4BMPB

Crystal structure of bacillus cereus ribonucleotide reductase di- iron nrdf in complex with nrdi (2.1 a resolution)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bacillus Cereus Class Ib Ribonucleotide Reductase Di-Iron Nrdf in Complex with Nrdi.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Oxidoreductase
molecule keywords RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT BETA
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bmpB00
3LT5A 5A4KA 1FX1A 2MWMA 3SVLA 1GG5A 1ZWKA 3N3AC 3U7IA 3W78A 1XYYA 3D7NA 3NHSA 1AMOA 1TLLA 1AKQA 1XI2A 2R97A 5F4BA 1AG9A 1CZUA 3OJXA 4YALA 1YDGA 5LBTA 4QODA 4ZVMA 3FVWA 2Z9BA 3B6KA 1DXOA 2XOEA 1X77A 2V5VA 3HA2A 3NHWA 4N82A 2XODA 2MT9A 2Z9CA 3O73A 4LTNA 4S24A 4Y9UA 1BVYF 3TE7A 4HEQA 2OHHA 3NFRA 3NLLA 3HR4A 1J9GA 3FW1A 4GQIA 5FX2A 2FOXA 1F4PA 3ESXA 3GFQA 3OWHA 1XT6A 2FVXA 5B3KA 1FLVA 1FVXA 3L9WA 1VMEA 2QMZA 2V5UA 1AKWA 3FX2A 2Q9UA 3JSXA 3N3BC 3NHJA 3OX1A 1TIKA 2V9CA 3B6MA 3G5MA 5ULLA 3F6SA 1D04A 2BZSA 2R96A 3EDOA 3OVMA 5LBUA 3W79A 2N1MA 4H2DA 4XDHA 4BMOB 5LVAA 3NHPA 1YKGA 2Z98A 1CZHA 3K20A 3QFCA 1AHNA 2OYSA 3FNIA 4H6PA 4PU0A 1ZX1A 2HPVA 2X2OA 3W77A 2BPOA 1QHEA 1RLJA 1YCHA 3L9XA 2QX9A 3F6RA 4PTYA 4XDGA 3TEMA 4DILA 5LLDA 1D03A 1QR2A 1CZLA 2KLBA 2OHIA 3ESYA 2FAXA 3EYWA 5FUQA 3GFRA 5LJLA 2HNBA 4C14A 3KAQA 1JA1A 1YCGA 4U7HA 1YRHA 2HNAA 3R6WA 2BMVA 4N9QA 2MOKA 3K1YA 3ES9A 1FLDA 1AKRA 2D5IA 5F51A 4QOIA 4PTZA 2MTBA 1V4BA 3B6JA 1YCFA 3NHKA 2QWXA 3NHYA 1KBQA 4LTDA 4U7FA 5B3LA 3NHLA 2FCRA 2Q62A 5EMNA 4F8YA 3KEGA 3NHRA 2QX4A 1D4AA 1JA0A 1WSBA 2FZVA 2W5UA 5FA6A 4ZVKA 4D02A 4HS4A 1OBVA 3NHUA 1FLAA 2OHJA 4U7GA 4OXXA 4CF6A 4R81A 1OBOA 1WSWA 3OJWA 4C0WA 3ZHOA 3QFRA 2M6SA 1KBOA 4NULA 3UXEA 3FJOA 2M6RA 1RLIA 3F90A 3KLBA 1B1CA 4C0XA 1QRDA 2QMYA 4QOHA 1H66A 2X2PA 1OFVA 3GFSA 2FZ5A 4FGLA 2FX2A 3N39C 4M0CA 4YAWA 1AKVA 4ESEA 1J8QA 4ZVLA 3TZBA 2KQUA 3QE2A 3RPEA 1CZNA 1YOBA 3OX2A 2A5LA 4QOGA 3S2YA 4CETA 1AZLA 2AMJA 5F12A 1I1OA 4YAFA 4QOFA 3KAPA 3OX3A 4YAOA 3UXHA 3HLYA 4GR9A 1C7FA 1J9EA 1DXQA 1DX9A 4DY4A 5BUCA 1SQSA 5EAIA 1CZKA 3NHFA 1RTTA 4Y7CA 1AKTA 1FTGA 1RCFA 2QR2A 1FLNA 1XYVA 2BF4A 3LCMA 4FGJA 4QOJA 5LMCA 1CZRA 2WC1A 2FDXA 1J9ZA 1QBGA 2F1OA 2QX6A 4YQEA 4YAUA 3P0RA 5EA2A 2ZKIA 3ESZA 5JROA 4C76A 2B3DA 3B6IA 1SG0A 1H69A 1AKUA 5NLLA 4J8PA 2BN4A 4Y9RA 4DIKA 3F2VA 3W7AA 3OWXA 1T5BA 3O2NA 1BU5A 3GAMA 4QOEA 1FUEA 4GI5A 4LAFA 1NNI1 5LJIA 2QX8A 4BMPB 3U7RA 5NULA 4FGKA 2GSWA 2Z9DA 4FX2A 4LTMA 1C7EA 1ZWLA 4ZVNA 1T0IA 4N65A 5TGZA 2ARKA 1CZOA 2FLVA 2RG1A 4NLLA 6NULA 4LA4A 4ICIA 1E5DA
chains in the Genus database with same CATH superfamily
2ORIA 4OK3A 1AK9A 2CB9A 4FZ3A 2X1LA 4Q1BA 2FH5B 2ZBRA 4KG7A 3VHQA 3ZD8A 2BMEA 1T8SA 4Q3NA 2WIFA 4JLOA 4WBNA 5KWJA 3DPIA 4ALNA 3TW4A 2GTHA 2Y4OA 3JD2A 4L5CA 4EI7A 3AM1A 5TSDA 5F23A 2O1SA 1PUXA 1KXZA 4GZMA 1P2GA 5A9SB 2J4DA 3AUSA 2PYZA 3WLPA 1ZHOA 5F5NA 4YJKA 2DVMA 4H1TA 2RI0A 5B3KA 3VNRA 1JJ7A 3B3GA 2PQ6A 3C6BA 2NVBA 3MGKA 2O8EB 3GJRA 3GYBA 3RWMB 5AVVA 1MTZA 1KJIA 2FMIA 2EHDA 1N3IA 1X7XB 1RRKA 1K7YA 4JX9A 4LQ4A 4TGLA 2BSAA 3HXMA 2HGZA 1YKGA 3KZ1E 3FTQA 3FZYA 1JTFA 4LFBB 1VMIA 5LQSA 2VJDA 4XQEA 3RFFA 3IR6A 1GTRA 1SRQA 4UTZA 3UGKA 1QNFA 4DQUA 4ENPA 3AVPA 2CLLB 4D9BA 5E8JA 3PD7A 2B99A 5C7IO 3R0JA 5JVDB 1V5EA 4QPDA 5IMSA 5EY5B 3Q2KA 4WI1A 1O95A 5B36A 1E3JA 1EGVB 4JC0A 4DA6A 4BNWA 5FNVA 2CXNA 3QW2A 2OR3A 4B3TB 3VPBA 5LMUB 3QVKA 3MZ0A 4H3KB 4RA9A 2VP6A 1F0NA 2HWKA 1LI7A 2WJYA 3OFJA 4HT3B 3RRMA 1IEWA 1DP4A 1EFHA 1GITA 2PUFA 1T1RA 2XMSA 3GQVA 3IV9A 2OB1A 2XNSA 4Q9NA 4KQFA 1O0SA 5BN4B 1NP7A 3EGIA 1YR8A 5I8ZA 2CK3D 2QUKA 3N70A 3NHMA 2OBMA 1F6DA 4N39A 2O50A 2R8OA 4PSAA 3RUFA 4BYMA 5JNWA 3A6GA 6REQB 3ENZA 3UFXB 2AG0A 1W87A 4Q7KA 4YDHB 1FXUA 4A8JC 2CXTA 1SCBA 2A9PA 1PJLA 5FTMA 3TJZA 3KXPA 2NYVA 3GCGA 2VI5A 4GZ6A 1C0LA 3ZZ0A 2AMLA 4OMFG 2VPZA 2OT3B 3ILYA 2H2HA 2OCGA 2ZSKA 4M9CA 4YAJA 4EQZA 3MXOA 2J9FB 2JIQA 4WN3A 4HQKA 1IIBA 3K2IA 1Z2CA 4QOJA 3RUDA 2ZIEA 3I5YA 2AHOA 3IBSA 1L8OA 5JDCC 1UZLA 1Q14A 2VHVA 5TR9A 1T0HB 3SM9A 4OIMA 4MVJE 4ZAZA 2YHIA 4FJ2A 2E7ZA 2Q5HA 1PZGA 3N2GA 3ZCXA 3QFTA 4HAXA 3B9PA 4NBUA 2K87A 1RHUA 1JJAA 1RYHA 1ZRMA 4UBOA 3G5UA 2V96A 1AUPA 2ST1A 4FOSA 4LBYA 3WAGA 1L5ZA 3ILHA 4KFSA 3W7VA 4K6OA 3CX6A 5JBQA 1MC1A 5ALVA 2WHPB 3X1XA 1EX9A 1YMQA 4PE5B 1MB3A 2HA2A 1SC9A 1JXMA 2LW7A 3WNQA 4ZDKA 1HE4A 4O2BF 2Q46A 3K8ZA 4TLDA 4AIRA 3EZGA 2EYUA 5G40A 2Y4NA 5EIXA 2E21A 1Q44A 1CNMA 4S1VA 3KHSA 5AOBA 3TEJA 2X3YA 1UKEA 4BBJA 2WVGA 1T4MA 1E7QA 4K6MA 1ZI9A 4QG7A 4J0DA 4JJ8A 1OI4A 1SKBA 1C3OB 2AJDA 4KXYA 4EK9A 4LYJA 2PUWA 3UGQA 1TAHA 2I6FA 1JJVA 4M76B 5ED0A 5BV2P 5E1OA 1YAHA 1AMNA 2ZQYA 4H1UA 4K2AA 1VJ5A 1WCXA 3VDNB 3NV9A 3A04A 3AKCA 2CSXA 1QYVA 1XJQA 2H16A 4P0TA 2ZBFA 4NL4H 2VUUA 1QAMA 3KVOA 1LBHA 1Z25A 3F5SA 3M83A 3O82A 4K8RB 4REQB 1JYEA 5CXUA 3QUSA 3TPZA 3ONEA 1HE1C 2YCLA 3F3KA 1OJ7A 5SZKB 3V4OA 2I2XB 1E3LA 3LTNC 3L40A 5TF4A 4RACA 1QQ5A 4CGZA 1JF8A 1YMUA 3IQDB 2A0UA 4IM7A 3JZAA 3E0XA 2FCAA 2J6BA 5T4EA 4FD2A 4RDIA 5HVNA 2O5EA 5JSHA 1YMVA 1G5RA 4U7FA 3WNBA 5LKRA 1OQAA 4X93A 3FB4A 3TI9A 