2Y93A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
275
structure length
268
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Oxidoreductase
total genus 91
structure length 268
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y93A00
2X7HA 1W4ZA 3PHGA 3SX2A 4KOAA 4TRJA 4Y6RA 3RWBA 1VI2A 4L4RA 3I9NA 7MDHA 1Z7EA 4D43A 1C0IA 3F4LA 3M1AA 3DZJA 1Q1NA 1B2LA 4U6QA 4BO0A 4R5HA 1CIVA 2EHDA 4NDNE 1UZLA 5JPIA 5EN4A 4Q39A 1YOVA 1PJSA 3AK4A 3ZW9A 2EJWA 4BO7A 4FC7A 3PPIA 1VE9A 4FJ2A 1H0KA 3F9IA 3RCBA 3VZSA 3AU9A 3B1JA 4MVJF 4JP2A 3RJ9A 5IAAA 4GGOA 4XRGA 1U4SA 3QQPA 4OOEA 1I24A 4R69A 5T57A 1AE1A 3GUYA 5I7VA 1T2FA 5LDHA 1DLJA 4ZA2A 3AW9A 1B15A 2FMUA 3H8VA 3FR7A 1WMBA 2OMEA 3WGIA 1XKQA 1G0NA 4RQTA 4QFDA 1R0SA 5ICMA 2GLXA 4PGFA 3SJUA 5JO9A 2J3JA 5LDGA 3VZQA 4IS3A 3UOGA 4FR5A 3KHUA 1PS0A 1SAYA 2X5OA 4H15A 2NTVA 3H3FA 1PQPA 2ZTVA 1R4NA 4LVCA 1K6XA 4U5QA 4HKTA 3CE6A 1ZW1A 2XF8A 1E1MA 3GAZA 1UH5A 3NGXA 1SBYA 2GNAA 4J1TA 5FI5A 1GYQA 1ZSYA 1KVRA 2HSDA 3PJGA 4A5OA 5DCWA 4NPCA 1T2CA 2HO5A 2DUUA 3VKVA 4E2WA 5L7YA 2DFDA 1YBMA 2QHXA 3GZNB 3GHYA 4DIOA 1NASA 5BSFA 1Y9EA 1I36A 3RFVA 2Q99A 4BNZA 5T5QA 2BI7A 3SC4A 1WP4A 2FRDA 3PHLA 2RHCA 5L4LA 2E49A 4HV4A 2O4UX 2YJZA 4XDZA 3PZBA 4YRBA 4YQZA 5ES3A 4BO2A 3PGXA 1UDAA 2EXXA 3TFQA 1N9GB 2FN7A 2P5UA 4ZD6A 2F00A 1X1TA 3E48A 4RVDA 2JL1A 2YHUA 3H5NA 3MWEB 5IJZA 2P9GA 4Q3DA 1C1XB 1K3TA 4AJKA 1JLLA 1UDBA 1A27A 1DIBA 4DLLA 1NBOA 2DPGA 3DBHA 4B8ZA 5L51A 5A9TA 1LDNA 1QORA 5GZ6A 5K0ZA 1QV6A 4BB6A 5HS4A 1E3JA 2X5JO 2C0CA 2IZ0A 2A94A 2BF7A 4FDAA 4JQCA 5H83A 2Z1MA 1JU9A 2JJYA 1UXHA 2VQ3A 3GVCA 4JK3A 1B8VA 1N8KA 2A9FA 3MJEA 1TXGA 5DNAA 4EUFA 3FCOA 1LUAA 2OXIA 3LLVA 4MIYA 3QE3A 4O0LA 3CXRA 4QX6A 1R0LA 4BKPA 4CMEA 2ZJ1A 1X7DA 2NU9A 1A5ZA 3DMTC 2A92A 4PLVA 4YJHA 1U3UA 2H9IA 1R66A 1WW8A 5B37A 2B69A 3M2TA 1FDWA 1HYHA 3NKLA 4PLGA 4RLSA 1NPTO 4P4GA 4GX2A 3AOEC 2PFGA 3IKTA 3AUTA 3PYMA 3E9NA 1M76A 2BFAA 2RHRA 4FFOA 4Q3BA 1ISIA 1ONOA 1ZJZA 3LLSA 5G4KB 1Z74A 1KEPA 2AQ8A 4XZ3A 1KEWA 2WMDA 3BMOA 4KDFA 2UYYA 4PLPA 1VKOA 3QWIA 4YDRA 1HRDA 2X22A 4L73A 5KJFA 2IEBA 1S6YA 4YB8A 3JYLA 3CZMA 3BHJA 3FNHA 4YCAA 2J3IA 4CMHA 4CMBA 4Z9YA 1XHLA 3HHPA 3U4CA 4I1IA 2GZ1A 3NT2A 4EJMA 1KVTA 1LU9A 1MLDA 3DZIA 4J7UA 4K28A 1VL6A 4RO0A 3NTOA 1UXKA 5CFZA 1X13A 4AJLA 4CLEA 4UREA 1PGQA 3ON5A 4FJ0A 3C1AA 1YJQA 4CR7A 4DREA 1UZNA 2Y0CA 3GVIA 4BO3A 2AMFA 2FSSA 4FGSA 3VDRA 2C5EA 3ADOA 2WYUA 3PFFA 3K73O 3GN2A 3G1TA 4CQLA 4CLOB 2YY7A 4GKBA 1T2DA 3BZUA 3NDIA 4R16A 3TOXA 1W6UA 1E7SA 4E5MA 2X0NA 4ZVVA 4DQXA 4J4HA 5L3ZA 4BNIA 1KVSA 3AI1A 1XELA 2GRAA 5IXSA 2E6UX 1LRKA 4IJKA 2BMAA 2G82A 4ZQBA 5CEEA 5FEUA 3F1KA 3PZRA 1CQJA 3WGHA 4HY3A 5ER6A 2J3HA 5ER9A 4RPGA 2X0IA 2G1UA 1LLCA 1I0ZA 1GD1O 4PLWA 3W1VA 4CMIA 4BGEA 4CLRB 2ET6A 4IM7A 2OHXA 1MG5A 3H2ZA 4YRDA 5G0VA 3WQRA 3OJ0A 4FN4A 2NWQA 4MINA 2H1SA 4PZEA 4WLVA 4ZQEA 3Q9UA 2FPIA 4MVJH 1U7TA 2OP0A 3OF2A 4NQZA 3GFGA 4XYBA 1F06A 3F5QA 4DPMA 1JWBB 1YB4A 4Y67A 1MGOA 5JYDA 1SMKA 1TT5B 4E30A 2VWHA 5DCUA 3RIHA 1LC3A 4FQ8A 2PLAA 1I2BA 3W6ZA 3ZV5A 4IINA 1NFQA 1ISJA 2QRJA 2GR9A 4XIYA 1WVGA 3L77A 3UAGA 4CLXA 4YEDA 3ETGA 1H93A 2PR2A 3PDJA 1ZJYA 2GDZA 2GZ2A 3IUSA 3OH8A 4WCFC 1EVYA 3D4NA 3RC2A 1B0AA 4E5NA 1R4MB 4MO2A 1NX6A 2P4QA 2X0JA 2DBVO 3GH3A 2VWGA 4D44A 3QVWA 2VN8A 4CM8B 5JAIA 1GZ3A 3ZWXA 4R1NA 4AJ1A 1X7GA 5I9MA 3D1LA 3V1UA 3HE3A 4L4XA 2WM3A 3AWDA 4J6FA 1LA2A 2UVDA 3K5PA 4XB1A 5IN4A 1G1AA 1U7HA 4E4YA 1LRJA 2PD4A 1I2CA 1E3LA 3L6DA 3GG2A 1HDXA 1PL6A 2G0TA 3AM3A 5T67A 3UCFA 1X14A 1XIVA 2CNBA 4OQZA 2FZWA 3I6QA 4XD2A 1EVJA 2E48A 3AU8A 5DP2A 3ZCXA 1Y5MA 1HETA 3GPIA 3IJPA 1Q7CA 3NT5A 3BTUA 1E7QA 2Q49A 1Y8RB 3RUHA 4Z3KA 2P68A 1UZMA 2Q46A 2YDXA 3EDMA 4NG5A 1QV7A 1QP8A 5CDGA 4TVOA 3WGZA 2D3TA 5JDIA 2ZTMA 4J0FA 3JQCA 1BW9B 1HZZA 3I23A 3QSGA 2VCYA 2WD8A 3P2OA 4KWHA 3UCEA 3RBVA 3VH3A 4DMMA 4UEKA 3ABIA 3D4OA 2PD3A 3UFXA 5DT9A 1PS8A 1DAPA 3GA0A 4GMFA 1KEUA 3QY9A 5DN9A 1ZK2A 4NJMB 3GDFA 1Q7BA 4IXWA 1PSDA 2GF2A 3GOHA 4OAQA 4A27A 2WSBA 1ULUA 4IMPA 4YBZA 1ZBQA 4B4VA 4E2YA 4Z6KA 5L7TA 2VYVA 3UVEA 4U0JA 4AJEA 3JQBC 3H9UA 3ZHBA 3HDJA 4BS9A 1P3DA 1BMDA 2BFMA 4Q3AA 4RZHA 3WFIA 4WLOA 2CDCA 3SC6A 4J2OA 9LDBA 2CSUA 3VDQA 1U2DA 3OEYA 1X15A 1MXFA 3KEQA 4A0SA 4D7AA 1CRWG 1FDVA 1C14A 4OSOA 4CMCA 3HN7A 3KVOA 5JC8A 2HAEA 2HMVA 1GZ6A 1DFIA 4R41A 1XR3A 3ZV3A 2DQ4A 3MEQA 3PGJA 1N9GA 1FDTA 4OGWA 2RCYA 3ETEA 4RPKA 4HBGA 3GMDA 2ZYGA 3IMFA 4O5OA 4ALKA 5BNIA 3SXPA 3WWYA 4PZDA 1C1XA 1DJQA 2Y1FA 3OQ6A 2YQ4A 2BI8A 4WLEA 3JSAA 2ILTA 3GUCA 5IDXA 4MVJP 5COQA 1D1TA 2VUTA 3JYOA 3E6AA 1V3UA 5DP1A 4Z0HO 4DLAA 3WSWA 5B1YA 1HDOA 1EUDA 3NYWA 4E5PA 4INAA 2VYNA 3WNVA 3MOIA 1SOWA 4G5HA 1GEGA 3ZV4A 4LSMA 3ZN2A 1U3VA 4K1LA 1GUFA 4WPGA 4B4OA 5AVOA 2G5CA 5IXYA 3D64A 2UDPA 4N5LA 2BFPA 4FIZA 2HUNA 5JY6A 4IDDA 2PKQP 1GQQA 3V2HA 2AQKA 3ZZNA 3DEYX 1YL5A 1O8CA 4M8SA 4L76A 1YXMA 2NQ8A 4L75A 5EJ2A 5I9LA 1QR6A 1BSVA 2W2LA 5GZ1A 3RVDA 4FJ1A 4U8GA 4YT2A 4OKNA 3CZRA 2JCVA 1W73A 2OUIA 4UVEA 4RVFA 1N1GA 3GRPA 3H9GA 1E3WA 3JQ8A 3LVFO 3JQ9C 4UVIA 2D8AA 3RKUA 3JQFA 3TL2A 