5DNVA

Crystal structure of kai2-like protein from striga (apo state 2)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
271
structure length
271
Chain Sequence
b'GSMNRVEAARNVHIVGSGDTTVVLGHGFGTDQSVWKHLVPYLVDSYRVLLYDNMGAGSTNPEYFHFERYSTLQGYAHDLLVILHEFNIRSCIFVGHSLSAMTGAIASIIRPDLFQKIVMLSASPRFLNTADYLGGFEPADVEQLAGAIEANYKSWVSGFAPMVVGGDMDSVAVQEFSRTLFNMRPDIARSVFRTIFTSDLRDYLGRVTVPCHIIQSSRDMAVPVSVAGYIHNRVGGRSVVEVMNTEGHLPQLSAPEVAIPVLLRHIKNDID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ShKAI2iB
molecule tags Hydrolase
source organism Striga hermonthica
publication title Structural basis of unique ligand specificity of KAI2-like protein from parasitic weed Striga hermonthica
pubmed doi rcsb
total genus 80
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dnvA00
3EBLA 3G8YA 5KBYA 5CH8A 4B7ZA 3GA7A 5AKJA 3KXPA 2QJRA 1XZFA 4A16A 5LZ2A 4ZV7A 5HK9A 3T52A 1EH5A 3C8HA 5F4ZA 4E15A 1WPXA 2OCIA 2GYWA 4D9JA 2CEKA 5CT4A 2XUFA 5I9IA 3LP5A 2BUAA 3WK7A 2XB6A 1ZD4A 5JASA 2B4KA 5LZ8A 2CMFA 5BOVA 4WCVA 1ZOIA 4L3WA 4FTWA 1J06A 3E1GA 4P92A 3STWA 1L7AA 4N5HX 3G9ZA 4GW3A 5AK5A 1EB8A 3PICA 1E8DA 4C4YA 3QMVA 4PF1A 3C70A 1SCKA 3QVMA 2PKYX 4QLAA 4XIIA 1P0QA 2XUGA 3V1MA 4B6GA 2WIFA 1EHYA 3BWXA 1VZ2A 1XLWA 2WTNA 1JFRA 4BCBA 1G42A 2ES4A 3R3VA 4Q1VA 3PI6A 5IVDA 3KOOA 4UFPA 1CPYA 3BIWA 1YS2X 4NVRA 5LKAA 4JEIA 4J3JA 4QWMA 4J03A 2Q0XA 1BCSA 4Y2UA 4W63A 2OCGA 5K3DA 2H9YA 2VJCA 3U1TA 3FYUC 4HTAA 1E89A 3DDUA 3FLBA 2WHPA 2GZRA 4PV7A 3WA7A 5AI9A 1VXRA 3CCBA 2VSQA 1UKAA 4Q34A 1GQSA 4UPDA 1Y7IA 3OM8A 1XFDA 4GEGA 4Q05A 3HJUA 4IH4A 2XMDA 1GXSA 2E3JA 4EY5A 1LPMA 5A7FA 1NX9A 4M0MA 4Q3LA 1DU4A 1TIBA 5AI0A 3FVRA 1FFBA 2WG0A 4PW0A 4AB1A 5CBKA 3C43A 3IUJA 4TPKA 3I6MA 3QH4A 2VTVA 2PUJA 3WZMA 1AZWA 3O0DA 3AFIA 4KACA 2XMSA 5LLSA 5FLKA 3HI4A 4OSEA 5ALLA 1Q84A 5FPQA 5SYMA 3S2ZA 4BTLA 5JIBA 1YASA 4WY5A 1G4HA 2XMRA 2WM2A 1GPNA 1LPBB 3SWWA 2WLSA 1U65A 4UHCA 5JD4A 2HA5A 3D59A 2ONCA 4BRSA 1OCEA 1E8MA 1QLWA 1A8UA 5FOQA 1R9MA 3C6ZA 3E4DA 3N0TA 3STTA 5AKIA 5ALIA 1AMNA 2JGFA 1DWQA 1QIDA 1AX9A 5C8VA 2CUTA 4HAIA 2ORYA 4Y2VA 3QITA 2VT6A 4J7AA 3F97A 4GXNA 4KE9A 1Z68A 5CT9A 3VXKA 5AKHA 4K6HA 3D3NA 5E4JA 1JKMA 4MWTA 2G4LA 1SC9A 2DSNA 3HEAA 4GDMA 1R3DA 2XDWA 3AIOA 4BDSA 2BFNA 4L72A 5T4HA 1YAHA 4FNGA 2J4CA 2WJ4A 3EF3A 2PSJA 4AO7A 4EHBA 3ICWA 4NS4A 4JUIA 4FLEA 2WU4A 5CTAA 1JI3A 5AK6A 5AOCA 4OB6A 4PSCA 3R3XA 1EX9A 3GFFA 5AOBA 3FVTA 4FDMA 4Y2PA 4RPCA 2ZYRA 4KE8A 2WFLA 1KEZA 1MO2A 3FCYA 2BGRA 3H19A 3WK5A 3R40A 5AKYA 3I6YA 3GBSA 1WHSA 2Z8ZA 1ZGBA 3Q8WA 3IUQA 3ZLUA 3W04A 2O7VA 3WMRA 3U0VA 5HCUA 2OQIA 3W9BA 4EBBA 5FV4A 4BAZA 1EK2A 1CFJA 2HM7A 3O4JA 3VDXA 4HXFB 1E8NA 4M0FA 1UKBA 4BZZA 4EY7A 2VF2A 1UK7A 3ANTA 2VEOA 1H2XA 1CUSA 4U2FA 4BP9A 4MYDA 3VVLA 5JD5A 1SCIA 2HADA 5FXMA 4FWBA 1EDBA 1P0IA 4KRYA 2V9ZA 1QTRA 2K2QB 1JT2A 2I03A 3F96A 5AOAA 4L9AA 1G66A 1HKHA 5ALDA 2DR0A 2IX9A 4B82A 3TGLA 3WYNA 4QLOA 3NOXA 2ZSHA 1QGED 2H7CA 2W6CX 5EFZA 2BUBA 7YASA 2WUFA 4K6GA 4UUQA 4J0IA 1EXWA 1X2BA 1MX1A 3VJKA 1B6GA 3STUA 4XVCA 3LS2A 2FJPA 4UFNA 4X90A 4DMFA 1DQYA 4KR0A 4KJXA 5EIAA 4FFWA 3MVEA 2DCMA 4Y2XA 2JGKA 2VT7A 2AJLI 1P0MA 2RONA 1NU6A 1ACLA 5KWJA 4DNFA 4Q82A 1IUNA 4ZRDA 3G9TA 1PFQA 5IVIA 4BVKA 4WJLA 1QJ4A 1USWA 2XLCA 5K3FB 1TK3A 4J0HA 5HQ3A 3FAKA 3V9AA 5FP0A 3V48A 1F0PA 2V96A 4E11A 5FRDA 1XRPA 1YS1X 4PSUA 2ZYIA 1YB7A 1UOPA 3EQ7A 2XI4A 3WJ1A 3WK4A 1BCRA 5AKEA 1UK8A 2HFKA 2WIJA 5DYYA 3DD5A 5JAOA 1J1IA 4EY6A 2H7YA 4W1SA 5HF8A 3RARA 2OQVA 5FKJA 3DJYA 1XZBA 2BUCA 5I7UA 1VJ5A 5ALRA 4OU4A 1FSSA 4AN0A 1GKKA 4B85A 1XKTA 3O9MA 3C87A 2CKMA 3JW8A 1U4NA 2J4FA 4EZIA 3WK9A 1BRTA 3G7NA 4Y2RA 5A62A 1MNAA 4ETWA 1VZ3A 4N8EA 1T2NA 2QUAA 3O9VA 1H2WA 1QIFA 1CR6A 2XLBA 3AIKA 2XMCA 4Y2QA 4F5ZA 3R3ZA 3WKDA 3H17A 4C6HA 1S8OA 1MAHA 4C4ZA 4BE4A 3I2KA 3M81A 4K5QA 2JIDA 3E3AA 2WU3A 1ZGCA 3ZPXA 2QS9A 3HACA 3DNMA 4BRZA 2AXEA 2WHPB 2HFJA 2X5XA 3HC7A 1ETHA 3A6ZA 1XZLA 3FYTA 4RE6A 1XRNA 3A2LA 4ARAA 5AJHA 4IH1A 4F60A 2AJCA 3H1BA 5EHXA 5ALVA 4CG1A 5EIHA 1GPKA 1CUEA 1MT3A 5J3JA 5JAPA 1O6FA 4OB7A 3GZJA 1HBJA 4G1FA 2PSHA 5C7YA 3H2JA 3K2IA 1CEXA 5BWBA 4FBMA 3QMWA 4YK7A 1UOQA 1EVQA 4A23A 2XQGA 1DX6A 3W9UA 3WYDA 4MEBA 1CUBA 3IIIA 1QIKA 4X85A 1CUHA 4X3CA 2JEYA 1R1DA 4G8BA 4B0OA 1LBSA 1BN6A 2H7XA 2XUPA 5DTJA 1UKCA 3QYJA 2QTBA 3W05A 1RYYA 4H7IA 4BC0A 5LKRA 2G5PA 3BJRA 5ALWA 4H77A 3BF7A 4QDZA 4U2GA 1X2EA 2HA6A 1ZI6A 1UOOA 1Y37A 1JJIA 1YA4A 2IIVA 5ALUA 1CUVA 4H18A 1LLFA 1MNQA 3HLKA 3G02A 4CG2A 1SOMA 3AIMA 5AK3A 2OCLA 2QVBA 4J0CA 3IVMA 5HF6A 5JARA 2OAEA 4C4XA 1I6WA 4UBKA 1K8QA 4IO0A 3KWFA 3BDVA 3F8SA 2JF0A 2EDCA 3WKBA 5D3ZA 4B81A 1LPAB 4ITVA 1U2EA 2V98A 2EDAA 1K4YA 1LPOA 2I3DA 2HA0A 1KU0A 1OXMA 2QMQA 3WWDA 2WIKA 3OTQA 2ZVDA 3BE8A 2D0DA 3WWOA 3IUNA 2HA3A 3GROA 1YAJA 2WFZA 3I28A 2ZSIA 5DWDA 3WKAA 1ZI9A 1ISPA 5AIBA 2CJPA 4LXGA 1ZJ5A 4QDOA 3PF9A 2O2IA 5HFAA 5JADA 4N8SA 3D7RA 1QO9A 4WFKA 2IITA 3QPAA 4H0CA 2BGNA 1Q0RA 4H7DA 5AI5A 6YASA 1ZICA 1LGYA 4TVKA 4QDUA 3E0XA 2OAGA 2VQ6A 3W06A 3QZUA 4JYPA 2ZYSA 5EHQA 4ROTA 2XMZA 4BAGA 5YASA 5CMLA 2DQZA 2WUEA 3X3HA 2WJ6A 2BKLA 5AHXA 3WWEA 3CN7A 3MUOA 2HA2A 2HU5A 