5F5LA 3F9IA 1FEZA 1O5TA 4UM9D 1DIGA 2WYUA 3DBRB 1FYEA 3FWNA 5A4IS 4CIAA 3ZJUA 4YHBA 1R66A 5ADHA 5K6RA 2PMDA 4LC9A 2FPGA 3HYSA 4FMCF 3TKAA 5C1OA 5MN5A 3BMXA 3QU2A 4P33A 5E9JA 1WMEA 2P9GA 4MGYR 4OHBA 4YV0A 1VDZA 4PS1A 3GDOA 1ONNA 5G2OA 4KXLA 2X0FA 3LX8A 1KMHB 3A6JA 4KAXA 4ZA2A 3U3OA 5LOVB 2G0TA 4J07A 4G0UA 1JWBB 4TKLA 5DN9A 1GTSA 5TQ2B 3LXXA 1HFWA 2OFWA 1I80A 3FCCA 4LBWA 3JTMA 3VYRB 4QUGA 3ZUGA 5A02A 2GAJA 3E3OA 5TT1A 2FJPA 2QMUA 1JTVA 4MKIA 3L49A 1WU8A 3Q7IA 1L8QA 4KH0A 3SEZA 3WWYA 4CFZA 4N18A 4UDXX 4ZCPA 1E4YA 4BE4A 1OFTA 1A9RA 5BSVA 1E9SA 1NDHA 2WJHA 3C0KA 4KX3A 1DAFA 1KVTA 5I9TA 3AFHA 2BF4A 4BFSA 5AM0A 3AVXA 2NSHA 4AULA 5FL7A 4N5NA 4BRZA 4MR8B 5IJ9A 4A36A 1ZOPA 3LYHA 3L0DA 2YWFA 3PE4A 3TMYA 1CVLA 2ZKIA 4LC1A 1VJ0A 1YZFA 3QXHA 1IZ0A 2PNJA 3B6IA 2XEDA 2FMTA 4ND2A 2NVWA 1E7WA 3F2VA 4H0FA 5E1MA 2OV3A 1JMVA 5FOUA 3WGNA 5JQGB 1EG2A 1RQXA 2IU0A 3BOSA 2IZZA 2ACWA 3M4XA 4YJGA 2G5TA 2CDBA 3DYIA 3L7NA 3AFGA 1YI0A 1UKCA 3MOSA 4H4EA 2H51A 2H1FA 4NZNA 4RJLA 3WTBA 4O4JB 4J0EA 1ZVKA 1J24A 2Y67A 3EGOA 4Y2HA 1CJUC 5LIPA 3QY0A 1UXOA 1VG9B 2VA9A 4PYRA 2H5JA 5BMVF 1FFCA 2WB2A 1BYUA 2JLCA 2Q6KA 3VO1A 4KKVA 3RRZA 4BO5A 1AKQA 1LW6E 3H7AA 1JR3E 4X66B 3IVRA 5CNMA 4ZOAA 5DIFA 3ZWXA 3WLHA 4MP3A 2CXHA 4ZVMA 4RYDA 1J2JA 3JAWA 4CCSA 1QP8A 2XUDA 3GJZA 3NYIA 3SBDA 5IM4F 1VE7A 1WBDA 5BYBA 2DUWA 1B15A 4HRVA 4UNQA 4GRAA 4B3HA 5FX2A 2PH7A 1VLHA 5CB4F 4DR3B 6ABPA 2TMDA 1R18A 2FVXA 2IW1A 1GUZA 1EFCA 1KJWA 2PUVA 3H8SA 4GGOA 1UBLS 2QE6A 1Z4PX 4A1OA 1A9XA 4KIFA 1SEVA 2ZWOA 2QMOA 4N0PA 3S81A 3ABSB 3H1BA 1NUPA 3KJNA 2N75A 3OSZA 4I50A 4N3AA 5T8KA 4EHLA 1MAUA 1MMFB 3DBHB 4BEVA 2ASEA 3FLEA 5LDDC 5LQAA 1UQUA 3HSSA 4P84A 3AM3A 5IJXA 1W44A 1B42A 2O14A 2NZWA 2OPHA 3NWJA 1XDBA 3A1FA 2D1SA 3I8SA 3L7CA 4BUCA 3CZAA 2PRSA 1HE5A 1W19A 3DBLB 2WYVA 3QLUC 4W8GA 3VNVA 4L8YA 3S0JA 3FRIA 4DEVA 5JMOA 3N2ZB 5EJ5A 3OHPA 4BFYA 1HDCA 2JGKA 5C51B 1R4NB 1NVAA 5EIFA 1T9CA 3GHHA 3Q8WA 4X5OA 4AFNA 2L2QA 1AGRA 3LYLA 2PV7A 4KREA 4B2PA 2QOEA 4TTRA 2QPTA 3SQDA 2QRGA 3RYFB 2HWWA 1NVBA 7REQA 3LM8A 5BT8A 3P4YA 4AUMA 4QJ5A 1F0KA 4DDMA 4ZMBA 1J20A 1RJGA 1TO1E 3L7AA 2PX6A 1QKKA 1Q0RA 2FX5A 2QTZA 4N7BA 3THRA 3DC2A 3U7EB 5HRUA 1XTSA 3AC0A 4KQ2A 1DEAA 1J39A 3NWOA 1G3QA 2I55A 5J2UB 1YQXA 3OM9A 4RANA 2C4HA 5DLQC 4LBZA 3VTAA 4BNJA 5KDDA 1J7KA 5EC8A 1CR2A 3RKSA 2AGVA 4DJFC 3NDRA 3OT5A 3HFGA 2YV1A 4GR5A 1Q22A 5JPIA 1U2DA 221PA 1M0TA 2AJLI 2JC3A 3CSSA 4QTZA 5FHRA 2WT4A 3A4IA 2NYAA 1LV7A 3DEAA 3O8QB 3RTDA 2JFBA 4XDYA 4E5DA 1QRSA 1JSZA 2NPIA 3U80A 3GLGE 4HNVA 2XITA 2WSSA 2PSFA 3AHDA 3QU4A 5JXHA 3CEHA 1HYEA 4AD8A 4V0NA 4C7OA 4W5WA 1SN7A 3A2LA 3DP7A 1LBEA 3KKNA 2C61A 2B9VA 2A86A 3F0TA 3KPWA 4M0FA 4XJXA 1R8XA 4CLRB 2BN4A 2FWAA 2W6CX 2VXYA 4L0DA 2WSSD 3HJBA 3STWA 3F96A 3INYA 1KEVA 3ORRA 3NVMB 5CFOA 1QBKC 3PDCA 3SCZA 1KI3A 1ZK3A 1XA0A 2EW1A 1G66A 4X94A 5ES3A 5JYDA 3AFOA 3H04A 1BFKA 2GLTA 5F21A 4EI2A 1KYTA 1UDRA 2XUZA 2XT6A 1C7ZA 1XXHA 2PQ2A 3K6RA 3WLEA 4B74A 1XU9A 1P7YA 1Y6RA 5BSFA 1P0MA 1KFCB 2P6PA 1B4DA 3B1JA 1WP9A 4KMMA 4MDHA 5JHGB 2EZUA 4MKXA 3DCNA 3EY9A 3A4YA 3Q12A 2LRHA 3IULA 1CZUA 1HT0A 3B36A 4LW8A 3HXTA 2H4XA 3EZNA 3LP6A 4H1HA 4W82A 3T6KA 3C85A 2Z9BA 4Z9YA 4MKRA 1OLXA 2YW2A 4ITRC 3ZNQA 5KYYA 5E4TA 3O73A 4PQGA 3HVHA 3JRNA 2YIMA 1P1BA 3O4IA 1E1QA 2C9ZA 3FTDA 3OP4A 3C6ZA 3BQNB 3FDZA 1K8ZB 1RAGA 2JZNA 3EW9A 4H4CA 5DGDA 4J8PA 1TPZA 2BM9A 2G9VA 3LPCA 2Q9UA 5EZYF 1Q12A 3HN6A 5K0ZA 4QGSA 3I1IA 2N1MA 3KKOA 1V7QA 3TZLA 2VTBA 2JH3A 4DANA 5EJEA 2HMVA 2H1RA 5E9WA 5CA1F 2D7JA 1AUOA 3FGOA 5DLDA 4EPVA 4XUEA 1E64A 4OUKX 4WBXC 2QXYA 3QV1A 2P9YA 4DUYB 2YL2A 4W7SA 1RZRD 1CY6A 1QHFA 1ORTA 2JF0A 1LI5A 4G9EA 4JOQA 3OPQA 4PG7A 2ATCA 1Y5IA 1J0XO 5L4LA 2WM9B 4OX9B 1XZAA 1W581 4KWCA 4P4LA 1CTQA 5T67A 4CM9A 4HNUA 3K0FA 3DTTA 4Y67A 1H8ED 3G3EA 4LK3A 3LXMA 3VR2A 1C3EA 2XQVA 3NKFA 3OOWA 2GAAA 4MV7A 4MV3A 3V2GA 3OWOA 5H8WA 2AFVA 2QUBA 1DC3A 1QMPA 3N2EA 3HCDA 1JI0A 1JHUA 3JWGA 4R8MA 5J5VA 1N4AA 5IVPA 4O4IF 4L3VA 1FW6A 2Z1DA 1W6RA 1A9TA 1G8SA 2O59A 2IHVA 1TC2A 2YUIA 2VNAA 4MB2A 3Q2OA 3USZA 3VM6A 4LWZA 3I34X 4A6PA 3PGXA 4OXYA 4Q1DA 2Y2UA 3KZXA 3OJOA 4GVXA 3QKSA 5GMOA 1MNAA 1NW3A 2JEZA 1N8SA 4YC7A 5D1NA 3VO8A 2JZCA 2X1VA 3BM5A 2Q2QA 3HJNA 3D7MA 2WM8A 2JL1A 1ZG3A 3OJCA 2H2WA 2A5LA 2JA2A 4MKFA 2AMJA 2VAVA 1E1DA 2WHPA 4OHRA 1U7TA 1GWNA 4N7RA 4ETWA 2V98A 4OSPA 1KZ6A 3LUHA 2XMZA 4FP9A 2VRWA 4K0RA 5ITVA 1U8EA 2QN3A 3R6LA 3J80A 4GP9A 3FTEA 3K5IA 3QVGB 2XOKD 4HAVA 3QH4A 5BN5A 3BERA 4Y2UA 5FR2A 4DC9A 1NNSA 2YWRA 5TVKA 3WGVA 1UCFA 4F6CA 2XJ4A 3M0EA 3A9TA 2RFLA 1NXPA 2FR1A 3OQIA 4NAVA 1WS6A 3IP5A 2GAOA 4JDUA 4KVFA 4ZREA 3TR5A 3UJ6A 4BZZA 5LQMA 4FI3C 1HL7A 1KMQA 4GLFA 2FTKE 3NBQA 3W4JA 5LD2B 4B2YA 4ENSA 3ZY5A 3IMCA 2E5LB 4UULA 3RUIA 3TLGA 2PSSA 2A0FA 2JG3A 2AWOA 3URKA 3EXG1 3NDIA 4TS1A 3DT8A 3IBTA 2WB4A 1T9AA 4MH0R 4YAKA 2IS6A 2P9ZA 4DLTA 1M8PA 2BFEB 1XEAA 2VSNA 3KYDB 1VKZA 3S4YA 3OAAA 1C81A 3KFLA 3HEBA 3EPLA 4LF5B 2G08A 4HLNA 1CY8A 1NFRA 4FB4A 4DJJA 1XMSA 4GSLA 2AQKA 3UBMA 3SF8A 4CEJB 3I30X 4LOKA 5CEFA 3E27A 1SKUA 1CFZA 4L73A 4GQIA 2G9UA 2IXAA 1ADFA 