5TX7A 4R54A 2YV1A 4RVHA 3LQFA 3LT4A 3NAQA 4MP6A 3MCVA 4R1UA 3UN1A 2AG5A 2X9NA 3IUPA 4R5MA 4TZKA 5BSGA 1AXGA 1ZNQO 1RM5A 2Y1GA 2VYVD 5EESA 4BQPA 1RM0A 1Z75A 3FBTA 4XYLA 4CMKA 4RDIA 2NVUB 1MG0A 2GPTA 3OJOA 4WEQA 4PVDA 3CIFA 3ZU2A 4WUVA 3NJ8A 3RC1A 1YRLA 1GUYA 1PZFA 2QQ5A 4TZTA 2DUWA 3K30A 5KVSA 1PGOA 1CYDA 2ZATA 3EC7A 3DO5A 3H5RA 3KXDA 4E3ZA 4HFRA 4JJFA 5F1PA 1Z73A 4CLOA 4IIVA 2H63A 4NH4A 4QEDA 4F46A 4DA9A 4YRAA 4YJDA 3PIDA 4BNYA 4FGWA 2Y1CA 2CVZA 2RAFA 3AUSA 1B3RA 1YONA 4NFSA 4X54A 3SVTA 1UAGA 1FF9A 4FFNA 2IXBA 1U5AA 4JBGA 3K92A 1GV0A 4E21A 4WASA 1Q0QA 1WNTA 2QZZA 2WYWA 3DBHB 3I9JA 4CM4B 4EUEA 4CLRA 3BA1A 4DL9A 3UGKA 4H3VA 2Z95A 3C7DB 1TA4A 3DTTA 3H65A 1KIFA 5TSDA 3UH1A 1P1JA 2D5CA 2DVMA 1ULSA 3HJAA 4MVJA 1WZEA 3CMCO 3Q9NA 1JTVA 5C7IO 2DC1A 2FZEA 4IJUA 4Z0TA 1O89A 9LDTA 4C7JA 3ADPA 2DKNA 3ZDFA 4IDGA 3MTGA 2RH4A 2O23A 2EKLA 4W9NA 3T4XA 1R37A 1TT5A 4I9UA 3TZHA 1P1FA 1N5DA 3ONEA 4YJHB 1EDOA 5I7SA 4AL4A 3RBZA 1Y6JA 4AJIA 1XU9A 2EKQA 5KJ6A 3WLFA 3JQDA 3BMQA 3HQ4O 4BKOA 3C1OA 5KVCA 2W90A 1QRRA 3GVPA 3BTVA 5JS6A 1WPQA 1R12A 4DPKA 1Y5RA 1HYGA 3FR8A 4ZJUA 2O3UA 4JX8A 1U2GA 3ROMA 3GQVA 1R4MA 1EE2A 4OXYA 3ZWAA 1ADGA 1ISMA 1HDZA 2C5AA 3H9JA 3JQ7A 4R1TA 3VZRA 1HEUA 1ZXLA 4LMPA 2RH8A 3TDKA 5ADHA 2OORA 5JMPA 3C3XA 3U4DA 3QVOA 5CEFA 3PYXA 3O4RA 1XSEA 3HADA 1VL0A 3OSUA 2ZTLA 1PWZA 1Z45A 4BMVA 5L45A 4JLWA 3UXYA 4KQXA 4XQ9A 3INTA 1P31A 4BKQA 1HLDA 3RC9A 4J7XA 2HRBA 1ZEMA 3IIEA 4URFA 2X0RA 5JE8A 5JSFA 3H2SA 3R3JA 5F1KA 5G4LA 4CQLB 5FWNA 1YO6A 2PZMA 3L4BC 4D46A 3KLPX 4BV8A 5BQFA 2OBYA 1PGJA 4BIIA 2B5WA 4YJGA 3W6UA 3KSDO 4YAKA 4TMFA 3HUDA 2X23A 4U0KA 5JDCA 2CVQA 3PTZA 4HNHA 3M2PA 4DIBA 3SLGA 2P2SA 3OMLA 3U5TA 1JAYA 2BGMA 1BW9A 2FY8A 2B4RO 1JKIA 4I08A 4CJXA 4NMHA 4AICA 4KTTE 1XEAA 1XWFA 1UAYA 4ONEA 3PWKA 3Q2IA 3IP1A 4MKXA 5FI3A 1Y7TA 2V65A 4QO7A 1VRWA 2IRWA 4ALIA 1UR5A 4CMIB 1AUPA 4J49A 3CINA 2PV7A 1T2EA 1E3EA 1MA0A 5TT1A 1PZEA 4MVJD 1X1EA 3B70A 3O8QB 2VZ0A 5JXWA 3PEFA 4NJMA 3RFTA 1ZXBA 4RPLA 5EMHA 4DQUA 5JY1A 4AJJA 3WTBA 1XLTA 1HDGO 3I83A 3PXXA 5A9SB 3ANMA 4BUCA 1D3AA 1QG6A 3RQSA 3H9QA 4HFMA 3TL3A 1G6KA 1EK6A 2BHLA 4DVJA 3QLJA 4FSHA 1XA0A 2B83A 1YE3A 4F45A 1JN0A 2YW9A 2JD1A 3U3XA 3ASUA 1XQ6A 3PFWO 4CMEC 2Y1DA 1E6WA 4OL9A 3WS7A 3ITKA 1GZ4A 2GN9A 3ZNQA 4BO1A 3I9OA 1DLIA 4KP7A 5KJEA 4XKJA 1UP6A 1JDJA 3AI2A 3RROA 2BELA 3PWSA 3C85A 4UAGA 2NM0A 3WBFA 3U9LA 1DHTA 4XYEA 2FOIA 1Z7BA 5HRUA 3HZZA 4TVBA 5F1OA 3HB4X 1UJMA 3BIOA 2YV2A 4ROSA 5IG2A 1O94A 1LSSA 4A73A 1GCOA 2EWMA 4B8WA 1X7HA 4BMNA 3R0IA 3IJRA 2O50A 1ARZA 2XAAA 4OSPA 3ZHXA 3ENKA 3ZNOA 4AFNA 1IY8A 2O2SA 2GN6A 3PIIA 4RLHA 2EGHA 3ULKA 5KIAA 2HQ1A 5KNLA 4WKGA 3EMKA 4A03A 1BXGA 4GWKA 5A3JA 3KYDB 1I2ZA 4LMRA 2R00A 1DIAA 4J0EA 2FR1A 3VH1A 2HLPA 4FFPA 2D5AA 2Y05A 4XYGA 1JA9A 2GN4A 5DBIA 4TRMA 3V2GA 1C3VA 3TZQA 4MP3A 3ETDA 4QT0A 6LDHA 4PCVA 4RV9A 4G81A 1M75A 3X2EA 2B5VA 2DLDA 2PH5A 2EV9A 3A1NA 4CV3A 1DBVO 3ZWYA 4CLDA 2Y0EA 3WFJA 4OIMA 1E5LA 3PLRA 1ZZEA 2I6TA 2Y93A 4I9NA 4S3MA 4K6FA 1HE5A 2IXAA 2OL4A 4NBVA 1PGNA 4XA8A 5EIOA 1UXJA 4CUJA 4A26A 1P77A 2GN8A 1H2HA 3GLQA 1BDMA 3E9QA 4BO4A 1A7KA 3EYWA 2JFFA 1Y81A 1PJTA 1R6DA 2C07A 1HKUA 1PX0A 2NVUA 3TOZA 4BO8A 2Z5LA 4XJTA 3KETA 1J4AA 1E3IA 4KQWA 4QQRA 4A2CA 4NBWA 4WLUA 2O7SA 3OA2A 3KSUA 3DTYA 1R0KA 3GC6A 2ZB4A 4GX0A 3JV7A 1ZMTA 3OHSX 5AOVA 5IZCC 1HDRA 3E9MA 1KVQA 4FD3A 4ND2A 3ZWOA 1GYRA 4UUOA 3R1IA 2JKVA 1T2AA 3PRJA 1V6AA 3K2BA 2ZQYA 2YV3A 3IOYA 1X0VA 4U7WA 4CR8A 3OIGA 1I10A 4I8XA 1YS4A 1LDYA 1E1KA 4IGEA 3O38A 1BGVA 2WDZA 5HWSA 2Y67A 3GGGA 1NVGA 2CZCA 3UICA 4XX0A 3OICA 3WGTA 1LTHR 4DBVO 1T26A 3FWZA 1EFKA 4RF4A 1Y1PA 2V7PA 2WE8A 2I66A 3ST7A 4FOOA 1NQTA 3GEGA 5MGBA 4CM4A 5COAA 4E0BA 3GFBA 5KOIA 3WICA 4BNFA 2HDHA 2CUKA 1CJCA 2XXJA 4KWIA 4DYDA 3DR3A 1PJBA 3KYBA 4JXKA 2PZJA 1KEVA 5HTOA 4IZIA 3C7CB 3GF4A 4BV9A 1HT0A 4D3SA 1WLYA 3FI9A 1F17A 4QSMA 4BNLA 4RVUA 3F5SA 3HFGA 1NQOA 4CM3A 4YYZA 3OJLA 5T8KC 3KRTA 3D3WA 1CEQA 1IB6A 4D45A 2E37A 4IXTA 4DRYA 2POQX 1DC3A 1U8FO 2PH3A 3GEDA 2CD9A 2Q2QA 1E7MA 3PDUA 4CQMD 2IZZA 5JDIC 2Q3EA 1DB3A 5TJ9A 1ZK3A 2YUTA 1E3WB 3JQ8B 3NDRA 4E5KA 1U4OA 3KOUA 2FR0A 3AY3A 1UXGA 3TF5A 1KC3A 1ZK0A 4F6CA 4F3YA 2ZYAA 2DM6A 3OETA 5K6AC 3LC7O 2VZ9A 4DLBA 1LSUA 1OZAA 1TVEA 4RQUA 2IYPA 4BQRA 1XU7A 1VSVA 1NTOA 4B7CA 2HMSA 2VHYA 4K6CA 4CM6A 3KYCA 4ZQGA 4FPXA 3OECA 4FFRA 4WE3A 4Q3EA 4GI2A 5JCXA 4ID9A 3UKOA 1I30A 3K31A 4PG8A 4DIFA 1IOLA 1DFGA 1OMOA 5DF1A 4MPDA 1EZ4A 4MKRA 2V6MA 1FK8A 1OI7A 1LLQA 1I5RA 2Z1NA 5ICSA 2JCYA 2WJPA 3QV1A 4A10A 1BXZA 2PK3A 4ZQHA 1LX6A 5C7OO 4JIGA 3DHEA 4CV1A 3PWZA 5A05A 4EGFA 4YAEA 2JHFA 5CDYA 2O3QA 1IYZA 5U4QA 3WJAA 4GSKA 2P4HX 4QXMA 4L4SA 4NR0A 2X6TA 4NNJA 1E1NA 1GYPA 1IPFA 2VZ8A 3VVBA 1TT7A 3FHLA 4IGFA 1SNYA 2B0JA 3BTOA 3F4BA 3G3EA 3O8QA 4DXHA 1NWCA 1GPJA 1LXCA 1A71A 4O59O 4DYVA 4J7CA 5A9SA 2C7GA 2VWQA 3DAPA 2ZIZA 3LF2A 4BO5A 5JO0A 1ISHA 2FP4A 2UV8A 3QRWA 1F8FA 5CG2A 1P45A 5EINA 2YDYA 4MIOA 3DAGA 1E5QA 1DRVA 2W4QA 1NPDA 3ZGYA 4B4UA 1AHIA 2VT3A 1PJQA 2WD7A 4R9SA 5B4VA 3NUGA 3PYLA 4TKLA 2CDAA 3BMQB 1BWSA 