2AKAB

Structure of the nucleotide-free myosin ii motor domain from dictyostelium discoideum fused to the gtpase domain of dynamin 1 from rattus norvegicus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
299
structure length
299
Chain Sequence
b'MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myosin II heavy chain
publication title Crystal structure of the GTPase domain of rat dynamin 1.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Contractile protein
total genus 99
structure length 299
sequence length 299
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2akaB00
1JEEA 4FIDA 2NPIA 1OB5A 4B44A 4CEJB 2X2EA 4BLRA 2VO1A 4PAMA 3KQKA 1DAGA 4OQMA 2CDNA 5SZHB 3PITA 4PFSA 3PUYA 3BJIC 4M1WA 4ZO4A 2OCBA 4ZCIA 1XEWY 2HEIA 3EWSA 3CRVA 2BV3A 1OFHA 1JBKA 1E1QD 4GFDA 4CIDA 1C9KA 4D26A 1Q22A 2QM7A 2IL1A 4MH0R 1VHLA 4BLSA 5IF9A 2EWWA 4LHYA 3GJ5A 4YMWA 3CNNA 4OQLA 1XXHE 3VAAA 5K8UA 1KOFA 4HDCA 5UKDA 1D2NA 4QGAA 4IVRA 3BWDD 2WJHA 3QPWA 3A1VA 1E2LA 5EE9A 2OEPA 2YWFA 2XOKA 2LCFA 3TK1A 1W5TA 1KK3A 4GZMA 1NL3A 3TJZA 5IT5A 1SVIA 3U5ZB 1AKEA 3QENA 2YINC 3RDPA 5E3HA 1XTKA 2VHCA 5JCPA 3AVTA 3IIMA 1GNPA 2DWOA 3Q3JB 1IY1A 3ND8A 4IEIA 3PXGA 2V1UA 3UWKA 1G17A 2E1RA 3I72A 5KSZA 2FU5C 2JIZD 4PZYA 2VBCA 3DMDA 2GF0A 5BXQC 1OH6A 4L5BA 3RS0A 4C0QC 2WWHA 721PA 2KJQA 3O8CA 1MABA 1ZD1A 3NG1A 4BFUA 4Q19A 3REFA 4ITRC 3N5CA 4D2IA 4LJ5A 1P9NA 4WZAE 3L2OB 4F7WA 1ZYUA 1RE0A 2MSEB 4PO8A 4JVNA 2PMDA 1F2TA 4NYIQ 3L0OA 3UIEA 1CU1A 3UMRA 4JLPA 3IGFA 4OI1A 2WKQA 3U6KA 3VX4A 5E4FA 4PHFA 3PV0A 1W7AA 3QKRB 3JZAA 3E2IA 5JI2E 1I4LD 1XPRA 3FKSD 2GXUA 3EIQA 1QHNA 4A2QA 5SZIA 4E22A 1QHHB 5FOSA 1K6MA 1FW6A 5F9FA 4YC7A 2QUZA 4LBVA 4X8MA 2VHQA 3ADCA 3RRZA 4Y0VA 4IFBA 4JLVA 4S35A 3U61B 3MFYA 1EESA 1TF2A 1MO6A 1CP2A 2AFHE 2LKCA 1NKSA 1TUEA 3GFTA 4HAVA 3C41J 4DIDA 1DO0A 3W34A 3SBDA 2WMNB 1UBGA 4JVMA 4Q4JA 1DAIA 1G5TA 1Z0AA 2GCOA 4L16A 5FBWB 1LF5A 4CVNA 1DTSA 5KHOC 2VP4A 1RPZA 4ZIRA 2G0NA 3I8XA 4I1VA 4EQ6A 8OHMA 1AS3A 3UATA 1UDWA 3FWYA 2OILA 1CIPA 1SVSA 3PENA 2WVJA 5DISB 4AKGA 1Z0IA 1TQ6A 