5DNVA

Crystal structure of kai2-like protein from striga (apo state 2)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
271
structure length
271
Chain Sequence
GSMNRVEAARNVHIVGSGDTTVVLGHGFGTDQSVWKHLVPYLVDSYRVLLYDNMGAGSTNPEYFHFERYSTLQGYAHDLLVILHEFNIRSCIFVGHSLSAMTGAIASIIRPDLFQKIVMLSASPRFLNTADYLGGFEPADVEQLAGAIEANYKSWVSGFAPMVVGGDMDSVAVQEFSRTLFNMRPDIARSVFRTIFTSDLRDYLGRVTVPCHIIQSSRDMAVPVSVAGYIHNRVGGRSVVEVMNTEGHLPQLSAPEVAIPVLLRHIKNDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of unique ligand specificity of KAI2-like protein from parasitic weed Striga hermonthica
pubmed doi rcsb
source organism Striga hermonthica
molecule tags Hydrolase
molecule keywords ShKAI2iB
total genus 80
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dnvA00
1JJIA 4AZ0A 3A2MA 4OSEA 3I1IA 5EIEA 1UK9A 2V98A 5LZ7A 5LZ5A 1SCKA 4ZWNA 4AO6A 5EHZA 2JGLA 2QXUA 4AXBA 4IH1A 1RYYA 3MUOA 4Q82A 4UPDA 4ITVA 1N5RA 3M3DA 5DNVA 4ARBA 4Y2SA 2JF0A 1OCEA 1WOMA 2VATA 3T4UA 1Q84A 3RKSA 1TK3A 3R0VA 1DTEA 4X7BA 4Y2TA 1A88A 1H22A 3FYTA 4YASA 5IVDA 2HIHA 1QIHA 3GFFA 1CQWA 3LP5A 1PV1A 5JAOA 4J03A 3QITA 4J7AA 2ROQA 3EQ8A 1QGED 3OG9A 1LNSA 2D0DA 1H23A 1AQLA 4ZV9A 4OPMA 3RLIA 3R3UA 5AM0A 1VA4A 2Z3WA 4Y2JA 5SYMA 4B80A 1YASA 4AN1A 4UHCA 3HC7A 4C4XA 2WIFA 4FOLA 5EIAA 5D3KA 3LS2A 5I9IA 2ZVDA 5CT9A 4MJ3A 4UBOA 3G8YA 1XZEA 2JIDA 5JD4A 1UZAA 3WZMA 4DGQA 3C87A 1LPBB 3WJ2A 4BE4A 2AJDA 3IUQA 4OYLA 4BBZA 1TRHA 4E46A 2ACEA 2RONA 4XX1A 1TCBA 1DWQA 2QZPA 4K6HA 2JGKA 4QE3A 4LYDA 5AIBA 2OCGA 4QLAA 2WUEA 4UHBA 5JZSA 5AKEA 3WA7A 1F8UA 5ALIA 4FBLA 5HK8A 3D4LA 3FWHA 3ICVA 4U2DA 3AFIA 1JKMA 4PSCA 3H2GA 1SFRA 4JYPA 1J1IA 3FVRA 1FFCA 2YH2A 4UBIA 4Q1VA 1MNQA 1HKHA 1ZIXA 1TCAA 1MX9A 1O6FA 5ALYA 4HVTA 1JMYA 5AP9A 2ORYA 1ZI9A 5AI8A 3WK5A 4QNNA 2ZSHA 5AHXA 3O4GA 5DNWA 1F0PA 1MTZA 4W63A 5ALTA 3WZLA 1SCQA 4RNCA 4H35A 3WL8A 4F60A 4MWSA 4W9RA 3HRHA 3EBLA 4ROTA 5A7FA 4X85A 1TKRA 1WCYA 1XKTA 2RIPA 5C81A 2QMQA 5AKZA 5IVHA 1UK7A 3F8SA 4TVKA 4UBNA 3IULA 3AZOA 3DL4A 4WJLA 1BU8A 5AK3A 4P93A 4UHDA 3UUEA 1U65A 2VJDA 4CG3A 2QVBA 3DYIA 4GECA 3WK8A 4HTAA 1KU6A 7YASA 2GZRA 5A62A 4G1FA 2DHEA 1LPSA 3D3NA 3LLCA 1E8MA 1XRNA 4Y2VA 2O7VA 3ICWA 5ALQA 1Q83A 2GBFA 4FHZA 2QT9A 1XZCA 2V9ZA 3UMJA 3UUFA 1HQDA 5JAHA 3H2KA 2Z8ZA 4U2EA 2OG1A 4HS9A 3H17A 1U2EA 5JAPA 4KRXA 1DQZA 4G8DA 3VVLA 4IO0A 1A8QA 1L7AA 2B61A 3C43A 4UUQA 3OOSA 3AUKA 3HZOA 5AM2A 5J3JA 4X97A 3AJAA 4FTWA 1O6GA 2D5LA 5JANA 1AGYA 1YAHA 5AOCA 2WFLA 4BDTA 1E8DA 2XUKA 4BP9A 4J0GA 1R50A 1R88A 1YB6A 2XUIA 4WCVA 2RGUA 3HACA 4DNQA 1CUUA 5ALPA 1LPPA 4MQMA 1XQWA 3AIMA 2AJCA 1QFSA 1IMJA 2K2QB 2FUKA 1VXOA 1W1IA 1CR6A 3STYA 2ACKA 4BYMA 5F4ZA 1K63A 2JGFA 2WG0A 4GWLA 5ALRA 3TJMA 1UFOA 4H7KA 4P08A 4C4YA 3JYHA 4U2FA 3G9ZA 1YCDA 1ZD2P 5FRDA 4RPCA 2HHAA 1E8NA 1QIMA 4HRYA 5EHNA 3WJ1A 2R11A 1VOTA 1H2ZA 3DD5A 5K3FA 1GQRA 4UBMA 1KEZA 3QM1A 3I2GA 4E14A 2J4FA 4JNCA 2Y2UA 5HK9A 5CH8A 2QUBA 2VT7A 4PO3X 1ZD5A 3G9UA 5A7GA 3PICA 1IUNA 4FDMA 5ALFA 2PSHA 4B81A 1J07A 2J4CA 1ZICA 3QPAA 4UBKA 3VJMA 2WFLB 1VZ2A 4OB7A 4G9GA 4Q3LA 4MEBA 4B0PA 1TCCA 5AKKA 4QDUA 3IDAA 4O08A 2XLCA 5LP1A 1R1DA 4IHAA 1YSCA 3TRDA 3JW8A 4UHEA 3VXKA 1AC5A 4XVCA 4KE9A 3WWCA 3BXPA 1WPRA 4B85A 1RWQA 2UZ0A 3BJMA 6YASA 1DT3A 2XQFA 3R3XA 2PU7A 4OCZA 1DWOA 1ORVA 1X2EA 3A6ZA 4JH0A 3GUUA 3D59A 2GBCA 2B20A 1ISPA 3QH4A 4G4GA 4KRYA 2QUAA 3N0TA 5A71A 3Q0TA 1ZD4A 4N5HX 5DNUA 2OPHA 4GXNA 2BGNA 1G66A 1XZAA 3IUMA 5ALMA 5LYYA 3X3HA 5K3CA 2DCMA 1W52X 2GBGA 5E4JA 5FP0A 1XZFA 1LPNA 2YXPX 2XUJA 2HRQA 3WKDA 4MEAA 2CMFA 5AKIA 2WHRA 2DHCA 4W1QA 4AO7A 4LIPD 5ALWA 4GLBA 2C7BA 3H1BA 1GT6A 5CW2A 3ESDA 4AZ3A 4OUKX 3PF8A 1LBSA 1G4HA 2OCKA 3EF3A 5JZBA 3C5VA 1GQSA 3CCCA 4RE5A 3H1AA 1NX9A 4I4CA 1VZ3A 1Q0RA 3W04A 3WL5A 4GI1A 4HRXA 4M0FA 3SK0A 3STWA 2IX9A 1X70A 1XQYA 4FLEA 3WWDA 5DYWA 3K6KA 3WQHA 2RHTA 5AOAA 3WWPA 4FFVA 4PSUA 3MVEA 5FPPA 3WI7A 2VTVA 1A8UA 1EXWA 4BCDA 1XRQA 4PQEA 1CUGA 2QOEA 1B41A 2HM7A 2PSDA 4H7IA 3H04A 4DNFA 1AZWA 4ZV7A 4KEAA 1HPLA 5ALOA 3F96A 1PFQA 2QRUA 2O2HA 1G5FA 4UFOA 4C88A 1AUOA 3WYDA 2IITA 2XB6A 3KDAA 1XLVA 1JT2A 2JGEA 2V96A 4G4JA 3D7RA 4X93A 2OGSA 4P92A 3OM8A 1CPYA 1HBJA 3HABA 3A70A 2C0QA 3HLKA 5C8VA 2PSJA 3R41A 1YS2X 4BP8A 1W76A 5ALGA 3FNBA 3FLBA 5AKGA 3SWWA 3NGMA 2H7YA 2X8BA 2HA5A 3IBTA 3L1JA 1P0IA 5CH3A 1MNAA 2WUGA 1MPXA 3G7NA 2Y6UA 2H7CA 2PSEA 4WY8A 2O7RA 4LYEA 3O9MA 4P9NA 5ALHA 3T52A 1VLQA 2HU5A 2WHPB 1IZ8A 3WYNA 4QWMA 1U4NA 4C6HA 4ZGBA 1DQYA 2ZYHA 1C7IA 3DDUA 5JATA 3OC0A 4H18A 3D0KA 5ALEA 3FYUA 3ZLVA 2ONCA 2H9YA 2HA6A 4RGYA 3I1YA 5ISMA 1XZMA 2PM8A 2DR0A 1E3QA 3D2AA 4OB8A 3OURA 4EB0A 1CUVA 3GELA 2WG2A 1TAHA 3H0CA 4Y2PA 5CBKA 1HLGA 2XUGA 4UHFA 1EK2A 1CUEA 2QJRA 1S8OA 4YPVA 5AJHA 4CFSA 4DMHA 5LLSA 3H2HA 4Y9SA 5BWCA 4A23A 4DTCA 1QIEA 4MXDA 1EINA 1C4XA 5JARA 2G5TA 4H7HA 2E3JA 1ACJA 1FFBA 2B9VA 2BUBA 2WIDA 5AI5A 1UOOA 3BF7A 1OXMA 4HZGA 3QPDA 3DEAA 1K6EA 1UK8A 2OQIA 4CG2A 4QZVA 2DQYA 1XZKA 2XUOA 3WKEA 4D9JA 2HA4A 1WHTA 2XE4A 2XQJA 2XQGA 4B7ZA 3CCBA 4ZI5A 4JYMA 2BUCA 4H7JA 2G63A 1CQZA 3ESBA 2BUAA 4XJVA 4L3WA 1EI9A 4WY5A 4Q3OA 1FFAA 3FYUB 4EY8A 3AINA 5C7YA 3W9BA 5AK4A 