5I8WA 4IQ0A 5TIIA 1PR9A 4YAIA 2GO1A 3E8XA 3L6EA 4BNHA 3GY0A 1E7YA 2TMGA 2IYOA 3JQ7B 1ENOA 1HLPA 2JFHA 5LCXA 5B4TA 2B4QA 2AEMA 5AXCA 5B12A 3MOGA 4Z0PA 2W2KA 1QKIA 4HFJA 1AN9A 1SC6A 5FF9A 1SB9A 2X9VA 2PNFA 3NTQA 3QVSA 3B1KA 1S7CA 3UF0A 3E03A 1YQGA 3UUWA 1M6HA 1H6BA 3JQ6A 4OM8A 2DBZA 2VTEA 4BO6A 1JVSA 3C8MA 1YWGO 3RI3A 3A4VA 3AY7A 1VC2A 2HRZA 3HG7A 3KYDA 5BNTA 1OFGA 2P9EA 3U0BA 3OFSA 3ZU4A 3ZNPA 2EGGA 3KLMX 4H7PA 1P1RA 3WIEA 4PFJA 2BH9A 1MFPA 3GGPA 2NV6A 1P9LA 5H82A 1NAHA 3KB6A 5HA5A 1V8BA 1B3BA 4TRRA 2PY6A 4D3FA 4IIUA 4WLFA 3DOJA 4B7UA 4N5NA 3G49A 3UW3A 4EZBA 4YJGB 4I9HA 5HS6A 5DOVA 3C7AA 1LI4A 1PQWA 1GV1A 3D0OA 1C0PA 3AI3A 4BO9A 4B3JA 4EJ6A 2I9PA 4L8VA 1E7WA 1VL8A 3L9WA 3DMTA 4LSWA 1IZ0A 1HDYA 4BB5A 5A02A 4JN6B 1KS9A 4DUPA 4ZQFA 4W99A 2AHRA 3X2FA 1EK5A 1EQUA 3AOEA 3JCZA 4BHTA 4ALLA 1ONNA 1O0SA 5U1PA 2B4TO 5TRTA 5TQVA 1GDHA 4QUKA 3TJRA 3WQSB 3ZWNA 1ZO8A 4BNGA 3G17A 1LSJA 1J6UA 2I67A 1NVTA 4CV2A 2AW5A 1M66A 2JAPA 1K6JA 1GTMA 4EJ0A 2NUAA 4IQGA 1EE9A 1IHXA 2DFVA 4L9RA 5IN5A 4J1SA 5GY7A 3V2UA 3EVNA 4EUHA 4BNMA 3RU7A 1GCUA 1FDUA 2JFGA 2VT2A 2WYVA 3EZYA 5JFOA 2VUUA 4IJWA 2Y66A 4NBRA 4NBTA 4YQYA 1A7AA 3IQDB 4DMLA 3I9MA 3OP4A 2OBNA 1E7RA 2NSDA 1U9JA 2JHGA 5KVQA 1A72A 1RJWA 5A5FA 1EBUA 3DZFA 2NQTA 4P38A 2R6JA 2AE2A 2C7VA 3DL2A 3CKYA 2HMTA 3G79A 4MP8A 4UEJA 1DEHA 4BNTA 1UP7A 3PVZA 3VZPA 5CPBA 3ROQA 3WYCA 1BXGB 3OIFA 4EITA 4ZHSA 2X5KO 1HE2A 2PGDA 3E5RA 2IODA 3ZWPA 4ZGWA 3VPXA 2HKIA 2VRCA 3L0DA 2YHIB 3QP9A 1DRWA 2O7QA 3FNGA 4ND4A 4NI5A 2B36A 4J90A 3L4SO 1YBVA 4ZRMA 5TNXA 1LDGA 1RKXA 3BTSA 3GZ4A 5KKCA 5L53A 1KBZA 3IS3A 1L7DA 4HUJA 3IKVA 4I5FA 3JD2A 4LVUA 4CM7A 3GT0A 1QSGA 2XXBA 3WJ7A 4QECA 5JDCC 3S8MA 1YKFA 1LBEA 3TZKA 4WGGA 3JTMA 4AJHA 4K9DA 3ZHYA 3PI7A 4CQMB 3DBVO 3DQPA 5A1TA 5C7LO 1LJ8A 2O4CA 4XDYA 3F3SA 1EUZA 4XR9A 1QYDA 4ND1A 5EERA 1YQDA 4MDHA 3INGA 4OYRA 3W8EA 2HCTA 4CL8A 4PG6A 3RD5A 4NFYA 2QZ9A 4YT8A 4GWGA 1JKJA 2WEKA 1KY4A 1U5CA 2J5RA 1YB5A 3KSZO 2XOXA 1E6UA 4GBJA 5JAZA 1CETA 4CV0A 4LRTB 4CM9A 1MB4A 4M86A 1CERA 3BMCB 5JAMA 4LGVA 5JCJA 5ITVA 1J0XO 3IAHA 2VTDA 2Y1EA 4YACA 5DULA 4EDFA 3O03A 3GK3A 5KJ1A 4BMSA 4IJVA 4B79A 1CF2O 1N2SA 2CMDA 3ONDA 3PP8A 4LN1A 1BRMA 3BXXA 1JVBA 3GPDG 1PL7A 1I32A 3Q2KA 3GDGA 1LQTA 1IULA 1SPXA 4TQGA 3WMWA 3I4CA 4BNKA 3PHHA 4CUKA 3BAZA 1DSSG 1GEEA 2NACA 3LZ6A 3JD0A 2PZKA 3D5TA 1PJ2A 4PN3A 3ASVA 1AHHA 2RBEA 2DBRA 4Q3CA 1IL0A 2GERA 5IDYA 2Y1OA 3WOHA 3QVTA 3U62A 3WGGA 1MC4A 1ZVMA 1MUUA 4LW8A 3ZH2A 3EHEA 2O2YA 2EW2A 1OC2A 3QWAA 3RKRA 4P8RA 4WK6A 2DT5A 5A4DA 1DJNA 2CF6A 3H4VA 5TS3A 1HL3A 1P1KA 5ENDA 4B7XA 1GQ2A 4PLHA 4R9RA 4OQYA 1NVMB 1T25A 1PJLA 5I7EA 3DONA 2O3RA 4E31A 1DC5A 4AJOA 2VRCD 4BNNA 1V0JA 4OXKA 4B3HA 3OEWA 5IDQA 1K89A 3LT2A 4EEZA 1ISFA 4LISA 1EBFA 1O9BA 3D3WB 1NR7A 3GNTA 2DTXA 3GG9A 4FC6A 4CR6A 1SB8A 1GR0A 1YBAA 3JQBA 4KUHA 2QW8A 4GKVA 2E4AA 2JD2A 3AFNA 3IDSA 1XDWA 3K2EA 1MX3A 4XWYA 1VJ0A 3RUDA 3A28A 5H81A 3NJ4A 5T64A 2BGLA 3LT0A 4GLLA 4KZPA 1HF3A 3GDOA 3RAJA 1F12A 1D8AA 1ZH8A 1CDOA 5G0SA 4W4TA 2XPCA 4JP3A 2Q1WA 4RPJA 4CM9D 3I1JA 2HJSA 1ZEJA 4QFCA 5JCJD 1WXDA 2PKRA 4PIVA 1K0UA 4Q9NA 1LQUA 3KYCB 4A7PA 2VHXA 1E92A 3ENNA 2PWZA 4ND3A 2VOJA 2G76A 4GMGA 5JW6A 2IE0A 1BVUA 4R51A 1KC1A 1W8DA 4IDCA 3KUXA 2Q45A 5A3VA 4IDBA 2X86A 3C24A 3QWHA 3ITDA 4R3NA 1O6ZA 1VSUA 5A04A 1ZKMA 2ZB8A 1QXSA 2QRKA 1J5PA 1I3KA 4D41A 3VHRA 4JCOA 1I3NA 3FN4A 3RUAA 5IZ4A 4M1QA 1ZCJA 5K9ZA 1ONPA 3EAGA 3MWDB 4M49A 4I5GA 2UUPA 1YDWA 2WE7A 4G2NA 3KO8A 4EYEA 2O48X 2I76A 4OMUA 5JYEA 1ID1A 1EMDA 2UUOA 4CM1A 4JJGA 3I9LA 2EJVA 3AFMA 1IUKA 3M1LA 4PRKA 1DFHA 1Y9AA 5CHEA 4KDEA 1PZGA 2X9GA 1K6IA 3JQ9A 3EK2A 2C20A 1NNUA 4GPD1 3S2GA 1B8PA 1G0OA 3N58A 4O6VA 5TC4A 4BOYA 1RPNA 5AQ1A 3GVXA 4TSKA 4XB2A 3TSCA 2QX7A 3SJ7A 4RCVA 4F6LA 4S1VA 5KTKA 1YDEA 4M55A 3HSKA 4NZ9A 1U28A 3RU9A 1YB1A 4EEXA 2Q4EA 2WD7B 1P0FA 4YVFA 5I7FA 1QYXA 4IDAA 2J5KA 3BMNA 1O5IA 4R68A 1NXQA 2BKAA 2HJRA 1I01A 3DBLA 4II2A 4WJZA 4Q3NA 1Q7GA 2IDZA 4HNGA 1B8UA 1JW9B 2CVOA 4O1MA 3KV3O 1H6CA 1KERA 3VPHA 5F5NA 3HNPA 1BG6A 2I3AA 4Y6SA 4PG4A 1DIGA 3GMSA 3WIDA 1I3MA 2EEZA 1MP0A 2W2KB 5L40A 2YFHA 1GPDG 3AUAA 2EKPA 1QMGA 3ANNA 3RFXA 4MVJM 4RZIA 2PA3A 1HZJA 3A06A 4CMJA 4MIEA 2O3TA 3OBBA 1WDLA 1ZUD1 4H16A 1GY8A 4YAJA 5L9AA 3OQBA 3AM5A 3IL2A 3ANLA 2QYTA 1U3WA 4M89A 2CF5A 4ZRNA 4AJNA 2EF1A 5GZ3A 4J1QA 5ITWA 3I4FA 1PTJA 2PGJA 1NP3A 4RJTA 3NT4A 4IDEA 1HE3A 3N74A 5B4UA 1ADCA 1BXKA 5CDUA 2YHIA 5F5LA 5C37A 2YYYA 4N54A 3AOGA 1TEHA 3QVXA 1PIWA 4GAEA 4QTZA 4XQCA 5FYDA 3WGYA 4KTVE 4WNCA 4UVGA 2C2XA 4W7IA 5EPOA 3GVHA 4MKZA 4CQMA 4GVXA 3DZBA 4N7RA 1P44A 4OHUA 3VAZA 2Q1UA 1EVZA 1R16A 1H9BA 5I9NA 1V3VA 2JD0A 4NU6A 4E12A 3VH4A 4YWJA 1GL3A 2UAGA 3V5NA 3ZU5A 4XJSA 5L4NA 1P74A 2GSDA 3S2EA 3FD8A 2QIOA 2ZCUA 2IEDA 3V8BA 3T4EA 4ALMA 1GU7A 1M2WA 4DGSA 3BMCA 3I6IA 2VOEA 4IQ8A 4XQGA 5A06A 2AA3A 3NEPX 2CY0A 3FTNA 3QIVA 2GZ3A 4IS2A 2C82A 1EEHA 3D4PA 1NYTA 1OC4A 3FRJA 1JKFA 5CDSA 3WBBA 2NADA 3HWRA 1LDMA 1C1DA 3EZLA 1MC5A 4JROA 3KZVA 2HK7A 4WCDA 1HTBA 2YQ5A 4KUGA 4ND5A 3WYEA 4NFHA 3DOOA 4OH1A 