2VRWA 2WWIA 1W4CA 4A0HA 1G19A 2FJUA 3CPJB 2IYYA 4B76A 1JR3D 4JBYA 4LBZA 3QG1A 1ZINA 3OAAD 4TMKA 2IXFA 4W5HA 2IBMA 4A1FA 1FP6A 2REBA 4DSOA 1E9RA 2Q9CA 2PCLA 4TTPA 1BYUA 3E1SA 4TMTA 1HT2E 5BN5A 1OFUX 1E0AA 2ZITA 1KI6B 1SVKA 1ZM9A 2WWFA 2XJ4A 4GZLA 4BLPA 2W2TA 3B1WA 3LBIA 3THYB 2TMKA 1ZNZA 1ZJ6A 4WVFA 3AVUA 1XEFA 4URXR 1GG2A 4MYCA 4JSYA 1OXVA 1WCV1 3FMOB 4GBMA 4DUGD 4TZ0A 3KKNA 1HT1E 5DLQC 1N0UA 3KJGA 1CS4C 4JMPA 4WZBE 3L8YA 5TXGA 4D6PA 2L0XA 5B58C 5E7MA 4JLOA 1F48A 1COWA 4RZ3A 1BS1A 2NIPA 4HUQB 1R8QA 2UZIR 5KUTA 3K1JA 3TRFA 3CPHA 1A82A 2OBMA 2JLQA 4ARZA 1U2RA 5BYKA 3BIFA 3DO6A 1GDDA 5AJZA 2AFIE 1QVRA 5EE0A 1S9DA 4EQ6B 5DGXA 1TX4B 2REOA 2WHXA 1KSFX 1ZM2A 1TL7C 4B6EA 2C04A 3L82B 2WWYA 5GJBA 4QJ4A 2WIBA 3UMFA 3QXSA 1Q20A 1Z6TA 3ASYA 3RC3A 2DR3A 4URWR 3SI7A 3VTKA 5JI3E 2JLYA 1IHUA 1EWQA 3MWKA 4BEJA 3IHLA 2JAQA 1Q57A 4MGIR 2QGZA 4UXHA 3N70A 3WBJA 4Z8XA 1KJYA 3G82C 5FL3A 1R0WA 1BIFA 1Z0KA 4DLZA 1W0JA 1HTWA 2CL7X 1YRBA 3X1ZA 2G0TA 5AJVB 3I61A 1EWRA 4NH0A 4Q4LA 4ZCLA 2CCGA 4MRNA 5B57C 4XSGA 2Q21A 2ZANA 4LYJA 4OI2A 5LB4A 2FMXA 2QSZA 4Q00A 2IUUA 4C2UA 4NONA 2QP4A 2VA8A 3AB3A 4JZKA 1S2MA 4EJSA 1V43A 4EPTA 3C15C 4BGDA 1N5KA 1N0WA 3NBXX 2A5YB 1QHSA 2PZGA 4JVLA 3L8ZA 3WP0A 4LJ8A 4ARZB 1OXXK 1G7TA 5FL7A 1KYIA 4LPKA 3U7HB 1J90A 4TLBA 1Z47A 1FQJA 1KDPA 4TT3D 2HXSA 2GEUA 2WZQA 3U3JA 4A4DA 4MRVA 4DVGA 3M1IA 1ONBA 3BERA 1KDRA 2R8RA 4B35A 1G8GA 2WJIA 4RVCA 4OHVA 2FFHA 3E5HA 2X19A 4ESVA 1VTKA 2JLSA 3R9IA 2OESA 2E9SA 1E4YA 1VCMA 3SHFA 2XXAB 3O8DA 2PJZA 1U0HC 4A9AA 4GP6A 4L8GA 1ZAKA 4PSKA 2V8OA 1PVOA 1FMJA 4DZZA 1QG4A 3P20A 4Q7LA 3CR8A 3C5HA 2A2ZA 1Z2CA 2ZSFA 2KBFA 2XNDD 3AP2A 2ODWA 1XD8A 3K0FA 2C95A 1EFTA 1HURA 1DELA 1GITA 2WJJA 4M0LA 5BN4A 4EJSB 3OZXA 3M4YA 3NIBA 2XITA 3LW8A 4I1OA 5JSZA 5DO9A 2XB2A 4IXNA 1ZUNB 1XRJA 1DG1G 1K5DA 3S1AA 4DSTA 1OLOA 1E0SA 1G5RA 1GFIA 3WYGA 4BFZA 2OCPA 5C2JB 2WAYA 3G5UA 3PJRA 3DEFA 1N6HA 5EE3A 2RB4A 2PJRA 1DOAA 3SE0A 4NCHA 1E98A 1AGPA 2WKRA 2WPDA 4V02A 2PMKA 2QP3A 4LRWA 2WJYA 2BDTA 2HF8A 4V0MA 2GAAA 1CKEA 4TWZA 1RRCA 3BFKA 4CEIA 3ADDA 