4BMPB

Crystal structure of bacillus cereus ribonucleotide reductase di- iron nrdf in complex with nrdi (2.1 a resolution)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT BETA
publication title Crystal Structure of Bacillus Cereus Class Ib Ribonucleotide Reductase Di-Iron Nrdf in Complex with Nrdi.
pubmed doi rcsb
source organism Bacillus cereus
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bmpB00
3NHFA 1H69A 3ESZA 3FVWA 1X77A 5F12A 2BZSA 4H6PA 1J9GA 5F4BA 1F4PA 4ICIA 4GI5A 4C0WA 4C14A 3NHKA 1QHEA 5FUQA 2FDXA 3NHUA 1FLVA 2BPOA 3OX1A 3KLBA 1DX9A 3R6WA 4GQIA 4PU0A 2BF4A 3GFSA 3K1YA 3EDOA 4U7GA 3ESYA 1AHNA 5A4KA 2Q62A 3K20A 3NHYA 3UXHA 3OVMA 4QOHA 2R96A 5NLLA 4M0CA 1TLLA 4FGJA 4YQEA 3GFRA 5LLDA 1FLDA 1YOBA 3GAMA 3W79A 3N3AC 3TEMA 4FGLA 2FOXA 3RPEA 3U7IA 1BU5A 1RTTA 1OFVA 2FVXA 1YKGA 4N82A 1B1CA 4YALA 1FLAA 4XDGA 4LTDA 2M6RA 1D04A 2ZKIA 5EA2A 2QMZA 2V9CA 4C0XA 5JROA 2A5LA 4DY4A 1E5DA 3FJOA 1YCFA 4ZVNA 2RG1A 4N9QA 4BMPB 5B3KA 2Z9BA 2HNBA 5LMCA 6NULA 4DIKA 1YDGA 3NFRA 4LTMA 3OX2A 3EYWA 1FLNA 3NHJA 3HR4A 4ZVMA 1YRHA 3B6KA 4Y7CA 1QR2A 1SQSA 2Z9DA 4QOJA 4FX2A 1J9EA 3P0RA 3O2NA 2HPVA 1AKTA 1FX1A 2FZVA 2M6SA 2OHHA 4LTNA 5LJLA 2MOKA 3O73A 1H66A 5LVAA 2GSWA 4J8PA 1AKWA 3FX2A 1XI2A 2OYSA 1V4BA 1CZHA 3UXEA 1AKVA 2QWXA 3ZHOA 4QOIA 1CZKA 1DXQA 1T5BA 1AG9A 3LT5A 1D4AA 5NULA 2XODA 1OBOA 3NHWA 4N65A 2FAXA 1KBQA 2W5UA 4D02A 1JA0A 1WSBA 2BN4A 4GR9A 5LBTA 4Y9RA 2KLBA 1FUEA 2MT9A 4QODA 2MWMA 4S24A 2ARKA 2MTBA 1ZX1A 3QFRA 2F1OA 2X2PA 3KAQA 1CZOA 1AKRA 1CZUA 3OJWA 1J8QA 1FTGA 1C7EA 2D5IA 1TIKA 1RLJA 3KAPA 1CZLA 2QX6A 1AZLA 5EAIA 2R97A 4CETA 3FW1A 3QFCA 4BMOB 5F51A 1YCHA 3KEGA 3W77A 3LCMA 4ZVKA 1BVYF 4LAFA 4LA4A 2Z98A 4Y9UA 1C7FA 2Z9CA 5TGZA 4ESEA 3B6JA 1J9ZA 3OX3A 3NHRA 1SG0A 3HLYA 2HNAA 3W7AA 3L9WA 4QOGA 1T0IA 2WC1A 4H2DA 5FX2A 3JSXA 2FZ5A 3ESXA 2AMJA 1GG5A 4PTYA 4OXXA 2V5VA 4DILA 5ULLA 1I1OA 1ZWLA 3L9XA 2FLVA 4NULA 3F2VA 2QX8A 3OJXA 3B6IA 5LJIA 1AMOA 2OHJA 4QOFA 4YAFA 3G5MA 3F6RA 2B3DA 5FA6A 3W78A 3B6MA 3OWHA 2QX9A 3TZBA 2N1MA 1RCFA 4CF6A 1FVXA 1JA1A 4QOEA 4YAOA 2X2OA 4PTZA 3QE2A 1CZNA 4YAUA 1QRDA 4U7FA 5B3LA 5EMNA 1XYVA 1WSWA 3F90A 3N39C 4YAWA 3ES9A 1VMEA 3U7RA 4HS4A 3NHLA 2FX2A 4XDHA 2Q9UA 4U7HA 3OWXA 4C76A 1XYYA 3S2YA 2QX4A 4ZVLA 3SVLA 1DXOA 4F8YA 1KBOA 1AKQA 1D03A 4NLLA 3TE7A 1CZRA 3D7NA 4FGKA 1YCGA 2OHIA 2BMVA 3NLLA 4R81A 1RLIA 1ZWKA 2KQUA 3F6SA 2QMYA 2XOEA 5BUCA 1AKUA 1NNI1 3FNIA 4HEQA 3N3BC 3NHSA 2QR2A 3GFQA 3HA2A 1OBVA 3NHPA 1XT6A 5LBUA 1QBGA 2V5UA 2FCRA
chains in the Genus database with same CATH superfamily
1Y3FE 1PD1A 6Q21A 1LSJA 1P1FA 4TTAA 3SIWA 1UXIA 2BJVA 4MVJA 3D7MA 2ESRA 1DBRA 1FNDA 3PXBA 4UUPA 2G9UA 1IY8A 1VKZA 5EIBC 4EB6A 4PPNA 1JQ3A 4RIIA 2OO5A 4ZZ1A 4JP2A 2O2GA 2YXDA 2GEUA 3NS7A 3QOFA 3O7WA 4D74A 1VB3A 5DZSA 1OXSC 2BEKA 3PGXA 3R9KA 4QG3A 1CVRA 3QTLA 5KYUB 1QGUA 4GYWA 5DHQA 1T4CB 1EIZA 1N5LA 2GBPA 3I9FA 2GN6A 4ENVA 1KH3A 2MYPA 3N2YA 4N5HX 2CMFA 3H8SA 1DEKA 2ZBVA 1B15A 1G17A 2C98A 1H5QA 2XMDA 3HB9A 2W2LA 3L7IA 4RC9A 3SP1A 1ZISA 5C46F 1SUPA 3ZOKA 1FX0A 1TAUA 3E2IA 1A76A 1GR0A 4ZT6A 1C0LA 4Z3KA 4L7VA 2IYAA 4JR2A 3Q15C 1UPBA 4IJMA 2IZ6A 4R7TA 3WGOA 3BH7A 1KTVA 1NZFA 2EWVA 4W7SA 1NONA 4YO7A 3E7WA 3ZUPA 1MX5A 3RYIA 2HSWA 3D6FA 1E6WA 2CB9A 2ZXFA 3OJLA 2G9NA 4F45A 5A7GA 3L41A 5ARBA 1R10A 1SAYA 5KC8A 3GV0A 3PSAA 1KIAA 2GETA 1WF6A 2DTXA 3D31A 1EJ2A 3K20A 4Z99A 1XZHA 2D2VA 1GDTA 1XNRB 4HX2A 3DDSA 3VRHA 4EVQA 3CKKA 3I04A 1OGJA 1A95A 4ZCSA 3JWGA 5TMPA 3LPCA 2Q4RA 4FOSA 2MHCA 3AUUA 2A0KA 2FVYA 1CQZA 5LQJA 1RRCA 4JT8A 1CERA 1GA1A 3IS3A 3IMKA 3HP4A 3V8VA 4CM4A 3DTTA 2CGEA 3OPYB 4J1TC 3N8GA 4MW0A 1ZMOA 3RSQA 1R27A 3GAMA 3W79A 4TN5A 1Z13A 4F3RA 2O5CA 1F4VA 3LUBA 5EKDA 2FTKE 3WJ1A 5FTLA 1NOIA 4PLVA 3KTDA 3OC0A 1BWQA 4A8JB 4BLPA 2ISCA 1KRWA 2GXSA 1G0NA 3PHBE 4BXOA 4FX5A 2XUKA 2HKIA 1UMCB 1UT8A 5JBIA 5FF9A 3EWSA 4MIKA 3EPJA 5DGHA 2Y1EA 3RKUA 3N0VA 1XDGA 2CNDA 2FGKA 3K0AA 2B20A 1G8HA 2OZEA 3ONFA 1H65A 2ZRAA 2HO5A 3H3FA 3NTOA 3UO8B 3R7FA 3FROA 5F2KA 2WG0A 3AFMA 3RK4A 3FSRA 1MIOA 4MDEA 3ORRA 3B85A 1JHUA 1E9CA 2J6HA 4FK8A 1T0UA 2BFEB 3KUCA 4BMZA 4D99A 1LVGA 5BYJA 1T1GA 2PX8A 3PCXA 5JQGA 3TLGB 1NKSA 2QTHA 5K03A 4V1CB 2XSZD 4P86A 3MWLA 1IAQA 4NVRA 4WZZA 5H59A 3AB8A 2GF9A 5E7IA 4MVJF 2I6SA 1QU2A 1EX7A 1XX6A 3HU2A 2ZWOA 2Q27A 3UZUA 2A5LA 3LKVA 4GMHA 4J1TA 5CM9C 4BE9A 3FNFA 4DY4A 4MHSA 3TFWA 1KAQA 3AUJB 3KQMA 1NDUA 5F1KA 2NOAA 1W30A 5GWXA 3FOFC 3L0OA 3PXXA 2OOKA 3L6RA 4RH3A 3Q9SA 3KJGA 1GG9A 3ZU6A 4PLPA 4PG8A 2ZB2A 4A2QA 3RAGA 1IPFA 1C30A 3S2IA 2WIJA 5FWXA 1VJGA 4PG5A 1UFQA 2WJWA 4BFLA 1C1HA 4NCAA 1RWMA 1EM6A 1Q7CA 1OT3A 1RKQA 5IDXA 1XCBA 1Q11A 1JLRA 4RLFA 5F73A 3UKOA 4BPBA 1UBEA 4WLOA 4Q7QA 5ICMA 4G2TA 3TFOA 4J2TA 3A4TA 4LJAA 2RI6A 1VDZA 3IEPA 1XVLA 1P9OA 2D5CA 2GZHA 1UKYA 3GZJA 3HBLA 1QHHA 4JELA 4TXNA 1CG6A 4GHWA 1XAGA 3O75A 4OKIA 2QG9A 1NVEA 5GV7A 3U60B 4ZO9A 4QPDA 2AE2A 2YZMA 3CE9A 3NGXA 5AOAA 1M7GA 3I32A 3HY4A 2NXEA 5EESA 4DV6B 1SUCA 2F2TA 2W93A 4KJXA 3OE4A 4O4LF 1NN0A 3E8SA 4ZVQA 1N2CB 2X0KA 1IH8A 4JIMA 2YJTD 1BN7A 4FP9A 4UQLA 