2ZQZA 3K96A 5AYVA 1KYQA 4CUZA 1GAEO 2AE1A 3JQAD 1KOLA 1V35A 5EQFA 1XYGA 3U49A 5CAEA 4NIMA 4EBFA 5DDIP 5JC1A 3L4BA 3R3SA 3DOCA 4CL3A 1C0LA 1QYVA 2RIRA 3DMYA 1JAXA 1GADO 4XQEA 4BNJA 2V6GA 1XCBA 3WGOA 1IPEA 3UHAA 3VVCA 3PLNA 3LC1O 3DFUA 5F21A 4JGBA 3JQGA 4TWRA 2R2GA 1IE3A 4E2XA 1ORRA 3NDJA 4RORA 4YR9A 4Y98A 3VTZA 1N1EA 5CDTA 4GLOA 2VHVA 2Y99A 1NFFA 1T4BA 2NTJA 4PZCA 2AG8A 1HE4A 2GD1O 2JAHA 4BKRA 4TKMA 2Q50A 3BHIA 1ADBA 2EIHA 4LCJA 4Y8VA 1I33A 1U3TA 2BGKA 3DC2A 4BNWA 4J2HA 1ZIDA 3E1KA 3H9EO 3D3EA 1U1IA 3ICPA 1DXYA 1WDKA 3STHA 4ZICA 3W8DA 4BNXA 3SLKA 1P0CA 1RM4A 3V1YA 1DPGA 1VLLA 4M54A 2FPGA 3FWNA 1RYEA 1YH3A 1K2WA 1LNQA 4B4WA 3I52A 3LK7A 3TWOA 4OJNA 4GX5A 4NBUA 3S2IA 2Q4BA 1HWYA 5L4SA 4WCFB 4CLHA 2O3JA 5AXBA 4QO8A 2W98A 3S1LA 4LCEA 4KUEA 4AJ2A 2H5LA 4PVCA 3E5MA 4G65A 3HDYA 3FF4A 3JD4A 3GNSA 1VJ1A 4MVJG 3KM0A 4MOWA 3OA0A 3K8ZA 1CQIA 1NQ5A 2EP5A 3PK0A 1A4IA 1PJCA 3F1LA 4HXYA 4R1SA 1PS9A 3DBRA 1NHGA 4ESOA 1C0KA 3KEOA 4R01A 1AGNA 3AM4A 3OIDA 1PWXA 5CPFA 4RF5A 4OO3A 5HM8A 3PJEA 1Y8QA 2PGLA 1BHSA 1EQ2A 4WECA 5C3MA 1H94A 1DO8A 4MJLA 4W7HA 2HU2A 3MJ4A 1I3LA 1IHYA 4E13A 2GGSA 3K6JA 3H3JA 5THQA 4LRSB 1YQXA 4IY1A 2BLLA 2AXQA 4NHEA 2A4KA 3NTRA 2BFOA 4II3A 4RF2A 3WB9A 4CODB 4OOFA 3ZW8A 5BSHA 2D0IA 1DRUA 3Q3CA 1E1LA 3FPCA 3PHIA 4JNKA 2QG4A 4YAGA 1D1SA 5J23A 2G17A 2FWMX 4DC1A 7ADHA 4AJPA 2OGUA 3WR5A 3FSRA 1H6AA 1VJTA 2VNSA 3WNQA 3I9KA 3JYQA 1F14A 5DBFA 3ZHZA 3WWZA 3RBXA 1EFLA 3FTPA 1ENZA 4XYMA 1SO8A 2Q1TA 4L74A 4ALNA 1EDZA 2YFQA 5G2OA 4GSLA 5JBIA 1QYWA 3KTDA 4UULA 3ZU3A 4L0QA 3F6YA 3Q6IA 3KBOA 2DAPA 2DPHA 3GAFA 3LC2O 3RUCA 1DC6A 1RWBA 2JCXA 1LSOA 1LEHA 3AY6A 2B35A 4PG7A 1MV8A 5BSEA 4YJFA 1N92A 1PQUA 5TGDA 2DBQA 5TF4A 3QA9A 2NVWA 1IZ9A 3PHJA 3L6OO 5IZCA 3NRCA 3N7UA 1NQAO 2A35A 4Z9XA 1TB4A 4YT5A 2ZTUA 4CMGA 3SEFA 4XGKA 4PLCA 4J16A 3WGQA 3JQFC 1PR3A 3SBOA 1GQYA 2ZB3A 1A9ZA 4UUMA 1PEDA 3G0OA 2AEJA 3IC5A 2X1HA 4E6PA 3LT1A 3W4JA 4W6ZA 3CTMA 4HWKA 8ADHA 3JYPA 5AXAA 1A9YA 4XRRA 5F3RA 5T6BA 3QW2A 1OOEA 4Y9DA 3BYZA 3M6IA 1KVUA 4FBGA 2PZLA 1EVIA 4GGPA 4J3FA 3ZWVA 3P2YA 4GL4A 2VHZA 5BR7A 4E2ZA 3A9WA 3CPSA 1PL8A 2ZB7A 1T24A 5IF3A 1NPYA 1RYDA 1U8XX 3NX4A 2E82A 2C29D 3TRIA 1ZK1A 3VC7A 4GH5A 1R15A 4FOSA 4MVJE 3HB5X 1W0CA 2PD6A 1DIRA 2D59A 5EL0A 1B7GO 2H6EA 2EP7A 1VPDA 1ZSNA 5C5IA 3VPFA 1PZHA 3INRA 3D5QA 3QJ5A 3U4IA 4D0RA 3DZHA 5T8KA 4BKUA 4Y6PA 4P22A 4C4OA 3GR6A 4BGIA 4EW6A 1LDBA 5JNLA 5FFFA 3ROPA 1L7EA 4JBIA 4RL6A 1YVEI 4I5DA 5COBA 2FSVA 1Z6ZA 4J9UE 2D4AA 1HSZA 1RM3A 3DAFA 4BGVA 3U4HA 3OQ1A 5IFLA 3TFOA 1O95A 3D7LA 5AXDA 3LSYA 3TPCA 3I5MA 2QRLA 3QWBA 3K9QO 3DXFA 4ZU3A 5K6AA 3COSA 5LC1A 1UDCA 3DHYA 4HP8A 1FJHA 2ZJ0A 5TT0A 3U09A 3MJCA 1KETA 1V9LA 3W4KA 2I5PO 4AJ4A 4W82A 4JBHA 5U9CA 4W9NC 4XCVA 5KCZA 3I3OA 1SEVA 3EVTA 1XG5A 3PJFA 1L1FA 3BMNB 1BTOA 3PQDA 4FW8A 3VOSA 4BGUA 4N18A 5BT9A 4R3WA 1WWKA 1ZK4A 1JQBA 1HXHA 3DBLB 1SOVA 2W8ZA 2P9CA 3GZNA 5A03A 3W4IA 3MJVA 3WQQA 3NV9A 3Q1LA 4ILKA 1QLJA 5KVVA 4E32A 2IZ1A 5KJCA 3EGOA 2NNLD 5KWEA 3JQAB 4P4LA 2I65A 4IPTA 1FMCA 5HBRA 2O3SA 4B3IA 1SZJG 1F0YA 2DTEA 3RUIA 4J4TA 2PTGA 2ZCVA 2Y0DA 1HSOA 2CDBA 4D0SA 4R4JA 3DZKA 5EQDA 5ILOA 1VM6A 3FBGA 4GQAA 3TZCA 3TZ6A 3WLEA 3EW7A 3ZI0A 5CEJA 4NU5A 1LDEA 3CEAA 3GN1A 3P7MA 1NHWA 3IP3A 5G0TA 1BVRA 2V6BA 1DC4A 3JYNA 3ZV6A 4WOKA 3PJDA 4P4NA 1V3TA 1YL7A 5THKA 3CUKA 4PLZA 4IBOA 4D3DA 3B6ZA 4NK5A 3Q11A 1KY5A 4DTIA 1Q0HA 4HFNA 1LC0A 1YOVB 3A14A 3L9XA 3NGLA 4PLTA 2EW8A 4WLNA 5GMOA 1TLTA 4YXFA 3HDHA 3T7EA 1DIHA 1E3SA 1NM5A 3T7CA 4IMRA 3RC7A 3CH6A 1H2BA 3GRKA 1T4DA 3MJTA 4FCCA 3DB2A 2I99A 3HFSA 5DCYA 3RSHA 3FNEA 4E33A 4K26A 5JAQA 3ZWMA 4DPLA 2ZKLA 1YGYA 3JD3A 2CFCA 2V6FA 3C1TA 1ENPA 3JQEA 4PRLA 4YPOA 2Q2VA 4WCFA 3TNLA 5DOZA 5KKAA 2VNAA 5BNFA 1MXHA 2I3GA 3HN2A 3MTJA 3OJFA 4PLFA 4WOJA 5G4KA 1OAAA 4DQVA 1CWUA 4XR4A 2GASA 1WZIA 1NAIA 2B37A 4RF3A 1N7GA 1R4NB 2DU8A 1XQ1A 2F1KA 4RVSA 1E6EA 1P33A 3LU1A 3EUWA 1GFSA 2HMWA 4IZHA 2VRBA 4CMAA 3AUUA 4PLYA 1NFRA 2YZ7A 2EG9A 3QWFA 1C1DB 5G0WA 1UXIA 3H5AA 1DAOA 4GVLA 3ONFA 4DBZA 1ML3A 2X4GA 4FFMA 3ZWWA 2VWPA 3BHMA 3F46A 3VH2A 4BNVA 4J9VA 1H6DA 4NJOA 2FPPA 5ILGA 3GGOA 5DZSA 1LLUA 3ROKA 3DFZA 4TRNA 2OP1A 1ISGA 2X8LA 4IUYA 4UEOA 3H6KA 2SCUA 1N7HA 2J6IA 5A9RA 4UUPA 2GCGA 2BD0A 1QLHA 2HK9A 1H5QA 1SCUA 3JQGB 1VKNA 4PG5A 4RGBA 1MFZA 2C54A 2Q2WA 4C7KA 3S55A 2OZPA 4ITUA 4DWVA 2X58A 1ENYA 1WAMA 5JLAA 3LYLA 3W8FA 3QHAA 1OBFO 1SEPA 3OM9A 1J49A 4YTEA 2VYND 1TI7A 5I8ZA 2R00C 3OJEA 4OKIA 4Z9FA 4WNIA 3VPGA 3DZGA 3VPSA 2OFPA 3L07A 4ZN6A 3O9ZA 4KMSA 4XEHA 1M67A 1Q0LA 3F47A 3GEMA 3TN7A 1AXEA 1B26A 2D2IA 4XIJA 3DWFA 1T1RA 4GX1A 1B14A 3PQFA 1NR1A 3MZ0A 4UVHA 5L95A 5DBGA 2FR8A 4CPDA 4DC0A 4BVAA 1PGPA 2AQHA 4YA6A 2J8ZA 2VHWA 2NU8A 4FFLA 3CMMA 3WDSA 2VUSA 4LK3A 3VKUA 4J4BA 2W2LD 3B20A 3RUEA 4IDFA 1H9AA 4XGNA 4BL5A 3S2FA 1A4UA 2LDBA 3GHHA 3E18A 4RDHA 1LLDA 3O26A 3P19A 3R6DA 1PU2A 3ICCA 2TMDA 1EUCA 5L7WA 5CG1A 3LF1A 3WMXA 1P1IA 4ALJA 1XGKA 2PKQO 3VTFA 3BMOB 4J43A 2J3KA 4JJIA 3G1UA 5A5EA 4MVJI 2HMUA 4CM8A 3DHNA 3WSVA 4O63O 4RPHA 3DBRB 5IDWA 2DTDA 1GUZA 