2Y93A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
275
structure length
268
Chain Sequence
b'MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Oxidoreductase
total genus 91
structure length 268
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y93A00
2HK8A 1X15A 3VKUA 4B7UA 2OHXA 2YFQA 4CQLB 1K3TA 4XJTA 1NHGA 2YHUA 4FBGA 1XA0A 4ND1A 4BQRA 4LISA 1LI4A 1T24A 4ONEA 3SJ7A 5I8WA 5FF9A 1MA0A 2GD1O 1OC4A 4E2ZA 4EUHA 3ANMA 5C5IA 1EFKA 4AICA 1VM6A 1ENZA 1MXHA 4K6FA 5JAQA 3WWYA 3I23A 5A3JA 2HK9A 4QO7A 4ALMA 4YDRA 1BGVA 4L74A 5EJ2A 5JMPA 1IE3A 3FD8A 1NYTA 3WTBA 1M76A 2B35A 4YYZA 4LSMA 1Y8QA 3U62A 4AJKA 3S2GA 4RPGA 1Z75A 4BS9A 1J0XO 4PZDA 1MUUA 1ZFNA 3GZNB 3GAFA 4BO7A 3VDRA 1V6AA 3EVNA 9LDTA 4ZHSA 3ASVA 3ZV3A 1HZJA 3LYLA 2Y0EA 4AJOA 3UCEA 3NKLA 4JJGA 4R1TA 4UVGA 1UXKA 5JCJA 5IN4A 2ZK7A 5G0WA 2HRBA 4DIBA 1XHLA 1ZK3A 1O89A 4CV0A 4YJHB 4W7IA 5AXDA 2NQTA 3PLNA 1FMCA 3HDHA 2OBNA 2O2SA 3QLJA 1HE4A 4E3ZA 4Y67A 4JROA 3SC4A 3C1AA 3KYCA 5JO0A 3AK4A 1YL5A 2WE8A 2NM0A 4JBHA 5FFFA 1EVYA 3CPSA 4IDCA 1XQ6A 5DBGA 3ONEA 8LDHA 2OP1A 2PTGA 3WIEA 1I01A 4C7JA 1HDOA 2O7SA 2Y1DA 3BMOA 1O9BA 1H6AA 3PZRA 5EMHA 2IYPA 3L6OO 1TB4A 1YL6A 1L1FA 3AY3A 1UZMA 1NPYA 1DJNA 4GH5A 1AHHA 2NQ8A 1XGKA 5AYVA 3IUSA 2Q1UA 4MVJG 4R54A 5THQA 3UFXA 3GDFA 1E3SA 3HN7A 1Z74A 3MJCA 5DOVA 1BDBA 1BXGA 3I9MA 3JQ8A 4CR6A 3FHLA 4EW6A 3UAGA 5G0VA 4DUPA 2J3IA 4QEDA 3ORFA 4J1NA 4CMAA 4ALKA 2GDZA 1LDBA 4BB6A 2HSDA 1YBMA 4R1UA 2WEKA 1NNUA 4MVJM 3S2FA 1G0OA 3FCOA 4XJSA 1Q7BA 3ZHXA 3WOHA 3O8QB 2YQ4A 4UVHA 8ADHA 1Q7GA 5JBIA 4CPDA 3WGYA 3U0BA 4J7UA 1C0KA 4H16A 3H9EO 3HG7A 4QFCA 3W8FA 4N5MA 4DPLA 3GGGA 3P7MA 2CDAA 1KS9A 3CH6A 3ZV6A 1I3NA 3E5MA 1JQBA 3RI3A 3KUXA 3K2EA 5KVQA 4UVIA 4E30A 5KJFA 3SLGA 1EFLA 3AOGA 2AEFA 3EYWA 2HJRA 5ER9A 1LSOA 5C7OO 7MDHA 1CDOA 2QYSA 4HWKA 1NFFA 3OQ6A 1Y8RB 2B5WA 3IP3A 4N7RA 3IAHA 3RWBA 4BNMA 5IAAA 3Q1LA 2ZTUA 3PJDA 3KYDA 3PWZA 4DBVO 4KUEA 4BNYA 3WX0A 1LNQA 2I65A 4L75A 1HWYA 4LSWA 1E7MA 4ZN6A 2A94A 3PLRA 4ND2A 1H5QA 1PGOA 3DBRB 3UH1A 2V6GA 3CMMA 4W6ZA 2J5KA 4D42A 5TS3A 4B79A 3DZGA 3OM9A 2CSUA 4YAIA 1QV6A 4XD2A 4YT4A 2B36A 3QWAA 4W9NA 4ZQGA 1KBZA 1DIBA 2V6FA 3F46A 1LDYA 3PRJA 5CDTA 1E6WA 3OIFA 1BXZA 4C7KA 4A0SA 1D8AA 4FFMA 1Q0HA 5C7LO 4N5NA 3GGOA 3KV3O 5CG2A 3WS7A 3GGPA 3HFGA 2PZLA 4P8RA 1AXEA 2Z5LA 3CZRA 4UULA 4AJJA 2W2LA 1LSJA 4OO3A 4OGWA 1E77A 1QKIA 2PKRA 4FC7A 4QXMA 4KWIA 1DIAA 3PEFA 4BMVA 4TVOA 2QZ9A 1X13A 1I36A 2NUAA 3DZFA 1U7HA 3FF4A 1P33A 1R12A 3PJGA 2GASA 5A03A 4TMFA 3OJOA 1N5DA 4JP2A 2VNSA 4OMUA 1XWFA 3H9JA 2AEMA 4RCVA 1YONA 1ZVMA 4CMCA 4FOOA 3R6DA 4CMGA 4BB5A 1Y9EA 1E1LA 3ICCA 1KERA 2XXBA 3H2ZA 3HDYA 1ZJZA 1HYEA 5L9AA 4JXKA 3MOGA 1I2BA 4GLLA 1NBOA 5CPFA 4DL9A 2HO5A 2QRJA 1CF2O 2JKVA 1LLDA 3CKYA 1P3DA 4PLFA 4CMEC 4YJGB 1KEUA 1NAIA 4II2A 4MP8A 1QMGA 1N9GA 2FR0A 3OIGA 4J1TA 4D45A 1C1DA 3RC2A 4BMNA 4J43A 4PG7A 2WYWA 3GZ4A 1LX6A 1NVGA 4FDAA 4FFRA 2E82A 4YTEA 3WJAA 1YB1A 1SOVA 3I9JA 4R16A 1G1AA 3I4CA 4IY1A 4PLYA 3JD4A 1RWBA 5CEJA 5LCXA 1DRVA 5KWEA 1EE2A 3F47A 3OMLA 3E5RA 4CLOB 1VRWA 4XQGA 1Y9AA 1JTVA 1JAYA 2WD7A 4P38A 3VZPA 4GI2A 2OL4A 1G6KA 1YXMA 5JAMA 1LU9A 1XYGA 1ZIDA 3VKVA 1K2WA 4ZD6A 4DIOA 3VH4A 3NT2A 3ZZNA 1QYXA 2PZJA 1I2ZA 1VE9A 2Y1OA 5TJ9A 3UGKA 1KY4A 5CAEA 3D3WB 4P4NA 1Q7CA 2VYVD 3M6IA 1YQXA 2O7QA 1HDZA 1T2CA 1A7AA 1D4FA 2RIRA 4XR9A 5KKAA 3SVTA 2GRAA 1P77A 4WCFB 3GHYA 2PWZA 1FJHA 3IJPA 1PGQA 4G65A 2VHWA 1J5PA 3I5MA 4GX2A 1K89A 3LT2A 3NJ4A 4B4VA 2NVUA 2OP0A 1B8PA 1I0ZA 1OZAA 2Q45A 3NUGA 4I5DA 2WTBA 1Z6ZA 2UVDA 3GEDA 4RLSA 3JD2A 3P2OA 1K6XA 4F46A 2B37A 3IC5A 4LMPA 1B2LA 4EDFA 1IZ0A 5TX7A 4R3NA 2NACA 4A03A 3BHIA 4YWJA 3RKUA 4DXHA 5IZCC 3JD3A 1DDOA 3ZH2A 2E48A 3V2HA 2V6MA 4DLBA 1E0DA 2LDXA 3ADOA 1E3WB 2YW9A 3I83A 1ZNQO 1LSUA 3F9IA 1QRRA 2JL1A 5BNFA 3VHRA 5AVOA 4ND4A 5BSHA 5CDUA 3TF5A 3RJ9A 1SAYA 4XRRA 2RAFA 1YJ8A 5B4TA 4IDDA 2PH3A 4MVJE 4YJFB 1HTBA 1ISGA 2X23A 2EKLA 2Q1TA 3HDJA 2ZB8A 3AW9A 3DTTA 3ZWBA 5G0UA 2PY6A 2QQ5A 1GTMA 1PJLA 2Y66A 3AY6A 4ZA2A 3GRKA 3RKRA 3V5NA 1L7DA 1UXIA 3ZI0A 4FOSA 4BNUA 2NTNA 4B4OA 1XDWA 3JQFA 4GX0A 3B20A 1PR9A 2XPCA 3BMCA 3VTZA 4HV4A 3QJ5A 1DB3A 4GSKA 3OSUA 1PJ3A 2Y1FA 5IZ4A 1KVQA 2VQ3A 3WGHA 4CQMD 4EJ6A 2QZZA 2UYYA 2QHXA 1P1HA 2GZ3A 4BQPA 5HTOA 1JWAB 2C7GA 3A14A 4S1VA 3IJRA 1VKNA 2P9GA 2PD3A 4NQZA 5IJZA 2DBRA 2PK3A 3EK2A 2ZJ0A 3HFSA 3FBTA 4UREA 3DBHB 2VN8A 1ZCJA 3VOSA 3RJ5A 2D3TA 3M1AA 4HFRA 2DQ4A 5C37A 4YAEA 1X7HA 2DFDA 3FN4A 3AUUA 3L07A 1SB8A 4ND5A 1IPFA 4HUJA 4PN3A 2GNAA 3H5AA 4URFA 2DFVA 3VH1A 1YOVA 3A06A 4ZGWA 1LLCA 4ZRNA 1EE9A 3K73O 4O5OA 3RUFA 2HU2A 3KVOA 1XSEA 1GUFA 1EUZA 2A4KA 4BNWA 1IL0A 3RC1A 3WFIA 4BO5A 1F12A 5L51A 5KJ1A 2F1KA 2NU7A 2ZYAA 4RF5A 1U2DA 1DSSG 3KSUA 4JLWA 2NTVA 4NJMB 2X22A 2C20A 3Q2KA 2HMUA 3WG9A 1AE1A 2EG9A 5L95A 3ICPA 4RF3A 4KDEA 4XGIA 2DVMA 1GCOA 1MC4A 1VPDA 2O4UX 3JQ7B 3LK7A 1HT0A 3LU1A 1RYEA 3W4JA 4RPLA 5BSEA 3RROA 2GN6A 1YH3A 3K6JA 4XIJA 1KEPA 1DXYA 3WTCA 3C85A 3ITDA 3BMNA 4ALLA 1HDXA 2ZCVA 4YRDA 3H65A 3QV1A 4OQZA 3LC2O 3LT4A 3WMWA 4J7CA 2IZ0A 2EF1A 3I3OA 