2OP1A 2HSZA 1U8EA 4RIGA 2YC2C 4MUJA 1SR8A 1WZ2A 1YS7A 3ZDYB 5LYJB 4HY3A 2Q2NA 3GVIA 1G5TA 4WBSA 3DDOA 4BGVA 3AG5A 2CVHA 5AM1A 4WLEA 3KOXA 1JEYB 2NN3C 2Y05A 1EB8A 1ZD4A 1VBKA 4MP6A 4LZLA 4WUVA 1J1IA 3PF9A 4XX1A 2XMBA 4P3YA 1D2AA 2JGEA 2PZAA 3K5PA 4GBMA 4TS3A 1F38A 1QORA 1SZDA 3IL2A 3SNKA 3S5UA 2N42A 2QRNA 3M6XA 1AKEA 3B9QA 3PGMA 3TZ6A 4DQLA 4FYKA 4RO0A 4EYQA 4HB0A 4ER7A 1AK9A 2OV3A 3UT6A 4LC1A 4L6CA 2GSWA 3R5TA 1ZG3A 4U7TB 5CB6A 4LJYA 4OM7A 4I1VA 5D3QA 5KWEA 3I76A 4DANA 1SN7A 1NPDA 3SAJA 4MUYA 3U48A 3QVMA 3BIWA 2PRJA 3E0QA 5CMLA 4G5SA 2BT4A 3V3KA 2DQ4A 2X9LA 4C4RA 2V8OA 3FHCB 2FPPB 4GMKA 3R76A 1IJKA 1YZKA 2Q2WA 2V7QD 4HDOB 1FFSA 3IQEA 1MH1A 4IKOA 4IQ8A 2BM9A 2DHDA 1M2VB 1SOWA 5CRIA 5DDIP 4KQ1A 3NP7A 4RELA 5IT0A 2GF2A 1UDRA 1RM4A 2VHJA 3CVXA 2PH5A 2XQIA 4HH0A 4KAXA 3DO6A 5FEUA 4AB1A 5GOTA 4DFDA 3FFAA 3QX8A 3HV2A 3C3PA 5TF0A 5EP1A 5L4NA 4IHJF 5JAUA 2ZRLA 4DMRA 1LJLA 3U2QA 3Q0EA 4Q1FA 1G2QA 1SHTX 1QG6A 2LD4A 1AM4D 3PIDA 1PSZA 5JVDB 1MXHA 1R8YA 2FLWA 2NNLD 2W8ZA 2ZBGA 3NKFA 3DVQX 2F48A 4AY6A 4HNUA 4GL2A 1BMTA 4RD3A 4EA8A 1OBHA 4J0QA 2K2QB 1VHTA 2G76A 4BO7A 5DI3A 1GVHA 3QBJA 5REQB 4WLFA 3UXYA 1GGFA 4LZPA 1HRKA 3ROEA 1OC4A 3IP8A 2HJGA 3RIMA 3F73A 3AT1A 1FDVA 3P0HA 1N32B 1I3OA 1W88A 2C88A 4M7PA 3FMVA 3AESB 3DAHA 1RXVA 4LY3A 4H3KB 2XSZA 2F8LA 3L0DA 2B4RO 1Q50A 1BC5A 2YS7A 2QZ9A 5FTNA 5G40A 5E6SB 4OREX 3I5XA 1EFCA 1RQPA 1RYBA 2QN7A 3CF4A 4IRMA 2DULA 2HY7A 3ITEA 3O1HB 2QTTA 2CF6A 2FPIB 2PX3A 1FTGA 1L7EA 3TL6A 2CSXA 4FPXA 1NXTA 1UPFA 1OFIA 2B30A 4OUDA 4A6DA 1ZKMA 2E21A 1D4OA 1RLJA 2WWHA 1EWRA 1S89A 2ZSAA 3WK9A 4WXYB 5AVQA 2WTUA 4GX0A 1GPWB 4YMSA 2EJBA 3RFFA 3MG9A 4Z4GA 1UFVA 1YACA 4DZRA 5KNCD 4ETIA 2ECFA 4X91A 1V9SA 3WKBA 4CNQA 4KXVA 4G5GA 2A3NA 4WNAB 1SEVA 5J4YA 1C3EA 4RY9A 2CVPA 1HNXB 1TZCA 2NADA 4KBYA 4OBEA 5TT1A 3GQBB 1U9YA 3F2IA 3WB1A 4ILKA 3PKIA 1W44A 2KJQA 3UCFA 2ANCA 2CDAA 2QNRA 3OA0A 4YRKA 2G08A 5K09A 2XBLA 4EVRA 3REGA 2R00C 3TBFA 3GLIE 1YZLA 3DE2X 1N92A 2H2DA 4ZVKA 3IEIA 5J1SB 3G2OA 2BTQA 2BI7A 2ECOA 1BVYF 1BRMA 3UV3A 5HOQA 4G9BA 3RVBA 2H17A 5BRNA 3WZ2A 5B12A 9GPBA 1PZEA 4F2DA 1RIIA 2E55A 3K4HA 3U17A 3WYGA 1HOXA 4BKPA 2H52A 3L0BA 3KOOA 1J5PA 4E51A 4JVSB 3JWPA 1TM1E 3U44A 1G59A 2RC6A 4MKGA 4TYYA 3ICWA 1AK1A 1NDHA 1YVUA 4PQYA 4KSYA 4C87A 1IRXA 5DYIA 1Z74A 2YVAA 2HX1A 1RI1A 2WVAA 3HNOA 4X90A 5H80A 5JD5A 4G89A 1Z5WA 5A2GA 4Y6QA 4QGAA 2YYZA 1B8PA 2A9QA 3R3SA 4NK4A 4U2GA 4WLNA 5D01A 1JLLB 1UOPA 1XFAA 4MKHA 2ZWAA 3O8BA 3T7KA 1DRVA 2J59A 4K9OA 1S02A 2OB1A 1G55A 2P79A 1SQFA 1XHLA 3M3PA 3Q41A 1NE2A 2QPLA 4JJEA 3P0EA 4O1HA 4BJ3A 1L9XA 3AHEA 4OMUA 2R7NA 1GPH1 3A31A 5FUYA 1N3YA 2X5KO 3GNQA 3ENWA 4O2AA 1W8DA 4BZZA 1EDBA 2C83A 2ZIWB 5KQLA 4GVXA 1E59A 3IE1A 1O58A 2E4XA 4CODB 1CK4A 2R00A 4EUFA 2OXIA 5GIOE 1N0HA 2GCIA 2YWRA 4BV9A 4JLOA 3F6YA 4KQ6A 4AZ3B 3HJFA 1JKJB 5ES3A 5HPYB 1DJMA 2D0OB 3ANTA 4CMCA 4R2HA 4WOPA 2VA8A 3RS2A 1Z38A 5FV7A 5K5EA 2GHTA 1YGYA 3H9UA 4UHKA 2GVDC 3NDRA 3HEBA 4ZOAA 1KY4A 1U1DA 3F6RA 4KGVA 2ODTX 3TZCA 4EUHA 2H59A 5JLJA 1OLUB 2I4MA 5CCBA 2BFBA 4R8SA 1OWPA 3GHHA 1ZA2A 1K97A 3RTGA 3UJHA 4ZZ3A 4EQZA 2RHJA 4WOKA 1SU4A 1V9LA 2Y0EA 4DMHA 4ZAFA 1JKXA 3D6MA 2FFJA 4H7IA 4RFLA 4M38A 4MV5A 5JMWA 2LR0A 1VE3A 2OK8A 3H18A 3OETA 3RJ5A 1RCFA 5ALWA 2VPWA 1U0FA 2W0SA 1J2TA 4PGHA 2JCYA 3MTQA 5K0BA 1KSFX 3LFHA 3NOXA 3QHQA 4DE5A 4POAA 4YYZA 5C7YA 3WGIA 1CZNA 3RFTA 1Y3IA 3RNLA 4UDOA 4E7PA 1QRDA 3ZY3A 1D8AA 1MCZA 1VE1A 2DQYA 2ERYA 1KDZA 3SYKA 2XEDA 1ZNYA 2ZIAA 5AI5A 5B3LA 4E70A 4OHZA 1XYVA 3PXGA 3DBHA 1TYBE 2XQKA 5DB4A 1U65A 2Y0CA 4K6FA 2PKWA 3ZK8A 5HWSA 3N39C 1DC6A 1ETUA 3OP4A 3V4ZA 4DF3A 1WVMA 3QV1A 5IFLA 3OIVA 2XE6A 5KWIA 1BMFD 2C9OA 2XYGA 4BFSA 5IDVA 4JYBA 1M72A 1RMTA 3DEYX 5DN6D 3F1KA 5IAAA 1CR1A 4LXXA 2ADOA 4FGSA 4C76A 4INJA 2EOAA 2XDQB 1A4IA 4M1OA 4PZAA 4OXNA 1RE1A 2WIGA 3IQGX 4ZVLA 1WMSA 4CL3A 2Z5VA 3N75A 1GQ2A 3OPXA 5CDHA 4L50A 3FKQA 3FNHA 4DGQA 3L7KA 1N6LA 1A1SA 1YDWA 1JWLA 1COWD 2WMDA 3R0VA 3FYCA 3LL4A 4M9ZA 2A0UA 2VF8A 1MGOA 1SCUB 4LPSA 3I1YA 5T3YA 5A9SB 5C81A 4MUIA 4Z4EA 1BCSA 3H8WA 4ITVA 1HC7A 2PKEA 3SI7A 5HFJA 3Q2OA 5C1DA 3R24A 3D1JA 3P52A 2ZFUA 4R1TA 4EJMA 5E6UB 1NP3A 1NFQA 4V0SA 2Q9BA 2Q4OA 3LW8A 5C52B 1X2EA 5JBQA 2VPIA 1OVGA 2NSJA 4GOOD 1XZBA 4KN5A 1ZAKA 2W2TA 1PGNA 1L3BA 1S2LA 2QN2A 1I01A 2WUWE 4PGFA 2H4JA 2N9UA 4QUDA 4GE3A 5COBA 2IZZA 2OAGA 2P2SA 4KQMA 5CAEA 2EBWA 4U0JA 4PAOA 4KYUA 5I9SA 2GXUA 5K0TA 1T29A 1JHDA 3SBEA 2QYOA 3PEVA 1CF2O 2D3WA 4IUDS 5T4EA 1OYYA 1VKHA 3O8QB 3VX4A 2QVXX 1U9JA 3ETEA 4BFWA 3D1VA 1DRJA 3FVVA 3WDSA 5C7IO 4O2AF 3BM5A 1ODCA 2EHDA 2FPGA 1CKEA 3HH8A 3K8OE 2D1TA 3Q9LA 2W42A 3NDPA 4HUTA 3N3BC 4GR4A 3K9QO 2RKBA 1Q6YA 4BP3A 4RYLA 5C8VA 4PLTA 4XFJA 1II8A 5EUMA 2JFUA 1WXEA 3LQ4A 5U9CA 4URYR 4NG4A 1Y3CE 4QQFA 3UWOA 4KE6A 4NJEA 4K6MA 3AF4A 3D3NA 3PNVA 4Z9AA 2FF5A 5LOVB 1ZI9A 2ZUVA 4FC7A 4YP1A 2IS6A 1OILA 1P6UA 2FWJA 2ODEA 3AUKA 2RHOA 4PR3A 4DIUA 1PJ2A 4KOAA 1E6EA 1Y8QA 3GBPA 1VZ3A 2PZMA 4R2KA 4FYVA 2GOYA 2JLRA 4AP9A 4F2GA 5HF9A 1OIWA 2DQSA 5LZ5A 4AO6A 3GNTA 2O8VA 4GLBA 4M37A 1WBJB 1W7AA 2XNSA 4KIGA 2KLHA 