1P1HA 1WMAA 1I8TA 3CSDA 2C59A 1HYEA 4HADA 3RJ5A 1Y8QB 4RVGA 1Z82A 5G0UA 2WTBA 3B1FA 4M87A 3E82A 1HDCA 3WYBA 2LDXA 3WX0A 3ZWCA 5ENVA 2NU6A 1ZSVA 5TLSA 3JD1A 2NLOA 1DDOA 4NK4A 3MJSA 2NU7A 1UUFA 1D7OA 1Y8RA 1DHRA 3TQHA 1PJ3A 2C2YA 1B16A 2Q1SA 4OXNA 4J1NA 4TROA 6ADHA 1D4FA 3EY4A 3FNFA 3ORFA 4Z3DA 3Q0EA 1FXSA 3LDHA 8LDHA 1WDMA 4UVDA 2OO5A 1LRLA 2OOSA 1NWHA 4D79A 2P5YA 4UUNA 1FDSA 4EI2A 2EERA 1ZFNA 2AQIA 2J5QA 5MDHA 3HDQA 2AEFA 5TJHA 2GYYA 1YL6A 4BNUA 4YT4A 2ZK7A 3RUFA 1X0XA 4FB5A 1BDBA 2NVBA 1DOHA 1F8GA 5CP8A 3ZWBA 2GUGA 1YJ8A 3V1TC 3WG9A 1E77A 3ZNNA 2Y68A 2ZYDA 2FHSA 2D1YA 3AJRA 3H7AA 4FS3A 3WXBA 4YJFB 3GNQA 4I5EA 4U6SA 2WWRA 5JMWA 1PJ4A 1E0DA 1Q2XA 2NTNA 2HK8A 1ADFA 1ZMOA 4AG3A 1K5HA 3JQAA 1M6WA 4N5MA 4E5YA 1T1SA 1UP4A 3PQEA 4D42A 1JWAB 3UCXA 2P91A 4WEOA 1QYCA 4XGIA 2QYSA 3P5SA 3RASA 4CM5A 3WTCA 4HX5A 4J91A 3DDNA 3FPLA 4AVYA 2BRUA
chains in the Genus database with same CATH superfamily
1W4ZA 2P30A 2XR1A 1T5HX 2ID9A 4MB6A 4B8YA 5L6MB 4TRJA 1NVAA 1VI2A 2BZSA 4L4RA 4LHVA 4D43A 3F4LA 3M1AA 1Y9JA 1NMZA 3T4PA 4DIKA 4CEHA 3H4MA 5BQOA 4C89A 3K7EA 4E1AA 5E1MA 2JLQA 1IY2A 3VNRA 5I4KA 4HXEB 3DV2A 4LAFA 3IXQA 5JZVA 1RYYA 1UZLA 4KO4S 5M2QA 1YOVA 3AK4A 3C5EA 4HHEA 3ZW9A 2EJWA 1SC4A 2CNWD 1GCIA 4LDZA 1ACMA 4FC7A 3QFHA 3VZSA 4FYYA 3HXPA 1MA3A 1VOTA 4MVJF 4JP2A 1COWA 4ZT7A 1VCHA 3MUFA 4MGHA 4XRGA 4OOEA 3A6JA 5IAAA 2ZT8A 1T1JA 3LX8A 4DLKA 5I7VA 4YALA 3BA6A 1FTYA 2OHOA 3UV6A 3VNBA 2FMUA 3WLHA 3O7MA 1YNOA 3FCYA 4IHJF 4S05A 5ISMA 1TE2A 4O3MA 4H35A 4C05A 3U3DA 3IKJA 2OB2A 4U7HA 3QUQA 3D54D 2WU1A 8AT1A 5JWRA 2P5TB 3GO4A 1J9GA 4YJKA 1CF4A 5K8VA 2R6ZA 3VZQA 2J9XB 3E81A 1BDJA 2I03A 2YWEA 4N01A 3USCS 4C9BA 4KKVA 1MABB 2X5OA 4H15A 1XRMA 4WADA 3FROA 3TR6A 4B3SB 2IU3A 2QL7A 1KA9H 2OD7A 3IILA 5A5VA 2RHGB 4U5QA 2ZWOA 4HKTA 1AO0A 2Z2KA 3UBTA 5IHXA 4F2DA 2IU0A 1ZW1A 3KQKA 3H19A 1E1MA 3GAZA 3OLVA 1CRZA 4HTFB 4QJ5A 1UH5A 1PE0A 2EFEB 1XZAA 3HCBA 5D5PA 4J1TA 3W5AA 1RP1A 3LXMA 1DCMA 3UATA 5JTTA 3C3BA 3N2GB 3K6SA 1IEVA 4I1SA 2B8WA 4E4RA 1NNSA 1B6SA 1TEVA 1D4ZA 1AZWA 1KVRA 4KPYA 4HDCA 3DW1X 3NM5A 1YTLA 1P18A 4NPCA 5DCWA 3F7OA 4E2WA 1T0PA 1G8KA 1PZMA 421PA 4EA6A 3KB2A 1YE8A 4TWAA 4Y2YA 2XT6A 2PEZA 4RK6A 4BX0A 1FMJA 3CF0A 4OV6B 4V38A 1AK1A 1MVLA 3K0FA 1THGA 2QAGA 2HF2A 2WF7A 4R0NA 3G59A 5EJ8A 3RQIA 5JAOA 4GT1A 3U60B 4G0UA 4QTYA 1FTGA 4PHFA 4HAOA 1C7RA 4MYSA 4OMCA 4HV4A 1V4VA 5WRFA 4MWZA 4M7PA 3PZBA 2EKZA 1UDAA 1E1DA 1Z2OX 2P2YA 4GHWA 3WWEA 3KB1A 2ZXEA 2C9YA 1KI1A 4ZDKA 1N9GB 2ADMA 2F17A 5J5CA 3E48A 4RVDA 2IIQA 2PL9A 5HFJA 2QG9A 2V9CA 3PNQA 3GLHB 4ME6A 2R47A 1JLLA 3UJ8A 4DLLA 1DIBA 3P8ZA 3U3ZA 4R9UC 2BM0A 3TLJA 4B8ZA 3D0RA 2VDKB 3NAMA 5JMTA 5FRDA 3VQTA 5GZ6A 2WJZB 1E3JA 4QOHA 3FVTA 3GFPA 3QUBA 2BF7A 3KZKA 2IY7A 4QODA 1AK9A 2Z1MA 4AZVA 1U2QA 3BB3A 2DULA 1UBRS 2YWDA 2QNRA 4JK3A 2IKSA 3EQ6A 1N8KA 4TTVA 3TW4A 1JSCA 3R23A 3RVLA 2ZRGA 5DNAA 4EUFA 4RIIA 3SP1A 5HJEA 2OHFA 1XTIA 4QX6A 2PXCA 3DEAA 3CXRA 3QE3A 2BL4A 2RHTA 4RXTA 2I7CA 2IP2A 2P9JA 2FW0A 2Q8NA 2GS9A 4J0IA 5IAJA 2WJGA 3G1WA 1S2GA 4Q34A 3WRXC 3ADDA 1EVLA 1I9CA 5B37A 3SQOA 4RLSA 4RA9A 1IPHA 3HSYA 4FKMA 2B1RA 5BV2P 1CY7A 2PFGA 3M1YA 3M3HA 2HF7A 3OO0A 3G0CA 1SVUA 5GJBA 1M76A 5FOVA 1ML4A 2ZIXA 5B64A 1NSFA 1ISIA 1ZJZA 2NZXA 2QTCA 3PFCA 1Q44A 2QUBA 1TVMA 4G56A 4X91A 1JQ5A 4Y1FA 3M9LA 1CUFA 4RDCA 4XZ3A 1G2PA 2WMDA 3CF4G 4KDFA 2PEYA 1NIPA 3N76A 1KPGA 4YB8A 1Q11A 1JVNA 1G8MA 2FN4A 3CZMA 1H3NA 3N2YA 4BFTA 3E70C 2J3IA 3A26A 4G9BA 4TSRA 4YHHB 2BH2A 3QNWA 1XCGB 1XK6A 4I1IA 2Z09A 4MKHA 4DCSA 3F2IA 1MLDA 4J7UA 1RPAA 3H05A 3MMXA 3L6UA 3NTOA 3W7VA 2EFJA 2I34A 2R8OA 3SLRA 3FAKA 4RCYA 1VDZA 1TJ4A 1PGQA 4KACA 3E27A 1GILA 4FJ0A 1KDOA 4JMPA 1A50B 5IU6A 1OB5A 4UFPA 2FGKA 5CH8A 4CR7A 4G4JA 4MLDA 4IRMA 4XLTA 2X13A 1Z4JA 4UFOA 2FHPA 3GVIA 4D80A 2Y1LA 3B3FA 4NFLA 3F8SA 3UAXA 1BEZA 1G6HA 4Z99A 2WYUA 5DEIA 3RVKA 5DWQA 2CHGA 5JCPA 1DUSA 4NOJA 5CNJA 3AY0A 4GKBA 4QBHA 4G86A 5DLYA 2DJ5A 3P45A 1FUYB 1E7SA 2LIPA 2GZDA 2SCUB 3OTOB 1TECE 4ZVVA 4QUDA 3CLVA 2RK3A 3BXPA 4J4HA 3CA8A 4P9NA 1EDBA 4UPDA 1DNPA 1GPBA 1JIKA 2ZR9A 2GRAA 4X3OA 4EKGA 1L7PA 2ZIWB 4Q48A 2NO1A 5DGIA 4IJKA 4CYMA 5AVUA 5LR6A 1S3SA 2HA7A 2TRSB 1E0KA 2ZRFA 1RIIA 1E1RA 3GL9A 4FDLA 4TOIA 1G59A 2R62A 4QPZA 3GJ8A 4HATA 2FSIA 1EGMB 1JR3D 1QFSA 3KT3A 4BMDA 5AIAA 3VR6A 1GN8A 2G1UA 2HDNB 3CZQA 1LLCA 5IJXA 1F4PA 3IBTA 2ZS8A 4LJYA 5H4HA 3W1VA 2FXVA 3K6RA 2OHXA 4M7OA 3NHRA 1YFLA 3OZCA 4RD6A 3H1TA 3PD7A 2AGVA 4MINA 4MS4B 4RZ3A 4MRMB 4AQ7A 4EVSA 2B2XA 3CF2A 2PG3A 3I64A 4L50A 4PFKA 4PZEA 4R8RA 4ZQEA 3KP1A 5BYBA 3ROEA 3L5KA 3RS8A 1KO5A 3KZ1E 3TD6A 1CR4A 3FUTA 3JVUA 4F06A 1IM2A 2WJ4A 4M8IA 4HSEA 4NQZA 5CA0A 4BLPA 2MMGA 3TBKA 4H18A 3IB3A 1UKEA 3F7MA 1SG6A 4GPBA 4L28A 1VJRA 1SMKA 3D3QA 3OF5A 1C4KA 4RD4A 4G0QA 3ZV5A 2PLAA 2V7UA 3EA4A 5K0BA 1QH8A 3SZRA 1NFQA 4MW9A 2NZYA 4UMDA 2QRJA 2HEGA 1QHGA 1DINA 5CLGA 5D3MA 2ZRNA 1E2GA 1GNTA 3F9CA 5EKDA 3V8NA 4ZVKA 4C0JA 5BWNA 1QRUA 3ETGA 1JU4A 1P91A 2BFEB 1U1CA 5K3BA 1M3SA 2QG6A 4LDPA 1GKYA 3PDJA 5LP6F 1AY0A 3LC0A 3KAKA 2Q5CA 1SXQA 1NX6A 1VIDA 