4OM8A 1LLUA 3ZGYA 4E5KA 1ZMOA 2C5EA 4I9UA 1M6HA 5T57A 1E3JA 2P9EA 1ZUD1 1UZLA 1HSZA 2O23A 2PA3A 2JJYA 4BO4A 3UXYA 3VPGA 5TRTA 4AJHA 1HL3A 4A5OA 4D0RA 3A1NA 3ZWCA 1FDVA 1PTJA 1CETA 4FFOA 4MP6A 3U09A 1YB4A 2IODA 3WLFA 2I67A 3FWNA 3WQRA 1SO8A 2PH5A 4JQCA 1PJCA 2OUIA 4Z0HO 4B7CA 1V8BA 1ENPA 2JCYA 2Q99A 4DQUA 5KNLA 2BFMA 4GMFA 4EITA 4U6QA 1I2CA 1I32A 4KMSA 4YA6A 3ULKA 1R4NA 1E3IA 3TDKA 3AJRA 3GF4A 5CDYA 1O0SA 2FZWA 1V3TA 2Z1NA 2RHRA 2IZZA 4K28A 4R41A 4BOYA 3UOGA 2R00C 3WMXA 5CFZA 1XEAA 3Q0EA 4J4HA 3FTNA 4J2OA 2DM6A 1C1XB 3P19A 4HADA 3ENKA 3H4VA 2Q50A 3WBBA 4JBGA 3S55A 1PS9A 5DBIA 3ROMA 4I5GA 3DR3A 3PFFA 4FFNA 4IS3A 3X2FA 5K9ZA 3PWSA 2X5JO 3FNHA 5F21A 3IMFA 4UUMA 2B0JA 1JW9B 1QLJA 3DHEA 1JAXA 2DUUA 5GZ1A 3EGOA 4QT0A 1K6JA 1OMOA 4IQ8A 3IIEA 3RBVA 1QSGA 3NDRA 5TJHA 3JQBC 1Z7EA 2B4RO 2P5YA 4J9UE 3DONA 1T2AA 4OL9A 3GVHA 1WPQA 4FPXA 4PCVA 1E7SA 3I9LA 4WUVA 5IDWA 3DBLB 1QXSA 2XF8A 4O0LA 2VYVA 4CM4B 3FWZA 1BW9A 4L4SA 3VVBA 2GZ2A 4AL4A 1CRWG 2VZ9A 3WJ7A 2FPIA 4BKUA 3D4OA 3E18A 4KTTE 2YFHA 4OKIA 4HKTA 1UDCA 4TROA 4ALJA 4RVSA 4W4TA 3EZYA 3GVIA 3L0DA 1B7GO 1NVTA 3AU9A 4W99A 2RH8A 2P5UA 4F6LA 2EV9A 4WJZA 4E5NA 2DU8A 3TZCA 3NX4A 3P2YA 4XYGA 2HDHA 2VZ8A 1Y81A 5L45A 4B3HA 4B4UA 4FS3A 4EUEA 1B26A 1T2FA 4G5HA 3JQAB 1F17A 3LVFO 1T25A 1NVMB 2ZCUA 3ONFA 3QE3A 3GOHA 3Q6IA 3V1UA 1X0VA 5L53A 4CM8A 1ZZEA 3EAGA 3RIHA 5IXYA 1JKJA 3LT0A 3RD5A 1I3MA 3LT1A 4XGKA 4LMRA 5HRUA 3ONDA 1CQJA 5ADHA 1NWCA 3C1OA 4NIMA 3KRTA 2EJVA 3H9GA 4Z3DA 2FMUA 4NFYA 4R1SA 5TIIA 5H83A 1U3WA 4XYBA 3GEGA 2ZYGA 5THKA 1TI7A 4IM7A 2DAPA 3NTRA 2NTJA 1PZHA 3JQGA 3WYBA 5A5FA 3NJ8A 4D3DA 4OYRA 2G76A 3TSCA 3I52A 4EYEA 1DFIA 3EHEA 2O3RA 2ZYDA 1R0SA 5COAA 2FWMX 4WGGA 2Y68A 4YPOA 1GUZA 1I5RA 2XAAA 3ZHBA 3INGA 5ENVA 2O3SA 5L4NA 5BSGA 3Q11A 4J7XA 5KCZA 4IXWA 3D4NA 3TZKA 3E9MA 4UUNA 5G4LA 4MO2A 4A2CA 2J5RA 2CMDA 3CEAA 4BNJA 3W6UA 4IDEA 4CQMA 3PXXA 3GDOA 4ZQBA 1E1NA 1A9ZA 1UUFA 2Y0DA 4RPKA 4BNHA 3B1KA 1WZIA 4WE3A 1PZFA 3C7CB 4LCEA 3DOCA 2ZTLA 1Q1NA 2JD2A 3DAPA 3MOIA 2YHIA 3U4DA 3VH3A 4DLLA 2O3QA 2HMWA 5I9MA 3E48A 3AM3A 4L73A 4U6SA 3A9WA 4FGSA 3RC7A 4E32A 4RDHA 1ZXLA 2AE2A 4XQEA 5DF1A 1PJBA 1IULA 2NADA 4KDFA 4MINA 4PLWA 4R3WA 4DBZA 4HY3A 3KO8A 2Z95A 4QTZA 4XZ3A 5C3MA 4FD3A 5JE8A 2HKIA 2HMTA 4PG4A 3PYMA 4OXKA 1FDUA 1HDGO 2PD6A 3SLKA 2W2KA 1XELA 2EEZA 1BMDA 2FPPA 3JSAA 5DCWA 2VUSA 2QIOA 3IQDB 3D3EA 4D3SA 1ZK2A 3BMOB 5LC1A 2ZTMA 5DNAA 1UZNA 3KLPX 2C0CA 3UW3A 1MV8A 1C3VA 1UH5A 5CDGA 5A9SB 2WMDA 1M75A 3ZWPA 4B3JA 3PI7A 5L7YA 2J6IA 3ZNOA 3W4IA 3UUWA 4KWHA 3MJTA 3KHUA 1DPGA 4D0SA 3IL2A 4E5YA 5JPIA 1W73A 4DQXA 1BXGB 2HCTA 4GKBA 4HNHA 4MVJI 4WCDA 3UHAA 3JQ8B 3L4BC 1DC5A 5ES3A 4BO1A 5JW6A 4P4LA 1ZXBA 2BI8A 4XKJA 5KIAA 3GC6A 3KXDA 1NQTA 4CMJA 4DQVA 3DAGA 1LLQA 1LA2A 1EVZA 3GZNA 4YVFA 2A9FA 4FJ2A 3MWDB 3Q3CA 2AE1A 2B4QA 3JYPA 1LDMA 1R0KA 2VZ0A 3S2IA 1RPNA 5I9NA 2DTEA 3F4LA 4Y8VA 3H2SA 3EW7A 3RU7A 1GEEA 1LDGA 2D1YA 4DC0A 1DJQA 2FHSA 4E31A 4Q3EA 4NBVA 3CSDA 1MFZA 1F14A 1U4OA 3I6IA 2WSBA 1GL3A 3PIIA 2JFGA 4XDZA 4EEZA 3U5TA 2DBZA 1ZSNA 1BXKA 2EIHA 5JSFA 2NNLD 1PL8A 2IXBA 4ND3A 1QR6A 3WFJA 1ZH8A 1DHRA 4XRGA 1A72A 3KYDB 4RDIA 1W0CA 1Q2XA 2I3AA 2BF7A 4AJPA 2E49A 1X7GA 4MJLA 3MTGA 4EI2A 3RCBA 1MGOA 4TVBA 1W4ZA 3M1LA 3F4BA 3DZKA 1B3RA 3DC2A 3NTQA 4I8XA 1NQOA 1PIWA 1U4SA 4CL8A 5JCXA 1HDRA 2H9IA 1YKFA 1IZ9A 2GN9A 1IHXA 3HSKA 4O63O 4WK6A 4TZKA 1IY8A 1M6WA 2BFOA 1A71A 2FSSA 2X0JA 1SNYA 2HJSA 3WIDA 4AJ4A 3QA9A 5ITVA 2P91A 4PRKA 1LRKA 5IG2A 5KTKA 1K5HA 5GY7A 2OOSA 3QW2A 3GEMA 3TQHA 1BHSA 1X7DA 4Q3NA 3W6ZA 5L3ZA 5JDIA 5I9LA 3V1TC 4PGFA 2VTDA 4TSKA 1NQAO 3A28A 2JAPA 2I3GA 3BIOA 1FDSA 4GX5A 2HQ1A 1KEVA 2RCYA 2X7HA 4CM5A 4IQ0A 1LQUA 4E2XA 1SC6A 2GGSA 4FJ1A 4XQCA 1PJ2A 3L6EA 3HADA 5AQ1A 1DO8A 3PK0A 1OFGA 4YRBA 5BR7A 4NR0A 1NXQA 4GVLA 3S1LA 1PL6A 1X0XA 4OSPA 1ZK4A 2ZKLA 5BSFA 2HMVA 4IPTA 3RBZA 5A04A 4A10A 1LXCA 2PKQO 4XA8A 3G49A 1LC0A 1Y8RA 1OOEA 4XCVA 4FSHA 2UDPA 3DO5A 4R69A 1H6BA 4U8GA 1NPTO 3PTZA 2OXIA 3AUSA 2H63A 1V3VA 1E6EA 4IIUA 2PZMA 1U2GA 4F45A 3ZWWA 5MGBA 3CXRA 3M2TA 3KM0A 5JDCC 1H9BA 1E6UA 2VUTA 3ZHZA 1BTOA 1D1TA 1LBEA 2PGLA 4XQ9A 1N9GB 4WASA 2HMSA 5TT1A 4ALIA 3QVSA 3DBRA 1LC3A 1YBAA 3BTSA 1KVUA 3FSRA 3JQ9C 3CZMA 1B8UA 2G1UA 1HRDA 2SCUA 1QG6A 4UVDA 1E1MA 3DL2A 2ET6A 4E21A 3MCVA 4BHTA 4YAGA 3COSA 5A9TA 1E7WA 2I99A 3FNEA 3BMQB 1DFGA 3PFWO 3JV7A 5T6BA 3UVEA 2BLLA 3NT4A 4NU6A 5L4LA 4Q3CA 4I1IA 2PD4A 2Q3EA 4PLGA 5EPOA 3JQDA 1LTHR 1QP8A 1DLJA 1JLLA 3GH3A 3PHIA 4GGOA 3GUCA 4BMSA 4E0BA 2DLDA 1X14A 4H3VA 4NFSA 4O6VA 3D0OA 4HP8A 1NWHA 1WVGA 5TQVA 1U5CA 3ROPA 5KVCA 3X2EA 3TFOA 4LRTB 2NU8A 1F8FA 1YO6A 1QYVA 4JN6B 3V2UA 3DHYA 2C2XA 3F5QA 3WGZA 5JMWA 3IKTA 2D4AA 3U4HA 4W7HA 3OHSX 4BKPA 3B70A 1H6CA 5TT0A 4QO8A 2BRUA 4CUJA 6LDHA 2EERA 4QSMA 3PVZA 1PQWA 2C5AA 4FJ0A 4OXYA 1B14A 1MP0A 3KSZO 5FEUA 4KTVE 3GY0A 5DP2A 2NVUB 3T4XA 4FGWA 1KOLA 5ICSA 2E6UX 2ZB7A 2GCGA 5JAIA 4RO0A 1CJCA 5U1PA 1ZMTA 5U4QA 1M66A 3NT5A 1YL7A 2GF2A 1WDKA 2J3KA 2UUPA 3PYXA 5K6AA 4YT8A 2DC1A 2ILTA 4E6PA 1DC4A 2Y99A 1GD1O 2EHDA 4BL5A 4FIZA 