4KK3A 4CUKA 3DC7A 2FOIA 2A30A 1H2EA 4XPIB 1UK7A 3M9LA 1NUHA 3IGFA 1PS0A 3E48A 1BXRA 4TRRA 3TJRA 4BC0A 4HGYA 2V55B 4Q9LA 3UN1A 4CZ2A 4ZVQA 2F3RA 2VJYA 1B15A 1ZIXA 5T67A 1SO8A 3WBKA 4BFVA 3ULKA 1PV2A 2X7JA 3U62A 4DIFA 4DR6B 4FUQA 1P60A 2QLMA 3IUSA 4GOKA 1V5GA 2YWXA 1B93A 2DJIA 3HCDA 5PGMA 4B4KA 3IQHX 4WA7A 4WCDA 4MK4A 1ZH6A 1AIPA 3R0QA 4JVSB 1QC5B 1U7OA 3JZAA 4R83A 3R7WB 3O73A 3F8WA 2NP6A 1PG5A 3VR1A 4HWKA 3F6YA 3GJ0A 2R4QA 4QJBA 1JHDA 4S1TA 2HR1A 2OAQ1 1YJCA 3BREA 1X39A 1XZGA 2ID7A 5IDYA 4US1R 4QL3A 4IMIB 4TRJA 2I7CA 4FFVA 5D3KA 5CAEB 2FPRA 3MMSA 4C07A 1ML4A 5JCJA 5JS8A 1P1BA 3A3KA 3DMPA 3DE5X 4LQDA 1QVVA 3T9BA 1KBOA 1UEJA 2PL1A 2JAQA 1R0WA 2QM0A 4CTOA 2HLDA 1DQPA 1U8CB 2I29A 3DVSX 3GJRA 5EMNA 2AOTB 3A31A 4QUGA 4KO2S 2WJZB 2YYAA 3KPUA 5HMLA 5I9LA 5JRDS 1OH7A 4ILEA 5ESWA 1RIFA 3SF0A 2JCVA 5LOVA 3BH0A 3GZNB 1MGOA 4FKZA 2G9NA 2WWVD 2BGJA 3EQ6A 3KUKA 3OQBA 1W8IA 3BSFA 3D8TA 3OJCA 4LOIA 4B6PA 4BUCA 3HGQA 1FUKA 4O8ZA 5DULA 1WV0A 1IUKA 1E9CA 2P9GA 1KMCA 3STUA 1ACMA 2LXNA 1AKWA 1N2XA 4L7VA 4EA8A 4C1NA 5BOSB 3O94A 2IA5A 1ENYA 4R9NA 3FVTA 1NC3A 4P38A 2LUOA 1D09A 2VDVE 4ZV4A 1YHNA 3DHEA 2XECA 3ZNNA 1IQ0A 5CD1A 3V8NA 1CQWA 2Z2IA 2IEZA 2IHKA 4GI3A 1SBHA 3S2EA 3QW2A 3DVAA 3ACBA 3TPCA 2VF7A 3PUJA 5LKAA 3BGIA 2GVNA 2JEOA 1KQGA 4KQKA 5TXGA 2GQ0A 3AIIA 3L7BA 4ZO7A 5HS6A 3I01A 3T15A 4EA6A 2AVNA 2QL7A 3DM5A 3M6AA 5I8ZA 5C35A 3PPYA 5KVAA 1O4VA 4UUPA 1BOFA 1CPYA 4UOZA 4PCAA 1FFHA 4NFHA 1CKEA 5TC4A 3H8SA 3WLEA 3SR3A 3EY4A 4QEZA 3GLIB 4FIZA 1IK4A 1RADA 2VEDA 4OBXA 4UHHA 1L4GA 4QYIB 4GI1A 3G7NA 3OLWA 4AQDA 5LDDC 5L40A 1MAAA 2IS2A 2EW2A 4Z4FA 2C29D 4RQTA 2XUIA 5FTKA 1DQSA 4ZAVA 4BTLA 3NIGB 3UENA 1NU6A 3JD2A 4ETMA 3RS5A 1G8SA 2IUSA 5G4KB 4W9NA 4ZYLA 4NH4A 3PI7A 2IV3A 5K4HA 1SJ9A 5LC1A 2RGBA 1C3OA 2PRZA 1E60A 2QTNA 1NGSA 3V4FA 3X43A 2PZ8A 2R47A 3HYTA 4P5PA 4Y0NA 1GL9B 3LGXA 1ISMA 4WZZA 1QG0A 1CZNA 1YCDA 3D8UA 3H5OA 1MAWA 3NKVA 4HUJA 3JQGB 4JJIA 4K6GA 4H3KB 5H68A 1UJBA 1VKZA 4JXXA 1DKNA 4Q16A 3CUKA 5F51A 2ZCJA 3D3EA 3BF7A 1DRJA 3EMVA 1GA4A 4F4JA 4M1QA 1BVHA 2SKDA 1CY7A 2D1TA 3VH4A 3IE1A 3SSOA 2R7MA 1KGSA 1MPTA 1ZGJA 1JKMA 3MJTA 