1R8JA 4B87A 2YFYA 1G6KA 1ZMOA 3REQA 5JWHA 3D7LA 4B4OA 3I9MA 2HA4A 1OILA 4H1VA 4WEOA 3V8PA 1IYZA 1K2VN 1KA9H 5BP7A 5KCMA 4EENA 4X6LA 2QAGC 2AK2A 3EDOA 5HMMA 3AJ8A 4DREA 2AOWA 5D5PA 4AJNA 1GR0A 3KVNA 4E1VA 1T25A 4NOMA 4B7UA 4B83A 1W75A 4I14A 1RAFA 1ZLXA 1J23A 1P9RA 4IOJA 1XTBA 1PLLA 3JAKB 1OA1A 5JVDA 2DUNA 1BS2A 4NZYA 3SBOA 3VH3A 4TRMA 5AI8A 4L51A 1NBHA 4AP9A 4Z2AA 2TMKA 3C3BA 1ZN7A 4QX6A 1NY5A 4X61A 3ZWNA 3HZZA 1PV4A 4TTJA 4QXMA 1VIVA 1QGDA 2FNAA 4NNJA 3AQ4A 5A4AA 3A9VA 2AG1A 1X19A 2VT6A 4ND8A 5DI9A 5EYPB 5LBIA 5FTLA 4TYWA 1X1TA 4YMSA 5IJ0B 3TLKA 2RGNA 4PSCA 2H63A 2VRCA 2IPXA 3MMPA 1LU9A 1PQUA 4PBTA 3UQYS 2EZ4A 4GYJA 9MHTA 2QUIA 4AY5A 3CCCA 3IBYA 1YU9A 2WZDA 3HEMA 2PLAA 5KYVA 1ZNZA 4NEHB 1OWNA 3UK0A 3VU9A 4RO0A 4PAGA 4WH0A 4M0PA 4BNUA 1Z6AA 2OQIA 3CNOA 1V8PA 3S2ZA 1W48A 4IGAA 3OEED 3ZWDA 2E4YA 1CY7A 3BD8A 2OFFA 1DBSA 4FYJA 3WMEA 3HY6A 3CZQA 1D2GA 4CIBA 5ITSA 1BDMA 1C4OA 3WDMA 3K5WA 4ZQFA 4HK4A 3IODA 1R0CA 3HS3A 3LXRA 3D4PA 1NF2A 1GY8A 3Q9UA 1IN1A 4A8HA 1UM9A 1A9PA 2VDRB 3OZBA 3P0IA 3Q7EA 5LZ5A 2B8WA 5CA0F 5HCIA 2CBZA 4GUAA 1NYRA 3MOGA 2OZEA 4P36A 1KZGB 4GKAA 1UF9A 2FX3A 2VQ6A 5DBFA 3B3QA 5GWXA 2BV3A 2HQOA 2Z56A 4DDKA 3TDKA 4URVR 4DLPA 3MWEA 3D8BA 4D3XA 3CXUA 2I1VB 3JQAB 3MINB 3PSHA 3Q9LA 2YV2A 4YP5A 4QEKA 3HA7A 4E88A 2ZANA 2BKXA 3ITNA 3GVHA 3LKZA 1OROA 1EXWA 2QR5A 3UA3A 5IYZB 2CL0X 2I4MA 5DM0A 5H68A 3C3YA 3Q2IA 4D9NA 3H2YA 1NOIA 2JAPA 1FVFA 3P0HA 5BW6B 4YMUA 1A2QA 1TD1A 4WXEA 5AT1A 4CHTA 3GI1A 5KYWA 4C05A 1SKAA 4E70A 3J7TA 5A4JA 4OGLA 4AYXA 3OQOA 3TRIA 1FMTA 1R8QA 2V55B 1OLSB 1L5FA 1QVAA 2ISCA 3GLSA 3KSUA 1TJYA 2BFDB 1PQPA 3Q6MA 2GEJA 1GG5A 3NBYC 2B8TA 3K8YA 3NM5A 3WK8A 3K9HA 1Q3TA 2FXIA 3PD1A 2H4FA 1NM5C 4IILA 1BN6A 1OX6A 5AVKA 4B75A 2VUTA 1ZGAA 1DX6A 2UZIR 5CDUA 4N41A 2P1DA 2VP2A 4HG2A 3VZBA 3ANMA 3N2LA 1PWZA 4FLEA 5GOZA 1M34A 2IK8A 2O0JA 1ZNQO 2P9HA 1H3FA 4N4AA 3EGCA 3RCBA 3RVDA 4Z2YA 1BWQA 1AKWA 4AZTA 2DPYA 2ZXEA 4PRKA 4C89A 2XZTA 1DWPA 4P7GA 3H9JA 1FBNA 1I2AA 1RKUA 2VH1A 2X9VA 3UHOA 3QELA 1T5SA 2C77A 3ABRB 2FJUA 1M2GA 3TLZA 5F33A 2IXGA 5JALA 3F4KA 3FM9A 4UOZA 1KZ4A 1BU8A 1XJCA 3G5AA 1N3LA 2GD6A 4FJ1A 1JDPA 1AXRA 3H2IA 4FFBB 4E5YA 4BVBA 1ZS9A 3DZJA 1JA1A 1LDGA 3HCAA 4C2BA 4M1TA 3NRCA 3OZGA 3RVBA 4O33A 3ER9A 3IUNA 1KERA 1NR7A 1G6HA 2FUCA 3EJ6A 3HNRA 3R20A 4QREA 4RAOA 3N1UA 4RZXA 3S29A 3SHOA 3W2EA 3WL3A 4L5AA 4JJIA 4Z1MD 5I4KA 2ON6A 5I9NA 5KC8A 2VNSA 3NHLA 5MFPA 3M70A 3D6NB 4ZXFA 4KNWA 2ZUVA 3L04A 3W5VA 3DMYA 4Y0NA 3EZ2A 5ISMA 2O23A 2FW1A 1UMCA 4RZQA 3H8VA 1TU3A 4D2IA 3D0OA 1POXA 5A4FS 4B3SB 5LA6B 3RFCA 3I9LA 2OBLA 2JKYA 5DZSA 2ZZNA 3C8HA 1OFVA 4H77A 5ERGB 3STHA 3L06A 2WWHA 5DNAA 5CVVA 3JY6A 4QSHA 2HMUA 4GLLA 5EEHA 1PTJA 1XWWA 3WIBA 1XIVA 3WBJA 3PX7A 4LV8B 4RIEA 1OI3A 5FFMA 4CTNA 2WPNA 3CLSC 3O95A 4CFYA 2WWRA 4BGUA 1KMIY 5IDQA 4PAWA 3HBNA 2QVBA 3UT5A 1Z68A 4A8JA 3ORFA 5L45A 3AETA 2JVKA 3X1ZA 3AHHA 2PK3A 4QD3A 3DR5A 5DK4A 4TWAA 3KETA 3FXAA 1AB5A 1KBZA 4L0QA 3P2MA 4JLPA 3TL6A 3D6UA 4LECA 4TWRA 1Y6QA 1OT5A 2OCDA 2CMKA 2IHBA 3O21A 2ZIXB 1ADYA 1OA0A 2RAFA 4U4AA 4XWWA 4MVYA 1G60A 5DGTA 3H9BA 1PUJA 4XLLA 1UOPA 4N40A 4ZCQA 4BKPA 4D9JA 4X84A 1JG6A 4E4RA 1ZGBA 2JHGA 5C4IA 2OCLA 5F1YA 2ATEA 4KU4A 3D2BA 2ZYHA 4F85A 1E5DA 2CUZA 3GXOA 4W1SA 1MDBA 3IHKA 1Q84A 3ANYB 3KAKA 4MPTA 2ZT5A 4G1VA 4LRTB 4XB2A 2BD0A 3W78A 4BL5A 1U2QA 3UATA 1Q0HA 3TX6A 2J3LA 1UEXC 2Z8ZA 1AF7A 1Y6JA 4MTLA 5ALTA 1JXOA 2JKVA 1Q5PA 2YYZA 4IJMA 4OL0A 2FOIA 1NIPA 2X58A 5I47A 1RZUA 1NC1A 1NBMA 1UT8A 3TSOA 3AVVA 3TB6A 2JGJA 1F3OA 1IM8A 1J9GA 3LLCA 4R05A 2D6FA 3H87A 1IUPA 5F78A 5EXEA 2OO3A 2QMZA 4WN9B 1UFRA 2Y6VA 3ZW9A 4QUKA 2I4NA 3DKIA 4C88A 4H27A 4F21A 5LBUA 2YDXA 2PO7A 2QG6A 2VHUA 3BZBA 4BTLA 1GNRA 1B76A 4IG4A 4LQCA 2JAUA 4U9IS 2H4ZA 3O83A 4AMBA 4C06A 5KTPA 1UBEA 3A7DA 1ZMTA 3FVVA 5AR1A 3WQHA 3BTSA 2ZWAA 4XWAA 4YA6A 4MJ3A 4MVWA 2RDMA 2RKOA 2X8BA 3W1VA 4OQNA 2HRDA 1KRWA 1W5SA 1UR5A 2NO1A 4V2UA 3VMMA 2AFIA 4TRJA 4JASB 3AUTA 4UREA 2UZAA 1MRSA 2DFTA 4Z1OA 2FZEA 2WIDA 2O2YA 3NX4A 3OZUA 2EGUA 3LUDA 2JIOA 1KO4A 5BR4A 3ZH9B 5TEVA 4YX9A 1D4OA 3BK1A 3DWFA 1YQEA 3VU9B 2WLTA 3KQPA 4M8NE 1TK3A 1I3LA 3I0MA 5EP4A 4F93B 2JI6A 3K1TA 5F9HA 3TLMA 3BRQA 3HDTA 4BVEA 2GFQA 1FSSA 3HLKA 4RKFA 3TNLA 2JBWA 4M89A 2VATA 4H0CA 2YV5A 1WSWA 1DBPA 1KAOA 3OIYA 3FYUC 1XTVA 3A4NA 5H1YA 1EESA 4I4IA 2AUNA 1IATA 3D5TA 3TD6A 4A6DA 3T1QA 4D7AA 2Q5IA 3HVKA 2R1UA 4PNZA 4XSHA 3OCXA 2O8CB 2ZI3A 2V7XA 3EG5A 4I1VA 3N39C 1JHAA 4YV7A 4WBNF 1HR0B 3RS7A 4ZCMA 3DMHA 4ZCLA 1XXHE 4FDTA 1BXKA 4RVGA 3JAKA 3LV8A 4PR0A 3W9SA 1DQNA 1BMDA 4I50F 3TUJC 2F67A 3R41A 3GJQA 2Z43A 3OQ6A 1HMYA 4CQLB 4LHXA 1EUCB 5FORA 1WDTA 2QAGA 1FRVA 1G21E 3GQBA 4INJA 4M0DA 3VMFA 3YASA 2JW5A 1CEXA 3RUCA 3TOCA 1NZFA 5JUWA 1TVKB 3C43A 4I55A 3P0EA 3U7JA 1PCXA 2VDLB 4BE7B 3G8AA 4WZAE 3HBAA 1KFKB 5JXJA 2ZSAA 2BMAA 2QG9A 5JD6A 5AUOB 2Q1XA 2VJLA 1U4NA 4IXTA 3AUUA 4ISBA 5CDFE 5IASA 4URZR 5G1NA 3QKRB 4LAFA 1YZ3A 1QV9A 1U8ZA 4GPZA 2ZE7A 2ZJFA 1MBZA 1GM5A 3IO5A 2WHYA 2I99A 3R3UA 2EZTA 3JPYA 5IBQA 1F8YA 3V7YA 1RHQA 1LGYA 1U7HA 3EFEA 3BWMA 3EC1A 1H0KA 1E8MA 4I5EA 