2Y93A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
275
structure length
268
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 91
structure length 268
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y93A00
1SNYA 2AMFA 1DAPA 1XA0A 2VHZA 1E5QA 3INTA 1BRMA 1ZSYA 4YJFB 3MJSA 2VT2A 1BWSA 2Q4EA 3V2GA 5F21A 2PK3A 3N74A 2HMSA 4RQUA 2P9EA 4BNMA 4BQPA 2AEMA 2Q46A 3GEGA 4GX1A 1E7YA 4ZA2A 3W4JA 1XLTA 3RFTA 3C1TA 2QYSA 1P1KA 4ALMA 4K9DA 2NQ8A 3RUFA 4NMHA 4ROSA 4OKNA 3JQAD 1T2AA 4JCOA 3LC2O 3ZW8A 1QSGA 3COSA 1SPXA 3TF5A 2YDYA 4IZHA 4IDFA 2P9GA 3P7MA 4PG5A 5BSFA 1G1AA 3KSDO 4YJDA 3KV3O 3RFXA 4B7XA 4J6FA 4DPLA 3JCZA 3V1UA 1Z73A 3DEYX 4HKTA 3LT0A 5T64A 3PQFA 2CSUA 1KY5A 2V6MA 1GFSA 4PG6A 4D0SA 3X2FA 1I10A 2RH8A 5JSFA 4XCVA 1EUCA 2BFPA 2D2IA 3IS3A 4PG7A 4QEDA 4CQLA 5DULA 1P1HA 2QZZA 5A9RA 5KJ6A 3WLFA 1NVMB 1YKFA 1UDAA 1ADCA 1UAGA 1XR3A 2ZB3A 4Z0TA 3DOOA 3VPHA 4Y6PA 4JIGA 3C1AA 2NSDA 4JGBA 4KTVE 4B3HA 4KP7A 1T25A 3U0BA 3U09A 3JYLA 4W7HA 5B12A 4WE3A 4CQLB 2D1YA 4HFJA 1DEHA 3WGHA 3ZZNA 2OFPA 5A03A 4YT5A 1C0KA 5K0ZA 3GG9A 1GUYA 1FDSA 1WAMA 3H3FA 2EKQA 1O89A 5JDCA 4FIZA 3RASA 4IJKA 3RQSA 1KC3A 3A14A 5AXBA 5BT9A 4EEXA 1O9BA 4W9NC 3WWZA 1DSSG 2J3HA 1E7SA 1PJ4A 1Y5MA 1R0KA 2LDBA 4WLFA 4IDBA 3GHHA 2ZQZA 2VT3A 4BO9A 1HYGA 2BRUA 2BKAA 1RWBA 3H9JA 3HFGA 1LXCA 4TMFA 3QWAA 3GDOA 2AW5A 3QVXA 4QSMA 4Q3DA 1ISFA 4XX0A 2BFOA 1D7OA 1R0LA 4BNTA 2ZK7A 3NYWA 4YAGA 1BGVA 2FMUA 2EXXA 2RCYA 1BTOA 4B8ZA 3WLEA 1NXQA 4OMUA 2CY0A 3DBHA 3HNPA 3JYNA 4WCFC 4E0BA 2V6BA 3DMYA 4GVXA 4IQ8A 4K26A 4CV0A 4WLOA 3PJGA 4PRKA 3AFMA 3I23A 3V5NA 3GLQA 4EJ0A 2A9FA 5CDUA 3A06A 1LDBA 3TL3A 2CDBA 3BA1A 1R15A 4XWYA 2JCVA 4HUJA 3DBHB 1FDWA 4CM3A 5F5NA 1Q7BA 5C7IO 3DHNA 1OFGA 1B14A 2HK7A 2Q50A 3AM4A 4WNCA 4E5MA 3NGLA 1LRLA 4IXTA 1AHIA 3K31A 3PZRA 4FJ1A 4GAEA 3RUEA 3B6ZA 1OOEA 3FR7A 1NQOA 1PQWA 3U62A 4L4RA 3P2OA 4YTEA 1I8TA 4GGOA 4B4OA 1JQBA 3DMTC 5C7LO 1DAOA 4DMMA 1P44A 3K73O 3TWOA 1F06A 2AE1A 4URFA 3H65A 4TZKA 5H82A 1HDGO 1V6AA 1ZO8A 4BHTA 1XIVA 2G17A 1U2DA 3ZHXA 3DZHA 3GH3A 1EVJA 4D46A 1V9LA 2DUWA 4TKLA 1TA4A 7MDHA 5ICMA 1WDKA 3FR8A 3SJ7A 2FN7A 1PJQA 4ESOA 5FEUA 3DAPA 1B16A 3S55A 5F5LA 3RBXA 3GEDA 2ZTUA 1OMOA 2A35A 3CEAA 5CHEA 5DT9A 1GCOA 2P5YA 2X8LA 2XXJA 3PVZA 5CFZA 2GN8A 3HHPA 2AG5A 4B4UA 2FY8A 1YQXA 3WNQA 3KLMX 4CM1A 4XQCA 2C2YA 2D3TA 1XWFA 2PKQP 5FI5A 3E5MA 3RWBA 3NDJA 4DWVA 3GMSA 1FDVA 1ZXLA 2VUSA 1PS9A 1YS4A 1MC4A 1B8UA 1SOWA 2VYNA 2XOXA 1O94A 4R5MA 1H6BA 4PLWA 4BNHA 4BO0A 4XR4A 3SX2A 1RJWA 4MKRA 2O23A 4DC1A 3NJ4A 2BLLA 4WLUA 3Q0EA 3JQ9A 4FB5A 2RH4A 3IKVA 5IFLA 3QV1A 1YWGO 4BNVA 4CMKA 2W2LD 4BNNA 1EVIA 1UR5A 3R3SA 3ZWMA 1ZEJA 4JQCA 3ANLA 2JAPA 1PL8A 4YQZA 3RJ5A 3TRIA 5MDHA 4UVEA 1ULSA 3GG2A 4MVJF 1GQ2A 5HA5A 3DFUA 4CMEA 3AJRA 4R1NA 1YGYA 1IUKA 2BH9A 1UXGA 5ES3A 4UEJA 4O1MA 3P5SA 3NGXA 1GR0A 4G81A 1M2WA 4RF4A 3TZKA 3QW2A 1LDNA 4B8WA 4J1QA 1KS9A 1SEPA 4HWKA 1NAHA 4MVJH 4DUPA 5IDQA 3TDKA 2AQKA 4QXMA 4RZIA 1A4IA 3LYLA 4CM7A 2V7PA 2HDHA 3JQBA 4CR6A 3VKUA 3SVTA 1DC5A 3UICA 1QYWA 1VL6A 5FFFA 2VNSA 3HJAA 3JYPA 4ALKA 3QE3A 4DTIA 4YXFA 4WJZA 5G0TA 2QIOA 1F17A 2Y93A 1LDEA 1AGNA 4WOJA 1CRWG 2E49A 3U9LA 5KVSA 1R12A 1W8DA 1QG6A 2EEZA 4CM6A 5IF3A 2VZ8A 3NTRA 4WASA 3LSYA 1A4UA 5L7YA 3EYWA 4RLHA 1LBEA 4H3VA 1ZK2A 5L51A 2DTDA 1MFPA 3H8VA 4LSWA 5DN9A 1I01A 4FC6A 1DFGA 4L4XA 1TB4A 1ENOA 3S2IA 3LT2A 1LX6A 1H6AA 3WG9A 4TRJA 5U9CA 4UVGA 5DZSA 1YBMA 3HSKA 3PPIA 4FGWA 5B4TA 2NTNA 1PJ2A 3FCOA 3ZNPA 3ROPA 2JHGA 1A7KA 1KOLA 2ZKLA 4J9UE 3WIDA 3RC2A 3OMLA 2WEKA 1H6CA 3GVCA 4OQYA 4RQTA 3CUKA 1SO8A 1XELA 1DXYA 3OJEA 4YAKA 5CEFA 4BO6A 4R69A 4CMGA 1W6UA 4P4LA 3ZHYA 4LRTB 4O63O 3TZQA 1QMGA 2EJVA 3ETEA 1D1SA 3UOGA 3FWNA 1I3NA 5G0VA 3RVDA 3GDFA 4YJHA 1CQIA 1E3IA 4GWKA 4R01A 4RPJA 2A92A 3V1TC 3PYMA 1V3UA 4FS3A 2CDCA 1E1NA 1G0NA 3UCEA 4EZBA 5IAAA 3LK7A 4YA6A 1LDGA 4IMRA 4E2WA 1F8GA 4IZIA 3S1LA 3D5TA 2WWRA 4PLYA 4EGFA 1HDXA 8LDHA 1N1GA 2VRBA 5TF4A 1HE5A 1MG0A 4CLOB 3I9LA 4N5MA 1HYEA 4NBUA 4AJEA 1DJNA 2BFMA 3QVOA 4NU6A 4YJHB 1OBFO 3JD3A 4BKQA 2X6TA 1M75A 3PJFA 4CLRA 4JK3A 1IL0A 4DIOA 1E1MA 3AOGA 3E5RA 3PQDA 3MJEA 5EMHA 1HTBA 1YH3A 5HBRA 5HS4A 4IDEA 1D1TA 1JWAB 4BNYA 3I9OA 1LU9A 3NAQA 1SC6A 3GFGA 4CUKA 1RM5A 4DLAA 4B7CA 1PQUA 3D1LA 1U5CA 3NTOA 3GGPA 3GGOA 3KVOA 4CR7A 3PDUA 3BXXA 5JE8A 4B7UA 3OQBA 1DHRA 4CLRB 4PVCA 2NTJA 2GR9A 2HKIA 4FBGA 2X7HA 5BSEA 2HAEA 1YJQA 4MIOA 1PSDA 1QV6A 3JQ7B 2IZZA 1OC2A 1RM4A 1ZEMA 3PHHA 1E5LA 2E37A 2AHRA 3TQHA 2G82A 5TSDA 2V65A 1HKUA 4FJ2A 3DDNA 5JC1A 5JY6A 1EUDA 5HTOA 2VYVA 3TNLA 1NTOA 2WTBA 1QYXA 3AY3A 4UVHA 3H9GA 3UXYA 4GMFA 4XB1A 1GZ6A 2JHFA 2PD3A 4GWGA 5CPBA 2Y1OA 5BR7A 2O7QA 3G0OA 1OZAA 5F1PA 3T7CA 1R16A 2FHSA 4QUKA 3WXBA 2A4KA 3S2EA 2FZEA 2HK9A 4KDFA 2DM6A 4FFPA 1ENYA 2EP5A 1WMBA 4UVIA 2AQ8A 4BNJA 2P4QA 4J4BA 1QYVA 3KBOA 4RF2A 4IM7A 2H5LA 2I6TA 2PA3A 3I1JA 4KDEA 2YYYA 4BKPA 2B4RO 4XDYA 4RGBA 3GAFA 5TGDA 1C0PA 5EQFA 5L7TA 3L6OO 5L95A 5A3JA 4J0FA 4CMAA 2C7GA 4JXKA 3ULKA 5JDCC 3D3WA 4A7PA 1Q0QA 3KETA 2PH5A 4QO8A 1QP8A 1P31A 5COQA 2QQ5A 1P9LA 