5TARA 2QP9X 4Z7NB 3N3AC 5EHIA 1RRFA 2X0JA 2XDYA 2MSEB 2VWGA 1Q74A 2EKBA 3QVWA 3C1UA 3EQ7A 2X76A 4CM8B 1HYBA 2JJ2D 1M2FA 2VQSA 3HP1A 3ZWXA 1PW5A 5AJVB 4D8VA 5JAIA 1EJBA 5KNDD 2AF4C 4EGCB 1K86A 2YBEA 4WZAA 2HL6A 1RHMA 1TKBA 4XB1A 1M1UA 1U7HA 4UU1A 621PA 1TM5E 3VYUB 2OV2A 1YQUA 2WZBA 2X2OA 3L6DA 3N59A 5EIXA 5J5AA 1AS2A 1M8FA 1PL6A 2VAPA 3SOPA 3UCFA 5KHOC 4G5YA 3V7YA 1X14A 2CNBA 2ZJ6A 3G0GA 4LE1A 3RWMB 3MS2A 5HMLA 2QVLA 1OVGA 2BR5A 5LOVB 2OZLB 2Z5FA 1D6MA 1GAQA 4PYOA 3D7NA 3DDHA 1W9MA 1VIYA 3FG9A 1WMFA 3FH0A 1XQYA 3BTUA 4FMPA 2Q49A 4M0KA 5TXGA 2H2DA 3SK0A 3W78A 4Z3KA 2J31A 3DLPX 1UZMA 2Q46A 2YDXA 1J2JA 4NG5A 4BFYA 1QV7A 1N77A 3OCCA 4P3PA 1V5GA 1BKDR 4F2HA 4X7RA 5AW6A 1YF3A 3U40A 2ZTMA 5EMJA 1TQ4A 2A1TR 3AVVA 4R8LA 2OGSA 5DHFA 1X70A 5FNZA 1ULHA 3L0YA 1VA4A 1YRQA 2PZEA 3AUFA 4I3GA 2PSEA 2BYTA 2YVKA 2ZE6A 1OQAA 2A3RA 4H0FA 3VDMA 3BKWA 2A5YB 4UXIA 3KCQA 5FCDA 4MR7B 1K5DA 3VX3A 4EI8A 2QUIA 4JVMA 4G0ZA 4BTVA 4EL0A 5JMOA 3CJQA 3DLHA 3AEKB 4XM2A 4DA8A 2GMWA 1Q0RA 1OKKA 2YWXA 2HRRA 4EFDA 1XRNA 3NUZA 3T3NA 1W44A 3GOQA 3K53A 1ZMXA 3GCZA 4O4IF 4O8CA 1XFDA 2GZAA 1HYQA 3KAPA 1TA0A 2D7CA 2I62A 4IXWA 1PSDA 2GF2A 5D5HA 3L1VA 5DYYA 4A27A 4DF3A 4BQFA 3BRWD 1SBNE 5AW1A 2WSBA 4YBZA 4AMGA 1Q14A 4JP5A 4ABTA 3LCMA 3ODGA 1S89A 2HDOA 5FLEX 3JQBC 3U5ZB 2IU4A 2WKQA 3T95A 3HDJA 1RLJA 4JL8A 1DPFA 3ETHA 3V00A 1RMTA 1XN4A 3JVVA 2Y1WA 3MIZA 2FR8C 4Q3AA 1G20A 2CDCA 3DE6X 4QU8A 4WLOA 3SC6A 3UXMA 4YMSA 4B6RA 2BKLA 1PG2A 2CSUA 1U02A 1U2DA 2GHTA 5JAZA 1MXFA 5BORA 3I72A 4IH1A 3KEQA 3R5KA 1RRMA 3DE2X 1C14A 3KVOA 3S29A 1QF6A 3HJUA 1T3ZA 1DFIA 1VCMA 4MB0A 3M6WA 1PN3A 1XR3A 3U26A 1M8KA 1Q0TA 4BPRA 3CH5A 4UPVA 3MYYA 2OZVA 1H0RA 1SQGA 4YUZA 1C7ZA 3GMDA 2ZYGA 4BFSA 3ZYCA 1KO1A 4B32A 4LJ7A 1XPJA 4X92A 1NSTA 3FPGA 1C1XA 3RBAA 1M0SA 3F3YA 4O4JF 2BI8A 4KSBA 4MA5A 1Q16A 1QPGA 2ILTA 1FXUA 5IDXA 4MVJP 2EW1A 3E6AA 2Z4SA 4I6GA 3CT4A 4TS3A 2HLNA 4OQNA 3W2FA 4B6QA 4PO9A 1NU6A 1EAMA 2EX1A 1QIKA 4E5PA 4Y2HA 4INAA 1RXEA 2VYNA 4O2AA 3MOIA 2WRZA 3GPBA 4D4GA 3U80A 1XMIA 3M70A 1YAJA 3LWBA 3EDCA 3TCXB 4CTOA 2GBGA 1N5KA 1OR8A 3RB8A 2WC1A 5F2NA 1K7XB 2C31A 1ZM3A 5AVOA 3SZGA 1LBSA 2ZLBA 3D64A 4YRTA 3LO5A 3RM3A 3PUXA 2QTZA 1QUFA 5IXYA 3PUVA 2BZ1A 4LRYA 3SC2A 2ZSBA 5JY6A 1Q0PA 1XZFA 5MF6A 5CIQA 3F78A 4NWIA 1YRBA 5HM6A 2PX2A 3DTVD 4K46A 2ORWA 2J4CA 1K7FB 4M8SA 3IHLA 2JIDA 2Q6KA 4R98A 2QTNA 2GHIA 5EWLB 4G5QA 2C9CA 1X1SA 5CW1A 3H0KA 4MWBA 1V37A 4U8GA 4QNMA 4YT2A 3MM4A 1ZINA 1U9IA 5JCOA 1N1GA 3LVFO 5LXTA 2YVLA 2QRNA 2OO5C 3NDBB 1IMOA 1Q91A 4JLUA 1QC5B 2AX4A 3JQFA 4ISCA 3SFVA 1YBFA 5TX7A 2N9UA 4ZZ1A 2OENG 1N0UA 4IMJB 3MTAA 3LT4A 1M0TA 3QOWA 4R1UA 5I47A 5BOVA 1KE1A 1U3CA 5K0SA 3R0JA 2X9NA 4TZKA 3UAZA 3RADC 1ZNQO 5AHOA 2H1LA 1P7YA 3C3JA 3KTFA 3ILSA 2OHVA 2OEPA 1Z75A 2FSHA 1IHPA 4R7ZA 1MG0A 2AK3A 3QBVA 5H16A 2NVUB 4B3RB 1E9FA 4R83A 3ZU2A 1L6IA 3C45A 2NUTA 1OYVA 4UZEA 4WESB 2JHCA 3RC1A 3IEKA 1PNOA 2DUWA 1PGOA 4IUCS 1WXWA 3DO5A 3W2HA 4CW7A 3KXDA 2BEWA 2FF7A 3MTIA 1NX9A 1SIBE 3TZEA 3CNNA 2ACVA 2XCOA 2I4OA 4DDKA 4AM8A 5LLDA 4QEDA 5GJWC 5I4BA 2H92A 4BIMA 4RY2A 4YRAA 2Z3WA 3BD9A 1A8HA 2YWBA 1QZXA 3B6MA 4FGWA 2CCGA 2Y1CA 4GI1A 4RXMA 2RAFA 4PRYA 3RFUA 1B3RA 5F4BA 5IAKA 3NBKA 4MYRA 4V0RA 2PL3A 3ETLA 1IN8A 5I7OA 2R4TA 4L2IA 1U31A 4FFNA 1HBJA 1SZPA 3K92A 5FL3A 1WM1A 3H5WA 3Q98A 2GM5A 1DGQA 4GZ6A 1KY3A 3ADKA 1AH2A 4GOJA 1AUQA 3EPRA 4EA8A 2CNLA 5F35A 1WDTA 3PEYA 1Q0QA 4FYVA 3I9JA 5E7JA 3L6RA 2NO4A 3VR4H 4IV5A 3A25A 3MNFA 1IIRA 3UGKA 4UOEA 2YINC 4I4TF 2Z95A 1CF9A 3DTTA 2JFNA 3L7DA 1KIFA 2X77A 3O83A 2YN0A 1JXOA 4HGOA 1DBRA 1XTSA 4NYJQ 1U6KA 1P1JA 2DVMA 1ULSA 3CF4A 3IUJA 2KWIA 2FZEA 1BN7A 1O89A 3NM6B 1YK0A 1JJ7A 2QOEA 1QHIA 1WKCA 1MNAA 3D8SA 4AP5A 1NQXA 2RGEA 3NOVA 3PI6A 1L7MA 4IDGA 4DDHA 3O8RA 4ZFNA 2GK6A 3SM3A 3W9YA 1R37A 4EY5A 1J56A 4WK2B 2G04A 2NU9B 2WWGA 4G09A 1P1FA 5I7SA 5JJCA 4YJHB 1EDOA 2COEA 3QGMA 4BX3A 1H69A 3Q40A 2YH2A 4PCUA 1MENA 4UBNA 4YLEA 1JEYB 3AVYA 4EFKA 2DUNA 3FBWA 3JQDA 3G2NA 2EWWA 4OQLA 2M6KA 2VF7A 1RQLA 2WWIA 4R1MA 1M34B 4ZRDA 2ABWA 4WCVA 3VR3D 4DPKA 4FIDA 4ZJUA 2O3UA 1DAMA 4JX8A 3H75A 4LBYA 3IPLA 1VMDA 3UNXA 2Y4OA 3MTQA 2F9LA 1QCDA 4G41A 4Y9SA 1SN7A 3ZWAA 1P0MA 2O54A 2C5AA 3H9JA 2Z6VA 4K8RB 2WAYA 4FGKA 4XWKA 3JQ7A 1YHZA 1N5MA 2JLAA 3VZRA 4LMPA 5ADHA 2EAUA 1O5TA 3FMVA 1G4HA 5D3QA 3ESYA 1KDYA 2X4LA 3QVOA 5CEFA 1XA4A 4C14A 3OSUA 4D3YA 1KMNA 1Z45A 2IZOA 5LBTA 1GZ5A 2WWXA 4EPXA 2OOKA 1IN7A 5BWLA 1OFTA 3TLGA 3GRRA 3JATB 1Y8AA 3QF7A 2VKTA 2ZU6A 4BEBA 4MVXA 5CLHA 4DV5B 1TZBA 1X92A 4IG4A 4KQXA 5BMVB 5J4VA 1UBOS 2QXUA 4FQ7A 1P31A 2EDAA 2CL6X 2H06A 2H2GA 3UT5B 4UTXA 1UWVA 3RC9A 4BMPB 2CLLB 2RK4A 4J7XA 3PC3A 2WJWA 3GLKA 1BMFD 1NN0A 1KZYC 2EZ8A 2L19A 2PCJA 3HB1A 2XKJE 4Y2PA 3WKEA 3E61A 5F2EA 3G2MA 4L3OA 4CQLB 3AH8A 2X3FA 3LUCA 2P0EA 4KXQA 2TMKA 2B5WA 3EULA 2XECA 4KHZA 2R7KA 4TMFA 3SSNA 2WSIA 1WXHA 2CVQA 4EOGA 4HNHA 4J94A 5KNBD 4PPNA 5EE0A 1DBQA 3ZLJA 4ZOLA 3U5TA 2J33A 4Q03A 1JAYA 5JS2A 1ZAKA 3LVQE 2JGKA 1NVBA 1QH1A 1V7CA 3BCUA 2GVNA 4AICA 4GM4A 4ONEA 1UAYA 1Z5WA 3LA8A 4K9MA 