3H2IA 1DT5A 3STUA 3HYSA 1R4ZA 1CUDA 2QM0A 1H2WA 1THTA 2WIKA 1GKKA 4WFIA 3V9AA 1P0PA 3WKCA 3I2HA 5EHXA 3O95A 2O2IA 5AIAA 2QR5A 2VJCA 3BWXA 3W2TA 5CT6A 3IA2A 1UK6A 4FWBA 5JAUA 2O2GA 3A2LA 3BL8A 3AZQA 1CUCA 5DWDA 1MAHA 2ZJ6A 1Y7HA 4CG1A 1A7UA 1U8EA 3AZPA 1YA4A 1HL7A 5E4TA 5I7UA 4E15A 2GYWA 3FAKA 1EHYA 4DYHA 2YYSA 3GROA 3QPCA 3AILA 2HFKA 2RAUA 3HJUA 2PSFA 4KE8A 4Z49A 4AMYA 3C6YA 2VQ6A 3QMWA 4F0JA 1XZIA 2VAVA 1XZBA 3FVTA 4LXHA 1GGVA 2XMZA 1EDEA 3FBWA 3DKKA 4QA9A 3STTA 4LKOA 4ZREA 4OU5A 5HFAA 3VJLA 3WLAA 4BTLA 2OQVA 4JEIA 2BAGA 1WPXA 3FSGA 5AKXA 1QTIA 5AH0A 2ZYIA 5CT4A 1P0MA 1XZHA 5SYNA 3ZV7A 3CN7A 2PBLA 4H7DA 3C6BA 4PF1A 2WTNA 2PKYX 3BJRA 4EUSA 4KYVA 1XKLA 2Y6VA 2XQKA 3M82A 2XMCA 3E3AA 1QOZA 3VKFA 2XUAA 4KAFA 1Q0ZA 3M83A 1AURA 4L0CA 1CUBA 1MAAA 5ALJA 1UKCA 2WJ6A 4JUIA 2PVSA 1ACLA 1J2EA 1THGA 3DS8A 1LZLA 2PL5A 4WFJA 2J3DA 5JALA 3WL6A 3WWOA 1QLWA 3BDIA 3DNMA 3M81A 5EI5A 1LBTA 1CUXA 4U2CA 3WKAA 1MU0A 3V1LA 3O9VA 2H1IA 3S2ZA 4Q34A 5E2IA 1M33A 1GPNA 2DQZA 1CFJA 1HDEA 2OXEA 2XUQA 2GYUA 3E0XA 5I8PA 4DM7A 2XMSA 2ZJ7A 2X5XA 5AI0A 4L9AA 1E66A 4F5ZA 4AO8A 4EY5A 1Z68A 5EFZA 5AM3A 3A2NA 1LPOA 3WK4A 5LIPA 5KBYA 3BDVA 4Y7DA 1DWPA 5AI9A 4BRZA 4EBBA 1XRPA 1EH5A 2ZYRA 5ALXA 4AQDA 3G02A 1IUPA 3V48A 2QS9A 2G4LA 5ALLA 2YASA 2GBIA 3S8YA 1MX5A 1GZ7A 2WILA 5EHQA 4NMWA 3PF9A 4GBGA 5JADA 1ORWA 3MUNA 5D3ZA 4X94A 5IVKA 3DKRA 1SOMA 3HEAA 4KACA 2GZSA 3VISA 2XUHA 3DJYA 4KAAA 2ZSIA 2WUFA 4Y2QA 1UKAA 1EDBA 3O4HA 3D5EA 2WJ3A 1K8QA 1ZI6A 1QIDA 2WLSA 4LHEA 3C5WP 4C89A 3VJKA 5AO9A 2HA7A 3AIKA 2PUJA 5KWIA 3KOOA 1DINA 4BVJA 4LXGA 1IVYA 5T4BA 1VE6A 4BTVA 1XZGA 5LZ9A 4UFNA 5DJ5A 1EVQA 1EA5A 5HQ3B 5HF6A 2BKLA 3U1TA 4CI9A 2VJAA 1FSSA 4QDXA 5K3FB 1CUAA 4WDRA 1UOQA 2OLEA 4YK7A 1YR2A 5FDFA 2WHPA 1R9NA 2QTBA 1GPLA 4H7FA 4EZIA 1BS9A 5KWJA 3F98A 5AK5A 4W1PA 1JMKC 2WKWA 1W6RA 3G0GA 5C8ZA 3LIPA 5E4YA 2CUTA 3G9XA 1BN6A 1XZLA 3B5EA 4DMCA 1VE7A 4I3FA 3I28A 4HXGA 5ALDA 2JEYA 1GPKA 1VKHA 1ZGBA 3FLAA 5DLPA 5K3BA 2OCIA 4E11A 2RHWA 4X3CA 4BZZA 4S0XA 1CUSA 3NUZA 4NS4A 5A2GA 4H0CA 1T2NA 2WFZA 3C45A 2OCLA 2WTMA 2I03A 4B84A 2ZYSA 1A8SA 3V1NA 2XDWA 3BIWA 2AJBA 3LIIA 3F97A 5FXMA 1UXOA 1XRRA 3R40A 5EIHA 1E5TA 1XQVA 5CH5A 2WQZA 4CCYA 1D07A 2C58A 4DIUA 4DNPA 4OYYA 5AKJA 3PFBA 4C87A 4DNOA 5JD5A 1TIBA 4X6XA 4BRSA 1RP1A 4A5SA 5K3DA 1ZOIA 2CBGA 2FJ0A 3QMMA 4ARAA 2PPLA 3ZWQA 2JGJA 5FKJA 5AI4A 5ESRA 1F0NA 3DCNA 1YA8A 3I6MA 4CCWA 1BE0A 2QXTA 5ALUA 2W22A 3RARA 1QZ3A 2JEZA 3PDCA 3B3QA 5DTIA 1FJ2A 3G9TA 3C8HA 1NU6A 5DYYA 1OILA 3W9UA 4Y2UA 2NW6A 2VAXA 3C70A 1SCIA 4DLNA 1XQXA 1XLUA 4OU4A 3DOHA 3U0VA 5CT5A 3C6XA 1BCRA 2IIVA 2HADA 1FFEA 1YAJA 1N8SA 2I78A 4Q05A 5C8XA 4EY7A 4X92A 2XMQA 2XQIA 4IH9A 3W06A 3QMVA 3PUHA 3HSSA 4BCCA 3PE6A 2WSLA 2HA0A 3FOBA 4UBLA 3V1KA 2XMDA 3QVMA 5T4HA 1BROA 1CUFA 4EY4A 4BCBA 5JD6A 4MYSA 2Z8XA 2Z3ZA 1W4LA 4DMKA 1QFMA 2OAEA 2PU5A 4Q3KA 2VA9A 1VJ5A 2ES4A 5LZ2A 2JGMA 3WK6A 4NVRA 3Q8WA 2C5FA 4EA6A 2HRRA 1EDDA 3VVMA 3DLTA 1LLFA 4QWWA 5JYCA 3B12A 3IIIA 3FYUC 3K9BA 3G0IA 4CCYB 1BEEA 2WFMA 2AJLI 5CT8A 2DFPA 2RI6A 5D7BA 4FNMA 1WB6A 4CIAA 1CLEA 1QE3A 1QJ4A 4GHWA 5EGNA 4B6GA 4FKBA 1ZGCA 1GXSA 3GZJA 4BVKA 2ZJFA 2OGZA 4TPKA 1C7JA 1XRLA 1XLWA 3WWEA 4EHBA 2HU8A 3I2JA 3SX4A 1QIGA 2DSNA 2VSQA 3G0BA 5ALNA 4HAIA 1LPAB 2VF2A 2HFJA 2OGTA 3C8DA 1GKLA 1E89A 1CUZA 4ZXFA 1BEZA 4IH4A 2I3DA 3DYVA 1Y37A 2CB9A 3GA7A 3WK7A 1CIJA 3YASA 4AX4A 3I2FA 2EEPA 4MWTA 4K6GA 5AICA 3PUIA 2VT6A 5HKAA 1EX9A 3F9CA 2X76A 2QKYA 1DX6A 4YX9A 2BJHA 2PX6A 3I2IA 3C6ZA 2XMRA 5YASA 3KWJA 1AKNA 3PFCA 1QTRA 4BAZA 5CRIA 5LKAA 5HF9A 3IUJA 2Z5GA 3JWEA 2DHDA 3IURA 3LCRA 3IUNA 2BGRA 1K4YA 1QONA 3WIOA 4N8SA 4J0HA 2CZQA 2VEOA 1EB9A 1XZDA 3RM3A 4FBMA 4QEKA 1JJFA 3P2MA 4Y2YA 1ZI8A 5ALKA 1F6WA 5AK6A 3G0CA 4INZA 3AIOA 3I6YA 4KE6A 4X90A 3TGLA 4B9EA 3H18A 5D6OA 1ZIYA 1R9MA 3QYJA 3ZLTA 4QDZA 2Y1KA 4WFKA 1N5MA 4QDOA 3DQZA 1WHSA 4X91A 4B0OA 4DMFA 4KAJA 5JASA 3HI4A 4C4ZA 3EQ7A 3IB3A 1VA5A 2LIPA 2WHQA 3MGAA 2GYVA 3OPMA 3HXKA 5FPQA 3SC2A 3TEJA 2HA3A 4U2BA 2WIJA 1MT3A 1G42A 1CV2A 2FX5A 5LZ4A 1L7RA 3R3VA 1CEXA 4FNGA 4I19A 4DSAA 2H7XA 1QIJA 3FSGD 4XIIA 1K5PA 5DYTA 3BE8A 3O0DA 4X6YA 1ZJ5A 3ANTA 1BN7A 1I6WA 1UT6A 2BFNA 3WKBA 3O4JA 4TGLA 2WUDA 5IH7A 1MO2A 2WG1A 5T4FA 1WB4A 4EY6A 3V1MA 3KWFA 3R3WA 3WA6A 1IUOA 5AI6A 5H3HA 1WM1A 4HXFB 5LKRA 1MX1A 1XRMA 3FCXA 1IZ7A 5HKBA 4G8BA 4PW0A 2XUDA 5A6VA 1XZJA 1JJBA 2I3ZA 3L1HA 4Y2XA 1CUYA 4X95A 5ALSA 5FLKA 4BC1A 2XI4A 3VDXA 4J0DA 1CUIA 5KREA 1H2XA 5ALVA 1CUJA 5FOQA 2PUHA 1SC9A 3ZPXA 3STVA 5CXXA 3CXUA 4BAUA 4GW3A 1N1MA 4FLMA 5AM4A 2XT0A 4W1RA 4LXIA 3EQ9A 2XMGA 1EB8A 2AXEA 4GDMA 2XMBA 4V2IA 3R3ZA 3N2ZB 4KE7A 4W1SA 1CVLA 5ALZA 4AMZA 5AKYA 4J3JA 3ESCA 4ETWA 3CN9A 1JI3A 3BF8A 3W05A 1XROA 1VXRA 2XUFA 4FLFA 1CUHA 5T4EA 4DSZA 3E1GA 5AM1A 1USWA 5BOVA 2WIGA 3NOXA 4UFPA 4WDQA 4Y2RA 3STXA 1P0QA 4N8DA 2CEKA 3I6ZA 5FUMA 4H7EA 1H2YA 4L72A 5HZGA 2WU4A 2R8BA 3ZLUA 2Q0XA 1PJAA 4G8CA 3OTQA 4X6UA 2XUPA 4BATA 4J0KA 4G9EA 3WK9A 1EK1A 1AX9A 4QLOA 4B83A 5JIBA 4PV7A 5HF5A 4GEGA 4OD0A 1T4MA 4UBJA 1B6GA 3G0DA 4M0EA 3D2CA 1BRTA 3ZI7A 4C01A 1YS1X 4F21A 4H77A 2P8SA 2WJ4A 1X2BA 1JU4A 4BB0A 