1CUXA 4ZWNA 2Z5GA 4KAFA 1W76A 1THGA 3B12A 2GYUA 3O4GA 3G9XA 3AUKA 4H7HA 1ZD5A 2PSEA 3F67A 2HRQA 1CUCA 1XRRA 4UHBA 1EDDA 4DNQA 5DJ5A 4BAUA 3DLTA 1Y7HA 4B84A 1QFSA 4BYMA 3CXUA 2XUAA 1CVLA 1T4MA 2PSDA 4GWLA 1SFRA 3O95A 2YYSA 4MXDA 3G0GA 2QT9A 4O08A 1XQVA 3DYVA 4BBZA 1PV1A 5CW2A 3AZOA 5JATA 1A8QA 4X95A 1CUDA 5ALTA 1CQZA 1CV2A 1DT5A 4QDTA 2G63A 1H2YA 2RHTA 1HQDA 4OU5A 1L7QA 2QOEA 1YCDA 1FJ2A 5D3KA 5EHNA 4MQLA 4X93A 4U2BA 3SC2A 2R8BA 4LIPD 2BCEA 1GZ7A 2DFPA 2OXEA 1OILA 2X76A 1XZAA 2XUJA 2JGJA 3PUIA 3WIBA 4YASA 4HRXA 1XLUA 4QZVA 4N8DA 4X71A 4UBMA 2GBIA 4X92A 2GZSA 2WFLB 2QXUA 1W52X 4HRYA 1IZ7A 2WTMA 5CT5A 3VVMA 4E14A 3HRHA 2BJHA 2CZQA 1ODSA 4WDRA 3S8YA 1GKLA 1YB6A 5ALYA 5ISMA 4GHWA 4KYVA 4W1QA 3NUZA 1JJFA 1QIJA 4QNNA 5E4TA 1HPLA 1XQXA 1CUFA 4QEKA 1Q83A 3ESDA 1C7JA 4LXHA 4Y9SA 1A88A 2P8SA 1QONA 4I19A 2QUBA 3DOIA 2JGIA 5D6OA 4X97A 4B9AA 3I1IA 3YASA 1DWPA 1QE3A 1UFOA 2XMQA 4E46A 1W1IA 4OB8A 4CFSA 2HHAA 3SK0A 5EHZA 5AM3A 4AMZA 4WFIA 4W9RA 2C7BA 5DTIA 4OCZA 3JYHA 1N1MA 1LPSA 1YA8A 4C87A 3FBWA 2OGSA 2QXTA 1EI9A 2WHQA 3H2GA 2HU8A 3ZWQA 5LZ9A 3PE6A 3G0CA 1MJ5A 4AZ3A 3ZV7A 1XLVA 2JGEA 1FFDA 3H18A 5CRIA 5HKAA 2ZYHA 3I2IA 2J3QA 3IURA 3I1YA 4J0DA 1YSCA 1TQHA 4WDQA 5A71A 4WY8A 3IDAA 1DQZA 2XUIA 2PU5A 4OUKX 4W1RA 2OCKA 3I2HA 4FHZA 1ZIYA 3ESAA 2HA7A 5CT6A 4MQMA 2WFMA 2OPHA 3WL7A 1DINA 5KREA 3F9CA 1N5RA 2C0QA 3D2CA 2CBGA 1WOMA 2OLEA 2XQJA 4UBNA 2C5GA 3AZPA 1HDEA 3ZLTA 5KWIA 3PF8A 4C89A 1FFEA 1QZ3A 4DMKA 4GBGA 4AXBA 4A5SA 5IH7A 4CI9A 5AI6A 1J2EA 1XRLA 1LBTA 3Q0TA 3V1KA 5C81A 3UUEA 5AIAA 4PQEA 1XZKA 1L7RA 5DNVA 4Y2YA 2ACEA 3W2TA 1HLGA 3AJAA 4CCYB 3BIXA 3BL8A 4MEAA 1UK6A 3WKEA 4DLNA 3IUMA 3DKKA 3DKRA 1CUYA 3IBTA 4FMPA 2Y2VA 4RE5A 5I8PA 3WKCA 3WQHA 4G8DA 3UMJA 5CH3A 2PX6A 1CQWA 4XX1A 5K3BA 3AZQA 3QPCA 3BF8A 4G5XA 2WIDA 1XZGA 4BB0A 3G0DA 2BAGA 2WIGA 4BTVA 5K3AA 3V1NA 4OD0A 4C88A 5LZ5A 2Z3ZA 1WB4A 4G4JA 1DX4A 1VXOA 3OPMA 1HL7A 3K6KA 1AKNA 3D4LA 1BN7A 3LIPA 3H2IA 3H0CA 3D5EA 1CUAA 2VJDA 4KRXA 5AH0A 3I2JA 1XKLA 1IZ8A 5JZBA 1SCQA 2PU7A 3SX4A 3PFBA 5CT8A 1ODCA 2Z8XA 1XZIA 5JZSA 1K5PA 1MX5A 2RIPA 5LZ4A 3FLAA 1N8SA 1VLQA 3MUNA 5A7HA 2RGUA 3T4UA 1JU4A 3AILA 1WCYA 1BS9A 2CB9A 1MPXA 1WB5A 1ACJA 2WQZA 4LHEA 3NGMA 3B5EA 4XJVA 4FLMA 1TKRA 2XE4A 1ZJ4A 5ALPA 5AP9A 3B3QA 4HXEB 3IULA 5IVHA 1GGVA 4F21A 5JZ9A 4CIBA 3VJMA 1MAAA 2XQFA 3WJ2A 4FBLA 1UK9A 1TCCA 1IUOA 1O6GA 5AM1A 1CUUA 2JGLA 2DHDA 5AICA 3ZLVA 2HA4A 4DMHA 4AMYA 4XWGA 5ALKA 3C45A 3R41A 4OYYA 5HF9A 2XUDA 2PSFA 2ACKA 5ALMA 3WL5A 3OURA 4H7EA 1XZHA 2HRRA 1CUZA 4KE6A 5D7BA 3WK6A 5T4EA 5ALOA 4MYSA 4AO8A 2AJ8A 5AO9A 2D5LA 2VATA 5DLPA 1RWQA 3OG9A 3HYSA 3R3YA 1XQWA 4DTCA 5AKKA 5AM2A 5IKXA 4X91A 4FKBA 2ROQA 3DEAA 2XUQA 2WG2A 4BCCA 3C5VA 2NW6A 4KAAA 3JWEA 5ALGA 4J0JA 4AO6A 2OGTA 5H3HA 2AJBA 5ALZA 2R11A 3QMMA 2VJBA 5LYYA 1VA5A 2HL6A 4V2IA 3H2HA 5A7GA 1U8EA 4BCDA 4X7BA 2HIHA 4QWWA 3OOSA 4IHAA 3ESCA 4J0KA 4Y2JA 4EY8A 4BZWA 2O2HA 3KWJA 4H7JA 5FPPA 3MGAA 1UT6A 4Q3OA 1QTIA 1VA4A 4DSAA 1EB9A 4H35A 5DYWA 2PBLA 2DHEA 1FFCA 3WZLA 4KE7A 2XMBA 3C5WP 4B0PA 1CUIA 4QE3A 5AM5A 1TRHA 1YR2A 1ZIXA 2QM0A 4P08A 1EA5A 1Q0ZA 3C6XA 3VKFA 1ODTC 5DNUA 1XRQA 4G4GA 4ZXFA 3QM1A 2B61A 3LIIA 5HF5A 1QIGA 5DYTA 3D2AA 4Z49A 2RHWA 5IVKA 3C6YA 1LZLA 1QO7A 3G0BA 3BJMA 5ALNA 3V1LA 4Y7DA 5ALFA 1W75A 3I2FA 3D2BA 3NWOA 3RKSA 3P2MA 3PDCA 4Y2TA 2DQYA 3I2GA 4UHEA 2PPLA 3QBJA 1TCAA 1DTEA 4ZV9A 2GYVA 5AKLA 1EK1A 2Y1KA 3FYUA 4EUSA 4I4CA 3KSRA 4C01A 1XZDA 4TGLA 3FWHA 4G4IA 4G9EA 4HZGA 1GT6A 1BEZA 4U2CA 5LZ7A 1JU3A 2QJWA 5HQ3B 3CN9A 2VAXA 2WUDA 1H23A 5AI8A 2C0PA 4DYHA 1A8SA 4U2EA 4J0GA 2LIPA 4UHDA 1RP1A 4LYDA 2Y6UA 2RI6A 3WK8A 2WG1A 1E3QA 5HFNA 2H1IA 4ZREA 4BE9A 2WJ3A 1CIJA 3C6BA 4L0CA 4JNCA 1QFMA 3WWPA 4X6YA 2PVSA 4B9EA 2HDWA 4W1PA 2YH2A 4X94A 4GI1A 4P9NA 1J07A 2YASA 4CCYA 4CIAA 5LP1A 3PUHA 4UBJA 1MX9A 3GELA 5ALXA 4GLBA 3DOHA 1B41A 5BV7A 5LIPA 4LYEA 4I3FA 4UHFA 1N5MA 5JANA 1XZJA 1E66A 3RM3A 2G5TA 1CRLA 3LCRA 1QIMA 4AX4A 4LKOA 2XQKA 3EIOA 3ICVA 4GECA 2XUOA 4IQ4A 2OGZA 1K6EA 5K3CA 4JYMA 1IMJA 3KD2A 2WKWA 3R0VA 2PM8A 3ZI7A 5AM0A 3H2KA 3VJLA 5ALEA 1IVYA 1F0NA 3DS8A 3A2NA 1QIHA 5A6VA 5A2GA 2W22A 3H1AA 3H04A 3FSGA 1EDEA 2GBFA 2ZJ6A 2XUHA 5T4FA 5DNWA 4INZA 1BE0A 4H7KA 3IB3A 3TEJA 4DSZA 5AKZA 2WHRA 1AURA 3STXA 2WUGA 1QIEA 4G8CA 1WM1A 3ED1A 5FUMA 4ZI5A 1WHTA 4YPVA 1JJBA 2QKYA 5ESRA 3STVA 5JAHA 3STYA 5C8ZA 4X6UA 2JGMA 1H22A 1VOTA 1WB6A 3M82A 4BVLA 2FJ0A 3A2MA 2Z3WA 1QOZA 1XZMA 3M3DA 1BU8A 3FOBA 3L1IA 1D07A 1NU8A 2JBWA 2QR5A 5JD6A 1KU6A 4HS9A 3EQ9A 3IA2A 3DL7A 5K3EA 3WL8A 1X70A 5AKGA 2GBGA 2HU7A 1MN6A 1W6RA 3O4HA 4P93A 1A7UA 4NMWA 5AKXA 1FFAA 5FDFA 3D0KA 4DGQA 1LZKA 3M83A 1QIIA 4UBLA 3WI7A 1R9NA 5K5EA 3HABA 3FLEA 1WPRA 2C4HA 4UFOA 2V97A 3FYUB 4ZGBA 1ZD2P 3OC0A 2PUHA 4RNCA 4KAJA 1K63A 1R50A 1VE7A 1M33A 1P0PA 2RAUA 5CH5A 2Y2UA 2PL5A 5HZGA 4K2AA 1VKHA 3KDAA 5CXXA 1EVEA 3TJMA 2OG1A 4LXIA 3BXPA 3FNBA 1ORVA 4UBIA 3BDIA 1XQYA 4FNMA 4MWSA 1UXOA 1EINA 2I78A 2VJAA 4OYLA 2VA9A 4PNZA 1G5FA 4HVTA 1TCBA 5AI4A 1AQLA 3DL4A 4EA6A 4M0EA 3DYIA 1BROA 2FX5A 4PSDA 5EI5A 3UUFA 3R3WA 4QDXA 3I6ZA 4NZZA 1JMKC 3DQZA 2C5FA 5E2IA 2VAVA 3ESBA 