4OVKA 5FI3A 4AY4A 5CA1A 2F90A 4RY9A 4V0LA 4GMKA 3IUMA 2IRWA 2VDRB 4KQEA 1UR5A 4QO7A 4J49A 3RSLA 3CINA 5DM70 2F3RA 3DF9A 5ALNA 3I05A 3HPQA 4B3MB 3PQ7A 3I0ZA 3G8AA 2VHEA 2O0HA 4RPLA 5EMHA 3JQRA 3QM1A 1P7CA 2BGJA 3EAQA 1HDGO 5A9SB 2KB0A 2QN7A 4M4SA 3QTLA 5FOTA 2OR3A 4BUCA 1D3AA 3ZOKA 1K8ZB 1Q1QA 1B2RA 1OGJA 3H9QA 4X20B 4YAWA 5AW0A 4D6PA 2BHLA 1RTTA 2IH4A 1KHHA 3QLJA 2B83A 3HYRA 1QTNA 2QU8A 3GRFA 2WAMA 5KVAA 3MGBA 4LWQA 3EW9A 1WB5A 3O5AA 3WIBA 3N2ZB 3WHPA 1HTWA 3PIRA 3DOFA 4UUAA 1E6WA 1FYVA 2W0MA 4OL9A 4WBXC 3ZNQA 1OLXB 5KS2A 3A6GA 3I9OA 4YMLA 1DLIA 1J07A 2VBIA 1V8PA 4X7MA 5KJEA 4D2IA 1GTVA 1UP6A 2XTMA 3A7DA 3JVIA 2QMUA 2G0NA 3TLAA 3QLUC 2H9AA 1J39A 2NM0A 3MPUA 5B1HA 3T0IA 3DPIA 1JZSA 3MT9A 4B82A 1KGDA 3B7WA 4FMDF 4JLVA 4LZNA 3HZZA 4OLHA 4GSYA 2JARA 3PR1A 5CHYA 1DTSA 1UJMA 2E4VA 3KXIA 2AFHB 3PITA 3ZJ5A 4ROSA 1QIHA 1V7PC 3ACCA 3CPEA 4LI3X 4Q1EA 2G1KA 2BUBA 2ESRA 4AZ3A 1TIKA 2DWQA 3LBIA 1W4BA 5ADVA 4LZWA 1GTG1 5JNUA 3I1YA 4MHTA 1HR0B 8MHTA 3IJRA 1ARZA 2XAAA 2VJKA 2JASA 3ZHXA 1P72A 1T9KA 3HBJA 3K9FC 1EP9A 2O2SA 5FOXA 3PIIA 3ULKA 4ANFA 4HN2A 2C03A 4EO7A 1BEEA 5JADA 2AOTA 3FE2A 5LUAA 3VGJA 1RWPA 5A3JA 3KYDB 2H17A 1I2ZA 1L4UA 1T3GA 2IP4A 2V9ZA 4LMRA 1V3QE 3AL2A 3JXEA 2FZVA 2R00A 3W7AA 3WYDA 1DIAA 5K1ZA 4J0EA 3OHMA 4FGZA 2WQ6A 4N6GA 5KKNB 5FR1A 1U80A 3VH1A 1AM4D 4FFPA 1E79D 1YGPA 2D5AA 2Y05A 4EH1A 1QZZA 4Q82A 4XYGA 1TFUA 2BKUA 2OYSA 2G0AA 2J9ZB 2K2QB 4FDUA 4JEUA 1C3VA 3M6UA 4Q7MB 1N6RA 4TRMA 1ZGBA 4LKRA 4Z8YA 2XCSB 3CB2A 3TR0A 1H3EA 4FCTA 1WZCA 1U90A 3D7KA 3GT7A 3BERA 1T4CA 4V0NA 3X2EA 2B5VA 1QS0A 2DLDA 2EV9A 2WFLB 3A1NA 5E3IA 5HIMA 4BCDA 4CV3A 2Y0EA 3WFJA 2WF9A 4F2WA 1X7YA 1E5LA 3N70A 1U0GA 3PLRA 1G8FA 2Y93A 4I9NA 3OI7A 4UBKA 1Z8FA 4G1CA 5CYPA 1X86B 3R9XA 4JJ6A 5IBRA 1PEAA 3UFXB 4Q9IA 1HE5A 2OL4A 3D6TB 4NENB 1KFBB 2AMVA 2NO5A 1IUNA 3I9V1 4G1VA 3TSOA 1P2DA 1DAFA 1WKBA 1VGVA 2XSZA 3H3XA 3OWOA 4LBVA 3PR2B 3TW8B 5BSWA 1R6UA 1X80A 2H4HA 1PJTA 1MDBA 2P65A 4JYPA 4BO8A 2WT8A 2Z5LA 3IVXA 3HEAA 4G6ZA 4XJTA 2B5OA 2Q6TA 4KQWA 2IBMA 3ICWA 4ASUD 4BFUA 1WXQA 1U8UA 2MYPA 3CFYA 3KIPA 1M73E 2X4IA 3O3NB 5SY4A 1O7JA 3KTAB 4UHEA 3TLYA 3B1XA 4RL4A 4M6WB 4AKTA 3WGVA 4GOOD 4ZHQB 1Y89A 1G63A 2ZB4A 2OGZA 821PA 3B8HA 3OHSX 2X4DA 3MAAC 1STOA 2PS0A 2CXUA 4K87A 3HDGA 3JR3A 1FFXB 4FD3A 4LX0A 4OQ4A 4XPIB 3ZWOA 5JTUA 3FPJA 2RC6A 1EWTA 1XF9A 3RJZA 4DQ0A 3R5JA 2W70A 2P4EA 3ZTYA 3BOSA 1M8PA 3CG0A 5KDLA 1QAQA 2YOHA 4I8XA 1V8FA 3PQ3A 4KEAA 4F8YA 1I2MA 1RXSA 1BGVA 1SXJC 4DCTA 1TCCA 4C03A 2Y67A 3GDWA 4L9AA 3E9EA 3CBQA 3UICA 4GW3A 3H42B 1T13A 1WF6A 5ICGA 4CQJA 5H4GA 4DBVO 1T26A 1HFJA 5AH0A 4F3CA 1Y1PA 4TMZA 2ZRAA 3C70A 3WL7A 1XTRA 3GEGA 3K1JA 2CC2A 4CM4A 5COAA 3GFBA 4LJAA 4IFBA 5AM1A 3KLNA 5E3JA 1ZIOA 5TVKA 4JI1B 1YJ5A 1C4OA 2WIGA 2V8OA 1CJCA 3VU8A 4KWIA 3H2JA 3DR3A 5EKXA 4BVGA 2GLUA 2ZAGA 4R8VA 5BV7A 2H18A 1KYWA 3KYBA 2JKYA 2FPSA 1KEVA 1OVMA 3BIJA 4GMXA 2FMHA 2XNSA 1HT0A 2WG2A 4D3SA 1EP2B 2NXCA 4QSMA 3N0RA 1H0SA 2HNAA 3F5SA 3HFGA 2UU9B 4BBZA 1NQOA 4FLEA 2DQKA 3IELA 2M1ZA 3VHLB 4HDQB 2HU5A 2QRZA 4JJZA 1IG3A 4NDZA 4O2BA 4QWMA 2B1QA 3D3WA 1V4NA 4PPFA 1CEQA 3OFJA 1BC5A 4CEJB 3U37A 4MXDA 2RIPA 4IXTA 4DRYA 4FLFA 4JAVC 1DC3A 3IHKA 2JATA 4MV5A 1F6WA 1JHZA 3I6ZA 5ES4B 1E7MA 4Y30A 2HF8A 4RJJA 1GIAA 3AESB 3R8XA 2H16A 3BXGA 4IVNA 1UMDA 5THXA 1EIWA 1M6EX 1Q22A 1O4WA 1RPJA 1E3WB 1V1JA 2FX3A 2IQIA 3JQ8B 1K9VF 1EIZA 3NDRA 4HJRA 1UODA 4LXXA 4UM7A 2XRMA 4Z9AA 1QHSA 4YV7A 1G20E 3TF5A 1KC3A 1HZZC 2A4MA 3T7JA 2ZYAA 1UOEA 1T3LA 1UPCA 2CLDX 4D0NA 3ZBPA 3KBBA 1L5ZA 1TVEA 3E9DA 3GEBA 4RQUA 1V11A 1MO5A 1MAWA 4PICA 1VCNA 4JJKA 1UWLA 3NGMA 1C7EA 3P97A 3U3RA 1KDZA 1JKJB 3UAWA 4EECA 4XE5A 4K6CA 3ORQA 1NF2A 1TTPB 1UKYA 3D1JA 1OBVA 3OECA 4FFRA 4FPXA 2AEEA 3ISVA 2ECPA 4RZUA 5ULLA 3TSYA 2IYWA 5LJIA 3PNLA 3UKOA 4FMBB 3OEEA 2IXFA 1PQ4A 4M22A 1RXYA 3HJGA 3GJ3A 5FHQA 4PG8A 3Q1KA 2J46A 2XUPA 4MPDA 1U9CA 4BVJA 2V6MA 1JPUA 4FBMA 3Q88A 1RI3A 2AFRA 4IUDS 4CDMA 3N05A 3LZCA 2J9RA 2RGNC 2Z1NA 3RIEA 1VE5A 4N7RA 4ZVSA 1M1XB 4D82A 3K72B 1BXZA 1T9ZA 4BTEA 1AGPA 3Q7IA 1LX6A 3RLIA 4B9EA 4WA7A 5AVQA 1JZTA 2ATXA 2EFYA 2WSSA 3HKEA 3PWZA 1N8SA 3PQ8A 4IVPA 4QYSA 2XNHA 3V4VB 4CV1A 5CDYA 1JL3A 3QLTA 4BLOA 2N1MA 1RC0A 1WJGA 4Q6WA 4EHFA 3V8VA 5FTMA 3WRYA 3ZGVA 5B58C 3VR4D 4HRYA 3I1IA 2P4HX 3NWEA 4QXMA 2A86A 4EJ2A 1J24A 3W5BA 4JUBA 5AK3A 2HHLA 1V1MA 1OBHA 2ASVA 1Z15A 2MINB 3HU1A 1IPFA 3GLIE 2OV4A 1TT7A 4IGFA 2B0JA 3O8QA 3OZUA 3UJCA 1NWCA 1U81A 1GPJA 4U2BA 3ZVLA 4O59O 2PTHA 4DYVA 3IAUA 2XYVA 1G4UR 9MHTA 4O4HF 4R7GA 1NBEA 2ZUCA 2ZREA 5KTTA 1RE0A 3WJ1A 1BAPA 1T0JB 5J4LA 3WLAA 5DTJA 2UV8A 5CG2A 1F8FA 1T8WA 5EINA 3PLAE 3I6YA 2YDYA 5TB5A 2CFRA 1E5QA 3DAGA 5I3CA 4YRQA 5CYGA 1N2CA 2J30A 2W4QA 1NPDA 4Y2QA 1UFRA 4U9UA 1SVKA 3E4DA 4IHJB 3ZGYA 4B4UA 1AHIA 3PXDA 2VT3A 1PJQA 2DXIA 2VF4X 3SG0A 4JP8A 1NKSA 5DASA 2IH2A 2XQGA 3I8OA 2XZLA 3PYLA 5K8TA 4TKLA 2P6RA 3BMQB 4K9SA 3OZRA 1ZR2A 1BWSA 1NVDA 3MUEA 1NE7A 5I8WA 1LPAB 4AWBA 4LYYA 5CLQA 3ER9A 2REQB 3DYBA 4CTJA 4NMXB 3I30X 1ZH2A 2P2GA 4L85A 5TIIA 1BA3A 4Q9LA 2IF0A 