4ZRDA 1LPMA 5BWBA 4AN0A 1W75A 2WU3A 1DU4A 4B82A 2HA2A 3FLEA 2EDAA 2JBWA 1J06A 4MYDA 4K6KA 1QIKA 4XWGA 3BIXA 5K3EA 3ESAA 1DX4A 1QO9A 3H19A 4BDSA 1QIFA 5CURA 1NU8A 5BV7A 2CKMA 3QZUA 2Y2VA 2CJPA 3L1IA 1ODSA 4AB1A 2C5GA 3RK4A 3E4DA 4K5QA 2J3QA 4J0CA 4K2AA 2AJ8A 4KJXA 5FV4A 1AMNA 4UHHA 3ED1A 3KSRA 3FCYA 3R3YA 4CIBA 1JFRA 2FJPA 2EDCA 2HL6A 3KXPA 4PSDA 3WMRA 2ECFA 2V97A 1CRLA 4HXEB 4J0JA 3QBJA 5LZ8A 4KR0A 3DOIA 4X00A 3IVMA 4G4IA 1ZJ4A 1QO7A 5CXUA 1ZD3A 3I2KA 4N8EA 3O4IA 4OB6A 3K2IA 4J0IA 1ODTC 3GBSA 1LGYA 2B4KA 3NWOA 3D2BA 1UOPA 4PNZA 5AM5A 1FFDA 2JGIA 4G5XA 2W6CX 1UWCA 1TQHA 1R3DA 4BC0A 1JU3A 2OAGA 1YB7A 1BCSA 1CUWA 4NZZA 4QDTA 3EIOA 1WB5A 5JZ9A 5IKXA 5CMLA 1XFDA 5AKHA 2WM2A 5CTAA 3ANSA 3F67A 5HCUA 1MJ5A 2G5PA 1ODCA 2C0PA 4FMPA 5K3AA 3KD2A 4FFWA 1Y7IA 2QJWA 1LZKA 5HFNA 5AKLA 4BAGA 5AOBA 1ETHA 2BCEA 4N5IX 5HQ3A 4U2GA 4A16A 1KU0A 5DTJA 1EVEA 3WIBA 3ILSA 2C4HA 4X71A 4RE6A 3H2JA 2VJBA 5HF8A 5K5EA 4B9AA 1MN6A 4BE9A 5IVIA 4MQLA 2HU7A 1UKBA 5A7HA 1QIIA 3DL7A 1L7QA 4BVLA 4BZWA 2XLBA 3WL7A 4M0MA 3PI6A 4IQ4A 2HDWA
chains in the Genus database with same CATH superfamily
4TZTA 1ZMRA 3PGXA 2C2HA 2KE5A 1DBWA 4OJTA 3S1AA 2QJTA 3CF2A 2IZ7A 3H13A 3GY0A 2FEKA 5JO9A 3T5CA 1VBFA 1AHIA 1N5OX 2HQBA 2EX4A 2GPBA 4BFVA 4EHHA 4MR9B 3ABQB 4W7IA 2A5JA 2BH9A 4G8JA 5LQKA 4WIAA 4TT3A 1XAJA 1P6QA 2MR5A 3OIGA 3ONWA 5THKA 3K0CC 3KTFA 4MHOA 2B1IA 5EHZA 3F3MA 4R0VA 4XB1A 3C5CA 3VYTB 2C78A 4D9EA 3N7TA 3CRZA 4RLHA 5K45A 2XTZA 2REQB 4Q82A 3O8NA 5KTNA 4FKMA 1N5RA 3NM6B 1DG1G 1RQGA 4PYMA 1L3BA 1CF2O 1MRSA 4GM0A 4ARBA 1PS8A 2XGJA 3OZBA 3LC0A 2TECE 2I2AA 3PCTA 1DADA 4IF6A 1UMBA 3KL2A 3QLVC 4I0WB 5JY6A 1KVQA 3NJ4A 2VATA 1M2GA 3MWJA 3T4UA 5L3QA 1Q84A 3T1YB 4RIIA 1TK3A 2QORA 3CTPA 2QL9A 2J4DA 3HY4A 4IKEA 4N1AA 3RI3A 3ZWBA 2BJVA 3GBPA 2Y99A 1C4KA 2FW1A 3BOSA 3S3TA 1XN1A 4D97A 1ATZA 1X42A 1RAAA 2NO9A 3R0ZA 5D5HA 1V11B 5EIFA 3VZPA 3KXIA 2VHYA 1MG0A 4F6LA 4RJIA 1CZNA 3GFFA 4BKQA 3RT1A 3LP5A 4PAQA 2J3LA 3G6KA 3B1XA 3QUCA 3TDMA 3UBMA 1ID8A 2CD7A 1MQSA 4WT7A 4IOMA 3HCWA 4ASUD 3JPWA 5C32A 4ZKEA 4DRXB 2G9RA 1BHSA 2ERCA 4M9XA 3QEBZ 2VJMA 1WBDA 4J7AA 2NO4A 3O03A 3P4YA 4YAOA 2KW5A 4HQKA 2ZRBA 4EJSB 2D0DA 5J4KA 3B6EA 1NW4A 3A7DA 1I2AA 1ZCFA 3IP3A 4DYDA 4AKIA 2V8OA 5KDLA 1ZKMA 3UA3A 2VC2B 1V5GA 2XMPA 4N65A 4YJFA 2NVOA 1TCUA 3LWZA 4OPMA 4MUXA 2QT0A 4DBLE 4F9FA 5T8KC 2VVTA 2H1VA 4B3MB 1WXIA 3C3WA 3AY0A 4YCBA 5LQCA 1MW8X 1WVMA 3B53X 3JQ7B 4I1YA 1O0BA 2Z3WA 4B80A 4ENTA 3ZNOA 5CDSA 2PFGA 3HC7A 4N7MA 4C4XA 1F5NA 2AQ8A 3GMDA 3H11A 3I01A 4HGPA 4DHWA 2JNWA 5FBQB 7ADHA 1DBVO 2OORA 1C81A 1UFQA 2XNDA 5I9IA 2L0XA 4FEYA 5FTJA 2ZUFA 4PVDA 4Y1EA 2GBPA 4XQGA 2AKAB 2EFDB 1FSFA 4DLBA 3QKSB 4C0XA 4FFDA 4CKCB 2JIDA 3ZS8A 4K2HA 3PX2A 2Q3LA 5L4LA 4D4MA 5ELXA 3HLYA 2F59A 4MGEA 4XPIB 5JD4A 4RD2A 2YFYA 4KIJA 3MUEA 1FDSA 4C2BA 3JVDA 4IJQA 2OB2A 1HE4A 3L84A 3TXXA 1EFHA 3DDWA 2I3AA 1YR3A 4BE4A 1YA6A 3RSZA 1VG9B 3E58A 3IUQA 4BBZA 2DULA 1TRHA 4E46A 4NK5A 4FYWA 2RONA 1FS5A 5CJPA 1KWGA 4XX1A 1TCBA 2FRDC 2E21A 1DWQA 4OMFG 2JHFA 4LZAA 2PX0A 4XEUA 4ECEA 5BN5A 4QE3A 5AVWA 3IBYA 4GF5A 5AIBA 1E2KA 3UUWA 4X45A 5EE0A 5KNDD 2PX5A 1WU7A 2WUEA 2WVAA 5K0CA 4BNZA 1EWYA 1F8UA 2C2WA 3AB3A 3GDHA 4EYOA 1SVNA 3ICVA 1CJTC 1W73A 3BXOA 3UJBA 1DGQA 1T4CB 3FRIA 2P2ZA 1E7QA 2W2KA 2AX4A 1JKMA 4M8KA 4F5DA 4ZDKA 3COWA 3NTLA 2EHJA 4OQDA 1U8TA 3PWKA 2H0QA 1VPLA 3RPEA 1ZWKA 2UXCB 5G40A 3AVWA 5B6JA 1DTSA 2C2BA 4IICA 1Z0KA 2FSVA 2OMKA 3TLGB 4RK7A 4HSEA 1X13A 3OPXA 3ODPA 2VLBA 1TKCA 4UZFA 3DKVA 1ZIXA 4PLFA 1YCFA 3AI7A 3KUCA 1O6FA 5I9NA 2YNMC 5AP9A 1D6JA 1ZI9A 5AI8A 3OCWA 5C34B 1U7OA 2J0EA 1AGXA 1WP9A 4MCIA 1MBZA 3OE7D 1AZLA 5A1JA 1PNRA 1Z5UA 2YHAA 4YTEA 3T15A 2Y3IA 1F0PA 1ZAKA 3CPEA 3DHEA 4XPIA 1B00A 1RLIA 2J9RA 2FI1A 1SCQA 2X8AA 5HGXA 1IE3A 1ZA1A 1EXNA 4FUTA 2FRVA 1E3IA 1QQ7A 3W5AA 4HVAA 4G5YA 2ZRGA 3FHCB 3RRBA 3HRHA 3R7DA 4KLNA 2V7BA 5JBQA 3IRVA 2OE2A 1VM6A 1DJMA 2H29A 1X7DA 4FI3F 4DG5A 4ROTA 4M7WA 1QPGA 3ZVNA 5A7FA 4JL5A 5GMOA 1G8MA 1J42A 1V8OA 3CT4A 4MMYB 4P2BA 5JVDB 4QPNA 2ID4A 3BH0A 3UC9A 2VRBA 4FU0A 2WWYA 1TKRA 1WCYA 3GPDG 1NVTA 2ZSEA 3WFZA 2CB0A 1YWGO 5C81A 3HXMA 1X0VA 3UQYS 3IULA 4OHPA 1ZINA 5BPFA 3U7GA 2V3CC 3UQZA 3GZNA 2XGOA 5DIZA 4JT8A 3LDFA 5G0UA 5CX1B 1GFZA 1P17A 1BEUB 5AK3A 5EKSA 5B6PA 5ABPA 1U65A 2YWRA 3FPHA 3EWAA 3QX9A 1W9HA 4KDCA 4NPHA 5FI1B 2V65A 5FYQA 4GECA 1T5IA 2Q9BA 3EFOA 2I8CA 3UM9A 4REMA 1OV6A 1BMTA 3TS1A 1XV5A 2JIZD 3DMNA 1PJRA 3U62A 3Q3CA 1KYZA 1GL3A 3DE7X 4TTVA 2PKWA 3VHQA 1N5DA 5AW7A 2ZZNA 2CW5A 1E8MA 1VLLA 1W85A 1V11A 1F2VA 1VCNA 2I9KA 3EODA 3GLVA 1TCVA 4V39A 2A9PA 3CLRC 1GPUA 3HMQA 4IIBA 2CXXA 4M88A 4MVCA 3ST7A 3X1WA 3P27A 5IHPA 5JXWA 1GU1A 4OQQA 3KKKA 1V4VA 3WGOA 4TV8F 4EKEA 2VTBA 3HZRA 4PSAA 2A92A 3B6MA 4HYEA 5BPHA 5JQGF 1HQDA 5JAHA 4ZV4A 4BQSA 4RULA 3KSUA 2JIOA 3H5NA 4JQZA 5A2QA 5LVAA 2PKQO 3UK1A 2OG1A 4HDKB 3HDTA 4PN3A 4J2OA 3T3HA 4EG4A 1TF2A 3JQAD 3J7AC 1Z5NA 1XK7A 5ESWA 1U28C 4YRGA 621PA 1CR0A 1KOJA 3LLSA 2C04A 2DP4E 3HHPA 4PBTA 1Q20A 4BQOA 1F4LA 4WL0A 4PLVA 2GCNA 1ORTA 2WVGA 1KEWA 2O2EA 3M4XA 1U2EA 1UBFA 4Q1FA 4ZO4A 5EZSA 4DCNA 1PT7A 3MHTA 2GFQA 