4NQRA 3ZQJA 4DG5A 2WJ6A 4KGDA 4JXXA 2AR9A 3MN1A 4D80A 4EFLA 3DZ8A 3ANTA 2QSUA 4JJAA 5D3QA 1TQ4A 2Z58A 5FULA 5ENVA 4BKMA 3CLHA 3UWDA 5KJEA 3DH0A 3DLIA 1ACJA 2A67A 2VHYA 4HVLA 1EXDA 1GL6A 3ESBA 2Q4DA 1N2GA 1WEHA 5LNK6 3QYFA 1K27A 1P2UA 3PF8A 4K9QA 5JBIA 5JH7A 4PANA 1U80A 3KHUA 3ABIA 4ILKA 3TAXA 1Z6ZA 3T95A 1F8GA 2V54A 3UXMA 3ZEIA 3E35A 4DSNA 4D0SA 4M36A 3UJHA 2C2WA 4G65A 3ENKA 3NBZC 3WK6A 1W59A 4I6GA 2OCIA 5JCJD 3QSYA 1XZ8A 2BY4A 4RV5A 3BH7A 1OH8A 4JP8A 4RS3A 1ESMA 1X8XA 2JH9A 1X70A 1JV2B 3COSA 2XZPA 4G8BA 2OL4A 4GKVA 4URFA 4PO8A 5DLYA 1OHHA 3RU7A 3TG8A 3GUZA 4ND7A 3DLPX 1RRMA 1BOOA 1KMMA 5KKAA 3RH0A 3VHXA 2V6GA 2PGXA 4MRMA 4MKGA 4YFVA 1ND5A 4N47A 1O95C 4JT9A 4AKIA 4LOHA 3DV0B 3QF4A 1SM4A 1N4DA 4R2XA 1WPGA 4ND1A 4WZBA 3N75A 3O47A 4BO4A 2QT0A 1EM8A 1FJ2A 1HV8A 3FUVA 4MJ7A 4UU8A 1PK9A 5FHQA 4B6OA 4MVXA 1AHIA 2CXQA 5IWAB 2MTBA 3GJ3A 3RLFA 1I33A 4RX1A 1NTRA 2R2GA 3OH8A 4RTJA 4WKNA 2VAXA 3B70A 4QRIA 2JZOA 4QQRA 1Z18A 5CPBA 4PGFA 1ZHFA 1UBRS 1ZIDA 1PFKA 5GONA 1XMOB 1NG9A 4OI0A 3UMRA 3A4TA 1XRLA 2C2MA 2XCRB 3V1TC 4E0BA 1XZNA 4EMBA 5AD1A 4RJ2A 4DCJA 1X7ZB 1WOMA 1MOSA 3P27A 2IE8A 3WICA 1Z22A 4M0KA 3T1VA 3UT5B 4A8JB 3ESQA 1XJWA 4BNFA 1AQNA 1IRIA 4MUAA 3CV3A 3W5DA 2ACKA 1NFFA 1J06A 3GJTA 3HU5A 3PC4A 3KTDA 3QZUA 3TOVA 2ZEJA 5BN3A 1HQYE 1TZCA 4UC0A 5KYUB 1Z0KA 3UUGA 4IIJA 3V7NA 3LRXA 2D06A 5FL7D 4RZIA 1VSVA 5F52A 2HQ1A 4K9MA 2OV6A 1E0KA 4XWTA 2EEZA 1VP3A 3OM8A 2GWRA 3OX4A 1P5ZB 4LX8A 3COVA 2C2OA 2IIVA 3B52X 3M9XA 4WCFA 4ASUA 2ZSBA 4P3NA 4M1KA 5E7IA 2HM7A 1UBKS 3L8EA 5CXQA 1V47A 3DNPA 1NSTA 2G04A 2JFVA 3ZCQA 1V11A 4HR7A 4FYKA 3ZTTA 2VF4X 1RAEA 1SQGA 2QLBA 1DRKA 4EGCB 4F84A 4XARA 1QCCA 4F9EA 1KE1A 3LOQA 2V9PA 4OD0A 2C1ZA 3DBRA 3KOOA 4K9PA 1YHNA 2BJVA 1BMTA 1LSUA 2C1XA 1I8TA 1N0UA 4OMDA 2X7XA 2W90A 1M2HA 5I7FA 4L9RA 5EIAA 4KO1S 2GK3A 5FOSA 4WA7A 1Z36A 3GEGA 4MYCA 4Q7JB 1UP4A 1JFFB 1EFVA 4NONA 2ZSEA 3SE7A 4W5NA 2L69A 1CR4A 1DKQA 1XSEA 2ODPA 3E8XA 1KDOA 1SZCA 3JQ9A 3LBHA 5LNK1 2J46A 3BMCA 1L4NA 3COZA 4I2VA 4W9NC 4WL0A 1NVEA 3N8GA 4MAAA 5BXYA 2GXAA 2V4UA 4O2BA 3LKBA 1B0AA 1EH5A 4JN6B 3ZV3A 2I3ZA 3COYA 1C80A 4FBGA 1TU4A 5FV4A 1DC6A 3CLTD 3GJ4A 3EHDA 3ZW8A 3BS4A 2NTJA 3TVTA 1QQ7A 3DVAA 1J0AA 1E62A 1GGNA 4IH1A 1K4MA 3HUTA 1X77A 3NHWA 1WTAA 3OUUA 2G5CA 5D7NA 3VV2A 2A5YB 2VWHA 3GEDA 4DR7B 5B1EA 1FC0A 3P9NA 1JQ3A 3PHJA 5TE9A 2JFUA 1T4DA 2B1RA 1NDUA 5DBOA 2V0NA 3BREA 3THWB 1GPKA 2NTNA 4GI2A 2XMRA 4AG5A 1B2LA 1JEEA 4E5NA 2CLCX 2XWSA 1Z2DA 1VGVA 5AJZA 3V1YA 1CF4A 1TIKA 1HBJA 1D04A 2ZR7A 3FYUB 4PLZA 4PGAA 5EVCA 1F2UB 3S68A 1TTTA 1Q92A 2BUAA 5FF9A 1KH2A 4PIPA 1IK6A 4Z9XA 3H0KA 4HJRA 1WW8A 2E1RA 4IOLA 1C7QA 2C5BA 3MWDB 4H6PA 1G9SA 4PU0A 2J4CA 4YJ3A 5T6BA 4YRBA 3BXXA 2EBWA 1QTIA 4CLOA 3IT0A 4OMCA 4C3ZA 5K20A 3T5DA 4F1JA 4ATNA 2I2FA 3TGWA 1FU8A 5EZ6B 1VL6A 1KY4A 2AFHE 1Y3FE 1Y5RA 3OA2A 2MOKA 2OZVA 1VE5A 1Z3IX 3KX2A 4IHKA 4PM4A 4EUHA 3RVSA 4FQ8A 4U1RA 2IS2A 4PTZA 2QJRA 3FSEA 1SURA 3EXIA 1LZKA 2ZCVA 3B6JA 2BE9A 2NIPA 2I0FA 4FXOA 4RKRA 4J2HA 1JSXA 1WWKA 3LF1A 1KQFA 3RU3A 3SJ7A 3EVCA 4RMNA 2ZWPA 2JHFA 1WL8A 4QT4A 3E61A 2QIPA 3BAZA 2A9QA 1NJSA 3HVIA 3PNYA 3MTAA 4WCFC 3LGAA 5C34B 4XVCA 1JEQA 3DCJA 4KIGA 4ZI3A 1T1JA 2IZ0A 4MCAA 3BXFA 3ZX5A 1NMQA 3TYXA 3RYCA 3R6DA 3BRSA 3R2JA 1EFPA 3FPKA 1JJFA 4M4SA 1SCKA 3HDVA 1YO6A 1PUIA 1OF1A 4XUDA 2Q2NA 1JDJA 1UP6A 5AKHA 1M5RA 2TYSB 2BI7A 2AOVA 3QKRA 5SZIA 3AGQA 5AKEA 1UPCA 4YCLA 3ZXYA 4EG8A 1NQXA 4RCVA 4BMDA 3E6AA 4A15A 2F4NA 3O9ZA 1P62B 4HATA 4ZDWA 3C8DA 2C2YA 1XLUA 3KOZA 1L4UA 1BH2A 1U0EA 4F92B 4GYKA 4YRAA 4EI9A 2BMJA 1MA3A 4UHDA 4P0PB 4KLRA 2WC1A 1UXHA 4QGGA 4HTFA 5DYNA 1YBMA 4CKEB 5MN6A 1UBUS 1TVEA 2GN4A 1ICIA 5J2TF 4B35A 1MR3F 1HNZB 3ZWMA 2DXIA 4XA8A 2EJTA 3OQMA 2AH5A 4JR1A 4TZKA 1VRVA 1XDWA 5DH9A 5IJ0A 2DSNA 4MR8A 2Z3ZA 4KR9A 5IJ9B 5CHEA 1CJKC 4BWFB 4OP2A 4XM0A 3A4MA 2OA0A 3OOEA 4XR9A 5MGBA 1ZJZA 3H4IA 4EEZA 2XMCA 5IH7A 2FETA 5L3SA 1DPFA 1PZHA 1ISPA 5IAEA 1N2XA 3TMAA 1JEOA 2Z2YA 3EDYA 4ICIA 4WFIA 4CM4A 1U1GA 3TTWA 1XNRB 1GRVA 3SS9X 5BOSB 4V0QA 3AI3A 5DTMA 1X1BA 1E60A 1U7OA 1R6XA 3A14A 3LT4A 1XNQB 5DK6A 1WXHA 3MQ4A 1H4VB 3NALA 5E2AA 3UHJA 2J7PD 3QWIA 4JBWA 5CCBA 5CD9A 1GJRA 4ZVTA 1JYFA 2PUTA 3H84A 4R8SA 2ZATA 4AN0A 1N6LA 2G71A 1I2MA 1Y48E 3UV7A 1I5EA 5FWNA 1F0PA 1U4OA 4OLHA 4Y2SA 2BJHA 3P4XA 4G0ZA 3RABA 5FOQA 1ECCA 2VHJA 1RMTA 2LBPA 3LUCA 2ZRHA 1R50A 3E8SA 3B6MA 3HXLA 4BZPA 3W6UA 1XNGA 2GTIA 3VZQA 5IXJA 3MRVA 2QY9A 4NWIA 4QZVA 1YL6A 3DHNA 2R6CA 3P4UA 5KAPA 4IINA 1XC7A 4ACAA 1GADO 3FVTA 3FNIA 5TMEA 1O97C 2PD3A 1I94B 4D8XA 1QQAA 4XEHA 3TNJA 1HURA 4JB8A 3CVJA 4W5JA 2Z6VA 2PTHA 3V97A 1DFHA 1MRZA 3PT9A 1LPSA 1PL6A 1N7GA 1NBMD 4NJOA 5JLAA 4QUAA 4MVJF 3SIXA 1GAJA 4L1KA 4LY9A 3ZLJA 1KEWA 3FPGA 3N8KA 1Z0UA 2XXAA 1GQ2A 4MUKA 5EE9A 5A3VA 4LE2A 2JCSA 4GZ5A 1ULZA 2DQSA 2QRMA 3ZEAA 1NXWA 3V4FA 4OXQA 2RB5A 2YZNA 2IZ7A 1IG0A 4DHEA 2JCXA 1G8FA 4OXXA 3EH1A 4UHEA 2YMQA 3TSZA 1I2CA 4C0WA 4H60A 2VVTA 5BN5B 3I3SR 4RETA 4XXHA 4IIDA 4E15A 4DIOA 5JFGA 2VDOB 5BPHA 5MFZA 1CVRA 3EC2A 3V4SA 2DB3A 4Q1FA 1OH5A 1RHKA 1TT5B 1SR8A 3QBJA 3GN2A 4J49A 3B48A 