4BVJA 3AINA 1CUGA 4MJ3A 4RGYA 4UBOA 1TAHA 1XZCA 3ILSA 1W4LA 3O4IA 3TRDA 1XRMA 2FUKA 4G9GA 4KEAA 3C8DA 1XROA 4PO3X 3HZOA 4F0JA 4OPMA 1AUOA 4S0XA 3WIOA 4BC1A 4DNOA 3VISA 3WWCA 4JH0A 2DHCA 2O7RA 3WLAA 2XQIA 1E5TA 5JYCA 1LNSA 1DT3A 1MTZA 4H7FA 1F6WA 2O2GA 1DWOA 3GUUA 4WFJA 2B20A 1IUPA 5HK8A 1UZAA 2GBCA 3K9BA 1F8UA 1GQRA 3RLIA 4N5IX 1GPLA 5BWCA 5EGNA 4DIUA 1BEEA 1ORWA 4DMCA 5AM4A 3N2ZB 4CG3A 5ALJA 3FCXA 4Q3KA 3LLCA 5EIEA 5ALSA 3G9UA 5JALA 5K3FA 2WILA 2ZJFA 5E4YA 2XUKA 2QRUA 1CUJA 3ANSA 1THTA 1MU0A 4FLFA 2WSLA 4K6KA 3L1HA 1LPNA 3RK4A 5CURA 4FFVA 1AGYA 1ZI8A 5C8XA 2X8BA 3FSGD 3HXKA 1R4ZA 2QZPA 5JAUA 2XT0A 5ALHA 4AQDA 5AK4A 1UWCA 2B9VA 4Y2SA 4DM7A 1H2ZA 4B80A 2XMGA 4AZ0A 4CCWA 4IH9A 2C58A 5CXUA 1PJAA 3G0IA 1VE6A 5SYNA 1XZEA 2Y6VA 4DNPA 1LPPA 1JMYA 3WA6A 2AJDA 4AN1A 1R88A 3DCNA 5ALQA 4ARBA 2UZ0A 3CCCA 4U2DA 4FOLA 3A70A 5HKBA 1C4XA 4HXGA 2J3DA 3L1JA 3WL6A 4BDTA 4UHHA 4BP8A 4EY4A 3QPDA 1ZD3A 3F98A 2JEZA 2EEPA 2I3ZA 4X00A 4X6XA 2ECFA 4QA9A 3R3UA 2ZJ7A 2YXPX 4YX9A 1C7IA 1CUWA 3EQ8A 4BATA 4B83A 5T4BA 3HSSA 4EB0A 3PFCA 1AC5A 1CLEA
chains in the Genus database with same CATH superfamily
3G8YA 3NWJA 4FCVA 4ZT7A 2R00A 5K3OA 2BISA 2IOFA 2X4IA 2XNCA 3DSRA 1D2NA 3KXPA 5AKJA 2A0KA 2CXXA 1YRHA 2HRBA 3C41J 3JD1A 3B82A 4N3GA 2QJRA 2PKRA 2PRZA 4Z2YA 2QZ9A 3U4QB 5DP1A 1PP4A 4BLPA 2Q4DA 3I39X 4EBFA 1EH5A 4J16A 2VUSA 3G23A 3BFPA 5HK9A 4C0LA 4II2A 4FE4A 4V24A 2XPCA 3E7PA 7GPBA 1S3IA 2YC2C 5B1SA 2J6IA 4E15A 3L77A 4W5RA 3W8EA 3KXDA 1WP4A 2PS0A 2ZIEA 3TRFA 4D57A 2B0JA 3GR6A 5T57A 5TNXA 3KZOA 4BNHA 2YVLA 1U3UA 2XUFA 4RVFA 5CVCA 3LP5A 5I9IA 2BUAA 1ZBQA 3WK7A 3SSOA 4YJ2B 4DA9A 1NNI1 2C4TA 3U40A 1G16A 1ZD4A 1WBDA 3PXUA 4G1MB 3Q9SA 5FUVA 2VQEB 2RHRA 2P5TB 1QRTA 3EGEA 2CMFA 1LLCA 2WWXA 3KJNA 4WKCA 5CM8B 4RXTA 2EX4A 4X64B 2GZ2A 4JB0A 4OTZA 4J75A 3B9QA 2ID4A 2IYXA 3RWOA 3E1GA 3IXLA 4H4EA 1XA3A 4P92A 3RIMA 2FZWA 1EMDA 3NGXA 4U3JB 4PCLA 4CKWB 3I0MA 1E7RA 3OX3A 5EMHA 3LDHA 4U7FA 4GW3A 4RNDB 2PGDA 1UJCA 3BICA 1EB8A 4J90A 3SG0A 1Y9AA 2IYEA 4YI3A 3ZU6A 3C70A 4GSYA 2IC5A 2QB5A 2RKWA 1QP8A 1XNJA 3QU2A 3QVMA 1Y7LA 4TQGA 1UDCA 3JQQA 1P0QA 2IEBA 4HVAA 4EKDA 3ZJVA 4GLOA 1SEPA 5F21A 2ZS7A 3PD1A 1KS9A 3K0FB 3BXXA 4K6CA 4UMEA 5IARA 3K70B 4TTVA 1X8XA 3LFUA 1Z9BA 3I01M 4LDAA 2XJ9A 3PNKA 1JFRA 3A31A 4XUEA 4RVSA 3GQBB 3T8YA 1PAUA 3EXHC 1XEWY 3QE9Y 5J63A 3IQFA 5TS3A 2R5WA 4JBWA 4S2EA 2CL0X 3PI6A 3FSJX 1R4AA 2Y1DA 3B5JA 4M9XA 4RV4A 1PS0A 5EIBC 3N6RA 2BKXA 3AUUA 4C22A 4J3JA 3L8HA 1PVOA 4P0QB 1BCSA 1HOTA 4CHTA 1KGSA 3EEYA 5C8DA 3OZTA 1MGPA 1AKUA 3CJQA 1JKIA 1WW3A 2VJCA 4N9QA 2Z2YA 5HQJA 4ZZ2A 3ZBTA 2HJWA 1TLTA 3H7AA 2RGDA 2PL9A 1E89A 1UQRA 4W82A 3FLBA 3AEUA 3MJDA 2IZ6A 3VDNB 1YZLA 4HRVA 1C14A 4RANA 4UMDA 4ITUA 1W94A 1ENZA 1OBHA 1RFGE 2HQBA 4Q4HA 4PV7A 3WA7A 1EXDA 3HDYA 1F5SA 4NBRA 1UKAA 3U7JA 2LCQA 4E33A 1NP6A 1GQSA 3MLAA 5DT9A 2FW8A 3QYFA 4L15A 3LYAA 3QF4A 3EH1A 4ZOQI 1I1OA 4FJ0A 4DABA 1Y7IA 4NWIA 4OKNA 5IBQA 4HAYA 2ZYWX 1EESA 4F3KA 2H59A 2P75A 2RGNC 4KGZA 3OM8A 1RLUA 4PLWA 4DIFA 1G38A 4IVPA 3SHTA 4D97A 2UYQA 4KW7A 4OK5A 1MUUA 3UJ7A 1J0BA 2GLXA 1KQFA 4MW1A 3VYSB 4P54A 4ZTUB 4YFYA 4M87A 3W7BA 4LYYA 1RYZA 1QVZA 4DB2A 3DAHA 4EL5A 4N3NA 3PD7A 4HLQB 5HVNA 3K1ZA 1XEXA 4BEWA 1BNCA 2CVFA 4OY3A 5ECGC 4EY5A 3IKTA 2CHEA 4Q0MA 3RROA 1RM4A 4QGBA 1WZ2A 1PN3A 5A7FA 4M0MA 4DDTA 3ZDAA 3EWSA 4DWWA 3AR7A 1WD5A 1TIBA 3RFUA 4NFSA 4NBKA 3R7WA 1BJTA 2ZCVA 4HNHA 5DBIA 3BEOA 2ZDQA 4TYPA 4AZVA 3FVRA 3N76A 3Q4GA 3ZLBA 2WG0A 1MZPA 2OENG 1PBTA 3MHPA 3C43A 3RJ9A 2XBUA 3FI9A 1U7TA 2G8LA 4Q1AA 3I6MA 5JJIA 1L8OA 3V4RA 4KPUB 4YDHB 4MYTA 4HWSA 2HK7A 2WNHA 3OE1A 1OTYA 1E4YA 1CF4A 1HNZB 4QOFA 1AZWA 3WZMA 1SKYB 5CDTA 4NC9A 3GLGE 4NULA 1JXAA 1NVTA 1V5IA 2W90A 2XMSA 3QF4B 2Y93A 3A1FA 2HREA 2WSIA 2O14A 2XWBF 3BSSA 3SOPA 1NXVA 2P5UA 1EUZA 1EXMA 2FJUA 4TKZA 5IUKC 5BSGA 5CAEA 1JKJA 1BX1A 4FS8A 1N6OA 5JIBA 4V3BA 5DHSA 2BEWB 4C3OB 3U7RA 1JPJA 2OV4A 2OKCA 1W1UA 1YASA 2CNBA 4MV7A 3LC2O 3ZE9A 4D1YA 4BY9E 1EIZA 1UODA 4Q4JA 3PQ4A 4URXR 1G4HA 1RRKA 1T4CB 4Q7JB 3H4VA 1JJVA 1Z0DA 1JE0A 1BCSB 2ZJ2A 1P2FA 4ZEOA 3RYTC 1U0NA 3N6XA 4I6JA 1XKQA 3IT3A 4YT8A 4Q1CA 3K73O 5JD4A 4BEVA 1F7UA 1HLPA 4N18A 1OBVA 4BE7B 1MW8X 2ONCA 1C2YA 2EFCB 1IJBA 3PA6A 4QRHA 4MS4B 1OCEA 1QLWA 2F9MA 1A8UA 2Q6LA 4BQSA 4DPLA 2O2YA 3A14A 2WUWE 3OEYA 2R60A 3U4AA 2C8JA 2XDQA 4GR5A 3ZGZA 3D7NA 1UBLS 2GTIA 1W4AA 4ZO4A 3UBMA 2CVQA 3F6BX 3ZUGA 4ETMA 1VFPA 4S0ZA 4YRZA 4CXMA 3FPEA 1P1BA 1SHKA 2QLTA 4QUJA 4RL4A 4BNUA 3L2OB 3W2IA 1MB2A 1HG0A 2QMZA 5IK2A 1KDVA 3E5RA 4HV4A 4TYYA 2O8CB 3BCHA 4C9BA 2JGFA 1DWQA 1OUMA 1AX9A 1QIDA 1VPEA 1Y8AA 2YN4A 2Z9CA 2YZMA 3UTDA 2ORYA 5E3HA 3QITA 2VT6A 3E9CA 1FPMA 2ATIA 3MLEA 4GKVA 3F97A 4O4JB 5CJJA 5BQ5A 3GOHA 4GXNA 4BGUA 1GRCA 4KE9A 2DFVA 1ULSA 2ZSKA 2ISQA 3ILYA 5CT9A 1H4QA 2F8MA 5AKHA 1BAPA 4P33A 2AOUB 1SK8A 3ID6C 4PC1A 3EXFA 1P0CA 2BR5A 3QG1A 4GPBA 2GPAA 3PC2A 1X80B 2IF2A 4N5LA 2DSNA 3OUUA 4GDMA 4RS3A 4AUEA 4QTYA 2L0XA 3SJAA 4LBVA 3WHPA 2R1TA 4X62B 4UUBA 3G2IA 5HTOA 2WA2A 3BEDA 4PCVA 2ACWA 2RGNA 5HGXA 3KJIA 3OF2A 1ZX1A 1RFLA 4B4VA 1NVGA 4OHZA 4B2IA 8MHTA 4QBFA 2HHHB 2YV5A 9GPBA 4LFCB 