2Y93A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
275
structure length
268
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGSVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Oxidoreductase
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
total genus 91
structure length 268
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y93A00
3WFIA 4L4SA 4JNKA 1LRJA 4AJ2A 5C3MA 1U9JA 3FR8A 7MDHA 2VWGA 3NUGA 4XJSA 5CPBA 1YE3A 1E5LA 5ENDA 3TSCA 4A73A 5JAIA 3LZ6A 1I30A 3E48A 3DO5A 1YJ8A 5H82A 3OMLA 2OORA 3RUEA 3JQ9A 5EESA 1NFFA 3D3WB 1O5IA 4MIYA 3GNTA 3OEWA 1PJCA 2Y68A 3AI2A 3FSRA 2YQ4A 3MWEB 5ENVA 4EJMA 4YJHB 1LUAA 2C7GA 1I3LA 1SEPA 2AA3A 2VYND 4QECA 5IZCC 4PLHA 4DBZA 2Y66A 3GVCA 2C2XA 1Y8QA 2VHVA 1QG6A 3GR6A 3GHYA 4RDHA 4XR4A 4BO3A 3IUSA 2CDAA 5CG1A 1R0KA 5H81A 1ZK0A 2PZMA 3KETA 1GDHA 3U49A 1DC5A 1AUPA 4OSPA 3R3SA 1PJQA 4HFRA 2UV8A 3KEQA 4D0RA 3WYCA 3JV7A 1RJWA 4IIUA 5CDYA 2JAHA 3HG7A 4U8GA 4JK3A 1E5QA 1PGPA 3BHMA 3M2TA 3RJ9A 4CM7A 3ZV6A 4BGEA 1GYPA 4FC7A 1IUKA 2ET6A 1TEHA 3AU9A 1J4AA 4GGPA 4W6ZA 4WCFB 2WDZA 1B16A 3RUIA 3VVCA 4ND1A 3WDSA 1ZCJA 3ABIA 2W4QA 4OOEA 3AWDA 3JQAA 1ONPA 2IZZA 2GZ1A 2FP4A 3FCOA 3OQBA 5JXWA 3WGIA 1WXDA 4TZTA 4TKMA 2O2SA 2X0NA 3ZHYA 5A9RA 4E12A 4CJXA 1GEGA 3TDKA 3GFBA 3LVFO 2BFMA 5TGDA 1U4OA 3K8ZA 1XLTA 4NBUA 3KYCB 3QA9A 1R4NA 1GQQA 1I0ZA 1P3DA 4PGFA 5TC4A 1V35A 4TSKA 3U3XA 4D45A 2EGGA 3H3FA 4CODB 3WJ7A 4TRNA 1M6HA 1Y81A 2OZPA 4RF4A 3DTYA 3MOGA 1S6YA 3I9LA 2C5AA 5DBGA 2J5RA 3B1FA 1KEUA 1BW9A 4BNGA 4XQ9A 1GEEA 4WNIA 4J2OA 5TF4A 2VT3A 3M1LA 3QVSA 4AJ1A 1GAEO 4W7HA 4RLSA 2QYSA 1BMDA 3RC2A 1WZIA 3V1YA 4J90A 1XQ1A 4U6QA 2PGDA 3JQCA 3ZWMA 2I67A 1O0SA 3GRPA 5TJHA 2P4QA 4RPKA 5CEEA 3OA2A 3PHGA 4IDGA 1FXSA 2R2GA 4B3JA 1O6ZA 3HNPA 4W7IA 3INRA 2Q1SA 1SMKA 1P1IA 2PH5A 4Y67A 3V2UA 3WWZA 4B7CA 3PIIA 5TX7A 5TJ9A 4AVYA 4PFJA 3UAGA 4G81A 3E9MA 2B4QA 5KKAA 3KUXA 4E4YA 1I2BA 4FFLA 4RGBA 1Q0QA 4KMSA 4CLHA 4D3SA 4ALNA 1NWHA 4IJUA 4JJIA 1A9ZA 1VL8A 1EK5A 1U3WA 4D3FA 1E7WA 3ZWOA 2IEBA 3NV9A 4L76A 3S2FA 1IZ0A 1LC3A 4LSWA 3FNGA 5BSFA 1UDAA 4YVFA 3PHIA 5F1KA 2ZB8A 4WNCA 4BO2A 1XYGA 1R16A 3SX2A 4U7WA 3GH3A 4J7UA 4M55A 5COBA 3PFWO 3B1KA 4FC6A 2Y93A 5JO9A 1P1HA 2O3JA 3DZFA 4YAKA 3KYDB 3ASUA 4W99A 1CEQA 1KYQA 3DTTA 4YT2A 1LDEA 2JD0A 4OQZA 2YDXA 2HK8A 4J3FA 1T2CA 1YB1A 4GMFA 4UUPA 1KVRA 2YJZA 5K0ZA 5GY7A 4ND4A 4XDZA 4ZU3A 3UUWA 5FF9A 3O4RA 2VZ0A 1K0UA 3JQ7A 4PG6A 4MOWA 3I5MA 5CFZA 3PHLA 1UXGA 1ULSA 5K6AC 1B3RA 1N7HA 2HO5A 4DTIA 4CPDA 3I6IA 4WCFC 3BYZA 4IDEA 3DAPA 4DQVA 3WMWA 4BNIA 5COAA 3ROPA 3W4JA 4BMNA 1YJQA 4G65A 1U5CA 3I6QA 3Q6IA 1ZMOA 5ICMA 4P22A 3KV3O 3KB6A 4DL9A 4TQGA 3GC6A 2DBZA 4L74A 3NT5A 1ZK1A 1GUFA 4EUHA 3PJDA 3ZWNA 5IN5A 2UVDA 2NVUB 4ZQEA 2X0RA 1ZK3A 1BDMA 1T2DA 5IDXA 3FTPA 3JQ8B 4J7CA 4OHUA 3A14A 3ZV3A 4GLLA 3QSGA 4PCVA 3T4EA 1BXGA 3I52A 4LMPA 3F46A 8ADHA 1PS8A 4NQZA 4CUZA 4DLLA 2YHUA 1IPEA 2I65A 4M86A 2PFGA 2QYTA 3IS3A 4O63O 4XD2A 4BO9A 1GUZA 4CLDA 2JD1A 3RSHA 4HX5A 1K6JA 4FGWA 1XDWA 2PKQP 5K9ZA 5TS3A 5T64A 3MEQA 4RVFA 5KJCA 4P8RA 4S3MA 5EN4A 1DSSG 1N92A 5JO0A 1LSSA 1MP0A 1HYGA 2Y1FA 3HQ4O 3HDJA 4Y8VA 1XWFA 3K31A 4LK3A 3B20A 3NTRA 1X0VA 4CMAA 5B12A 3UCXA 4BNYA 4CUJA 2CZCA 5JNLA 4BV9A 1PJBA 4NU5A 3AUTA 1C0LA 2P9CA 4R1TA 3UCEA 3TQHA 3QWFA 3TOZA 1ZW1A 3IMFA 1B14A 4JBIA 2CUKA 4IINA 2J5QA 3D7LA 5IDQA 5B4VA 2GERA 2AE2A 1TT5A 2WE8A 3AY3A 3F6YA 1SC6A 4JX8A 1HETA 1NXQA 4NK4A 4RF3A 2I76A 5CP8A 1KVSA 4UVGA 4ALLA 4NG5A 2BI8A 4NH4A 4YJGB 3KM0A 2Q49A 1K2WA 3QVWA 4RQUA 5HA5A 3AOGA 4OYRA 4J4HA 1JW9B 4J43A 8LDHA 4KTVE 4A03A 2NVWA 4LGVA 1MG5A 1EBUA 1P44A 1K6XA 1PZHA 4UVHA 3ZWBA 3EVTA 1X1EA 1P1KA 3GZNB 2V6BA 3GDOA 1GFSA 4YT5A 2VNAA 4E30A 3N58A 1F06A 2CF6A 4FS3A 1IY8A 4CR7A 3MJEA 2C29D 4HFMA 1A4IA 2P9GA 3P2OA 2PY6A 3DOCA 3VVBA 3BMQB 4KWHA 4BNWA 3KO8A 3DHEA 4WLOA 3WICA 2IZ0A 3ETGA 4DXHA 4UEKA 3R6DA 5AXDA 1EK6A 3BMOA 3H7AA 2CNBA 3GN1A 2CD9A 3DZIA 4FB5A 2ZATA 3JQ7B 4OQYA 4TRJA 1I3KA 2DTEA 1UZNA 1DFHA 3D3WA 1GZ3A 1QYVA 2XOXA 5A3JA 2H6EA 2AQ8A 1H9AA 4BHTA 5COQA 1E3EA 3EK2A 3JQ9C 5KVVA 1C0IA 1E6WA 4BO5A 4AICA 1L1FA 3F4LA 4JIGA 3IOYA 4C4OA 5GMOA 1GR0A 4DVJA 2AXQA 3M6IA 1MXFA 4NBRA 2Y0DA 3JD0A 1LLUA 2NWQA 1UZMA 2WE7A 4PLTA 5ER6A 5L40A 1YXMA 3PYXA 1RM0A 3RI3A 3DBVO 2WJPA 4IJWA 4MKRA 1I3NA 2NTNA 1ENZA 1QP8A 4E2YA 3ZWXA 4GGOA 4OGWA 5DCWA 3NDRA 4URFA 1K89A 4ZQGA 4EZBA 2G1UA 2ZYGA 2VZ9A 1C1XA 3H9QA 1PGJA 4LCJA 1YBMA 4EJ6A 3CINA 3H65A 1Z45A 5EMHA 2BGLA 1GU7A 4YJFA 3OA0A 5IXYA 2B35A 3CEAA 2X22A 4CLRB 3FN4A 4O6VA 1KOLA 3FTNA 3KLPX 1DC6A 1PL7A 3LLSA 5G4KB 4YRAA 4IDBA 1LDBA 4RVUA 2X7HA 2PNFA 3GOHA 5THKA 3L0DA 1M67A 2X9VA 5I7EA 4GSKA 2AEFA 4RV9A 1YOVB 3D3EA 3SJUA 3CZMA 4J1QA 1NQAO 1BGVA 2Q4EA 4BNLA 2GSDA 3QQPA 2EKQA 3E6AA 2YW9A 3OM9A 3QV1A 3QHAA 2PKQO 2DUUA 5FYDA 5ILOA 3ZWCA 4MVJA 1HDXA 1CJCA 1B3BA 2FSVA 3BXXA 3SXPA 1PS9A 2B0JA 5L7WA 5BSEA 2XF8A 1DB3A 1V9LA 4PRKA 4ZGWA 4IXWA 2QIOA 3JD2A 4Y9DA 1XELA 3X2EA 2XXJA 4KP7A 2QZZA 2GZ2A 1PL8A 1U8FO 2WWRA 4ZVVA 1B8VA 2BKAA 3K6JA 2CFCA 4BO6A 3M2PA 2P91A 5CEJA 1EQUA 3DL2A 4L9RA 4Z0TA 