1B3RA 2ZYAA 1DJQA 5EL0A 3W8FA 3LF1A 5IN4A 2PD6A 2XF8A 3GVHA 4II2A 2X86A 4UUOA 4XJSA 4L0QA 3D3WB 3RKUA 1YL6A 5THQA 3WJ7A 2OL4A 1I24A 3ANMA 5ITWA 1PX0A 5GMOA 2DT5A 4ZQBA 4Q39A 2FRDA 1R37A 3WNVA 1GZ4A 1PTJA 3Q11A 1KVTA 4FPXA 2EW8A 1U3TA 4BB5A 1H6DA 1LC0A 4K28A 3CSDA 1CWUA 4YDRA 1OAAA 2O48X 5CEJA 1DB3A 3ETGA 1ENZA 5CP8A 1VJTA 2Q1SA 4YAJA 3RROA 1ENPA 3D3EA 1BG6A 1PGJA 1H2HA 1DOHA 2ZYDA 4R1TA 2GN9A 3ZN2A 2NVUA 3OJFA 3NDIA 4YRBA 1SBYA 1VSVA 2EP7A 2O3UA 3NUGA 3NEPX 1ZMOA 3AY7A 5CG2A 1I30A 4NIMA 1CF2O 1E3WA 3F6YA 3MJCA 4IJVA 3T4XA 3L0DA 3T7EA 4IS2A 3OHSX 4P4GA 3WQSB 4HV4A 1AXEA 1E7RA 4QTZA 3GZNA 1O8CA 2NVUB 1NVGA 1JU9A 2X5KO 3VH4A 5TS3A 1NQTA 1E77A 2EV9A 4NJMA 3KYCA 5A3VA 3ZH2A 4UREA 3JYOA 3L9XA 4N54A 3VDRA 2QRJA 1NX6A 2DBQA 1E3WB 1QYCA 1PS8A 2UYYA 1YOVA 2I5PO 3PP8A 4BGIA 3CZMA 4YYZA 1ZJYA 3O4RA 5CG1A 4ONEA 4FCCA 4MVJI 5DCYA 4U7WA 5ILGA 2VTEA 2ILTA 3GZNB 3PGJA 4GL4A 1UP6A 4ZQFA 1HWYA 4XDZA 2IXAA 3GPDG 1KEVA 3H5AA 3I9NA 1TT5A 3JQAA 3KYCB 4RPKA 3HB4X 1M66A 4R1SA 4DC0A 4NQZA 4PLTA 1YOVB 1U4OA 1NVTA 5DDIP 2GNAA 3DZFA 2NM0A 4PIVA 3WWYA 2ZATA 3H2ZA 4D43A 5GZ6A 4E3ZA 4PVDA 4WNIA 4CV1A 4TRRA 2EG9A 1T1RA 4GVLA 4Z9YA 3UF0A 3FBTA 2GASA 3BTUA 3JQAB 1TT5B 2CUKA 2CVZA 3F1LA 1Z75A 3PFFA 4ND5A 3ORFA 2NU8A 4ZN6A 5I7EA 5JDIA 1IZ0A 4MVJD 2X0IA 4J1NA 5EJ2A 4ZICA 3BMNA 1JKIA 2J5RA 3F3SA 3GUCA 3MEQA 5JYDA 3AWDA 3TJRA 2I9PA 1E1LA 1F0YA 1KERA 4D42A 4RO0A 4OQZA 2AEFA 1ONOA 4HX5A 2IEDA 4CM8A 1CETA 5KIAA 1ZCJA 4A0SA 3ZNQA 3R3JA 3BMNB 3PHGA 4GGPA 1XG5A 3GPIA 1PL6A 4GMGA 3WGGA 2UUOA 3PLRA 5B4VA 4CMEC 1B8PA 1X13A 4U6SA 3GNQA 3EHEA 3KEOA 1N8KA 1SOVA 2GN4A 1B0AA 1G0OA 2OBNA 4NFHA 1XDWA 4IUYA 2GDZA 2J3IA 1ONPA 1LLCA 3H9UA 5EESA 3K8ZA 3PFWO 2VQ3A 1N92A 1A9YA 1KVQA 1LRKA 4D44A 2C5AA 3PJEA 4XRGA 2E6UX 3RFVA 1P1IA 1N5DA 3NKLA 4MP8A 4RVFA 1JLLA 4XQGA 3RCBA 3WTCA 5BSGA 4QT0A 3R1IA 2SCUA 1IE3A 1A27A 1VJ1A 2ZB8A 5K6AA 5K9ZA 3JQBC 3BTOA 4FN4A 1TEHA 1L7DA 4OM8A 2CNBA 1BVUA 3DOCA 4BNZA 3DTTA 3OIDA 3GGGA 3D5QA 2I99A 3L6EA 1CJCA 1YQGA 3OQ1A 1SB9A 3JQ8A 1X1TA 4J7XA 2PY6A 4UUNA 5I9LA 2B0JA 1FK8A 2E82A 5A5FA 3ON5A 1KY4A 2GGSA 2IEBA 2F1KA 1T4DA 1J0XO 4GLLA 1T1SA 4GLOA 2VN8A 4DQXA 3AFNA 2ZB7A 3LQFA 3WYEA 4DGSA 1KETA 2JCXA 4R3WA 1JN0A 3NV9A 3Q9UA 4WCDA 3ZWBA 5IZCA 1KEWA 5KJEA 4R41A 1MLDA 3JQ8B 3UVEA 4B4WA 4BVAA 1E3LA 5JAQA 1MP0A 1PJTA 1LA2A 4WLEA 1GV1A 2Y1CA 3GRKA 2W90A 3VTFA 1BXZA 5G0UA 2FPGA 1ZH8A 1YXMA 4UAGA 3HDQA 4PLHA 5AQ1A 1QLJA 4IINA 3WBBA 3ZU5A 1X1EA 4KOAA 2VOJA 5TT1A 2X5JO 4GH5A 4MP6A 3GRPA 5DP2A 3QSGA 5AXDA 5LCXA 4EEZA 1ZNQO 1H93A 3ROMA 2C2XA 4B4VA 4YWJA 4WLNA 4BQRA 5KJCA 1YJ8A 5JXWA 2Y99A 2B35A 1E7MA 3A9WA 2VWPA 3AY6A 4RL6A 4BS9A 2B4QA 2NVBA 2AXQA 3ZI0A 3CINA 1O0SA 2X1HA 2DKNA 1PL7A 1Y81A 2DUUA 1JAYA 3GF4A 3WIEA 4W6ZA 4CJXA 1GZ3A 2Q49A 5JYEA 2V6GA 3IUSA 3KSUA 4J3FA 4J1SA 3K5PA 4GPD1 1MG5A 2ZYGA 3L07A 4WEQA 3W1VA 4A03A 5CDSA 1I2CA 4YBZA 3A4VA 3ONFA 4BNWA 2QW8A 2PLAA 4Z9FA 3G17A 1Q7CA 3MJVA 3BMQA 4IDCA 1WLYA 3R0IA 1U3VA 3R6DA 1Q2XA 4PG4A 3W6UA 3DL2A 4W7IA 1PJ3A 3PXXA 4RJTA 3DBRA 3L4SO 2W98A 4HNHA 4RZHA 4GQAA 1BDMA 2EF1A 2DBVO 2WE7A 1BSVA 4NJOA 2IODA 4D0RA 3K92A 3V2HA 1LDMA 3WJAA 1MX3A 3RJ9A 4QFCA 3WX0A 4I1IA 3BMQB 4E2YA 4BO5A 4BGUA 3AM5A 1MXFA 5JCJD 4JP2A 1HDYA 5DF1A 3K30A 1X0XA 4GKBA 3DBRB 4G2NA 5JAZA 3K6JA 5BSHA 3GK3A 4D45A 4CV2A 1VC2A 2EHDA 1MFZA 1IPEA 1R4NA 2W2LA 1ML3A 1DLIA 4JLWA 4IY1A 4NH4A 2ZJ0A 1A5ZA 1YB4A 3ENNA 2WYVA 4D3FA 5FF9A 4R3NA 3I9JA 5ER9A 4I8XA 4I5DA 4X54A 2Q1UA 2W8ZA 4CQMA 1B15A 1ZXBA 3L77A 3L4BA 3OICA 3ONEA 4BMVA 2HMTA 3GQVA 2HCTA 2RIRA 3ZV3A 5KKAA 1R4NB 4NK4A 4B3IA 1GADO 3OEWA 3WYCA 5A06A 1I32A 4WPGA 4LCEA 3ZWNA 1VL0A 4RPHA 5DP1A 4CLHA 4CQMB 1QRRA 3DXFA 4ILKA 2OBYA 2Y1DA 1PR9A 1BDBA 3CIFA 5B4UA 1EFKA 3M1AA 5H81A 2WMDA 4LSMA 4CMBA 4EYEA 1NASA 3ZWYA 3OSUA 3DAGA 4LK3A 2JJYA 4QQRA 1LI4A 1F14A 1LLUA 1NYTA 2PZLA 3FD8A 3FPCA 5CAEA 3CTMA 4CR8A 4EBFA 3VKVA 4AJJA 1UDBA 4A2CA 1U1IA 6LDHA 3QRWA 4XA8A 3ZU2A 1Y6JA 1T2DA 4IQGA 1G6KA 4PZEA 3DHEA 3IP3A 2J5QA 2JFHA 1NFFA 2VHWA 1XSEA 1HEUA 2VWHA 3Q6IA 2CF5A 5AXCA 2X22A 3GY0A 1XQ1A 3BAZA 3HB5X 2BGKA 1O5IA 3KRTA 3N7UA 3E03A 4NHEA 4MKXA 5G0SA 5ILOA 4KUHA 4CL8A 1D8AA 1U5AA 2I3AA 4IPTA 3OFSA 4KUGA 3PHLA 1DHTA 3JQCA 3RSHA 2YHIA 1V35A 3RBZA 3GNTA 1JVSA 1ISMA 1N7GA 3LDHA 3Q1LA 2RHCA 1JAXA 4IMPA 3U4CA 3CPSA 2HK8A 4DYDA 4FFNA 3HE3A 2D59A 3H5NA 2YV1A 5HM8A 4OYRA 1E6EA 2EIHA 3MJTA 3V1YA 3BMOA 3JQEA 4BMNA 5I7FA 4BB6A 3HN7A 2IZ0A 4MO2A 2H63A 1PGQA 1Y9EA 1ZBQA 2YHIB 2BHLA 5DNAA 3NT2A 4MDHA 1PZFA 3QVWA 2YHUA 2Q45A 3P2YA 4MVJE 5ITVA 3D4NA 3WGQA 3IMFA 3WB9A 4AVYA 1YONA 4CQMD 4CUZA 3BMOB 2Q2QA 4C7KA 1H2BA 1LSJA 1NFRA 1LC3A 1P33A 2R2GA 4J49A 5TRTA 4YJGB 5ICSA 4ID9A 3FSRA 3SJUA 3A28A 4ZGWA 1EMDA 3RC1A 3AUUA 3AI1A 3OIFA 3B1FA 4RCVA 4RPGA 4HXYA 2ZIZA 3ITKA 3M2PA 3OETA 3OM9A 4AG3A 2Z5LA 1YB5A 4OOFA 1A72A 1WDMA 1ISJA 1GUZA 1JVBA 1P74A 2C54A 2JFFA 2NU6A 3O9ZA 4MINA 3WGOA 4E21A 2Y0EA 3CMCO 1RYDA 4U8GA 4DIFA 2C07A 4PCVA 3D0OA 4DQVA 4XEHA 1YL7A 5DOZA 3ZNOA 1U4SA 3DOJA 1JKJA 1V8BA 3QVSA 4ZQHA 2RBEA 1UP7A 2NACA 1Z82A 