2PSEA 1J07A 2W6QA 3ICEA 1NQUA 4MB6A 3KO8A 1ULHA 1GRQA 3AHEA 3IEPA 4R2IA 1SH7A 2X4LA 4XSVA 5GZ1A 1KETA 1JBEA 3AR4A 1F5NA 1THMA 3DZIA 1VPEA 1QDLB 1QIDA 1ZGHA 2XB2A 1HGXA 4OLFA 1E77A 1LPPA 2HPAA 3NEJA 4WXMA 2ILVA 3UK2A 1Z5UA 4P82A 2C7PA 1XPRA 5IKMA 3B1ZA 4JFRA 4JOSA 4MQBA 4XWGA 2C2KA 1EINA 4ALMA 3TFWA 3JSAA 4YUXA 1V2GA 2RHTA 4A7PA 4X63A 5JXGA 1QTQA 1U3CA 4WNAA 5I51A 2I66A 2GNPA 5TX7A 1V1MA 1JH9A 2O20A 4HO1X 5KNDA 4CG0A 3GK3A 3I5AA 2H7YA 4FE3A 4UHHA 3WDKA 4FM9A 3CEPB 4D74A 1GHTA 4HGNA 4L74A 1RC1A 1GPBA 1T9GR 1WPQA 4LOIA 2R25B 3CB4A 1NNI1 2QQ0A 2R6R1 2DUMA 2H1HA 3AERB 3CGWA 3FDJA 4I8IA 3CGGA 4NG4A 4QATA 3VHLB 2ZAIA 3GGOA 4ZCTA 1VPWA 2FR0A 1R4AA 4F9FA 4WOJA 4BQIA 3PC2A 1KZHA 2Y1DA 3HN7A 1L0BA 5E8RA 2JLYA 3CMMA 1HXHA 2LP4Y 2EP8A 2LVBA 3I0ZA 3RVLA 3UTDA 5B1DA 4DNQA 2YFKA 4MINA 4YGYA 2Q6IA 1XK6A 2Z5GA 3MMZA 4K88A 3SJZA 3DDOA 3T5CA 1DOAA 2YXLA 5ILOA 1JIIA 2IP1A 3EGXA 1NLFA 4Z4CA 1SKYB 3EIFA 3RIHA 5IZCC 3BL6A 2YHIB 1N6IA 2OMKA 1M33A 3GYGA 4LRQA 2R7NA 4AMUA 5BN1A 1GRRA 3EHEA 4NKRA 5H7XA 3VR3D 4BJ5A 4Q9DA 1PJQA 2BFBA 2QSJA 3ZU3A 1TK2A 4KQ1A 5CK5A 3OF5A 3U60B 4UUOA 4Z1MA 1OYOA 1DQPA 2JHPA 4X54A 3OVMA 1ZOLA 3RKUA 1YT5A 3RS8A 2SHKA 5GJCA 3JQRA 1HYQA 3EAGA 4JVMA 1L8LA 1XHEA 2H8GA 2V74B 1CUIA 1OI2A 3W5CA 2BFDA 4P7FA 2FZGA 3LOPA 2WZQA 5FO0A 1ZUD1 1RWWA 5H9VA 4X41A 1IONA 1A9OA 4LRXA 1G2PA 3K7EA 1GCUA 3NC0C 3LIIA 2VKQA 4X8OA 4F12A 3GLTA 5CJJA 1E1KA 3A9UA 3QPBA 1ZVJA 4NBKA 4WVFA 3U6KA 4MKZA 2FPWA 1DARA 2NV6A 4O2RA 4K2HA 3U6BA 1BDIA 1AB6A 1ISHA 1DCMA 1USIA 3ELYA 2IL1A 3CHYA 1OGIA 3K35A 4YRZA 2K4MA 3P19A 3PEYA 4KR3A 4FYXA 4P0QB 4F4FA 5JXIA 4C0BA 1EVEA 1E1RA 4QFDA 3MWYW 3GT3A 3P9QA 5CT5A 1K0FA 4X6UA 3ZV6A 1WMFA 5CR9A 4D9KA 5C8YB 3NP9A 1M73E 1XRJA 1XZKA 4GECA 2WABA 1HL3A 1ULUA 3KHTA 3TNFA 2Y77A 2H3EA 1P2DA 2VP4A 1VLJA 3FDXA 3IAXA 4QYMA 4RKYA 3T9CA 5HKKD 5JSYA 3MS4A 1CYDA 2PG3A 1DMRA 1RKVA 1Y3BE 2FMHA 2J08A 2XXBA 3NKVA 3F7MA 3LDGA 3CF0A 1GUDA 3E7FA 1ZUHA 2WTMA 1JJBA 1VCIA 4XX0B 4AX4A 4D41A 2LWIA 2P1ZA 3LA6A 3G9XA 4ESEA 3GDWA 1IJFA 1Q1ZA 5J4VA 1BXGA 4PHFA 3FR8A 1L7NA 4G36A 1OTXA 4PZCA 5L8VA 4MGEA 3OX2A 3WLTA 3EVZA 1U04A 2Z5FA 2HDOA 4BBZA 2IPOA 4NX2A 1Y1SA 4HWOA 1XCBA 2M6KA 4YV2A 3RYCB 1IVSA 3EZ7A 4JLDA 4M3NA 3S28A 5FBLB 1J1IA 3A1UA 3QI7A 1H1TA 4NCNA 2PUEA 4JK3A 1ZONA 1U1DA 2F17A 3DULA 1RJEA 2KJQA 1Z4NA 3KDSE 3E81A 5IFLA 1JXQA 3MTIA 4HP8A 2GO7A 3RFVA 1VQ1A 1RZVA 1X42A 5D85A 4WW0A 1AKUA 3EA0A 2J67A 3SYKA 4EJSB 4QQFA 4V0KA 1TZBA 4DPKA 3UCEA 5ALWA 5JYCA 1XTRA 1LLDA 4ZGWA 5JWOA 4B81A 4JA2A 4NJMB 4MQ4A 2D7CA 2Z9DA 5IKOA 4P81A 1ISSA 3JQQA 2FSVA 3QSGA 1J2TA 4QYWA 2PFKA 3K92A 4EKGA 2GR9A 2HUPA 2AWNA 1KKMA 1IU9A 2P2SA 3AONB 1J2UA 1SWWA 2WJIA 2YJ6A 3IV7A 4NYJR 1YB6A 4D6PA 3HU3A 1OXBB 3AW9A 3FKSA 3QUAA 3T41A 1AG9A 1Z08A 3MSCA 3NETA 2VLIA 1A71A 4RMIA 5CNKA 5A62A 4GL2A 2K5UA 5J1TB 4TOIA 5IC4A 2EX0A 2XODA 1M6WA 1ZR4A 4CXMA 1EFAA 3Q3JB 4LMAA 4U02A 4Y8VA 5ALZA 2WWIA 2AOUB 1VCMA 4BO6A 1S4MA 1G18A 1Z2PX 1FCJA 1UC8A 2J9ZB 2O52A 2QAGB 2QW1A 1ZIXA 2R62A 3C3DA 3GQBB 3TKLA 3NIGB 4GD3Q 4DBLC 1KZ1A 2JHCA 5A5GA 5ICFA 1VI6A 5BSTA 4IJWA 1EFLA 3KVRA 1YV9A 2FSHA 2YS7A 1YACA 5SZHB 3EEFA 4TXMA 2XWQA 4UHFA 2GZ1A 1E89A 2NM0A 1Z4QA 2OYSA 3FPSA 4Q24A 4NNOA 2AB0A 4N6GA 4QUDA 3QY9A 5AM5A 4B9EA 2AA3A 4XM2A 3BSWA 3B51X 3HB0A 5AVZA 5J3JA 4V0SA 4DLRA 2R87A 4I6EA 1U02A 3MM4A 1QFMA 4FR2A 3F78A 4G2TA 1N5OX 1YBHA 5JFTA 3CX4A 3VYTB 4FIDA 1VJ1A 1NNEA 3ABQB 1JFFA 4EZEA 4IF6A 2WWTA 2YWJA 1M6HA 2RC5A 5H16A 4H31A 2O7VA 3N2KA 1PX0A 1Z5VA 2W7TA 2C1EA 3QE0A 3NUZA 4HQLA 2B6HA 4N6OA 4QBTA 3KQOA 4U7PB 1V6AA 4ZOLA 3UJAA 4DB4A 2E4WA 1FFDA 2I1LA 3UMFA 4GMDA 4G24A 2EHJA 1GA6A 4UFNA 5ECYA 1NOJA 2CJYA 2OV1A 5C8ZA 4WLFA 2VIIA 2AUTA 2FUEA 3LPNA 1IBCA 1P2BA 4PCLA 5GTDA 4NULA 3WAJA 1XVVA 2QPAA 1KIAA 2BKAA 2RG7A 2FK7A 3KLBA 2WJVA 3AT1A 4DN6A 2F90A 3KLPX 1EJ6A 2P75A 3GFSA 4JYPA 2QVLA 3GAFA 1NQ5A 3GMDA 4EEXA 3MIZA 4F2GA 1V48A 1IPEA 4ZAXA 2LKCA 2AN3A 2ERXA 2LIPA 3SYNA 4UMFA 3WFIA 1RE1A 1Z7YA 2E6KA 4MMZB 4N1AA 4CCAA 5IWCA 1E7MA 5K0BA 1NBWB 1TTHA 2E0IA 1G8JA 1KY5A 1G4UR 2NZ2A 3CVOA 4M6WB 5CU7A 3DAGA 4FOTA 3ON5A 4BATA 1T2CA 4XSGA 2KHZA 2QJTA 4YVFA 3HNPA 4BB0A 4D45A 5CT8A 2ZJ0A 3L5OA 1FLNA 3AR8A 3V3KA 1Z2OX 2BT4A 5FPKA 5LQUA 4ZZ2A 2GBLC 3VV3A 4R6WA 1FFXB 1XZMA 2GEFA 5SV2A 1YB7A 2IYFA 2SCUA 2BEJA 1NA5A 1RYFA 3SXJA 3JR3A 1JILA 2AMYA 2Q1SA 1KC1A 1P4RA 2P3OA 3TS1A 1S2DA 4NABA 2J0EA 2QAIA 3AIKA 3NH6A 4I0WB 1V8BA 4WXHA 3GFFA 4DIKA 2DRIA 3RHTA 1W2WB 2X8WA 3A3OA 3ROPA 3ZHVA 3W90A 4B73A 3EQ8A 1M1XB 3MNFA 1H1LB 1EGQA 1N2SA 2BEVB 2I6QA 3IVXA 4GI5A 1I7DA 2HAEA 3TDMA 3DDNA 3SQLA 3V4PB 2RBKA 4QDXA 3WSVA 1QCZA 5IG2A 1MW8X 1EWQA 5JY1A 1K6XA 4OJTA 4CL0A 1EBBA 3RVPA 2QG4A 3ILSA 4RVSA 3AL2A 3OKPA 4K28A 3WIUA 3ZCTA 4WZBB 1ZWKA 1U9ZA 2CEKA 2OG2A 3D7NA 3K0BA 2VCEA 4PLYA 3FOCA 4PQRA 4DJAA 1EVIA 1OBFO 1U8XX 2X5NA 3M6XA 4PC7A 1QP0A 3G7UA 3ET4A 2IHUA 4FCVA 3L02A 3RKRA 3UWKA 1YDHA 4IVRA 2IF2A 3TQRA 1KVUA 2QTAA 3VQTA 1T2FA 2HRBA 1T3TA 4ARIA 1JHRA 1S89A 2HMTA 4IJQA 1C3JA 1DAKA 4IKOA 1T6ZA 4HCJA 5C4GB 2GVDC 3DE1X 5LZ7A 4DCPA 1CD5A 3IPXA 4HWGA 4R1SA 1C0KA 