1EUZA 4M89A 1ZXBA 1U7HA 3H8VA 1IULA 1BW9B 2GUGA 3HN2A 4QUKA 3VDRA 3F5QA 2WTBA 2EJWA 5U1PA 1NNUA 1YONA 3GGOA 3JQBA 3BMQA 3MTJA 1XKQA 5A03A 1E3WB 1ZEJA 3L4SO 4E5MA 1DBVO 2VYNA 2LDXA 1UP6A 1WAMA 3KYBA 4FJ2A 1NTOA 1EVZA 1PEDA 3RASA 4R68A 4CLOA 1F8GA 1U3UA 2EIHA 3UN1A 2OBNA 2P5UA 5DP2A 3U5TA 1GQYA 4FW8A 4Y6PA 4PZCA 4RLHA 5EPOA 5IG2A 1GZ6A 1DJNA 2VRCA 3FPCA 2X1HA 3I3OA 3VPGA 1P1JA 4FGSA 2VUSA 3BZUA 4GH5A 1Q2XA 1EQ2A 4PLGA 3EAGA 2FR0A 3AUSA 3RIHA 1T2FA 1I01A 4YWJA 1A27A 3K2EA 1G0OA 4MVJF 4L75A 2AHRA 2DUWA 4P4LA 2Y1EA 2Q1WA 1HSOA 3AI3A 3OJOA 3OEYA 4XYBA 5KCZA 2VHZA 5BNIA 4II2A 2YV3A 3H5NA 3AOEA 3F1LA 3PVZA 1B8PA 5A9TA 3B70A 1PS0A 3BAZA 4PG4A 3RUCA 5JAZA 2FZEA 5IAAA 5KVCA 4DYVA 3GA0A 3L9XA 1PJLA 4OJNA 2P4HX 5DCUA 3SC6A 3LLVA 3QY9A 1GCOA 4JROA 1WLYA 3HWRA 4YJDA 4NZ9A 4YJFB 1NQTA 4DLBA 4JP3A 4ZQFA 2JJYA 4L0QA 1DIHA 3O9ZA 1VJTA 1D1SA 1NVTA 4CV3A 1NFQA 2X5OA 5TRTA 2IDZA 3ZN2A 1GCUA 1VI2A 4DPLA 2PLAA 5JYEA 1LDMA 3GZ4A 1PJ3A 2DAPA 3WWYA 1LLCA 5MGBA 1YVEI 1PIWA 1N2SA 2PH3A 2ZYAA 4DRYA 1JU9A 2E4AA 3O8QA 1U1IA 4UAGA 4P38A 4FBGA 2B69A 3BTVA 1DFIA 1D7OA 5IFLA 1DXYA 1Z82A 3BMNA 1V3TA 3HDYA 4YRDA 5L4SA 4D44A 3MJVA 2NM0A 4N5MA 4LRTB 5KWEA 5TSDA 4CMJA 3CIFA 4HY3A 1DRUA 5JBIA 3ZU4A 1W8DA 1H6AA 2DBQA 3WGQA 5TT1A 4BO1A 3RBZA 3ICPA 1JDJA 4XA8A 4ZICA 3DQPA 4PG8A 5DBFA 1M6WA 1WWKA 1U4SA 2WSBA 1MX3A 4WKGA 2HQ1A 4ALKA 1ZEMA 3STHA 1IE3A 4G5HA 3PLRA 2RCYA 2WD7B 3G17A 1N8KA 3NKLA 4NJOA 5BSGA 3RUHA 2Q1TA 5LDGA 3RKUA 4J2HA 3BIOA 1F12A 1NHWA 4IS2A 2GPTA 3GVPA 4TZKA 2Y1CA 3S2IA 1BTOA 1DDOA 4UEJA 3I1JA 3QP9A 4BB5A 3BMNB 5ITVA 1DIAA 5U4QA 1FDVA 1NAIA 1WNTA 6LDHA 2OFPA 3F5SA 4Z0HO 5J23A 4I5GA 3PWZA 1I5RA 3OFSA 4R69A 5L7TA 3U62A 3PHHA 5ADHA 1GUYA 1PU2A 1F14A 2Y1GA 3E5RA 2Y1OA 2C59A 4J0EA 3V2HA 2DBVO 1R6DA 4WLFA 4B3HA 2J3IA 4X54A 2VYVD 1E1MA 1YH3A 2W98A 3ENKA 4UREA 3WS7A 2UAGA 4P4GA 3VH3A 2EGHA 1SPXA 1CERA 2AEJA 1NASA 4KOAA 3NJ4A 1EVYA 3WSWA 1HEUA 1OAAA 3ZGYA 1JKJA 3PLNA 4LMRA 2CVOA 3S2GA 4B3IA 5A3VA 2AQIA 1E1KA 3D5QA 3PWKA 3D0OA 3WGZA 3VTFA 4QO8A 2GF2A 4UVDA 3LSYA 5F3RA 1TI7A 3WNVA 4CV2A 4GX5A 5JW6A 1UDBA 3JQEA 4D3DA 3FBGA 4QX6A 3OF2A 3OJFA 1LX6A 4GBJA 5C37A 3WLEA 3VPFA 4KUHA 1O94A 1TVEA 3WX0A 2BHLA 3A06A 2EKPA 1PZGA 1CQIA 1PZEA 4Q3DA 1H94A 2V7PA 1BG6A 1ZNQO 3E03A 1MV8A 4XX0A 4IJVA 2GN6A 2AEMA 1A5ZA 4PVCA 2JFHA 3P2YA 2I9PA 2FR1A 2G76A 4R3WA 3PP8A 1H2BA 4HADA 4IGEA 3NDJA 2I3GA 3GPIA 3JQFA 3JQDA 3DONA 2UYYA 3OQ6A 3PQFA 4QFCA 3W4KA 4XDYA 3WGYA 2UUPA 1B8UA 2ZTUA 1YQXA 4CM5A 5I7SA 1CDOA 2BRUA 4IXTA 2V65A 3VPHA 3JQAD 4W9NA 4E5NA 1ML3A 4E0BA 4BOYA 1JAXA 1KERA 3X2FA 1PGOA 4HXYA 1KEVA 4DLAA 3CH6A 1EMDA 4R9RA 4MVJP 4E6PA 4GL4A 1MG0A 1IHXA 4IDFA 1QV7A 3JD4A 4WE3A 2PD6A 4IQGA 5BR7A 4MVJE 1YRLA 1JKIA 3V1TC 3JQFC 1ZVMA 3C1OA 2B37A 3PGJA 3KTDA 4I9UA 4Q9NA 3C7CB 4E5KA 1X15A 1ZO8A 5B4UA 1QRRA 1EFKA 3AUAA 1ZMTA 4XCVA 1I10A 3ST7A 1HL3A 2HU2A 3PI7A 1T26A 4CUKA 5JC8A 1T4BA 4J1TA 2DBRA 3FNHA 4YAEA 3VH1A 5DULA 1KEPA 5C5IA 3ANMA 4RVHA 1U7TA 1NVGA 1WDKA 4NFYA 5EERA 5JDCC 1VE9A 4CQMB 1VKNA 4E32A 3HDHA 3H5RA 2X4GA 2X0JA 2NSDA 4LVCA 4ND3A 4RO0A 1LXCA 3GRKA 2FPIA 3QWHA 4N18A 3DZGA 4PG5A 5F21A 4AJHA 1GTMA 3W8FA 4TVBA 2DPHA 5G0TA 4CMEA 2D2IA 2V6FA 3GHHA 3VZRA 1CWUA 2BI7A 3G1UA 3OIGA 3GY0A 3PDUA 3RC1A 2VTEA 3NEPX 5L4NA 4DIOA 5GZ3A 2NU6A 2NADA 4BO4A 4E21A 4KQXA 3DMYA 1QYDA 3DOJA 3E82A 3E1KA 2EEZA 1ENYA 4CLEA 1ZUD1 2ZB4A 1X13A 3D5TA 5I7FA 4I5FA 1LNQA 1BXKA 2SCUA 1E3LA 4IMRA 3WJAA 4INAA 1P1RA 3WOHA 2YFHA 4GQAA 5C7LO 2RBEA 3U4HA 1RM3A 2OBYA 3D4OA 4CQLB 5JS6A 4RDIA 5G2OA 2NLOA 1R0LA 1BHSA 1GYQA 5L45A 4XYLA 3WBBA 3GAFA 2O23A 2JHFA 3F47A 4GPD1 1EDOA 2BGMA 2Z1MA 1KC1A 3M1AA 3LC2O 2BF7A 4PIVA 3SLGA 4OAQA 3C1TA 4E2XA 4XRRA 1YB5A 1Y7TA 1YOVA 2IYOA 1ZXLA 4GX2A 4AJKA 1Z7EA 3ZHXA 1FJHA 1JQBA 4A7PA 2Q2VA 1PQUA 3G3EA 2VOJA 1EVJA 1NYTA 5CAEA 3WGTA 3TJRA 4L73A 1ZK2A 3EMKA 3IJPA 2FPPA 1Y1PA 4GWKA 1OZAA 3TZKA 4CM8B 2X6TA 3U4IA 2AMFA 1ZSVA 3C7AA 3OQ1A 4LSMA 1Q1NA 1Q7GA 3BHIA 3HFSA 3DOOA 2E49A 3NTQA 4DPMA 5A02A 3O03A 3V8BA 4RVSA 3PQDA 1BVRA 4CMIB 2GGSA 2IYPA 4E2ZA 1Q0LA 1PJ2A 3PJGA 4MPDA 1LDYA 1NX6A 4NMHA 1O89A 3CE6A 2FMUA 4FQ8A 5LC1A 1S7CA 1WZEA 3VHRA 2FRDA 4ALMA 7ADHA 2XAAA 4PLYA 2Q2QA 1DIGA 1ZSNA 4K26A 3L4BC 2GNAA 5JDCA 1IB6A 1OFGA 3FPLA 2DVMA 4XR9A 4A0SA 2YHIB 3GUCA 1O8CA 4J1SA 1O95A 3AY7A 4JP2A 4ALIA 4RJTA 2QW8A 5C7IO 1R15A 2NU7A 4GLOA 4WLNA 4GSLA 1AGNA 3CXRA 4PZEA 4UUMA 3D4NA 3ZI0A 4Y6RA 1GV0A 4BQPA 1U2GA 4R16A 3C7DB 3TL3A 1HTBA 4I9HA 3GNSA 4BNMA 3GDGA 4LW8A 1VSVA 5KJ6A 5JSFA 3MJTA 2J6IA 1ADBA 1E6UA 1E3SA 2C20A 1HWYA 3ON5A 1F8FA 1PR3A 2CVQA 2DKNA 1E7RA 3GLQA 4R54A 1CIVA 5ER9A 1M75A 1AHHA 1Y5RA 2BFAA 3AOEC 1ARZA 3ETEA 2J3HA 3KBOA 4I8XA 5AVOA 3S55A 1R0SA 4G2NA 3JYNA 4QQRA 4KDEA 1P9LA 1DFGA 1QYWA 3JYLA 4DMMA 1BVUA 1W73A 3CPSA 3T7CA 5ITWA 3ZNNA 1BRMA 5AXBA 3OIDA 3GGPA 3EZYA 3RVDA 1LLDA 5JMPA 2R00A 4U6SA 4XGIA 4NFHA 1W4ZA 5F5NA 4M8SA 2GZ3A 3L9WA 4R01A 3VAZA 1ZKMA 1I8TA 3D1LA 5DOZA 1Z75A 3ZH2A 2HK9A 2CSUA 2LDBA 3MJ4A 3C1AA 4AJPA 3I4CA 2VCYA 4BO8A 4F6LA 2I3AA 4IS3A 4FFOA 4OM8A 4FN4A 3DWFA 2W2LA 1YO6A 