5EIOA 3RABA 3V8VA 4OOEA 2MWMA 1JUDA 2ADFA 1NW3A 1UR5A 3A1SA 3OLYA 3EDQA 2XNDD 1CQJA 4ZEWA 3M4ZA 3TQIA 3ZU3A 4LOKA 3MW8A 4X97A 5EIXA 3AJAA 5CDFA 2GA8A 5CNMA 5KTSA 3CSSA 2FP3A 3HSKA 1UANA 1EUDB 4JZYA 4LX0A 3TMYA 3QUQA 4EELA 1PQYA 4ZJYA 5EJEA 4AT1A 1AGYA 3DA8A 4B73A 5C3MA 2JIQA 2FG6C 5JLJA 1YAHA 4GOKA 1XZQA 3AL0C 1E0KA 4ZK2A 4NHEA 2NO0A 3ZVMA 2GHIA 1E8DA 1ZLXA 2BJWA 2ZVJA 4NBKA 5CB4B 1JQEA 1H0KA 3L6UA 2ENWA 4RQTA 3DHWC 4G0PA 5HNKA 3VX4A 1GL7A 1E3WA 1U0HC 4JIMA 2BFBB 2J3KA 1PL6A 2PAAA 3HACA 4YB8A 3GLFB 3VU0A 4Q9HA 4H3SA 3IXMA 1R6DA 2WJAA 5H02A 5AHWA 4D0GA 4DIUA 1RZRD 1CD5A 1W0KA 4QOIA 3RUAA 1LPPA 4BV3A 1YOBA 4MQMA 1ZNWA 3AIMA 1EK0A 3SYLA 1RKXA 3RU7A 4YA6A 2K2QB 1TIKA 2YZNA 1GCAA 3IVRA 2GCGA 1CFZA 3EULA 5BR1A 4A8JB 2DRIA 4WN3A 5DCWA 2P35A 3RR2A 2HQRA 3STYA 4ZAFA 2WAMA 3OT1B 4CUZA 5C5CA 1YCHA 4A8JC 721PA 4WAUA 5F4ZA 2GRJA 3HA7A 1KH3A 1LCIA 3GXOA 4PYIA 3GLHA 1L5KA 3DDZX 4GWLA 2HJGA 2DR2A 2IXFA 4Y3UA 2QK4A 1POXA 1U3CA 1ENYA 3KOXA 3S70A 4NDNE 1MZPA 2JKZA 5F35A 1PKXA 3WLMA 1YCDA 2PS1A 4W5RA 4ZYYA 5I7HA 5CIQA 3MCVA 4D57A 5KOJA 2JG3A 4I9GA 4DV6B 3SSNA 2GDZA 2HHAA 2KLBA 2M6RA 3AY3A 4F8JA 2HT1A 2CV1A 4H1WA 5ANRB 3OFVA 3I9NA 2ZW9A 4NCNA 1GGMA 1UBUS 3DO8A 1PD1A 1ZH2A 4P4LA 1E58A 3ZXUB 3KBBA 3RJ9A 3NP7A 3I1JA 2IS1A 4FSHA 4CDMA 2PA0A 4LNUB 3H16A 3ZR4B 2VQEB 1SD5A 2GB4A 2FFRA 1EU1A 2G9VA 1CS0A 2GM9A 2V6JA 2Y93A 3PUXA 4LXQA 5G1OA 2J4FA 1Z75A 3HP1A 4JNCA 3D4OA 1I7DA 4PX2A 4Y1GA 5B36A 1NNLA 3WL3A 4PO3X 2VYND 1XEFA 5EG5A 3UJDA 4UOEA 4X7RA 4DCVA 3T34A 4GFDA 3HCNA 3NS7A 3QE4A 3CGGA 5A5GA 4C0SA 1FLVA 1Q7EA 2HIGA 5A02A 4A2CA 2YOFA 2VPQA 4LPSA 1UDXA 3SC6A 2ECKA 4EDFA 3MOIA 1KR2A 1YZUA 1JIKA 4POOA 2OQRA 1HDZA 2Y0EA 4WBNB 2PLAA 5FOWA 3DKPA 1U0NA 1H5NA 3MCZA 4G36A 3FMVA 4UBKA 2WHYA 1XZPA 4INPA 2HK8A 4BLSA 5L7YA 1IAVA 2B4YA 2OAQ1 1NMZA 3I05A 3KSMA 3VJMA 1DLIA 4FFLA 2VSYA 3RFXA 4DIFA 4OB7A 4JFRA 4R8LA 1PQ4A 1Q7RA 1W1UA 4G9GA 4RMHA 3QFFA 4RK1A 1NBME 3GJYA 4O1HA 1TCCA 4A82A 4CQMB 4DZTA 4EHNA 4EUFA 1BXGB 2HO4A 5F5NA 3KB8A 2Q4DA 3PFHA 5AKKA 4QDUA 3GLQA 2CL7X 2GTPA 2VWQA 3MINB 2QUIA 4HS4A 2Q62A 2XLCA 4O08A 3W4JA 4ZDIA 5IFKA 5LP1A 1NXPA 3EZ7A 2R5WA 1R8JA 1OT5A 1YSCA 3IMEA 4MUEA 1G3UA 5JSZB 1Q0SA 2YN4A 3ICEA 1VIAA 3KFVA 2CHFA 1PRYA 4KR7A 1R37A 2A0YA 2QUJA 3L1UA 5ADWA 4KQ9A 4DEXA 3GU3A 3JYLA 3FRJA 2A0FA 2FETA 3RUHA 3OFSA 1WPRA 4DLZA 3MMPA 2OCDA 4AAYA 1TJPB 3BJMA 1PFUA 4KHPB 3DMTA 3VPDA 1QZXA 4HN2A 1KAEA 3B52X 1YFLA 3ENVA 1IJFA 1DT3A 2XQFA 1HC7A 3FWPA 1ZH0A 2PU7A 3R3XA 3W1VA 4OCZA 3ADBA 3K71B 2DLCX 4YACA 2I2DA 2X6TA 3KQMA 4M0LA 5EJ5A 1DWOA 3L2OB 1ORVA 1PJ8A 4DM4A 3RRYA 4HI0E 5CJJA 4C3OB 4X1YB 5GZ6A 2IQIA 3GUUA 3KOYA 2GBCA 3QH4A 4OX9B 1S2IA 3HP4A 4G4GA 4NV3A 3ZWNA 3ZCUA 3UFXB 3P96A 4JLUA 2OBLA 5CM8B 4TKUB 2W5UA 5JBIA 1K6XA 4KMRA 4RF5A 5DYGA 3WSTA 1Q92A 3G68A 4YPOA 2I3BA 4X54A 3I83A 2AZXA 3Q0TA 4DF3A 4B3CA 3BDAA 4NENA 1OXBB 2FFHA 2P5UA 4AZTA 2ZBEA 5AK0A 1G66A 1KY2A 2JARA 3FJ1A 4WZAE 3QBEA 4GKAA 2AK3A 5H83A 2C8VA 1GZUA 1NPTO 3FI9A 2DCMA 1W52X 4QSHA 3S29A 2GFIA 3EGOA 2CKDA 5CLGA 1XJCA 3I73A 3QX7A 3FCCA 3GDFA 3OPYA 3DUWA 1U02A 2QN7A 3PR3A 4TKZA 4Q12A 2QRNA 5E4JA 3R9XB 3GFVA 4AF7A 3ZHQA 1QH1A 1SUAA 3G17A 4PLYA 1LPNA 3WKDA 1ZX1A 4D9FA 1I2DA 2XZPA 3DE3X 3LECA 1XF9A 4G5RA 3K9WA 4MTCA 3ZIAA 5A03A 5ER9A 2PVCA 3RW9A 2CMFA 1GZVA 1RZRA 1MG5A 2NV0A 2VG8A 4GNKA 3TGWA 3WJAA 5BV2P 2GWHA 1NN5A 3ZE8A 1NW8A 1D8TA 2O54A 5IM4A 3WFIA 1G5QA 5SICE 5ALWA 1G291 5FFFA 3IDFA 3RE1A 1KETA 3RIGA 4UXHA 1NC1A 1W9MA 2BDEA 1YB4A 2VXCA 1RRKA 3AR6A 4AZ3A 3HWRA 4LF6B 1ZD1A 2IJGX 4DQ0A 2OEPA 4E2WA 5I8WA 2A7XA 1D2CA 1QK4A 1XNGA 4R6WA 6Q21A 1G4HA 2OCKA 1RWOA 3NHZA 1GQSA 2PZKA 3Q3JB 4PIMA 1VE5A 2GHTA 5ED4A 2EFJA 4XVHA 2ONJA 4CIVA 1PYOA 3CKMA 5EZYF 4N5LA 3IA7A 1WUKS 4Y18A 2C4UA 3AXSA 3W04A 2PKRA 1T5BA 3WL5A 1XAHA 4JB2A 1QK3A 3L8EA 4M0FA 5DRYA 4JKOA 1A72A 4C4AA 1Y6GA 3BN3A 1NVDA 1T5OA 1X70A 2ZOSA 1E3MA 1EKXA 2DT5A 3I3OA 4TZKA 4PG7A 5DHSA 3K6KA 3V2IA 4I4NA 3WQHA 2ZCJA 4UQOA 5ICEA 2WW8A 3K9HA 1J09A 1ICEA 2WABA 4ZCPA 2EWMA 3BGSA 2GTHA 1PJQA 4GI3A 4PIPA 3RTBA 4MCAA 3GGDA 1APBA 1ILWA 1SH7A 4B4UA 5FNVB 1GZ3A 5NLLA 2WD9A 3TQFA 1ZRHA 3UJ9A 4NCHA 1TUBA 2VTVA 3GWZA 4CKEB 4ESHA 1OE0A 3K1AB 5C1PA 1UFKA 1V6SA 1MQAA 5CD1A 3A7EA 4H1UA 1SQFA 3DUFB 1GZ5A 2XECA 3JXEA 4QRIA 5K0NA 4JT2A 3SD7A 3WIVA 1R8YA 1XRQA 3OCYA 2YDXA 3ULKA 2DCUA 4Q4HA 3BBLA 5JNUA 4Q3EA 1HEUA 1E1MA 1SU8A 2HM7A 2PWZA 2QOEA 1SEPA 3R6LA 4QODA 3U4CA 3PUZA 4HUTA 1VE1A 2WEKA 2WK1A 3F2IA 4LRSB 4F4FA 3A2KA 1DC6A 4GRIA 3U9LA 3CNHA 4HP8A 5I7WA 3QVJA 5EKDA 3RT9A 4CLHA 3H6HA 2D6FA 1EVYA 2I5PO 4JFAA 3R7AA 2XGMA 3AERA 1W8IA 3F2VA 1BGWA 2EZ8A 1AUXA 2QE6A 4CW7A 3PJRA 1U98A 2R8EA 3HM9A 1HPLA 1ZEJA 5BMOA 1OAKA 1Q7BA 1HE8B 2ZU0C 1FK8A 2Z9CA 4AUKA 1PU2A 2H1RA 3F96A 1DMRA 2QRUA 3F90A 1F4VA 3DAPA 4KRGA 1GGJA 1PJ4A 1P74A 1BWSA 3OIUA 1F48A 1RBZA 4TTRA 3ROPA 4RKEA 3UV6A 3F71A 2Y67A 1NXXA 2C8KA 1JDSA 2P77A 1FYEA 2BI8A 3CZMA 3HJHA 1FFXA 3BGWA 4LOIA 4BRUA 1XTSA 3UGQA 5I8ZA 1PKEA 4X6LA 2AE2A 3OLQA 1YZFA 4KR9A 3B36A 1WXXA 1GT91 2CUKA 3ETHA 3F6YA 3QV2A 5HZKA 1U3DA 4OJNA 1EJ6A 1OXKB 1XHEA 2B69A 3D8BA 3OM8A 3Q10A 1HBJA 4YCDA 