1QIGA 2BKLA 2DR3A 4LKOA 2PJUA 4YJFA 4NCIA 3HDYA 4W7IA 4CV2A 3KV1A 2XYRA 3JASB 3PHGA 2WG0A 3WIVA 2HT1A 1Z47A 1Z34A 3GFVA 1SQFA 4RQBA 3NKLA 3NOOA 2CW5A 5TV2A 3CKMA 3Q87B 4YXWA 4DEXA 3Q72A 2P6MA 1JZTA 1Z2EA 2G25A 4HADA 2NAPA 1KIFA 3IHTA 1AX9A 1LK0A 1N0HA 3G0GA 4UVDA 3U1TA 1YCGA 3VVLA 4C07A 3G2KA 4YP0A 2EWVA 3RK1A 4EHFA 4HYTA 5FWYA 3GCZA 3H13A 1R6TA 1Y82A 4R3NA 1I6KA 2J5BA 5ARDA 1NHWA 3G0CA 4XW2A 3A7EA 4RLHA 5LN1A 3S99A 4HUQB 2BBSA 1NN3A 3K3PA 4WK2B 1T9GS 1GD1O 3SQMA 5CFNA 1JFSA 1DQSA 2Q0XA 2VK1A 3CFYA 1Y1TA 4RDCA 1EA5A 3T9EA 2H0RA 2RKWA 4FIZA 2WTBA 1Q95A 1UQTA 2QW0X 4YH1A 3LH5A 3E82A 1OXSC 1SD5A 3AM4A 5H82A 5BWMA 3WG9A 3IESA 3S8YA 3A6KA 1MEJA 1GA4A 1SVUA 3GH1A 4ERXA 3SIRA 5IK2D 3O8QA 2DG2A 2M6RA 4JBIA 4B34A 4CM4B 4G0XA 2YZKA 3OBIA 4JBNA 1ZM9A 3PDWA 1HPLA 1P4GA 3KB6A 3PC7A 3UGTA 3TJRA 1KR5A 3MJ4A 3OJFA 1GUYA 5FOXA 3JQCA 3PZBA 3QELB 4RPCA 2YQ4A 1MP0A 3H6KA 3P9PA 2O8CA 1RWVA 1TD9A 2ZTSA 4ZANA 2C4NA 2NZUG 3PITA 2VZ0A 4BO2A 2ZRKA 3WR5A 3C39A 1X0XA 3B13B 4CQJA 1KOFA 3MHPA 3RRFA 3QVMA 3GJSA 4I1YA 2Q3BA 2HFKA 3AGPA 2FKAA 4NZMA 1YOVB 2YNMC 1ENOA 4PIMA 1TAQA 3FOZA 3WLKX 1MN6A 2IUUA 3PKIA 2XTMA 2FB9A 4DUGD 2QA5A 1NQVA 3NATA 3H97A 5ADVA 2AEJA 5FNVB 1N78A 2O5RA 4BJ1A 2DR2A 2EKZA 3VNAA 2QM7A 5AXCA 4DA9A 3I3OA 3G0BA 3OLWA 1JB1A 4JITA 3U3ZA 1XN1A 4I5GA 4I7EA 3CVWA 3NNNA 1DX4A 4RPHA 1IZ9A 5LYJA 3VNSA 1E79D 4DQDA 4NCBA 4R98A 1OZGA 3CURA 3G59A 3GLRA 4YBRA 4YCNA 1I3CA 2I3GA 1L4YA 2F8TA 1QFJA 1Y7PA 4ZQHA 3VPHA 1YZKA 2CFTA 3RV3A 4L08A 2DT5A 3PLNA 2F3QA 4BV8A 5DCUA 4KPEC 1NRXA 3R5KA 2XOEA 3MWEB 3I9JA 4MRPA 3E2MA 4N82A 3MWKA 5CYPA 1UANA 4Q18A 3E48A 4P98A 4EBFA 4EUKA 2GDZA 4IUDS 2UU9B 1SC4A 2C9DA 2RGAA 2CT8A 3KG2A 1IHOA 1P9LA 2BEWB 1FRNA 3O3MB 3ESXA 5BSHA 1JHVA 1YUNA 1U3WA 4IV8A 4B3FX 4BLPA 2X0KA 4R1OA 4R2MA 3K70C 4L15A 4TTAA 1V4NA 2FLWA 1R0LA 2OUKA 2Z8YA 1EVYA 1RTKA 2AXNA 4L50A 1UL1X 3KZVA 1D6MA 2HWYA 3H18A 5IVIA 4C2AA 1KDPA 2EOAA 2XF2A 2O3RA 1D2MA 2ZETA 3ADBA 3M89A 3OICA 5IEJA 1XKLA 3DOCA 1A4UA 1RHMA 1TLTA 3E4DA 3WGUA 1L1EA 4URUR 2D5BA 1CG6A 4INAA 4TT8A 3A1WA 1TK9A 3IELA 2O2SA 4R7ZA 4EMTA 2P2GA 3LLUA 4XLZA 3ENQA 3ZDRA 2I6UA 4E4YA 3AF0A 1BX3A 2WK1A 2NU8A 2PS9A 3T4XA 3IJPA 1XEWX 1KJZA 2ZYGA 4JHXA 3HL4A 2FP3A 1G2IA 1NPDA 3F7TA 4RHFA 2EJUA 3G2HA 4F97A 3PB3A 5FWAA 4BO0A 3DBIA 5LQCA 4BAUA 2GJSA 2W2XA 3L46A 5LP6C 2G0NA 1N2CB 1OBVA 4RUKA 1Z5ZA 5AVXA 5KO2A 4RKWA 5JS7A 3IKTA 4Q82A 4FU0A 1DI0A 3O26A 1VM6A 1E6EA 1PEYA 2EJVA 4OATA 2CMHA 3OU6A 4EPTA 5INTA 1RJDA 3FNBA 5BNWA 3MJHA 4OFXA 5KS2A 2CNDA 2HCBA 4B44A 4Z53A 2PL5A 1MV8A 3HABA 5E9QA 5CX4A 4DOMA 4BKRA 2BAGA 2GD2A 1YE8A 1DJPA 1UC9A 2XECA 3IOMA 1VLVA 4BO8A 1Q7CA 2JCGA 5I7VA 2BELA 2PWPA 3FIJA 4OU4A 2L17A 3II6X 4W5RA 1CY1A 4ARCA 3MCZA 3O8LA 5LMCA 1JR3D 3C3JA 4UEWA 4B6EA 2F8LA 4WD3A 1JQ5A 4YTEA 3SE0A 5A3SA 2PS3A 3NYWA 4WOKA 3EZFA 1NW9B 1OXVA 4WT7A 5IKPA 5K6TA 5LR6A 2PO5A 3DGEC 4QE3A 1BCRB 4L4YA 3PQDA 5ALRA 4YQFA 4ZU3A 1ILEA 1HM5A 5K8JB 4RTOA 5ELXA 2JH8A 3U1VA 2JDIA 2P5UA 1XDSA 4X7MA 5ITZB 1P1FA 2BFFA 4D3YA 1HSZA 2C7GA 1PD1A 3IPCA 4H9GA 4Y3UA 5CB4B 3ZIUA 4MI6A 4ZHSA 2GHIA 1BHJA 3OPVA 2G6TA 2X2FA 3HP4A 2EFDB 5AJXA 4CTKA 4DA7A 3LE8A 3I53A 4NSNA 4FX2A 4NTZA 1M83A 4ZVNA 5BN3B 721PA 5DP2A 2GHRA 4TT3A 1BJTA 3OURA 2GLXA 3OG9A 3G0DA 4JMPA 3IUJA 3KQSA 3VKVA 4Q4CA 5EHIA 3DO6A 3EF1A 3WQSB 4C6TB 4TVBA 5KOYA 4X64B 3KSBC 1PV1A 3HADA 3P8ZA 2JK0A 3SEAA 3E84A 4FFWA 4LSWA 3P2OA 4AUNA 4ZI7B 1KZ7B 2G82A 1VL1A 4H7HA 6NULA 4YB8A 3RQIA 2PFSA 2HC9A 3SZMA 3H19A 4A5OA 3L7OA 4E2FA 5CBKA 1XR3A 1PVOA 4Q47A 2HDWA 1P4AA 5ALOA 5A7HA 4AJLA 2OD7A 1DV2A 4XD2A 5GGYA 3DEHA 4BRWA 1GKLA 1MORA 3GGSA 2IELA 4BNDB 5F77A 2QL9A 4M8IA 4ZYVA 2UUAB 5ALYA 5CFMA 3UG7A 1BKYA 3AKEA 3OO1A 4O5AA 5KNLA 3B82A 4KWEA 4QKQA 3GZJA 2F8MA 3H9CA 1XVTA 2GXUA 3JS5A 1T26A 3N76A 4R84A 4RIIA 2NG1A 1W5FA 4RMHA 3GARA 4GMGA 5LIRA 2LIVA 1C1XB 1KFEB 5JE8A 2ZG6A 1G8MA 2IODA 1XL1A 2KLBA 1PL8A 2X5XA 4QPPA 4B82A 1O08A 2JRCA 4G0OA 2VT2A 1ULTA 2Z4TA 3JYNA 2GZAA 3Q3HA 5JMPA 5JD3A 3UMYA 3R7SA 2QRVA 2MSWA 4R6XA 2FUG1 3MHTA 1A1SA 4JKYA 3O3OB 1IJEA 3C3EA 4M8LA 3VNQA 4Y1FA 2H1OA 5DT9A 2P9JA 3SVTA 4F4JA 1ZGCA 1P4JA 4YGXB 1DRUA 3G88A 1XCLA 2QTFA 3IMKA 1KVQA 2V5AA 3M6FA 4HDMA 3S2UA 3TQFA 4EG1A 4F5YA 4YT4A 1LQUA 2GHQA 2FW6A 2P67A 4OG2A 1JA0A 1WUTA 1G8YA 5DNYB 4ZO9A 2ZAYA 1PS9A 1RE0A 4BZXA 1XA3A 2PA0A 3ZYCA 2QTHA 2WG2A 3AF2A 1VI2A 2X77A 1X38A 2J9FA 5D87A 4S0ZA 1GQOA 4HY3A 1G20E 2C20A 5H5JA 4EOGA 1OW3B 1O8BA 1ECLA 1XQ9A 2A78A 3FROA 4PSKA 1M0EA 3T7IA 1YB1A 2VP5A 2A1TR 3PJFA 2D2FA 1V1RA 2RGEA 4L8WB 2O57A 1E96A 3VTZA 3ZE6A 3JQEA 4BO1A 2NUAA 4YNBA 4GHWA 4YEDA 2HU7A 1DFIA 5FBRB 3SAJA 5CNJA 3L0SA 4BGEA 5SY9A 2XD9A 4DS3A 3D4IA 4RGBA 1QGYA 5DASA 1NI4B 3AU8A 2GBLA 3P97A 1O3YA 3N7TA 1JUDA 3QYAA 1XNJA 3G85A 4KTVE 3HLYA 1EHIA 1SBIA 4J0GA 3W5AA 1Q50A 3ZI4A 3I4CA 1PYOA 5I7WA 1RQRA 3I2YX 1G7TA 1A9XB 3O6VA 4ROTA 3R23A 4OA8A 4XPIA 1ZRSA 2FW7A 2QTGA 5ALNA 4GKJB 2QTWB 3EAFA 4J3FA 2VEOA 1RQ7A 3KZMA 3QEBZ 3CINA 1B00A 1OLXB 2QQEA 1A72A 2R65A 4EA6A 1W85A 1I2DA 2E49A 1TM4E 2HLDD 2YJTD 3BGDA 2YBEA 3DWIA 2C9CA 2VPPA 4FTWA 