5BRNA 2NTYC 4W5OA 2TYSB 2OCLA 3BSSA 4K6OA 3SEQA 4BJ3A 1NJ5A 2ZRQA 2A5FA 5B64A 2IQIA 5LD2B 3LO8A 2EX4A 1TIBA 2X5NA 3MYRA 4PR3A 3RSZA 4PAOA 4B6RA 1FC0A 2A5JA 3QE4A 3BERA 3CEHA 3EQ2A 1L5QA 1BO6A 4LRUA 3V7FA 1TD9A 3NNDA 3BTOA 3IUBA 2QGZA 3PGLA 2OV8A 4G0UA 2POQX 1FMLA 1OV4A 4UTPA 3AM4A 4ZCQA 1SQGA 5JH7F 3K96A 4CL8A 5KPJA 1KZ4A 3FDJA 5IK2D 4RHUA 1QYWA 1VOTA 5K0ZA 5C5CA 2HSJA 4YJHA 3AX6A 2SICE 1AC5A 1NATA 1X0VA 2QB5A 3OJFA 4KNWA 3FPLA 3DL2A 5B7QA 3MJEA 1QIEA 4URWR 3VH1A 2B4AA 3K0AB 1KRHA 4TVOA 1C8LA 5D01A 3EFOA 2VPIA 3S3TA 2WSYB 3IP3A 3PIDA 4QPPA 1WF3A 1U4OA 1NP3A 5A3RA 1NTOA 2JW5A 1KO4A 2QAIA 1IHOA 2GB4A 2VK1A 3B85A 3GK3A 3H0KA 5EE5B 1SA0A 3MINA 1BWRA 2C8KA 3W6NA 2O3RA 1PKEA 3OWOA 1KI4A 2B99A 2VWGA 1P7YA 1Z18A 3EF1A 5INTA 4PPFA 4BVGA 5EIXA 3E05A 3NCHA 3A1WA 1Y6GA 3KEQA 5BO5A 1CR2A 1U5BB 3QOYA 4LPSA 4P36A 2JIOA 4M36A 3ZJTA 1FTQA 1LRLA 4PGGA 3RRZA 3ZZ0A 3MS4A 1U8FO 1V9CA 4N6NA 5C0OE 2H6EA 3DYVA 1KEKA 3FD8A 3R3UA 3WKDA 4AO7A 2GPAA 1Z12A 2JAOA 2WZQA 1E1DA 1W0CA 1T2NA 1XK6A 3LSYA 1R5JA 2NPOA 2ZTHA 2V7UA 3I53A 1ZXBA 2YN2A 1MOQA 2XQKA 2WWRA 4HAZA 4G24A 3CH7A 3T5BA 1GFZA 4DKXA 2HA7A 1OH6A 4WEOA 5THQA 1Q92A 4QOSA 2FK8A 1RKXA 1HL7A 3R0XA 4ZT5A 1JLLA 2P9FA 2WT4A 5CDUA 2RHOA 5J4HA 4YXFA 4FFBA 5AJYA 5DHQA 2HT6A 1QCYA 4KODA 2ACKA 2LKCA 1NUPA 2R8BA 3WHLA 3J81k 1FFEA 2MTBA 1E7WA 3GRRA 2TMDA 2VK4A 4IJQA 3TFQA 2CHVA 5LZ4A 2H1SA 1MW8X 1LW6E 2AZMA 2GZAA 4JU9A 4EGSA 3FDZB 3OX1A 2QZZA 2XWBF 2PLAA 2PMWB 3L46A 4WCVA 5JI3E 1VHQA 4AKGA 3O9VA 4OP3A 2DHDA 4LC0A 4G1CA 4BGVA 2V6GA 1T10A 4QLAA 3K6SA 1ISGA 4KQMA 1INLA 5H81A 1T1GA 4KI0A 3S55A 3X1YA 1I3OA 5LMZA 3WGHA 2EX0A 3P4YA 5JHGB 1MV5A 1CUGA 4QWWA 3QI7A 2PNFA 3OSUA 5ADVA 1JU4A 5AVJA 3U3XA 3DVQX 5FBVB 1YVUA 3FNBA 1JTEA 3PWKA 4DAOA 5F35A 4DCTA 4O4JF 4XB1A 1Z4JA 3Q1LA 4BWGA 4RVFA 1J33A 1JAIA 3KEFA 4A8TA 1K9SA 2VRCD 5FL7D 3WGMA 1C1YA 1BH6A 2NN3C 4F6RA 1Q1QA 1XFAA 3WYNA 1YZTA 2VTKA 3LS2A 4H7FA 4LXTA 1YBVA 5KC8A 3B12A 3NPAA 3GUUA 4CQNA 1OFHA 2FPIB 4DT1A 3GGSA 3UJCA 3PQ8A 2E7ZA 4JP2A 4MI6A 3ELYA 3STXA 3T3EA 4Q01A 3UICA 2Q07A 2GN0A 1WPQA 3E8XA 1H2WA 4X66B 3OX2A 1DAKA 1KFBB 1JKJA 4KH0A 5BNFA 3AZPA 