1GU7A 1K3TA 3VZPA 5L53A 3JD4A 4YPOA 2VRCD 3TZCA 1HZJA 1ZVMA 2C59A 3I9MA 1AUPA 1FF9A 2AE2A 1HT0A 1ZJZA 4WEOA 3VHRA 3OJOA 3VZSA 3GMDA 1LQUA 3PWSA 3WOHA 4GX2A 2WSBA 1F8FA 2HRBA 1E3EA 1T26A 4D79A 2HMUA 2Y1GA 3H9EO 7ADHA 1JA9A 1R66A 3O8QA 1X7DA 2XAAA 4J7CA 1JDJA 4YVFA 2C7VA 3UGKA 2NTVA 3GT0A 1PZHA 5JDIC 3QA9A 1B2LA 3TSCA 5F1OA 3U3XA 3ZWXA 2G0TA 1HLDA 3EK2A 3EW7A 4FDAA 1EDZA 2TMGA 3GUYA 4BNGA 3I4FA 4GBJA 2EKLA 4CLOA 3SC6A 5JCXA 3JQ6A 4NK5A 5L9AA 1VI2A 3SC4A 2DC1A 1HE3A 5EN4A 4FOOA 3O8QB 4DL9A 3JD1A 4BGEA 1T2FA 1UXHA 5TJHA 3IDSA 3RAJA 4BV8A 2RHRA 1W4ZA 3PTZA 1ZK4A 3RI3A 1GAEO 2HUNA 3FNHA 3H9QA 4WOKA 4EDFA 2POQX 5JO0A 2PKRA 4OIMA 1NM5A 3G79A 4MVJP 1GV0A 1X15A 4TZTA 5T6BA 5AYVA 3F4LA 5DCWA 3AUTA 4Y6RA 3DZBA 4RPLA 4GX5A 1NHWA 4BNLA 2UUPA 1YE3A 3MCVA 3OQ6A 1M67A 3IAHA 4ND4A 4YCAA 1U3UA 2Q3EA 3GNSA 5L4LA 4Z3DA 2OOSA 1PZGA 1CEQA 5CPFA 3ZV6A 2O50A 5H83A 2I65A 3JQ7A 1M6HA 2J5KA 3C7CB 1DLJA 1HDZA 4TROA 1H9AA 3B70A 3U49A 4AJIA 3G3EA 2VHYA 1EK5A 1YB1A 3LZ6A 4M8SA 5K6AC 3FWZA 1ONNA 2PGJA 1HF3A 4Z0PA 1HE2A 2Q2WA 3HUDA 3FN4A 2B5VA 2GZ1A 4NI5A 1I2ZA 1Z6ZA 3PHIA 1LNQA 4ZHSA 3IKTA 1KVSA 1W0CA 3WGZA 3GN2A 4KWIA 4D3DA 2J6IA 1IZ9A 3I52A 1NPTO 1GL3A 3PHJA 5DOVA 4FGSA 4TRMA 3EY4A 3IL2A 3OF2A 3HDHA 2YUTA 4ALJA 1I3KA 3F5SA 2DTXA 3UKOA 3OP4A 4CMCA 1FDTA 3I5MA 3G1TA 4AJ4A 3HADA 4Z3KA 1GEEA 3BMCB 3CXRA 2VWQA 4I9UA 2VHXA 4O0LA 1VE9A 3MTJA 3UFXA 3ZW9A 3NT5A 5IZCC 1P45A 3QJ5A 3W4KA 2C82A 5COAA 2D4AA 3ADPA 4XQ9A 5KCZA 2X9NA 1C14A 2GF2A 3ANNA 1PQPA 1E1KA 3OJLA 1LSUA 3UW3A 2CVQA 4RDHA 3EDMA 1YBVA 3WGYA 4J91A 3M6IA 3V8BA 2Y67A 4L4SA 5JMPA 5THKA 4E2ZA 3FI9A 3DTYA 2VOEA 2X9GA 4DBZA 3OEYA 1D4FA 4D7AA 5ER6A 3HWRA 1T24A 4K6FA 3KYDA 1ZK3A 4O6VA 2WDZA 1PGPA 3GDGA 4HFNA 1LEHA 1V0JA 1B3BA 2Z95A 3QVTA 2Q1WA 3TL2A 4N5LA 4EJMA 2Q4BA 3ASVA 2O3TA 1DFHA 4EI2A 1K89A 1E7QA 3C3XA 4PFJA 4W82A 1AE1A 4NNJA 1X7GA 4CLDA 2O7SA 4J1TA 5U4QA 2H6EA 2Y0CA 2YV2A 4XRRA 1NQAO 1PWZA 2G5CA 3DONA 3RUDA 3A1NA 1IPFA 2PH3A 2PR2A 3KYDB 3RUHA 4IJUA 1XGKA 4AJ1A 3E9MA 5G2OA 2QRLA 1EE2A 4BO4A 1DIGA 2YFQA 1YRLA 3OJ0A 3WR5A 1ARZA 3JSAA 3C85A 5TT0A 4MVJA 1JWBB 4BO2A 2HMVA 1MB4A 4L74A 4K1LA 1NAIA 1CYDA 4HY3A 3Q2KA 1XHLA 4XJTA 3ZU4A 4AJNA 1Q1NA 1BXGA 3GFBA 1TXGA 2C5EA 4ND3A 1KEUA 2YW9A 2YQ5A 5A5EA 4WUVA 4Y8VA 2O2SA 1GTMA 3DQPA 4GX0A 1ISIA 4L75A 3AI2A 3AW9A 1HETA 1VL8A 3O03A 3ZWOA 4A10A 2FSVA 3N58A 1S7CA 5TJ9A 2IYPA 1E0DA 3W4IA 4MIEA 3E6AA 3LT4A 3QY9A 1IHYA 4M1QA 3WGIA 3KO8A 2X5OA 4CLXA 2BF7A 3P19A 1GUFA 1BXGB 3VPGA 1YDWA 5KWEA 1U3WA 3H3JA 4RDIA 2GLXA 3JQDA 1P0FA 4Q3BA 1GY8A 4H15A 5IDYA 5L3ZA 3VZQA 4DRYA 2DAPA 5F1KA 3L4BC 5TNXA 3S2FA 2W2KA 1F12A 5G0WA 1AXGA 4YT4A 1C0IA 3QP9A 2QRKA 3H2SA 4IDAA 3H5RA 4PLZA 4ND2A 5LDGA 4P22A 4Z9XA 2JAHA 2XPCA 4JROA 2JFGA 1Y1PA 3EZYA 5KTKA 1GD1O 2CF6A 4AL4A 1RM0A 1EBFA 3ADOA 1T4BA 2HMWA 2PZMA 3WFIA 2P4HX 5GZ1A 1DIAA 5ADHA 1PJBA 1K5HA 3GHYA 1KEPA 1U2GA 3KOUA 4NPCA 3M1LA 2C29D 1ID1A 2J8ZA 3GAZA 2W2KB 1H5QA 5IN5A 4IQ0A 2JKVA 4C4OA 3KXDA 4J2OA 3ROKA 3VOSA 1WP4A 2NADA 1ADBA 3ZV5A 3WDSA 2GO1A 1J6UA 1X14A 3NTQA 2DPHA 4YAEA 3SEFA 4NBWA 4A26A 3ONDA 2GN6A 1EDOA 2EGHA 3ZWAA 3U5TA 4J4HA 4PLVA 1SEVA 3FPLA 3RUCA 3ZHZA 4FW8A 4DREA 2PD4A 3VVBA 4M89A 1DFIA 5DBGA 1DIRA 2UDPA 4EUEA 4BIIA 1VM6A 4TSKA 5A05A 2VWGA 4CV3A 1UP4A 2Z1NA 5I7SA 5KJ1A 3LT1A 4Z0HO 2Y1FA 2FZWA 3CH6A 3VVCA 1N2SA 1N9GA 1UXJA 4OO3A 4HFMA 3WSVA 4U0JA 4GI2A 4PZCA 3Q3CA 1P1JA 1LSSA 4FFLA 4KQWA 4R1UA 3IOYA 1H0KA 4BO8A 2ET6A 1HL3A 5JO9A 4W99A 4H7PA 1DRUA 2PFGA 5AOVA 2VNAA 4R5HA 2GYYA 5CDTA 1XKQA 5JPIA 1N9GB 3VH3A 3ETDA 3U4IA 1YBAA 4NBRA 3F9IA 5AXAA 2I66A 6ADHA 1PR3A 3FNGA 4S3MA 3TOZA 2DBZA 1H94A 3OA2A 4PLPA 4KZPA 3EUWA 1DDOA 3RC7A 4DBVO 4KUEA 2X58A 5T8KA 3IIEA 3RUAA 3K9QO 3RUIA 4R54A 5L40A 2OGUA 5JFOA 4I9HA 3UHAA 5C7OO 2FP4A 1OI7A 1Y9AA 3NDRA 1EK6A 4XGKA 2WYUA 1FMCA 2Q99A 3KYBA 3AOEA 4CM9D 1TVEA 1YQDA 4OOEA 1MXHA 1ZW1A 1VLLA 1YO6A 2GPTA 1I3MA 2JD0A 4LCJA 1Y8QB 4MIYA 4U6QA 3VDQA 3VPSA 2PGLA 2O3RA 4MVJM 4HP8A 4D3SA 2BMAA 3PYXA 4E2XA 2G76A 2ZTLA 4OHUA 1JTVA 4P38A 5FYDA 4Y6SA 4OXKA 5JCJA 2B69A 3D64A 3HFSA 3AI3A 4QECA 4J16A 3RU7A 2DU8A 3F5QA 4LMRA 4EJ6A 4JBIA 4EUHA 1HDCA 4ZQEA 4O5OA 2O4UX 5L4SA 3RU9A 2Q2VA 2R00C 4E31A 1DC6A 3KB6A 3ZWCA 3DO5A 3PWZA 4UEKA 3T4EA 3ZWWA 1E3SA 3C1OA 1ISHA 3KTDA 2YJZA 4PLGA 1HXHA 4RLSA 4MPDA 5A4DA 5A02A 2W4QA 2FR8A 5L7WA 3F46A 1U8XX 3HG7A 3I9KA 4B3JA 4IGEA 1U8FO 5KOIA 3ABIA 4CUJA 1PIWA 2OUIA 4GKVA 3C8MA 1DPGA 1BMDA 1GYPA 1GPDG 4GSLA 2JL1A 3WQQA 2P91A 2OHXA 1Y5RA 5IG2A 5IXSA 2EW2A 2VUTA 4RVHA 4JBGA 3I4CA 1UUFA 5KKCA 2BELA 3RBVA 4O59O 4GSKA 1EUZA 1T2EA 2JD2A 4BKUA 2IZ1A 4YB8A 2FPIA 4OL9A 4XIYA 2QYTA 5I9MA 4E5NA 3G1UA 4TQGA 1ZK0A 5A04A 1UH5A 3QIVA 4E5KA 3ZU3A 4MP3A 2XXBA 1UZLA 3DAFA 3IJRA 5EPOA 3WTBA 1BXKA 1LLDA 1KYQA 1QR6A 1HYHA 1QV7A 4R51A 5EQDA 1W73A 2J3KA 5HRUA 4FFOA 2Y1EA 3PWKA 4F6CA 1DC4A 4F3YA 4IJWA 4UUMA 5TLSA 2BGLA 5JBIA 2O3SA 3JQFA 5HWSA 1Q0LA 4TVBA 1Q0HA 3BTVA 4XGNA 4LN1A 4NFSA 3JQGA 5JS6A 2DTEA 4N7RA 3DWFA 2AEJA 2FR0A 1I33A 4J7UA 2WD8A 3WQRA 1P3DA 4BUCA 3WGTA 4R16A 2YDXA 