3ICWA 3EGXB 3O8RA 4R3NA 4FLEA 2OCPA 2GVDC 4U7WA 3S44A 4E2FA 2JJ2A 4U8GA 1BW9A 2G0AA 4A1FA 2VH5R 1HYEA 1FDWA 4G1VA 4MI3A 4TT3A 4PSCA 4QQFA 2HJRA 2CLKB 3TTTA 3FUTA 1VMDA 1JR3A 4J7CA 2GILA 4I1SA 4RD2A 4B32A 1SQ0A 3ODGA 4HDAA 5E6SA 5F64A 3FVTA 3TLZA 1YTUA 1SXJC 1V5FA 3L18A 5IAJA 1YE5A 1T6YA 2HXGA 3I0NA 3I52A 4OQQA 1T2UA 4Q4CA 5DNEA 1APBA 1SCAA 4MPTA 1QF7A 1YOVB 1EFTA 1KEZA 1I14A 1MOZA 1RSZA 1MO2A 3FCYA 3MOGA 4P4SA 5JYDA 4PTYA 2D13A 1WEKA 3H19A 3K2BA 1OI2A 2JJYA 2UVPB 1G18A 2YFHA 3ZIAA 2ZRDA 3EUEA 1D04A 2NPFA 4X1IB 3UH0A 3UA4A 1CDEA 1TKCA 1DZIA 1BOOA 4KSCA 4FIDA 3AHEA 3ZE2B 2Z8ZA 3MJFA 4FFBB 4QUGA 2M98A 4U0KA 2HWUA 4J9VA 1ZGBA 4MV3A 1E5XA 4YCJA 2FE1A 3WWYA 2BP7B 4CETA 4FMDB 1NTRA 1YTLA 4PQGA 5LNK1 4PXAA 1WG8A 4MUAA 2O8VA 1MB3A 4QODA 2G08A 3D6JA 3HEMA 4GBMA 4LS3A 3ZLUA 3QOWA 3IO3A 2OEPA 5E9AA 3UCEA 3ZTYA 2DH5A 2YQ5A 3RC3A 4MDEA 1G8FA 1MR3F 4N7RA 5BVGA 4HEA1 4Q02A 3U0VA 2OZKA 2OQIA 3D7LA 3W9BA 3RIYA 1L3BA 2Y4NA 4MHOA 1YDMA 2VA8A 3ADCA 1FBNA 2EFDB 4WXMA 1SUEA 3GPCA 4Q9NA 6ABPA 4JQZA 3PVCA 5GWXA 3S3TA 1Y82A 1B00A 1PR9A 1EK2A 2BFFA 4M99A 3QSYA 4EA7A 1U5BB 2QGFA 2P9YA 2HM7A 4I9UA 3O4JA 1Y33E 2TS1A 3IXMA 1H2HA 2CF5A 2A5GA 2R8EA 2B82A 4RD6A 1PFVA 4MGHA 1PE0A 1UFKA 4C0QC 1VG9B 2OK7A 3ISTA 4BO2A 4A36A 1W5TA 4EY7A 1B8PA 1UK7A 4KWIA 5LN1A 4FSHA 5A02A 3BGWA 1KI6A 2AQHA 2VEOA 4M1MA 5H3CA 4AG5A 1KMNA 1YJCA 2RGGA 4PO1A 1MX3A 4MYDA 1NUQA 3WTCA 1QZUA 1R5OA 2CCGA 2KBEA 4IIHA 2X0FA 3IC5A 4BVFA 1PIWA 1VB5A 1Z73A 3RS2A 1E2KA 3OKCA 4RQAA 2FPWA 2WV7A 3FTCA 2ZM6B 2GBPA 1PV4A 1U9JA 3KZMA 3CW2A 3NUQA 3OFKA 3CO5A 2TECE 4KRYA 4R5HA 5IMSA 1Z7BA 5ECDA 2K2QB 4C5BA 4INJA 2GWHA 2I03A 4JJ4A 3AHJA 3QFRA 5KTOA 2ZW9A 3K1TA 3WLRA 1TGVA 3A37A 1WHSB 1P9OA 2CXRA 3GRFA 2IPLA 1G66A 2OWEA 2XGMA 5LQRA 5ALDA 1U0OC 3AF3A 5FOWA 4B82A 2AEJA 2NV2B 3FPGA 4J3NA 5J2TF 2BGIA 3CSDA 3KSDO 4X44A 1V5WA 3JQ9A 1I51A 4K88A 3J81k 4QLOA 2FLKA 2J8ZA 3BFVA 5KZMB 3G82C 4Q1FA 1RC0A 1PT7A 1T9HA 2XTAA 5EFZA 4ENPA 2W0SA 3N58A 3VKGA 1WDKA 1NVUQ 2IP4A 3WWZA 3RYFB 1VKJA 3AG6A 4K6GA 1F1JA 4LSGA 4Y0AA 3CH7A 4J0IA 4UNSA 2SCUA 3DLBA 3TJRA 1ZL0A 2CLMB 3HM9A 1EXWA 2XA9A 4OGGA 1MX1A 1OLUB 3ZVLA 1G5PA 3ZY3A 3PEYA 4CMBA 1ZMTA 4JLJA 3EBOA 3TNFA 3STUA 1E99A 4XVCA 2H1LA 1XZQA 2IUFA 3T7TA 2R4QA 2IZOA 3QLTA 4GQAA 4XJXA 3CX4A 4UFNA 5KQPA 1JPUA 3QE4A 1LW7A 4RA6B 4IXTA 4AY3A 1DCMA 1X7DA 3KHTA 4U9HS 1KQGA 1Y3FE 4Z3DA 3E1SA 1FK8A 4KR0A 2I6TA 2YMQA 3DV2A 4BGIA 1GV1A 1F2VA 1HZZC 5B57C 5EIAA 4FFWA 4JMLA 2P6RA 3GJ4A 1Y8QB 2DCMA 4Y2XA 1XCJA 4ZAWA 3WO1A 1UF9A 4FCWA 4Q7MB 2Z9DA 4U6NA 4L4YA 4BP3A 5BNTA 3HCOA 1L8AA 2JGKA 4TQ9A 1P4HA 3AO0B 2OXCA 1GPDG 4FU0A 3TGWA 2AJLI 1I33A 3PFGA 4L0MA 4PLZA 1DAGA 1QG4A 4AZ0B 5ADVA 1P62B 1PZMA 1R6TA 1T29A 2JC3A 3PDJA 3IPXA 4Q93A 4LEIA 5F33A 4QRDA 1AQNA 1U8UA 5HKLA 3LDFA 3WGJA 2PJUA 3HNOA 1PFQA 5IVIA 2XZPA 3CUTA 3PFKA 1AO3A 2HLNA 1USWA 1DQRA 3D8SA 3KYCA 4LMRA 3HY3A 4W6ZA 5A04A 3I61A 3KDSE 2QTMA 3F5QA 3HVUA 5KOHA 3DE1X 3DP7A 3H9UA 4NCIA 1REQA 5CTJA 4F3CA 3ENKA 5FP0A 1GCGA 4OFXA 4RLHA 1KMHA 1R8XA 3HWWA 3Q10A 5F9FA 3GLKA 1T3TA 1H0HA 5TMBA 5K8TA 3QKUA 2G80A 2JD2A 2VDKB 1U3DA 1YB7A 3QJ5A 1UOPA 7ABPA 3ZVNA 5JCZA 4CIYA 1CZRA 4G85A 5T3YA 3EQ7A 3ORFA 4RAQA 2PLFA 4BX9A 4LGMA 4DAOA 2XI4A 3MK31 3P2OA 2RHDA 2A5DA 3WK4A 3A6LA 1AKMA 1BCRA 4CW7A 3JQ7A 1G4UR 1R6VA 1RYMA 1SZPA 2PTGA 4ZHQB 1T4BA 1TUEA 5DP2A 4DAEA 2JAUA 2WIJA 1LDNA 1T1JA 1HQKA 1QGOA 4HNVA 3NQ41 4BLTA 4FDAA 3RK0A 1UQTA 3MMNA 2AOWA 1CQJA 1ISSA 2JFWA 3COWA 2AC7A 2CHFA 2UDPA 2BOVA 3LKVA 1L8QA 1PZEA 3GGSA 4GGOA 4ZOBA 2JJ2D 3RE1A 3ZQJA 5JYEA 1J1IA 1N2CB 5DULA 1YBAA 4EY6A 2AZDA 3FGZA 2H7YA 1UP7A 1SVKA 2ZYDA 3EVNA 3Q6MA 5K8LA 1MDFA 1KIFA 1J23A 1UM9A 1NW3A 2C7QA 4IP0A 2VNHA 3INNA 3DJYA 1XZBA 2OQVA 2GOYA 1NVXQ 3OLZA 3TPZA 4B3RB 1VJ5A 4QAQA 4Y1EA 4BMYA 2IS1A 3IHLA 5GV7A 5BNZA 4K40A 1QTQA 4PN7A 4PHGA 1SUFA 4AMBA 1RXSA 2H1HA 3TZLA 4TLCA 1Q91A 1YJBA 1PX2A 2ZR8A 3OBIA 4JUCA 4V0SA 1QU2A 1U0LA 1KWGA 1WNFA 4TM8A 2BL4A 2DWUA 4KNYA 2ZJ8A 1WDLA 2RGCA 2C9CA 3L0SA 1U11A 3ND7A 2QRJA 1BWPA 5JRZA 2EKLA 1HKUA 3BH6A 1WQ1R 1T9BA 2J4FA 4RTJA 1LX6A 3H97A 1IH8A 3AERB 4I14A 5LQDA 3FG9A 3DV9A 1OZGA 1SG0A 5A62A 1M0WA 5AT1A 4EAAA 1ZM4A 1UFQA 2FEPA 3SIXA 3NC1C 4N8EA 3AC0A 2FW9A 4RTQA 3KHSA 1EVYA 4AS2A 1NWCA 1E6MA 1HE4A 1V39A 1YIDA 2GF0A 3HY6A 3IE2A 1S8FA 2Z6QA 4MQEB 1DBIA 4YCCA 4MUHA 1LEHA 3WDLA 3FYDA 4HUTA 1L4UA 3ZU4A 1FDRA 2UYOA 1GVHA 3NANA 4Y2QA 3I37X 3L0PA 3R3ZA 2C42A 1A9SA 1QFJA 1RWKA 2XD4A 3I4LA 1YHYA 2K87A 1IL0A 3VDRA 3H17A 3WKDA 2ONKA 2R7AA 3H5TA 3T35A 1XF9A 3I2KA 1N2CA 3KRTA 4ZO7A 3U09A 1KOFA 2HWYA 4PINA 2O7SA 1KY5A 1H3EA 3M81A 4K5QA 4MV9A 1V1MA 1KXJA 3VYWA 4EUKA 1DHTA 1NRXA 3UFXA 1WB9A 2Y92A 3ZD7A 2WAXA 1ZGCA 3RC8A 1KR5A 2KB0A 3ZV5A 1FYDA 5B36A 3AI2A 4DPKA 2QS9A 2C92A 1NVWQ 1U3VA 2IUYA 1X77A 2VK4A 3G1UA 3GLTA 3ND6A 4JU9A 1WCIB 4WLNA 4XPIB 4GC9A 4CV0A 2JFOA 4ZV4A 4LFBB 2JLAA 3CH4B 4Q1DA 2UZ1A 2WHPB 1MENA 1YBFA 2HFJA 5I9BA 2ODNA 3OY2A 3PDIA 3II6X 4B4DA 4HNUA 1ETHA 1TW3A 4I1OA 3IEPA 3NTRA 1XMOB 3UMBA 3HN7A 3ZWAA 4YJ3B 3TFOA 4QBKA 4DEXA 4QYIA 1W93A 2AFRA 3A25A 3HKCA 1U0BB 4HVLA 1UFVA 2BI7A 3Q9LA 2ISCA 1QVRA 5IJZA 