1DV1A 1M76A 4JA2A 3PDCA 4GX2A 1E6CA 4FYJA 1TQ8A 4P53A 3VKFA 3GGCA 1KDPA 4YQYA 2X0DA 3HI6A 2FW9A 3GYBA 1MJFA 3JXEA 4O1IA 1NA5A 1JFFA 1VA4A 1WOYA 2H00A 3AXTA 1HSOA 2VZLA 1L3IA 1LU9A 3BSFA 3NX4A 3PQFA 4ICIA 1DOHA 2DT8A 2WD9A 1KQFA 2QL7A 2G1KA 4QHYA 4EY7A 2IH4A 2OENG 2BI8A 1PWEA 3NNSA 1PWYE 4LRUA 4WESB 3RVPA 3VO8A 4TVKA 3UMCA 1VC2A 1V4VA 1AF4A 1L8QA 2FK7A 3PCRB 1ZOPA 1X38A 1YL5A 4RPLA 3UJ9A 3NHUA 4FE3A 1TUIA 1GQOA 3AP3A 4KN6A 5CT8A 1MO3A 3N70A 4CNBA 2W2XA 2VK8A 1H85A 4CCWA 3SHWA 2LRHA 1H1TA 2GM9A 1WF3A 4FFVA 4F85A 2P8SA 4XGIA 1D07A 5KMGB 2XCIA 5LNK1 2C20A 3IPRA 1L4NA 1XK6A 4N5MA 2QTAA 1NJ6A 4RHUA 4IFTA 4I55A 1Q0PA 4RVGA 2GBLC 3FYSA 1KEWA 2OL4A 2PNFA 4Q4AB 4M8NE 4Y1RB 5CLQA 3WNDA 4WK6A 1X2BA 4FTWA 4ZOLB 2FFAA 3T5GA 4G0YA 5IWCA 2BHNA 1KWKA 2GLXA 4C22A 5P21A 4JBWA 1KIFA 2RDMA 1UUFA 4LVNA 2PMDA 5IW8A 5EMJA 3TLKA 2HCBA 1J0CA 2R96A 3EQ8A 3L1JA 5NLLA 5ICGA 1DBPA 1QH1B 4FCWA 4U2BA 2WYOA 2E37A 4EF6A 3URMA 2P9JA 5F78A 1KEZA 1A7KA 3AUTA 4MW9A 4C4OA 1CUXA 1OMOA 3L7AA 4WY5A 5L51A 2OHGA 1X42A 5GGYA 4R7GA 4TZTA 4ARZB 3Q12A 4ROSA 3VO2A 1X94A 4ZCPA 1Q1GA 2XAUA 1C8LA 3FGZA 5LA6F 1BGXT 5AUPB 4DREA 1D5WA 4M0DA 1KEUA 1NI4B 1GKYA 2FRXA 1OFUX 3ROMA 3UIEA 2GJKA 3WRVA 1MQSA 3ZWOA 3TECE 3LUPA 4LYJA 3OHMA 1DE0A 1LQUA 5G4KB 2NZYA 4JDUA 4Q7KA 4EDHA 3WK5A 3OUZA 2FA9A 1KEKA 1Y89A 1SC6A 3H2KA 4ZJUA 4ZA2A 3SOPA 4G4IA 1S4MA 2C84A 2J0UB 1IHDA 2PJRA 1W5TA 4YGXB 1T8TA 3CRRA 4M36A 3UC9A 1I7SB 5CBKA 1U80A 1BMFA 1WMDA 2WR8A 3A3YA 5D1HA 4F3CA 3AHJA 3D8NA 3GUCA 2GBLA 3OOSA 1HUQA 4KQCA 2I1LA 5DN6A 5EJ5A 1H22A 1C9YA 3L0CA 4D3SA 4ND5A 2EF1A 5FEMA 2J87A 1D04A 5EZYA 2IHYA 4MRAA 1GD1O 4BNNA 2LUOA 3VC7A 4D4KA 2DYKA 1XZJA 3CW2A 1V3TA 4GS5A 2W11A 2B5VA 1PGOA 3NIDB 4JL5A 1COWA 1EKXA 1CEYA 2BFWA 1CJTC 1WUKS 4RDIA 1F51E 4ALKA 2PE5A 1VYHA 4D0LB 4BNGA 2MYUA 2I29A 3CWCA 3C3DA 5CNJA 3OJOA 3TZHA 4KPEC 4G09A 2C42A 3NVAA 2JHCA 4JEIA 3VAZA 2PGOA 2H3EA 4ZGGA 3F5DA 3C5VA 5I7UA 1K75A 5C9ZA 3DZJA 3ZZMA 1T8SA 1QOQB 1ZRSA 2GLTA 4H6XA 3F4BA 5IDWA 1FDUA 1YCFA 3U4IA 2FJ0A 3JQ8A 2RGEA 1AHHA 2BFFA 5GQSA 1IZ9A 1JLKA 3ZEAA 3ZH9B 5IZCC 5A3VA 2X9VA 1TKRA 3D4BA 3P94A 2GK7A 3L05A 2X77A 2G1PA 2HNBA 1RJDA 2UZIR 3NDBB 4E30A 4U1RA 1OFGA 1P7YA 2JAWA 2K2WA 1XPJA 3C97A 1HL3A 1NQOA 2R8PA 3OT1B 5EINA 4DM7A 5AI6A 3PGKA 4RQTA 4HH3C 4D6YA 4HWOA 1M34E 3HR4A 3KR1A 1G3MA 5THQA 4I55F 2YBDA 2GERA 4OJYA 3TJMA 3QRWA 4MGIR 1P7WA 2CNBA 1XD2B 3C1UA 5FAXA 4MWEA 2HBQA 2X4IA 1SXHA 5HF5A 3VH4A 3RFXA 4RH1A 3A14A 4GSLA 2A78A 4HYEA 2Q49A 3PUIA 1XKQA 3QXJA 3M70A 1X9GA 4LXGA 1BJRE 1G64A 2HRQA 1E63A 1SY7A 2PT9A 3SG0A 2PN1A 1XTVA 4G0WA 1PLJA 2GT1A 4D9EA 2UZ1B 3HKCB 3VKUA 3BJRA 4IJ5A 4ONEA 3UWKA 4PE5B 2VTVA 3ECSA 4FYHA 4BJ1A 3AV0B 1IWPB 1AKTA 1M2OA 2XDAA 5IZCA 3GLIA 4EZEA 1J07A 1OAKA 2G5PA 5ALSA 3NZEA 2QLLA 3MWEA 2VDVE 1JLHA 5AJTA 4DSTA 4RCZA 4GXTA 2M6LA 4I4TF 2YUIA 4XPIB 3KSBC 3KV1A 2UZ4A 2VWHA 1JMVA 3D43A 4ZTUB 4Y2VA 1Z12A 2FSVC 4QARA 2ZE7A 2V54A 3OZGA 4JFRA 4OA8A 4PG4A 3AF2A 4LQDA 1J2YA 5DEIA 1MB3A 2O23A 1FJ2A 1QV9A 3RRJA 3RVSA 4BVLA 3TOXA 5C0OE 3VHRA 2ZAOA 1E4OA 5FL3A 1CUSA 4IOLA 4HEA1 1II0A 2XB4A 1GPMA 3FX2A 5E9JA 1TZ2A 3ZCRA 2P3QA 3IUQA 3JVVA 4OIFA 4UTNA 3R3YA 4RFVA 4YRTA 3HCDA 3W5HA 3ZHOA 1Y7PA 5J2TB 4F6RA 4OI2A 2QTMA 5JY1A 5ADUS 3HUDA 5BMVB 3NPAA 4X6LA 1R88A 5IYZF 4C4YA 2QQFA 3AR9A 2I4RA 4LHEA 4JVNA 4N0QA 4Q18A 1J56A 1TEHA 5NULA 1GLNA 2Z4TA 3CLTD 1OYOA 4ANFA 5DYWA 5AOBA 1B3RA 3UW3A 1CUEA 1J8MF 3ECCA 1GYQA 1ZOOA 2Z57A 3LWBA 4YP7A 1KMHB 4YTEA 1D3AA 2HU2A 4NV3A 1QG4A 2WNSA 1EWQA 2P65A 3GIDA 2YHUA 3I3OA 2UZ3A 5L4SA 3HSSA 3SYLA 5BPHA 2FSVA 4FOLA 4KR3A 2ZU6A 1BDBA 5ENZA 5HRAA 1ULTA 3A6PC 1B0AA 1TRKA 1MOZA 1NUPA 1RTKA 5FNVF 3JD2A 4IYJA 4KWEA 3NHAA 2WWXA 4NYJQ 3ZWDA 4AAYA 4BUZA 1PR5A 4DIOA 2ISSD 2NO1A 3NJ8A 3COPA 3LWDA 4U5QA 4ZVOA 4BNLA 1UBNA 3EZ6A 2KBFA 3NYQA 4GYYA 2WLSA 4M1ZA 3PQCA 2KWIA 2ARKA 4YJDA 4KLRA 1ZK0A 2OCGA 4FYWA 3H5LA 1RXWA 4A9AA 3O95A 3MMNA 5G3YA 1FNSA 2GUGA 3OJCA 4PGAA 2QUJA 2PWZA 1Y7TA 3QFRA 5K4HA 1P2TA 2ZRBA 1KI2A 5B58C 3I6QA 1D2NA 1L7OA 1KPIA 1YH3A 3RLFA 3GRRA 3IAUA 3FDZA 3JQPA 3ZWPA 1V39A 1UINA 3FUCA 2D5AA 4IICA 4D3XA 4XEUA 3FPEA 1AZWA 1IHOA 2HH9A 1JG7A 3ED5A 5AKZA 2PBFA 5JMPA 4LWZA 3VKWA 5ITZB 5H8WA 1BG6A 2G09A 5K3EA 4WECA 1POWA 2VCHA 1ITZA 2QN1A 5KREA 1CZLA 3H99A 5CHEA 4BVGA 1ZRHA 1P18A 3L18A 4OBBA 3VC2A 3U9TA 5DWVA 1EX9A 3VYWA 4BGDA 5FL7D 1UPUA 2HZBA 1KKUA 4Q9DA 2YMLA 1V71A 3PPXA 2JHFA 3PGVA 4JUCA 3ZDFA 1CEXA 3QBTA 3HADA 1AQJA 3UKDA 5I5GA 5IU6A 3KEGA 1JBEA 1SXQA 1VGRA 3LBHA 1L7PA 3QWBA 3ZKWB 1G63A 4MUBA 2EFGA 1XRSB 4IXNA 4XX0B 3R7WB 1NF3A 2OBMA 3OZVA 2W43A 3VOTA 1G5HA 2NU6A 2DFKB 4F11A 4KR6A 4FZ5A 4AYXA 3RVJA 2BFNA 2QLBA 4FBGA 1HNNA 4Q3LA 1Z6ZA 5HKKD 3P9RA 1E2QA 1FCJA 1G21B 4DWOA 1XMPA 4IIXA 1E9BA 1IEQA 1M67A 3B6JA 3EEFA 1O03A 3AHIA 4G8DA 4OXRA 1FFCA 5KDLA 3PJGA 5LLSA 4AF6A 4CT5A 4TS1A 1DWPA 1ODJA 2HNKA 1GITA 3HHEA 3PF8A 3MHTA 4ETNA 1NM5C 1CIJA 5CFZA 4L6IA 2P0EA 3I01A 4GZLA 4IIHA 1PD0A 1M0EA 4OP1A 4QOGA 3QENA 1NE7A 2VLIA 1YRBA 1ZH0A 1A2QA 3I2YX 2P4SA 4FEEA 4L3VA 2GH1A 2H4FA 3PRKE 6GPBA 4KVZA 1LFAA 1YR6A 2FSHA 