3TVTA 2J7PD 1VJ1A 2ZRNA 3VOSA 5IG2A 2NQ8A 3A70A 3HLKA 2IUUA 4DY6A 1GILA 3OZVA 4Y30A 5DULA 4C76A 4EYKA 2PSJA 1Q14A 3PD7A 1LLCA 4AS1A 5ALGA 1NXSA 1YRAA 4Z53A 3H86A 2WF6A 3FLBA 4I9NA 1T8SA 2X3UA 10MHA 1B2LA 1L8QA 4AP5A 2BEUA 3SWWA 5IMBA 4UC0A 2X8BA 4BWVA 4DV3B 2H3HA 1RIIA 3KCQA 1N5LA 3N28A 5GVSA 2CLEB 2VPZA 3DLPX 2FX2A 4P5PA 1OI7A 1Q57A 1C9DB 2YHBA 4O4IB 3V1UA 4YRTA 4E2XA 3PX7A 3NG1A 3RBZA 1Z0JA 1WBBA 1FBNA 3L8FA 3O2JA 1AK1A 3SXJA 4Z3KA 5HOQA 4ND7A 2WUGA 1E1QD 3K31A 4NRDA 1DPFA 1G8GA 4FIDA 3H6GA 5CA0A 3VO1A 1IN1A 1Q3KA 2QDKA 4IIYA 4M37A 1I6LA 1UKEA 2Y6UA 4KN8A 4NECA 3WX0A 1FX0B 3ZQJA 2ZIFA 3BHJA 1VL2A 1VL8A 1XJ5A 2HRBA 1JXAA 1K7CA 3Q3GE 1II8B 5EP3A 1G5IA 2EWVA 4CGYA 5TQ2A 3U3DA 3ZDAA 3QVOA 3MYYA 3LY8A 3RRXA 3MJVA 2JA2A 4P32A 4B7AA 2WWWA 3WYNA 4A10A 4Y6PA 2KJQA 4MWBA 4RA6A 3SZ3A 2J9ZB 2VP0A 2ZYHA 4C2UA 1WSDA 2RG1A 3OJLA 3ADPA 3O4FA 3PQCA 3B1VA 4IIFA 3ZIAD 2X1VA 3FTNA 4EJFA 4YHBA 2NT4A 4CQNA 3H8SA 1X1CA 1WRBA 3T41A 3CUTA 4B32A 1N7IA 2D0IA 1NBWB 3D0KA 1DXYA 3AETA 3PNLA 2YVAA 4IX9A 1XCBA 3HB9A 1F9AA 4S05A 3FYUA 3PGVA 2PANA 3EBPA 5KOHB 4RHTA 1F2UB 1VJ0A 1WZEA 3EXHB 4TRMA 1ZC4A 3ZLVA 3D6VA 2AFHB 2GI4A 5JCJA 4ZKDA 2HA6A 3A32A 3B2NA 3FFBA 3SSAA 1UZUA 5TQJA 3HR7A 4B4KA 4Y6OA 4BNDA 4E2FA 1DO2A 2HZ7A 1YCGA 4KJZA 3ANYB 2DR0A 3H3FA 2NNWB 4LW8A 5FTLA 1S9DA 1X7WA 1KJYA 5JJCA 2MSWA 3O91A 4S2EA 1RYMA 2G7ZA 2HPHA 1PWZA 2RMKA 4OB8A 4RHFA 3ZNQA 2FB9A 5K0FA 1O8BA 1CUVA 4ID9A 3UOWA 3LOUA 4JI2B 4EGSA 1F2TB 2IXAA 3MF4A 2XAUA 1WUTA 4ON9A 1P72A 4QUAA 5FTNA 8ADHA 1CVRA 1QYWA 2G3YA 1YE3A 3C3KA 5AXDA 4RJTA 3OO0A 2C2ZA 3I3SR 3D43A 3PDIA 1M7BA 3AVVA 1S8OA 5AJHA 4CT0A 4DMHA 2EBHX 4ND5A 2CY0A 2XH8A 3VU8A 3H2HA 2A67A 4L5AA 5BWCA 3LQ4A 2JLYA 4GMGA 3HNRA 2D74A 5CR9A 4OF4A 1H69A 3W5UA 2HN9A 1IXSB 1C4XA 4BJ1A 2RIRA 3VKVA 4N76A 2G5TA 3EVDA 2E3JA 3LOQA 2F3RA 1ACJA 4Z1MD 3WR5A 1YV9A 3LRPA 1ENOA 5FBKA 5HIIA 3V4RA 3KLPX 4JT4A 3WGJA 5DB4A 1E5DA 1R0BA 1YRYE 2IYAA 2PJDA 3AF5A 5AI5A 5DCUA 3QLUC 5A5EA 3O8OA 2WV9A 2JJ2A 3N2KA 4S0ZA 5F33A 3GP8A 1ZXBA 5JRJA 2Y1EA 3CX6A 1J56A 2Y0CA 4HY3A 5AVKA 5GWXA 5I9MA 1Z74A 4CM9A 4MQEB 3IEVA 1UK8A 2C9OA 2OV3A 3CS3A 2ZRIA 1OI2A 3H97A 4CG2A 1Y5MA 3BEDA 4B71A 3LA8A 3KPYA 3ANLA 3DBRA 4QECA 3EVFA 2FDXA 3LUGA 3UUGA 5LU8A 4D9JA 4Q4AB 3QE9Y 4WOKA 1BXRB 5DBGA 1N6NA 3R9WA 1AH2A 5E8JA 1AE1A 1WHTA 1T9BA 2XE4A 3A8TA 1VL6A 3DXFA 4ZRNA 3EUWA 3CCBA 3IMCA 5FL7A 4ZI5A 1M8FA 4YR9A 1KARA 1DCTA 3BGVA 4YCJA 3CR3C 4RWZA 5TJHA 4G0UA 3QWBA 1DRUA 2BUCA 5HS6A 4EPYA 1RP7A 2O48X 1HYHA 1TKAA 1PWEA 4L3WA 4WLVA 4XQ9A 2QLLA 1ATIA 4M87A 3GPCA 2WYOA 3FYUB 1RMYA 4EY8A 5HRCA 1JW9B 1KFBB 2V7XA 2NZYA 2XHZA 4F9GA 3H2IA 5AK4A 1KDYA 3RS9A 3STUA 3PWSA 3KS9A 1PV2A 1R4ZA 1IBRA 2B99A 3O7WA 4KU4A 5EVCA 4IOJA 4M9CA 4JUDX 3QYFA 3UKDA 4A26A 2IYYA 4BGUA 4RFVA 1DBQA 1KJZA 1JWBB 4KO2S 3V9AA 1VMKA 4EG0A 3KEOA 3WKCA 2AKYA 3ABRB 3BXHA 1VL5A 3OTHA 4P58A 4I9FA 1QC5A 4IRMA 2NGRA 4MP6A 5DN9A 2F6RA 1CJCA 4IDPA 1YIAA 3FZYA 3E8MA 4A9AA 5AIAA 3WGNA 2QR5A 2VJCA 1WCIA 1GHTA 4E4YA 2IYZA 3NDBB 3ORQA 5IC6A 3CEMA 4L4UA 5DTRA 4P35A 2PR2A 2N47A 4HFRA 2BGIA 3GEIA 1RNLA 3VH1A 3DTVB 2IYPA 4PFKA 3ZIDA 1SKMA 3AEQB 1E1YA 3C4VA 1CUCA 1G8JA 1WZUA 4NU8X 4Y1FA 2Q0QA 4EFNA 1LF0A 1MOQA 2EGUA 5CA0B 2C8LA 1FJXA 1NVFA 3VH4A 3CLUD 5FHRA 1R0WA 4RLQA 1T0IA 1NYRA 4LOAA 1YR1A 3C3YA 3PQ6A 5HGJA 4AYTA 2GUWA 2ZT8A 3M3HA 5EYPA 2EBWA 5BUQA 2Q7DA 2Y92A 1GNTA 3JWPA 1P2UA 4YP7A 4HMPA 4TVSA 1GA6A 2CF6A 2J9FB 1RRMA 1YA4A 3EIEA 3H3XA 4WXPA 5IYZF 3KDSE 3GJXC 3KTAA 3KP1A 4EEZA 3NHAA 4ZJPA 1YJAA 1JSRA 5LQRA 1PVOA 1J20A 1N2OA 4KUGA 3CLTC 3KZVA 3IO5A 1UM9B 4OXQA 2V4MA 1D2HA 8AT1A 1TA9A 1Q7TA 4QDJA 1L5QA 3RNOA 3E61A 3IDOA 3NHRA 4O33A 1Z2OX 2RAUA 1R8SA 1FYWA 4D81A 3OLXA 4KE8A 2F9LA 4LBWA 4KN5A 2G1KA 2W48A 1JEQB 4L5CA 4P86A 3RHFA 1A8PA 2R8ZA 4EL0A 4MUJA 1C0EA 1SVWA 1Z4NA 3QMWA 1LEHA 3EMKA 1E1KA 3MJRA 3SYRA 3PC6A 1XZBA 3DAFA 2P6PA 1YONA 3FVTA 4I55B 1B8UA 2HCTA 3DDOA 4KLCA 1SKYE 4KVAA 1IONA 3FBWA 5ECGC 2BF7A 3ZK9A 1MXHA 5FBLB 2BEWA 2WSSD 4LKOA 2NTYC 4N47A 2G76A 5HFAA 5DGCA 3MILA 3WLAA 5DXFA 2OQVA 4RCZA 1CE8A 5LM3A 3AFNA 4EJ6A 1N4AA 1JIIA 1I4DD 3LSYA 1V4BA 3MTBA 5JJIA 3NBYC 4UVHA 1WPXA 3OUTA 1EFTA 2N1MA 4EZEA 1OBCA 3ND9A 4DMUB 9LDBA 1PVVA 2D1RA 4H2DA 4MVJA 1O58A 3MRSA 3GB9A 5AH0A 3X1KA 1NF9A 1NNI1 2ZATA 3SS8A 1ONPA 1R3UA 1XI2A 2ZYIA 3LFHA 4KZKA 4EOGA 5HEKA 1DDIA 1NG1A 4QOFA 4TTAA 2GZMA 2IEYA 3P2OA 4QBHA 3GRKA 3EA4A 5IKEA 3WA6A 1MKYA 3N7AA 1CZLA 3BA6A 1PNVA 2HBQA 5A3QA 1WB9A 1VHTA 3ZGZA 5FOTA 4BLUA 1I01A 2PT7A 3TNFA 3EISA 3CISA 4Z1OA 2NUPB 1P4GA 4CEJB 4H7DA 1E77A 2RHMA 1Z7GA 2XSZD 1B1AA 1W0JD 2WTNA 2PKYX 3A4VA 3GMIA 4WD3A 1S3SA 2LR0A 1SUEA 2X6RA 2XDQA 1JEQA 3OLWA 5KNCH 2EU8A 2KM1A 3HPRA 4JI5B 3ITEA 4KYVA 3TQSA 3A4LA 3USES 1E2UA 3TOCA 2VL7A 1ZESA 4H4EA 3WOVA 5EJ2A 1WG8A 2O3TA 2YTZA 3ORFA 3C3CA 5CHEA 4NEGA 1QOZA 2CHQA 2HBYA 2PCJA 1N2CB 3M5PA 3VKFA 4YAIA 2O7SA 2L18A 2XUAA 1JALA 1NR1A 4W5TA 1EE1A 4YRQA 4Z51A 3IELA 3EZFA 3G3EA 2AYXA 3LRXA 3PGA1 2JJ1A 3RFFA 1GSOA 1SOUA 4AZVA 4UPEA 3CF4A 3OETA 1L7OA 1YMQA 5I3CA 1XTQA 4WINA 4HX2A 5IJ0B 4AJNA 3KJIA 1H8HA 2OCYC 4BLVA 1JTEA 4C29A 2WRZA 3QVGB 1IHPA 