4JX8A 3UKOA 4M87A 3KTDA 3BYZA 3ZU4A 1GYRA 4LCJA 2BI7A 5COQA 4MVJF 3AOEA 4OIMA 2I9PA 5HS6A 4RF4A 5BNIA 1E92A 1E3LA 4LK3A 4WNIA 2C29D 3RFVA 1EVIA 3AM5A 1Z7BA 2DPHA 4K9DA 2GO1A 1ADBA 2B83A 1PJ4A 1P31A 3OQ1A 5I7FA 4JGBA 4J9VA 4CM1A 1HE5A 2WD8A 4R01A 3ZCXA 4I5EA 4CLHA 6ADHA 1J4AA 5DDIP 3OBBA 3O26A 3WGTA 3KOUA 4LGVA 4IGFA 4LRSB 5B4UA 5TNXA 4DA9A 2OO5A 3BMCB 4DMMA 4TQGA 4WCFC 1JN0A 4BO8A 1XU9A 1UAGA 4R5MA 3N58A 2OBYA 3F6YA 4I9HA 3MJEA 4NFHA 4X54A 1RKXA 4RV9A 4CM3A 2YV2A 4OAQA 1KC3A 2BELA 3H3FA 3OETA 3RSHA 4Q3AA 3IOYA 1A9YA 4W82A 1N1EA 2CDCA 1YRLA 1PGJA 3K2BA 1EMDA 3MWEB 2EW2A 3RUCA 3U4CA 1XR3A 4CM7A 3JD1A 4KOAA 3KBOA 4AFNA 1LDEA 1HKUA 1R15A 2B69A 3G1UA 4Z0TA 3AY7A 5AOVA 5ICMA 3HB5X 2Y05A 1F8GA 3GVCA 3DWFA 4BO3A 3WSVA 4K26A 4LW8A 2NVWA 1T26A 3L6DA 2QRKA 4JIGA 4RVDA 5T64A 3SEFA 4CLRA 2CVQA 2TMDA 3GRPA 4KQWA 2DTDA 1FDWA 5KJEA 1DAPA 3NAQA 4CMIA 1U7TA 3DZHA 1PSDA 1B16A 1IUKA 3JQFC 3PPIA 3DOOA 1YOVB 5A02A 1QORA 2Y1EA 4J4BA 2YUTA 3FPCA 4IDAA 2BKAA 3I6QA 1OAAA 1BVRA 1X1EA 2P9CA 4M54A 2PKQP 1D7OA 1Y5MA 4L4RA 5G4KA 4M49A 5JLAA 3ETDA 2O3UA 4Z6KA 1GYQA 1ADGA 4YT5A 2J3HA 2WYVA 3GR6A 4J0FA 4WEOA 4FFPA 3OJEA 3RFXA 4F6CA 1YE3A 3SX2A 5KJ6A 2CZCA 1CWUA 3LQFA 3ETGA 1U8XX 2Q2QA 4ID9A 3QHAA 3TJRA 1E5LA 2A92A 2X58A 5LDHA 2BHLA 3O38A 2IEDA 2ZQZA 2RH4A 2V7PA 5F1PA 1A4IA 2FY8A 2XOXA 3AUAA 1V3UA 1ZO8A 3PWKA 4GWGA 5BT9A 1GYPA 5FYDA 1ZW1A 3DMTA 4AVYA 3OP4A 4Q9NA 4OHUA 1MG0A 3STHA 4PRLA 1JVSA 1UP7A 1JKIA 3VPHA 4R9SA 1HXHA 4NK4A 1ID1A 3M2PA 3BTVA 4YB8A 1AUPA 1PQPA 2YY7A 3H9UA 4B8ZA 4KP7A 1H6DA 5EIOA 3INTA 3GLQA 4MDHA 1ISIA 4LVCA 1QLHA 2YV3A 4A26A 4PIVA 3K9QO 2W98A 4L0QA 4QECA 2X9NA 3D64A 1VLLA 1U8FO 1GR0A 1P1JA 1UP4A 2Q1WA 3NDIA 3GDGA 1I3LA 4OKNA 4BNVA 3JYNA 3F5SA 4BKOA 1DIHA 3W8EA 2VHYA 1HYHA 2PV7A 3MJVA 2C7VA 1DOHA 1X1TA 4XEHA 3ZWXA 4BUCA 3E8XA 4L76A 3G0OA 2GR9A 2VRCA 1NASA 3TOXA 4YR9A 1XKQA 1B15A 1T1RA 1R4MA 2D5AA 2O2YA 1C14A 1TA4A 2W4QA 5ER6A 1MLDA 4RQUA 4XIYA 4J90A 3ZNNA 1PS0A 1Y7TA 3B1JA 4NJMA 4XYEA 2Y93A 1GV1A 3WR5A 3H5RA 3ZU3A 1NFRA 1ISMA 3GVXA 1UDBA 4Q3BA 4CR8A 1DHTA 5T8KC 3DHNA 3E6AA 1LRJA 4CV2A 3HB4X 1E7YA 1ZK0A 1TT7A 1DBVO 1DLIA 4YACA 4BV9A 1B0AA 2QYTA 4RL6A 1A7KA 2CNBA 4BKQA 4YXFA 4WLEA 1ONNA 3BA1A 4XWYA 2X9VA 3JYQA 4J91A 4CM9A 3VPSA 1IOLA 2C54A 4YJDA 2AEJA 4I5FA 1OC2A 3GN2A 4CMBA 2PGDA 3GMSA 3HZZA 5JO9A 4B4WA 4JP3A 4CMHA 3ZWMA 2IZ1A 3PHGA 1NAHA 4PLVA 4DREA 3N7UA 5EESA 1F0YA 2A35A 3W8DA 5FWNA 1R16A 1DIRA 2VCYA 1EQUA 1JKFA 4TRNA 4GSLA 5I7SA 5T67A 3PGXA 2VWPA 1R0LA 2NVBA 1N92A 2VOEA 1VL0A 1TT5B 1UAYA 1PWZA 3QY9A 5HA5A 4BNNA 1D3AA 2FSVA 1P0FA 2VNAA 4BO9A 4DVJA 3HUDA 1ZBQA 4IIVA 3FI9A 3PP8A 1PEDA 3AWDA 4FB5A 4J49A 5F5LA 4M8SA 1DC3A 3CE6A 3JQCA 3QWFA 3FPLA 5CP8A 1H93A 4FCCA 4S3MA 2PLAA 3L4SO 1HLDA 4E5PA 1ENYA 3GVPA 4ZQFA 5B4VA 2I5PO 3QQPA 1G0NA 1RM5A 3VAZA 1SEPA 4CUKA 4D7AA 4EBFA 2AQKA 3AM4A 3OH8A 1WAMA 3DB2A 4JCOA 4N5LA 4OOEA 4CLEA 1ML3A 2JHFA 5I7VA 2I66A 3NGXA 3RUAA 5GMOA 3RUEA 2G82A 3WBFA 1DRWA 1ISJA 4CM8B 4HFNA 2AXQA 5U9CA 4O1MA 4U0JA 4BO6A 3UN1A 4RVUA 4MIOA 4R1NA 3WQSB 1E5QA 2IRWA 4YBZA 1HLPA 2GN4A 3IP1A 4RQTA 4Z9FA 2O48X 1GADO 3ZU2A 3R3JA 3HJAA 1GQQA 2YYYA 2YZ7A 2RBEA 4YAJA 4BGIA 1GPDG 1ZEMA 2DT5A 3LLVA 4UEJA 3JQGB 3ASUA 1BVUA 3D7LA 3JYLA 4NNJA 1PGPA 2Q2WA 2V6BA 3L77A 2QW8A 3F1LA 2NU9A 2W8ZA 1ZSVA 4G81A 3DBVO 1AGNA 1YJQA 2H5LA 1BWSA 4CLXA 1ISHA 1YQGA 3NDJA 5B12A 1QV7A 2WDZA 2VT2A 4ESOA 3H3JA 1GU7A 3HDQA 4TWRA 5LDGA 5HWSA 3RUHA 2AG8A 3DBLA 3BZUA 4EEXA 1NTOA 4HFMA 4CM4A 1JA9A 3BHMA 3JCZA 4J4TA 4CQMB 4II3A 2IDZA 3KZVA 3PHHA 1SZJG 1I33A 1XLTA 3GFGA 2BFPA 3QVWA 3L9XA 5EINA 4IGEA 4CMKA 3GUYA 4ZVVA 5GZ3A 5JC8A 3ADPA 4BO2A 1VKOA 4IJUA 4RPJA 4Q3DA 3K8ZA 1WMBA 4XR4A 2O50A 5C7IO 3LF1A 3QWIA 1V9LA 5A5EA 2QX7A 2ZQYA 4RGBA 2YHIB 2UAGA 2CFCA 3VPXA 1GFSA 3ZV5A 2OZPA 2Y0CA 2IXAA 5EQDA 4CLDA 2NLOA 3G17A 5ENDA 2EGHA 1YGYA 1E3EA 1Y8QB 3HHPA 1SMKA 3LC1O 2Q4EA 1ISFA 2C59A 5IDYA 3AU8A 4NBWA 1PU2A 1FDTA 1ADCA 1JWBB 3GNSA 4WECA 1EK5A 4DWVA 2VUUA 1WNTA 3WGQA 2X6TA 3OQBA 3B1FA 4KZPA 3AI2A 1M2WA 2I76A 1SEVA 3IUPA 3PYLA 1QYCA 2W2KB 3VVCA 3H8VA 5FI5A 3Q2IA 3ZWAA 4OSOA 3EVTA 4P22A 3WXBA 5EQFA 4RVFA 4PZEA 3GMDA 2Q49A 3ZWVA 4P4GA 3LDHA 1PWXA 2GN8A 4YT2A 3DEYX 4MKZA 1E7RA 1RM4A 1T4DA 3GAZA 4ZJUA 3BTOA 3ZDFA 1T1SA 1IHYA 2OGUA 1CERA 4IQGA 5JXWA 2ZB4A 3KYCB 4GX1A 1W8DA 4BNXA 3C3XA 1DC6A 4FQ8A 1O5IA 3QWBA 2JCVA 1GV0A 1P1IA 1FF9A 5BQFA 1VJ0A 2AQIA 2R6JA 5KVSA 4J3FA 1HDCA 3I4FA 1JU9A 4H7PA 5A1TA 3VZQA 1NX6A 3ABIA 1WWKA 3V8BA 4RLHA 4RJTA 3KLMX 4J0EA 3PQDA 3AI3A 3D1LA 2D5CA 2X0RA 1N7GA 4EGFA 3VPFA 4CQLA 2E37A 2AG5A 3LC7O 3T7EA 1GEGA 2POQX 5F3RA 4DYVA 1LDNA 4EJ0A 3AFMA 1CEQA 3WYCA 4YQZA 3GG2A 2C82A 1NPDA 1YDEA 2GERA 4BGEA 3P5SA 3ZHYA 5CEEA 3ON5A 2H1SA 9LDBA 4XB1A 4XYLA 1U3UA 1PJSA 4BNFA 2Q1SA 3VTFA 3TZHA 3ST7A 3U3XA 4TRJA 3E9QA 3C7DB 3L4BA 5T5QA 4M89A 4B3IA 3GHHA 1UR5A 2J8ZA 3OICA 4Z0PA 1U28A 3OEWA 2NU6A 2OFPA 4XX0A 3SC6A 4BNTA 2P68A 4JBIA 4A27A 5AXCA 1GQYA 1V0JA 4XYMA 3RQSA 1T2DA 1VL8A 4DIFA 3I9KA 1ZJYA 4UUOA 3OIDA 1YBVA 3S8MA 1U3VA 4TRRA 4YJHA 3ZWOA 4WPGA 