1N5DA 5LDHA 3JQGA 2YV1A 4AJIA 3RBXA 1QV6A 1HE2A 1RYEA 1K5HA 2H5LA 2V6MA 4Q3AA 5CG2A 2G5CA 3GUYA 1YL6A 4PN3A 4CLRA 2DTXA 3IC5A 4GX0A 5L3ZA 5HS6A 4ESOA 3K30A 5IXSA 2BFOA 1NM5A 4PVDA 1A4UA 2EWMA 3QWIA 3VPXA 1V0JA 5T57A 4MKZA 4DC1A 3LF1A 5DN9A 1N9GA 3QRWA 3QVTA 1E3WA 1QMGA 1IYZA 6ADHA 2X8LA 2YFQA 2O2YA 1W0CA 3OJ0A 4PG7A 5EIOA 2PGJA 4J4TA 5U9CA 5DCYA 4XGKA 2X5KO 2IZ1A 1EE9A 3H9JA 3MJSA 4RVGA 3H5AA 1KETA 3PZBA 1RM4A 4PLFA 1H6DA 3JTMA 2B4RO 5L9AA 4Q39A 1C1DA 2AQHA 5JCJA 2TMGA 3ICCA 4IIVA 2GO1A 3FRJA 5T8KA 3IKTA 4DGSA 1DOHA 4YXFA 1ZJZA 4XGNA 2JD2A 4UVIA 4J4BA 4J16A 1Y8QB 1Q7BA 1I2CA 3TZCA 3AI1A 2HSDA 4BGUA 5A5FA 4YCAA 3WTBA 1NWCA 2HCTA 4F3YA 1DLJA 2A94A 3DR3A 1YS4A 3H9UA 4IM7A 1Z7BA 1SOVA 4AJ4A 1DAPA 5K6AA 3O38A 5GZ6A 4R51A 1KVQA 2DFVA 1HLPA 4D46A 1IOLA 1E3IA 3IIEA 1RYDA 4O0LA 4DQXA 4CV0A 4H7PA 5F5LA 4WLVA 3UXYA 3L6DA 3RD5A 5EL0A 2Y1DA 3KSUA 3DZHA 1OMOA 5JY6A 1BXZA 2D5AA 1JLLA 4YACA 5F1OA 5G0WA 5A4DA 4M87A 1VRWA 1UZLA 4DIBA 1VJ1A 2X5JO 4JQCA 4BO7A 1IL0A 4FJ0A 4R3NA 5THQA 4MVJH 5MDHA 3GEDA 5IJZA 3GG9A 5CDSA 3IAHA 4W9NC 2HMVA 1OC2A 4BGVA 5JPIA 3ZV4A 1YB4A 1ZSYA 2NU9A 5JYDA 3ANLA 3LT1A 2RHRA 4HWKA 1ZK4A 2DM6A 3RU9A 4XB2A 1Y9EA 3ROQA 4QO7A 3Q0EA 5HTOA 1NHGA 1T24A 4EEZA 4JGBA 5ICSA 1YKFA 5CEFA 3TPCA 1UDCA 3F9IA 3RBVA 2G17A 4ID9A 3CZRA 1JVBA 2NQTA 1J6UA 1U5AA 3LK7A 3LT0A 1FDTA 2C07A 2O3SA 2QRJA 4IQ0A 2NACA 4ZA2A 4OKNA 2X58A 1WW8A 4YRBA 1ISHA 2O3TA 2P2SA 1GV1A 3HHPA 2B36A 3E5MA 3H6KA 4PLVA 5A04A 2Y0EA 4J6FA 3SJ7A 1VPDA 2WD7A 2YZ7A 4IDDA 4OXNA 4Y6SA 1C1DB 4KDFA 5A1TA 4DC0A 1QYCA 4DPKA 2EKLA 4QSMA 2J3JA 2C54A 3VZPA 4CQMD 1MFPA 1JKFA 2CDBA 3AUUA 1HLDA 3EZLA 3KVOA 3AFNA 2X9GA 4BMVA 1K3TA 1X0XA 3VKVA 3CMMA 1FF9A 3F4BA 1ISJA 1DO8A 1B26A 1SCUA 4CM9D 3HE3A 1E77A 2ZK7A 2O50A 4LN1A 2AW5A 3GNQA 3DC2A 5KKCA 4ND2A 4ZQBA 1NQ5A 3FBTA 4YEDA 1JVSA 3VPSA 4CMGA 1X14A 3UW3A 3A4VA 4FFRA 3LT4A 1EZ4A 1I36A 3PJEA 4N7RA 1XQ6A 3UICA 4Z0PA 1ENPA 1ENOA 1H9BA 4ILKA 3ZWVA 3PZRA 4QT0A 3U9LA 5A9SB 2BELA 1GL3A 4MP6A 4Q3EA 4E3ZA 1G1AA 5T6BA 3SVTA 3GAZA 4EGFA 5KJEA 2X86A 1XGKA 3WGHA 4N54A 4TVOA 3UKOA 5KIAA 2QHXA 1P74A 3WB9A 2E82A 2GN8A 3LU1A 4IMPA 4OKIA 3TWOA 4OH1A 3HJAA 4XRGA 3PRJA 2O3RA 4KUEA 5FI3A 4CM8A 3GQVA 2PD3A 3RKRA 4NBWA 3U09A 1GADO 5AXCA 2EF1A 3E8XA 3I83A 4MKXA 5JLAA 1EUCA 4GVLA 1XU7A 1LSOA 4CMIA 2D8AA 3WQRA 4QFDA 1HDRA 5HS4A 2BH9A 1LSUA 3KHUA 4ND5A 5FI5A 3WIEA 5IZCA 4F45A 3I9OA 4J91A 1HZZA 2EP5A 2UUOA 4O59O 2BD0A 5G4KA 4YTEA 3VZQA 4YAJA 3JQ6A 4XEHA 1BSVA 1C3VA 1UAGA 1WDLA 5JMWA 3UOGA 1R66A 4PLZA 3BMCA 2G82A 3NYWA 3AW9A 1UR5A 1A7AA 3ZHBA 4CMBA 4I1IA 4FJ1A 5DZSA 2JCXA 3ADOA 2OOSA 3ZWYA 3FD8A 1UH5A 5T5QA 3JSAA 4OIMA 4K28A 4PLWA 4WEQA 1YWGO 1LRKA 1U3TA 3Q2IA 1PJ4A 3DDNA 3VDQA 1YL7A 4FR5A 4JBHA 3WMXA 5BNTA 4RZHA 1Q7CA 5I9NA 4RQTA 5KVQA 3BTUA 3DZBA 1KIFA 3L77A 2OUIA 2Q1UA 3S8MA 4LCEA 3H4VA 4Y98A 5L51A 3VZSA 1P33A 4KZPA 3DBHB 4CM9A 4FCCA 4XQCA 1M76A 1D1TA 2BLLA 2VYVA 1RM5A 1YBVA 5HM8A 2X9NA 4NR0A 4FFNA 5CDUA 3T4XA 3RC9A 2OMEA 1EFLA 5DOVA 4R1UA 1BWSA 3DEYX 5LCXA 3L4BA 1IPFA 4NPCA 1G0NA 5TNXA 2AE1A 2J8ZA 4II3A 5KOIA 1HE5A 1QSGA 3RUFA 1YQDA 4B8ZA 3WBFA 4RF2A 4AJJA 3ADPA 4FFMA 4KTTE 4YR9A 2YY7A 4H3VA 4S1VA 4XYMA 1N9GB 2HMUA 1FDUA 4RPHA 1YL5A 3JD1A 2PTGA 4AJLA 4C7KA 3DHNA 2Q3EA 1IZ9A 1WMBA 2GASA 3KZVA 3TZ6A 4ZRNA 1KBZA 5A9SA 2X23A 3IUPA 4FD3A 4ZJUA 5F1PA 1QR6A 1NP3A 1XCBA 3AJRA 2Q99A 2ZCUA 1ZZEA 1B15A 4BMSA 4QTZA 2B83A 2W90A 3ONDA 2VT2A 3VOSA 1M66A 3B1JA 4JN6B 1E3JA 4PRLA 5ILGA 4Q3BA 4KWIA 4XKJA 3OH8A 4E33A 1PL6A 3DFZA 5DP1A 3V1UA 5TQVA 4GI2A 4MDHA 4R4JA 4DUPA 1GPJA 4MVJD 1P0FA 1KC3A 1NPDA 2AG5A 3COSA 1NVMB 2H9IA 2R00C 1PJTA 1X7GA 3BHJA 3JQBC 1NR7A 4GVXA 4Z3KA 2EHDA 2E37A 2NQ8A 2C82A 4J0FA 3P19A 5B1YA 4CM1A 4RORA 1PWXA 4PLPA 3W4IA 3KOUA 1CYDA 3BTOA 4MP8A 2YUTA 3PJFA 2POQX 4RVDA 1I24A 3OECA 2FY8A 4DA9A 3L6EA 2HRBA 2Q46A 1Q0HA 4OSOA 4EJ0A 5L4LA 3DHYA 4BKPA 5KJ1A 3BTSA 1ZIDA 4TWRA 1T1SA 5FFFA 5CDGA 3BMCB 4MIOA 3HFGA 2VNSA 2ZQZA 1NQOA 3WYBA 3NJ8A 1DPGA 2VHYA 1WP4A 3IP1A 5KJFA 2H1SA 1G6KA 1PGNA 4BNVA 5JFOA 1QXSA 4UUNA 3LT2A 4I9NA 3WGOA 4BQRA 3RCBA 5BT9A 3QE3A 4Z6KA 2WD8A 4AG3A 3U4DA 1GPDG 3R1IA 2CVZA 3GN2A 4NJMB 2ZTVA 3Q2KA 2ZJ1A 2PWZA 4E5YA 3JYPA 3INTA 4B8WA 3ZWAA 2EG9A 3K96A 3G49A 3PTZA 3SC4A 4ALJA 3LC1O 1T4DA 2ZIZA 5AXAA 4OO3A 4YPOA 2R6JA 3HN7A 5JDIA 1K6IA 2W2LD 3JCZA 4IUYA 2FZWA 5C7OO 5L7YA 1A72A 3HADA 3W1VA 4DWVA 2FPGA 4BIIA 1OC4A 1Z74A 2HLPA 1QLHA 3DXFA 2JCVA 4ITUA 4BNFA 2PKRA 4ZQHA 4CL8A 4UEOA 2HRZA 5G0VA 3WR5A 1HZJA 2B4TO 1SAYA 2PA3A 2DU8A 2PGLA 2JAPA 4HKTA 1NR1A 3LF2A 1OBFO 1SNYA 4CR6A 1TA4A 3HZZA 3ZU2A 1GZ4A 4GMGA 5HBRA 1EEHA 3K92A 1SZJG 3W6ZA 1MFZA 3R3JA 4XQGA 4DYDA 5AQ1A 4CMHA 1XR3A 2GLXA 4YQYA 1E1NA 3DZJA 1SEVA 4F6CA 4AJNA 5FEUA 1PQPA 4IZHA 4RF5A 3H3JA 4WECA 1AN9A 3WLFA 4CMEC 4B7XA 2W2KA 4DMLA 3Q1LA 2PD4A 3ZZNA 1GYRA 4L4XA 3LYLA 1ONNA 1DIRA 4BUCA 4BNXA 3TNLA 4N5LA 4R5MA 4EYEA 4P4NA 4DIFA 1EDZA 2JFGA 3C24A 3GF4A 4E31A 2FSSA 3CMCO 3EDMA 4D43A 3KYDA 2FOIA 3FHLA 5BQFA 1RKXA 3QWBA 1DJQA 2O7QA 3HSKA 3OBBA 1MUUA 1VSUA 4J1NA 5JCXA 4MO2A 2DT5A 3FNEA 4M54A 