3N2KA 5GJWC 3CLTC 4KRGA 2AD5A 5TF4A 1E6UA 4H18A 3JSXA 4M8LA 4MYHA 3RWOA 4DZTA 1N9KA 1S3IA 3VPBA 4BWFB 1OPXA 5I9MA 1M6HA 3IHLA 3ESXA 3QKRA 4QD3A 4ML3A 5JO0A 3RM3A 3TXYA 1GG5A 2FPOA 5SZJA 3ANNA 1IL0A 3QVTA 3TNLA 1F2DA 4FCCA 3E1SA 2PZLA 4MQ5A 4GKJB 1SIWA 1Z15A 5DM70 1N77A 1LH0A 1XROA 1ZBDA 1IXSB 1S2NA 1S4QA 1U4NA 4LG1A 1GG2A 3ZVMA 3HTXA 3L9XA 1YK1A 3DBVO 2IK8A 5DBIA 1ILWA 4G5HA 2AS0A 1A82A 4HQOA 1KGDA 3CO0S 3JVUA 4YMIA 4RKQA 2QMQA 1SCJA 1NXSA 2Z04A 5E4JA 5COAA 2A7XA 5TV2A 4FM9A 1E2MA 3A9RA 3CKYA 1TYCA 3UK1A 4ROTA 4BJ6A 1P9NA 4NCJA 3TLZA 1US8A 2XE8A 1E3DA 1DMSA 3GP3A 1XG5A 4B46A 3Q8WA 4JLJA 1IE3A 3V7NA 1NM5A 1P2SA 4EHAA 1B0UA 3E3NA 1N2GA 2XNHA 3K0KA 1WEKA 4BNZA 4MOWA 1K3FA 1YQQA 3N6VA 1JYSA 3IB6A 4IQ0A 1L5NA 3P9PA 3H9CA 1GPJA 1I1HA 1P2DA 1WO8A 1YONA 4QU0A 4IP0A 3T6KA 4DGSA 3MUFA 8OHMA 1KPGA 2AG6A 1G2PA 1CETA 1SUBA 4F06A 3CIFA 2X2OA 1VI6A 4L2IA 4UEOA 5E7MA 2BR4A 4AS1A 2YJ4A 4EKYA 3QE2A 1O96A 2P5SA 4AJLA 4MYUA 4AFNA 2VOJA 3A2NA 1HZJA 4DLSA 3ZGNA 4RDXA 3MMSA 2AEFA 3K4QA 4KYTA 4P33A 3LXRA 5EJ8A 4AD8A 3KE9A 3IT0A 3UT5B 4JXXA 1RM5A 2AK2A 2ZRHA 3F90A 4D97A 2H4WA 4DT1A 1ZIYA 3TAXA 3A10A 4Y2SA 1CY0A 4UBOA 5EVJA 1I30A 2YWDA 4LGYA 4PRZA 4K9NA 3UYKA 4UUMA 4UVDA 2YV5A 1RP7A 1KJJA 2Q46A 2FX2A 2D1YA 2FW6A 3AKEA 3B5JA 4I9GA 4CKWA 4WW0A 3F8SA 1QVVA 4JLSA 1T5HX 5HUHA 5GONB 3PKZA 3QX9A 4OU5A 2E6KA 4K6GA 1E2NA 1Y4AE 2FPMA 2W2OA 3PZBA 4OOFA 4EAQA 5BR7A 1OKKD 2VF4X 2UV8A 5IJXA 3RSLA 1U4SA 1GGEA 1ONNA 1FTYA 4UDXX 2XUOA 1R6XA 1SWVA 5I7WA 1FZTA 2CJXA 2BDUA 1UBTS 1VZ2A 2RCYA 3T9AA 2FRDC 3LECA 4FOTA 4ZI7B 4E1BA 4YUYA 2IDJA 4JBHA 1QG2A 2F00A 1TO6A 2FG6C 3IKTA 1Z73A 2MU1A 4NFYA 4D8UA 2B4QA 1TTTA 4LIPD 4C0LA 3TDMA 1I94B 2CYAA 4LF4B 2JJ1A 4V0QA 4BMDA 1Z0AA 4DAEA 1JWAB 4PHHA 4FIZA 4ZAZA 1TMGE 2CBXA 5DO9A 2AE1A 2DUNA 5EI5A 4EITA 3E2PA 3H5WA 1ZNQO 2BBSA 2KQUA 1ESEA 1ZUWA 1INLA 4MB2A 5TARA 4D9GA 1ZUHA 3IAXA 4L95C 1SQ6A 2A1UA 7REQB 1BHJA 2ZJ6A 4GOXA 4HPXB 4EELA 1GZ7A 4EO4A 1VTKA 2YWHA 4QT0A 5FL7A 3L84A 4URWR 5KU7A 4K9PA 1K66A 1OWNA 3E22B 3JD3A 4IDNA 2Y3IA 4M2LA 4BEWA 1P5RA 2X5OA 4S2EA 4D8VA 4NXNB 1EDZA 1GN9A 1Y63A 2WKSA 3K09C 1ECPA 4PC3A 4AY4A 2ZI7A 1XRLA 2N46A 2ZS8A 2BFAA 1KJ8A 1OYWA 1SC1A 4ZYWA 5A5DA 4I6GA 2PJUA 5K8CA 4DV2B 2I2AA 4XQEA 4YACA 1SMKA 3NC0C 1Y1QA 4TX1A 4YWJA 4B8ZA 4REMA 1ZUNA 5HKKA 1PR4A 3HLTA 2PDAA 3KWJA 2FRDA 4ZQCB 3UHAA 2IHJA 2YIJA 3KDPA 4KXNA 4YJGA 2QLJA 1YBMA 4YRCA 3T12A 2JH9A 1OA1A 3Q1KA 2X0IA 3DYIA 4Z6KA 1IFXA 2YCLA 1Y81A 3OLZA 4Q1EA 3O2SB 4G24A 4DHWA 2V7TA 1X7GA 2ZYRA 3L7CA 2JI4A 1NUTA 5A4FS 2H2AA 2WVJA 3BMQB 1TVCA 4TZKA 1TF2A 5JR3A 3B9PA 3JQGA 4FINA 5I48A 3AEKA 1ZEJA 4RANA 5E4FA 4IMJB 3C15C 4WCFB 3ZWAA 2IYEA 1EUDA 3KKKA 1H23A 3O0DA 4I4CA 4V02A 5UKDA 1ZN7A 2Q50A 3IMEA 4E11A 4RSGA 1M34A 1KR2A 2JKZA 3D5TA 4PANA 1B6GA 1PKEA 4EATA 4CGZA 4ENRA 1Q14A 2ZSFA 2D0PB 2WYVA 1G8GA 1PT7A 2DR0A 3EBPA 3LA8A 4Z8YA 2ZKLA 3WHLA 1F0PA 3K0FB 5JPIA 1LPPA 2GD0A 1HDYA 4G4GA 1CVLA 1XRRA 5FUQA 3ROGA 4ZHQA 1PNTA 1Z7BA 1LSSA 2CNKA 3W2TA 3WO1A 3K09A 5EKXA 3R6WA 4BVKA 5KTKA 5KNDD 5G0SA 4ZFNA 1GQRA 3O21A 5IVHA 1NRIA 3SSAA 5JCZA 4U6SA 2OZPA 4NMMA 4PSUA 2PX2A 4Q4HA 1L1QA 4LSGA 1NFFA 4IM7A 4N03A 2VTBB 1AQYA 4B7CA 3BWVA 2P9TA 1U6IA 2CFRA 2PL5A 4V2UA 1WG8A 3MAJA 4CTNA 4LKRA 4NZNA 4WEOA 2VQDA 3ZH2A 3KPVA 1JEQB 3OVMA 2Z30A 4P22A 1TJPB 3X1WA 3U4MA 1MORA 4MV6A 1YNSA 2OV1A 3RQIA 3VUFA 4F72A 4YMWA 3L0PA 3AB3A 4PLFA 5AIBA 1KO5A 4DB4A 1E7YA 1WS6A 5EJGA 4NCKA 2IPNA 2B37A 4E08A 1MV8A 3M34A 4X6XA 4ZJPA 2GN9A 2ODNA 3V1KA 5EJMA 3EXFB 3IT3A 3G7NA 3NEJA 4H7FA 4QICA 1P74A 2JDID 4QBGB 4B6JA 4CKCB 1F4LA 4Y2TA 1IPHA 3GNSA 4TV9B 2XYPA 4BQNA 2FWPA 1YMUA 1Z0JA 3EIWA 3H0EA 3C8HA 3W1EA 2H4HA 1OH7A 3NNNA 4LJ5A 4BKOA 4DV4B 2XUHA 5KJCA 2FN7A 3I1IA 1TTQB 3TIXB 4PRKA 3PVZA 4FQ5A 1YC5A 4Q37A 2VSXA 1L4GA 5JCXA 3KZKA 4RSRA 2X7XA 2P1RA 1G8FA 1PQ4A 3OLQA 4CTMA 3TRDA 4QBHA 1ILEA 4LDRA 3I23A 2B69A 3IAS6 4ARAA 4DMKA 4CLRA 3CH6A 4LYEA 1NMZA 3LYAA 4JLUA 3NAGA 1C7QA 1XZKA 5IBCA 4CMIB 1SKYB 3P7MA 4K5QA 5LQSA 1I1QB 1SEPA 2HXGA 4BDSA 4L4RA 1NY6A 5DTJA 2GHRA 2H57A 1OVMA 2PMCA 1IZ8A 5DEOA 2C2OA 1KKLA 3EWIA 5CT6A 2FFRA 1OKKA 1UF9A 4D4HA 1OAAA 4YFYA 1G9SA 5CVVA 1HNZB 3MS7A 3RASA 1IATA 3WIVA 4A91A 4RMJA 1HDOA 1T9DA 4KIFA 1PSDA 3O8CA 1YBAA 3G68A 1JLMA 1ZD9A 3FGPA 4R2LA 4UASA 2LXNA 1XLWA 4FCVA 2H5EA 1BVRA 4IXMA 3V1MA 3CR8A 2AV6A 4N8SA 3W8FA 4A0SA 3C3AA 3WOHA 5INTA 3I9JA 3WIBA 3U7GA 4FCTA 4KXXA 1P72A 3DZFA 3KKZA 3EXG1 3GFBA 4N3NA 4UU8A 1PTJC 3PFCA 4MR7A 3S8YA 3R5KA 5K3BA 2JBAB 2OGWA 5EZ6B 2H48A 2BMJA 3FETA 4MMXB 5EE0A 1JPUA 4TM8A 3ZJVA 2C4UA 4RTMA 2C8KA 5C8YF 3THYA 2VTKA 2ILVA 1DPFA 3HCEA 1HSZA 1FOEB 4UW9A 4B8YA 1R0SA 2XJ4A 5FOTA 4AF7A 3FOAA 3T0GA 4BX8A 2FSPA 2BEWB 2G4LA 3Q7TA 1WB5A 3HO1A 1RYDA 1COZA 1QGYA 2XMGA 2HBRA 4HQ6A 3R75A 4CV0A 4DLBA 4LSMA 2OXCA 1XVVA 3FSGD 2UVQA 4UBKA 3TTUA 5G2OA 3VHXB 3ABZA 5BYAA 1GTMA 1KMMA 3CS3A 3JQAD 1AGNA 4FFOA 2VBIA 1EBUA 1V41E 2IBSA 5ALVA 1QP0A 1L5RA 3O3NB 5IAOA 1E61A 3WTBA 4V39A 3L1UA 5F23A 5ES4B 1EUZA 4A03A 2EARA 1NU6A 1VKJA 2NVOA 2HSEA 3BA1A 3CH7A 3OFJA 4HEHA 4P35A 4W7IA 1ESCA 