3TWOA 4IDGA 3EC7A 1LRLA 2V65A 3ITKA 4OXNA 4RVGA 5A9SA 4M1QA 5JFOA 3ZW9A 3ETEA 3U9LA 4IDBA 3Q9NA 3MTJA 4MIEA 2VT3A 3ROQA 2HUNA 3MZ0A 3TRIA 3WGOA 3RBXA 5EERA 3GG9A 1TXGA 1P1RA 4YAKA 1RJWA 4WEQA 1KC1A 4BGVA 5JNLA 5COBA 4YQYA 3O4RA 1UDAA 2W90A 3QSGA 4FC6A 5IF3A 3GT0A 5I8ZA 3CMCO 1SOWA 2WWRA 4INAA 1U9JA 4MIYA 1GY8A 1P44A 1NP3A 2JD0A 1PQUA 1LUAA 3WLEA 3C1TA 1GZ6A 1MC5A 2Q4BA 1PGNA 3I9NA 4D41A 3DFUA 5IXSA 1DAOA 1T4BA 1GDHA 4NBTA 3GK3A 1EQ2A 2Y1CA 4DMLA 3E03A 5JY1A 1VSVA 4QFDA 1WXDA 1IYZA 4TKMA 3RUDA 4GMGA 3H9QA 4Z3KA 5DOZA 2WE7A 1UXGA 1U5AA 3L9WA 3ZNQA 3DQPA 5F1KA 1JDJA 1LSSA 4Y6PA 4K1LA 4MVJH 1YS4A 5A4DA 2BH9A 4NDNE 1Z73A 3O8QA 2P2SA 4GAEA 1EUDA 3E82A 4M55A 2BGLA 3WSWA 1E7QA 4ZRMA 5JDIC 3KEQA 3RC9A 1PS8A 2X9GA 1EBFA 4DTIA 4CJXA 4TKLA 3SXPA 3OF2A 3RUIA 3JQ6A 2YDXA 4W9NC 4E2YA 3IS3A 3V2GA 1KIFA 1OBFO 4A73A 4BO0A 4DLAA 1KYQA 2VRCD 2EKQA 1YDWA 1KEWA 2CD9A 3FR7A 1K6IA 1SBYA 4D46A 1B3BA 5EN4A 2PZKA 4R68A 2VTEA 2B5VA 1TLTA 3Q9UA 2EGGA 1GZ4A 2FPGA 2F00A 1XCBA 2BGMA 1PX0A 3GPDG 3JQEA 4OOFA 2GUGA 2EWMA 3FRJA 2AQ8A 5A06A 2EXXA 4BNGA 4TZTA 4BNIA 4WLFA 3AUTA 2O3JA 1WW8A 3PGJA 4OJNA 2X1HA 4EZBA 4IMRA 1C1DB 2X5OA 2JHGA 1MFPA 3PQFA 3NTOA 4I08A 5JDCA 4JNKA 5DP1A 4CODB 3C8MA 2X8LA 4JK3A 4AJLA 2CUKA 3VC7A 4CM9D 4J1QA 3PHLA 1Z45A 3JQ9A 4PZCA 5L7WA 2G5CA 1Z82A 2AQHA 3GPIA 4FR5A 2B4TO 2WD7B 1KY5A 2ZB3A 2C07A 3EUWA 4LVUA 1ZK1A 1EDZA 1YWGO 3OFSA 4XDYA 4NBRA 3SJUA 4XGNA 2X4GA 1ZSYA 1EDOA 3HQ4O 2Q46A 4D43A 2FZEA 2CDBA 1MX3A 4GVXA 4CMEA 2AA3A 1PJQA 1RYDA 3ZN2A 3GA0A 4AJ1A 2XXJA 3PJFA 3TPCA 3HNPA 2CVZA 3C7AA 3VDQA 3EZLA 1H0KA 5F1OA 2D8AA 2VHVA 2J3JA 2LDBA 1HDYA 1N2SA 3WDSA 4QX6A 1U1IA 3ZU5A 5J23A 4HBGA 5TSDA 1TVEA 2Y1GA 3GFBA 1GUYA 3K96A 7ADHA 3W4KA 1FK8A 4Y9DA 2Y67A 4WLVA 4BNKA 3BMQA 4J2HA 5ILGA 4CM6A 1DRUA 4ZQHA 4MVJA 1ADFA 3TN7A 4DYDA 2NV6A 1HE3A 5FI3A 4WKGA 4J6FA 3RFTA 5CDSA 1Q0LA 4YJGA 4BKRA 3WICA 4GL4A 4Z9YA 4ZU3A 5ITWA 4IS2A 1VC2A 4BIIA 1DFHA 5K6AC 3MJSA 3DFZA 3OA2A 5CPBA 5ILOA 1S6YA 3FR8A 4IXTA 1EVJA 4ITUA 4CR7A 1H9AA 1WP4A 2BFAA 3O03A 3RASA 4CLOA 3S2EA 2JFFA 4NH4A 3K31A 3VH2A 4YRAA 2NSDA 3AOEC 4Y98A 1HEUA 1P74A 2JFHA 1VJ1A 2AMFA 2VWGA 1N7HA 4DPMA 3OECA 2BGKA 2YQ5A 3BAZA 4MVJP 5IFLA 1CQIA 4HX5A 2VWHA 4OH1A 4K6CA 4GQAA 3PQEA 1I30A 5HBRA 3RAJA 4E33A 3D3WA 3GQVA 3K30A 1ARZA 3ANNA 3NYWA 5DN9A 5IZCA 4UUPA 1WZEA 1IB6A 4PLCA 2PGJA 4PLZA 1L7EA 4G2NA 1PR3A 3CINA 1P1FA 1Y5RA 5TF4A 1XQ1A 1PL7A 4CLRB 5BNTA 5I7EA 4WOJA 2HAEA 4RZHA 4IMPA 5L4SA 4CMIB 3WB9A 1DIGA 2I6TA 3KYBA 4NPCA 4WCFA 2ZTVA 3TL3A 1XIVA 4UEOA 5KOIA 3LLSA 1PZEA 3H6KA 2BD0A 2D2IA 4MP3A 1ONPA 1VI2A 1XG5A 4IDFA 4LN1A 4PG6A 1ENOA 4PG8A 4L4XA 1SCUA 2PFGA 3LZ6A 4GPD1 3VZSA 3FNGA 3D5QA 2ZJ1A 5G4KB 3JQAD 4CV3A 1KETA 3FBGA 4KUGA 4BVAA 1CYDA 2VYND 2G17A 3WNVA 4I9NA 2JCXA 1UXJA 3TL2A 3WGIA 1NHWA 4J16A 5A05A 4IZIA 3TZ6A 1I24A 3EDMA 2AW5A 3BHJA 3I1JA 1A4UA 1YB5A 1C0IA 1VSUA 2HK7A 3DOJA 4IJVA 3ZWYA 1E3WA 3KB6A 4XB2A 5A3VA 1GAEO 2FOIA 4PLTA 1H2BA 1BSVA 4BV8A 4IBOA 4OQYA 3AFNA 3A4VA 2VWQA 2DTXA 3JD0A 4YJFA 1O95A 3K92A 3R1IA 3UCFA 3CIFA 2R2GA 4PLPA 4ALNA 1I8TA 1XU7A 4BNZA 4PVCA 5F5NA 4AJ2A 5DBFA 4NI5A 5H82A 1HETA 2FN7A 5KVVA 4PVDA 3IKVA 3WGGA 3AI1A 3TNLA 5JYEA 1GQ2A 2X5KO 3O9ZA 5TGDA 1VL6A 3LF2A 3ROKA 3K5PA 3QWHA 2NWQA 3MEQA 3E1KA 1P0CA 5IDQA 4HFJA 4IZHA 3BMNB 3GN1A 2QG4A 3QVOA 4FW8A 3PZBA 4L9RA 1WDLA 4E5MA 3DMYA 1AHIA 4D79A 4R4JA 2O4CA 1R66A 5IDXA 4NBUA 4PLHA 3ZNPA 4YCAA 3DXFA 5KJCA 5IN5A 5JYDA 2EP7A 3CUKA 5DCYA 5B1YA 1F06A 3WWZA 2EP5A 3DMTC 5L7TA 1J6UA 5DZSA 3NGLA 1R4MB 4CL3A 5DCUA 3DBHA 2P4HX 5AXBA 1AN9A 3DTYA 4GGPA 2CF5A 4R51A 3RVDA 1ONOA 2RHCA 2JAHA 1AXGA 3B6ZA 5JCJD 2D59A 4N18A 3G3EA 4TRMA 3ZW8A 1QYWA 2AHRA 4EUFA 3HWRA 2UUOA 1GCUA 1UJMA 2IYOA 2PNFA 1KVRA 3ENNA 4NK5A 1R4NB 1E1KA 1P9LA 4GKVA 1J49A 3PDUA 1EK6A 4FFLA 3WNQA 3JYOA 3NRCA 3QP9A 4DC1A 1H2HA 4Q39A 4D3FA 1I3KA 4ROSA 3DZIA 1K0UA 1CIVA 3BTUA 1SPXA 4R5HA 1IPEA 3MJ4A 4MPDA 3U49A 4RVHA 5JY6A 1P45A 1BRMA 3TFQA 5CG1A 2YDYA 1N1GA 4Z9XA 1HSOA 4RF2A 1NM5A 1O6ZA 2DUWA 1A5ZA 4EJMA 4QQRA 3VZRA 3JQ7A 4E4YA 5JAZA 2IE0A 2WM3A 3ZV4A 2DPGA 5TC4A 4AG3A 1V35A 5HM8A 3ZWNA 1WLYA 4IJKA 5T8KA 1YQDA 3D5TA 1NR1A 3IDSA 4FN4A 2EW8A 3T7CA 3INRA 5HS4A 4AJIA 1VJTA 5EL0A 4DPKA 5A9RA 5MDHA 4NU5A 4IJWA 4R9RA 3CTMA 3I9OA 4AJEA 4QUKA 5L40A 2R00A 4WLNA 3NV9A 4O59O 2GZ1A 4Y6RA 1TEHA 1FXSA 3H5NA 2WJPA 3V1YA 1BW9B 4WLUA 2TMGA 2UV8A 5CEFA 2GYYA 3UCXA 1GZ3A 1M67A 3ANLA 1U3TA 3F3SA 2QRLA 3RU9A 3F1KA 1HYGA 2GLXA 3QRWA 4MKRA 4NHEA 1C0LA 1R37A 2C2YA 1EBUA 2DKNA 1D1SA 3QVTA 1Q0QA 2VHZA 1BDMA 1N8KA 1ULSA 3T4EA 3U4IA 3JQBA 3TOZA 4WNCA 4F3YA 5TLSA 4H15A 2FRDA 2HRZA 4NG5A 4RORA 3KETA 4CV1A 1WMAA 3R0IA 2X86A 3E9NA 3UICA 1MG5A 4NZ9A 2JD1A 1UP6A 1KVTA 3FTPA 4NJOA 1O8CA 1DEHA 2YJZA 4PFJA 3UF0A 1A27A 4E2WA 5JS6A 3SBOA 1H94A 2ZATA 3OJ0A 1YVEI 1T2EA 4MKXA 1EUCA 1B8VA 1JVBA 1C1XA 3JTMA 4C4OA 3G1TA 5G0TA 1GPJA 3GNQA 3WQQA 4B8WA 2G0TA 1KVSA 3PHJA 4GBJA 3W1VA 3DDNA 4E12A 2VRBA 4DRYA 1MXFA 4ZQEA 1MB4A 1NQ5A 5GZ6A 3HE3A 2E4AA 4UAGA 2VOJA 3LSYA 1O94A 4KUHA 1TT5A 4DGSA 4WOKA 4JJFA 5G0SA 