4QM6A 3MG9A 1G6HA 4RFSA 2GETA 3CH4B 2ERYA 4NYIR 4XWOA 2IYRA 3OIVA 3NKVA 1Z6XA 1GKIA 2QENA 4ASUD 3QJYA 2OSBA 2VP6A 5CITA 2RGCA 4X8HA 4U00A 3EG5A 5JJLA 1Q3HA 2GNOA 2IT1A 2QPOA 4DJTA 2J3EA 4DB2A 2NOAA 3GEIA 1W47A 4NMMA 1XNJA 2R9VA 4BZXA 4RD2A 1RIFA 2G1KA 2ZQ5A 1SVMA 3TE6A 3BRWD 3QEJA 3CH5A 1EFRD 2BEJA 4FXPA 4OJKA 1QHXA 2G9NA 1A4RA 1XPOA 3KJHA 2R65A 4EPVA 4DCUA 1GNQA 2QT1A 1CJUC 1RW4A 1P61B 1OIVA 3GD7A 3RANA 4IOJA 3ZZ0A 1OIXA 1T0HB 1AN0A 5E95A 2Z4RA 4RD1A 4URYR 5C4GB 3R7WA 3N2IA 1S3GA 2J5XA 2FA9A 1IM2A 3BBPA 4H1UA 4XIGS 4DLXA 2F1IA 4OHZA 2FFAA 1FP7A 1P4SA 2B92A 2P5TB 1E9EA 3NDBB 2IYSA 3AF2A 2ZJAA 2V6JA 4TQAA 1P73A 4D25A 5FUWA 3CIOA 3LXXA 1OHHD 1E2JA 3TW8B 2W6ID 5JRJA 2K5UA 3P4YA 2W0SA 3DPUA 4KI0A 1MV5A 4MGKR 3PVSA 4G5RA 3D31A 4O2RA 1ZIPA 1KSJA 3DM9B 3SQWA 2BOVA 2FX3A 2J59A 3CM0A 1RRGA 3CPEA 3P4XA 1PUJA 1BMFD 4KBFA 4LC0A 1M6NA 4P4TA 4NCKA 4RD0A 3FHCB 4XWAA 5FR2A 4Q03A 3NBZC 4QGGA 4TMWA 1KIMA 1RVDA 3IDQA 5KPDA 4LJYA 4DCTA 3IBGA 3SN6A 3THXA 4BLQA 2IX3A 2J9RA 3C4JA 3SFVA 4BFWA 3HR7A 1NP6A 1G41A 3E70C 4RJLA 1P60A 2XSZA 3A58B 4QGHA 1J8MF 1X86B 5EXXA 2GJ8A 5CIQA 3ZQJA 1G1MA 4LHXA 1W48A 4LX0A 4MYUA 1NLZA 2JLZA 1SVLA 4AI6A 1DAHA 2XZPA 5FBRB 4M1OA 1EGAA 3OEEA 3Q72A 3QXXA 5EZ6B 1U98A 3QXCA 3KB2A 1KDTA 2IYWA 3LX8A 5EXSA 3QXJA 3SDZA 4C0KA 4H1VA 4MDEA 3FMIA 1QRAA 4OI0A 4YMUA 3HPRA 2OCYC 5IK2D 4B3XA 4EKDA 2ZSDA 4QOSA 3IIKA 2Q3HA 1R10A 3Q5DA 3U3MA 4US1R 1R4AA 2WWGA 2WWWA 3K09A 4R7ZA 1KJWA 1RZ3A 2CXXA 4C4PA 1P9RA 1X3SA 2EYQA 1YQTA 1NN3A 2ZE6A 3P1JA 1II0A 4OJQA 1UBCA 2F3RA 5A4JA 5H68A 5L3RA 4PC2A 4JL5A 3FE2A 3LLMA 4IEEA 4CF7A 2OFXA 4NCJA 821PA 1DAMA 5FH9A 4C7OA 1AIPA 1H8ED 2AKYA 1W49A 4OQFA 2CHQA 1ETUA 2N42A 3VKHA 4DIEA 2P6NA 2RHDA 3NVAA 3SJCA 3C5CA 1KHTA 3PR1A 1U94A 2D4HA 1ELOA 2A5GA 4U7DA 2GK7A 4DDTA 1Z3IX 2IWHA 1LV7A 1YJ5A 2CCKA 1E2QA 1QF9A 5JHHB 2EYUA 4XVRA 5DI3B 3LV8A 5HR5A 2XTMA 3LD9A 4M53A 4A15A 4G3XA 5K8IA 3TR5A 5CB8A 3DKVA 4U5XA 3LVQE 5AUQA 1WBBA 1EX7A 4JVSB 3KTAB 2AKAB 2OXRA 2ZETA 1Z8FA 4M1YA 4C30A 4RZXA 1T91A 4HLUA 1CF4A 2ATXA 1Z28A 4BPBA 1CR1A 2G83A 