1R9MA 3HVIA 5ALQA 4N0PA 1PV1A 2F1HA 4BNHA 1PEYA 1EHIA 3LP6A 1M5RA 3O0DA 1XZNA 5AK4A 1W49A 2JFHA 5LCXA 1BNCA 2AEMA 1U0SY 5EJGA 4D1YA 3MOGA 3ZC3A 2W2KA 4HFJA 2AFVA 4HSGA 4RH3A 5FF9A 2CLHB 3V7FA 4DWOA 5FX2A 3AIOA 4AZ0B 2GYVA 2PX6A 1YI1A 3B1KA 3KJHA 2QLJA 1VP9A 1M6HA 4BO6A 1F2DA 2PS3A 2VTEA 3JQ6A 4OM8A 5IVPA 1MQ9A 2CFOA 4IKPA 1VC2A 3U0BA 2YY5A 3PEEA 3OFSA 3A8TA 4WOPA 1CW2B 3ZU4A 5AJYA 4ZYUA 3PJRA 4P1ZA 5LZ5A 3QE9Y 3VR1A 4D9IA 1P1RA 2A1TS 2RGUA 5AKLA 5B30A 4ZYWA 1LV7A 2JW5A 1F2TA 3HB7A 2R96A 3GGPA 2NV6A 1P9LA 1NAHA 3NHFA 4RZ2A 5FBQB 3L7BA 1H8HD 1V8BA 4EHBA 2XNDD 5J2TA 3VHXB 1CEXA 4D3FA 4IIUA 4GZ3A 4WLFA 4B7UA 2ECQA 2B4YA 3G49A 5DLPA 2BFBA 3UW3A 2WJJA 4KYVA 1SBIA 5FLYA 2F43B 2XAUA 3C7AA 1LI4A 2H4JA 1E2HA 3WV4A 4LYAA 3BWVA 4LIPD 2DQSA 4EKNB 5K20A 1W7AA 1XVUA 1QB8A 2Q5OA 2Y2UA 4M53A 4B3JA 4L8VA 4MJ3A 2FPLA 4JA2A 1NDUA 3L9WA 5A4AA 1K6MA 4W9RA 4LSWA 3RS0A 2Z0MA 1OWPA 3RU2A 3AKEA 4BB5A 5A02A 3NQ41 3TQTA 1Z5VA 5KHAA 3RF6A 3IBGA 1QANA 1SRQA 2AHRA 1EK5A 1H23A 3X2FA 5TE9A 3G89A 2CLOB 2AJTA 1JLSA 3U7JA 1G16A 1O0SA 1S2NA 3HL0A 4HNAA 5K4GA 2WT9A 5TQVA 4QUKA 2XXAB 1MW9X 3GXOA 4L95C 5EYPA 4BNGA 1TVKA 2F2TA 1LSJA 2FZGA 4WT7A 3IPXA 4F9FA 2IA5A 1V2GA 5AI5A 4DSAA 5GINE 1W36D 1FZQA 1NXSA 1UK9A 3SHFA 2AW5A 1M66A 2JAPA 3CZ4A 5KSZA 1JJFA 1GTMA 1P9RA 3M8KA 4FT4A 2NUAA 3VYWA 4EJ0A 5IJWA 1NI3A 3UJBA 4AKHA 2X0KA 4Z1OA 4YCCA 5T3YA 3QEOA 4GM0A 4P3XA 3T34A 4EUHA 3EIFA 1HOXA 3UMSA 4RADA 1NQWA 1I2AA 1FDUA 1G5TA 3GT3A 2JFGA 3RAEC 5EKSA 5E3HA 1V96A 3EZYA 5MN6A 1XTKA 2D2EA 2HGSA 3AKYA 3NALA 1K4YA 1U7PA 3DQQA 3FSGD 3U7QB 3HI6A 1J8QA 4GXNA 1APBA 1YS7A 3OM8A 3DE7X 3ZY4A 1Q77A 2HPZA 1WBJB 3FLAA 4Q37A 5AVKA 1WXGA 1NY6A 2JEZA 5K0JA 1JLRA 4NKRA 3QVUA 1YA4A 2BEVA 2NSDA 3NOQA 2JHGA 2RGCA 4E14A 3TKYA 4YUVA 5A5FA 1EBUA 1Q7RA 2HHAA 1E66A 3OD1A 3BD7A 4R2HA 1RU3A 1ZRHA 2NQTA 4X3CA 4DCVA 1SC3A 5HKKD 4JA0A 1VE6A 4PYMA 1MAUA 3R0QA 1US8A 1L5KA 3DL2A 3CKYA 3G79A 4YCDA 1ONBA 1DJMA 4AMUA 1J2TA 2P7IA 4Z53A 1P5RA 2VYFA 3BRSA 3W05A 2BI4A 5AKIA 3IT1A 4UZFA 4DKXA 2CJXA 4BBAA 3PVZA 4D9NA 4ER0A 3NEJA 1R0YA 3TJMA 3ROQA 3WYCA 2IZ6A 4NPHA 3DGFC 3OIFA 2QM8A 2MCFA 1GSAA 1ZWKA 2X5KO 3NWBA 4MUAA 2CV2A 4Q01A 1Z28A 2VP3A 4N5HX 1IFXA 2ZYTX 3F71A 5EQJB 2PGOA 2DT8A 3D8RA 5E9AA 2IODA 4J29A 3ZWPA 2B92A 1FFBA 2FK7A 3IH5A 1E5DA 3HCOA 3LCRA 1NVXQ 2BOVA 3FNGA 4KI7A 4Z4CA 3KB8A 3L4SO 3DR5A 5TNXA 2AUTA 1LDGA 1RKXA 2BBOA 5L53A 2MSLA 1FQWA 4FSDA 4PYRA 4FCVA 4I5FA 3JD2A 1S1MA 2RI0A 3QU2A 3GT0A 1QSGA 3UMYA 5BOSB 1ELOA 2OV8A 3AVQA 4QECA 2XCQA 2BMWA 1XDZA 5FV4A 3B48A 4AC9A 4MVCA 4FE3A 1NU8A 3O4HA 1CZOA 3JTMA 3ZHYA 2F6RA 4I9FA 4UOQA 2PS1A 4CQMB 2GD2A 1BROA 3KAQA 3G8YA 1LVHA 5CTJA 3E7XA 1LJ8A 5A1TA 1N1MA 2O4CA 3KNZA 3HHEA 4XDYA 1LVUA 5EUBA 4OU4A 2FQXA 2OXTA 1YQDA 4MDHA 3W8EA 1E8NA 5DI3A 4BP3A 2HZ7A 4CL8A 5E2AA 4NFYA 2QZ9A 4I1RA 1QTIA 3BXZA 1TJ5A 1U5CA 2IUTA 1Y37A 2J5RA 1Q3HA 2PGAA 3KSZO 3Q6NA 4GXTA 2R86A 4QOJA 1CETA 5CM2Z 3RYTC 4CV0A 2QD4A 2XE4A 3I5YA 1FLAA 4U00A 1GPH1 1KJ8A 5J2UF 3M6XA 1CERA 1Z4MA 3MT0A 5EUMA 5JAMA 3BICA 4C7VA 3VX4A 4C4SA 2XWBF 5K3CA 5ITVA 2D7JA 1J1UA 2MIIA 2VTDA 3MIIA 1JDPA 3O03A 1CR6A 2B6NA 4K03A 1JQAA 4NQRA 1FSPA 3JX9A 4TS4A 2CMDA 1A8UA 2C8JA 1DBSA 3I2KA 3BXXA 3EXEA 1IQUA 3BILA 4OGLA 4C78A 5JFGA 1E2BA 5FKJA 1ZICA 2W2PA 3GDGA 3NWJA 4JC4A 1LQTA 3HV2A 3CS3A 4B7ZA 1X9HA 2QMOA 4BNKA 5LP6B 3TK1A 3LUGA 5ELLA 3E23A 1Z6GA 4KGZA 3U19A 1N75A 4EHLA 4PN3A 4HLDA 2QW1A 2FTKE 3GX1A 5ALJA 2UYCA 5FUXA 4P32A 2ILVA 4Q3CA 4JENA 5CAEB 2I6XA 2GESA 2NV0A 3U1VA 3P32A 1CUJA 1OZ0A 1OXUA 2XWJI 4H1WA 4D9JA 3MB8A 3X44A 3WVNA 1MVNA 4BB9A 2OAGA 3D0KA 1K1EA 4ZIRA 3LWDA 4G5FA 1F2VA 2EW2A 4CXMA 1GAJA 1O94C 3MVEA 4BQOA 3AONB 3T41A 1KQFA 2C7QA 3CSUA 3AIMA 5TS3A 4IIFA 4KIGA 2OM6A 4XM0A 1GQ2A 4QPPA 4OQYA 2G9VA 1VE7A 3BSFA 3FIJA 4DSOA 2QTRA 3DONA 1U5BA 3KAJA 2L18A 1HG1A 2QM0A 2V97A 1KH1A 5TDHA 4P3NA 1L7BA 1R50A 3H5LA 3ONVA 5DISB 2JNWA 3L02A 5FBZA 1X1DA 3MFYA 2BT4A 5CCXA 4KE8A 5F3WB 3EPKA 5CVCA 3M4JA 4JLOA 4FC6A 1PJRA 4QAQA 2HJVA 4CR6A 2P67A 1YBAA 1Y7PA 2VDVE 2WHPA 1AHPA 1YTUA 5HUJA 3CVXA 2QW8A 2JD2A 1OFIA 3IDSA 1E96A 4B87A 1XDWA 4MHSA 1W5TA 1PWYE 5C53B 3FCCA 1Z6PA 1RIFA 3GBVA 1VCOA 4B40A 4IICA 5H81A 4EF6A 3PFBA 4KZPA 3E5NA 3QMWA 3GDOA 5JANA 4P34A 3FFAA 4K2AA 4KQ1A 5B3JC 1D8AA 1ZH8A 3C4VA 4FGLA 1SBZA 2X15A 1ODIA 1QBKC 1OHHA 1W4CA 1DWPA 1ODCA 2REXB 2XPCA 3AEXA 3B51X 2WU0A 3FRHA 2QN3A 4O4IB 3T99A 3WLOA 1UPBA 4CM9D 2I6SA 1P17A 4DA7A 5C8DA 3LKBA 2N0SA 2QMQA 4YLYA 4RMNA 3P9YA 4YRNA 4QJBA 2C99A 1RR6A 2HJWA 5BN5B 4URVR 4J1TC 4LNHA 2XYHA 4Q9NA 2G70A 1AUXA 1ITZA 1YUMA 2Q5EA 3KYCB 3ZCRA 2J41A 4A7PA 3FOCA 2A0KA 5KBYA 1X7WB 1QHYA 4FEEA 4X64B 3AZOA 2VOJA 4GMGA 2OLJA 1PJAA 2ZBDA 1G8JA 4DKJA 1KC1A 1W8DA 4IDCA 4UM8B 3FMIA 4IGAA 2Q45A 1XNHA 3CLUD 3M81A 1HY3A 4FKZA 2MSCB 3SX0A 4P7GA 4DIDA 4IDBA 4C29A 3EISA 3BGOS 2QAGC 4MA0A 1P3Y1 3E9CA 3F6BX 3VHRA 3RUAA 3GIWA 5EJMA 3I01A 2O7VA 1SCDA 3ID6C 1I2DA 2PXXA 1I14A 1ONPA 3EYAA 5FL7D 2J1LA 1IOVA 3VXKA 4I5GA 2UUPA 4J75A 4X94A 1NBMA 4GNKA 2GN0A 3KO8A 1QGUA 3MMSA 4GPEA 4MQUA 3I8SA 3IBSA