4U7WA 3GNTA 1W6UA 1ORRA 4UVEA 4U5QA 4ZICA 4PG5A 3EMKA 3H7AA 3N74A 2WYUA 2Q2VA 4KQXA 3C24A 2BMAA 3QVXA 4M86A 5B37A 1R6DA 2W2LD 2GSDA 1UXHA 5DT9A 2DBQA 4CUZA 4E13A 5K0ZA 3PJEA 1QYDA 4U0KA 5JC1A 1NR7A 3QIVA 1LEHA 2CF6A 3FNFA 2OMEA 2P4QA 2X0NA 1S7CA 1SB9A 2H6EA 3OJLA 5CHEA 4MOWA 4HNGA 3BXXA 4ILKA 3EY4A 3OEYA 2X0IA 1P1KA 1EEHA 1HZZA 1PZGA 3G79A 4J1SA 3WYEA 1ZKMA 1BG6A 3NEPX 4GWKA 4UEKA 2OORA 2EKPA 3PIDA 1HE2A 4Y6SA 2PR2A 2FP4A 3TZQA 4BNLA 1ULUA 2J5QA 2ZIZA 3HN2A 3D4PA 1LQTA 1I10A 2CY0A 5KKCA 1ZEJA 3JQAA 1Y1PA 2HLPA 3DAFA 3R3SA 2VYNA 2Z1MA 1NFQA 3OJFA 4YEDA 5H81A 2FR1A 3DZBA 1C0PA 2CVOA 4N54A 4RZIA 4RPHA 4WLOA 2D0IA 2GPTA 4B7XA 1HF3A 1RM0A 4A7PA 1OI7A 2YV1A 1EZ4A 2FR8A 1LJ8A 4IINA 5AXAA 2DBVO 5G2OA 3DZJA 3KEOA 3OA0A 4GLOA 2IEBA 4L8VA 4BGUA 3PDJA 4D44A 2EJWA 4JJIA 1WDMA 4MVJD 5DULA 4HXYA 4AJNA 1Y6JA 3KSDO 2VHXA 1PJTA 1RM3A 2O3TA 4IUYA 4NMHA
chains in the Genus database with same CATH superfamily
3DEZA 3LUDA 2BMDA 5EXPA 4L5BA 2HRDA 2OHXA 2YFQA 3D8UA 3R3XA 3IA2A 1M0SA 4KPUB 4CQLB 1QK5A 1CU1A 1XA0A 1XTSA 1P60A 2YHUA 2ZI6A 1T24A 3BWBA 5I8WA 2PUCA 2YV4A 1E3TA 2GD1O 3OWXA 1OC4A 5JHHB 3BRSA 5C5IA 3NORA 1X3LA 2WUGA 5FUBA 3WV4A 5CLFA 3W5BA 5JAQA 4K6FA 3WWYA 5A3JA 1UBLS 3BCRA 3I64A 4TXLA 3ZBTA 2QP4A 5K3OA 5H3CA 5EJ2A 5JV5A 4MQUA 2FOLA 4Z1OA 4YR7A 3OUZA 2OHGA 1QK3A 4TKVA 1JMKC 1OA0A 3MSXA 4RPGA 1Z75A 5ECGC 1J0XO 4FT2A 2CN1A 1MUUA 3GO4A 3GZNB 3ACBA 5FTWA 1KI8A 3LYAA 3GEHA 4LG1A 3L92A 1N6HA 1V6AA 3WJ2A 3OT5A 1AQLA 1RP1A 3I0NA 4UMEA 4BBZA 4D9KA 3SVLA 4W9RA 3L8FA 1B8NA 4IW3B 4K6OA 3WGLA 1YZNA 2NU6B 3DYIA 6NULA 4B43A 4W1SA 1PNOA 3EIOA 4JJGA 3ZK9A 4NP6A 4R1TA 5H68A 2FW9A 1GPH1 3T6KA 1TFUA 2F3PA 1FQJA 1VL5A 3CYFA 3F9RA 1JQKA 3ODPA 1HR0B 1GPAA 3IYLW 4DCNA 3PKZA 2TS1A 3ZE0B 4OYLA 4OLJA 2FRVA 1RPTA 4OVKA 1OYOA 1FMCA 1OLOA 4N1AA 3W5CA 1J9GA 2XUIA 4HH4A 4EBBA 3LY8A 5KYXB 4PZPA 4UE3S 3H75A 2EQBA 1KR2A 3SI7A 2PBLA 4D9NA 2PMFA 1OJ7A 4OP1A 1TQ8A 2QF7A 1A9RA 4HPJB 4OBXA 4WXYB 5B58T 1W5SA 4P53A 2AUTA 5D3KA 2NUTB 4X92A 2Z5GA 3CH7A 1QRUA 2EFJA 2QMOA 2W93A 4IDCA 1N2EA 2CXPA 1JIUA 2CLHB 1K75A 4LXYA 1M5RA 4B3GA 3ZX5A 1Y63A 4IJ6A 3DMDA 8LDHA 1OZ0A 1I01A 3FY4A 2HB6A 3RYHA 5LQCA 4AIRA 4A9AA 4ZZ0A 1O9BA 1H6AA 2GJAA 2YHSA 5EMHA 5IANA 1VJGA 1QTIA 5K2MA 1DMSA 1TB4A 4ZZ1A 3TNYA 3C43A 4YMHA 2AFIB 1XMVA 2PSJA 3AY3A 3OCYA 3WHLA 1NPYA 5B1HA 4GH5A 1M2OB 3SJCA 3UTDA 1WE2A 1AS0A 2NQ8A 2RHWA 5HJ7A 5AYVA 2ALJA 4B35A 1FS5A 1QO0D 1YRWA 5CVDA 2A7XA 4CG2A 4C5CA 1GLGA 1CYEA 2EZ9A 3RU2A 3EEQA 2OXCA 2WWFA 1I2MA 3GDFA 4GM1A 3TR6A 2O52A 3W0LB 1APBA 1Z74A 4ZZ3A 2DPXA 1BDBA 3LDAA 4ZGBA 2BM9A 1O9HA 3R7FA 4CR6A 4EW6A 3Q88A 5J1SB 3PHBE 2BUBA 5G0VA 2ID7A 5C8VA 2ZSEA 2J3IA 3STWA 2GDZA 1LDBA 3ANTA 3KSBC 1VJDA 3LW7A 1YVUA 2WLSA 3FCOA 1WB9A 4XJSA 1Q7BA 4RVNA 3O8QB 1YCDA 1GNTA 1EUDB 4UVHA 2HQSA 5KYUB 4ISBA 4FKBA 5DYNA 1L5KA 3COJA 5AW6A 1QGDA 1IATA 1L5HB 3HNOA 3L8DA 3CKKA 2W9XA 4Y0VA 2H7VA 2BPOA 3ZYZA 1E1YA 2CFSA 3TR0A 2OBXA 3LH5A 3PL1A 5FBLB 2V3CC 3NVKI 1ZM4A 1VRVA 2M98A 3KUXA 2PCJA 1PZNA 4QQFA 5D85A 2BBOA 3SLGA 5KJFA 3AOGA 3EXG1 4LWZA 3NEJA 1PT6A 2VJDA 1CDOA 2QYSA 4HWKA 3ZJUA 3OQ6A 1WXFA 2H1FA 5J5AA 2UYQA 4JUFA 4WKNA 3IP3A 1C30B 1BWPA 4MDYA 1RHRA 1X6VA 4EGCB 1ZQ9A 4HUTA 2RGXA 2Z2KA 1A5AB 3SF8A 2JARA 3AQIA 1VGQA 2J4FA 2C7RA 2SKCA 3EW9A 2QQGA 4NFLA 2H8GA 3WX0A 5LLDA 4N8SA 1U2QA 1I1NA 3T61A 1G8JA 3M4NA 3V34A 4BVGA 4D4GA 4HDNB 1E7MA 3KC2A 4ZN6A 3UANA 1QH8A 1RLUA 1KMHB 1BJKA 2V6GA 1Y1SA 3MN1A 3NZEA 4IVRA 3SM3A 2ODEA 4RIEA 3S27A 3WNZA 3ZHOA 3DZGA 4DV2B 1K1EA 1V5FA 1KBQA 1K4YA 2CSUA 2WTEA 4MR9B 1QV6A 3A4YA 1O08A 3CH4B 2RI1A 1J0CA 2B36A 2UUBB 4F3KA 2UZIR 3PRJA 4G4SP 3B52X 1R0BA 3WLOA 5CDTA 1BXZA 2DRIA 1Y1RA 2QY9A 4C7KA 5DHPA 5BW8A 3RVPA 4TQUS 1Q0HA 3PF9A 2RB5A 5I7WA 3MTAA 4QYTA 1W1UA 4WACA 3R41A 2GBGA 2FW7A 3QEKA 4UHJA 1NE2A 4P8RA 4RJLA 4ZV4A 2XB6A 2GN0A 5DBEX 5JRJA 1LWOA 3DE0X 3CZRA 1E8NA 1TUGA 3DMGA 3DE7X 3NKFA 1QTRA 2W2LA 3BA6A 1LSJA 3DDWA 1U4NA 5L6MB 3EAQA 3WKDA 3AXTA 2I3DA 2HPZA 4KWIA 2Q62A 4A8JA 2HNBA 5AOAA 2NUAA 1XA4A 3BVPA 2D3WA 1XCPA 1KAGA 4LZZA 2Q3BA 4F9FA 2XUAA 3AEKB 1N5DA 4OQLA 1NW3A 3DP9A 1T5DX 3X2SA 4FOLA 5H8WA 1ZVMA 4GZ5A 3L0BA 2C2HA 3R6DA 4CMGA 1G21E 1SVIA 1E1LA 1Y9EA 3I45A 3U3MA 4FLMA 1KERA 2XXBA 3H2ZA 1CVIA 1FMJA 3HR4A 4MW2A 2XMBA 3ZY5A 4AY3A 4E7PA 6REQA 2QTTA 3L1HA 4I19A 1RBZA 3K7EA 2YY5A 1TL7C 1DTEA 4JXKA 3LTEA 3MOGA 4P92A 2P40A 1U0JA 3VUEA 3QX3A 2WW8A 4GIBA 2BONA 4JAVC 3RAPR 3D02A 5LQJA 4RLFA 4BUZA 3KNZA 1CF2O 2HZ7A 1E9RA 2QU7A 3HGMA 1F60A 2FJPA 2R2AA 2WAOA 3QUAA 2JGJA 2AI3A 3TLYA 3EDCA 1VRCA 1QMGA 2PJDA 5E7MA 2P2GA 3L8MA 4J1TA 3TMAA 5ARCA 4D45A 4DDUA 2PSDA 4O8CA 4PG7A 1EP3B 2CJFA 3BE5A 3WAGA 4EF6A 1NVGA 4FDAA 1W1IA 1SURA 4XI9A 5FPHA 3WJAA 5JQGB 3K4QA 1KQPA 4OATA 3ZY2A 1ESEA 5ALYA 1BMFA 5CEJA 3A1CA 5LCXA 2GK4A 4UXJA 3F47A 5EIWA 2X0KA 3E5RA 4CLOB 1VRWA 4XQGA 1IXKA 5AKXA 5EHGA 3VZPA 3K6RA 5JAOA 2QLTA 3HCNA 2OL4A 1KDZA 5JAMA 1XC7A 2IPLA 2PGXA 4K2HA 4QODA 2WWIA 1JIKA 3DR5A 2PRYA 3BBPA 3C15C 3NT2A 3QLUC 3QITA 1CQIB 3EFBA 4CIXA 2JIZA 4TUYA 1I2ZA 5TJ9A 4OLBA 