3AR6A 1U9CA 4JT8A 3M5CA 2G04A 4LNUB 1KTVA 2VK1A 1PW7A 3A1NA 4M22A 1M2HA 2ENWA 3LYLA 4XI9A 1ZWLA 3CRMA 3NCTA 3QKSB 4G5RA 5DM4A 5EIHA 4CG1A 4GUDA 3KM0A 3O5AA 3PNQA 4OA8A 4P7BA 2QX9A 3F4BA 4Q18A 3WNDA 5KNCA 1M75A 1OC4A 5KINB 1ADBA 5DM1A 1O6FA 5J3JA 4D6PA 4ITRC 1WQ3A 4CF3A 2D1QA 4YAJA 3UAZA 5AD1A 1JDVA 3MOIA 1UAYA 1Y4SA 4G1FA 3TLKA 3DTYA 3H2JA 5COAA 1WUKS 1SCUB 3PBKA 2CLOB 2Q5CA 4RYDA 2QDKA 3CO0S 5G4KB 3F47A 3KFXA 4DA8A 2PV0A 4DDMA 4NCAA 1P75A 3MJSA 3O3CA 3PCXA 1KSGA 3PEUA 1YFLA 2D7JA 3DZIA 2J9FB 3PUKA 2B8NA 4MLCA 4G1CA 3AJ8A 3WICA 4RC9A 5KCZA 5F2EA 4QXQA 2C9BA 2EZUA 2XE8A 2JASA 3NLLA 1NRIA 2G82A 4IM7A 4RK5A 1G64A 4RX1A 5FHRA 3UAXA 3W6NA 4ENWA 5I01A 3WGUA 1HZZA 4HDRA 1QIKA 5DCYA 1CUHA 5JPIA 1PK9A 1LFAA 3RSFA 3TLYA 1R1DA 2MMCA 2LDXA 2UYYA 3GJYA 3GVPA 4UUAA 5EPEA 4QNRA 3VSEA 4B0OA 5H8WA 3V34A 3DMNA 4WH0A 2IDMA 1VJ0A 4EHAA 1LBSA 4ER5A 2BFBA 3OX2A 4LWOA 1SR8A 1K7CA 3CB2A 5ED0A 1JHVA 2H7XA 1AUPA 1S3SA 2K4MA 2I34A 2YMLA 2JVKA 3DAPA 3FUXA 4JVLA 4RY9A 3QYJA 3S1AA 1HE5A 3HYCA 3LZ6A 3VPHA 5LMZA 5BRAA 1GPUA 5FI3A 4BC0A 4NAUA 4PN3A 5LKRA 3IAUA 3ZY2A 1YS7A 1YRLA 3BJRA 5ALWA 5BV2P 1W19A 4U2GA 4DCTA 3RJMA 3CTPA 1X2EA 3EK2A 5TMEA 1ORHA 2HA6A 3WQBA 3CVUA 4LF5B 1ZI6A 5H3LA 3UOWA 3ZHUA 1UOOA 3H2SA 4B5KA 3GFPA 2G67A 1OLOA 2G6BA 2Q2NA 3JQRA 2IYUA 3IP9A 4PE5B 5L3QB 3EDYA 4M53A 3OJWA 3SYLA 3TQFA 1UJ2A 2PMWB 1UBKS 1T6XA 3AFMA 4CG2A 2ZYGA 3JYQA 4GPD1 1ZPDA 2B69A 4LYGA 1GSIA 2YWJA 4JBYA 1B16A 3NAGA 1JS1X 1GR1A 2QVBA 2ZS8A 3C1TA 2M1ZA 2ERXA 3Q0EA 4JNKA 1JA9A 4QUIA 3S7ZA 1I6WA 1XVAA 5BT9A 3JV7A 3MCTA 1SOAA 2P1DA 3SBXA 3ZI4A 3WV4A 3ORYA 4NQRA 3KWFA 1CU1A 2C9DA 3BDVA 3VO2A 1ISJA 1FXWF 3QXCA 2ZZNA 1H42A 2H1VA 3EY9A 1OV6A 1DUIA 4XCXA 1Q77A 2QQ0A 3OLCX 4C06A 5AUPB 4OJKA 2ANCA 3WKBA 3RPEA 5M3BA 2OV8A 3T4PA 1YZNA 2PFGA 3OLQA 1YBVA 2BFMA 1ESNA 1NJ2A 2FF7A 2VRNA 3NM4A 2BH9A 5D8DA 3Q40A 3TQQA 1FDSA 3X1DA 4I5GA 1DVRA 4HDCA 2OUKA 1UXHA 5JJBA 3L0CA 1KU0A 3EE6A 3B52X 3UPUA 2Z1NA 1KJWA 4DR3B 4NU0A 4NFYA 1MEJA 3OTQA 5AJWA 5JCOA 4Q7QA 2DGDA 2HIGA 3EUAA 3OZEA 1X13A 3JR7A 1ZKMA 2PH1A 4Z9FA 4HQ0A 4P22A 1A9XA 3OAAD 4JUFA 2C3OA 3WWOA 5KKNB 1G63A 1YV9A 3IUNA 5LVAA 2V5UA 1FP7A 1YAJA 4FFBA 1FTYA 4Q9LA 4CQNA 1G5HA 3ETEA 2VHEA 5B12A 3VMFA 1P39A 4MVJM 3D31A 1TUBA 3DJFA 1ISPA 2FSGA 3GW8A 4TSFD 5AIBA 2Y1LA 1TT7A 1FNSA 3E27A 4IJMA 1JAIA 4MP3A 4QDOA 2B8TA 2PG3A 1SH7A 4MUYA 1SC3A 1SVIA 3R5KA 3BTSA 4RMHA 5LQSA 4WFKA 3RUEA 3QPAA 2IWRA 4H0CA 2BGNA 1Q0RA 2ONJA 3CLRC 3W3ZB 1HNXB 2W6MA 4QXPA 3KQUA 3IQGX 4RHTA 1ZICA 3VTFA 4TVKA 721PA 3JZMA 4EHHA 1DKLA 5L4SA 5ITWA 5JXWA 2O0KA 3BHIA 3ESRA 2QD2A 3ABRB 3C14C 2OECA 3S5JA 3NC0C 4IQ8A 1I1NA 2JZOA 3D3WB 1RKQA 3QZUA 5BWLA 4MDYA 1IOWA 2F67A 4C2AA 3FLMA 4FMCF 4O25A 2EYUA 2J7PA 2XMZA 1DDIA 3AUSA 3E3MA 4ROTA 5FBZA 5TPZA 5YASA 4M1QA 4BLVA 5KQSA 3MAJA 5TT0A 2DQZA 2W83A 4E1VA 3L4BA 3ND8A 2OG2A 2WUEA 3U39A 1NZFA 1RQ2A 1CQXA 1JF8A 1JPVA 5IYZB 3WDKA 1HA3A 2AWOA 2NP7A 4CGZA 1U2DA 3HXTA 4RD0A 4LYHA 3RW9A 3OWHA 1ISMA 1HH4A 4M0LA 2WJPA 4B6SA 1M54A 3DMTC 3MRSA 2R1TB 4FYVA 4RVHA 4FD3A 2DEUA 2JS7A 1TYCA 3PR2B 3TQRA 1Z2PX 4YGXB 1T2FA 1EE1A 2YZGA 1CUXA 2B8EA 4TUYA 4Y2GA 2B6NA 3G5LA 1PNTA 1G21B 2REQB 3CZRA 3UC9A 1Y9DA 3L8MA 5EA2A 4E6EA 3ZH2A 4K9MA 2GYUA 4BLWA 2A3RA 4P4GA 1U63A 1QU3A 1L4KA 2J0VA 2ZRCA 1N5KA 1UJ4A 5E1OA 4O4LB 4C0BA 1XPOA 4LCJA 1VP3A 1PHPA 2VH1A 4BFLA 1M7GA 4MIYA 1DEAA 1RXEA 2BFEA 2ZRMA 3ZQ4A 1O5TA 3F67A 4UEJA 1USGA 3IUSA 3KZNA 4WCDA 4A2PA 3DDOA 3H5AA 2HRQA 3F3YA 1SIOA 1N7IA 4J2TA 2FOLA 4TTIA 1M73E 1XRRA 5FI1B 3TXAA 2DQSA 4D3SA 4M8KA 3SF0A 1DQPA 2MYPA 2Z5FA 2ZEJA 4BAUA 5CLJA 2HPAA 1WIWA 1Y5MA 4L4UA 4MPDA 4MROA 2VHXA 3ASVA 1M0SA 3K5WA 4B84A 3CXUA 5EMJA 4BYMA 2XUAA 4C3VA 1O94D 3PDIB 1HG1A 1T4MA 4G5HA 1YUMA 2WE8A 1T2VA 3KCNA 1PG0A 1AF4A 1H94A 2FE4A 4HMPA 2ZQYA 4F11A 2QGZA 1MPTA 2ZR0A 3DOFA 1GZVA 4HAWA 4K9PA 2C8VA 4QYIB 2OFWA 3OMLA 4H16A 2VKQA 2QW0X 3UJ8A 4MV4A 1QKIA 5JATA 1EM8A 5ETJA 1CUDA 1T4CA 3QX7A 4KO4S 4LGCA 5D84A 2NU8B 5HZMA 1GUFA 3JRWA 4FN4A 3OD5A 2QPOA 2A59A 2C5SA 1K0UA 2QDXA 1H2YA 2EU8A 3KYJB 1E94E 2RHTA 4F6LA 3NIDB 4TL9A 1V9SA 2J9XB 4CR8A 3ZG6A 2AT1A 3VYVA 1L7QA 2OOSA 1X9IA 1JYFA 2QOEA 4KOEC 3OZWA 1YCDA 4DUGA 2XNJA 1KSHA 5D3KA 4BJHB 4M83A 4BQQA 4RCYA 1DJLA 3G5UA 4OUDB 3MCAA 4LOHA 1ZHOA 3E9DA 1YB2A 5LU9A 4J4HA 3QU4A 1CDDA 1RWNA 3A8TA 3P96A 4MQ5A 4BZQA 3CVOA 4EHFA 3SC2A 1TO1E 2GVNA 2NP6A 2FP4A 4K26A 1Z2NX 3SHVA 2OGWA 4K87A 1G17A 1GLNA 2CZCA 4TMFA 1ZOPA 3T7DA 2GERA 4Q47A 3Q5DA 1XZAA 2GPNA 2ZBRA 3E9MA 1YHNA 2GDJA 3OQIB 5EIFA 3RFFA 1N0HA 2JFUA 3GNTA 3IV7A 3WIBA 4YASA 2CDRA 5DBHX 2BH2A 3OFSA 2O5RA 2QF7A 2D4HA 2A4KA 1CY6A 2QTVB 3PHIA 3PRYA 2ZR9A 3QU7A 1MF7A 2FQXA 4M0KA 4UU7A 4ZN6A 5AXBA 1OXUA 3NR2A 1VYHA 2RGBA 2I7CA 2XX3A 3N8DA 2VYVD 4UBMA 4X71A 4MW6A 3HBLA 4X92A 2GZDA 4CI0B 1QHFA 1UBSB 2CFTA 1JA0A 1SBZA 1IIRA 3G2HA 5EKUA 3UM9A 1ZO8A 1JZTA 3TTSA 2WJYA 2QRLA 4E14A 4P7JA 1B1AA 1P44A 1YACA 4B76A 4AYWA 1A2KC 1F38A 3DTVD 2CZQA 2OLJA 2ZLBA 3ZHQA 3EGCA 1K6JA 3COYA 3FYHA 4K9LA 4PGFA 5EZ6B 3T3EA 4YMVA 2PMFA 2X0JA 5EIXA 3N28A 1AM4D 1U2DC 2EZ8A 4TZTA 5I9TA 2NZWA 1PU2A 3TD6A 3TUJC 1MQSA 1V6CA 1YR8A 5IG2A 