3HO1A 3RC9A 4TL8A 2XDWA 4QTXA 3BKWA 4XYMA 3DMPA 4RSHA 1GU1A 3ZU6A 3H1GA 2OYCA 3PRJA 2XY4A 1UK7A 4L16A 1E1RD 3A10A 4GQAA 3G2QA 4GSKA 5C31A 3VPCA 3FBTA 4LTMA 2RGYA 3HJCA 4HWKA 4EZIA 6REQA 2ARKA 5TC4A 5HXAA 2PUHA 1R6DA 1VIAA 1SBCA 2R66A 1XE3A 1RI3A 1XP8A 4C3UA 1ECBA 5FOTA 1AQYA 1VCOA 2FPKA 3D0KA 2J7KA 1YH3A 4PHCA 3WADA 4ARZA 2G40A 4FQ5A 4COKA 4FI3F 2WJ3A 2KM1A 4PS0A 4AWAA 3RSOA 1Z6GA 1KYYA 2YNMA 4LKRA 4UBLA 1IQRA 1ZH0A 2VWQA 4J1NA 1IUNA 3R0ZA 4NOLA 1U99A 5BVHB 4LDRA 2IXEA 3WGQA 4KSCA 1GPNA 1QHHA 1NKTA 1B6TA 1ONOA 1SGWA 3AM5A 4MW2A 3OD5A 1I7LA 1W0JD 3SKXA 3WZMA 5JJ5A 3FTCA 2EJBA 2HU2A 2FGKA 2IYTA 4L8VA 2BZSA 1GL3A 2C0CA 3BEOA 3QWBA 3DOIA 2YZ7A 4X7RA 2OQ2A 3R7DA 4BLRA 2YTZA 3H5AA 1R2QA 3D8RA 3TSAA 1O4WA 1PZMA 4Z7JA 1OLUB 3K4HA 4EEKA 1LBTA 2XADA 3GVXA 1NP3A 1LBIA 3KAJA 2F3UA 4FFOA 1QE3A 1HRKA 4BFVA 1EFPB 3SEQA 3P9YA 3SXPA 5JAQA 1G3IA 1OKKA 5IK2A 3VKHA 4ZI7A 4UNPA 3VI4B 2W83A 3IIIA 5KU7A 1TF5A 3R6WA 1RFGE 4KV7A 3DL2A 3QX9A 2B83A 2GT1A 2IZ6A 4IP0A 3EZ6A 3O8RA 3A6PC 1L7RA 4JODA 4TKMA 4EJ6A 1F2TB 2X23A 4DA8A 7REQB 3OIFA 3ZDAA 1W73A 1TYBE 2GESA 3A9SA 4ON9A 4WBSA 1CLEA 4XIFA 3NWPA 4MUYA 1RI2A 4DCNA 4LYEA 2OCBA 3GRCA 3OZAA 1T5LA 1CUBA 2BR3A 3KEGA 2XB6A 4MS4B 4O4JF 3CF2A 2ONYA 4QARA 4RSRA 4XFDA 4A6EA 4EGQA 3Q3CA 1DHRA 3EXIB 4MK4A 4PZDA 2EZ9A 3B1XA 4Y6QA 5IT4A 4B46A 4I9GA 2BFFB 2G80A 2LCQA 1DKNA 2D2EA 1M8JA 2DSTA 1QIFA 5F9FA 4YRLA 5K4GA 1EB8A 2QROA 2NZ8A 3Q3VA 2ONZA 4GGPA 4KFRA 2YN4A 3I5UA 5C3MA 1TQ8A 1CETA 3RNLA 5J59A 4A0RA 2ZTMA 3BJEA 4IUYA 3WKAA 1MTOA 2EW2A 2VAMA 3OIUA 3SHVA 2FWMX 4RTKA 5IARA 3LOUA 4P7KA 4CETA 3QX3A 2I91A 2A4MA 3OT1B 3LWDA 1WB9A 4IZ6A 1DV1A 2BM8A 3GLHB 2I5PO 1D5CA 1YWGO 1D8AA 2MU1A 3KAPA 5K2MA 5BUCA 3WWZA 1C8BA 4MUFA 2WF9A 4KPUB 1TJ4A 4EB0A 4F3CA 1Y7LA 1U7WA 1E0DA 3WYEA 1O94D 1D2AA 1L6RA 3VZSA 5LMNB 1RYEA 1XYVA 2VN8A 3VZPA 3HK2A 3ECCA 4V0LA 4IF4A 3GLFA 4C6RA 1W88B 1B41A 1J9ZA 1FTSA 2TRSB 3NEYA 4P4SB 3VSAA 4ARVA 1TUBA 2B4QA 2JIMA 4AS2A 4P53A 1SVKA 2ZWMA 1Q6YA 3IR7A 3Q15C 1LRJA 5B30A 4P3YA 1G20A 5CUQA 5T41A 5LSAA 4R83A 4ARSA 4MQMA 4UOQA 1UMKA 5CT9A 3WFJA 1WXGA 3DYVA 5A9RA 2GEVA 4DV1B 3WWDA 1ZBQA 4QOSA 4BVGA 1VC2A 1X1CA 3OQ1A 3BMCB 1TEXA 1CRZA 3W6ZA 1JLHA 1ZFNA 3OTOB 3JTEA 1PV2A 4EG3A 2PMEA 2B7BA 1W8IA 1DRWA 2HX1A 3AEQA 4ZRMA 1NWCA 1TFRA 3BTVA 3WGTA 5I7AA 2BF7A 3LCCA 3ETJA 2HLHA 2D5CA 4JUCA 4QTYA 1EJ2A 4RFLA 3LMKA 3I76A 3DLHA 5A7FA 5I7UA 3I4FA 1P73A 1T1GA 3M4ZA 3QVTA 3RS0A 2MT9A 1TMKA 1P45A 4DV2B 1QHNA 2IEAA 2HZ7A 1WULS 2IQ5A 3ER6A 4DRXB 1ZW1A 4LF6B 2YJNA 3FUXA 2M98A 3WSWA 4GM0A 4B09A 2IF0A 4BUJA 2X5JO 1AM4D 2W2QA 4NQZA 2VUSA 4P3KA 2ZUDA 4G9BA 5TARA 4KITB 2DLCX 4F3YA 1ECPA 4DRYA 1R4MA 4J7AA 1V9LA 2GTPA 4MPJA 2JFWA 2VHCA 2ZRMA 1HLGA 3KPUA 2B92A 4RVNA 3SHTA 2QT9A 2GMWA 2I71A 2OZLA 4EY7A 2Z08A 1U6JA 3DYBA 5K7SA 1AQJA 1FQKA 1R5NA 1KY3A 2ZP1A 3QXXA 1OH7A 4NU6A 3DMFA 4I81A 3QIVA 5GJVC 1PSZA 1KMHA 3KAQA 2XLCA 5E0OA 4X24A 2YXNA 3D6MA 4MQEA 1BZYA 1ETUA 1CF2O 2P2DA 3WLLA 3SLKA 4BFXA 4U2CA 3ROTA 4OQ4A 3WP0A 1L5GB 4WLEA 2CXRA 3VHRA 1V43A 3ND6A 1B26A 3RTBA 1Q57A 4DIMA 1JHDA 2CEAA 1TKAA 1UADA 2V58A 4R1TA 4EARA 1FMCA 4N01A 4PNEA 4XYLA 2ES4A 1DU4A 5DKFA 5CLLA 3HN2A 2PJRA 1P4SA 1HYBA 4OHXA 2G8NA 5G0VA 4E07A 2ZJ2A 4BLTA 1AXEA 2A1UA 3LLSA 2ERYA 3I6BA 1JS1X 4DLWA 2CV1A 3WMGA 4C0XA 2WUGA 5DDIP 1AT1A 3KIPA 1A5ZA 1X7YB 2V4MA 4FGLA 4OJMX 2G67A 3RO7A 3WAKA 4D9IA 1LVHA 2CMFA 4HYQA 2FPIB 5A4DA 4D1YA 5KYWB 4BB9A 4C0LA 2XZOA 1J1UA 1ABEA 2Q29A 3KJHA 2KBEA 4WKPA 4QDUA 4AUEA 1R5OA 3ROMA 2H4YA 4YMGA 1OX4B 4X1KA 1EHCA 2YY5A 1WHSB 1D0IA 1AN0A 2JI7A 2YJZA 5SYMA 1E1NA 3ODPA 3H2KA 3KHKA 4XCXA 1JVNA 2VJMB 3PU6A 1EUDA 5C5IA 2HJRA 4HLDA 5TPZD 1LPAB 2BTQB 1WKCA 3WKCA 5J4KA 1TZJA 1QBGA 1T29A 1Z82A 4UDYX 1P1CA 4BNIA 2VSYA 3KUXA 4JI5B 2E5WA 4F3TA 2JD1A 3ZBPA 2VSOA 5IS2A 1GPLA 1IK4A 1OWOA 1BMFD 1QS0A 4LXTA 5D2CA 5IAGA 3T3GA 4Q0MA 4C20A 1MH9A 1T6NA 2WNIA 1HA3A 2ZJ6A 5CX1B 5HJ2A 4YP7A 3UAZA 4HJXA 1K86A 1BC5A 1L8XA 1M9NA 3PEUA 1ZK4A 1YQGA 4A4DA 4DB2A 2YMPA 4N0MA 1P1HA 3NAQA 2BFPA 4R16A 3VH2A 3VNBA 3X1KA 3VA7A 3AJRA 2L18A 3U3RA 4RMGA 3PXXA 4HUQA 2NO6A 3BZUA 3ZQKA 2D8MA 2OXRA 4TZ6A 5DGIA 4O4HF 5FBWB 4XGQA 2F1JA 1XQVA 1SVOA 3EJWA 4MS3B 4UKDA 3KJGA 4KP7A 3BC1A 5AKLA 1JG2A 1T4BA 3ND9A 5HKLA 1WNFA 2P9CA 2J5KA 3BQMB 3TBHA 4I4TA 2HPZA 4KJXA 1ZMXA 3VKFA 4FMPA 1FQWA 2XNDD 2D3TA 3OIVA 4X0EA 1KDYA 3B9QA 3HLTA 3RRXA 1GYRA 4M9RA 1JWAB 1WNTA 1IEQA 2OGWA 3C87A 4HOYA 2KW5A 2XB9A 4YJFB 4CQLA 3PQ2A 3MGCA 4AKGA 4BJHB 3VKWA 1IZ7A 3KQWA 2IZOA 4YMTA 1B43A 4U6QA 4EITA 4RTSA 1PEKE 1TYAE 4RKEA 3FPBA 1NUTA 5ALKA 4JJ6A 3UN1A 4D4LA 2AEMA 1KKUA 4MZDA 4O8CA 2XUAA 1NQOA 1OV6A 3CT6A 4D81A 4B3RB 3UANA 5JAZA 4OYYA 1MEOA 3ZYZA 2X2OA 3MPUA 4GWKA 3WMFA 2GB4A 2HDNB 4RY2A 4R8RA 1TT7A 4Q00A 4XI9A 2VCYA 4YJHB 3EA4A 1D03A 5KB3A 1PJ3A 2DHRA 4O4JA 2IHNA 1P2TA 5BUQA 2O9JA 2RHGB 4YJGB 2VDUE 3A37A 2HYDA 5H4HA 2LNDA 3IKJA 4IFEA 3ZTWA 3H2ZA 1RXVA 1E2PA 3E18A 2ONCA 3IPLA 4HGZA 3Q7TA 4RA9B 4NU5A 3NBKA 4D46A 3FSGD 5JAOA 2O54A 3MS7A 4G0MA 2J59A 1KJJA 3GPIA 1B2RA 4R51A 3HDQA 2W5UA 4OKSA 5DJ5A 3HCOA 4A8PA 3MBIA 4E30A 4EZBA 