3VU9B 3FMOB 1LY1A 2W6PA 4X45A 1Q7CA 1FRFS 1NLZA 2CWDA 3QBEA 2L42A 3M6IA 1PHRA 4ND8B 3TH5A 2RK3A 2H5JA 1O94D 1UDXA 2XKJE 1E8DA 1A7AA 4L5AA 4S0XA 4GMKA 1D4FA 4ZU6X 1TVKA 4HVLA 3MMXA 3SVTA 1SQGA 1YE8A 1AKQA 2NUPB 3IIKA 1K5PA 4HYYA 3MTIA 3WIOA 1GFZA 3MW8A 4Z2AA 2JH9A 4RTOA 3GHYA 3M83A 2R0QC 1PBTA 1FJHA 2BHTA 3IJPA 4TTSA 4RK5A 1WG8A 1TE2A 3DMNA 3E7WA 3WBKA 2WAXA 4G2TA 3I5MA 1E64A 1K89A 2ECQA 2OLEA 3NJ4A 4U7PB 4C0BA 2WJAA 3DULA 4Y2UA 4N7MA 2OP0A 1I0ZA 2Q45A 2DFTA 2A4MA 4P5PA 2PRIA 4B9EA 2ZJ2A 3JD2A 3P2OA 3CLUD 1E62A 3LUAA 2PLNA 1XVVA 5FUXA 3IC5A 3QUQA 5KSYA 1ZN9A 1HLGA 4M0UA 4M7PA 3M6XA 2WBLC 1ZOLA 1IZ0A 1U7WA 2H2AA 2HBQA 2VDUE 4MVWA 2CBXA 4RCZA 1NSFA 3SFVA 3RK0A 4A03A 2VQEB 3EGCA 5IJWA 1D2CA 1JEQA 3ZW7A 2OQRA 2FMIA 3A2MA 3K0HA 1Z2AA 1LPPA 3II6X 2ZWOA 3CV3A 3LZCA 1VKRA 2H4WA 4G1CA 2LDXA 3ZH2A 1DCFA 1BD3A 4ZO4A 2YW9A 4BXOA 4R3UC 3F9IA 5BNFA 2JL1A 1SA0B 2Q07A 3Q9LA 4ND4A 4X7BA 4WNAA 1GTG1 3A6KA 4FUQA 3CVOA 3FJOA 4AD8A 1CUBA 5CNKA 4RD0A 3EZNA 3G2JA 5EXXA 3ZI4A 2HMAA 2A9RA 3IUYA 2VBGA 4ZYUA 4MQFB 1A88A 2BFBA 2DHRA 4MVJE 1NJFA 3STXA 1XDGA 4CIDA 5ISMA 1U0EA 1P17A 3I6YA 1OU0A 5HQTA 5IKMA 2Q1TA 1UFRA 3HDJA 2R60A 3Q7EA 3AW9A 4PBSA 2BZGA 3F73A 4FCWA 2FFRA 2QQ5A 1DZ3A 5CNJA 1PJLA 5DLYA 4C30A 1L7DA 1NMSA 3ZI0A 4Q01A 5IAJA 1XDWA 3JQFA 5IJ0A 2RHDA 1QO0A 2Q4DA 2BGNA 1DCKA 1ZXXA 3QJ5A 4HQ6A 4YJ2F 4A2WA 4BLOA 1P5JA 4YRSA 5IZ4A 1KVQA 3PR3A 2VQ3A 4S1WA 1IBKB 4CQMD 2G9QA 2PJZA 1G291 3TEFA 4P7JA 2GZ3A 4BQPA 1OLUA 5HTOA 1RXEA 1JWAB 3FCCA 3GRUA 4D5GA 1JLKA 5HFJA 3RJMA 4I99A 3C4JA 1W96A 4M7RA 3N07A 3MWEA 2PD3A 1JE0A 2VP0A 3K0CC 4C7OB 4LJ8A 2IF0A 1W0JD 2A9KA 2DBRA 1P3Y1 1LCIA 4NQZA 5FWAA 3HFSA 2XKAA 3HVKA 3I4LA 1FLNA 5IEBA 2OG1A 1R88A 2VN8A 2RG1A 1O95C 3FOBA 4JR2A 2O0MA 2LPMA 4Z7QB 2I4MA 2I29A 2K2WA 2WUVA 3ANSA 3B1WA 1WKVA 2QJFA 3RJ5A 4CIVA 2HLHA 4OGFA 3CHYA 2DFDA 1CY7A 1DUVG 2P5TB 3ND8A 4GBGA 3NS7A 4K9KA 5H9VA 4B6SA 5ITSA 1VLQA 5K3FB 4U9IS 1XMIA 3KYJB 4M76B 5DYGA 3UEOA 3ZDEA 1SB8A 5JXJA 3A2KA 2IS4A 4IGAA 4QRDA 4KL8S 4TLEA 2CV1A 3ILHA 1Y3BE 3H5AA 4DRXA 2DFVA 3VH1A 1YOVA 3EXIA 4PAMA 3G2LA 2I9KA 4HB0A 1LS6A 4ZRNA 1EE9A 1USWA 3KVOA 2A58A 4G07A 4JELA 4O3FA 2CSXA 1GUFA 1EUZA 4IIFA 4MIKA 3T4PA 3B8EA 1QF6A 3V8VA 3CWZA 5L51A 3A1WA 4FE4A 1P81A 1U2DA 4FI3F 1T5TA 3KOWA 3N0TA 2NTVA 4HZUB 2AJTA 3GLUA 3KAPA 1C3OA 5DYWA 4CEJA 4FE7A 3EB9A 4H2DA 3Q2KA 5G3YA 3A1DA 4AWAA 3AIMA 2ZZNA 2OVBA 3F0TA 3ICPA 4XGIA 2CJXA 1MC4A 3OUTA 3IDZA 2OO3A 4S35A 5K3BA 2P78A 3AG6A 5CH3A 5EZ6B 1RYEA 2WKWA 3OZEA 2Q6OA 2DUNA 1XZQA 4RPLA 4HMPA 3TRFA 5DNDA 3GMIA 3RBAA 1NXSA 3NWJA 1J24A 4XIJA 5DM60 3ZDBA 4L9SA 4E4TA 3UPUA 4D25A 2H7CA 2GJ9A 4ALLA 1YQTA 1YFKA 2ZCVA 3L7AA 3EUEA 4ZC1A 5GQSA 5I51A 1P7PA 4DR5B 1ZUWA 4P7BA 4KGXA 2BYTA 3ZDDA 2XAUA 3STTA 5A4MS 2IZ0A 3ZIAD 1AKYA 2PUGA 2EF1A 4WK4B 3ZGYA 3TGLA 1VTKA 1ZMOA 1KYIA 4F4DA 1CVLA 5KQMA 1OFTA 4TYMA 1OU4A 2H11A 4B6OA 1DO0A 1E3JA 2P9EA 3MBKA 3ZJ5A 3RT1A 3GLIE 3IAM1 1HSZA 2YXBA 2FAXA 2QRGA 2V7BA 3TSYA 3UXYA 1D6MA 5TRTA 4AJHA 1OH8A 2P30A 5AKIA 2WIKA 3NAZA 4G0PA 5IJAA 2EFHB 2CUTA 4EHIA 2VHEA 3HA3A 4WFJA 2J3LA 3A1NA 3BQMB 3JALB 3ZWCA 3DMFA 1TEXA 3BSFA 2DSNA 2VK2A 3O7MA 4ON9A 1FXUA 2VPXA 1SCNE 1PJCA 1KIAA 1ZUNB 4Z0HO 5FLYA 5K6RA 2BEUA 5GTDA 1L0BA 2QB5A 2YWCA 5EKXA 1X42A 2EAUA 2XMDA 4JQSA 4RK4A 4XFKA 2XKKA 1RJFA 4YA6A 5JCPA 1R4NA 1T5HX 2ADMA 1E3IA 1I80A 5BMVB 4AZ0A 3I42A 2GN1A 3AB3A 3AJRA 3TDKA 4CI9A 3EXEA 1JYSA 1RHJA 2HV9A 1V3TA 3T12A 3T5GA 3UGQA 1L3CA 4DCOA 4ERXA 4BOYA 1DNPA 2JBHA 3EGDA 1TYBE 3R5JA 4LNHA 3LUFA 4XGRA 8MHTA 3WMXA 1CEYA 4BZPA 1P18A 2YINC 1MX1A 4M9UA 4F93B 2PKCA 2WLTA 4RIIA 1A2KC 4J4HA 5CJ2A 1EUCB 1KDRA 3E3NA 2YN4A 3PNLA 1UANA 1NLMA 1Z47A 3BJEA 1P0PA 1RXIA 2B78A 4H35A 4K5QA 2PANA 3ENKA 4R2HA 3ZHQA 4BBPA 1EP2B 2YOHA 2V0NA 1T8RA 3S55A 3HGQA 4O4JA 3VPBA 4R71A 2VXOA 1FQWA 1ULBA 2ZRLA 1Y33E 3DR3A 4FFNA 5AJYA 5LZ7A 3L7BA 5CT6A 1T10A 3EBOA 2AWOA 3PQ2A 2X5JO 5ALGA 1UPXA 1BDJA 1RFGE 2ILVA 3WGJA 2IHTA 1SM4A 2QLFA 2YHBA 5EWMA 4EG1A 3IMFA 3MJDA 4WESA 5CNMA 1YJAA 1S2GA 5GZ1A 1VCNA 4GNRA 3FCAA 2PGAA 4QQNA 4RC9A 5LR6A 4RM3A 1K6JA 4C4TA 5BUQA 1OFHA 4UASA 2QV0A 1US8B 3WMFA 3WI7A 3JQBC 1D2AA 1D2NA 2FRDC 3M6FA 3PKJA 2E4ZA 2WMOB 3SF0A 4P98A 1PE0A 1T2AA 1Y1LA 5E6UA 3O8BA 2IU0A 4QWWA 3T5BA 3TBHA 1ZNXA 1PKXA 1QJCA 3GEEA 4BUJA 5F4ZA 4F2HA 2QT9A 1KZ9A 2WTUA 2EU8A 2FGJA 2PJUA 1YRAA 1SVMA 1VLJA 2ODWA 2BP7A 5DJ5A 2I2CA 1RMQA 4QBKA 1CE8A 2PZAA 1PG0A 2IOHA 4DM3A 3IUMA 3KJHA 5IRCD 3UC9A 1BW9A 4ZT3A 1LLFA 2QPAA 2QDXA 4KX5A 4LF9B 1Q0UA 1HNZB 1CT9A 1EJ0A 2ZIAA 3DS8A 4AMYA 3E18A 4KTTE 4AMVA 1ZGGA 3GZTB 3GEPA 3MS2A 3PDIA 4OKIA 3VDMA 4IKEA 4TROA 5DEIA 2I1WA 5EIXA 4MUXA 1NVTA 3B6EA 3GJTA 1RKBA 3OQOA 2FN3A 3CNEA 1T36B 2IITA 4F6LA 4XXHA 3C98A 3QFHA 1K9SA 2IPAB 5JBQA 4HB3A 3DEAA 1OI4A 1XCGB 1V41E 3PCXA 1RE1A 2PIDA 3C6BA 3TKYA 2ZAOA 1H2RS 4EUEA 4F8EA 1J90A 5KCMA 2X7JA 1F17A 3LTNC 1EUYA 1TCUA 1HYQA 3IHTA 3QE3A 3ZHTA 3IQIX 3EIUA 1MPXA 2LE0A 5EJ6A 2ATVA 1G5QA 2CE7A 3U7FB 3B60A 3KAJA 5L53A 4UMDA 4DV3B 1M3SA 1Q15A 4EAAA 1ZZEA 3EAGA 4N49A 4BJ3A 3K5WA 1YB7A 2AOUB 