1FDWA 1ID1A 1BXGB 2GDZA 5TIIA 1W6UA 2ZTMA 3ZU3A 3KRTA 2I6TA 3HB5X 4YB8A 3WQSB 3WIDA 2RIRA 1EBFA 3O26A 4BNHA 2QRLA 1VKOA 3RC7A 3ZCXA 2VWPA 4BNNA 3RUDA 4MVJG 4AL4A 4CLOB 2O3QA 3INGA 1T2AA 4R1NA 1OI7A 4PLCA 3K2BA 4QEDA 3TZQA 3UH1A 2HUNA 4UUOA 3A28A 2GCGA 3JQGB 1U28A 3NGLA 3AM3A 4Z9XA 4B4VA 2HJRA 1T2EA 3VC7A 4W4TA 5KVSA 4BS9A 3V5NA 4GKVA 3FI9A 1UXKA 1YBAA 1LTHR 3F3SA 3GFGA 3L07A 4WGGA 4WJZA 3U4CA 2Q4BA 2XPCA 2PZJA 3Q9NA 2J3KA 4YBZA 5H83A 1N7GA 4A27A 4JXKA 5T8KC 1B0AA 1LEHA 1TB4A 3DZKA 3FWZA 1B2LA 2NVBA 4D42A 4UULA 2Z95A 1Z73A 1Y5MA 4IJKA 1BDBA 4L4RA 2Y0CA 5ES3A 2P5YA 1O9BA 2I66A 3HB4X 3SLKA 3V2GA 4BKOA 2EW8A 4CM4B 4EI2A 4EUEA 1N1EA 3H9GA 1X7DA 5JC1A 1PQWA 2PK3A 4CMKA 4B79A 5IDYA 1LC0A 5B4TA 5BSHA 1EE2A 5GZ1A 4NHEA 1MA0A 2CMDA 5HRUA 2DQ4A 4EEXA 5EINA 4B4OA 2ZB3A 2HMTA 1KVUA 3L6OO 3PQEA 3WQQA 3BA1A 3QJ5A 1V6AA 2HK7A 1HDCA 5KTKA 4CM3A 1DHRA 3ONEA 4FFPA 5I8ZA 4K6FA 4A5OA 3F1KA 4AJOA 1H5QA 2P9EA 3E9NA 3RJ5A 1R4MB 3C8MA 4MP3A 1XU9A 3AU8A 2NTVA 1X7HA 4NFSA 3ONFA 2O4CA 4WCFA 1L7EA 3TL2A 1ONOA 3IJRA 3U0BA 2DLDA 1DHTA 2XXBA 3KLMX 2VWQA 3R0IA 4TROA 5CDTA 1QLJA 5G0SA 2VUUA 4CV1A 3C3XA 3PEFA 3NAQA 1MB4A 2Y99A 3ETDA 3ZDFA 2JFFA 3I9NA 1UXIA 1E7YA 1ADCA 2IEDA 2W2KB 4U0JA 3RFTA 2P68A 3ZNOA 2I5PO 4M49A 4UVEA 4WLEA 5HWSA 2QZ9A 2YV2A 3DBLA 1YQGA 4GX1A 2GYYA 5JDIC 2AG8A 1XA0A 2G0TA 3DAGA 1WMAA 2WEKA 3WNQA 4ZHSA 1AHIA 4BKQA 2OHXA 1AXEA 2Y67A 3ZNPA 3TN7A 1ISGA 4J9UE 3RU7A 9LDBA 4RCVA 3DMTC 2EW2A 4CQLA 1NPTO 3P5SA 3P7MA 3BMOB 1R4MA 1I33A 3N7UA 4YAIA 4Q3CA 2WM3A 4FOSA 4FDAA 1JA9A 4O1MA 4K6CA 1HRDA 1YDEA 3ROKA 1R4NB 3NT2A 4OXKA 2WYWA 2Q50A 4XYGA 2RH8A 3IDSA 3MOIA 3OIFA 2ZTLA 4D7AA 2W8ZA 4XWYA 3OICA 4XYEA 2DTDA 1H6BA 4BB6A 1VJ0A 3OP4A 1SOWA 5IDWA 3ZW8A 1XSEA 4MINA 2YHIA 4CM4A 4JLWA 1HDGO 2OGUA 4CR8A 4D0SA 1PTJA 3S1LA 4JJFA 3FF4A 5JCJD 4A10A 4QXMA 3UGKA 3GMSA 5T67A 1MLDA 3PXXA 3NRCA 1MC4A 2YQ5A 1PGQA 1HYEA 3DBRA 3G1TA 2VRBA 3GT0A 4TKLA 1YGYA 4YJHA 2RAFA 1X1TA 4AJEA 3AM5A 2YDYA 3CSDA 3N74A 4ZRMA 1XHLA 4A26A 3PGXA 4KUGA 1EUDA 2NVUA 3GK3A 4ZD6A 4BKUA 3NX4A 2HKIA 3HUDA 4NI5A 2Y05A 1LQTA 4BVAA 4WCDA 3CTMA 2JL1A 1HKUA 3RAJA 4BNJA 3JYQA 1R12A 3MTGA 1DIBA 4NU6A 2OO5A 5A06A 2J5KA 1QYXA 5JAQA 3D4PA 4EDFA 1D8AA 1ZJYA 1PZFA 2C7VA 2FR8A 2VHWA 1HT0A 4B4UA 3E9QA 4J9VA 1VM6A 1LA2A 3MWDB 1PSDA 3WGGA 4CLXA 2O48X 4ROSA 2H63A 4IGFA 2IXAA 4E5PA 4Z3DA 1H2HA 3GGGA 2EP7A 3OETA 5AOVA 3ZWPA 3QWAA 1JWBB 1RPNA 5CPFA 4TRMA 2O3UA 3I23A 3G0OA 4D41A 4RPLA 3NT4A 1JAYA 4U5QA 1UP4A 2OP0A 4R41A 2D3TA 3C85A 2EERA 3K9QO 2D0IA 4YT8A 4HNGA 1SO8A 4PZDA 5CHEA 5B37A 1J0XO 4HNHA 4EW6A 3T7EA 5AYVA 3RFXA 3PYLA 3ZHZA 1YDWA 2JHGA 1ZH8A 3QIVA 3IKVA 1IHYA 1ZFNA 1HDZA 2YYYA 3FNFA 1NFRA 3IP3A 4EBFA 2EXXA 4U0KA 1LDNA 3ITKA 4JJGA 4NJMA 3ZW9A 4B4WA 4C7JA 3PDJA 4WPGA 3GG2A 1V3UA 1V8BA 3LC7O 5DF1A 1EVIA 1N1GA 4IDAA 5DDIP 4GWGA 4WUVA 4XZ3A 3RWBA 1GY8A 2ZQYA 5L95A 2B5VA 2D5CA 1C0KA 1D4FA 1ORRA 1MGOA 1ISFA 4MVJM 4D79A 3LQFA 2DPGA 4I08A 3EYWA 4H15A 5EQDA 1F17A 1DLIA 3CKYA 4FPXA 1SB9A 2ZYDA 4YQZA 2E6UX 3WG9A 1ADFA 3ENNA 4CQMA 1E7QA 2PZLA 3ZWWA 1LU9A 4ONEA 1CETA 4WASA 3PPIA 5A05A 1MXHA 1KY5A 4J49A 3JQ8A 4BNZA 3JQAB 3UHAA 1VL0A 3GEGA 4RL6A 3KEOA 3GVIA 4YJGA 1HDOA 4Z9FA 1AXGA 1P77A 4HFNA 3VH2A 1ADGA 3GEMA 4IDCA 3TRIA 4B7UA 1WVGA 4CM6A 4YDRA 1CRWG 1PX0A 4A2CA 9LDTA 3DBHA 3JYOA 5KNLA 2QRKA 4WLUA 3KYCA 1AE1A 3FR7A 3MCVA 2WYUA 3AY6A 3VTZA 4FIZA 3DAFA 3OJLA 1GQ2A 1TLTA 1U2DA 2NU8A 2JKVA 2CF5A 3EC7A 3W6UA 1UXJA 1JN0A 1JTVA 4H16A 3WFJA 4YAGA 4ZN6A 2ZB7A 4NBTA 3WSVA 1PR9A 3QVXA 1CF2O 3TFOA 4Q3NA 3D64A 2PZKA 2QG4A 3PWSA 5I7VA 1MC5A 2HDHA 4IZIA 1UXHA 1FK8A 1T25A 1SB8A 1Y8RB 4EUFA 3I9MA 4KQWA 4OL9A 1DC4A 1H93A 1RWBA 4FSHA 1HF3A 5IZ4A 3ASVA 1J5PA 3UVEA 3QW2A 5I9LA 3UF0A 3MZ0A 4L8VA 3AFMA 5TT0A 4EITA 2AQKA 2D1YA 2ILTA 4F46A 1KY4A 3TZHA 2ZKLA 3O8QB 2TMDA 4O5OA 2NV6A 4HUJA 2BFPA 4M1QA 1Y6JA 1UJMA 2EJVA 2QQ5A 3I9JA 2JCYA 2WYVA 4CMCA 1E1LA 3GMDA 2VQ3A 3K5PA 5JAMA 4NNJA 4R1SA 2D59A 1HYHA 2FWMX 4K9DA 4E2WA 3PIDA 2NTJA 3EGOA 1D3AA 2GRAA 4RZIA 2A4KA 4XB1A 1I32A 1HSZA 1HE3A 1QKIA 2A9FA 4DREA 4I5DA 4J7XA 2BGKA 3G79A 3TF5A 1Y8RA 4HV4A 1LI4A 4BKRA 1CQJA 3GDFA 3ROMA 1A9YA 1JWAB 2GD1O 2GR9A 3EVNA 2Q2WA 3PFFA 2I99A 3EW7A 1XEAA 4JCOA 1H6CA 4N5NA 1ISIA 4WOJA 1I2ZA 1DAOA 4BNTA 4NK5A 4LISA 4W82A 4OXYA 2PR2A 4R9SA 2RH4A 2C2YA 5G0UA 1TT7A 1E6EA 3AM4A 3K73O 3WTCA 1TXGA 3OSUA 3PK0A 1ULUA 5IN4A 4AFNA 4YT4A 4BV8A 4BNKA 3DFUA 1PWZA 1WPQA 2HAEA 1FDSA 4FOOA 3IL2A 1GD1O 3IQDB 2VRCD 1E7SA 1DEHA 5BNFA 4BL5A 2OL4A 1HDYA 3PYMA 1LRLA 3EUWA 2VN8A 3EY4A 2Q45A 2NNLD 2F00A 3VKUA 3MJCA 3ULKA 1DRWA 1LSJA 2CDCA 2GN4A 3DBLB 4YYZA 1ISMA 1KEWA 2CY0A 5G4LA 1HXHA 4GAEA 3UFXA 2IODA 4OOFA 4YA6A 1U3VA 2ZCVA 3QVOA 1XG5A 4NDNE 5JY1A 1VL6A 2VHXA 1LJ8A 3ZU5A 4MJLA 5DNAA 3FWNA 1NAHA 3B6ZA 2Z5LA 1Y9AA 3H9EO 1P1FA 1SBYA 1KS9A 2BMAA 2F1KA 4NIMA 3I9KA 3QLJA 4MIEA 4WEOA 3W8DA 3ITDA 2VUTA 2VWHA 2C0CA 4JBGA 1V3VA 3DMTA 2ZJ0A 4XJTA 4DQUA 5EJ2A 4NBVA 1VC2A 4Z9YA 3KSDO 4BNUA 3WXBA 5I8WA 1DRVA 1C0PA 2EV9A 3NDIA 2VTDA 4K1LA 3I4FA 1C14A 1I3MA 2C5EA 4I5EA 4LVUA 5JE8A 1A7KA 