4LHWA 5IUKC 3QK7A 2LR0A 1L7XA 4Q1EA 1TTQB 3AR3A 2A5DA 4MW5A 1QSGA 2C2HA 4E6EA 1HG0A 4D9FA 3CZMA 1S3FA 4FFDA 2AR7A 3SZOA 3KB1A 4F1KA 2OVBA 2I6SA 4KUEA 4B9AA 1H66A 2NXEA 2IYVA 1VE6A 3W04A 5B2FA 2AUMA 2HLDA 3DFZA 1GNPA 3BVPA 1XZIA 3BG5A 3H11A 4U39A 4OHMA 5T64A 2VJQA 4W9RA 3MJEA 1Z06A 3NGLA 3W4KA 1XLWA 3USCS 1Q1BA 5FWXA 1O77A 2XNJA 2F1RA 2PKYX 3GZNB 1O87A 1E5VA 2HD4A 3B60A 1K8QA 1N8NA 4AS1A 3F5QA 1VGRA 1SQSA 4OYLA 3TQCA 2P77A 1F9EA 4ZYLA 1DAEA 1CUCA 4HTAA 1E4EB 2YV3A 4FFNA 3C1UA 4OLJA 2NZJA 1JB9A 2CMDA 3GLIA 2CV2A 1ZMBA 3EEQA 5ENZA 2VL7A 4YRTA 1IPFA 4EB8A 2QB5A 3CLKA 3EIUA 2NT4A 3PTAA 2Z5LA 4BO9A 5CXXA 2JIBA 2GKOA 1OOEA 4RELA 2QR3A 3Q0TA 4MYHA 1NULA 2PKXA 3W5IA 5F2OA 1LNZA 2EL7A 3RSGA 1OZAA 4E5SA 3TBFA 5KSOA 4ZT7A 5KDOA 2I2AA 1G6OA 2QL6A 2GEBA 5DWQA 4CM3A 2ALJA 3TGLA 4LDPA 3EMDA 4MIKA 3IDQA 4QSMA 5DCLA 4CIXA 1VZ3A 3T61A 3DL7A 4E5UA 1J1ZA 1IHUA 1L3BA 4CPDA 4EVSA 4IDOA 2GFHA 2O2CA 2PJDA 1BJRE 3D81A 1MGPA 4MW1A 1PAUA 3TPCA 3V33A 3M2PA 2BKVA 4Y6LA 4UW9A 2DBYA 4PSDA 5EJFA 3HWWA 5KVSA 3U44B 8AT1A 3REFA 5FKJA 3BHNA 4HDKA 2ZCJA 4BN0A 1XK7A 5G3YA 3EWNA 4MW9A 4NBNA 1QVWA 3LPAA 3O03A 1E2EA 1PQ4A 2GPTA 2ZT8A 3IOYA 3D6JA 3U3DA 1JSLA 1L4HA 1ZW6A 2FRXA 2BUCA 2BBOA 1P0FA 3C8ZA 3MUOA 5AJWA 4S12A 3S2EA 2WQ6A 3KOUA 5F98A 3Q11A 2R11A 1HYHA 3FX2A 4ND5A 1DC4A 2GJAA 4YROA 2KX7A 3FNRA 3X0DA 4EKNB 4JXZA 3IVMA 4ZMSA 1I6MA 3PNQA 4TS9A 4XDHA 4FPXA 1KARA 2O3QA 2FQXA 3B85A 5JNLA 1J33A 2AIRA 1VYVA 2XVYA 1M2VB 1KK2A 1VJDA 2R1TA 3HEAA 5AQ1A 4DNFA 1T0JB 5COAA 4DQKA 5JYEA 2JLQA 2YX1A 5FUQA 2VTBB 2OESA 2BGJA 1UXGA 1U1IA 1N1MA 1IRXA 3IP3A 1M3SA 1ZGZA 4AF6A 4OUDB 2ZI5A 1NJ5A 1BQ4A 4WCVA 4ITVA 1ORWA 3IKLA 4UDNA 1T8RA 1CQJB 5KVCA 4UARA 2FZ4A 2AE2A 2E5FA 2UYCA 3ZC3A 2NUTB 5BV0A 4ROSA 3NTRA 3MGBA 4C03A 2WHQA 4HB2A 2ZTVA 4JMLA 5KNCD 1OI7A 3GC6A 5JAMA 2WU3A 2EBHX 3PR3A 3W1EA 1NLMA 3A0UA 1GTJ1 4LHSA 2Q6TA 2EXXA 4BZQA 2B1GA 1FLAA 2H5IA 2ODTX 2RB4A 3UMSA 2GA8A 4E08A 3CVUA 2WVAA 4C4AA 4P83A 1M54A 2WIKA 1XDGA 3M6IA 3ZDEA 3BWXA 2BFMA 1E1YA 2YIVX 3P9KA 3GDHA 1ZITA 3L82B 4D8VA 2WMYA 3PQ7A 7AT1A 1YR3A 1N36B 4RL6A 3ZHRA 2JI9A 2WFMA 1C7IA 1ML4A 4TXHA 5JWRA 1VHQA 4R1LA 1GG9A 2YH2A 3EF3A 5D8DA 3TZHA 3CRQA 3RE1A 2C5FA 3T3PB 3ZCVA 4GOOD 1Z8NA 3U61B 2P9BA 1KS9A 4ZV9A 1CDOA 3D6HA 4TMXA 2PX3A 3GP5A 1E2JA 3O3CA 3IEMA 1L2TA 2C57A 2WIJA 3V2IA 2DLDA 1SCJA 2G1UA 2DECA 3G2JA 3UFXA 1NVTA 1Y8QA 1U2GC 2R8EA 1R16A 4K87A 4BNXA 4C29A 1DX9A 2WFZA 3HG7A 3ICCA 3FNEA 3NIWA 4Z7OB 1I1HA 1QH9A 3V32A 4GNRA 1PEAA 2WZBA 2A58A 1KH3A 1WCIB 2IYLD 3I58A 1Y8AA 4P5DA 3FTFA 2X3UA 3GRKA 4EFMA 1JN0A 4CF4A 5IXSA 4UOEA 4PLHA 1II8B 2B1JA 4KQIA 3UNXA 5EOVA 4IXDA 4BVAA 2OHOA 4XWKA 1GFWA 4Y9RA 5G53C 2A9KA 1P5FA 5ALQA 1FIUA 1A3CA 3CRZA 3O2NA 3SC2A 2P7IA 2PCJA 4PPFA 2GM4A 1YD7A 1C9KA 4PZZA 1ZSVA 2JFPA 1EEHA 4JNCA 4YPOA 1VE3A 2HSJA 4ZK6A 3VC7A 5NULA 4WZZA 1Q20A 3HZOA 3IAEA 3ILVA 5KNCH 1CXZA 1FW8A 1P8AA 4N65A 1Q1QA 4MCIA 1U5AA 4H6VA 3D4OA 4ZEMA 1CLUA 2EU8A 1GPYA 3M1IA 4V1CB 4G1MB 5KI6A 5AKYA 2JBHA 3MYRA 5CB8A 2WKSA 2KPOA 4E31A 2H4JA 2O2HA 3MSXA 1TLLA 3NHSA 2V7GA 3E0QA 4ZT4A 3U0BA 4LIPD 3OJXA 4R1UA 1ZC3A 1FQOA 1VYTA 1UXJA 1H5UA 1KYWA 2J3KA 4K40A 1VYHA 1U0TA 3SKVA 2MMGA 4KQKA 1HQKA 5HK9A 2J3EA 1C5KA 2E85A 1M7HA 2PX2A 4O4IA 4LE0A 5H83A 4TN5A 4KOEC 3WLJA 2ONJA 3SC2B 4QEZA 3D0RA 4DJTA 1GAXA 4HWPA 1T36B 3HJRA 1FSPA 1FZQA 2QTTA 4HNQA 1RRCA 4E7OA 3GA5A 2JAOA 4GKKB 2VDWA 4MI3A 1AIPA 5HQJA 2P78A 1LX7A 2P8JA 5TPWB 3A8TA 4X71A 2B69A 1XU7A 3L9XA 4PTYA 121PA 1FYFA 3DB2A 1A04A 1E2KA 4I6JA 3RIEA 1J0BA 2ECKA 3KE9A 5ALUA 5CEJA 3WB2A 4Z51A 3OPYA 4FT4A 2IBSA 1CQJA 1U2RA 1VMKA 2P2LA 3F5DA 4WGFA 5C2JB 1BE1A 1PJCA 3ZZUA 4LNHA 2XWBF 3B3AA 4UZFA 5BRAA 1GLGA 1RJ9A 1EX7A 1SC1A 3EVAA 4FK8A 4LXXA 3B5JA 2ATIA 5K8TA 3VR4A 2XOXA 3ZE1B 1YCFA 4FFVA 1ZOOA 2QE7D 2SKCA 2WMNB 1DS6A 3TLJA 1B6SA 1VB3A 3WLNA 2CHUA 4FWIB 4CMCA 1AQ6A 1C3VA 1MGOA 2HIAA 2I7VA 2BYTA 2I03A 3QLVA 1I7NA 5U4XA 1BE0A 5LQRA 1OBOA 1IN5A 3PUYA 5EWJB 3T99A 7MDHA 1UZNA 1JT9A 1J70A 1QMGA 2YNMD 3Q6IA 1KI1A 3G9UA 2EQ5A 2YIJA 3DCIA 1RLIA 3IP9A 4ER6A 1JEYB 1QHIA 1US8A 2CGEA 1SD1A 4IHQA 4CW7A 4P35A 4X3OA 1ZH2A 1EVKA 1K5HA 1ZXLA 4B7XA 1Z7BA 1ZY2A 2NP6A 1SBYA 2FLKA 2H00A 5LOVF 4Q02A 4O4LF 1RR6A 2DM6A 3ZE2B 4BY9E 5F12A 5FUXA 3MIIA 2PH1A 4XEUA 1AK2A 1IDOA 3UENA 3CSDA 3EZLA 4EUFA 1DDGA 4KGXA 5KKCA 4DA4A 2B21A 1CUHA 2RMKA 3OT1A 5FL3A 3WMXA 4EI8A 4PBSA 1BOFA 1LD3A 1G0OA 1GA1A 2KI5A 2ZRCA 1X7YA 3DR3A 1QCYA 3LCMA 3KYJB 1QGUB 4G5XA 3PFWO 1EFDN 2P41A 2VPTA 3KTAB 4K03A 3K9FC 3CKKA 2DGDA 2NU7B 2ZSHA 4B6FA 3SIPA 4LZOA 3Q5DA 4FOLA 4RFSA 3SKYA 3U9SA 4AURA 4OHCA 3BN3A 2WD7B 1L8AA 1LC3A 4I9HA 2IY9A 1Y3IA 2QQGA 3T0GA 5AICA 1O6CA 1PL7A 3ISTA 4KR0A 2AJCA 3DB1A 3I8XA 4P7BA 4PRZA 3RSCA 4YR7A 4YDSA 5HNKA 4CCYB 1DZ3A 2HJWA 3TF5A 1EIWA 4I3HA 1E58A 1BGVA 5K99A 3HL0A 3HSYA 3ENVA 1E5LA 3FMPB 1T9DA 2C96A 2M1ZA 4GSYA 4UM8B 3HO6A 1CE8B 4AJ2A 1WOYA 4TQGA 2DF8A 4HZIA 3K71B 4W5OA 4RIGA 2H2AA 2X0EA 1RM0A 1E3TA 4L9AA 2PANA 5ESDA 1DBIA 1Q83A 2VZ8A 1P9NA 4W1RA 2X6RA 1DQRA 4C78A 5LD2C 4EY6A 1OBHA 4JI1B 5JEEA 1KI6B 1L5YA 3FHOA 1UFOA 1ADGA 2VZLA