1BMFD 1M6WA 2WJ6A 4RS4A 1UC8A 3W79A 2RK3A 2QX6A 4KREA 4W5JA 3ZDFA 2QX4A 1UPBA 4XD7D 1J2EA 1THGA 3F4LA 3NHUA 5CHYA 1Z08A 1P4HA 2YOHA 1H4SA 2JD2A 4WFJA 4DLLA 3GLGE 4ENRA 2V74B 1BDBA 2C57A 1X80B 4BB5A 4HL6A 1VP3A 3WAGA 4RPHA 1CYEA 1SCJA 3T9DA 3EHDA 2IKQA 4IDFA 4CF6A 4DW8A 2C7RA 2GXSA 4B74A 3KKNA 3OJXA 2B1RA 3LC2O 4M3NA 1V9CA 5LNK6 3E9EA 3A26A 4QPPA 2IU0A 1CUXA 3KQWA 3DEIA 2XNKA 3WKAA 1MU0A 1D1TA 4RZSA 4UNIA 4TMTA 4LVNA 5ARDA 1A1SA 3K8OE 4NTZA 3VI4B 1FVXA 2Z04A 5B1DA 4Q34A 3IMGA 5E2IA 2MMCA 1QKIA 2ZXEA 3D8RA 3UWDA 4DDMA 4LDNA 2GYUA 1XELA 4K3UA 1HFJA 1XCJA 2VQSA 1EG7A 2ZQYA 4LKRA 1FDTA 4NBNA 3U3KA 1RYZA 3CW8X 3S7TA 1NVWQ 4R2XA 3ISTA 1P0CA 1QAMA 4AJ9A 2VHQA 2JRCA 1E66A 1VKJA 2C7QA 1A2QA 4FGLA 4UHJA 4F5ZA 2VSOA 2XCUA 2CC2A 2HXYA 4NBTA 1Z68A 2EQ5A 5TPWB 4BL5A 1GJRA 1KZ6A 1J0CA 1R6VA 1U2RA 2PGIA 3OLVA 4EPWA 5AM3A 3WP1B 4BNGA 3K70D 2CLCX 1TZ2A 1YVDA 2AVNA 1Y4UA 3KUKA 4JEMA 4CIWA 5LIPA 2RSLA 5KBYA 2LV8A 3CRVA 2UV8A 3MTEA 3NJRA 3N70A 4AN4A 1WF6A 4ND3A 3PYLA 5D1HA 4BE7B 4AQ7A 5EKUA 1FSGA 4BRZA 1XRPA 1EH5A 1JEJA 2C8JA 4JNKA 5DMXA 5F5LA 3NBZC 2OZEA 3OI7A 4E6EA 1E2PA 1DRJA 4WXEA 2QG6A 1TO2E 3PG5A 2CFOA 2AOUB 2QS9A 1N1EA 2YASA 4OATA 2UZ1A 1MX5A 3PK0A 1T35A 2JFXA 2JCVA 1NMYA 4MIKA 2VRCA 4HLNA 5E9WA 5A4JA 3FX2A 2UZ1B 3MWDB 5IRCD 2PAFA 2WD7B 4KOAA 3ORHA 1NUUA 2DBYA 3UJAA 1D03A 2P6NA 1GQYA 1AZSC 1T8PA 1K88A 2CBZA 2WMYA 2VPXA 3L0BA 3WXMA 4EG5A 4GQAA 3ID6C 3ZJVA 2X7HA 3TFOA 2AE1A 1GL9B 2ZYDA 4KACA 2Q2NA 1B16A 1KO4A 2XXBA 3OZWA 4LOLA 2XUHA 3DJYA 1A5AB 2O59A 5JCXA 2QJFA 1FUUA 3T3EA 4LRXA 2WUFA 4XARA 3THRA 4NE9A 3G5TA 1NN3A 3K2BA 1UJ6A 4Y2QA 3PXDA 1TYBE 3RHTA 3EC7A 2ZI3A 4MVJD 4NBLA 4QICA 3L0SA 3U4IA 3WADA 2LE0A 3O4HA 3G1WA 4FYPA 4M0UA 2Y8EA 2R6JA 1JG2A 1U0GA 3WGYA 4ERXA 1JL3A 1KYQA 3ETCA 4RPJA 5FWXA 1ISJA 4N03A 4YMSA 3TZBA 5IULC 1KYYA 2JASA 5A3VA 1KI4A 1AY0A 4WVLA 3VSAA 1GPH1 3LHDA 4HD8A 2DBVO 2PJRA 2G67A 4IOLA 4OUDA 1A5SB 4FX2A 3M9LA 4YP5A 4S1TA 1OA0A 2OUIA 1T4BA 1IVYA 5KYUA 1VE6A 4BVJA 1XZGA 3DCJA 1LBEA 3AUUA 1KZ1A 1Y9ZA 1W0JA 4HG2A 4HLCA 4PYKA 2HJRA 4EO4A 5KUTA 4QHSA 1G9TA 2TRSB 4XGIA 3FYHA 3FTCA 2YV3A 3K1YA 3UYKA 4L5IA 4K87A 1RCUA 5ICCA 2ODEA 1U5BA 1ZBQA 4QDXA 3IHKA 2XZDA 4NQRA 4WDRA 2IKSA 3AB8A 1JR2A 3C5HA 3NXKA 1YXMA 2OLEA 5BSUA 4YK7A 3T1OA 2PCLA 1W2GA 3NR2A 2JBHA 1NWCA 2O4UX 3D3WA 3NUQA 1Z29A 4LN1A 3UMFA 1E7RA 4YDQA 5TARA 4UTZA 3IP8A 4EL5A 3SS9X 4N48A 1KJ8A 2YXDA 2ZI4A 1N8KA 2QAGB 4CKZA 3G2JA 5HYVA 5EHGA 4JUFA 5F1OA 2IOQA 4E0BA 5E1OA 3CLUC 2FMKA 2PVPA 3FXAA 2QTNA 2WF7A 1GTG1 2JB9A 3CU5A 4PX3A 3RYTC 1QDEA 1IL0A 3CO5A 2FWRA 3D6MA 4LJ7A 4RL4A 3F98A 5G3ZA 2FK8A 2H4ZA 2FSSA 4W1PA 2HK9A 3U7RA 1DTWB 4G4SP 3G0GA 5ESDA 1A4UA 3HYRA 1PO7A 5HMMA 2HDNB 3MERA 1SRQA 2C5HA 2W2LA 1UBTS 2BI7A 4B6PA 3LG2A 3KNZA 3U3RA 1G6Q1 4N40A 2P3OA 4GLFA 1XYVA 3KWLA 2ZS9A 4X8MA 1N2CA 1E32A 1XZLA 3OECA 4TV9F 3LTNC 1DAKA 4WK2B 4OIMA 2Y71A 4DMCA 1G3QA 1KJNA 1NBHA 3ZJUA 3LT4A 4I3FA 3S2SA 2A35A 3I28A 1RC0A 2IU3A 2JCBA 1I7SB 1TEVA 2Q5FA 2QTZA 3MOGA 3UVEA 1CQIB 3QU2A 5ELLA 3TN7A 5TPWA 1EFUA 1LH0A 2ZRKA 3NBUA 5M3BA 5ARBA 4G89A 1RYNA 4Z8XA 4ZZ1A 3FPKA 3QVKA 1PJSA 5BOSB 3HB7A 3IOBA 5C51B 5A2GA 3PGLA 4H0CA 1IXKA 3TL6A 3ZQUA 4AI6A 5TS2A 3D8SA 2BTEA 1D5WA 3H5RA 2IHKA 2I03A 2RHGB 1C14A 2GAIA 2KPOA 1FFXB 1CJBA 3H4MA 4B84A 2PUCA 4NMXB 4EO9A 3EPRA 1NLZA 3TYXA 1L5RA 3TDNA 4ZI3A 2P90A 1QPBA 1FDRA 4HWOA 2XDWA 1CQJB 1JHDA 3JYOA 3AR2A 3H11B 2Y66A 5JS2A 5AHKA 5JCZA 1O08A 3DBHB 2GDJA 5FXMA 2EEZA 3WYAA 3TUJC 4CCAA 3ESYA 2A9KA 4JB3A 4WVFA 5JPIA 3R40A 1RRVA 3LUPA 2HXGA 2B9EA 3Q98A 3VU9A 3UAGA 1P2TA 4IGAA 3ASUA 1SAYA 4CCYA 3ORSA 1VJDA 2GSWA 3TQTA 3LU1A 1NP6A 4LF9B 3IQDB 3KPWA 3LO5A 4UAVA 3ZTTA 2B8TA 3EH2A 2GJ8A 3LQ1A 1E2NA 1S7CA 2QM7A 1P7WA 3PL1A 3UV3A 4X6XA 1TZCA 2J9XB 3RFUA 1VE3A 4EMSA 5K3DA 2FJ0A 1LSSA 1EUZA 1AN0A 1VRCA 2O3QA 1UBSB 3VOBA 3WGHA 2JJQA 4HJRA 1Z6YA 1EFLA 4ARAA 1LXCA 3LXUX 3IILA 1KFKB 3AR7A 3NT5A 1UDCA 2WWXA 3H2YA 4EAQA 1F0NA 2GPTA 3M33A 3ABIA 3JSXA 3KZKA 3I6MA 3N1UA 1P5JA 4TMYA 3O8BA 3EVCA 3EWIA 5ALUA 4B43A 3SLGA 4MYCA 1RXIA 1HURA 3DAGA 1CZUA 3JATB 3B3QA 5DTIA 5IDVA 5CA1A 5FNVA 4BBJA 1ESEA 4A6EA 2B83A 1TYDE 2WVHA 1P1CA 4NICA 5DYYA 3W9UA 3HJFA 5LOVA 1KEVA 1PD0A 1OWNA 2A9OA 4L4RA 3PEUA 3TQCA 2X3FA 3DLHA 1NT2A 4MUFA 4RZUA 5J9FA 4PQRA 4K6CA 1R16A 4L4ZA 3DZDA 1CF4A 4OU4A 1E64A 4DCSA 2R65A 4ALJA 1PJTA 3IERA 1KYVA 2HDHA 3BICA 3H84A 4FK8A 4HB2A 4MUAA 3MD0A 1TTPB 2OZVA 3NPAA 1W4RA 4HGQA 2R8YA 4MKGA 5CFNA 1IC6A 1E1RD 5FJJA 5ICGA 1J2YA 1GVHA 1FFEA 3BRCA 4EPVA 4DUZB 5DHTA 4M99A 1T5TA 2FFBA 1UC4B 1UMDB 3WTCA 5CA1B 3GA0A 5FWDA 4UM9D 2A5GA 3R44A 3NTVA 5C8XA 3K0AA 2D13A 4KAXA 2O0LA 3FOAA 3ROEA 4IWNA 3CX3A 2SNIE 1YI0A 4PICA 4X92A 2EFGA 3WHIA 3OZEA 5AUPB 2PA3A 4FB4A 3HXOA 3QMVA 4FHDA 4KUHA 2PGOA 4LJAA 2W37A 4ENVA 3F6RA 4XAQA 1VB3A 3LHKA 5L3SB 2HBZA 3CW2A 2HA0A 2ZPUA 3FOBA 4UBLA 3SHTA 4EW3A 1G21A 4DCPA 3BD9A 3PTZA 1NBIA 2XMDA 3DHNA 3L92A 3R6GA 2J6BA 1VCHA 4OP2A 3V4ZA 3WMFA 5A0TA 2GTIA 1ADYA 5FBZA 4A7PA 2NO7A 4ZT6A 3JQ6A 2GK7A 2GZ1A 2FYTA 1VECA 1YKGA 2I1VB 1BROA 2WT4A 1CUFA 2GZAA 3LX8A 1Y3CE 3QVMA 4Q21A 3VNQA 4ZZ0A 2VUSA 2VDNB 1DRWA 