2I3GA 4PGFA 1HZZA 4PG8A 5GZ3A 3LLVA 3AM3A 3JV7A 5I7VA 1JW9B 5CDGA 3JQGB 2BGMA 1E92A 1C1DA 1I3LA 3NT4A 4HNGA 5I8WA 1KVUA 3STHA 2FWMX 1GPJA 1NPYA 4XD2A 1M6WA 4NU5A 4E5YA 2HQ1A 1YVEI 2FR1A 4YT2A 1UDCA 4EUFA 1ZUD1 1EZ4A 2Y68A 2OO5A 1WW8A 2DLDA 3FHLA 1C1DB 3W6ZA 4JJGA 4U0KA 5L45A 3FBGA 2Y05A 1EFLA 4YEDA 3TOXA 2E48A 2X4GA 4A73A 3OECA 1ORRA 1QXSA 3GEMA 3D7LA 4ALLA 1TI7A 1C0LA 3SLKA 1K6XA 2HU2A 4LISA 4QO7A 3VTZA 1Z7BA 1K6IA 3E82A 3PK0A 2IRWA 2PV7A 4M87A 4M49A 3HZZA 5CEEA 5JY1A 1EQ2A 4NBTA 1UXKA 3EVNA 3S2GA 2PZKA 3CMMA 3MWDB 3K96A 2DPGA 4XIJA 3S8MA 3LU1A 2HJSA 3ZWVA 4AJ2A 1NWHA 2HRZA 5ENDA 4MJLA 2DQ4A 2PKQO 4N18A 3WMWA 4BNFA 5L4NA 2Z1MA 2Y0DA 3NRCA 2NLOA 1GDHA 4AFNA 3BHIA 5LC1A 3E48A 3O38A 2A94A 1L7EA 2DFVA 2VRCA 5JMWA 3F4BA 3ZHBA 5DBFA 3CE6A 3DR3A 1GEGA 2B4TO 4FSHA 5JC8A 3VZRA 4BMSA 1K6JA 3BTSA 1FDUA 4XYGA 3I83A 5G4KA 2D0IA 1K0UA 3IJPA 4FFMA 4ITUA 3B1JA 5IXYA 4WECA 5B1YA 1C3VA 3D4PA 3DBLA 1R0SA 3K2EA 2X23A 3VPXA 2J3JA 3CKYA 3I6QA 3MWEB 3BHJA 3PJDA 2BFAA 1A71A 1ZMTA 4I5GA 4BO7A 4CL3A 3TN7A 3E9NA 1RPNA 2E4AA 4YRDA 5G4KB 1PGNA 2UVDA 3FF4A 2JCYA 1PWXA 3L9WA 4CM4A 2EERA 4XYEA 2IXBA 2CMDA 3H6KA 1ZSVA 4F6LA 5GY7A 4JJFA 4YJGA 3DBLB 2VZ9A 4BV9A 2QX7A 3HDYA 2V6FA 3DZJA 1VJ0A 4E4YA 5TIIA 5HS6A 2X0JA 3SBOA 1ADFA 1XYGA 2D5AA 1GQQA 4W4TA 3L6DA 4UEOA 1VPDA 5IDWA 1OC4A 3QWIA 1DRWA 2OZPA 2PWZA 4CM4B 5EERA 1P0CA 1IHXA 1N7HA 1NPDA 4FQ8A 4JP3A 1DIHA 3WYBA 5KNLA 1Z45A 1ZK1A 4CMIA 4A5OA 4WGGA 5T57A 1X0VA 4IS3A 4LVCA 4J4TA 2DFDA 4JX8A 4FD3A 4LMPA 4WK6A 4P4NA 1HE4A 1Z7EA 4RVUA 2OXIA 3V2UA 2IDZA 1GYQA 5T67A 9LDBA 4NG5A 5AVOA 4CMJA 1QYDA 4INAA 5KVVA 1NR7A 3ENKA 3MJ4A 4FJ0A 3ZWPA 4AJPA 4DXHA 1E6WA 1QKIA 4KWHA 4NZ9A 4CMIB 4TRNA 1XQ6A 4OAQA 3OA0A 4RVDA 2B36A 1H9BA 3AK4A 3TPCA 4E30A 1BVRA 5BNTA 4HFRA 4UULA 4ZU3A 3LF2A 4MVJG 2R00A 1QLHA 1MUUA 3LVFO 1KVRA 1UZMA 3RD5A 2X0NA 4K6CA 3Q2IA 2X0RA 1ADGA 1U28A 4JN6B 1A9ZA 1IB6A 4Y98A 3ZV4A 5JAIA 4CPDA 1NHGA 1DBVO 3IUPA 3F47A 4IXWA 2NNLD 1RYEA 3H4VA 2QZ9A 3WSWA 2NVWA 2NV6A 2PTGA 2VUUA 3VC7A 4H16A 1J49A 3PZBA 3H7AA 2O2YA 2YQ4A 4L8VA 2PGDA 4OSPA 4J90A 2EJWA 3WICA 2NWQA 1E7WA 4JBHA 3AU8A 3ST7A 2O3QA 1DIBA 1ZSNA 2GCGA 4BGVA 5IDXA 1GCUA 3C7DB 3DB2A 3PIIA 3DFZA 1HSOA 4Q3AA 2B83A 4ND1A 1DC3A 1LDYA 2NU9A 5A9SA 3KEQA 4BOYA 2EKPA 4G65A 1ULUA 1NBOA 1DO8A 2GERA 3NX4A 2UV8A 1J4AA 5JNLA 1MA0A 2B37A 4PN3A 3O26A 4TWRA 3JD0A 4Y9DA 4BL5A 1R4MA 4L73A 2DBRA 2NQTA 4J2HA 3DZGA 1UZNA 5T8KC 4C7JA 2VYND 1D3AA 4DLBA 3GVIA 1MC5A 4IDDA 5A9SB 5CDYA 2BI7A 2ZB4A 3PDJA 2OMEA 2AQHA 2QG4A 4ZJUA 1TT7A 3UN1A 3UCFA 1U7HA 5JLAA 3IC5A 5A1TA 3QQPA 4EW6A 2VZ0A 1PZEA 3AOEC 3QWBA 4I08A 1R4MB 4E5PA 4PZDA 2O4CA 1EVZA 1XEAA 3KM0A 3I3OA 3EVTA 4RV9A 3JTMA 2EWMA 2OP0A 4W9NA 2VHVA 1B8VA 3UCXA 4LRSB 2WJPA 3KHUA 1IY8A 5TX7A 4R68A 1M76A 3TZ6A 3QLJA 2BD0A 4I5EA 4R9RA 4CLEA 4RF5A 5FWNA 3BMCA 1CQJA 2I67A 4NDNE 4XZ3A 4RVGA 1NWCA 2ZQYA 5LDHA 1UXIA 1GYRA 3TFOA 4UUPA 1FXSA 1CERA 3NJ8A 1RM3A 1WPQA 3UH1A 3PGXA 2NU7A 4L76A 1LTHR 2VTDA 2HSDA 4NFYA 2AA3A 2AQIA 2I76A 1J5PA 2WE8A 3ZNNA 2BI8A 4AJHA 4E12A 1YDEA 3EGOA 4J9VA 2DVMA 3IQDB 3EZLA 3PI7A 3EMKA 1Q7GA 2X9VA 4WCFA 3U4DA 4CM5A 4PRLA 2PZJA 3GN1A 3KZVA 3KUXA 3F1KA 4IIUA 1SAYA 3G49A 5KVQA 4YRAA 3K2BA 1EQUA 5C5IA 4TVOA 1BW9A 1ZZEA 3MOGA 3GA0A 4ZRMA 1XU9A 3W8EA 3RC9A 3BZUA 4S1VA 1JKFA 1KBZA 1WNTA 3PYLA 4YT8A 4YACA 2WM3A 4BNXA 1IOLA 3MOIA 2C20A 3WBFA 4DLLA 4BO1A 1ZIDA 4TKMA 3FNFA 4WCFB 1NP3A 1BHSA 4Y67A 1QORA 1SZJG 2Y66A 1P1FA 5MGBA 2IYOA 3DZKA 4DPMA 1NFQA 1BW9B 3E8XA 3INGA 1O6ZA 1PS0A 2GUGA 3OH8A 4XB2A 2JD1A 1EBUA 2EGGA 4XYMA 1HLPA 4I9NA 3GOHA 5DCUA 1ZFNA 2HLPA 3E1KA 3VAZA 4IIVA 4WKGA 2OP1A 1XCBA 2CVOA 3DMTA 2AG8A 4RORA 5T5QA 1O95A 4DVJA 4DA9A 4NR0A 4L9RA 2UAGA 1V3TA 3JD2A 4BNKA 5TQVA 4QX6A 3KSZO 4FR5A 8ADHA 3ZGYA 4AJOA 1GQYA 1PU2A 1EVYA 3FTPA 4JJIA 4KQXA 1EEHA 3DHYA 3JQFC 4M54A 3X2EA 1WVGA 2YFHA 4HADA 2P68A 3TFQA 5BNIA 2O3JA 5I8ZA 1SMKA 4Z6KA 4CMHA 4A27A 4OGWA 4MKZA 3QWFA 3INRA 1KC1A 5BNFA 2F00A 3LLSA 1N1EA 1V3VA 1NQ5A 1NR1A 3PQEA 1TLTA 5J23A 2R6JA 3D4OA 4YAIA 1LSOA 2GZ3A 1P77A 3ICCA 4AJKA 3UUWA 3AU9A 4XYLA 1HSZA 3PLNA 4FFRA 4HBGA 3LC1O 1T2CA 1L1FA 2P9CA 4F45A 1PJCA 3ZDFA 4PLCA 1UAYA 3C7AA 2IE0A 4CODB 1U7TA 1VRWA 2WD7A 4OSOA 1ZKMA 4EITA 2PNFA 3FTNA 1ISGA 5DBIA 4E33A 5FI3A 5KJFA 2GSDA 3GR6A 3GC6A 4CM9A 1LJ8A 1X7HA 3OIGA 3TZHA 3W8DA 2G1UA 2CZCA 4AICA 5TC4A 4R4JA 4PLFA 5A9TA 2CFCA 3WS7A 1AHHA 3DZIA 3FNEA 1MV8A 1PJLA 2ZCVA 1XU7A 2TMDA 2Q1TA 1WMAA 3VH1A 2WD7B 3M2TA 4FC7A 3VH2A 2ZJ1A 2VYVD 4IGFA 5ENVA 1YL5A 3ROQA 2VCYA 3B1KA 3WFJA 4B79A 4DQUA 4LW8A 1LUAA 4DIBA 1LQTA 2ZTVA 2CDAA 5EINA 4E6PA 1KIFA 1SCUA 4R9SA 5C3MA 3HN2A 2OORA 3SXPA 4D41A 1I2BA 4Q3EA 2GRAA 4OXYA 4XGIA 4G5HA 4OJNA 3UAGA 3U4HA 3PRJA 3EAGA 4NBVA 4BKOA 4ZRNA 2GD1O 1I5RA 3PEFA 3RKRA 3Q9NA 4YR9A 3KLPX 4ZQGA 3HQ4O 4OKIA 3HDJA 2RAFA 3AUSA 4AJLA 2D5CA 3I6IA 3IP1A 4I5FA 4P8RA 1LLQA 5EIOA 4M55A 1VSUA 2FSSA 5F3RA 4ALNA 5JW6A 1IULA 1C1XA 1PEDA 1A7AA 3MZ0A 3JYQA 5B37A 4M86A 4Q9NA 4NJMB 4ZD6A 1CIVA 1WZEA 1B7GO 3E18A 4YQYA 5G4LA 4Q3CA 3ZCXA 2ZCUA 1MGOA 