1HYBA 4JJZA 1E0JA 2Z58A 1T9GR 2EFEB 2OUIA 3JPYA 2PBLA 2J9ZB 4JQSA 1QONA 4WUVA 3REQB 5A62A 3QFHA 2Q2OA 3HCBA 1R9NA 2GD2A 3F5FA 5BN5B 1O95D 3D4PA 2CZQA 1WXGA 2C88A 4CM3A 1Z6AA 4FN4A 4P3KA 3WYBA 1UINA 5AW8A 4C0BA 1D7OA 1EUCB 2RKBA 1TT7A 3AUSA 3P4UA 4HQRA 3WV5A 5J3JA 3PIRA 4TWZA 1W2HA 2CXPA 3Q4GA 1JV2B 2W7TA 3H5VA 1GKKA 2GO1A 2VLBA 4C7VA 5EHQA 4L3VA 1W1UA 2Q2QA 3KTAB 1GGJA 4JOQA 3ED1A 2Y0PA 1GNTA 4NCHA 3TWOA 5BMVA 2CXTA 1EVQA 4IGAA 5F7XA 1PL7A 3HLYA 3EQ9A 4L6CA 1KI9A 4MITA 1Y8QA 3RREA 1ZC3A 5FBLB 3RVDA 3KJNA 2YJ3A 3QVTA 1X7GA 2OLEA 3CLSD 5FDFA 1QJCA 3Q3VA 4NBRA 4AVYA 2ANCA 1NY6A 2YXLA 4BAUA 2G36A 3NGLA 1KR5A 1YKGA 3BQMB 4J4TA 4PYOA 1WMAA 4Q4JA 3ANYB 2E2WA 2P69A 2V6JA 3TD9A 1D0SA 5KKNB 2ZKLA 2TSYB 1MO6A 3SFVA 4HEJA 3ZWCA 1UBEA 2OORC 2G0NA 2DBQA 4H4DA 3VSCA 3B1FA 1RYFA 2Y1CA 3FZNA 1NHGA 2FR1A 4JN6B 1XCMA 5KDDA 1AKUA 1WSDA 3ITKA 4IS3A 2G4LA 4W6ZA 3T7RA 2H11A 5IAEA 5JNSA 1EFCA 1FUIA 2PDAA 3QXJA 2NZVG 1LDMA 1AQUA 3HYCA 2ROQA 4IV0A 3AEUA 2L0XA 2V7VA 2CEKA 4RY9A 2ODWA 1PR4A 2WU3A 4DEVA 1V5EA 3F96A 5EXEA 3ZD9A 4ZZ1A 1JH9A 1PYGA 4IMPA 1J9GA 1H1LA 5CFQA 5H16A 4E51A 2V0GA 1BXZA 3HVKA 5LQCA 1GRNA 2J08A 1R37A 2P3SA 3LVRE 4EHHA 5A7GA 2WWGA 1EGQA 4K8RB 1PJRA 2CVOA 2WWYA 2E18A 4E1BA 4P7GA 3TLGB 1TKCA 3WA6A 1NHWA 1HSZA 3DLAA 6NULA 5ALDA 5U9CA 3HADA 4IS2A 3HFSA 4ZDWA 1QMGA 3VTFA 1C0KA 1H2YA 2PJUA 3E1SA 3PF8A 5IAGA 3SE7A 4NARA 4BFSA 2WJ4A 3NYRA 3EOAI 2LE0A 3ETEA 1BROA 4US0R 3WB2A 3HL4A 4HFJA 2J5KA 1YB4A 3DR5A 5I47A 2G4CA 4GOMD 2AN3A 4DR5B 4WBXC 2RGDA 2XZTA 1VE1A 3I6YA 4R51A 5AI5A 1ZS9A 1U0RA 4QG3A 1VDZA 1C0EA 2X6TA 4J6EA 5EXXA 4AK9A 1FY2A 4GC9A 1JQ3A 1U11A 1C7EA 2BM9A 2OLKA 2QP4A 2VYVA 3JR3A 1GCOA 4RIHA 4GVLA 4NG5A 2RARA 2W2LA 5DCUA 3IUMA 1FNMA 4FR2A 3WYAA 3JWIA 2O3JA 2YR0A 4URYR 1UJCA 1MEOA 1ZDMA 3NIDB 3CLTD 4PG7A 2XYPA 3JQFC 4ARCA 4HEA6 1DE0A 2RK4A 3ZTTA 4DRZA 2GTHA 5AW1A 2AFHE 2WSLA 3Q8LA 3LL7A 1KAGA 5CM8B 2DHQA 1HE4A 2PSSA 2BKVA 3UKJA 1C7ZA 3UPDA 1GU7A 4PTZA 1KO8A 1J8FA 1OZ0A 4D9NA 2IXBA 4DGQA 4ZXFA 1UKEA 4LYEA 1RI3A 3A1VA 5C8DA 5T4BA 4KRGA 2HPAA 2QZ9A 3IPRA 2PGJA 1Q6ZA 1X7ZB 1SC1A 3TYXA 3D8NA 2C4WA 2XB8A 4YACA 5LYJA <