4IICA 1GKLA 4WCFA 3ZVMA 5EG5A 2GM4A 4OKIA 1A76A 4GVPA 2L82A 4UM8B 2D00A 5IWAB 2R79A 4GHWA 1PNVA 4R1SA 4UOZA 3PZRA 4KYVA 2GSWA 3AUJB 2Q7DA 1KJ8A 1JJFA 1QIJA 2JFPA 4QEZA 5BXQC 1A2OA 3K53A 3EODA 4L22A 4OM8A 3CRVA 2C4KA 5KYGA 5KPJA 5C51B 1XQXA 1CUFA 2XTNA 1HYQA 4EHIA 4HB4A 4JUAA 4LXHA 1J1UA 3FF4A 3DOCA 3QFFA 1NQTA 4YMSA 3RSZA 1KDZA 5L95A 1QONA 4QTZA 3UFXB 4Y7CA 4YR9A 5FUXA 4QFDA 4X60A 2C54A 4HZUA 5LMNB 4AAYA 3RYHA 3I8SA 4AMVA 1WD7A 4CIDA 4ZHSA 5IHXA 4TMTA 3BX1A 3TL6A 3DOIA 4O4IA 2JGIA 1IFXA 2RJ3A 2HZBA 5D6OA 2VQ3A 1RYBA 2YW2A 3JYPA 4PC7A 4PAWA 4B9AA 5JQGA 2VSNA 2CL7X 1K7XB 4EFKA 2FFAA 3LQ2A 2PANA 1GSHA 1IDOA 1MXFA 3MJRA 3TNDA 5K4GA 5KNDA 4PYMA 4Y2HA 5K2OA 1C30B 1U0HC 5K8CA 1OC2A 2GXUA 1EP3B 1JH9A 1BKDR 2AF3C 1BTOA 2ZSBA 2JI7A 1Q95A 1D5CA 1QMGA 3CUWA 3GNLA 1RXYA 4KDFA 3SQLA 5GQSA 5KX5A 1JDPA 3IJ5A 1DNPA 1CY4A 3P26A 2VQDA 4YCLA 1ZR2A 2IHZA 2WHXA 3F3SA 1VMIA 4M1EA 1JSCA 1IIBA 1YR6A 4G4SP 1PDWA 4OCZA 4O0LA 1NVEA 5FFFA 3W2FA 2FDXA 1GGKA 1LPSA 4KQMA 3FPSA 4D4MA 2DSTA 1Q7CA 2YS7A 1GJRA 4BP1A 2KYRA 2WHQA 4PLVA 4Y1FA 5LZ9A 1DC4A 1ABEA 2PUVA 3HJCA 3K9NA 1RJDA 2PCJA 1GP2A 3QWAA 4HNAA 4J1NA 5GMOA 5BWMA 1XLVA 2JGEA 3GFOA 2UYCA 3NH6A 5CRIA 2BHRA 5HKAA 1CQPA 3M3PA 5DX8A 1KEPA 3NONA 3BGSA 1S89A 4F71A 3ZXUB 3TTYA 5AW0A 2IIPA 3FIJA 4BBPA 2DFNA 4DN6A 2J3QA 2RFLA 3Q7PA 2VK2A 1AT1A 1WTAA 2PZJA 3I1YA 1C9MA 2CEAA 5M29A 1C0LA 1TQHA 3DVLA 5T6BA 4CR7A 1TJ5A 2FETA 5CNMA 1XK6A 5DW3A 1NMEA 5BUQA 3E22A 3V4VB 3W5UA 1T26A 1VPWA 3VI4B 1DO0A 1Z4OA 2FG7C 1BX3A 1OJ7A 1DQZA 5LQJA 4G0QA 2Z4RA 3TG2A 3N1UA 1XTZA 2JLZA 1W5SA 3E8XA 3K2EA 2XUIA 5CYOA 4B75A 2JRLA 1QOPB 3IAS6 3LRXA 3I2HA 4J1SA 3WRXC 2VL7A 3CEPB 4M38A 3KL4A 3EDMA 5HOEA 1EBFA 2HF7A 4KO8A 4JLUA 5DI3A 5IASA 4EWLA 2QLJA 3Q3VA 5CT6A 3CT4A 2HQSA 2WFMA 4CEJB 3DZCA 2H16A 5JHHB 4H17A 4JLNA 3DVAA 2QG6A 4RKYA 4AURA 5U1PA 4ZYLA 2NPOA 2FVXA 2IL1A 2ZIXA 4M89A 4CKBB 4DIOA 5EJ4A 3MJCA 2FWMX 4YDSA 5L8VA 2ECKA 3RFTA 2JKYA 2VHJA 2WTXA 4P4NA 5EJIA 1ZEMA 1RHKA 4LHVA 1P73A 5EVJA 2CVZA 1YS6A 3SNKA 3H4IA 1CDZA 4MUFA 2XQJA 3ROGA 1XZNA 4E1BA 1U2GC 4HEA6 1HDEA 2PZLA 3VDMA 3ZLTA 5K6AA 1E2HA 5G0SA 1YL7A 1AV6A 2IVZA 1BVHA 3MGBA 3P45A 3DF9A 2A33A 3F6RA 3PF8A 5CXSA 3CT6A 5IMBA 5A4FS 4X1YA 2I2BA 2HSGA 2Z08A 3FY4A 1M5UA 4LJ5A 2FEAA 1ABFA 2I3GA 3E4CA 5DCWA 4YRPA 3MBOA 4PBRA 5KVQA 5LXTF 3ZYZA 1J6UA 2BMWA 3V1KA 5C81A 1W44A 3O8NA 3VC7A 1JDBB 2H1OA 1GITA 3UUEA 1Q16A 2RKOA 4PQEA 3RV4A 3U3JA 4KYIB 1EQ2A 3MILA 3LGSA 2C7VA 1KI6B 2ZPUA 4L76A 4JLWA 4DCUA 2QL6A 4P84A 5CLLA 1L4HA 4GP9A 1CNFA 4IDNA 2JJ1A 2W4QA 4ZVKA 3ROXA 4HTFB 1Y1SA 2QIPA 2DTDA 3DC2A 4RZIA 3OQOA 2DFTA 3BE6A 3N2GB 5BYJA 3V8PA 3NBXX 1V3VA 3QELB 1E5LA 4KFTA 1NYLA 3PHLA 2CMHA 5K0LA 1FUEA 5E1BA 5L6LB 1U5BA 1HMPA 4CV3A 1KI2A 3I2YX 2BGWA 3NWEA 3TZHA 3DKKA 2P3OA 2B94A 1IHPA 2X5OA 4BUJA 2GK7A 2Y0DA 3IBSA 4AKHA 1L5SA 4FMPA 4JLBA 1U3TA 4LTNA 4JR1A 1IEQA 2WDPA 3EVZA 1KJIA 1OB5A 2X6TA 3JQDA 3R75A 4LMBA 2X9NA 1H2EA 3WQHA 1FNNA 4EYGA 4HB0A 2NYUA 3FUWA 2JBAA 1QE5A 5B7GA 4I9FA 3Q3GE 2UUCB 2RH4A 1GTSA 2A9JA 3R24A 4O5AA 1T35A 1X7WA 3G0DA 3TLAA 4ZQEA 1RACA 1CE8A 4WGFA 2X0RA 3L8YA 1WETA 4Z8XA 1ZNWA 1KY3A 4L5IA 3LVFO 5E6SB 2NUTA 1VQ1A 4QGSA 5CLFA 2AG0A 3U7QA 2XZLA 2R5NA 1A5SB 2P41A 2XH8A 5LZ5A 2AK2A 2GJ9A 3SSMA 1TU3A 1WB4A 5TR9A 1VXOA 3WNVA 1W87A 2V3VA 4X65B 1H8ED 2DLNA 1E6UA 3BH7A 4KWHA 4YBZA 4PNEA 2DP4E 3OCWA 2L42A 2VCHA 1ADFA 4U00A 4WGGA 1GTMA 3PQ6A 3D7MA 4MH0R 4XXHA 3AUTA 2ILTA 2DY1A 3R9IA 3DT8A 3QPWA 3LF2A 1BN7A 1P74A 1ZN8A 3PT5A 4YQFA 4KAXA 3NYIA 5CBPB 2OP0A 2EGGA 1ZMXA 1GPBA 2I7VA 4LFAB 1K88A 1ADCA 5FWAA 3KTDA 1KK0A 1SA0A 3BKXA 4F8EA 3ZQUA 1DE0A 4TWAA 2E37A 1RADA 1YNOA 3Q8XB 2GAJA 4LDQA 2WVGA 3CB4A 1JYSA 3CX3A 1L7DA 1P9NA 4HDNA 3G2QA 4DSNA 2ODTX 1Z5OA 3CA8A 3ELYA 1DAPA 3WQRA 4WJZA 1BZYA 1L7EA 4MZXA 5FI5A 1DV1A 3RIXA 1TO6A 5JW6A 5DM0A 1VKRA 5DW0A 2DLCX 1LBEA 1P5JA 1P5RA 2V0CA 2HPZA 3DV0B 3O90A 1IZ8A 4KH1A 2JAPA 5GGXA 1JSLA 4UM9D 4KPFC 2OFXA 4ZAYA 2ZBPA 3SX4A 2O3QA 1E6LA 3TTXA 4N7MA 2UXBB 1U2RA 5C5IA 2ZUEA 3HU1A 2JJMA 3G2LA 3L6RA 2O8CA 3T5GA 1AK9A 1ODCA 3MCZA 4RTMA 4FUTA 1DOAA 2H85A 6Q21A 4IOMA 4QU0A 5JAZA 4A8TA 2PZMA 3HYTA 4IX9A 2BKUA 3V2HA 3UT0A 4G3XA 5JMPA 3KQVA 4EVRA 3CF4A 5JZSA 5FLXA 1GCAA 1JDSA 1AV7A 2DG2A 5KYKA 1N2XA 2HH9A 3TD2A 3WP1B 5LZ4A 2V7UA 3KPYA 1ML4A 2NNWB 4NY1A 3HU3A 4PC2A 3OZCA 4XVUA 2R6CA 3KYBA 3GZTB 5CB4A 2CK3D 5CVUA 3S7TA 3DDCA 4DG9A 3U6KA 3COPA 2DYKA 1HDOA 4NBVA 2WUVA 5D86A 4HUQA 4IUDS 4KQ9A 2DKNA 3O75A 2YVAA 4TYWA 3IQXA 2OMKA 3UKDA 5AW6A 3P32A 3W3AA 1ACJA 1UMDA 1XMXA 4D0SA 1H0RA 4TS4A 5ITZB 2XECA 4OAQA 3WYBA 5FH9A 1PTJA 1SBTA 1TKRA 2IPXA 4PGHA 4G0OA 1RZ3A 3M4JA 2J3HA 4PBTA 3X44A 3OFND 1C3OA 2F4VB 3KSZO 3U3RA 2O3TA 2O1XA 3AUXA 1PGQA 5NLLA 3CYFA 1GTVA 3T9DA 4XWKA 4RACA 3K9HA 3R0ZA 3UHPA 1ZIPA 2N3ZA 1V7PC 3ROEA 5JZ9A 4IX1A 3AXSA 4L2IA 1N77A 1UBRS 1V1RA 3B78A 4CIBA 2OVBA 5DNDA 4A0QA 3L8EA 1WUJS 1JN0A 1NBHA 1ORIA 1VBKA 3BMCB 4Y0VA 4ICIA 1Z82A 2A58A 2OBNA 2HKIA 4M9CA 4FONA 4P98A 4PC3A 3OETA 1XCMA 2BBTA 4A9AA 1TCCA 1IUOA 4LZLA 3GRKA 3NJRA 2W71A 1XTUA 2WNSA 1QANA 2Q2OA 3LOQA 1LA2A 4QOSA 3E2IA 2VHZA 1FLDA 4WEQA 3E61A 4RY2A 3DL0A 