2BUBA 2P6NA 3DWEX 3NEYA 1W5SA 1MAUA 3PFHA 4Z54A 2F8TA 2B7CA 1B8NA 4I3HA 4RKEA 5AVSA 5IXSA 3F3YA 1GTSA 3E03A 2D6FA 4Q3BA 3GEGA 1M2EA 5D5HA 5KTRA 1XOIA 4V0RA 5HF6A 4C4PA 4E5NA 4P5PA 4B3RB 3M9XA 3VJRA 1H1LA 2WUEA 1I36A 3DH0A 1PTJA 5EE1A 3K53A 4HUQB 2E87A 3D3QA 1MW9X 1QHFA 1X8JA 5AI9A 4F1KA 2ZZNA 4M8KA 4BU0A 3AEQB 3MOGA 5FRDA 2M6SA 1XJ0A 2ZIEA 3B12A 2HRCA 3O74A 5TQ2B 1VMIA 4MRPA 2ORYA 5CR9A 1QLHA 5F76A 4DQXA 2GPYA 5BSWA 5JG7A 5TQ0B 2O5EA 2XKJE 2PFKA 2V59A 1DNPA 1FUUA 4LTNA 3KZXA 1DAFA 2O6HA 3F6EX 5EHZA 2PRSA 2HK6A 2FZGA 1B74A 2QM0A 3IQFA 5AT1A 3TSAA 2RKOA 4CIWA 3B2QA 2A9VA 3RSHA 5K05A 2BKEA 2ZJAA 5KAPA 1U0SY 2EFYA 3CINA 5KNDA 4UZEA 4BO2A 3NBQA 5AJUA 2DM6A 4AYTA 1NR7A 2A59A 5EJ7A 5CX1B 3FBGA 1FA9A 1JDPA 1Z5PA 2C5FA 4Q7EA 2A9KA 4GSKA 4UAVA 4X8MA 4OX9B 3QUTA 2IPAB 1RKUA 2QD1A 5BO5A 3W3ZB 4OXKA 2GRAA 4IKPA 4IGEA 3IILA 1BROA 3B3AA 3CF6R 4IGKA 3AERA 2FFQA 1N7GA 4OGLA 1AG9A 1IN7A 4X94A 5D6OA 1PQPA 1WCV1 2NVUB 1JHZA 1GILA 1P1RA 3UPUA 4H6VA 1F17A 2R6FA 1XQ1A 2ZRQA 2ZT7A 5FO1A 3OE7D 4L16A 4Q1BA 4XGKA 1R5BA 1L4EA 2AOXA 3DKVA 4YLGA 4DNXA 5JJ5A 3NAMA 4DA0A 2EG9A 1C3OA 1NWHA 1Z2CA 3VNBA 2W71A 4D02A 3WKDA 3PJEA 2F62A 4GD3Q 4MGHA 4E32A 2LWIA 2F3TA 4X61A 3VTKA 5AM3A 2HTEA 4CKBA 5IJ9B 3GRPA 1II9A 3BQNB 3R23A 4ZIRB 4X97A 2D5LA 5JLAA 5JXJA 3C6BA 3RDPA 1KJWA 3QYAA 2GZMA 4GICA 5A9TA 1H9AA 5IN5A 2OYCA 4DARA 2HIHA 1HORA 4R68A 4RHCA 4E88A 2X1HA 1XB2A 4B8WA 2CHGA 1SIUA 3K9CA 3U1BA 2AUMA 4PNPA 3OZDA 1CY7A 4A16A 2W2PA 1P3DA 1G9XA 1J8YF 5CLIA 1ZHOA 4PFJA 2JFFA 2ZJ8A 4FDUA 4IJQA 4L1KA 1NQVA 4X95A 3UOAB 3ZLTA 2CFCA 2JKVA 3ZPXA 2GDJA 2BM8A 8AT1A 1GLVA 1QV7A 4K9LA 4Q01A 3VNUA 5EXPA 4QYTA 4PYMA 5C4IA 5CURA 4L4XA 1WXFA 2QZJA 1PV2A 1WWKA 3KWFA 2IPLA 5IUNC 3SZUA 3C41J 3AIIA 3PD7A 4C07A 5FOQA 4H16A 2FPLA 3LT4A 2UUPA 3KX2A 1Y1LA 4PHFA 5F1YA 1Q1QA 1Z82A 5FKJA 2V3CC 4H1HA 4BQQA 1MDBA 4EFMA 1YZVA 4X3PA 5BYKA 3VOSA 1FEZA 1J33A 1P1JA 3AO0B 3OCXA 3G02A 1OGYA 1ST3A 3I5UA 2GHQA 1E18A 1T2EA 4GPBA 4AJJA 4Q9JA 2IEDA 4J91A 1U28C 2CXTA 4GOKA 5EUQB 5C8ZA 1QRSA 1P9RA 1X7XB 4CN9A 2VKTA 4EL0A 5AM2A 1JT2A 3LUGA 1SVOA 2VH2A 3HGQA 1DGQA 2YIMA 1X87A 3D64A 4DXHA 2EYQA 3U37A 4K05A 1JUDA 4X6UA 1RJWA 4BCBA 1U2ZA 5ICEA 3L1IA 1FU4A 1V5FA 4WKCA 3QU2A 3CXRA 4NENA 3N8DA 3WL5A 4I8DA 1XVIA 1A5BB 4G0UA 3LU1A 4K88A 4ALNA 4OM8A 2C5GA 3EQ6A 3W77A 3WAJA 1TLTA 2CWDA 2WM9B 2BVNA 4Q9KA 3HXOA 1TC1A 1ZICA 3U3DA 5HOEA 4JBLA 3FSGA 3KR0A 3GHYA 3E15A 3OTWA 2ZCUA 2VRNA 3T7DA 3IAM6 1IM5A 5FD8A 4FN5A 3SX4A 4B44A 4Y9UA 3WHIA 3WV4A 2WKPA 2Z9CA 5KYGA 4JI0B 1Q0RA 4CM1A 1DIRA 1JG3A 2Z3WA 3NBZC 4ZRDA 4DSZA 4WH0A 1I14A 1VHLA 2VDLB 2PY6A 1KS9A 4TLBA 4RXTA 3RJZA 1RP1A 2QK4A 3QF4A 3UBTA 3WL3A 1Z2NX 4P9NA 1U28A 4QGSA 4EP1A 5JEEA 1P39A 5EMHA 4DLNA 2PK3A 2VH5R 2ATEA 5JNLA 1N57A 1P1HA 4KOEC 1XAIA 3M9LA 3D6JA 3L04A 1M73E 4JJ7A 4H2DA 1CUCA 1I7PA 4Q3AA 3DP7A 4BP9A 1BFUA 2VC2B 3B1ZA 1P4GA 2AQKA 2X5NA 4EW3A 1P7VA 2DFDA 4FSHA 4IGAA 3V4PB 3WISA 4ID3A 4G0VA 3B9RA 3H05A 4UUOA 3FOZA 1HNWB 2WK1A 1UPTA 4PTYA 3TLEA 2F90A 3RYHB 1NF9A 3TDNA 3KJQA 2RK6A 2AEEA 2XRMA 4C5BA 3QE9Y 2GBFA 3Q72A 4HQFA 4HWPA 3U3XA 4M0FA 4Q48A 3D9QX 4YJ2B 2P27A 1DFHA 2WHPB 3P32A 4WK4B 4WZAE 2H7YA 3R5FA 5AKKA 5FR1A 2ZSBA 3DWFA 4DJTA 5IKMA 3OJXA 2H7XA 4DA4A 4IG4A 4RHYA 1ZYUA 4E5VA 1VI2A 1ZKDA 4N3GA 5EFZA 5C3MA 3IA7A 4Z0PA 3UV6A 4C01A 3HSKA 1B2RA 1G7SA 2B3DA 1EM8A 2ECKA 4FN4A 3EZ2A 3H2SA 4BZPA 3FCUB 1HDXA 3Q7SA 4UPEA 3TPCA 3B6MA 5HK9A 3AI3A 3DZHA 3EIOA 2ZYUX 4KO8A 1XN1A 4E2XA 2RH5A 4UAUA 4PRYA 3RC2A 2I6FA 4TUYF 3O8OB 2ZRIA 4F4DA 3WJ7A 3D0QA 4WY2A 3M33A 4LHWA 3QTBA 2W70A 3VPHA 2EDCA 3WGMA 5ERGB 1TF5A 5C8DA 1KGSA 5CD9A 5J9FA 3FI0A 1W47A 4CG2A 2QXUA 4UU7A 1OX4A 1LW6E 2VUUA 4YRFA 1NTRA 2RAFA 4NG5A 4EHHA 2QE7D 4IEIA 5KX5F 1TEZA 1VBMA 3QUCA 3DPUA 3F97A 1ZQ9A 4CFYA 2O9JA 3DB1A 4NXMB 2ZYDA 3H2JA 3N87A 4ZAGA 1GGJA 3RS9A 4FEAA 2CVQA 1RADA 5DHAA 3AGPA 3GD5A 1N9GB 3KYBA 4MQFA 1Y3DE 3H2BA 5IJAA 2MSLA 5ICFA 5A4DA 4QVKA 3CX8A 4XD7D 3QXSA 1A69A 1NMQA 3AY3A 4DCTA 4URHA 3TIIA 4ZOQI 8GPBA 1EFVB 1Q3HA 2ZIFA 1E8MA 3AJ8A 1N36B 3OKCA 1DXYA 1C4XA 3FPJA 4QEKA 4EB8A 2NT3A 3UK7A 2JAPA 5JD3A 1J20A 4BKQA 3SVLA 1WNFA 1NV8A 3H9EO 1I3LA 3O3CA 3KSMA 4MR8A 4QA9A 3D7SA 1KBOA 1KFKB 1D8TA 2Z8YM 1PE0A 3FPLA 1EK6A 1NLFA 3C0KA 1OUMA 3DR5A 4J76A 1PBNA 4MWOA 1Z2DA 2CV0A 1P61B 2ACVA 4F8EA 4TZ0A 1USGA 3KVOA 4DM3A 4IQ4A 4GDMA 1ADFA 1SG9A 3OUUA 3ZCSA 1UOOA 3BB1A 3RARA 3L06A 1BA2A 2XQGA 3M4ZA 2AD1A 1XMVA 1RRPA 3MJDA 5K3SA 3W1VA 1U9IC 3WLIA 4JEUA 1UM8A 2NUTB 2WMYA 3P9CA 2IUUA 4F5DA 4Z4IA 1Y3AA 2WE7A 4JOSA 4CXMA 2ZRCA 3GCXA 3BMCB 2DUUA 4EBBA 4D0RA 1T1EA 3IESA 1QIDA 3O3MB 3RTAA 3COSA 3PC3A 1AS2A 3NWPA 1ODTC 3UOGA 2ZBPA 4D43A 1U3FA 3TR0A 3FXAA 1QFZA 3VPGA 4HWRA 1YJAA 4M1SA 2CBGA 2FP3A 2FE4A 5TLSA 3ZWCA 2NU9B 1HWYA 5LZ8A 3DE4X 1QIIA 1S3FA 4LDPA 1K08A 4YV2A 3FUTA 3FRJA 1XRNA 5JZVA 4F9TA 3EW7A 4D6XA 2H8KA 4D81A 1JHXA 1R50A 1ZD1A 2IEYA 2YFKA 1OC2A 3O26A 4JGGA 5K3FB 2Z2XA 3GVHA 2RB4A 1EMDA 2ZVPX 3VAAA 3V9PA 4C6HA 2Q3BA 2C2WA 4P7JA 4LF9B 5H9VA 1XNQB 3GVCA 1V6SA 1I6WA 3CF2A 1H6AA 1DKMA 2EW8A 4WKGA 1QC5A 5EOVA 2OBFA 3DDWA 