1NPYA 2VZ8A 2A35A 3NGXA 3KSZO 2OXIA 3ANNA 1LBEA 2V6GA 2GN9A 2FHSA 2DFDA 4R5HA 1UUFA 2IRWA 4HBGA 2NUAA 1UAYA 3NTOA 1QORA 4IY1A 3DB2A 4OMUA 1ZBQA 3RROA 1P0CA 2VOEA 4HP8A 1KVTA 2B5WA 1VLLA 1P31A 4LRSB 4IPTA 1UP7A 4MVJI 2QX7A 3WYEA 1E92A 1T1RA 2FN7A 4BO0A 1A71A 1OOEA 1R37A 3HDQA 2IXBA 1L7DA 1P45A 2O7SA 2DC1A 3RFVA 2OP1A 3A1NA 4IBOA 3E18A 1FMCA 3PHJA 2E48A 4TRRA 1DC3A 4BGIA 3H2SA 1LDGA 1NBOA 1B7GO 1WDMA 1HE4A 3GVHA 3H2ZA 2UDPA 2Z1NA 3UCFA 3DBRB 3SEFA 1XIVA 3W8EA 4E13A 4RPJA 4DBVO 3GZNA 5FWNA 1E0DA 3ORFA 4RPGA 4WK6A 1TT5B 5EQFA 5TLSA 3CUKA 3OHSX 2X0IA 3TOXA 5IF3A 1C1XB 4CL3A 3S2EA 3LDHA 3Q11A 4XIJA 3OJEA 2PV7A 3JD3A 4HFJA 5DT9A 1J49A 5L53A 1Z6ZA 1PJSA 2HMSA 3KXDA 2O4UX 3Q9UA 5DBIA 4XQEA 1E7MA 1M2WA 3ZNQA 4TMFA 1H0KA 4IQ8A 3TFQA 2A92A 1U8XX 2RHCA 2HJSA 3EHEA 1LLQA 3GPDG 2WMDA 5I9MA 5A5EA 4WOKA 3RQSA 3SBOA 3A9WA 2D4AA 4GKBA 3AK4A 3VH4A 3GVXA 2IE0A 2HMWA 1LQUA 3Q3CA 3RUAA 3ZV5A 1F0YA 4XIYA
chains in the Genus database with same CATH superfamily
3WFIA 1LRJA 4LFAB 2QUHA 3FR8A 4GKKB 3JY6A 5H9WA 1L6RA 3LY7A 1G4AE 3HB1A 1GITA 4XEUA 3OLCX 1YE3A 3S68A 4A73A 3TSCA 3ISJA 3LZ6A 3V7WA 1I30A 4M1KA 5IUNC 4BX2A 4H7KA 4M7OA 3RUEA 1QVAA 1U81A 2AN9A 5EESA 5BWOA 2O2ZA 3ZE2B 1FFXA 1RS0A 3IKLA 3MAAC 4M76B 2Y4NA 3V2IA 5K1ZA 3K1TA 1ZNZA 2UYQA 3TW0A 4RABA 1M6YA 4RHFA 2FPOA 3SEZA 2VNJA 1I3LA 1SEPA 5KYUA 2FF5A 5SZKB 2PS1A 5L3SB 4UASA 3IXLA 1E1QA 4OA8A 3DT6A 1U1FA 3GVCA 1IM8A 3B3GA 3G5AA 3NORA 3ZD8A 4CKWA 2C2XA 3BJIC 3GRCA 3I2GA 1QG6A 1FUYB 1YR8A 2WVAA 3CEJA 5E4TA 2OVFA 3WKBA 5CBKA 2JZCA 3D8BA 1Z47A 4JSTA 3W3AD 3LHIA 1ZK0A 2HNAA 4YMHA 1GDHA 1K88A 1DC5A 1NBEA 4YUVA 4MYHA 3TLGB 1TVKA 4E2FA 4TS3A 2OSVA 3IUYA 3KEQA 4DWWA 3LRXA 4NRDA 4WGFA 5LQKA 3UJ8A 5FDFA 5HE8A 1GAWA 1UQRA 3IBGA 4MW7A 4P5EA 1R5JA 3WZLA 2JAHA 3OIVA 4YV2A 5B6IA 3O8BA 4JK3A 2ZJBA 1UT8A 2B3TA 1GFWA 3BHMA 3I3SR 3N0XA 5IS2A 4QBIA 2UXBB 4QEZA 1GYPA 2MTBA 3OZXA 2GMWA 1Y5LA 2ET6A 4HZUB 2JEYA 3C87A 1HI9A 1J4AA 4KIJA 4CEJB 4GWLA 2G08A 4MJ3A 5B3AA 1GTG1 1WW2A 3A9RA 3PRHA 1FDRA 1PFGA 2ZYHA 4ND1A 4YMWA 1MO5A 4OOEA 4CGYA 3OT5A 2ESRA 2H00A 1WG8A 1QIJA 5LOVA 4KPYA 2FP4A 4CIDA 1PYOA 5JS8A 1WXDA 4TZTA 4U2EA 5K2OA 4BC1A 4V38A 3ZHYA 2V7XA 1LPSA 5DGXA 4CJXA 2WJHA 3NHUA 3UQZA 1ZQ1A 4RD0A 2IOQA 2PKWA 7MHTA 3VYVA 2BFFB 3TDKA 1U4OA 5F12A 1K5DA 4J0HA 3GJ0A 2JVKA 4NBUA 4ZIRA 1C2YA 4Y2HA 2XRFA 1R4NA 4O4LB 4ZO9A 1GQQA 5AKGA 5LJLA 1X38A 3EH2A 1FLNA 2W6OA 3Q8XB 3RSZA 4D45A 4OUDB 3ZQUA 2QRVB 2V4MA 3A3NA 3MILA 1R1DA 2BSXA 4TRNA 4MITA 1IBKB 2JDIA 3DTYA 1S6YA 3IKJA 4MI1A 4KREA 2A6PA 2ZYWX 3LLUA 1FYEA 4XWGA 1J70A 2HSWA 4XQ9A 3PUJA 3MMXA 3B78A 5TF4A 4YUXA 2H4YA 1XRLA 4JI1B 2OQVA 4DJFC 4LVOA 4W7HA 3IIKA 1C29B 1SCKA 2YJ5A 4BN5A 2FPSA 3JQCA 1U8TA 3JX9A 4M7WA 2P4QA 2PIDA 4G4GA 1E9EA 5DRTA 5EE0A 5CFMA 2R2GA 1TQDA 4HN9A 3HNPA 4W7IA 3S7ZA 3OZFA 1CQJB 1XZ8A 2FSHA 2YASA 2FP4B 2Q1SA 1E9AA 4I9FA 1P1IA 4Y67A 4ZVRA 3G2LA 5FHQA 4ZYYA 1PTJC 5TJ9A 4AVYA 2RFLA 3EFBA 1D0VA 4U1RA 2PE5A 4EMSA 1U2QA 4QYIB 4OGLA 4IR7A 2WIBA 1NXSA 4QPJC 4E4YA 5FIUA 4FFLA 1JG2A 3HP7A 1Q0QA 1VJGA 2BBSA 2XXAB 4CLHA 3N70A 3O7MA 4EELA 1WBBA 1YZQA 3RJZA 1X1AA 5KREA 4JJIA 4BXOB 1VL8A 2WOJA 4RH0A 1NVWQ 3R6GA 4H6VA 4XLZA 3CA8A 4DGQA 2XUFA 1LV7A 5ALVA 4UQLA 1L4YA 2C98A 1JS1X 1ECFA 3SZMA 5CB6A 2X15A 3UB3A 3NV9A 5AM0A 3IEIA 4HVTA 1B6GA 1IZ0A 3AEXA 2E0IA 2JVJA 4MYUA 3A6FA 3V55A 4CG0A 3UQYS 3TPZA 4RK7A 1QRSA 1ESZA 5B1SA 2AR9A 5P21A 3EAFA 1XYGA 1R16A 5E6UB 3SX2A 4LYYA 2Q5QA 4LDAA 1VG1A 4C0HA 4U7WA 1N2HA 1IJEA 2QJRA 3WIVA 4IUCS 4U8HA 1I7NA 5AM5A 1GSAA 1QH0A 3PFWO 4M1ZA 1PR4A 5JO9A 1XX6A 4ZYUA 3KYDB 1U1CA 2I80A 3ASUA 3DTNA 4QU8A 3E81A 2GI4A 4M83A 1L7XA 2GXUA 2J0VA 4OATA 3SSNA 2P35A 3DTTA 1VIYA 4YT2A 4X6XA 1LDEA 4P7KA 1M5TA 2CXRA 4L9WA 4J3FA 4J1TC 5DYNA 4UUPA 3VV2A 1KVRA 3PITA 2WWFA 2YJZA 4RHYA 3AGPA 2JGMA 1UFVA 4YJ2B 4UPVA 3T35A 3MBIA 4ND4A 2JGEA 4PAWA 1RPAA 2IHKA 2P65A 3O4RA 2VZ0A 1K0UA 3PXDA 1BS1A 2RHHA 2JCBA 3P9XA 4PG6A 2J87A 4DG5A 4YV7A 721PA 2AFHE 2VEDA 5J2UA 1L5HA 3RRYA 4X8OA 2WF5A 2R1VA 4GE0A 3WLQA 3G0DA 4KIUA 4B9EA 4PN7A 5K6AC 4KOEC 2WM8A 5AKEA 1XPJA 3DAPA 1EP9A 1JLSA 2LTAA 3MLEA 5BPHA 4U2DA 1S2MA 5COAA 1HT2E 5FB3A 5GP1A 3ROPA 4BMNA 1CJTC 3F6EX 5FA6A 2IBSA 2V1XA 4QFMA 3I6QA 3Q6IA 1ZMOA 4LF5B 1JPJA 2O8EB 1RP7A 1U0NA 4XASA 3NIGB 2R48A 4L8WB 2DCUA 4DL9A 4OHYA 3DLTA 4Z4GA 4A8PA 2Q62A 3CV3A 3A31A 4RSHA 3ZWNA 1RMTA 1Z5VA 5ERYA 2X0RA 3RYHB 1UZAA 2UZ3A 1G5HA 2FLVA 5JCPA 2H92A 4L6IA 2AMLA 3NS7A 2FN4A 3R7SA 5E8JA 4GLLA 4QHTA 3FFWA 4D9HA 1RFGE 3TM4A 3I52A 4O4IF 1U6JA 1QNLA 5LA6B 1N2BA 4RQBA 3H2JA 1IPEA 2BN4A 6REQB 4K05A 1F7UA 2PFGA 4LRUA 4L2IB 2FQXA 4O63O 4AYXA 4C03A 1Y80A 1BDHA 2VA9A 4ZYTA 2FLWA 1VB5A 3W5BA 2FFQA 3G9XA 2HA5A 4HX5A 5I7WA 2SKCA 1K6JA 3N87A 3RVNA 2EP8A 2NXWA 3IE1A 2G40A 4DR5B 3TLBA 5TS3A 1FU8A 3THYA 1BKYA 2CNLA 2O1WA 1DBSA 1E9VA 1JQ3A 2FZ4A 4OHWA 1VGVA 4EI7A 1X2BA 3FKQA 3PQ7A 5IPFA 1HTTA 1N92A 2OCIA 5JO0A 3REFA 1HYGA 3HJBA 1K4YA 3K31A 4M0EA 5JAOA 3BWXA 4HEQA 1GL6A 2SCUB 1DC8A 3D6NB 5EWMB 1X0VA 3WE7A 1GNPA 4F9TA 5B12A 1BFDA 3PC7A 4ER7A 2IF2A 4WBSA 4E46A 4ZOQI 