1E3JA 1K2WA 3GVXA 3GVPA 4DYVA 4E13A 2B5WA 2GZ2A 2NUAA 3DBVO 4BKRA 4FOSA 1U9JA 2FPPA 2YY7A 1NNUA 3BHMA 3WMXA 2P2SA 3VPFA 1E6UA 1Y8RA 4Q3NA 4DMLA 1C1XB 3QHAA 3FRJA 5U1PA 1CDOA 1HDOA 4RVSA 4F46A 4XKJA 1EE9A 4J0EA 1P1RA 3BYZA 3E9QA 1I0ZA 2P5UA 3ASUA 1WWKA 4JNKA 4OH1A 4II3A 1WZIA 1Y7TA 3EC7A 2YV3A 4N5NA 4XR9A 2YZ7A 3AUAA 4J43A 1Y8QA 4KTTE 3RIHA 4E32A 4WLVA 1Y8RB 2QHXA 1WDLA 3OBBA 1WXDA 4XYBA 1Z74A 3LC7O 1PGOA 1RKXA 3MTGA 3BIOA 4DPKA 3ICPA 2HO5A 2FOIA 2HJRA 4BO3A 3JQ9C 4ZVVA 1DRVA 4LVUA 3QWHA 5C37A 3DC2A 4XQEA 1VKOA 3B20A 9LDTA 5JAMA 2LDXA 3CZRA 5COBA 3ITDA 4IBOA 2WYWA 4BNIA 5BQFA 2H9IA 1PJSA 2D8AA 1B26A 1I36A 2ZTMA 4KMSA 4YJFA 5KVCA 1LRJA 4BNUA 1SB8A 4RF3A 1IYZA 1HRDA 2CD9A 1S6YA 4LGVA 4CM8B 5I9NA 3C24A 1R6DA 1HDRA 5IZ4A 2C0CA 4U5QA 4ALIA 4IDGA 5IJZA 3GZ4A 4QFDA 4MOWA 3PIDA 3SLGA 2H1SA 4UVDA 1FJHA 1UJMA 1VKNA 4OXNA 1AN9A
chains in the Genus database with same CATH superfamily
2WKWA 1SNYA 1DAPA 1XA0A 1PR1A 2DULA 4FINA 2O1XA 5LR6A 3Q7SA 4LZZA 2IHZA 3QX8A 4MRSA 2RI6A 3N8NA 3QY0A 2PK3A 4TWAA 4HWRA 4RQUA 1WNFA 4BQPA 2AEMA 3LPAA 1E7YA 4ZA2A 1E3QA 2DFKB 1XLTA 4TT3D 3UUGA 3ECCA 1Z07A 2QYSA 5GM1A 1UFOA 1K7XB 2VJMA 3RUFA 4NMHA 3MTAA 4WDRA 3RVNA 1B42A 1N1DA 4HNVA 4ROSA 3JQAD 3AEYA 3PG5A 1J2TA 1T2AA 2VH5R 3WXMA 4DG8A 2WWIA 2JFZA 3CW8X 1J7JA 1SPXA 2II6A 5KYXA 5BN3B 4FYPA 5DNYB 3P7MA 1EPUA 3HU2A 2Z9BA 1XN4A 3L06A 5DHPA 1RIFA 3AFGA 3KV3O 3RFXA 1DAIA 3S5UA 2ZI4A 1DT3A 1Z26A 5EZ6B 4AY3A 3WIOA 3LT0A 2WZBA 1BOFA 5T64A 1JZQA 2ZE5A 4Z49A 1U63A 1FBTA 2QI9F 2VA9A 4WX2B 4W63A 1P4SA 4MCJA 4PG6A 1V8OA 1I10A 1YIDA 3OAAA 4LQ4A 2X0EA 1VP9A 1UOOA 1U6IA 3FF1A 8OHMA 5JSFA 1KI6A 3HL4A 4Q4LA 4JLDA 2D2IA 4NAVA 1ID8A 4PG7A 1RHRA 2QTZA 3JYHA 4MUBA 2QZZA 1RYBA 2PXCA 1K7FB 2JI4A 1UDAA 2XZOA 2WV9A 1XR3A 3KAJA 1F51E 1MOQA 3O8BA 2VJYA 4JIGA 1GKUB 3VPHA 4I8DA 1PW5A 2AHOA 2ZGVA 3JRNA 5AW4A 3C1AA 4LQDA 1UC5B 1QFXA 1T1IA 3NFRA 1KMHB 1G7CA 1XTKA 4KP7A 3ISTA 3GLIE 3U09A 2ZI7A 4CNBA 4KXMA 5ALTA 2CD7A 2HGZA 1GUYA 1FDSA 2OB1A 4B31A 3L4EA 3L7BA 2P35A 4INZA 1JMKC 2E85A 4IUCS 1W5FA 4F56A 3ZDQA 4RM2A 2V98A 3RQSA 1L6RA 3BJMA 4WXYB 2X14A 3AJEA 4EEXA 1O9BA 3G1WA 5H68A 1ZITA 2I4OA 4K6HA 4QPCA 5HIJA 4X44A 3KVNA 2GEFA 1N5RA 3BDIA 3HVUA 3NBMA 4N3NA 2ZUTA 2GLTA 3TMKA 3VR4H 2Z4SA 4Q16A 1QB7A 1FTQA 4J76A 3O9MA 3QLEA 4WLFA 1E59A 5CMLA 3Q85A 3GHHA 3IDFA 3JATA 2X1LA 1JECA 1NMQA 2OFWA 2Z2JA 3IVXA 1LXCA 1LFAA 2OM6A 4TMFA 3GDOA 1UJBA 3AJAA 3U60B 4I1OA 3OJXA 2Q8NA 2XE8A 3EWSA 1D7OA 1GPAA 4RMNA 3QXCA 4RYDA 4BNTA 3L1JA 4DV5B 2ATXA 3A0RB 3C41J 4YAGA 2EW1A 4TV9A 3FWYA 2QPTA 1UDXA 2RCYA 4L2IA 4PTLA 5EMLA 4B8ZA 1P6UA 1YAHA 1ZC3A 2XZLA 3PC6A 4MARA 4M38A 5ES4B 4E0BA 1BEUB 3JYNA 3KD2A 3ZVLA 4R2MA 2QUZA 4K26A 3CT6A 1YDHA 1QUFA 3STTA 5KQLA 2A88A 2IYXA 2ID9A 4XX0B 4CV0A 4MQ4A 3VO9A 3PJGA 3I23A 2K7ZA 3GLQA 2A9FA 4HB0A 1Y80A 1AQUA 2WOJA 1XF1A 3LZDA 3ZX4A 1JEQB 2CDBA 4RE5A 3SSMA 2GA8A 4EO9A 2V7EA 4HDSB 4JVLA 4XWKA 4N76A 1AKEA 1YI8A 4O2BF 5IC6A 4CM3A 2XD9A 1FDWA 2AR0A 5F5NA 3OBIA 4QAQA 4KMMA 4O2LA 4PHGA 2RI0A 1RKBA 1UPUA 2Q50A 2HHJA 1QRTA 2FOLA 4GGMX 5LBIA 2J33A 1XZEA 3THWB 4ZI7A 1AHIA 1B4DA 4QFBA 1C4OA 3B6ZA 3IVRA 2E4XA 3FR7A 3NAGA 1NE7A 2X8BA 1PQWA 1VOTA 3A9VA 4QU5A 4FYJA 1DKMA 1JQBA 4HLNA 3K5WA 3TM5A 4RULA 3CBGA 3F2IA 1IIRA 2ZYTX 2AE1A 3O8DA 1VSQA 3ANYB 1PK8A 4TZKA 5H82A 2AW3A 1XIVA 3H4IA 3KOOA 1BH6A 2R85A 3ZCTA 3AL2A 1ZA2A 3DZHA 3NTVA 4S1OA 1VLVA 1CTQA 5ALXA 3SICE 3TSYA 4LRQA 2CNNA 2DUWA 2IPMA 1Y6RA 4Z0NA 3MGAA 3F7OA 3FR8A 2J1LA 3MOSA 4WXEA 5FEUA 1ZUIA 1RP7A 2V59A 3QHPA 1B16A 2OEPA 1NG1A 5F5LA 1MRNA 4WA7A 2A35A 4WINA 3SBXA 4TLCA 2WJJA 3RVQA 4AUNA 5TVKA 3AKCA 3PFBA 1CUJA 1RAIA 2L18A 3GLHE 2IXDA 3HXLA 1UBJS 5FI1B 4E7OA 1PR4A 2TYSB 3MGGA 1K8XB 3T9EA 1X3LA 2FY8A 3G9TA 2A58A 2HNKA 1G1MA 1YQXA 1XL0A 3T0IA 1DEAA 1USVA 5AQEA 4EI8A 2D3TA 1Z8NA 2YYSA 4O2RA 1E2EA 4JKOA 2VHJA 3EDOA 4YRZA 1A98A 2R8EA 3MG9A 1PS9A 1AD2A 1AKQA 1X9IA 3N28A 1K97A 1U0GA 3TW8B 5NULA 1TKBA 1X2EA 2E18A 4IGIA 4L0DA 4RW0A 4Y1GA 5DTRA 1DGQA 2BE9A 4HQ0A 1GFIA 4AY5A 4Q7QA 4BNHA 4BO0A 3CUTA 4XR4A 2QTNA 3ZGVA 1TD1A 1RYZA 2O23A 4MCAA 3KJXA 2ZYWX 5FTMA 1FRZA 3JPWA 1X42A 4ZMBA 1RQXA 3SM9A 4WLUA 2IYWA 4LYEA 4LDZA 5JJCA 4GFDA 5IFLA 2RH4A 2WA2A 2O8EB 2OO3A 1NKTA 4RSMA 3DMHA 3R7SA 1ZWKA 2E9SA 1JG1A 4BNVA 3IQZA 5DLYA 3R3SA 4BGDA 3VI4B 1T9AA 4JQCA 4HG2A 3ECAA 2W6OA 2QB5A 3HNRA 4YQZA 3TRIA 4UVEA 1ULSA 3GG2A 4L57A 1MQ8B 4MVJF 5HA5A 1FFBA 4EGQA 3HB7A 3PNKA 4URWR 1HX7A 4CMEA 1ES9A 3H75A 5ESDA 2JIRA 2WLSA 3AJRA 1NVDA 5DLPA 1TDJA 3OHPA 5AESA 1FEZA 2H0RA 2NOAA 3NP7A 4Z4IA 4G1FA 1EM8B 5EIFA 3ZXSA 4DEYA 1SD5A 1VECA 1Z0IA 1K68A 1JHMA 5FT9A 1V7QA 4E94A 1N6RA 1FS4A 1M2WA 4EG8A 1XNRB 4PYQA 1F2TB 3HXQA 1Y1KE 4LCBA 5BYAA 2I6UA 4Q02A 4J1QA 4OUDB 1SEPA 3NG1A 4HWKA 1P2DA 4OYYA 4Q21A 1JGTA 2O6HA 2WU3A 3BSYA 1A4IA 1YBFA 1Z68A 3K0AA 2V7PA 3LYLA 4RZIA 5F4ZA 3DT9A 4AIIA 3MWYW 5DV9A 2HDHA 3JQBA 3HXTA 4PFKA 3SVTA 4TL6A 4OHWA 1VL6A 5FFFA 1JSXA 4YXFA 4PGGA 1Y6QA 5AUPB 1U7ZA 1BE8A 4EG4A 2Y93A 5FLYA 4ARBA 3LSTA 4WOJA 2YV5A 1QGUB 2XSZD 5K4GA 2VPZA 1MOSA 3F6PA 