2MR5A 2R7MA 3FETA 5FA8A 3BWXA 1I3MA 3LT1A 4XGKA 3JVUA 1HFJA 3QU2A 1XK7A 3QW4B 5HRUA 1VLHA 2Y77A 1HLFA 5ADHA 5FI0B 1NWCA 3GLHE 3MTEA 3KRTA 4Z3DA 3UAXA 4E70A 2FMUA 5ARBA 5TIIA 2CLIB 1U3WA 5JALA 4CDRA 5LIPA 5LIRA 2AG0A 2HY7A 1TJPB 2NO0A 1TI7A 2OENG 2P9BA 2VTKA 2IU4A 3H1GA 2BMEA 3IP6A 1QZZA 3JQGA 1D03A 3MBIA 2FN9A 3Q85A 4LBVA 3GJRA 4NESA 1CK4A 2KHZA 3PXGA 4F5DA 4HEA1 4XSHA 5C46F 3K09A 3TSCA 1I4DD 3TLGB 4EYEA 1L8QA 1THMA 4DLYA 2XSZD 2PFKA 3EJ6A 4UOQA 1SHTX 2VPQA 4PC1A 5A4KA 4K9OA 5CURA 4DCCA 1N3BA 4DQDA 4YPOA 2ERCA 2F3QA 2IYZA 3GRFA 4LZJA 2W6NA 3INGA 2UVQA 4GOND 4JD5A 2O3SA 2P77A 3FUWA 3OPQA 4PX3A 1B76A 5BSGA 1J8YF 2UUCB 2AX4A 1NVVR 3D4NA 5YASA 3C3EA 4I1YA 4DA0A 3QU7A 5KNBH 4BJ1A 1XCOA 4X8LA 4DMRA 2BFNA 3BFJA 1BOFA 3PXXA 4J0HA 4TWBA 4CQMA 3GDOA 3FKJA 3CQ9A 4MUIA 4HNVA 4FR0A 4YAUA 5TPWA 4WOCA 1XKTA 1UUFA 3NG1A 1REQB 2CL7X 4Q9DA 1QPZA 1E4EB 4Q6BA 1MO6A 2V7GA 1TRKA 5AJUA 2AGVA 4XTRA 5LXTF 4CF3A 1Y4SA 4KWEA 1EFPB 3LBYA 1WMDA 5DRYA 4D9MA 4UOZA 4X94A 4ZAXA 4MR8B 1Q1NA 3NWEA 4RJIA 4BWGA 2D5BA 2O2ZA 3QKUA 3TLEA 1II9A 1BQEA 2XD9A 3CKLA 3WMGA 1GNVA 4GZ3A 4TL6A 4DV0B 3VH3A 2Y1XA 4DLLA 2C2GA 3WO1A 5I9MA 3A6HA 4BEJA 1QIKA 5CHYA 3WL4A 3ZY6A 4GLFA 3AM3A 1L8XA 3I2IA 4AJKA 2VYFA 2P9FA 3BIJA 3AXSA 1OT3A 2AR0A 2H0AA 2ZBQA 1Z39A 4FGSA 3DEFA 4LCBA 1F20A 1Q0PA 4PU0A 1ZXLA 4RDHA 4XFJA 3KFXA 2R7NA 1MGPA 4KWCA 2BAGA 3ESRA 1QWSA 1TTHA 2ERXA 3E1GA 4KDFA 4B87A 1M2HA 3KO8A 4C2TA 1MCZA 5C3MA 3IH5A 1R4AA 2KLHA 1QYIA 2HKIA 2MR6A 4YS6A 2QR2A 2B2NA 1OV6A 1DKNA 2QMHA 4OK6A 1XELA 1BMDA 5DCWA 2QIOA 3DEIA 1CJVC 3X1KA 3BMOB 5LC1A 4G0VA 4GQBA 2CYBA 5DNAA 5FOSA 1UZNA 5T4HA 5FULA 2C0CA 2HIHA 1C5KA 1GZDA 3D81A 1O3YA 1UH5A 3IAAA 2WMDA 1J06A 4QUIA 4RAOA 2OAQ1 3SEZA 1K7CA 3ZWPA 5LZ9A 5D7NA 5LZ5A 5BYJA 4LPSA 2AIRA 3W6NA 1CNMA 1TZ2A 2F1OA 2YH2A 4RENA 2J6BA 3RARA 3ZNOA 4AAYA 1KMQA 4QULA 5JEDA 2DBYA 4XM1A 3ROTA 4KWHA 1XA3A 3UFXB 3KVNA 1DPGA 4D0SA 1TAQA 3P20A 2DKOA 4LJ7A 2LR0A 4E5YA 3IL2A 4HNAB 5JPIA 1XFAA 2HWWA 4QPCA 1BXGB 4GKBA 2Q8QA 1XU4A 5ES3A 4Z7OB 5IJ9B 4P4LA 1W4AA 1G8SA 1H66A 3BSYA 4XKJA 3ZIAA 3B82A 3GC6A 4ES6A 5KIAA 2JZCA 1WKBA 1NVKA 2ORWA 3F98A 1AUOA 4NJEB 1LLQA 1FP2A 4KWTA 3RV3A 1FX0A 4NCHA 4WXEA 4C3ZA 1YZUA 4N7JA 3IJEB 2FQQA 4HDOB 3L82B 2UYHA 4Y1RB 2IA5A 2QRHA 5IVDA 3JYPA 1R0KA 5LQMA 3GLFE 2JH3A 2JFOA 4E5DA 1MABA 1I6KA 5F2KA 4CQJA 3JZMA 1BS9A 5JD6A 2ZYTX 2QN6A 1DX9A 2ZAGA 3LHFA 2DWUA 4Y8VA 3RU7A 5E4FA 3K72B 3OPYA 1DJQA 2FHSA 2R8OA 2Q5JA 4J2TA 4O4IB 1CFJA 2QZ4A 2W11A 3CSDA 4NY1A 1AMOA 3QVJA 1RYZA 4TS9A 5E1MA 2G77B 1XRSB 2XVZA 3I6IA 1D2RA 1AX9A 1CUSA 5BXQC 4MKIA 2JI8A 4EEZA 3MT7A 5DGTA 1CDZA 2DBZA 1ZSNA 3CR3C 4XEHA 4I1RA 5JSFA 2PXHA 4KYTA 2NNLD 2IPMA 1XZHA 3K6KA 1VB5A 3HMKA 1QR6A 2XGJA 2JFVA 2I91A 1J70A 1SBNE 2HUPA 4MV4A 3KLOA 3WFJA 1DHRA 3K0AB 3P0FA 2B1IA 4XRGA 1S8NA 4I5IA 1W0CA 1JHOA 1FVHA 4AJPA 2PYIA 1J97A 2QSYA 4O2AB 1N1DA 4IX9A 5CT5A 4JJZA 3OM0A 4EI2A 5BPHA 1N4AA 1W19A 4TVBA 4BCCA 2MINB 2OSBA 3O94A 4JT4A 2A5DA 1P2TA 2PWAA 3M1LA 4G8JA 2MIIA 1DAHA 3FDFA 4JI5B 3BQNB 3NTQA 4I8XA 2B30A 2MMGA 1P75A 2A2ZA 5DSTA 1GG2A 1U4SA 2F4NA 1ZH0A 4HCJA 1W75A 4TT3D 1H2AS 1HDRA 2I2WA 4OLFA 3HCFA 5FADA 1R5OA 1Y6ZA 2CVHA 4TZKA 4KQFA 1I0LA 4OI4A 1IWOA 3S1AB 2FWAA 3QXGA 3I5XA 4C21A 4JQZA 2REXB 1L4MA 2C92A 3OC0A 5KTKA 1U31A 2H54A 1K5HA 4YP9A 1O57A 2OOSA 1ZH6A 3GEMA 5GY7A 3RYIB 5CA0B 3URMA 1WUKS 5GOZA 5K3SA 4LFAB 1V8OA 3OX2A 3L8EA 2Z43A 3K1AA 5L3ZA 4Q47A 1AB6A 3PHCA 4BVKA 4PGFA 2Q6KA 2VTDA 4WZBA 1NQAO 1KKUA 3A28A 4L8WB 2I4LA 2I3GA 3SG0A 3R0JA 3P52A 5HF9A 1Z0AA 4AZ3B 5CBPA 1FDSA 4PNHA 3OQPA 4PZLA 3BD6A 3MGCA 1N5IA 3KD3A 3BWVA 3SXUA 3LHDA 3O7WA 4RS4A 1PJ2A 3DO6A 3L0YA 4M6WA 2C0PA 4FN5A 4PSVA 3RV4A 1X70A 3PK0A 4EW3A 3DW1X 1MF7A 5L3RA 5BR7A 2V59A 1U7XA 4XPIB 3W34A 1N32B 1XQWA 3HA7A 1ZZGA 2EX0A 1PVVA 1OVMA 1I7PA 2ZKLA 3I01A 4IPTA 4L02A 3G6KA 4MQMA 3RBZA 1PKEA 2ATCA 2ZRMA 2UU9B 1LXCA 4WBXC 1P5ZB 3G49A 1Y8RA 4KIJA 5ULLA 1Y42X 3PNVA 1TJNA 5ITZA 4QGAA 4EZIA 3DO5A 1H6BA 5CYOA 4CEHA 1NUUA 1ZGZA 3LWZA 2OXIA 5KC8A 2H63A 1V3VA 3T0GA 1IXYA 2FZ4A 5DX0A 1U2GA 2FUCA 3MWLA 4F45A 5MGBA 3EN0A 3FTCA 4IRXA 1R0YA 3O1HB 5IT0A 3G59A 3KM0A 4R98A 1E6UA 1BTOA 4LYJA 1D1TA 1LBEA 4F12A 5FR1A 1N9GB 4WASA 3RVRA 2CXHA 1ADYA 1XPJA 1SC9A 1EFTA 1Z0UA 4I2VA 4XLZA 3FSRA 3JQ9C 2ZDHA 2G1UA 3GBSA 1FX1A 1JXMA 1QG6A 3EPPA 4L85A 2ET6A 2W6IA 1Q83A 4QFBA 3A31A 1RPZA 5A9TA 4BVHA 1O2DA 4JC8A 3FNEA 1D0VA 5KYWA 4M1OA 3I9V1 3MG9A 1JXQA 2HXYA 1I2AA 4FEEA 3A9UA 2VRWA 3FYUB 1N2JA 1JHYA 1R9JA 1GPBA 1T8SA 1UF9A 2A5YB 1YS2X 2AKAB 1NQWA 2HIMA 2Q3EA 4PLGA 5EPOA 3VR5H 4DHEA 3AVVA 4JGIA 1NT4A 4GGOA 4KG7A 4HVAA 2YFYA 4EQ6B 1X14A 1T15A 2XSZA 4NFSA 4O6VA 3IBTA 3VO8A 3FB1A 2JLRA 4H08A 4JT9A 3D0OA 1E5DA 4ZAYA 3N70A 3O21A 2X8JA 2MWMA 5FNZA 4EX6A 4Z4FA 2ZJAA 1E3MA 5FJJA 1S8OA 1Z4NA 1F8FA 1YO6A 1Z5PA 3NHAA 4CT5A 3QKRB 1CB7A 2GXQA 3OTGA 1G9TA 2C2XA 3EXFB 1AZLA 4XVQA 5GWXA 3TLAA 1S96A 3W2EA 2D4AA 4GPAA 3U4HA 3N0VA 3H83A 4FHCA 1SOMA 4US2R 2JFQA 4BKPA 1GPKA 5HGJA 2ZSAA 4RJJA 3TGWA 1H6CA 2H9YA 2Z4SA 6LDHA 4FGLA 4QSMA 4TYWA 5AUPB 2HLDD 