4J1SA 4TVSA 3ESZA 1GAXA 3C8DA 1UT5A 3EXIB 2DUMA 2LTAA 4KLCA 2C2YA 3RYCB 3VUEA 4AZ0B 4R71A 5F12A 1T8WA 1XRMA 1U3TA 2ZYHA 3LHKA 1ONOA 3IUBA 4C3ZA 2FEPA 2GN1A 1U9IA 3CRMA 3EAQA 5ECGC 1IBLB 3IEUA 1T4MA 5LD2B 2YICA 4ISCA 1E2UA 4UTRA 4WA8A 4YONB 5F4BA 5DLQC 2FR1A 3GARA 4KDFA 3ZHBA 3U19A 2YW2A 3IV7A 4QO7A 3RSGA 2HJRA 4CMEC 1KQPA 4D4LA 4DCNA 4NAVA 3TPZA 4AJ4A 4R1PA 3VC3A 2XXAA 3LQ2A 2BKUA 1W4CA 4R83A 5EHGA 3S68A 3MJSA 3BORA 3WRXC 4FFSA 3EXAA 4BMNA 5A7FA 1JQJC 1D7AA 2EQ5A 1K3TA 1DG3A 4YDRA 4HPJB 2P5UA 4Y67A 3NTXA 3LZCA 1FSZA 3W9UA 2PKCA 1KJ9A 1UAGA 5AK4A 1V96A 3BWMA 4GWGA 1THZA 3OOHA 3RD5A 4QIHA 5A0FA 2XGJA 3L0ZA 1LNQA 1ND5A 3DYVA 2EEPA 4XR4A 3MPOA 5CVTA 1LBQA 4BBJA 3UENA 2GFHA 3HXLA 1PWZA 3WB0A 2MMGA 4A1FA 1PG5A 4CF3A 1CS0B 2GZ3A 1GU0A 4KP7A 1ZGCA 3UK2A 3ZDRA 1QOZA 2ZM6B 3K1JA 5FUXA 3PEFA 4MW4A 4BASA 3P71T 2QGZA 5EKUA 1BIFA 3T8YA 1RYYA 1W2WB 2IYPA 2R4QA 3AETB 1BN6A 2IQ5A 3PDUA 4LBVA 4BNVA 3GJTA 3WWPA 1W0KD 3KPYA 4PX3A 4RU1A 4YQEA 1JVNA 4O0MA 3KFVA 1YR3A 3N2EA 2VQFB 3K5IA 5K0CA 2O54A 1Y48E 4MQBA 3BE6A 4TWZA 1Y80A 2FZKA 4AIIA 4WKPA 3ZE1B 4CMEA 4DVGA 1NVKA 4G4SO 2IUTA 4RBNA 3KUKA 4EHBA 3WRXA 2Y66A 2NZUG 4Q7LA 4H17A 5FBWB 2VNHA 4OYLA 4RSHA 1WCIB 1F14A 2FOXA 2ZSKA 3IBYA 2QE7A 2XQVA 2HRZA 4Z8XA 1FFDA 1FSSA 1LGYA 4XJTA 4K0KB 1T10A 3ID6C 3SC3A 2PZEA 4ZVTA 2YFYA 4ZXFA 1TECE 5AHWA 1OZFA 2BUCA 3UJ7A 3DNMA 3EYAA 1T5TA 1WB4A 2DFTA 2RI1A 4RSMA 1BYIA 4I5EA 1ESMA 2O4CA 4J03A 3W3AH 4XD7A 2O7NA 3AKCA 1G20B 1FFWA 4GZ5A 4XWYA 5IABA 1MX1A 1B1CA 2HJVA 3OMXA 1G3RA 1E5QA 3LCJA 1HLPA 4XDGA 1SU8A 4LTDA 1OHHA 3SXUB 1DUSA 1Z7EA 3BKXA 4YHBA 3M89A 5ED0A 1EI9A 3CZPA 5H81A 5C8XA 2QMZA 3P9XA 4MH0R 5MN6A 1KMNA 3B5EA 3ZK9A 3TQFA 2EJTA 1RD4A 4LBYA 2JS7A 2HO4A 1RAIA 3OHPA 2YL2A 4P34A 3ZLBA 4ZMRA 1W19A 5J43A 2J3IA 3N2GB 2QAIA 2B92A 5E8RA 4S1VA 4OGFA 4HDKB 4UQPA 3G0GA 4WFKA 2RHRA 3EXEB 4QFBA 2EAUA 4QUIA 3Q7QA 3UHJA 3OQIB 5BW6B 5FB3A 1YDFA 2JARA 3WBJA 1U9ZA 2FMIA 4R1MA 3I4CA 2CHVA 4DPLA 2FEWB 5A3RA 2BIFA 3W6UA 1C80A 1ZD5A 2VDKB 3GGDA 5FUWA 1Q1BA 2XB8A 4ZYTA 2B8EA 2BF7A 5DU2A 2R8EA 4CLDA 3PUHA 2ICAA 1XEXA 1CDZA 1ZS9A 4LQCA 4C3UA 1CHDA 1HFEL 4F93B 4OXQA 4BNDA 3OM8A 4U6QA 1NHWA 4JT4A 5D85A 2JIZD 2GYVA 1ZI8A 2VHVA 3T3MB 3K16A 3ZHZA 2DGDA 3TK1A 2CNNA 4WD3A 3S5JA 2ONCA 1J06A 1M1NA 1SXJD 2Q2QA 1J39A 5FOUA 1MJGM 5JAQA 1XDZA 4F84A 4R0MA 5BN4A 2CCJA 3RT9A 2WJYA 1U2SA 4W9RA 3AF1A 5BT9A 3NHMA 1DZ3A 2W2KB 1XAJA 3OX2A 5TQVA 5KTSA 4XQGA 2ZTSA 2A84A 5K6TA 5IAKA 1FLNA 1KK2A 1JT9A 1UPAA 3LDUA 4JJ6A 4M53A 5DLYA 4BNWA 2EVWX 1W35A 4KWHA 1OROA 5JYDA 2ZJBA 1KORA 3LY7A 4JSYA 2FPWA 2YNMD 4QYIB 4B85A 3L1VA 2ATCA 2IIQA 1JP7A 2Q3HA 4P4SA 5DGCA 4CWAA 2V7EA 5THKA 2XMPA 1TUBB 1ZK4A 4MSUA 5DHFA 2OCIA 2CLMB 3IE0A 1YT5A 4FYYA 3U1VA 1TEVA 2XUIA 4Y7CA 1L7DA 2B2CA 4BP8A 3C6MA 4BQFA 4PN7A 5FI1B 1IOWA 2NO9A 3ND9A 1T1IA 4J2HA 4K2HA 2NXWA 1LNSA 2AI1A 2VT7A 5C1PA 1I6KA 1SKUA 4MYDA 2IU4A 1UK6A 3FPAA 1FF9A 2A88A 3FB1A 4ZP1A 3GLGE 2B82A 1R6TA 1Q2XA 5KYWA 3B3QA 1V16B 2EKDA 1YHZA 4FOOA 1P1IA 2AXQA 4AX4A 1NN3A 5HE8A 3UJPA 3D6TB 4GKVA 3KB2A 2UYYA 3AONB 1VJ5A 4V0ME 4JLDA 1IBKB 2R6HA 1FFGA 4HDCA 5KJ1A 4LE1A 3G1UA 3VZPA 3EGDA 1XPUA 1E60A 1SWWA 2C2MA 4TTIA 2ZT6A 4OP3A 2OGUA 1X39A 2PYDA 3O73A 4NAUA 2JFNA 3JAKB 4NKRA 2VJNA 4F92B 3MJHA 1PJSA 4OB6A 3DZDA 1REQA 2GEFA 2F67A 2HIAA 5AHOA 4EY8A 8ATCA 4EBFA 1NT2A 2LE0A 5AW5A 3V8RA 3HRHA 1Q12A 3A2KA 2C4TA 2Y1WA 3ZJUA 1WDWB 1FNNA 3PXDA 3EG5A 5EWMA 1FYEA 4FHFA 5JYCA 5ELLA 4O4LA 2CWWA 1AKVA 2G83A 4IINA 4ZEXA 2I76A 2NSHA 4CEHB 1GKLA 2Q2OA 4M1KA 3WIDA 1QCCA 3PFWO 3UMFA 1YS6A 3NMUF 1LQTA 1ZR2A 4L57A 4HYYA 1YRLA 1NNUA 4DW8A 3L7OA 5AP9A 1EA5A 1RR6A 3IDZA 4GT1A 4PO8A 1TYEB 2Y0PA 5FADA 1OBOA 4JQCA 1QIJA 2PUBA 3R8XA 5E0KB 4XLTA 5KJ6A 1F48A 2ZI3A 4IDFA 4YLEA 5JAMA 3LBYA 4DNQA 4L0CA 4WZAA 4LK2A 4EG4A 1S5PA 2M1XA 1R8QA 4HWTA 1ZP6A 2WVHA 1VSBA 4PVDA 4KXWA 5J3JA 1GU1A 1CJSA 1ODKA 1U2PA 2XT6A 3ECAA 3GUUA 3I42A 3PHIA 5E4TA 2J9FA 2QSJA 1Z88A 5TDHA 2JB9A 4WJKB 3VISA 1VSQA 4BMXA 2ZT5A 4OFWA 3E8MA 5A6SA 3DOEA 2BGNA 4F2WA 2QNIA 2DH6A 4Y9RA 3E9YA 4A3SA 4F3NA 4ZZ0A 3AU8A 1B43A 4HB2A 2P6PA 3T3GA 2ZETA 4MAFA 1FZQA 1BJKA 4JUFA 2WMOB 5IULC 4DR3B 1GADO 4IBOA 4LDAA 2ZLBA 2B2NA 4D0NA 1OB5A 4BMYA 4BUJA 2MWMA 3ABOB 2AFVA 1NYLA 3PWTA 4QPPA 4UE3S 1SK9A 2HC9A 3P2KA 3EIHA 2VSOA 3S29A 3FH0A 1M74A 2UUOA 4PHGA 1NLMA 2YNMC 1VCIA 3I9LA 3C3EA 3MBOA 3OZCA 4J2OA 5JV5A 4ZEVA 1C8BA 4M4SA 5KYYA 1R5OA 1ACLA 3TE6A 4P82A 3RGWS 2WTMA 1H2BA 4BV8A 3MPUA 2PV0A 3AFNA 2WQ6A 2L17A 2Y68A 4IDAA 4L4SA 5CIWA 3WP0A 4IOMA 4DMMA 1P1BA 3Q3IA 2ZYTX 3HWRA 3CE6A 2Q1XA 3ZN2A 4JB3A 1EFPB 3QEAZ 3H97A 1EJ0A 5C5EA 4DSAA 2WAYA 4R1OA 2GI4A 3PPYA 5TGTA 1AA6A 3AM3A 5EQFA 1PV1A 3PGJA 2XB2A 4EO7A 2JIZA 3C7KA 1DVRA 4ZEWA 1ONSA 5JANA 3JYHA 4TSFD 4BLVA 5JSZA 4ZREA 3PFFA 1XMXA 4LGVA 1RAAA 4HAZA 4G0ZA 4EI2A 5CEFA 2PUHA 1KH1A 3BDVA 3TMYA 5KYTA 1KIMA 1JL3A 1R5JA 3FUUA 2IYOA 3G82C 4RV4A 1PV4A 2JBHA 3FGNA 4QDTA 3S1AB 4CDRA 3V4LA 4AS3A 5KTOA 3UB3A 1UEIA 3KT3A 1CRLA 3IP9A 3C39A 1CUIA 1Y1SA 2FXVA 1DKOA 2HF7A 1NVGA 1HKUA 3E6AA 3FNBA 3ILHA 4HQNA 3W6ZA 1FP2A 2DERA 2YNMA 