1Q3TA 4H6XA 1W4LA 2E6UX 3Q5DA 4B6FA 2YRWA 4YEDA 5FO1A 3M5WA 2B3TA 4LFBB 2VA9A 3KK0A 3MWGA 1A2BA 3T1HB 3AKEA 2FSVC 2B1QA 4FC7A 5E6UA 4F2PA 2JGMA 1LFAA 1Y6QA 2D7CA 2Z30A 3D6TB 3IGFA 5EKXA 2X2PA 3QVXA 4Q66C 3WK6A 4ZO9A 3ZWCA 4D9BA 5KDOA 1ZGAA 4H16A 3ILHA 4KLAA 1JTFA 1GUFA 2EBFX 2GZHA 4JYAB 2GNPA 2VHWA 5CTJA 3ZK8A 2OXTA 4BNNA 1H8EA 2OBYA 4CM8A 3EOBI 3AKYA 1Z3CA 5C2JB 2IYVA 3OQ1A 2HW8A 4F96A 1USGA 3Q9UA 3QG1A 3QTTA 3IAUA 4DUYB 2GF2A 2OMEA 4CF7A 3FPBA 2EKBA 3IIIA 4YDRA 3ZHBA 4QUHA 2DJ5A 4R4JA 2YCBA 3IH5A 4D79A 3O5AA 4U3JA 1PJBA 2PSSA 2QTMA 4ZOEA 2PPVA 1MAVA 3DZJA 4C6TB 1BEEA 2WFMA 2XD9A 2AJLI 2BSQA 5CT8A 4RESA 1N0HA 4F46A 4OXKA 2IVFA 4F3CA 1RFLA 4H3KB 2W6QA 2W7TA 1HO3A 4S35A 4V0QA 4WOPA 2I91A 5DO9A 4HNGA 4DKJA 2XWQA 3JVUA 4GXQA 1GCGA 3TZHA 4LZJA 4GHWA 3P4UA 3IRUA 4WZZA 1UPXA 4CLOA 2EATA 1IOZA 1IBCA 4FYKA 1XRSB 2ZI5A 3HWSA 3FZEA 3HJCA 1R5JA 4UJ5A 4WJZA 5KKNB 2HWXA 3GZJA 3PPIA 3V8MA 3Q88A 1SXPA 3KXKA 1P3DA 3UICA 2HF7A 4TPKA 4CQMA 4Q48A 1XRLA 4BNYA 2BFAA 5A3JA 2HJWA 4IGEA 3ON5A 2JLZA 3AEUA 4PN7A 4CYMA 3KZNA 1XJQA 1RJWA 4NJMB 1JNXX 2FWAA 3S68A 2YVUA 3T3OA 1AS3A 3HM2A 4WCFA 3SKVA 3GFBA 2IOFK 2JFQA 3AKZA 3WISA 3GP5A 4XIYA 2IU4A 5BN4A 1K7YA 3O74A 4QT4A 1LPAB 3LT5A 4G6ZA 3DHYA 5KOHA 1KRHA 1L1QA 3TG2A 1ILEA 3PHLA 1FZQA 4LFCB 5HWSA 3TVYA 3V8NA 3IQEA 1MABB 2FZCA 3LQQA 3W4KA 1ELOA 3IESA 4TS3A 2RHJA 3D6JA 4QQRA 3U48A 1GKLA 2H2FA 5FULA 3ZXSA 2YWDA 1E89A 4L0DA 4ND4A 4BEVA 5L40A 3K73O 2JLWA 1HZJA 1E7SA 3T3GA 1CUZA 3OAAD 2Z2IA 4GD3Q 2GT1A 4IHQA 5FPHA 4BNWA 4A2PA 3QF4A 4IH4A 2I3DA 2FN4A 1BYIA 3U40A 3MJCA 5HKKA 4B3SB 1R4MA 1XL0A 3HUFA 1Y37A 1Y1PA 4C7XA 1NFRA 4RGVA 2A0KA 4B45A 3SHWA 4D8XA 3HO6A 2ZBVA 4D41A 2C3YA 2W43A 4PZYA 3TW8A 2H59A 4QGBA 2EEPA 3FMPB 4H4DA 4NF2A 4V0RA 2VJOA 1I1QB 4MI1A 4ZI7A 2IHUA 5IJWA 2YYZA 4Y98A 1X77A 3C3XA 3CNEA 3OSUA 3IHWA 2VT6A 4PO9A 2B78A 3OJWA 1XMSA 3HV0A 3DEHA 3IDSA 1GPBA 3PEWA 4LJ8A 1U5CA 3WWYA 2D0OB 4I50F 4FR5A 2GN8A 2I3GA 4MDYA 2NSHA 2X76A 1DX6A 1U0BB 2MYPA 4NJEB 4ZOLB 1N78A 1Y6JA 4Z7QB 1FTNA 3N8DA 4F4HA 2REBA 2F90A 2HTFA 3GFOA 1NJGA 2PX6A 3QYAA 2R6CA 1QH8B 4DDKA 1MC8A 1P1BA 1Q0UA 2PMBA 4R83A 1JHRA 4Y6QA 5ERXA 5DM70 2XCSB 1ZVVA 1A5ZA 3AR4A 1SNYA 1ZVKA 3P71T 1SUIA 4UM9B 3OJEA 3CPSA 2Q1TA 2VQ3A 3S1AB 3WSVA 1ZM9A 1RRCA 2WU0A 3GT0A 3GLHE 3M70A 3ER6A 3PFCA 1GPDG 5IARA 1GV0A 3ZJ4A 1QTRA 2BISA 4D9HA 5GJBA 1M6VA 5LD2C 2VO1A 1T6XA 5HIMA 1I2CA 2BE7A 1KO1A 1JLLB 4AZWA 4XWWA 3OOJA 3E3NA 3CJQA 3L6BA 1N57A 1WA5A 5LKAA 3IUJA 1TYZA 2BW0A 2NUAA 3EB9A 4S1OA 2O19A 4DXHA 1CRWG 4L8GA 4ZO6A 3BSSA 2P11A 4MWCA 1ZNYA 1MENA 3IPRA 3L7MA 1CZKA 3LCRA 3OKAA 4OXRA 3IEPA 5A05A 4LZWA 1QWSA 4WNAA 1IM8A 3M3PA 3OCVA 2G07A 3U7JA 3K09A 4DHEA 1IY8A 3TLEA 4OL9A 4ZAWA 3ZV5A 2G17A 2R1ZA 5FBVB 4QL3A 5KTMA 1RQ7A 1A2KC 2E4ZA 1ZCAA 1F06A 3GP3A 2RE8A 1GAWA 3KWMA 1FL9A 1OLUA 5ER6A 1ZK1A 4L8VA 5KMGA 1U3GA 3AF2A 4OKNA 2YZKA 1J9ZA 4CT4B 2RG7A 2Y1OA 4MW0A 3VZDA 3W3AH 4ID3A 1EIZA 1OGYA 4IIEA 3RKRA 1SC6A 5FUQA 4FBMA 1D9ZA 3K3PA 2NQ2C 1JJFA 3AJ8A 3P2MA 5AESA 3IOEA 1XG5A 4NWIA 1F6WA 1VSTA 3SEZA 4DA0A 3GRUA 1H8ED 4E70A 3HO1A 1QWOA 3G0CA 1ODIA 4AVYA 3BMQA 4YCLA 3CNNA 3JQBC 4K6OA 5BSVA 1YR7A 3NIBA 2YV4A 2FEAA 2X4IA 5FPSA 3SVTA 2V6BA 4BEBA 1Y8CA 2CUZA 1U1GA 3PJEA 4XYBA 4KE6A 5A9SB 4G37A 1MRZA 4QXAA 3HNOA 1SZCA 2E55A 5PNTA 2FPPB 4ENPA 3U19A 3IQXA 4BQPA 3AY6A 1NW7A 2FQWA 2PLRA 1E1NA 3PRKE 2OA0A 5JYDA 3CX8A 2X9VA 4EHDA 5CDYA 4KMSA 1EAYA 2P9QA 1UDAA 3OQVA 3QBDA 4JELA 4GZ6A 2QRKA 4Z7JA 5EJIA 1JHYA 1ZUHA 2QLJA 2Y1KA 3AEKA 5DLDA 1NP3A 3RV4A 2RAFA 3IV7A 2B82A 1SZPA 2UUAB 1HTBA 1W85B 2WR8A 4QG7A 1OSNA 2CVFA 1JMVA 5CUQA 5F77A 4CODB 4PZ9A 4KAJA 2XXAA 2L17A 1OJ7A 3PJFA 2QE7A 4A0HA 5JASA 1KSGA 4OMUA 4TWRA 4YXWD 4K05A 4B3BA 4H3HB 2VRNA 4RZHA 4E33A 4POAA 2VYVD 1AO3A 4PPNA 3RVPA 3VHXA 5CK5A 1M2JA 1U9YA 2NYVA 1KL7A 1Z4LA 3BMOA 1WEHA 1J21A 1HX7A 3IB3A 3ETDA 1X1TA 1Y48E 1LWOA 4JP2A 3CF6R 3EXFB 3NCHA 3OZSA 3KZOA 5E9JA 3JRXA 4DQXA 1GSHA 2GYVA 3T3DA 3TE6A 4C04A 1V8FA 3CVXA 2KWIA 4RTOA 4DV1B 1WOYA 4R0NA 1ZK4A 4KK4A 2QZJA 2X1HA 1PFGA 2VJQA 3TEJA 2HA3A 3EWSA 2GBLA 1JQKA 2IXEA 3FMOB 1E79D 3H5WA 4L5JA 5T64A 4OHRA 5F7ZA 1MT3A 4WSOA 4ZI7F 1M8PA 2WJYA 1B0UA 2P6MA 3C5EA 5H3CA 5H59A 4ZHQB 1TU4A 1FP6A 1KC1A 5B7PA 4KITB 2H00A 1AKMA 2WKSA 3MS4A 1CV2A 2B30A 2FX5A 1U1FA 1YL6A 1L7RA 2HF8A 1KAOA 1P2BA 2HF2A 5GVRA 4EW6A 5JQGA 3VPFA 3BTUA 3EZ9A 4YV7A 3CB4A 3E2MA 1O96A 4LWOA 1OTXA 3SKXA 3JYNA 2TYSB 4N0DA 1TJNA 1IBMB 1VLVA 2APJA 3FUCA 3OAAA 4B3HA 2NXNA 1A71A 3UJ8A 2HU2A 1E5LA 2XVXA 3QEMB 4M1TA 4WMLA 4CTNA 1T1EA 3IQIX 4FNGA 3ZHYA 5JYEA 2H7XA 2RKWA 3PUYA 3RUEA 1E1QA 1E1DA 1F12A 1B93A 1AVTA 1WMAA 2JRLA 2ID7A 5DI3A 2WI8A 2IEZA 5U1PA 5IJ0A 1KVRA 3BE8A 4JBLA 2UUOA 1J2RA 1SXQA 1QRDA 4O29A 2OECA 2YXNA 1ZJ5A 2MOKA 2B25A 3DFMA 2Q41A 3GGPA 5GONB 2VOEA 5JWHA 3LPNA 2VXOA 2J87A 1T4DA 1A4IA 4UPVA 5LUAA 5JNWA 2EXXA 4Q47A 1B0ZA 3N3AC 5IH7A 3X1YA 2AR7A 1ECLA 3TLGA 4HFMA 1U9IC 5EWJA 1SHTX 3I0NA 3GUYA 1DAOA 3K05A 3R6DA 5KVVA 5T4FA 4AJKA 2X7XA 1WB4A 4CEHB 3ITDA 3R3WA 2W2KB 1YZYA 2GH1A 2ZE6A 1T36B 1W35A 2OO3A 3EGDA 4Z0NA 3K0EA 4BPRA 8ATCA 3VHLB 3HCDA 3IOYA 1SUBA 3WYCA 4DR5B 