5AICA 2BW0A 3ZDCA 1KHTA 3RYCB 4ZRNA 1NP7A 4DMHA 3NEJA 1N3YA 4TVOA 2ZSFA 3WJAA 5T41A 4AMYA 3B8EA 2AOUA 3H6GA 3EDOA 1G8AA 4FFLA 3SVTA 2KMLA 3N9IA 4G0ZA 4X1KA 3A6GA 1Z6XA 2ZAGA 3KQQA 4B3BA 1HGXA 5LWQA 4K46A 2SKEA 4G0VA 2CJWB 3ZGVA 4URWR 1M6WA 2QW1A 4N0EA 2I6QA 2MDTA 5KAMA 2H4HA 1JBKA 1JIUA 1DIGA 4F2GA 5CEJA 1J0CA 3QOXA 3DFUA 4G1UC 3WL5A 1PJLA 2FPPA 1TF7A 1E3WB 1Z3IX 2YWCA 1EHIA 1XZHA 3EF0A 3OKPA 5FAKA 3F90A 5IXYA 4TZ0A 4GM4A 3FKSA 1CUZA 4PX5A 1V16A 3H9GA 3DZ8A 3MELA 4H3KB 4B74A 1O0CA 5E0KB 4CMCA 1F8XA 4EKNB 3FCSB 4JR0A 5DBGA 4HH0A 4WD3A 3TSOA 3CMCO 2BVNA 3ZWXA 2PDAA 1P4JA 3GGOA 4N40A 4TWZA 4N5NA 1BFUA 2WWTA 4WBXC 1F4PA 2R6GA 3WYCA 5B64A 2JIZA 4NMXB 4ZVRA 3K70C 4G0UA 2NVBA 2FX3A 2VATA 1VIVA 4FGZA 4L8GA 4OFBA 1ARZA 3JQ8B 2D3WA 1GYPA 1SUSA 1NVKA 3ZE1B 2A5LA 1CRPA 1CHNA 1Q6ZA 1U7HA 3OA2A 4A6EA 2Z95A 2PRJA 4M9ZA 5AM2A 2CFRA 2H51A 4X91A 3AJEA 1DRJA 1GNTA 3I83A 3L7CA 1CZOA 3P0IA 3MW8A 1RRFA 2ROQA 2XUQA 3DEAA 1FVHA 2JI9A 3DUFB 5AVZA 3PSAA 2GRJA 3GDOA 3ROFA 2WZBA 1UBJS 4OKSA 3C5VA 4EG7A 2Z2XA 2NW6A 3R20A 1KI9A 4MWEA 3KB6A 2EERA 1M1XB 4QPCA 5ALGA 4MI6A 4H6VA 4DDWA 4DJTA 4NXMB 2VP3A 4AO6A 4D0RA 3RBXA 4A4DA 3AEXA 3H8WA 1U81A 3PNBA 4BJ5A 2E7ZA 1V16B 2RGAA 2WWHA 5ALZA 2OTCA 1EBUA 4G26A 2B5VA 5IAKA 4DLLA 4YYEA 2BTQA 4N7JA 5A7GA 4R83A 3VR2A 5IVPA 3D7SA 3R6GA 1WMBA 2P3SA 4JEUA 4WZ6A 2GEFA 2HIHA 4DLSA 4RXMA 1UBUS 3KEOA 1C4KA 1QG2A 2D74A 2FPIA 2I2AA 4TTTS 5I9SA 3MOSA 2G1PA 4NKRA 3TZCA 1JHPA 3IO5A 3QOYA 3KTAA 4JC8A 4R2WA 1D3AA 5KQMA 1YDGA 3DTNA 3QY9A 5CGQB 2CHVA 1OFUX 2YHIA 1SCJA 2WR8A 3NALA 4H7JA 4II7A 5FPPA 2A9QA 1AIPA 4HVCA 4LC1A 4MS1A 3T1VA 2JCBA 1UT6A 4Q3OA 4FFMA 3I73A 1QTIA 3QJGA 2HLDA 4K2HA 1HDCA 4OUDA 4DSAA 5IXJA 1ZL2A 3AW8A 3F6EX 4J3FA 3EGDB 2I54A 5K1ZA 5BW5A 3AK4A 1ECBA 4P4UA 3OCCA 2SICE 4NL4H 4YRRA 3V6LA 3ZYCA 3H65A 2DHEA 4B6QA 3WZLA 1FLAA 2FH5B 1GA4A 2Z6VA 4A73A 3C5WP 3VNBA 3BMCA 1Q0PA 1F6BA 3BQNB 4FC6A 4CLHA 5JG7A 3DXYA 5BNIA 1Y6JA 2QM0A 3HUDA 3I8OA 3O3MB 2R7LA 3W6ZA 3B1VA 4YLGA 1N4DA 1T43A 4AWBA 3MFYA 3V9PA 3SZMA 5AQEA 1Z34A 3EUWA 1CJCA 3C6XA 3VKFA 2P3QA 1VMKA 2PVPA 4EQZA 3QVSA 3H13A 3ZS9A 3AM1A 1YD7A 2OBXA 5DNUA 3Q6NA 2B4QA 4FEAA 1XRQA 2XD9A 3UHOA 1LBQA 2A3NA 4QGFA 3PCTA 4M0DA 1KP9A 2A0FA 2WYUA 4L5AA 1E79A 3OZDA 2F2TA 3R7DA 3D2AA 1SXHA 2DKOA 3FDFA 2IK8A 2RHWA 4F6CA 2D2XA 4DV0B 3EG9A 1YUNA 3G0BA 1DEHA 1FUUA 4KIGA 3T4EA 4EKIA 4KDRA 5ALNA 1CKEA 2PKWA 3OPVA 1E1CB 1X92A 1ZHFA 1VHWA 1IN5A 1E18A 3ZK9A 3D2BA 4EKEA 3I5AA 5LIRA 2BFEB 4FYWA 3NWOA 5BSTA 2PQ2A 5EE5B 1V8DA 4A8JB 3K9FC 1ZJJA 4O4LA 1GXSB 3QE0A 4MO2A 2DQYA 1Q74A 2X0EA 1PLJA 1V47A 1WULS 4ZJPA 2HWXA 4QECA 4UHEA 4QJ4A 3SF8A 4KR6A 4MVJH 1M5RA 2NVUB 3D1JA 3PKJA 1ENOA 1N7JA 3E8MA 3FE2A 1XBTA 3WMWA 3Q6IA 1ZA1A 1Z18A 4GZ3A 1NV8A 3OJFA 4JR2A 4LHYA 4TM7A 5AKLA 2H57A 2Y1KA 4LWQA 2AOTB 2E89A 1UWLA 2FEKA 2RC5A 3OZVA 4B87A 4CQMD 4PY2A 4NZOA 3DMFA 4O0MA 4Q1BA 4EUSA 5CFRA 5LLTA 4H4CA 3KSRA 1QH9A 4GWGA 4RMJA 1Y3BE 3NEPX 3CV3A 1M6VA 1HLDA 4TGLA 5A3QA 4R71A 4HB2A 1GTL1 1RAHA 1Y5IA 4JB3A 4DSOA 1ZOOA 1B42A 4PTZA 5CX1B 4P2GA 3GRUA 4IKOA 4G4IA 3OEWA 4L8WB 4QQKA 1H4SA 3T95A 3OBBA 5DLQC 4G9EA 1MXHA 1NHGA 1CS0B 2HBRA 5GVRA 3AY7A 2ZANA 1T9KA 3BT7A 1BEZA 5CA1F 4ID3A 1NONA 4LC9A 3NETA 4RPLA 1FFSA 5LZ7A 4FW8A 3ZLJA 1JIQA 2DOKA 3V4SA 2TMGA 3PFNA 1NQWA 2UUPA 3TXYA 4B79A 1OY1A 1AKYA 4C21A 2V5VA 1EP1B 2QJWA 3WHIA 1DRVA 4RUKA 4PZPA 3SCZA 5JNVA 3L7YA 4OXKA 1QAMA 3T5PA 3Q9UA 1H23A 4I5DA 2D06A 2FW1A 3BKWA 1WZNA 4TTQA 1Z83A 1NQAO 1SQGA 4DYHA 3W5AA 3JWHA 3MS4A 3PA8A 2BKEA 4RTLA 4Z7QB 1BMFA 1X9HA 3K5HA 2RI6A 2ZP1A 1T34A 4JQSA 1DG1G 4ARZB 3ADBA 1G3UA 3HDVA 2WG1A 2PGAA 2QP3A 3UB3A 1ZM9A 3DVQX 1E3QA 4ZT4A 4BO9A 1D4FA 4BVHA 1J97A 1XKXA 2VRCA 4HMQA 4X5OA 1FU4A 1R4NA 3LP6A 2V0GA 2P7HA 4BE9A 4OLAA 2WJ3A 4X6LA 1WXEA 3C6BA 4NP6A 1BSVA 4DB4A 2VAPA 3TVDA 1XHEA 2CNWA 3TJZA 1QRRA 4JNCA 3R7FA 4CMAA 2EOAA 3I58A 4I6EA 4X6YA 4HYQA 5IF9A 4Y67A 3DBRB 2HDWA 1B0AA 1K7YA 1ZGHA 3BORA 3QUTA 3VBEA 2Y77A 3P8ZA 4KTVE 1UOEA 3I30X 4P58A 4LV6A 3ZWKA 4AKTA 4W1PA 2YRXA 4B44A 2VPIA 4EL0A 1KO1A 3HJTA 3IT1A 1HT0A 1DJPA 3A1CA 4TTRA 3P71T 3GCXA 4X94A 3CRNA 2P9QA 1JL3A 4L16A 4EB6B 4P9NA 2ERCA 3EQ2A 3ONFA 3L3BA 4K6MA 4WNYA 4HAXA 3UIEA 2PGJA 2QNBA 3B2QA 2YASA 1FXUA 2A5JA 4BO3A 4K03A 1OXTA 1QH0A 5B55A 1BDIA 3A9CA 1Y5LA 1P8JA 1PI3A 1OBCA 1X7XB 1XDBA 1VP9A 2IOYA 4FWTA 4ZQIA 2RHLA 1KIMA 1QAQA 3O3OB 3NWBA 3WB9A 2NUPB 2PTHA 3CRZA 3L8FA 1XI2A 1C8BA 3GELA 1T2AA 1KO7A 4Z9BA 3KQTA 3LCJA 1SUBA 2W2VA 3HR8A 4ZOAA 3D5TA 4Z2AA 3GT0A 5ER6A 4A7PA 1Z8HA 4I2VA 3SYKA 3OP4A 3LOUA 4OAOA 3F4LA 2HTFA 4HGPA 1Z35A 2VDMB 2ZRBA 2QTLA 3MYRA 1L5RA 2PWAA 4DIDA 1WR8A 2F48A 3ZOKA 2CZGA 1YZVA 2C84A 1PGOA 1RJFA 3PWSA 1G7TA 1XZJA 1E66A 3ZZMA 1Q11A 1A9RA 1V6SA 4AQYB 1GPYA 1Z0FA 3D4IA 3LMKA 4ID9A 2FN7A 3FPBA 3LCRA 4FBGA 3K1JA 4ZO6A 1M6YA 1QK4A 4JUDX 4AX4A 4LKOA 3M1YA 2D59A 3CBQA 3H6KA 1KYZA 3KB8A 1PS9A 5COBA 2WY2D 4B3DA 4GECA 2WBLC 1X8LA 1GQQA 4LQCA 3TTWA 2HMUA 4B46A 1KDYA 5K99A 4FOPA 2EEZA 5CW1A 1XK7A 5AXCA 3KD2A 2WKWA 1B14A 1N9GB 4DQDA 2NZ2A 2RH9B 4MVJD 2GARA 4UTRA 1ATZA 5ALEA 1CNEA 3A0UA 3I09A 3PGMA 2HSZA 4JP1A 2GEUA 2ZIXB 2QD3A 