1NMSA 1VCOA 4EUNA 3LKZA 2Q28A 4NPAA 1J9ZA 1R8XA 1RLTA 1TMOA 3HA3A 3KLPX 3RANA 3TQHA 3QEJA 1Q2UA 5AW2A 1HEYA 1OJ7A 2W6MA 1AC5A 1I6LA 1QH0A 1XEWX 1H42A 2JJYA 3K7EA 5BYBA 4OY3A 3PWSA 4B83A 5I47A 1DJNA 1W1IA 3BC1A 1XZQA 2NV2B 1WLSA 4G5QA 5F35A 1G5QA 2Z5LA 4RZUA 4QXOA 4ZOCA 3VSAA 1C1YA 1NW7A 3V8NA 2RB5A 3QVOA 3MLAA 3S2SA 1EXWA 2Z58A 2ZK7A 3CLSD 3MN1A 3WWEA 3AEUB 3CRNA 3E9MA 4JYMA 2GNOA 3HUEA 5TPWA 2IYWA 1F0NA 3A1EA 5B3AA 3V4VB 4X63A 5FPPA 3SJZA 1T9AA 3GMSA 3OJFA 4TMYA 1ZFNA 1EE9A 4H0CA 2PHZA 1KO1A 4JROA 1MXFA 5KYKA 4KJZA 3ZTTA 4X62B 4H15A 4JHXA 2J33A 2H1CA 4FHZA 1I1OA 2G6TA 3R6LA 4CM3A 4DKJA 2NP6A 1ZWLA 3BMNA 3L8YA 3BAFA 1P5ZB 2R8BA 2EZ8A 1Q0QA 4PAGA 2PA3A 3AL2A 1SVSA 1T5LA 1XU7A 3EH1A 4QRDA 2HJSA 4G5FA 1N8SA 2N0SA 2J9GA 5CA0F 1EWKA 1Z36A 5A5VA 1NVBA 2QRGA 3AQ4A 2AR9A 3GCGA 4JR0A 5LBIA 4KR9A 2XRYA 4FR5A 3KCQA 2JFHA 2AYZA 3KQSA 1TADA 3MILA 4W8OA 4D46A 3TOVA 3F49S 3PDHA 4U7PB 2V3WA 2YRWA 3GJ8A 2PH3A 2PZ8A 1U7ZA 4LSZA 5CA1B 2FSFA 2CLHB 2K87A 4KR0A 4F60A 1ECJA 2QXTA 1DCTA 3CBGA 2N1MA 2W6NA 4MTLA 1SUIA 1ACJA 2EGGA 4LQLA 5JH7B 1NG9A 1SCDA 5JNUA 5K2OA 3H42B 4W5RA 2ET6A 3KZ1E 2Q1TA 2Z8XA 3GW8A 3I0ZA 4MCIA 1P29A 5FULA 5LP6C 2JCXA 3ZWBA 3STVA 4EZBA 1MB4A 1MC5A 2AI2A 2IH2A 2IELA 2VQ3A 3DEJA 2VJQA 3OZBA 4LUCA 4HNQA 4BRUA 1CE8B 2JLYA 1ZJWA 4C2UA 1JJVA 3FTFA 1PTKA 1UK7A 4PZUA 1O4WA 3RTBA 2BH9A 4S12A 1H5UA 3D6AA 2J5BA 3KU1A 4DLAA 5I5EA 4TXHA 3DTVA 1XHFA 1I24A 1VECA 3VPCA 1FSGA 5GTDA 4RGQA 2RD2A 4Z9BA 3FLMA 4PSVA 3HCRA 2XUJA 3S2YA 3KXKA 4NV0A 1BWPA 5F4ZA 5HQJA 4QGHA 4WV3A 5T6MA 3WYFA 1LC3A 4EJSC 4MRRA 3J81k 5EWJB 3NM4A 4EMUA 1XNHA 1LX6A 1E3JA 4IIEA 2O2DA 1A5TA 5I9NA 4CQMB 3PS9A 1IHXA 3EMDA 3L46A 1W581 1R6DA 2OAEA 2NQ2C 3IMGA 3THRA 3CXUA 3G2KA 1KYWA 4NCNA 1L4LA 4GX1A 1W0JD 2HQBA 1VL5A 4GMDA 4LOHA 4YRGA 2OHFA 3B1JA 2W4MA 4FI3F 1LTHR 2YXNA 2AOVA 1AGYA 1H0HA 4MDHA 3GJRA 1VLQA 2NP7A 5ALFA 1CEEA 1I10A 2WZCA 2I4NA 5KHAA 2PGLA 5IG2A 3H5IA 3G8BA 3MWJA 1EGMB 4OHRA 1J7JA 1ZIPA 3LOUA 2ZZMA 1LLFA 1G5RA 2REXB 2RFLA 2QAGB 1CB7A 3GA5A 2GTIA 3IGFA 3WYNA 4B6RA 2HXSA 4F9EA 3EZGA 2BHTA 3FPKA 1T26A 3CLSC 4RETA 4J0IA 4B9EA 2I4OA 2ZJ2A 1JDVA 3TG8A 2D8MA 1XV5A 2PL1A 3ORFA 5TB5A 3QLVC 3T54A 5BSFA 4QM7A 1PFVA 4UTPA 1UJNA 4TSFA 2X6TA 1GQQA 1Y6GA 3FDIA 2GCNA 3GPIA 5LC1A 2WU3A 4AULA 1FS4A 1Z47A 2RHCA 3GVXA 4G5XA 4M55A 5ESRA 4EJSA 1QX4A 2G80A 4IIJF 4DEYA 1W5BA 1L7BA 4L5CA 2AW3A 3ICEA 3MW8A 1P73A 3IBGA 4AQYB 3GN2A 3M4NA 3ZWQA 4O2BB 4UM9D 5K0JA 4YXFA 2JI8A 2ZAYA 2ZTHA 5IMSA 3ZVKA 4JVMA 3ANYB 1YQXA 1OB2A 4LJLA 4FILA 4BBPA 2A0WA 4MR9A 1DWQA 3VU1A 2HL6A 1ENPA 2O3SA 4P3PA 1TTPB 1ISPA 2AI3A 3ODGA 1DI0A 1QZTA 1YE5A 3MGCA 5DIZA 1R4MA 3OZXA 1QIHA 4QO8A 3SY8A 1BWSA 1BW9B 1PEYA 1SB9A 3DYBA 3VJKA 4A6EA 1I5EA 3Q3VA 5AW9A 4PYNA 3V34A 2JLUA 2CUKA 3LLMA 2ZQYA 2ZROA 3ENQA 4K9SA 2YQ4A 1GPUA 1EXMA 1EQAA 1C9EA 3MZ0A 2CHUA 1CDEA 1WKCA 2D62A 3QLVA 4L76A 3WLKX 4WXMA 3H9QA 3HCCA 4E5PA 1E89A 4PC7A 2WRZA 1TQDA 2CL0X 2HTFA 1FK8A 4HADA 3BJIC 2CSUA 2P67A 3E35A 3OU7A 4HVAA 1Q0TA 4OAQA 3O3OB 2ZI4A 3QMPA 3WQHA 3AVQA 1GN8A 3ZYCA 2GKOA 5I8ZA 5T67A 4GQIA 4JMLA 1G41A 2HHAA 1Y6FA 2D1RA 2A1TR 4UMVA 2VCYA 5IXJA 1I33A 1Q57A 4RD0A 4U7GA 1OE0A 2Q1WA 5EIFA 4CN8A 2L0XA 5TC4A 3ZNOA 5KQPA 3GLGA 1U02A 3AI2A 5FTMA 4ZOBA 5ALNA 4J0JA 5LB4A 5A4KA 1I4LD 3KZVA 4B3MB 3VYSB 3AJEA 3HPRA 3QNMA 1EP1B 3A70A 3ZHTA 1P8AA 5A04A 4JVOA 2IU3A 5C18A 5AOVA 3RAEC 2ZJZA 3PQ7A 1UDBA 4V0MA 2JIMA 5IBQA 2EGUA 3CQ9A 2IHKA 4EW6A 4N9WA 3OIGA 4M0LA 1EFDN 5DBGA 1XTKA 3ZVNA 1W76A 3T5TA 3TG2A 3N5KA 2IYSA 5F9MA 4M46A 4JT9A 5HM6A 1VE5A 4L0DA 3L6UA 1NW5A 1E4YA 3GAFA 4UTVA 2VDWB 4DYDA 4YC7A 4RVHA 4ARUA 1Y4UA 2EFDB 1EDDA 4OYRA 2EF0A 4TT3D 1E7QA 3AUXA 3H6KA 4FGLA 3DOOA 2EZ9A 4MPPA 1WV0A 5CH5A 1RWNA 4URZR 5F5XA 1DLIA 1KI4A 1VCNA 1YI0A 3MRSA 3UJCA 3LK6A 1SIBE 4I6EA 2Q07A 5DSTA 3SLRA 1BU5A 3LNTA 4V0OA 5F9HA 3KQVA 1XDSA 3EG9A 3I61A 3SSNA 4Y1GA 4UC0A 1M1XB 2F1HA 2PAAA 4O4HF 3KJXA 3AF0A 4UD2A 4TYMA 1C7JA 3OT4A 4X20A 3FI9A 2PXHA 1E5LA 3D6HA 1YZNA 4YR9A 5ITVA 5CB4A 3H86A 2J7KA 3BXZA 3C2QA 5L3SB 3FSEA 5IC4A 4JEHA 2GKGA 3W4IA 1KU0A 1V3UA 3IAS1 3M6WA 4MO9A 3ZD7A 1UBOS 1VL8A 3FJ1A 3U3JA 3IELA 1T6ZA 3EF0A 1QK4A 3JAWA 3UH1A 1DIOB 2H7VA 4N54A 1TU3A 3BL5A 2NU7B 2F1KA 3UAZA 1UP7A 1W0JA 1ZIXA 1WJGA 2JK1A 3WB2A 2C92A 2VKQA 3C7CB 3H87A 4ETWA 1L7RA 2B4TO 3HC7A 4RE5A 1GAJA 8ADHA 5JATA 1GPDG 1T3HA 3VR6D 1E5DA 2WHXA 2GO1A 3M1AA 2O3TA 3T5CA 3OJEA 3ME5A 3BMXA 4JN6B 5EFOA 3U7HB 1BQ4A 4KFTA 1YFJA 4BB0A 4DIBA 4BMPB 5EQDA 5BQ5A 4KK3A 3PA6A 1JU4A 1Q77A 3E9QA 2B9EA 2IOHA 3IPXA 4LXTA 4GSYA 1HURA 4Z9YA 1U3CA 1A1VA 4GGPA 1UXOA 1PVOA 3G5TA 1PX2A 3L7DA 4Q4JB 2ZE6A 5JS8A 3N1UA 3NRJA 2CVZA 3INGA 3SQLA 1RRVA 5LMCA 3HXMA 1T6YA 2I6UA 1K7SN 2HADA 3A37A 3C1TA 4L8YA 2CYBA 1M8KA 4NHOA 5ALRA 3W90A 2A2ZA 2BONA 2JASA 3VYUB 3KJFA 3PQ4A 1PS9A 3WGTA 2ZE5A 4XJXA 4HVTA 4IIVA 4XVUA 4W5HA 1WMAA 4FHEA 2D3TA 2NX2A 4K0RA 3CNHA 3GFFA 2EFJA 4MWTA 4QUGA 1WXXA 3C16C 3RABA 2C8LA 1QS0A 2FPRA 3CRQA 4K87A 4PZ9A 1H05A 2Q7XA 2WWRA 3T5DA 1QZXA 1WPRA 4D9KA 4WOJA 4TTJA 3LDHA 4Y6SA 5BN5B 2ERXA 2VPTA 2ZI9A 4OFXA 4AG3A 