4OEHA 3M3HA 2CLLB 2C00A 3HI4A 1KAEA 2DRIA 3RVMA 1RADA 4BN4A 5KU7A 2J5XA 1T9ZA 2P9CA 4TWBA 1SUIA 2WKRA 3WGMA 3Q87B 2AMJA 1XZJA 5P8WA 2Z5GA 1C3XA 4RK4A 5IDQA 1UMKA 5F52A 1Z07A 4Y9SA 3KKOA 3DMNA 2AE2A 1TT5A 2WE8A 3AY3A 4JX8A 1HE1C 3DDSA 1HETA 4DUGD 4BFSA 4NK4A 1M2HA 1XRJA 5DHFA 5ENZA 2VSNA 4ALLA 2OFOA 3F7OA 4QARA 2BI8A 3DBIA 2ZIWB 5BOVA 1B6TA 3L0CA 4LX8A 4DLTA 4RQUA 1I1OA 3TAHA 4D9JA 4Y7DA 3U16A 5TQ0A 1X1CA 1E4VA 1JYFA 3EEIA 4H18A 4J43A 1CZHA 3GRZA 3TTUA 5HJ5A 4ZJPA 3AEQB 3KQQA 3KQVA 4HXEB 4KTVE 4LGVA 4IOLA 1A95A 5FOSA 1T5IA 2VO1A 2I2CA 2WU0A 3A4YA 4UVHA 2OCGA 5EJMA 1X1EA 2AOWA 3MXOA 3AQIA 4EG6A 4Z4FA 4OHVA 3PEWA 2CF6A 4FS3A 1IY8A 1I6MA 4M0UA 2PGNA 4QNRA 3GLFE 4HFMA 1J00A 2C29D 2X40A 4C6SA 3P2OA 1O3YA 1N9KA 4Z7JA 4KWHA 1T35A 4JP1A 1T2UA 4PS1A 3BM5A 3WICA 1NBAA 2IZ0A 3Q8WA 1JHPA 4FN5A 1M3SA 3T7JA 5AXDA 4BP8A 4DQDA 3H7AA 3NRBA 1DTWB 3AKZA 3DZIA 2Y0PA 2IPAB 2X8JB 2IDKA 1WZCA 3D2LA 2BIFA 2YC2C 3PT5A 5IEBA 2I6UA 3HBNA 1FFXB 1KOFA 2YUIA 2H2HA 1BEZA 3I32A 2QAIA 4INZA 1Z0SA 2H6EA 2ZR7A 4TT8A 2AQ8A 2FPIB 3L18A 4UDNA 1S9DA 3U1BA 1K6MA 3D3JA 1Z9BA 4KPUB 4B46A 5EUMA 5BYBA 3JQ9C 2RI0A 2VDMB 4KXYA 1SELA 5LZ7A 1E6WA 4I5IA 4B45A 1L1FA 4LC9A 4FU0A 3P2EA 3IIIA 2WMYA 1OW3B 3IOYA 3IOEA 2G3YA 3N8DA 4TVKA 1CW2B 2CXXA 1IY2A 1Y1RA 4KX5A 2ZAYA 3LLMA 3V4VB 4NBRA 5A4FS 2VSYA 7REQB 4RZ2A 2BC9A 1XMSA 3JD0A 4QLAA 1GNLA 1LLUA 3BH6A 1W52X 3GRYA 1FFEA 3ZZUA 3FZNA 3PYXA 3DBVO 3ELWA 2FWIA 3N75A 5CNJA 4YX9A 1N6KA 5THXA 3ILSA 2IYSA 1NMYA 4MQ5A 2G9UA 1FDOA 1QP8A 5DM60 3KZNA 4QDKA 4CNBA 4OGWA 4EG7A 4GZMA 4B34A 1RYNA 3KALA 3NDRA 4URFA 4EZBA 2H52A 2XECA 2BZ1A 4DDMA 1XVVA 3B6EA 3H9QA 4KE8A 3FKSA 1QGDA 5CK4A 1YBMA 4JQYA 5DNEA 4KLRA 5CJJA 3LDFA 3QBJA 5EMHA 4HD8A 2ZQ5A 4QDOA 5G53C 1W2GA 1EM8A 1R5BA 1I7PA 1OKKA 2X22A 3K9GA 4PF1A 1XQYA 2B7CA 4O6VA 1HNNA 1LVUA 3AVPA 3FNIA 4X64B 1QQAA 4YRAA 3L7CA 1NBWB 5E3HA 4EL5A 3QPWA 3C8UA 4PNPA 1CZOA 1KQPA 4GYJA 3GOHA 5IBCA 1I0IA 1H8HD 5K3CA 1QO9A 1M67A 4BQEA 1TIPA 3GP8A 4GSKA 4YMSA 3ROZA 1X3LA 3NHMA 1YOVB 2BFFA 4YUYA 2CFIA 3CZMA 4OXRA 1S89A 4BNLA 5JATA 2GSDA 4AMUA 1B43A 1IY0A 2O54A 2K87A 5JCOC 1T9BA 3BXOA 1T8RA 2WM2A 3R8XA 2NXJA 2XOKA 4DR3B 1UPAA 4JKOA 1W93A 2VDKB 3O3MB 4QJ4A 2GA9A 2ZBUA 3K1ZA 3A1TA 4D4MA 3UJNA 1B3BA 3BXXA 4WJKB 3SXPA 2I4IA 4LHSA 5FT9A 5JYBA 1RI4A 1L4KA 3HXPA 2XF8A 1ZN2A 4W5OA 5E4JA 5EZ5A 4UNIA 4IXWA 2QIOA 3T99A 1QTNA 4ZYVA 2NPIA 3RDPA 1XELA 2NP6A 4KP7A 3O4HA 3V8PA 2QZZA 1M10A 3IVRA 3O2SB 4ZVVA 3K6JA 2BKAA 1JXOA 2P2NA 2WKPA 3DO8A 4RETA 3W79A 3UHOA 4H4EA 5CEJA 2F3UA 3GGDA 2YYSA 3A6LA 3WLRA 1NUTA 3RFFA 1EUZA 2LKDA 1C50A 2WTXA 1C7QA 4DV1B 1KEEA 1U7HA 1TQHA 3CRRA 3PXEA 4JBXA 1A76A 1IULA 1NVEA 5EIAA 3HN2A 3V4FA 1ZOLA 4HQFA 4BJ6A 4I14A 1AZSC 2AN1A 2D0PB 2O20A 3D2CA 4QOSA 4QUKA 4AMYA 2FSPA 4HMQA 2H18A 3KB8A 4LJ5A 4DDVA 1PVOA 1XP8A 4Q3OA 4JT4A 4WACA 2EJWA 2LNDA 1Q84A 2YVQA 2OGWA 3JQBA 3WB2A 5DW3A 1JU4A 2II6A 2H2FA 2FETA 1XKQA 1DCTA 3OE4A 3BH0A 3GOQA 4QQKA 4E5MA 5BW8A 2HREA 1DBVO 4P82A 1TX4B 1K3FA 1R18A 3HZRA 1XXLA 3DP9A 3MQFA 1QBKC 4C4SA 3TEMA 3U4QB 1C8LA 1PEDA 2XQGA 3RASA 5BMVA 3PBKA 5FJJA 4I1YA 1XVTA 5BPFA 3H8WA 4D8XA 1GQYA 3DL0A 4FW8A 4Y6PA 3U5TA 1LBQA 1SQ0A 1KK1A 2M9MA 2Q5OA 4KQCA 2OT3B 4LXUA 5BMVF 1U0LA 2P62A 5EPOA 4EA8A 2JFNA 1DJNA 1T8PA 2CXOA 1O08A 3I3OA 1OH6A 2JGRA 3T34A 7ABPA 1BHJA 3H13A 5C53B 5K0NA 4GH5A 4MUYA 1Q2XA 1EQ2A 1G291 1CY1A 4F0JA 2QXTA 3EXHB 4JYPA 3AVWA 1YQQA 1V8FA 2QMUA 3M4YA 4MQFA 1KE2A 3BIXA 3STXA 4L75A 2DGDA 3OM8A 3PL5A 3RVKA 2ZSHA 1IUPA 3RARA 3VMMA 3OEHA 1MC8A 3OM1A 1TCBA 3KR0A 4RMGA 3ZK9A 1W49A 4FT2A 5C9ZA 1C0EA 2C58A 1GA4A 3OJOA 3P0JA 3RT9A 2YV3A 3H5NA 3OKCA 1EAMA 2WUDA 4AWBA 5A9TA 2R4QA 3B70A 3D9QX 4PG4A 1GA1A 4O4JB 3OQPA 3J80A 5IAAA 1ZGCA 5KVCA 3O1LA 3SQWA 1T5HX 3EOBI 3EXIA 3L4EA 3GA0A 1OSNA 3OZGA 3MT0A 2DFTA 4DYVA 1L7VC 4TWAA 4UFNA 4W8GA 1AQNA 1P0PA 2L42A 3HLYA 4TOIA 4JI6B 3CG4A 4P4TA 1HO3A 1ZW6A 3T54A 3C1UA 4RTPA 1NQTA 1QO0D 3PGA1 3VDNB 1JEQA 2Q6VA 5EWJB 2IFTA 2BDTA 4H1HA 2P11A 1J39A 2AI3A 2C83A 3EUEA 3ETLA 4MWSA 5FTNA 1ZHHA 4HYQA 3UPUA 3B6IA 1NFQA 3LXXA 1NXOA 1YRBA 4NYMQ 4F91B 3ZN2A 4DPLA 1MQ9A 2P75A 1ZN8A 3DE6X 3GZ4A 4H17A 1LLCA 3IR6A 1QE0A 2O2EA 4DRYA 4UU7A 1A8SA 1U1IA 1C3LA 1ZG3A 1FE8A 2W93A 1E59A 5F77A 5BXQC 4FBGA 4BLOA 5HIJA 2O7VA 3BTVA 4PQEA 4WW0A 2VP6A 4E5SA 3R7LA 3O2JA 2HHAA 1Z82A 4BLPA 1KBQA 1CB7A 5L4SA 1CRQA 4WZAA 3ZTTA 1P3Y1 4P4UA 3CZ9A 4OQFA 2XSZA 4CMJA 4MWBA 1U1GA 4RTJA 4HY3A 3K09C 2HC9A 1G8SA 1Z88A 2ILVA 3ZU4A 4CRWB 1H6AA 3WGQA 4RZQA 4BO1A 4CCYA 3R9XB 5FPYA 3VKHA 3RBZA 2OAQ1 4KFUA 2VHEA 1RJFA 2ECFA 3I09A 4F9GA 3IBCA 3TRKA 2NT3A 4JENA 2HF9A 4XA8A 3U56A 4YAFA 1NONA 1R8XA 4IG4A 1ZESA 1PR6A 2BM0A 3CKKA 1ICIA 3BCHA 4EY3A 4ARIA 2WYHA 4EKEA 1U4SA 1JJVA 2AFHB 3UO8B 4LGYA 4IDNA 2Q3HA 5DHPA 2HQ1A 2Z3WA 3DMHA 4ZEWA 4N3NA 1T6ZA 2X3UA 1P6UA 4OYYA 1ZEMA 5F3DA 4TYWA 3VO8A 5K3AA 3G17A 1N8KA 1P0QA 2C3UA 4KSCA 1U9ZA 1CJSA 2Q1TA 4DT1A 1Q6ZA 1UK8A 4ZJZA 4K6HA 2HIMA 4M9RA 1F12A 3SS7X 2PWAA 4BX8A 1CF4A 1KBOA 2VZLA 5DM0A 4IS2A 4H9GA 3V9PA 4U2FA 5AK4A 4LOIA 1VKRA 2VTKA 5C8YF 3UWDA 