4MA0A 4CIXA 3O1JC 2BF4A 1R5JA 4NF2A 1T3LA 4FP9A 4EYOA 1GO2A 2FPUA 3JRXA 5A3JA 3NT2A 1UBEA 1BWRA 5BNFA 3BA1A 1YA6A 4PAQA 1D0IA 5A2GA 5LXTB 4D43A 5EJ2A 3OIDA 2W22A 3H1AA 4AJ4A 2GN8A 1EDEA 2WKQA 2RBEA 1FSZA 2GBFA 1L7XA 3RF7A 3IVGA 1KEKA 3I92A 1C4WA 5T4FA 4GRAA 2B7CA 4UVGA 2JCGA 3I04A 3O4FA 4OMCA 2XDAA 1BXRA 2XNDA 2OP1A 2V1UA 3V8VA 2GPBA 2X5NA 1P6UA 3L0YA 1HDXA 3H6HA 5DMXA 3LKDA 3TEJA 4BNWA 1GDDA 3G13A 5EQFA 1SCUA 5AKZA 3EEOA 3HCEA 1IXKA 2XE7A 2WHRA 2F3SA 2ZXEA 5HDBB 1MVOA 1NXQA 4FNAA 1NBMA 4IIDA 3SXPA 4BVGA 4NYJQ 1VKZA 2V58A 1QIEA 1KP3A 4YJGA 1B8OA 5TF0A 3SZOA 3VR6A 1DKOA 3PC8A 5HW0A 1HRKA 2BCGY 4M8IA 3V5NA 5FUMA 5BWNA 4EO9A 3IP3A 1R6XA 3K20A 3UXMA 1O87A 4AWAA 3SS7X 3PIIA 1ECJA 4A0GA 2V8OA 1KORA 3WYFA 2DPXA 2BFAA 5DHAA 2RAPA 3DE5X 3U9SA 2NO0A 3FUVA 3X1KA 4QXAA 4UKDA 1ULUA 2GH1A 3A3OA 5ENDA 2RG1A 3IUYA 3WZ2A 4NICA 4E03A 3PGJA 3GUCA 4GGPA 2LWIA 2ATXA 2FSUA 3C16C 4W8OA 5KTSA 1JPNA 4JOBA 4ALIA 5JPDA 3CX6A 2IVFA 2FN3A 5KU7A 4Z5XA 3RB8A 1JVNA 1XZMA 3BTUA 3M3DA 5DLYA 3ZIDA 5DT2A 1BU8A 1URPA 2YDYA 3HCFA 1PQWA 2ZBVA 3CG4A 1E2UA 2Q8PA 5TT1A 3HA3A 3LQFA 3Q9NA 5EQJB 3C7DB 2JFHA 4EG1A 2O07A 1VSUA 4TV8F 1JQ5A 3RS5A 2B6HA 2M6KA 3ZDBA 5F12A 3AB7A 3GHHA 3HVRA 3JQAA 3I9FA 2G9ZA 5KHOC 4GQBA 4HS9A 4ND1A 5KCMA 1KZHA 4IPTA 3TD9A 2Y71A 2FWRA 3EQ9A 3JRNA 3UV3A 2OYRA 1XZ8A 5EJ9A 3MB5A 1KJJA 4L95C 421PA 4ARVA 1QM5A 3SIRA 1ENYA 2B34A 3LC0A 4YMWA 4DRZA 4P36A 2P79A 3X1MA 1PGJA 4WWHA 2GBGA 3INYA 3FJYA 2AQIA 1TCVA 2ZWVA 3AFGA 2H1RA 3JS5A 4ILEA 4L75A 4P93A 4W9NC 4BMVA 2WC1A 2ICAA 3O8OB 1XLTC 4NZYA 1H2BA 5BRNA 4ETNA 1KRHA 1MFPA 3JQ7B 5ANRB 1BCRB 1I3NA 3W9YA 4D8VA 7ADHA 1G5RA 1ND5A 2WT8A 3FLEA 2OV2A 1TJYA 1W6UA 1WPRA 1YKFA 2VH2A 3JQFC 4L8YA 3TKAA 3AF2A 1SGWA 2Z1MA 4ZGWA 2Q5LA 3MCWA 3OC0A 2IU6A 2QTCA 4RNCA 1KZ1A 2P2DA 3L4EA 4YJFB 1P17A 2BC9A 1IJKA 1ZG3A 1FTGA 3LBYA 3TPCA 4HYYA 4IVNA 1X87A 1PKEA 3HVHA 5DSXA 4EFMA 1NAIA 1MDBA 2ZE5A 3MMXA 3LO8A 3GNQA 3PQ5A 4FFNA 4WHMA 4YGYA 4YVFA 4DCNA 4MRMA 4RPKA 4YRLA 4XW2A 2P5SA 2EIHA 1P1JA 2V65A 4Q9IA 2NVWA 3R6DA 2P4SA 2ORWA 5CH5A 4Z9YA 5HZGA 2WNIA 3DAYA 4LZNA 3ER6A 4G0WA 3H0KA 4N5DA 2DECA 5CXXA 1JVBA 1TU0A 2PL1A 3TCNA 2XT6A 2ORED 1JQEA 2DWPA 4I2NA 4QX6A 1J4AA 3R4VA 4LXIA 1BMQA 2EBHX 3BXPA 3FNBA 5E1DA 1E1CA 1ORVA 5EPUA 4OBXA 1AZTA 3CRW1 3SFZA 3PNPA 4JX8A 1WP9A 4FNMA 4JD5A 4U7TB 3W7AA 1RAAA 3HA2A 1D6MA 3L7LA 2WI8A 4CL3A 1S2IA 3HKDB 1EINA 5BSMA 1D1QA 2AE2A 2I78A 4OYLA 1UBNA 2MR6A 4Q9KA 3URMA 3UWKA 2DWQA 3WIUA 2E2WA 3VC1A 4ADSG 3NHFA 1EAYA 1FS6A 3OQPA 1G5FA 4NDNE 1T8TA 1FVFA 4ZVNA 3KSUA 5BSFA 2ZJAA 4KUHA 2ZTSA 3U16A 1N2HA 3LPAA 2EYQA 2OZEA 4EA6A 3DYIA 1CQJB 3F6PA 3KEQA 2FP4B 4LI3X 3N6VA 2YN0A 1NJ1A 2OO5A 4LV5B 1LK7A 1JG4A 3WNZA 4A0SA 2R96A 4JB8A 5EI5A 3G85A 2OUIA 3SZLA 1YXMA 4QDXA 4UZFA 2IXGA 4V0LA 2Z4TA 1MH1A 1ORDA 3KAKA 2RI1A 3UB2A 4X3OA 2W6JA 4EW1A 1RE1A 3H8VA 1FP4B 4ND7A 4NZZA 1JMKC 3DQZA 3MWGA 1T2DA 2C5FA 2PAFA 3UJHA 4KR2A 2XEXA 5FV7A 2BKVA 3CPJB 3ZWDA 4JUBA 1LY1A 4X7MA 1VTKA 3ANYB 3WC4A 1NBIA 4I5EA 3U2QA 2R8YA 3R9XA 2A30A 5L6MB 3SE0A 2XVXA 4I36A 4H6PA 2YHIB 4J4BA 3FWPA 3ZW7A 5B1DA 1W4LA 1X39A 2KBFA 3NU1A 3TDKA 2FA9A 4C4TA 4XRRA 3REQB 1EFVB 4GE0A 1GZ4A 4IXWA 1FQKA 1TM5E 1G0NA 2O2XA 3KAPA 3KKMA 4MR7B 5KSPA 2FPIB 4R1PA 1K7SN 2C2HA 4MUBA 4EYEA 4WKOA 1CB7A 2CFIA 1TDJA 2HRDA 3V4PB 5F23A 4BO7A 3K35A 1JNYA 4TV8A 2NT3A 5C18A 1I80A 3C8DA 4NEGA 1XROA 5KVAA 1MTOA 4C7KA 3I05A 4HQOA 2QRHA 3GEBA 4KG7A 4OSPA 2ZG6A 2CLLB 2ZUTA 1XCPA 4A82A 4TRRA 2XYPA 3IT0A 3BILA 1AUOA 1E0JA 1UJ6A 4DIBA 2PQ0A 1JP7A 5DB4A 1JI0A 3D3JA 3QEKA 4OJMX 3NHMA 1PR2A 4URHA 2OORC 4W9NA 5HJEA 3NVKI 5KJ1A 1AN0A 1E62A 1SEVA 2DHCA 3DOEA 3IJEB 5LBUA 4JJAA 1WXFA 1HTTA 4H7FA 2QM3A 1EP9A 1P1IA 2FUCA 4MQ4A 4KUEA 3S2EA 3BXGA 2O2GA 1TU4A 1IN4A 3GUUA 4M1OA 2G8NA 4P2BA 4XM2A 1LK0A 2PGOA 3GGCA 5EZSA 4GICA 1DRUA 1PEAA 2P4QA 2GBCA 2JHCA 3QEOA 4BFXA 5JXIA 3AV0B 3NMUF 3I9MA 4BX8A 3OUTA 3IAM6 4NAHA 4JL6A 4F85A 3BRQA 1GQRA 1JR4A 3AKDA 4OATA 1ZW6A 3RLIA 1G21A 5IKEA 3M4YA 3PIRA 5EGNA 4PZAA 2NIPA 3O2QB 1F3OA 1W46A 1F9AA 1BH6A 1HXHA 2HLPA 1N3LA 2PUWA 3GCWA 4JCOA 3K71B 4F8JA 1MQ9A 4I4TF 3N2ZB 3JQ9C 3T6KA 3UC5A 3LA6A 4C3ZA 1DB3A 4Q3KA 3DQQA 2V74B 1JT9A 3VAYA 1POXA 3H5IA 4JJGA 1I30A 2JFVA 5IKOA 1U6KA 5K3FA 3HWSA 5FTMA 1KMCA 3EXG2 3NTUA 1JX6A 2HSJA 2AUTA 1JLLA 3Q2IA 4KMSA 4PIVA 1GM5A 4R98A 1GUYA 1X1CA 1VIAA 2ZBUA 3U13A 3X2SA 1HWYA 5CD9A 4HB3A 3NNNA 2EF1A 1UBCA 2YRFA 3RH0A 4AMGA 2ZIAA 3IL2A 2XEDA 4KITB 2QV0A 1Y6ZA 4PZZA 2Q27A 3PC3A 3WGMA 1DOZA 5C8XA 1Z0KA 5GINE 5DXJA 5ALHA 4AF7A 4MLDA 1EK6A 3MWEB 1R6UA 1RWXA 4HQLA 5LQAA 5AK4A 2IBTA 2ATCA 3QVUA 3RYCA 2E49A 1T8SA 2E1RA 2NTYC 4DM7A 3FPKA 1W36D 1SXQA 4B80A 2ZB7A 1UR5A 1Z07A 1GADO 4YWJA 3VZCA 2PT5A 5CLIA 4G2TA 2BGGA 2O8EB 2HNKA 4ARIA 3IDOA 2RGYA 1GNRA 3P9ZA 2B7BA 1XN4A 4RHFA 5SYNA 1EA7A 1RCFA 3BB4A 1MQAA 3I72A 4G8JA 1WF6A 1WZEA 2Y6VA 3N53A 4L07A 3EFHA 4BMCA 4PIMA 5CA1A 4AN1A 3R9WA 4JAVC 4QQ8A 4XTRA 4M8SA 5ALQA 2OBMA 2CBZA 2WLTA 1U1DA 3SP1A 1PK8A 2IYPA 4XSGA 5AHRA 1AN9A 2KW5A 4A2WA 4Q24A 2HIAA 4W5HA 3ZD8A 3G7UA 3UV7A 5L3RA 1ZEJA 4QHYA 4BDTA 2PA3A 1MO6A 4MVJA 4UHHA 1CR2A 1E9VA 2I29A 2P6UA