1NX9A 3WLNA 3SQDA 1R8XA 2BDTA 4WASA 3LSYA 5FJIA 3SBEA 3EYWA 4EMUA 2BFCA 4BX9A 3RSGA 4HAOA 2DTDA 1MB3A 3PQ8A 1KR5A 3H8VA 2PX5A 4IHJA 4LSWA 3O94A 5FPKA 1DFGA 1JKXA 1TB4A 1XX6A 3NP9A 4JLVA 3ZCPA 5B1SA 5DZSA 1DBWA 1DKNA 3PPIA 3BERA 3GLIA 5JRZA 2R86A 1PJ2A 3VI3B 3VMMA 1RAAA 4ZAGA 1BDHA 4J9UE 4NOLA 5DN6A 1ABBA 5BORA 1LH0A 2YZMA 4NCXA 2WEKA 4TWJA 1Z47A 4NZPA 3IURA 4EL5A 4ZTUB 4EW2A 3HVJA 3VNBA 1V5IA 1VYHA 3OJEA 3BKXA 3ETHA 1UQUA 3NHRA 3WYFA 3MTBA 5EJ7A 4R69A 1SU4A 4CMGA 1L0BA 2IW3A 2PN1A 3FGZA 4CM4B 1QMGA 3CKLA 4X61A 1KIAA 1RXSA 1QU3A 3UOGA 1TQ8A 3ZS9A 3ZJTA 1KZ4A 4AN0A 3G0HA 5EJEA 3ZDBA 4GWKA 2H29A 4YJ3A 4JENA 3D4IA 1V37A 4OREX 1HY3A 3CNOA 1KMCA 3GQBB 3JVUA 5EIAA 4KDCA 2ZSKA 2A92A 3OC0A 5EZ5A 4CIXA 3UCEA 3PB3A 3ZIDA 4EZBA 1KSGA 1K1EA 3W34A 2YN2A 4DMCA 2BH2A 3QU5A 5CVJA 3JZMA 3WRXC 4RADA 4E2WA 4UASA 2QRZA 1TAHA 2OESA 2RKWA 2WWRA 4WWHA 4QD3A 4M7OA 1HDXA 3S1LA 3E5NA 4OXXA 3KFVA 5TF4A 2AOVA 1HE5A 3PDHA 4EIWA 1E9VA 2G3YA 2DH5A 4N5MA 4TUYF 4Y18A 4AJEA 3GJ5A 2BFMA 4FLEA 2ANBA 2VDMB 4JYPA 5JVDB 3T1QA 1T3TA 4AKSA 4RIGA 1OZFA 5J5CA 1VXOA 2FZGA 3T7RA 4CLRA 2R4TA 3E5RA 3O4FA 1II8B 4BVBA 4IIJA 1JT2A 1O1YA 2FFRA 4X93A 5EMHA 5FUWA 4EY5A 3U6KA 1JWAB 1YQ9A 3I9OA 1DOAA 1RQLA 5D85A 4BAGA 1ABFA 1IRIA 1LU9A 1N1MA 5FH9A 2HT1A 2FK7A 3H6GA 4CUKA 4WXHA 4DLAA 4ZCPA 2GFHA 4F84A 4KLRA 3DEIA 1NRWA 4GP7A 3L7YA 3HWX1 2C5GA 1JAHA 4OHRA 5DTQA 4DEXA 1G2OA 4IOLA 5D1NA 2DPMA 1IHUA 1ICEA 1QIMA 4OFWA 4B7UA 2QTCA 1C8VB 3Q7IA 1IXYA 3L1HA 1E1DA 2GR9A 4WZAB 1CY7A 5D00A 4FBGA 4CL2A 3AXSA 4YNBA 2EHJA 4RTJA 4NAHA 4ER7A 2DFTA 2X7HA 4IDPA 4MIOA 1W2HA 3VR3D 1KA9H 3MVEA 3ZY5A 2HXGA 1QV6A 3WLSA 1UEJA 3MLAA 4QUAA 3GGSA 2PT6A 3PHHA 2WTUA 1EHYA 2E37A 2W6JD 2QW0X 3TQHA 2G82A 4QT4A 3AINA 2HSZA 2Q2NA 2V65A 4MS4B 2AXNA 3UB3A 3FKJA 3P9NA 4I4IA 4ESVA 2CB0A 3O73A 1L8OA 1H2AS 5ELXA 4RA6A 5YASA 5CB4A 2HDNB 2XMSA 3W1WA 4YP5A 2BR5A 2D5BA 1U6KA 5CX1A 3IE0A 1QF9A 1NTOA 5FOWA 2QL9A 5TQJA 4DMRA 1TQ4A 2NT3A 3QEKA 3VR4D 2LWIA 5KDLA 2GTIA 1L7XA 5ULLA 3UXYA 2IZOA 2O9JA 4LV6A 3WNZA 1YZYA 1KYZA 2VRWA 5FUQA 1GQFA 1SRQA 2PD3A 4G0WA 2WHEA 1RADA 1F1JA 3B6KA 4GMDA 4L9AA 3WIUA 3T7CA 2R5WA 4IQFA 5E7MA 2FHSA 1FNMA 3ACBA 3QXJA 2X0FA 4HVCA 1CF4A 1XJ5A 3E7PA 3N2GB 1P72A 2FZEA 3BG5A 3VYTB 4LF5B 2DM6A 3GLHA 1ENYA 1WMBA 1K8YB 2JFUA 2EJBA 1VBNA 1YJXA 4UATA 1GGFA 5DK4A 3WBKA 1ZNZA 4QU8A 3UMGA 4HNAB 5DYNA 3Q87B 3E53A 3TX2A 2VDUE 1DX4A 1NZDA 2B4RO 3FPEA 2DWPA 2EATA 3EGDA 1C1YA 2A7QA 4C5BA 4JBXA 1TL7C 1E9EA 1N0VC 2UZ1A 2VBIA 5AW9A 5A3JA 4J0FA 1Q44A 1NONA 1SPBS 3EVEA 4NHOA 2QUKA 5FXMA 4P2BA 4MAMA 3WWOA 5KTRA 2OK7A 2XT0A 1B1AA 1GP2A 1X7WA 4TTRA 1FMFA 2W2XA 3DNMA 4QO8A 3ZCQA 2H5JA 5LQNA 2RB5A 1OYOA 2QBYA 3DPIA 1WCV1 2QQ5A 1P9LA 3RRZA 4MW9A 5C80A 5EL0A 4P1ZA 3ZXYA 2PS0A 1F4PA 3I04A 4B33A 1H8EA 1FP7A 1V47A 3GP3A 4HH1A 2QN6A 3D1VA 4L5CA 4NZZA 2XF8A 3GVHA 4YMUA 1NZFA 1UIMA 1AKVA 4II2A 4ZQIA 3WL5A 4BN4A 1YS6A 4EGJA 1QANA 3FJOA 4TMVA 4XJSA 4AF8A 4C43A 2PYIA 1XVIA 2R4QA 3U13A 4DDHA 3MBIA 3WJ7A 3UWMA 5ITWA 1PX0A 3B60A 3K72B 4I55F 5GMOA 2DT5A 2P6PA 1M5UA 3VU1A 2GCPA 4CFZA 2AOTB 1KI1A 2B92A 1BDJA 1STOA 2NTEA 3K9HA 1RBYA 3W05A 3WNVA 3ZEIA 4CKYA 4FPXA 3NEJA 2OXEA 3LI2A 4HX2A 3T5DA 3ZDDA 1ZMXA 3NWOA 3DYBA 3SDBA 3T95A 3JAKB 4NCHA 2GBGA 3KJQA 2HRCA 4G1VA 2FSUA 1Y1TA 3T99A 4C0KA 3D2BA 2AC2A 1OGIA 2A5YB 2HYDA 2IF2A 2YJ4A 3E9CA 3LBYA 4RFSA 5DNDA 1FBNA 3OU2A 1ENZA 1JQ5A 3GWZA 1ENPA 2A57A 4RSGA 1PGJA 3I8SA 5G53C 1MABB 2PO5A 2WICA 1AO0A 8MHTA 3V46A 3SG0A 4AD8A 4H27A 1E6MA 2I71A 2I4NA 4AT1A 4ARSA 2Z08A 2P8JA 5BV2P 2C5BA 1BEZA 3AETB 1ZMOA 4UBOA 4B6FA 4FCTA 5BMVB 4UFNA 2Q1XA 4NIMA 3V42A 5CG2A 3GLGB 5JJIA 3L0DA 1AJEA 3I9V6 2PSSA 1XRPA 3ZUPA 1VL5A 1A9SA 1BDIA 1DE0A 1XZBA 4ID3A 3TTSA 3N2YA 4BZXA 1WPGA 3W5CA 4DWJA 3MT7A 2G6TA 1VKZA 3X3HA 2AG0A 1W2WB 4HWSA 3GU3A 1ZONA 3VH4A 1Y8CA 4ZDIA 3NKFA 3ZH2A 4UREA 1RZVA 4DA0A 2VH2A 3TMYA 1PS8A 4Z9BA 4KX5A 4MR9A 2OAGA 1N6LA 3FMFA 4YYZA 4MSUA 4TM8A 4OQPA 1TFUA 1VG0B 4GC9A 5TPZD 1U2DC 3TOCA 4F04A 1QHXA 4TT3A 4U7WA 1TJYA 4XVQA 1SD1A 4GL4A 2VDOB 3QUAA 2B61A 2NUTB 3FMPB 4H4CA 4IOJA 2FPRA 3T7KA 5EWLA 2HJGA 1TT5A 1R8QA 1F0NA 2HPAA 2ZBGA 3JQAA 3O75A 3PD7A 4HDMA 3HACA 4BECA 3TZBA 3FLEA 1MRZA 1WP9A 2ORYA 3HCDA 2C96A 3GJTA 4JR0A 5JADA 1M1NB 5AVXA 2GNAA 3QBEA 3UT5A 2NM0A 3FY4A 3W9BA 2EZ8A 4IAOA 4RY0A 2YASA 5GZ6A 5EZYA 3ZZTA 3R2JA 4WNIA 4F7WA 4CEIB 4TRRA 2PYDA 3EF1A 5A71A 2WKRA 2D7JA 4DR1B 1ZUNA 4Z9YA 3ER6A 1OTXA 3F1LA 4ZN6A 1Z75A 5K5EA 5C5DA 3I0ZA 4C6TB 2YX1A 2X41A 1CS4C 2MYNA 3HUTA 3ZYZA 2FMHA 3CVVA 1T13A 4J1NA 1RWPA 1TJ4A 3BMNA 4G5OA 4WZBA 3N6RA 5I4BA 4CKEA 1IXKA 3N2EA 2BGTA 4HTFB 2BR3A 3B8HA 3MEQA 4DANA 3EY9A 1JFVA 4QBFA 1GPYA 3EAFA 5FHQA 3DVLA 4D42A 2YN0A 5I3CA 1QTQA 4P08A 4OQZA 1JLMA 1NVXQ 3R76A 1A8SA 3KOXA 4PPFA 2I9KA 4CM8A 4P84A 4P83A 5JAPA 3PDCA 4F1WA 1VFPA 3CVWA 4A0SA 4BJ3A 4AI6A 3TQRA 1O96A 4O5AA 3CVXA 1NL3A 3PHGA 2FE4A 3M5PA 2FK8A 1RJ9B 5IKOA 3U7RA 3BJIC 1MHTA 1NBEA 3WGGA 1JHUA 2UUOA 4IXDA 1K7CA 5MN5A 3DJYA 1B8PA 1X13A 2G1JA 2I03A 4OU5A 1DEKA 1FUUA 3UJ9A 3NHZA 3K6KA 2HHLA 2CLSA 