5EJAA 2JGIA 5AW8A 3PDJA 1R18A 3B6KA 1OQAA 2J9XB 3MCUA 1P44A 2MCFA 4X64B 5CNKA 2OG2A 1HY3A 2QSUA 1Z4IA 4W5JA 3QU5A 1E1RD 1L5SA 1SRRA 1HDGO 2ZRGA 2DECA 4R0NA 1ZMXA 2Y1XA 3AR2A 3DLBA 1Z0DA 4ZCRA 4Z0HO 3F78A 3INRA 4BTLA 4HB3A 1PJCA 3SZRA 2D7JA 1DKRA 4QDOA 4ZV7A 1X9HA 5AKEA 2EGHA 3T1TA 1DCFA 1BFDA 3QXXA 3Q3CA 4C2BA 2V4MA 1M8JA 3U0BA 5B1YA 2FZVA 3VU0A 3QLJA 3EISA 4DBLC 4MMYB 2QJOA 1E5TA 1TFRA 1U0RA 2GWHA 1EFAA 4FFPA 4R4JA 1TZKA 4E5SA 3KNZA 4H0FA 2PX5A 3QYFA 3WLSA 4FKBA 5DCWA 1QQBA 1L6RA 3RS5A 2WTXA 3TD6A 4D82A 1QU3A 3RFCA 2BUAA 2LCFA 2IHVA 5H68A 5MDHA 1VMDA 1NJ2A 5KSPA 1H66A 5LVAA 2L18A 3Q3EA 2YIDA 2VK4A 1M10A 1WTAA 3FCYA 3UB2A 4XWKA 5AESA 1HV8A 3NV7A 4KWCA 4XTCS 2FJUA 1CZHA 4A73A 1W6UA 4X92A 5K6AC 1PJTA 5E9QA 1Y1KE 1UBKS 3PE3A 3WWOA 5DGDA 1Q83A 1UMBB 1ZVQA 4O8CA 4XYMA 5DX8A 3TL3A 3G7UA 3ZV3A 2FQ1A 3LCUA 1QYCA 3IA2A 2DT5A 1UWLA 1G4UR 4I50B 3TQOA 3LT5A 3DE3X 2I3AA 4KR2A 1B41A 3FYHA 3JV7A 3O91A 2YN4A 3ILSA 1ZITA 3ZW7A 4YAEA 1UDCA 4DABA 1RAEA 2O0HA 2PVSA 1IN5A 4KTVE 5JSKA 4DMCA 4GRIA 1N25A 3A9CA 2W5UA 3K6RA 2PXXA 2QUKA 1UKVY 3GUZA 3MCAA 2QUIA 1ZPDA 2VOEA 4FDLA 1YDMA 4Q4DA 4TT3A 5HZMA 1ABBA 2FY8A 2R1VB 4AUKA 4J0CA 1DU4A 1JS1X 4L74A 3FYUB 2XV1A 3TI9A 1G6Q1 1MAHA 2OD2A 3IKMB 2WP0A 1CJMA 1XTTA 4I1IA 1IEXA 4HXYA 1GTG1 1PJ4A 3UG7A 3VNRA 5EEGA 3FWKA 4CCYB 3GJSA 2MSCB 1BMDA 2CUZA 4H7EA 4QHSA 3OQHA 3VH3A 1ULAA 3AVXA 4J0KA 4KYVA 4QODA 5LQRA 5K6AA 2D5BA 3QXCA 3TLXA 3UWMA 4CEIB 1UBRS 1N7IA 4MI6A 2XCOA 2VH1A 3MQ2A 4IZHA 5B2ZA 3PNQA 5DMXA 5HZHA 3U09A 4LI3X 2FLKA 3DE5X 3RIHA 3SFVA 4QM6A 1NBEA 3DOJA 3QEMA 2KW5A 3TJRA 4DMUB 2UXCB 2G77B 2PQ0A 3N0RA 1L7MA 3RQSA 2W83A 3BFXA 4LBWA 4TL9A 1Z7WA 2NZWA 3LX5A 1MR3F 3ELYA 3EVEA 4V0NA 2H5LA 2WHRA 1SBTA 2B94A 3VHLB 3GMIA 3IMFA 2H9IA 4JHLA 4ZKEA 1VPLA 1YB1A 3J80A 4B81A 4UNQA 1JTVA 2XWQA 5AI8A 2VWPA 3UICA 1E2PA 2R1ZA 5B64A 4V24A 1JTFA 1C7EA 1TIKA 1DFGA 1JHAA 1GUYA 1JRLA 1ZM3A 3A27A 4NBUA 4DAOA 5I7HA 4YCJA 1JG4A 3QUSA 3VR6A 5KU1A 1BHSA 1AHPA 3OIYA 4JBGA 4G23A 5TE9A 3WYCA 3BXXA 3ERCA 1ISSA 2IF0A 2YW9A 5DPMA 1KVRA 1DXHA 3SBDA 3W5UA 4Q21A 4DRXA 5I7VA 3FMIA 1E7RA 2CF5A 3DL4A 2GRJA 2DUWA 2XWSA 3K2BA 2AMLA 3PHLA 5A6VA 1UMCA 2QM3A 3Q87B 1H9CA 1R6VA 4BU1A 4LHXA 5JADA 3F67A 4ENWA 4DKXA 3M49A 2I4IA 3ICQB 1NDQA 4HQKA 4LC0A 4MVCA 3H7IA 3RU9A 1DCMA 1WV1A 3AJAA 4K1XA 3GOHA 4RK5A 4D79A 2FQQA 3LIPA 2WINI 2QTVA 1WP9A 1VDMA 3TR5A 1AT1A 1JPJA 1X7WB 4LAFA 5PNTA 4CIDA 3OC6A 1VB5A 1F6DA 1CDOA 4R8KA 3MM4A 4NQRA 5JIBA 1UMDA 1ZHFA 3JQCA 4WBNA 1Z56C 2WU1A 4IGIA 1O0CA 4V1CA 3OE1A 3WXMA 6ABPA 4HAVA 3BF7A 1GRQA 3G6KA 2MSKA 4EYKA 5EQJB 3FHOA 1X86B 3IAM1 5E95A 5ALMA 4HBGA 3KIPA 2P2DA 2GM3A 3ISTA 3KKQA 1HT0A 3NTQA 4M49A 1BXKA 1FDWA 1ESNA 2ZJFA 3OCVA 4LOJA 4PXAA 1CY1A 3EAGA 4DLKA 5PGMA 6REQB 2Y2VA 1E1RA 3B6EA 1P4JA 4GM4A 3ZCXA 1FE8A 5K0SA 4OH1A 4M54A 4G01B 3RW9A 1V11A 2FQWA 4BIIA 2XGOA 3GWGA 4DLYA 2F3RA 3ZI0A 4UAGA 3PV0A 2R1UA 3KC2A 4KFUA 2GN8A 4O5OA 1CTQA 1NVTA 3WVNA 3ZXXA 1RWPA 1U8ZA 4WT7A 1R9MA 5I4CA 4OLHA 1K7YA 4CBVA 1RZRD 1L7QA 1EEHA 4O6VA 2VHUA 5BWMA 2J3DA 3HCOA 4IVPA 4DILA 1MBZA 1U2GC 2HHLA 4UZFA 4O25A 5IVDA 3QU7A 5AM0A 3ANMA 3FAZA 1KXJA 3U7FB 2JIQA 1F12A 4E22A 2J0VA 5A7HA 2P2GA 3S6JA 5K51A 2P9EA 3ZE2B 1HZZC 5LZ9A 1P4SA 2NTVA 2VAVA 4H7JA 3HJAA 3KHKA 4FIDA 3ZTWA 3OZ7A 3ZDCA 5AOCA 1CP3A 1T1SA 2F3SA 3H5NA 1Q1EA 1J0AA 1GUDA 1R0CA 3GGGA 3CPJB 2JAQA 3GZNB 3ILYA 2CZCA 1VFNA 2I3BA 3R3XA 3UHPA 1QP4A 1RCUA 3UCEA 3T1HB 2II6A 4J3FA 2QQEA 1ULHA 3GLTA 3I9KA 1PR1A 1PYDA 1JAYA 3AHFA 3PRHA 3PPWA 4KB5A 3A3OA 4F3YA 3P19A 2QN3A 3G89A 4KGXA 4BQEA 2SBTA 1N5OX 1UQRA 2JJMA 1RJ9A 2NYRA 4NBRA 1SHKA 1ZVMA 1UBUS 3LXXA 1DRUA 3VM6A 5J58A 1VRVA 4CF5A 2I2WA 4HRVA 3BD9A 1Z0IA 3QW4B 3P2EA 3R7BA 4DG5A 2ZRKA 5HMMA 3X1YA 4LHVA 1TYAE 4P81A 5J2UA 3H4TA 3RYFB 1F9AA 3WYAA 4HX5A 1KZ1A 1QM5A 1T8UA 1BE1A 1U2GA 1CEQA 1JA9A 4OYHA 3ZIAA 2QRQA 3GEHA 4LPKA 3U6KA 1ISMA 1EP3B 1D6NA 1JHMA 2VCEA 3AR7A 3EFHA 1EZ4A 3MHPA 3MMZA 2X19A 1IDOA 4RD4A 2IW1A 1G6OA 3OLVA 4W7HA 1HZZA 1ZK3A 3QKWA 5AJVB 3IXLA 4CPDA 3FR8A 3EDCA 4PFSA 4IDEA 4WNYA 1YRAA 1LPNA 3FDJA 3IEVA 1H2WA 2JCBA 3F3MA 1OLXA 1XYYA 4BOYA 3VGPA 4WXPA 3T5PA 1TFUA 4AP5A 3V8BA 3LCCA 4NZOA 4WGGA 1EHIA 1CNEA 4IDGA 1HEUA 1SELA 3Q40A 1E2JA 4CIAA 2PUEA 2O8BA 2G07A 3ABQB 2QLNA 4EB6B 3DCNA 1AKQA 1QRAA 3PC2A 4GL4A 1DC3A 5B7GA 4ZTBA 3ADBA 2H2GA 4JYAB 1X1CA 2I2XB 3K9FC 1WSAA 1XJWA 2H5JA 4MVYA 2YKGA 4HGPA 1ZOIA 1QGUB 3NWOA 4RMGA 3K6KA 1R5NA 3WICA 1IIBA 4BZXA 4JAVC 2NZ8A 4JL8A 3NKLA 3MTAA 4PYOA 1K6IA 2V74B 4Q24A 2EZ4A 4HAXA 1IM8A 1U04A 3HDHA 1UJ4A 1AXRA 4PGGA 5JASA 4Y9DA 2GZ1A 4MV7A 3FRIA 1A3CA 1FX0B 3ZD6A 3B13B 1RBMA 1XD9A 3HMKA 3B6ZA 1DO0A 2XOEA 2BC9A 1VGQA 1DWUA 2CMGA 4AJ1A 3E1KA 5JVDA 3T5MA 1PLLA 4QNMA 4D9HA 1T8YA 3RYIB 3OURA 2J5XA 3A8TA 3BPSA 4HWKA 1U1GA 3ZIUA 2FDCA 2EX1A 3OM0A 3ENNA 5BWBA 3FMGA 3SBXA 3BHNA 4X6YA 3TDKA 4J4TA 2PRYA 4KKXB 2EJCA 2AQIA 3VH1A 4NWIA 3D0OA 5TEWA 4ENSA 1J1UA 2QRJA 1L5GB 3Q9UA 3PJDA 4QPZA 3KS9A 4S1TA 3V2HA 3AESA 1YQWA 5IAJA 1U63A 3DDNA 4RPJA 4CM4B 1IUPA 3BD7A 4KO2S 4TWAA 5L40A 4H6PA 4XJSA 1P4AA 1Z2EA 3TB4A 3IEKA 3HBFA