1P7CA 2NO5A 1AIPA 1V41E 5H3HA 2JBAA 3RYHB 4DWJA 1J39A 1MX1A 1M2NA 1TQ4A 2IHVA 4XX0B 1QYIA 1M66A 4BEJA 3M34A 3E15A 3V1YA 5HCIA 5MGNA 1IZ7A 4OQ4A 2I6XA 2AEFA 2LXNA 2RBGA 5C52B 2DTDA 4OREX 4PW0A 5A6VA 4CHTA 5KQPA 2HNAA 4KPUA 2BHSA 4AJ2A 3D8TA 1MO3A 4N5MA 4PFSA 3HBFA 1JJBA 2WTXA 2HPVA 3CVYA 2COUA 3D7MA 4Y2XA 1P8JA 4FZVA 3RHSA 3D2LA 4R2LA 4X95A 3REOA 2JHPA 4G2NA 3UK6A 4BLRA 3ZY2A 4MV9A 3VDXA 4EI2A 4J0DA 4YV0A 5FWNA 3QW2A 2IX3A 3H4VA 4LC1A 4CL0A 2O6HA 5CB4F 1H2XA 2QGZA 1L5YA 4Q6WA 3BCUA 4LDAA 4UD6A 2JLVA 2EKLA 4MI9A 2ZZMA 3N75A 4C7MA 1G8SA 4C7KA 2O3RA 4RKQA 4KIGA 1NMSA 1TM1E 4J1TA 5GADl 4WLFA 1HMPA 2IT1A 5AM4A 1PL8A 1BNCA 3TM5A 2PJUA 1JQ3A 2D5AA 1QZZA 3ZCVA 1D4AA 3E8XA 3HADA 3LI2A 3TSCA 3ZGXA 1P62B 3C3DA 3ENWA 2D8AA 2D2IA 3HN6A 3FHTA 4UM8B 5FAXA 1UEXC 3VR2D 1SBNE 3JQ7A 1MV5A 2AXEA 4J8PA 3MFQA 2AW3A 1XXLA 2X8LA 3E9YA 2GNOA 4V2IA 1OHHD 4EEKA 3L6OO 2WUWE 4S12A 5AVUA 4LE1A 1ESNA 4L6CA 4YLEA 3SICE 2LUOA 3E4CA 3JASA 3OIYA 1CQIA 1M74A 4KIFA 3FA2A 2IEDA 4R54A 1C9EA 3CX4A 4TTJA 5KWSA 1M10A 5JDIC 3ENZA 2PGDA 2R60A 4KPUB 2NZ2A 2HUPA 2PGAA 1QPZA 3SOZA 4W6ZA 2LKCA 1JN0A 5EXSA 3HG7A 1V35A 3BCHA 3WJ1A 1VXRA 1MORA 1SMKA 3JQFA 4PRYA 4BNIA 4CM9D 1CUHA 1PZNA 5T4EA 4DSZA 3E9MA 4F45A 3SQXA 1PUXA 2PRIA 1ZM3A 4BLWA 4ABTA 2ZJAA 5DNAA 3AVOA 4ZJUA 3T4XA 2WZQA 3P9XA 4LNUA 1X7XA 1NPDA 1H0HA 4ND2A 5BOVA 4GI5A 4NAUA 1WSAA 3TSAA 4UFPA 1DTWA 3FTFA 2QE7D 2GJ4A 1FW6A 2PMFA 1T5DX 1U1EA 3E7PA 4KGDA 1DUSA 3DONA 3TI9A 4LGMA 3V4LA 4E5VA 1TQ8A 1VGQA 2XF8A 4JJ4A 2IZOA 3AHHA 4MCJA 13PKA 4FVTA 1OUMA 3GVPA 4MAMA 4P0PB 4UKDA 2ZB7A 1P0QA 3NYQA 1XFAA 2JAHA 3I34X 4N8DA 3R5KA 5I4IA 3HEBA 1W5TA 2CEKA 4E88A 4TTQA 4C4SA 1ZHOA 2IE0A 4ZMBA 5JNTA 3I6ZA 1UMBB 3TWOA 3FMGA 2UYHA 1FVHA 1Y1SA 2YIJA 3HKEA 2GEBA 3GCWA 3EDMA 3Q0IA 3OQOA 2FZGA 1H42A 2R8BA 1QP0A 2VEDA 3SSOA 2WBLC 1XCMA 4MGKR 1XBTA 2ZK7A 1M1ZA 4X6UA 2XUPA 2QIPA 2X0FA 1XXHB 2O7NA 1E79A 4G9EA 1E9VA 1G8YA 4ZPJA 4MRSA 4LDPA 4PSKA 3L40A 1SURA 4AQYB 1EK1A 2PL1A 2G0NA 3UGTA 3HCAA 3K1JA 5A5FA 1TFRA 5JSYA 4B83A 3BB3A 2DFKB 4EKNB 4ADSG 2P65A 1VDMA 2H4FA 3M49A 1ZH6A 4Z0PA 4HDMA 1MTOA 1RE0A 4TRRA 3F46A 2WAXA 3NEAA 2QRQA 2ZI7A 2IYEA 4TWAA 1SCUB 2ZIXA 3W5VA 3BC1A 2QY9A 5DHUA 4CLEA 1TPYA 2GN6A 2PGXA 4JI7B 4DPLA 1EFAA 5C1IA 4IJ6A 1E3DA 3SFZA 5DF1A 2QQ5A 4V0ME 4X20B 5LMZA 4EM6A 3ZI7A 5HQTA 4JWTA 4WADA 2AI3A 4H77A 1L7NA 3WNZA 1X2BA 2WU8A 4FOOA 4QPDA 3FPCA 4OMDA 4DJ5X 1JU4A 2TS1A 4ZEMA 5SYAA 5H80A 4BB0A 3I12A 3IKLA 3LQ2A 1E7MA 4PPYA 1P2GA 5E7MA 2QX7A 1W75A 4AN0A 2J0QA 2O8DB 1P1KA 4F4JA 4LY0A 4G01B 1EXMA 4J16C 3F4BA 4B82A 3C7AA 3FLEA 1HTWA 4R3UC 2F7SA 5IJAA 1DIHA 1U7WA 2Y9MB 1P44A 2FLWA 4QU5A 4RKYA 4D96A 4MYDA 5LXTA 4C0JA 2CLSA 2HQOA 5ILOA 1FLDA 1NBMD 3V2GA 1GNPA 1E92A 1UMCA 5IWAB 4CKWA 3SNHA 4BFUA 1QIFA 1R18A 3EIWA 3QWIA 3IFSA 3CZAA 4JQYA 2IGTA 1WW2A 1XDWA 2QRVA 4P4SA 1MAWA 2GF9A 3QEJA 4IXNA 5FPTA 1LRJA 5SZJA 4LYJA 1FB5A 4E3ZA 1T6ZA 3HXPA 1KDVA 1EVJA 2PX4A 4O4HF 2XE6A 2MTBA 2XB9A 4JENA 5B4TA 2I66A 4HDKA 4I2NA 3WRXC 1XTIA 3NM5A 2IA5A 4NYMR 4WBSA 2I87A 5AVJA 2B8EA 1UKYA 2C5GA 2YWBA 2FPUA 3OA0A 4UNRA 1ZSVA 3EG9B 5LOVF 1C3LA 4A0RA 1OXSC 4Q1AA 5CDHA 3LMKA 3AHDA 4QQNA 1EVKA 2OV2A 1IHXA 2I7CA 3GUCA 4GOLD 4KJXA 5FQOA 4AJEA 5AVSA 3DBHA 3IAM1 1Z8HA 4M83A 4OHKA 4DUGA 1VQ1A 1KORA 3ZGVA 1K3FA 4YLYA 4RSMA 2YL2A 2CSUA 4DCMA 5JZVA 2XCIA 3R3YA 3INGA 3M6AA 1OFVA 3MNFA 5DVZA 1RC8A 4FYMA 2PLWA 4XYGA 3WRYC 1WDLA 1JVBA 2GPJA 2HL6A 1IN5A 2QUHA 2CLIB 2RGGA 3V4OA 2EVWX 3OIWA 3AM4A 5DSZA 3TX6A 3I61A 3MAAC 3OJ0A 4R2JA 1OWMA 4PSDA 4OJKA 3WMRA 1A97A 4DLVA 3LY5A 2V97A 2ZP1A 2E4UA 3E9RA 3BT7A 3D0RA 2J6CA 4HXEB 3JPYA 4ZVOA 4FDTA 3DOIA 3FYCA 1A7KA 3IVMA 4AFNA 2QMUA 3H42B 4YDSA 3NDJA 5GGYA 3AG6A 1ZJ4A 2CJFA 3VZQA 4UOQA 4G0XA 1N6KA 5EJGA 5C7LO 3G1TA 5CP8A 4ZZIA 5JVDA 3MT7A 3O4IA 1ULUA 1TMOA 4OB6A 4ZOCA 4TRNA 3K2IA 2K2WA 3OPYI 3L05A 4ZT2A 2Q6OA 3W2FA 2Z4SA 1DFGA 2IUEA 3ZW9A 5LDDC 4QX6A 4TMFA 4TUYA 2AKEA 1DJNA 2OP0A 2ZKLA 3MWEA 2ZRAA 3UWOA 1LGYA 2ACVA 1BJRE 4B2YA 2Y1GA 2FW9A 2QY6A 3E7DA 3GLKA 3GNLA 2BCGY 1Q17A 3R5XA 1XZNA 1ZZGA 1T0HB 2WJVA 4OXIA 4KQHA 1JAYA 1PLLA 2CMKA 3U37A 4Z9XA 3V8EA 4KR2A 4U6NA 2Z43A 5GOZA 4CBVA 4TTPA 2BEKA 5DM1A 2ZIGA 1PGPA 1ZS9A 1HETA 1UQUA 3QOWA 1R3DA 2X9LA 3L7AA 2FPOA 3P9KA 5DX8A 1JU3A 2YOGA 4COKA 4RC9A 2OAGA 3UJPA 5FO0A 1CUWA 1N2SA 1Z0AA 2QLBA 4NZZA 5F23A 3IBSA 2A9JA 1F2DA 2WC1A 2WF5A 2XYGA 3EIOA 2ONYA 3I32A 3QKWA 2ZYWX 5GTDA 3U56A 2CNNA 3RIYA 1TTHA 3LM8A 2OHFA 3AGPA 2J9GA 1YQ9A 2Q1UA 3H99A 3HYLA 4UASA 5CMLA 1XFDA 1YACA 3PNMA 4ZI7B 4U6QA 2ODAA 3N8GA 3NH9A 2HOQA 2BLNA 3KYBA 5AW0A 4PQYA 5JISA 3S1SA 3U4GA 1S8AA 2E37A 5LMUB 2L82A 2SKDA 1CHNA 2OORC 2JBAB 2PBZA 3FF4A 2IQ5A 5TGDA 5CCBA 2YV1A 1LTQA 2AWOA 1MJ5A 2O6LA 4L2IA 1AK2A 5WRFA 4ERNA 4BBAA 2PZGA 1FX1A 3GLHB 4B8WA 2OSBA 2OVBA 5K3AA 1E5QA 1B8NA 1Y7IA 1Z34A 2H2GA 2QJWA 3T7JA 4B2IA 1U3FA 1VRVA 2BEVA 4ICIA 3BIFA 3NLLA 3I39X 2RGEA 2H6EA 3IBGA 4OA5A 4PYLA 1DJOA 4BAGA 4CKYA 2P6OA 3WMWA 5HQ3A 4X44A 1NHGA 5JY1A 3IVXA 5DTJA 4XZ3A 2HIMA 4KB5A 2ZJBA 2AFIB 2WA1A 3C2QA 1T34A 4EB8A 1ZLYA 2GJKA 4ER6A 1GZ4A 1ZGJA 4IVRA 2Z9DA 2ZPAA 4L3OA 1ODFA 3KKZA 2XIQA 4OUDB