4M0DA 5AIAA 5EP4A 3DSRA 2OBNA 3EC1A 1Z0SA 4IUYA 2GDZA 2V7VA 1ONPA 3H9UA 5FOQA 2P1ZA 1VE6A 4KIWA 2VQ3A 1PFWA 1JEJA 2YRFA 1FFDA 3I04M 1KVQA 3IP8A 4YDQA 5IJAA 1Z5UA 4N7MA 4KHPB 2E6UX 3KX2A 4UAUA 1P1IA 1N5DA 2RAUA 5FA6A 3RFVA 5BSGA 2C7RA 3C6XA 3SEAA 5BWLA 4QT0A 4KQKA 3WDKA 3QU9A 1IE3A 3A6FA 3MIIA 1A27A 4L0MA 1VJ1A 2ZZKA 2JZNA 4CG0A 4ZO6A 4BBAA 1L7DA 1QIEA 2BMDA 1HGXA 1Q50A 1Y3CE 2CNBA 2FW7A 2BKEA 3BGIA 421PA 2Q5LA 3H2IA 1P0QA 1IMOA 4BNZA 3OIDA 1KQ3A 2GESA 2B1JA 1ECBA 3EIHA 1ZN8A 3I32A 4HAVA 1Y1RA 4JB0A 4CQLB 3GPBA 1S8AA 3W90A 2FPUA 1KJ8A 2PSDA 2FQXA 1SB9A 1RW4A 4W6QA 1JI0A 4BVHA 4J7XA 4OLFA 3KVRA 1LBQA 5LQMA 5IT0A 4JV5B 2B0JA 1LGYA 4GI7A 2VH1A 3JTEA 3T52A 5A5FA 1OFVA 2I1LA 1NMZA 1Y8AA 2NZXA 4AWAA 1T4DA 1DKUA 4GLLA 4XUDA 3NASA 3IVCA 4GLOA 2FFJA 1EINA 4MX8A 4M0MA 2ZB7A 2NO9A 1BGXT 2GYVA 4A5SA 4FT2A 4JS0A 4EVSA 4R3WA 1JN0A 3NV9A 2P90A 5ALFA 3Q9UA 4MI1A 4K3UA 3ZWBA 1FS5A 2EBUA 1QX4A 1AC5A 2F9LA 2P30A 3JQ8B 3N0VA 1KU0A 1MP0A 1SHKA 3ELBA 5EJ4A 1GV1A 1KJQA 2P67A 2W90A 4WH0A 3VTFA 1UT8A 1BXZA 1TZJA 3A1VA 3AEKB 3BICA 4GXNA 5EUQB 5LXTA 1YXMA 2CLEB 4PLHA 3AVQA 5ITSA 1MF7A 6AT1A 3OFVA 1ZU4A 4KRFA 1KO5A 4MEJA 4MPTA 3ENVA 3QKIA 4KOAA 5TT1A 1I4WA 4MP6A 1Y5NA 1EJ6A 2W8BA 1NW4A 1MRSA 3T3HA 2RAPA 3P32A 4PZZA 3GJXC 5GGXA 3FYTA 5LCXA 2C2XA 1JP7A 4HDCA 2GJ4A 4MWOA 4YWJA 4B4VA 2CMFA 4IFTA 1V26A 1E7MA 4RACA 5CXQA 2ZDGA 2L2QA 3AY6A 2HA2A 4RL6A 5FOUA 5C1OA 4ZAYA 3KDPA 1YTUA 1F5SA 2DKNA 1PL7A 2YZ2A 4Y2XA 5D7NA 3RR2A 3R7DA 1U7DA 2Q6OA 1M33A 4CJXA 1GZ3A 1L5GB 5KYTA 4BV2A 3SHOA 1FFEA 3KKNA 5KYUB 4J1SA 1PYGA 1GXSB 3K5PA 4GPD1 4NENB 4ZDKA 5KO2A 2VQFB 1G8FA 3A4VA 2X40A 3ONFA 1SBHA 2QW8A 2PLAA 4BNWA 4QM7A 3G2OA 4AP6A 2OHVA 1D0SA 1SZPA 2RI1A 2IIQA 1Q7CA 3LA8A 3LZCA 3MJVA 3U19A 3HM9A 3U7FB 2HSGA 3ZE7A 3QIVA 5EJ6A 1OFIA 4BE9A 4DF3A 1QH8A 1U3VA 3R0IA 4PG4A 2MR6A 4DLWA 4QJ5A 4RTOA 2NGRA 2XDQB 1TECE 3B7GA 2W98A 1T8RA 2QQGA 4Y1RA 5D87A 4RZHA 2VK2A 4ZODA 2NO1A 4B5KA 3SJZA 4OXQA 2VSFA 1QVAA 2PMDA 3Q41A 4ZVUA 3NW9A 2DBVO 4P3YA 2ZRBA 3T34A 1WR8A 1FRQA 3DZ8A 3EVDA 4N6NA 3VUEA 3WP1B 1ZOOA 3HCAA 4DADA 2PL5A 3ODPA 5KHAA 3BMQB 5DXAA 4ENPA 4ZEVA 1NYQA 1TFRA 2H2AA 4HDSA 1GO2A 4K8RB 2BEUA 3RAPR 4BO5A 4F91B 1EVQA 4JP2A 1CR6A 3V8QA 2D54A 3U7HB 3LECA 2JK1A 2DCUA 4MUEA 3DBRB 2PLWA 2H2WA 2XLBA 3P45A 5DW0A 3I28A 3D1JA 5ICGA 2AL7A 4GI5A 2QAIA 3IEMA 2ZYIA 3WDMA 2EHDA 1MZPA 1MFZA 3B1ZA 1R4NA 5DCLA 2HXYA 1U81A 4BFCA 4IY1A 1RRMA 1A5ZA 2ZJ0A 3I64A 4JELA 4NDZA 5FF9A 4R3NA 4ZCLA 3IPYA 4M8KA 4X54A 5DNEA 3HR4A 3RC3A 4ETWA 1F8UA 4F5ZA 1IBCA 4RLQA 1ZXBA 2R1UA 4M88A 1LLFA 1NIPA 1XB2A 3KQWA 1X19A 4KFCA 4G5SA 3ONEA 1BS2A 2OBLA 3HMKA 4ZZ3A 2CL5A 2QG6A 1GSIA 3OTWA 1GTVA 1Q0RA 1R4AA 3KYJB 4C7MA 2HCTA 2OE2A 4YPFA 4ATNA 3M33A 4X8OA 1PDWA 3IXLA 1AQLA 2YYZA 3AO0B 4QNMA 4DV1B 2FW1A 1GADO 1P3JA 3LGSA 5AHOA 4RNDB 1KI3A 3WQBA 3S1AB 3E70C 4I1PA 4HPWA 2WIAA 4A2QA 5DP1A 3D7RA 1FJGB 4JJAA 4GZLA 2QY9A 3SIPA 2Y1DA 1PR9A 1BDBA 3OKFA 5B4UA 2VUHB 3W2HA 3X0DA 5H81A 4EX6A 4EYEA 3P8ZA 1NASA 4GKAA 3IVMA 3MRXA 1YDGA 2E89A 2H06A 4CKBB 3U56A 1VLQA 3FD8A 4A0QA 5MF6A 4M46A 4CDGA 2IHYA 4LJLA 3H1BA 4D9NA 2ZWOA 2XSZA 1UDBA 1L5OA 2G9QA 2XQJA 4QU9A 5DGIA 1U2QA 4AJJA 1NJFA 2P9JA 3QRWA 1XALA 2QJRA 4QOEA 1V8DA 3OLWA 3QFRA 5HPYB 3OQNA 3DHEA 3HKDB 1WD5A 4DDMA 2JFHA 2VHWA 2W0MA 2VYQA 3MPUA 2NXCA 1HEUA 1MX1A 1LI5A 2WM8A 2QMOA 7MHTA 4XFDA 1UEIA 3L2OB 4M9UA 3LCRA 2MT9A 5AI8A 1IZ7A 5JEEA 1O5IA 3NANA 5CAEB 2JNWA 3E03A 1RC0A 4NHEA 4P7KA 3CJRA 3O1HB 3UMSA 4F96A 1I7QB 5IM5A 5ILOA 1T10A 4KUHA 3VJRA 1GZHB 1N77A 1I6LA 2VKTA 1R27A 3E4CA 3NOOA 4MR8A 2I3AA 3VZBA 4WFJA 3ANTA 1AXRA 3VBEA 2XD4A 1QZ3A 1SQSA 1WRBA 3U4QB 3KTOA 3UZUA 2Z9CA 1JVSA 1ISMA 1QIDA 2JKYA 3C6BA 3GNTA 3LDHA 4OB7A 1MW9X 3C6ZA 3P5BA 2QP3A 4UD6A 4IMPA 1SCDA 2B30A 2RAVA 3HY3A 1IQ0A 3HHEA 2ISCA 3FZQA 3H5NA 4HJXA 4INOA 3UWKA 1M2HA 5HM8A 4J7AA 1E6EA 5KSYA 3BMOA 4K87A 4YCCA 4OHZA 1RTTA 4BMNA 3FVWA 5I7FA 2SHKA 4RIEA 3G2PA 1U9YA 4IW3B 4RJKA 2W43A 1Z33A 2QUAA 1UOEA 4US2R 1FQJA 3AW8A 1L3BA 1R88A 2BHLA 3CQ9A 4YP0A 1R9NA 4N3GA 5AW5A 1KDTA 1NVWQ 1EVKA 1JFTA 4NECA 2Z4TA 1T5IA 4AVYA 4BXOA 1CP3A 2QN8A 2FEWB 4A8TA 1H2BA 2WJHA 1C3LA 2FMXA 2Z2YA 3BIXA 1LSJA 3F3MA 3QYAA 4MV1A 3RS9A 2IT1A 2WUWE 3W04A 2FWRA 3U0VA 5TRTA 3GPLA 3GP8A 2BTQB 4G36A 1CIPA 4J0JA 1U2PA 1VJCA 2JFXA 3B78A 3SJUA 5C4IA 4FI3F 5HCIA 4U02A 2X7JA 1GA6A 3RC1A 4LHXA 1ZD5A 4BVEA 2ECPA 3AI1A 3LUGA 1R0ZA 2C2KA 3SSAA 3B1FA 4NEQA 4RCVA 5A3QA 1MEEA 3JASB 2ZB2A 3MBKA 1N25A 2Q5QA 2V5UA 3DFFA 1PW7A 4U7TB 1YB5A 4OOFA 2XNKA 2OHJA 2OYCA 4KQEA 4EGCB 1A72A 2CJWB 4FXPA 2FG5A 1Q57A 1JVBA 1PNQA 2NU6A 4DLYA 5I7SA 4LWOA 3LBAA 2VAVA 3WGOA 4E21A 3CMCO 1VMAA 3ZWKA 3VR3A 4DIFA 3KXIA 4U8GA 2JKZA 3U7GA 4Z9AA 4XEHA 3NU1A 4R71A 2W6JA 4CCYA 1V8BA 3T61A 1V4BA 5BN4B 4DM7A 2R6FA 3BWVA 4ZQHA 5DYTA 4KQGA 2CDNA 5F51A 5LLSA 3SYKA 4AP5A 1SZDA 1YMVA 1K3TA 3VZPA 3MAJA 4PC6A 3JD4A 4GOOD 2XZDA 2NAPA 4R2JA 2C59A 1YIAA 1N6NA 4RFLA 2OCGA 3TZCA 3W5JA 3WGNA 1HT0A 2JDID 4EENA 4WEOA 1IBSA 5D5QA 3PWSA 3OG9A 3DPSA 2ZBQA 3T5BA 3VR4A 2PMBA 2ZUEA 1E99A 2QLBA 