5CA1F 4Z2AA 4L7VA 1WNTA 4PCLA 4RTQA 1P4JA 6LDHA 1J09A 2W0MA 1DBWA 3T1NA 1QH1B 4IJ5A 4XWOA 3FGOA 4Y2TA 2N1MA 4R7GA 4YAUA 4FNOA 4I5GA 3JR7A 3PWZA 1I5RA 1CUAA 1UPCA 3I6BA 4N8DA 3TSYA 5L7TA 3PHHA 2ZAIA 4QQ8A 2FN8A 4NOJA 2WUFA 5TVGA 1SXGA 4OTZA 5BW5A 2MWMA 3TNJA 3TNFA 4J0EA 4CKEB 4KW7A 4A1OA 2J0SA 2RC5A 5T7BA 1HA3A 4HNSA 3MINA 4W5HA 4GR5A 2YFYA 5HE9A 2AFHA 1CERA 4MV3A 2XCTB 1CSEE 2YJ4A 5LN1A 3NJ4A 4QDXA 3WSWA 2QVGA 3GI1A 1SUCA 1JKJA 3AF4A 3FMFA 4B3IA 1IN7A 4KPEC 5A3VA 4AMBA 1OLXA 2A5JA 2PSSA 4DA4A 4X66B 3D0OA 1B00A 1M7HA 1DO0A 2GZDA 4TV9B 1KYIA 2C4NA 1TLLA 5G3ZA 3I45A 4HNQA 2IXGA 3V1LA 1TFRA 2AWNA 2CXPA 1O0BA 1SCAA 1S8OA 1M1YB 2X41A 1FCJA 2DPLA 1TI7A 1CNFA 1UKZA 3PDHA 2V7EA 3Q6NA 3FTQA 4N6NA 5DWDA 3S28A 4M0MA 4DCCA 2VUIB 1V2HE 1G2PA 1C41A 1Y6ZA 3C4JA 4D3DA 1FTQA 3OI7A 4DE5A 1ZR2A 2FUG1 4M1TA 3SC2A 1F5SA 5JSZB 3OX2A 2OD9A 2FNAA 2YOHA 1ETHA 4KUHA 1MPXA 4I9GA 3OCVA 5E8RA 1QHEA 3V46A 2EDCA 1YZNA 4F5WA 1X2EA 3ZE6A 2AOUB 2ORYA 2V7WA 2XEDA 2EKPA 2JLSA 2E85A 1WCIB 2NSJA 3VDXA 3T15A 2UZAA 1H94A 3Q8KA 1QZZA 2D2XA 4RE5A 3FOAA 4RX1A 5EXEA 7REQA 5JXJA 3WAJA 1MIHA 1DT5A 5TV2A 5ITSA 3FIJA 4ZYZA 3KT3A 4PVCA 1JMYA 2DMRA 2I9PA 2G76A 3MRVA 4WXYB 1C9KA 2I3GA 3JQFA 5JS2A 1ZA1A 3OQ6A 4ZTZB 5B3JA 2QRVA 1EWVA 4M1YA 1II9A 3RSOA 2PU5A 2XADA 2Y27A 4RA6A 3HB7A 1MTOA 5C8ZA 3QXCA 3MD9A 4DUZB 5FBWB 3BDIA 5D3KA 1TOAA 2BRUA 1M33A 2I7DA 2V65A 2EQ5A 5H3LA 3THOA 4E5NA 2FGKA 3TG8A 3TUZC 1ML3A 3DLIA 4QOHA 3OURA 1KERA 2CDNA 4HXYA 3SSOA 3UMBA 4Y2JA 4X92A 1EMDA 3EC1A 1RWXA 4E6PA 2QPLA 2C04A 2YKGA 2ADOA 4F60A 3FLAA 4BQFA 1H5NA 4XDHA 3KPJA 2FFAA 2BGIA 2REOA 4NY1A 4COOA 3B60A 3FWKA 2AYZA 4PPYA 4Q47A 3FZYA 5K2MA 3VSCA 1BNCA 4WE3A 2XH8A 3TMKA 2XKAA 4NENA 4TWJA 4BMYA 3HXQA 1YRLA 3O83A 3V1TC 3WA7A 1ZJ4A 1LNZA 1ODSA 4I9UA 2J1LA 1SG6A 3QE4A 1QRRA 1U0JA 1EFKA 3PFKA 3E1GA 5ALFA 5KOHA 3EPKA 3AUAA 1ZMTA 1IWBB 4M36A 1HL3A 4DJAA 1JWLA 2QPOA 1T26A 1BVHA 2DBRA 5CA0B 1PT5A 5HCUA 3W6NA 1U7TA 3QEMB 4U2GA 3V3TA 3I5XA 2PV0A 3ZUGA 3WJ1A 3P26A 4CBVA 4NFYA 1JFSA 4K0RA 2IEIA 3LX5A 4HC4A 5EERA 1VE9A 4ZAGA 4ZVKA 3GQBA 2OGSA 5CLFA 1KK0A 5AW0A 3HDHA 2B34A 4RM3A 4D9BA 3H5RA 5DM70 2X4GA 2D8MA 2NSDA 2X0JA 3NNDA 3P2IA 4LVCA 2HQSA 3TVYA 4KPGA 3F49S 1XZQA 1GRVA 2ZP1A 2JIDA 4AJHA 4D5EA 4MA4A 2ZUBA 4FNAA 4H7JA 4HOYA 5I9TA 4HDCA 3O95A 3W8FA 3RRXA 2FK8A 4DDTA 3GHHA 3W5CA 3HHEA 1HOTA 3QM1A 1F1JA 3H2IA 3OIGA 3VNBA 5BUCA 3GY0A 2CN1A 3BN3A 2CGEA 3GUHA 3RC1A 3ZDCA 2CLIB 3ZR4B 4UC0A 4MV8A 5GZ3A 2PPLA 2G36A 3A2NA 2NADA 3LDAA 4E21A 3KT0A 1QYDA 4MKHA 1DAMA 2IKSA 3E1KA 1XRNA 3R20A 4ISCA 3BK2A 1X13A 4N0PA 2ZUDA 4CQJA 3HKCA 4AI6A 1LNQA 3W5HA 5HJ7A 4HGZA 2FX5A 4WA7A 5IYZF 3WOHA 4E4TA 2B9VA 3BFPA 4WVFA 5EE3A 1I6WA 2FW8A 2FJ0A 1PYGA 2JHCA 5CHYA 1YACA 3GUZA 1C4WA 4MYTA 3THSA 3SSAA 1FDIA 3MWEA 4BVGA 4QVKA 4IFBA 4AIRA 2HK6A 3OG9A 2ETVA 2CLOB 1SA0A 2EX0A 2AN5A 3D4OA 4NBSA 2B25A 4MA5A 4E7OA 1XL1A 5JS6A 1EXDA 1VHQA 5BNZA 5D00A 5G2OA 3CNOA 1GYQA 1O9HA 1XTPA 3IEMA 5BMVB 1KI3A 2Z8YM 3PB3A 4GPD1 3WBBA 2GXAA 1Y34E 3KQTA 4MQFB 2BGMA 2GXQA 2JJ1A 5IJ9A 4YLEA 4KQHA 5H16A 1SRQA 3LC2O 2HDWA 4UBOA 4PIVA 2GPWA 4HDKB 3NDPA 1QHHB 2W4MA 4P1ZA 5A4AA 5JPDA 1SHJA 3SX0A 1KDOA 1Y3AA 1GG5A 1NOKA 5KNBA 4IQFA 5B2EA 1X8XA 1L8QA 2NUTB 3CGWA 5LR6A 3C6KA 1FJHA 2XHZA 2W42A 4K6MA 1E1CA 3CWZA 3G3EA 3CSUA 2WHXA 2JLWA 3IAM6 4DTCA 3RB8A 4YRMA 1EVJA 3SQXA 2JRLA 2P0AA 3TJRA 4H27A 4AB1A 3L7JA 2XIJA 1QR2A 1DX4A 1ZK2A 3EMKA 2FPPA 3AXSA 3A9UA 4CM8B 3WMFA 4YAOA 2X6TA 3IGFA 2OYSA 1ZSVA 3KJZA 4PS0A 4BLSA 3ANXA 4FM9A 4DSTA 4M0LA 1KMHB 3H1TA 1AB5A 1O97C 1J20A 2QAGC 4WIAA 3ZXIA 1GPLA 3HFSA 5FORA 4DPMA 4F4HA 1BEEA 2WHYA 2AUTA 4RVSA 3PQDA 3P52A 3V8BA 4AMGA 4OLAA 6REQA 4H1UA 1QGED 2Q4TA 5CT8A 2ACEA 4W5NA 4ZOLA 4CIYA 4I6EA 1O89A 5LC1A 2AK2A 1WZEA 4I7EA 5KSPA 2V7QA 1K8XB 4ALMA 3PXGA 7ADHA 1SXQA 2P1RA 1V96A 2NZXA 1G5PA 1P72A 2XUOA 1BYUA 2DY1A 3QBEA 4K26A 3L4BC 2GNAA 2B1QA 5KYXB 2EARA 2OCKA 1IB6A 1W59A 2DVMA 3G88A 4GPAA 4RGVA 2YHIB 4S05A 3DV9A 4J1SA 1O95A 1R8SA 2HLDD 4PTLA 4YJ2F 2O6LA 4WLNA 1KEKA 3NMUF 4GSLA 2ZAOA 1M8KA 4UU8A 1Q1ZA 1OAKA 4PZEA 4YP6A 2IYUA 3QUCA 4YECA 2C8LA 4KMRA 4CIAA 4ZAFA 4P3KA 1QTQA 1LY1A 1NSYA 1P7CA 2A57A 4F3NA 1QZXA 2PLRA 3C7DB 1IK6A 1HTBA 4GI5A 4GPEA 1GQRA 3BIWA 4HEJA 1XZNA 4JWTA 1VSVA 4G0OA 1PZXA 3GA7A 3B8EA 4OQ4A 3T1VA 1GGJA 5JSFA 1UKCA 3OQNA 4P3YA 3TQOA 1E3SA 4KXUA 4RCYA 3LL7A 4CG3A 3R40A 3BBPA 3OE1A 1RRCA 1V43A 2QL6A 3COYA 1ODIA 2PCLA 1F8FA 1PR3A 1Q12A 3EY9A 2IBMA 4QXRA 4QL3A 4C89A 3VU1A 2QTHA 1KS2A 1M75A 2BFAA 1Y5RA 3KBOA 3AOEC 3OZIA 4HI0E 4I8XA 3MSXA 2JLAA 1DL5A 2JFOA 4WA8A 1PSWA 2I2BA 4MW6A 4EATA 3L82B 3R41A 4X6UA 4ZOLF 3Q2OA 2D2EA 1HV8A 3DT8A 1QYWA 3AETB 4NMWA 5BY2A 4DMMA 2R7LA 2D06A 3N76A 1W73A 1Z4OA 2Q3JA 2HU7A 2WZDA 1R5OA 1A9QA 1UBGA 4H4DA 4MUKA 1OT3A 1BRMA 2JIOA 5DWQA 3ZNNA 1FUEA 2RHTA 2QD5A 1EIWA 3LMKA 2R00A 4OHOA 2FE1A 4AZ0A 1TFUA 4U6SA 3TQCA 2CNWD 4NFHA 2I3ZA 2R6DA 1I4DD 3B1YA 2QNBA 4MIKA 4R01A 1V11B 3EPJA 1NW5A 3X1WA 2V97A 4WBNA 4RXMA 3OIUA 2FDRA 5DOZA 1Z75A 3EXHC 1A9PA 3C1AA 3IBYA 4PHHA 3BORA 5KZMB 5AIAA 2VCYA 1XXHA 2C9BA 