3CZ4A 2LBPA 4EYGA 1OAKA 4OCZA 2OLJA 2D74A 3BULA 3CT4A 5AW0A 2IFTA 2G1PA 1B14A 3KSZO 3H2BA 1LNSA 4S2UA 2J3QA 2XYPA 2ZRJA 4ZDKA 4KTVE 1EGAA 1VECA 4R84A 2CDNA 5TF0A 3S0JA 1GCIA 4A0QA 4P58A 5B64A 3O8CA 2E1RA 3DSRA 1GXSB 1YK0A 4FGWA 4G9GA 5JRDS 1M9NA 3FOFC 1II8B 2W2MA 2ZB7A 4JBLA 1J39A 1EP1B 1Y9DA 3OKAA 5IBCA 1R8JA 3D6MA 4RO0A 1W36D 1CJCA 1GGHA 2RDMA 5CB8A 4ZT7A 1J0DA 3PQ6A 1KFKB 4MCJA 5U4QA 4A6DA 2J3KA 2UUPA 3PPVA 3FRIA 3PYXA 2C5GA 2OCPA 4YT8A 2DC1A 1Q0SA 3FDZB 1DC4A 1SBCA 4M1YA 4E6PA 2N47A 5AKYA 3L2OB 4BL5A 4FIZA 1JSZA 4Q12A 1F38A 4REQA 3K20A 2FVYA 1WXXA 1IJBA 1SZDA 4EUKA 3DKPA 3ED1A 3R9IA 4Q4JB 3BYZA 4PX5A 1N25A 2QOEA 3OJCA 3TB4A 1M2NA 3ZU4A 2PN1A 1Y0BA 4UE2A 4CT0A 3KB2A 3IAFA 4LCJA 5DXAA 2PRKA 1AJEA 1RJ9A 2C3PA 3H42B 3SZMA 1PD0A 3EBLA 1E2BA 3PRKE 1NUHA 2HOQA 4LK3A 4YAFA 5J9FA 2C29D 1E96A 1P5RA 1RXCA 1OY1A 1ZJ5A 1BMQA 3AF1A 5FWYB 5IDVA 1XWIA 2VDLB 4GO1A 3A1TA 1BS2A 4UQOA 4QGSA 3CUUA 2PS3A 3KIPA 1V16A 4JGBA 3HUUA 1C7QA 4CM1A 4S1TA 4QREA 2HPVA 4X95A 3VSCA 3ZCXA 2EKBA 4GYYA 3IQEA 6ADHA 2VP4A 5CTJA 5DDIP 1JI0A 4LGVA 4U7JA 4BRWA 4EYOA 1ZIOA 1JHRA 3UJ9A 4ZYLA 4PO3X 2CNOA 4TQGA 1JN0A 2PRJA 5DHSA 4ABYA 2VA9A 3ZE6A 2VJQA 1GUDA 3N58A 2OBYA 4F8JA 5JS1A 4MQEB 3UV3A 1HG1A 3A2LA 2P2ZA 2YWBA 2WT4A 5BV1A 1KC3A 3OETA 3PC8A 4Q3AA 4DIEA 3T35A 4W82A 1GT91 1K27A 2HRRA 4C2BA 3K2BA 1A9OA 2XHZA 4YJ2A 3QU4A 3U4CA 1ZN8A 2QM8A 1KJIA 1JQAA 2J1LA 2IBMA 1XR3A 4DA6A 2R8RA 4TTRA 1LDEA 5H02A 4QDXA 2IJGX 2WAMA 5ICMA 2PUEA 3ONWA 2HWKA 1L8LA 2DFLA 2OCAA 1LBTA 3ZGLA 4LW8A 3CCCA 1T26A 1Y1TA 3H1BA 2ZRGA 5DTMA 3L6DA 4MV1A 1OB2A 3K6SA 4IUCS 4RVDA 4UNIA 5T64A 1KQGA 3SEFA 1EZZA 3GRPA 5EKSA 1DAPA 4CMIA 4JVLA 5EZYB 3SOZA 2C8LA 3PXBA 1GPYA 2I7TA 5BVHA 1WHSA 5EE0A 3T9AA 2KBEA 1QORA 3R9XB 4HQRA 3V4OA 2AUNA 4PYKA 3TPFA 4TPKA 3I2KA 5FNVF 4TMVA 5A3RA 3FPCA 2VT7A 3LMKA 1CZNA 3I6QA 3RSLA 1XAIA 2WICA 1ODFA 1X1EA 1CY8A 2Q5QA 3R5SA 5J2TB 2PKQP 4KH1A 5ICCA 3NHYA 3NDPA 3I2GA 3RYTC 4MR7A 4OL0A 4QTYA 3LY9A 1S2OA 5G4KA 3R5FA 4IUDS 5JLAA 5IM4F 3KTAA 2J3EA 3IGFA 2CKMA 2J3HA 3RIMA 3QXHA 2EZUA 1MO2A 2ZS9A 4FFPA 1FLDA 1YR9A 2RAPA 1X9IA 4LY9A 2IKQA 4ZRDA 1B8OA 2ZBRA 3TR5A 1NYQA 4RZQA 2MSWA 3CEPB 1U8EA 3QKTA 3PQCA 3TJRA 3EEIA 4BAUA 5ICEA 5FLXA 1AOXA 2A92A 1M7HA 2BHLA 3MC1A 4TT3A 1SCJA 2ZQZA 5F1PA 1A4IA 1KHHA 2YTZA 3RRBA 5BT9A 1V3UA 1ZO8A 5A71A 1WMFA 4NV3A 5IAEA 4I55F 3ZWQA 3P0JA 1A2QA 1RRGA 3C8UA 3MMNA 4M8IA 1U0SY 1JH8A 4XWTA 1AF4A 4QNRA 4AN1A 4EAQA 4US1R 4LA4A 5KX5B 5CIQA 1I7LA 2EYQA 4PRLA 1JVSA 4LTDA 1JKIA 5G41A 3CVYA 4KXQA 2CE2X 3T0FA 3M2PA 4CGYA 1NP7A 1LV8A 2QX6A 1H0HA 2Z98A 1NQXA 3EXG2 2V7TA 2JI4A 3HB9A 4ATNA 4B8ZA 3KOZA 5EIOA 5BV7A 1SXJE 1GRNA 5CDFE 1DG1G 2J48A 3OJXA 4OMFG 4LVCA 3U61B 2F4VB 1QLHA 4ZCRA 1M54A 3RWMB 4PIVA 4Q1AA 2Q3FA 1U0GA 2FSIA 1IXRC 3MK31 5DHQA 1Z62A 1U8FO 5ALPA 1GR0A 3NDIA 5JZVA 3ROZA 3GDGA 1I3LA 4OKNA 1FTSA 4YRMA 4BKOA 4P3XA 3W8EA 4K9SA 1WZCA 3UAWA 4Y2QA 4WZAE 2W4MA 2WP8J 3B53X 4PBRA 5IF9A 4X62B 2D7JA 4RTMA 1RKUA 2E5FA 3C6KA 3NHRA 4WA8A 4LNAA 2AKEA 4L76A 4LJ9A 5C5CA 3U3RA 3DWGA 2X13A 2GR9A 2VRCA 5FTJA 3DAHA 4Z1MD 3EVDA 4ZVSA 5IMSA 5KBYA 2C5HA 2BZ0A 1C14A 1JXAA 1TA4A 2DFNA 4IHJF 5ER6A 1Y3FE 1X94A 1KQOA 3B89A 4MRMB 1WQ1R 4RQUA 3SR3A 4GPTA 3TKAA 4EHHA 1H3NA 1IIRA 4CNBA 2R44A 5LBUA 3RRXA 3T3DA 5I3CA 4NJMA 4A1OA 4XYEA 3WR5A 3VOTA 4EPYA 4O2BB 2WJGA 5AW9A 4GC5A 3GVXA 5IUNC 1UDBA 4KAAA 3SC2B 5HW0A 2QUHA 1SKBA 1MOZA 2VSYA 2IUSA 1LRJA 3RNLA 1RLIA 1AGPA 2EJCA 2JJMA 1ZGAA 1M10A 2VQ6A 3HB4X 4FNOA 5HIJA 5KNBD 3DE4X 1DLIA 1SG6A 3GQBA 4YACA 1OX6A 4MI6A 2HJWA 4WQMA 5E1OA 4C05A 1B0AA 2QYTA 4RL6A 3FUVA 4BKQA 1VFPA 2GUWA 3BREA 3GP5A 5D84A 2JEYA 2BFFA 2JIMA 4J91A 4H31A 4BIMA 1JIVA 3LCRA 3MGGA 2C54A 4YJDA 2L82A 3FSJX 1X7XB 1QGOA 4PSUA 4CMBA 2O20A 2A5LA 2PGDA 2AR9A 2X19A 3GMSA 1C9MA 3AUXA 4GXNA 4B1FA 1Z4LA 3RODA 3U4GA 4B4WA 3PT5A 4Q05A 3ZKWB 4N3CA 4JYZA 2CEAA 3PCRB 3U4QB 3PHGA 4FXPA 1J0AA 3RDPA 3C3CA 2GCNA 2ICAA 3ID6C 3IV6A 5EESA 1GUBA 1WOMA 1EX6A 3DEJA 4NOJA 3IHLA 1ULHA 1CFZA 1JKFA 5I7SA 1E1QD 1CY4A 1PR4A 3PNYA 2UVPB 3WNBA 1J8VA 4EB6A 2GPSA 3FJ1A 2VOEA 5HA5A 1PWZA 2JLAA 3CLRC 2XF2A 1CUYA 1D3AA 3AHDA 1ZL2A 1K8ZB 1P0FA 1XNGA 2FSVA 2QZPA 3KQQA 3NFRA 4EA9A 3NHZA 2ROQA 4UKDA 1WU7A 4XDHA 3U26A 2AZMA 3CO5A 3PITA 3NYQA 4IIVA 3V00A 2HLDA 1XRRA 5ED0A 3PP8A 3L1VA 2JKZA 1PEDA 4RLQA 1NNSA 1U63A 5CITA 5ALKA 1D9ZA 3KTFA 1H93A 1UPCA 4ZQFA 1UMDB 4R7GA 1AKUA 2DECA 5HYVA 1ABFA 1RM5A 2C5SA 3VAZA 1SEPA 3VKWA 2KJQA 4D7AA 5E4JA 2OD2A 2RGDA 2QMYA 3MQ2A 4IEIA 4RY9A 4E6EA 4JCOA 3OJWA 4OOEA 3UPDA 4CLEA 1ML3A 3HYTA 3LGSA 5AVQA 3ICQB 2HQBA 5I7VA 1BQ3A 2I66A 3NGXA 1X9HA 5E3IA 2I3ZA 1QK4A 4TYPA 3S5JA 1DRWA 2H2FA 1ISJA 1N9KA 4YLGA 4CM8B 1IM8A 5AJTA 2PMEA 4O1MA 1Y89A 3QELB 4MIOA 2GM5A 3NB0A 2BZ1A 3H5TA 4HYEA 3F8SA 4R1NA 2W70A 4C5BA 4EO4A 1CQJB 4YBZA 3OZWA 4ZQIA 1ZOIA 1ZG3A 5DNYB 5IVKA 4Z9FA 3OOSA 1JR2A 4MRAA 3ZU2A 1VLMA 1PFYA 2EBWA 1W88B 4IICA 1MOQA 2RGGA 1CLUA 4PEVA 4YAJA 4JSTA 2DR0A 4PZ0A 1N77A 3HDVA 3LLVA 3LQRA 2CLLB 3JYLA 2FSGA 1BVUA 3ASUA 4P81A 2EBFX 3QF4B 4QOHA 1L5GB 2Q2WA 2V6BA 3V55A