3BD8A 4H4EA 4JKIA 4KIFA 4M0LA 3TJMA 3BD6A 3H9EO 1I0IA 3IESA 3NWPA 4FFBA 2UVQA 1R66A 1QWSA 2PGXA 2NT4A 3L05A 3VDMA 5IJ9B 4QDJA 3G2QA 4D3XA 1I4TD 2ACEA 4IFEA 4PXAA 3MT0A 3QBJA 4YVFA 1C8LA 1V8ZA 1Y34E 2JGEA 1NVBA 1XN1A 3EQ9A 5F52A 4B75A 2JEZA 2XB8A 3QA9A 4KQIA 3ZWXA 2G0TA 1HLDA 1TLFA 2XHZA 3EK2A 3HDGA 4G9BA 4RTLA 2NN3C 2D1QA 1AZLA 2PBFA 2QSJA 1MCZA 3R6LA 2PX3A 1HQCA 1IBKB 4IEEA 3LY8A 5CH8A 3V1MA 4KREA 4V0KA 1J0BA 1GT91 3SHQA 4K81B 1YUNA 3SC4A 3KQVA 4EHDA 1RWNA 3KL2A 1EVEA 3ZK7A 3OHMA 3LW8A 4DL9A 5TJHA 1T9HA 1G9SA 4BV8A 1GQRA 4B48A 4ZZ1A 1ZK4A 1XZ8A 1T3SA 4O3FA 4J0DA 3DVQX 3PNVA 3RI3A 2EJUA 2HUNA 3EG9A 3C70A 1C2TA 3MAGA 2WU1A 4RKYA 1RI3A 3WLRA 2AV6A 5IS2A 4OIMA 3RS2A 3G79A 4YI5A 5TY0A 3IEIA 1X15A 821PA 3PEYA 4TZTA 2IIPA 2F6RA 2IEYA 3KB1A 3GBVA 2VPQA 3I2IA 3AUTA 3KQNA 3ZKWB 4LF6B 3B9QA 2HB6A 2ACKA 1J5XA 1NHWA 2UUPA 4B40A 4BNLA 3OQ6A 4MUIA 5F73A 3R9XA 4YCAA 3CJTA 3GNSA 3FPHA 4W8GA 2OYSA 5HMLA 5TV2A 2XB2A 1A4XA 1F48A 3IA7A 1POWA 2CEAA 1P4JA 2I65A 1YU9A 3NHWA 4N5IX 4YMIA 2ZPAA 1KBOA 3EXHB 1U11A 2G1AA 2YWRA 1WEKA 1QHGA 4ACAA 4AJIA 4AYWA 3NHBA 5FBRB 1E0SA 2VHYA 1XEWX 3ABOB 2NW6A 3FWZA 2GM4A 4HLQB 1ONNA 3KQSA 3SP1A 2OV8A 2VJOA 5FA8A 2ZW9A 3FZNA 2ZSFA 3FN4A 3HUDA 2SKDA 3AIIA 5K0FA 1OSNA 3A4TA 2PWAA 3IKTA 3F0TA 2EF0A 4Z1MD 4KQHA 1MQAA 1RRGA 1KI4A 4KWIA 4LNUA 3SYMA 4AZSA 5JH7F 1IY2A 1F3LA 1MN6A 1NPTO 3PHJA 2B3DA 1KMMA 1XL1A 3WMFA 2VBCA 3OF2A 3HDHA 3G85A 3KWJA 4O2BB 2FMIA 3NVMB 4RXMA 3UKOA 2Q5OA 3OP4A 2XJ4A 3I5MA 5A5DA 2NO0A 4EGSA 1ZCZA 3UQZA 4YUXA 2O8FA 3F74A 3F8TA 5CNJA 2YV4A 3HADA 5C2JB 3PXAA 5BYJA 3SN6A 3BMCB 2X5XA 4FEGA 5IEBA 4ENQA 3W5SA 1D2CA 2VHXA 1DAHA 1VE9A 4G8DA 3UFXA 1N5IA 2G7ZA 4X24A 5EE5B 4P98A 1V7CA 2GETA 3ELYA 3WDLA 4C2TA 3T9BA 3W2TA 2UYQA 4OQMA 2C2BA 3IEVA 5LZ5A 2QL7A 2ZULA 3O8RA 1DQSA 1Y42X 4HHEA 2VZEA 4XQ9A 1QQAA 2H4XA 1C14A 1P9RA 2JFNA 3ANNA 4GLFA 5DEOA 1PQPA 2FFBA 5LYJA 3VU9B 4LE2A 1Z2CA 1NMSA 2W70A 3WGYA 3U3ZA 3LBFA 2Y67A 5B7GA 5A4AA 2DY1A 1GNVA 1NLUA 2DSTA 5TPZA 4D7AA 3IQFA 3I61A 2QVXX 4CVNA 3O2NA 4HNQA 4O6VA 5GINE 2CYBA 3FAZA 3EODA 1X1RA 2OBFA 2ZRGA 3BK2A 5HQJA 1C7QA 4HFNA 3I6ZA 4F3KA 1V0JA 4XM0A 3TLXA 2Q1WA 1JQEA 4A91A 1AIPA 2ZR9A 1ZM3A 3FSGA 2O3TA 2O0KA 1DTWB 3FX2A 4FYYA 1G9TA 1K89A 4P5EA 4MEAA 3DO6A 1T9CA 4LV5B 5DYGA 3U7JA 4BKMA 1JEOA 4W82A 4NNJA 2DX7A 3UV3A 2LW7A 1D2MA 2Y0CA 2I1QA 4HN2A 3JQRA 1PWZA 2G5CA 3DONA 2YXDA 3A1NA 1IPFA 3CF4A 5EKUA 4L5JA 1XGKA 4XQ0A 3SQOA 3NNDA 2W2OA 4XM1A 4Y9UA 4DNFA 5KTMA 3DVRX 1PZMA 2ZWMA 2ZJ4A 2GBLC 3DAHA 4QVIA 2OBXA 5JI3E 1HG1A 2AJ8A 1FMLA 4J6EA 2XUFA 2VT7A 4M1EA 2YVUA 2F8SA 2HMVA 2WR8A 2CJFA 4K1LA 3I2FA 1XHLA 2PEZA 3BXPA 4I19A 1Q1NA 2O7RA 2OQVA 4YROA 1DXQA 2DPXA 1XTBA 1ODTC 1Y3FE 1NUAA 2B7BA 2OHGA 2WIGA 2YQ5A 3O0DA 4WUVA 3S2ZA 4LTDA 3DQPA 4GX0A 3AI2A 3AW9A 3AETA 3ESRA 3ZHCA 1VL8A 3C5VA 5AVSA 2NUBA 3FJ1A 3F6CA 4J03A 4OA8A 3EG5A 1OLXA 5TJ9A 4KYTA 2PYZA 4Q82A 1ZBDA 4AECA 1W46A 2YQZA 4MIEA 3LT4A 4KSCA 5AKJA 3TR0A 3PGLA 4AMGA 4M1QA 3WGIA 5DRTA 4A4DA 5I01A 2FMTA 2BDEA 3DFMA 2BF7A 1F6DA 3B13B 5FPYA 1WU8A 5EWMB 1Y63A 2XUZA 3FGOA 1QIIA 4RDIA 5EOVA 1W4AA 1VI6A 4M60A 4C0LA 4F93B 5F3WB 3M3HA 4MV9A 1Z4PX 4Q3BA 4S0XA 5AMXA 4A6PA 3WA7A 1THZA 2BF4A 3O84A 1M6YA 1UKVY 2RH5A 5F1KA 3S2FA 2WJIA 1S02A 4GM0A 3CUUA 1F12A 3G0CA 4XWTA 1AXGA 2YZNA 5AKYA 2FH5B 3LWZA 4IDAA 3F90A 3GB9A 1P80A 3H5RA 3N6VA 3TLCA 1QCDA 4P22A 2XPCA 4Z9XA 2JFGA 3EUEA 1Y1PA 1YZKA 2DERA 1YF3A 4FE7A 1RM0A 1FTSA 4P86A 3LDFA 2PZMA 1FFXA 1PE0A 3K9GA 2FJUA 4JVSB 5DBEX 2NXJA 5K7SA 5GZ1A 5ADHA 2R47A 1Z34A 4B3BA 1K5HA 3GHYA 3LL7A 3FH0A 3PC2A 4JXZA 1SU7A 1Z5WA 3D6AA 4HB4A 3M1LA 1ID1A 5GWXA 4BMDA 4ABTA 4UXIA 4GOLD 5AW0A 5EEHA 3V1LA 1TZCA 1YHNA 3H2HA 2PWPA 5CDFE 4IQ0A 3OPYB 4QTUB 3TKAA 1YR6A 5DEIA 2QX8A 2C4MA 4BV3A 2F3QA 3IGFA 2ES4A 1E2FA 1TVKB 2PM8A 4YAUA 1ADBA 5DW3A 3ZV5A 4BLPA 2CL7X 2GO1A 1X7YB 3IODA 5EGSA 2KJQA 4B3SB 4A26A 3U5TA 2EGHA 2Q1YA 1YIOA 3PUKA 4QGSA 4FW8A 1G8JA 2BJWA 4ZVQA 3KPJA 4KQ1A 3T3NA 1ZNXA 2VCEA 1DIRA 3EXG2 4F5YA 5LFAA 2VWGA 3OCJA 2JHPA 1UP4A 4B6QA 2J6CA 1JQAA 1RHKA 3DDCA 2I1VB 4I50A 4Z0HO 3UHPA 4MPRA 3CH6A 5KDDA 3DL0A 3KT3A 1RZRD 4B9AA 3BWYA 1N2SA 3OQPA 3VNAA 4AZTA 2JIOA 5A4MS 5KWIA 2BBWA 1PT7A 2BMVA 1JR2A 2GBIA 2ODQA 3PRHA 3C6KA 1N3LA 1SUBA 3JVVA 2AN4A 4TKVB 4TTAA 5J2UA 3CEMA 4HDNA 2BFNA 4RHTA 3RG2A 3WGKA 4AQ7A 2R8PA 1P1JA 1RLMA 3OLYA 1KYWA 5G3YA 4R1UA 2WVAA 4N12A 5A2GA 2ET6A 4MA0A 5JG7A 3H1PA 1DRUA 4H7PA 5AOVA 4Z53A 4A8HA 2H7CA 3NHLA 3A3OA 4G1CA 4R1LA 1XKQA 3OT1B 2RHWA 5A5VA 1P5RA 3VH3A 3VXKA 2R1TA 1LPSA 1S2LA 4NBRA 4Y0AA 2WYHA 3F9IA 5AXAA 2I66A 1PD1A 2FFAA 4I4TF 1L4EA 1PR3A 6ADHA 1UBEA 1AK9A 1ZVJA 4P7JA 3D8HA 1EIZA 1G20E 3IT3A 3T94A 5JNSA 5DHTA 2R6AA 2DBZA 3KHSA 1H94A 3FSJX 3OA2A 4KZPA 4PRYA 3ESAA 3H1GA 1CSEE 2AKYA 3KG2A 2WKSA 1DDOA 2R79A 3MQFA 3THYB 4FFVA 2X58A 3RUAA 1X9HA 2H4JA 1OXTA 1Z0DA 4LDNA 2ZBVA 5K4HA 2HQOA 2WT4A 3WZLA 4HN4B 5JFOA 3ZBUA 1CJTC 2UVPB 3K2IA 1AGXA 3UHAA 2G80A 1GCIA 1RJGA 3NTXA 1NVVR 2GBCA 4G5FA 1W5BA 4UBNA 4CTJA 3KR9A 5BW8A 1E98A 1GRCA 2Q99A 4B6GA 1WKBA 4REQA 3WJ1