2UYOA 3MAGA 5E9JA 1OTHA 2YXNA 4BO8A 5FUWA 5TMPA 2NPFA 3F3YA 3FCYA 4FFOA 3OCWA 4DB2A 3P97A 4P7FA 3UHFA 3UT0A 2W2LA 3K3PA 3SQLA 3DEFA 2DR2A 3KD3A 2R1TA 1Z6TA 2Q9BA 4RPIA 1YVDA 4AJIA 1QV6A 1TK3A 3FE2A 4M60A 2H17A 3WISA 2RG1A 4ARCA 1P7YA 1DCFA 1P61B 4G8DA 4L8YA 3T6KA 1L4GA 1UJNA 4E22A 4X60A 4YMTA 4Q3AA 3PPWA 1KKMA 5CG2A 3OQMA 2X9QA 2AD1A 1YL6A 4FZJA 1PR0A 3JASA 5L3ZA 5HS6A 3WKCA 4Z4HA 4OLJA 4F4IA 4D8VA 5IXSA 1NM5A 3AONB 3ANTA 1ML4A 2EWMA 1DCKA 1ESMA 1IHDA 1GSIA 2Z58A 1YZLA 4HTAA 5A7HA 3WL3A 4DRXA 1W36C 2ENWA 1WCV1 1HEYA 1G9XA 2AF4C 3IV9A 1Q15A 1E5XA 1DBPA 1N9GA 3QVTA 1Q21A 2GPYA 1E3WA 3GPLA 1QMGA 1IYZA 3BK1A 3HCWA 1Z0UA 2J3DA 3ED5A 4PG7A 1W0CA 4E6EA 1PRYA 5F33A 5KX5A 3NU1A 1UT6A 2P0YA 1RQPA 5B1IA 2QZJA 5FBHA 1L7PA 1V5GA 4QUEA 5EZ6B 3WMEA 4MRSA 3H9JA 2INGX 3H5AA 1KETA 2AOTB 4KNWA 2GK6A 3L8YA 1H6DA 3ORQA 3HKDA 3LRPA 2B4RO 4FYKA 4IJ6A 4MWCA 4F7DA 1C1DA 2AQHA 5JCJA 5HKKD 3FRJA 4DV6B 2W2QA 1ZJZA 4PIPA 5TQ2B 4XOIA 2JD2A 3U13A 2UUBB 3ZIAA 4J4BA 3KVRA 1P75A 1N2XA 2FA9A 1Q7BA 1I2CA 2BAGA 2Z04A 3CZ4A 3TZCA 4YV0A 4YCAA 1X1SA 2F9LA 2G0AA 3CLSC 3FDZB 3DXXA 2K4MA 2XTMA 4I50A 1YS4A 4A8HA 2NU8B 1TVKB 1U99A 2GJKA 4R7TA 4ZVQA 1DAPA 1BQ3A 2PZBA 3JU3A 2CT8A 5ANRB 4Q7QA 3MJFA 5HYVA 4OP1A 3L06A 1Z4LA 4TTJA 2R86A 3UGQA 4D46A 4DM7A 3EDCA 3N6VA 3NYRA 5ELMA 1E3IA 4Q9LA 4AWAA 4DQXA 3LV8A 2HPHA 3MYRA 2EBWA 3ZG6A 4CEJA 4CV0A 1Q0UA 4RVCA 3FPBA 1UANA 3HI6A 1VHLA 1RD4A 3VC3A 1LBTA 4B3RB 1VMEA 1E8NA 1QIHA 2Y1DA 3DZHA 3KSUA 3NBMA 4L5CA 1AS0A 5FULA 3TLGA 4D0LB 4PR0A 5F1OA 1HDIA 3WIUA 1VRWA 5DTIA 4HQNA 4DIBA 4AKSA 1VJ1A 5BVHB 2P2DA 1K63A 3QVLA 4JLUA 4WOBA 1NMEA 2H9YA 3BXFA 4EFMA 1BE8A 2AN4A 4BBJA 1O58A 4R3NA 5ALZA 1SC4A 2W6ID 4EA6A 4NV3A 4EJ2A 2PUHA 1X80A 3GG9A 3IE2A 5IJZA 3VBEA 3W9UA 4MV1A 1OC2A 3NWOA 1KJ8A 5B53A 2PUBA 2ODBA 1VOTA 4ETIA 2I6FA 2X8BA 5BUSA 2P9HA 3TDMA 4X00A 3DUFA 4YRLA 4JJ6A 5FNVA 5JYDA 1JEYB 2FDCA 2RHRA 2VBFA 5DHTA 5HDBB 1RRFA 2RGEA 3A4LA 4HWKA 1ZK4A 2DM6A 4B80A 2YMMA 3ROQA 4QO7A 5FTLA 3WDKA 3OE7D 1YA6A 1OFVA 5HTOA 1NHGA 2A0XA 2GEJA 3CH5A 3E27A 4GRAA 5ICSA 1R7RA 1T6XA 1YKFA 1OBOA 5K01A 1ATZA 1L5OA 1UDCA 1X77A 2ZAMA 4EBBA 3EGWA 2G17A 2J9FA 3QU5A 3RVJA 1EJ0A 3UMJA 3CZRA 1EFRD 5L3RA 4EHAA 1JR4A 5AKLA 4XFJA 3EVCA 2O3SA 2QRJA 1BVYF 4IQ0A 5EMKA 4BB0A 3GARA 4W9RA 4ZA2A 3P9PA 3SXUB 5ALUA 1QANA 4MAFA 1WW8A 3W77A 2O3TA 3EF3A 4YRBA 2P2SA 2FPMA 2FU5C 5KPDA 3E5MA 3R77A 5A04A 4PLVA 4BUZA 4JI8B 2O1XA 1G5TA 2R8BA 3CLTD 2YRXA 3AR9A 4N1AA 4YP7A 3ZGOA 2FXVA 1NYLA 1MB3A 2QM7A 2WD7A 2YZ7A 3QK7A 3ETNA 5TMBA 2VP3A 4KDFA 5A1TA 3TKAA 4DPKA 2EKLA 5LLDA 4JT9A 3M89A 3T7DA 1LFDB 4KMOA 3HBMA 3AEUA 3VZPA 2C54A 1CUIA 1NV9A 1Q3HA 4ODIA 3MG9A 2CDBA 5E1DA 2WJ4A 3AUUA 1ORTA 4V2IA 5FNVB 4EF6A 4IF4A 3CLUD 1JEYA 4YRSA 3MJDA 4BMVA 4Q4JA 1MAVA 4GZLA 5IC6A 2FWJA 5K4HA 4KO8A 1T0PA 1OAOA 1DO8A 2V9ZA 1WD7A 4L4YA 4UAJA 3UKDA 1RHUA 2WK1A 1V9CA 4J3JA 1E77A 2O50A 1NTRA 2AW5A 2G1AA 2A9KA 3A0UA 5C81A 4ND2A 1Z17A 2R65A 4EK9A 3GELA 2I8AA 1X14A 3C5VA 5I9IA 2WJ6A 4FFRA 1RDFA 1OTXA 1EZZA 1AKYA 4N7RA 4P6VF 3UICA 1UT5A 4Z0PA 1BDJA 3PWTA 4LI0A 3TH5A 3M6VA 3AG6A 4GPTA 1ENPA 1ENOA 1H9BA 1TTQB 2A4MA 2E2WA 2QLJA 2XQVA 4EFKA 3HKEA 3V4RA 2NGRA 3G2KA 1XZLA 3GLKA 1SG0A 1OVGA 5ECYA 3GB9A 3NPMA 1G1AA 1XNQB 1N9ZA 3MBKA 3A1CA 4L4UA 2XMCA 5KJEA 1VE5A 1SOMA 3LAWA 2GN2A 3CG0A 3MGCA 2PWYA 2O5CA 3IR7A 4HSEA 3IBTA 1VQ1A 2C84A 1ZD1A 4ESEA 4UATA 5LP6C 1OA0A 5EFZA 4HUTA 1CUZA 1Q14A 3RTCA 1GAQA 5KTNA 1W0KD 4FK8A 1KQOA 3DHWC 5EXXA 4EFNA 4EAQA 3T41A 3TCKA 2E82A 2GN8A 3PX3A 5C5DA 3ND7A 4OKIA 1M2VA 3TWOA 3NTXA 1N2JA 2ZUSA 3OZBA 4LWOA 5AIBA 3PRJA 2O3RA 1A88A 1E2BA 1QONA 3O8DA 2ORWA 4KUEA 4CM8A 3GQVA 1T3TA 1PBNA 1J2EA 2PD3A 4UHFA 4GP9A 4AUNA 1ZL2A 4MDFA 3HEBA 5GJWC 2IKQA 5DBHX 5DNUA 2FJPA 2SKDA 4UJ5A 4WFQA 4DR6B 3BFKA 1PLKA 2D8AA 2ADMA 3UJBA 4ND7A 3KAPA 3L6CA 2ATIA 4TN5A 2RGRA 3WIEA 2Q5JA 5IZCA 3PKIA 2G63A 4RD2A 4TYPA 2EP5A 3THXA 4B3MB 1WCXA 1ZHFA 4D4HA 2O8CA 3TVTA 2BD0A 1B0ZA 3COVA 4HQRA 4N8EA 4YTEA 1KI1A 2ZZKA 3MK31 3RWOA 1UAGA 3UYLA 1WDLA 3EFHA 3UOGA 3GLSA 3AJ8A 3F9CA 1N3IA 3KVYA 2YXLA 1JKJB 2ZJ4A 2G82A 5I7HA 1SXHA 2WUVA 3HNOA 1NZJA 3T38A 5M29A 3LIIA 4XH9B 5CVEA 2JVIA 1DBIA 3I2JA 2FPWA 2IOYA 2PT7A 3S1AA 1FL9A 4EHKA 5K0SA 2YJGA 5EIHA 4FJ1A 2NXEA 2A14A 3I04M 4JOCA 2R6ZA 4N82A 2Q9UA 1TADA 1VLZA 4CKEA 1D2EA 1KFCB 1IONA 1LBIA 1UH5A 2QP3A 4MWGA 5DK6A 5ULLA 1H8HA 4P3NA 4P83A 4Z7NB 3JSAA 3OQVA 4OIMA 4AJ9A 1C4XA 1MKYA 2Z6AA 3Q8MA 1M83A 2BEWB 1HQYE 3T1OA 2WZBA 4AZVA 1WUYA 1LRKA 1U3TA 1R6XA 3Q2IA 4JS0A 3SAJA 3JAMA 2E1RA 4JLBA 4HWGA 1SCUB 3UMVA 5FNVF 5DJ5A 2GZAA 4FR5A 5H1YA 3AIMA 2ZSEA 3WMXA 1OXMA 3HV0A 2B21A 1Q7CA 5I9NA 1ORDA 3F8WA 3BB1A 4HAYA 2XWPA 4O29A 5A7FA 3IP9A 3BTUA 3QXGA 3A3PA 1YT5A 2RGYA 3DZBA 2GM3A 2XUIA 2Q1UA 2IPMA 3BWMA 5IKEA 3ZD9A 4L78A 1NVVR 3RIEA 4GDFA 3U3KA 1TRHA 1CUSA 3VZSA 1P33A 4KZPA 4Z8YA 1FS4A 2FWNA 4RV4A 2RB4A 4JT2A 4CM9A 4ZCPA 1M76A 1D1TA 2H4WA 5HM8A 2X9NA 4NR0A 1L3BA 5H9VA 4HG2A 3RC9A 3NP7A 1CK4A 3B9BA 1E2KA 4R1UA 5FWYB 3ILHA 2QQFA 2JH8A 3L4BA 1W47A 4MB2A 1G0NA 1G7RA 3GUUA 3JVEA 2ZRBA 4V2UA 4LF6B