4GDFA 2RGNA 4V03A 1XMVA 1OH5A 2OV2A 1IN7A 2CCJA 3ZIAD 4ZV4A 2ZUBA 4D0NA 3NEJA 2QMOA 4B2PA 4XTRA 3AVVA 4MYHA 1Q12A 1WQ1R 1VECA 2JASA 1G21E 2QL6A 1E9BA 2G3YA 4GPTA 1XCPA 4E5UA 3T35A 5KYKA 4Q7KA 1Z0JA 3T1OA 1HH4A 3HU2A 2GBLC 2ORIA 4CZ2A 1KY3A 3LFUA 3WNDA 4QM7A 1YVDA 4BFVA 2ZUCA 2VL7A 2PT7A 1L4UA 3AQ4A 1H8HA 3DVLA 4MKIA 4LSGA 5CK4A 3ZVLA 2MSCB 2BCJQ 2FWRA 3VNUA 1QHYA 3GJXC 2O8CA 2ORVA 3PUWA 3TSZA 3KX2A 3LX5A 3GLFA 1E9FA 4HAUA 5L3QA 3DOEA 4BRUA 5FPTA 3SR0A 1UM8A 2CK3D 4W7SA 4R71A 4KVAA 3MJHA 3OHMA 2HUPA 2QY9A 1XWIA 3CX7A 5DYIA 4DEYA 3EPKA 4BECA 4MDFA 4PC3A 1VG1A 4UXJA 4TMVA 1AK2A 1KMQA 1S3SA 5GVRA 4Z54A 3IILA 2ASEA 3X1WA 1CJMA 4E03A 1P75A 1ESMA 3ND9A 3GLIA 1CJTC 2XZOA 2JCSA 4JJKA 2J46A 1II8A 2QAGB 3RWMB 3U60B 2CLCX 3NBYC 1XP8A 3A1SA 2OFWA 4NE2A 2AD5A 2V4ZA 3A4NA 2AXNA 4Q1EA 2JJ1D 5IRCD 4MKFA 3B8HA 2ZRAA 1J8YF 1G6OA 2VH5R 3FFAA 4LPSA 4Q01A 2RHMA 1W0KD 2VIIA 4URVR 2W83A 5KSOA 2J41A 4JLBA 1P3JA 5CB6A 2EFGA 4B71A 1RJ9B 4OHYA 3UANA 1R8SA 3MRSA 4EPWA 1S96A 5P21A 1EXMA 4RD4A 5CLQA 1U8YA 2XZLA 5JBQA 4ZDWA 4PC1A 1LW7A 1G3UA 4DLUA 5FOUA 2N1BA 1OPXA 1IOZA 2ZRMA 3FVQA 1C4OA 5FBLB 3TW4A 3VR6A 2J0QA 1ZM7A 1JR6A 1GL9B 3QF4B 4IFEA 5J47A 3GLFB 2NO0A 5L3QB 1VCOA 3L0PA 2A5JA 1SXJA 2CE2X 3KJIA 3BFXA 1VIYA 1KTVA 5TV2A 4A8JA 1OT3A 2LKDA 2ZRLA 4TLDA 5DH9A 3AF3A 2ZROA 4ZDJA 1K8RA 1J7KA 1LFDB 3CO5A 2IYXA 4D0LB 4OBEA 1UKZA 4FMCB 3ZS8A 1LVGA 3QVVA 1OKKD 4D80A 4BUJA 2ZJ5A 2JLRA 5KTYA 2IYZA 5TB5A 1RFLA 2F43A 1EK0A 4G5QA 1RYHA 3WHLA 4B47A 3K53A 3EPHA 2NGRA 1NG1A 1FX0B 4KVGA 4QKQA 1AGRA 2PH1A 2W6JD 2QZ4A 1E6CA 3B1XA 4JT4A 2QE7D 4QHSA 4BLOA 2O8DB 3UG7A 1TEVA 4KV9A 4F93B 1GNRA 5FBVB 3LY5A 3AF1A 3ZGXA 3ETLA 1ZMXA 4C0HA 2YWEA 1RKBA 3HDTA 2QU8A 5JS7A 2CL6X 2PLRA 4DSUA 5HCNA 3AEZA 2MMCA 2Q6TA 2HJVA 1KO1A 1A1VA 3ZYCA 2BVNA 2RGXA 2C9YA 4ZI3A 1US8A 1YZTA 5JRZA 2ZAOA 3EA0A 4KITB 2O0HA 5CDFE 1SXJB 4EUNA 2OFOA 4LI0A 5HZKA 1IXSB 4C2TA 3JZMA 2P65A 5FPKA 4NTZA 3IIJA 4Q9KA 1FZQA 3QPVA 5DN6D 5DYGA 2VSOA 4GMXA 1KMHB 5AUOB 3K0CC 4ERNA 5TMPA 4Q9IA 1FOEB 4Q66C 2GJSA 1GRQA 3MWLA 2RMKA 2F3TA 2JLWA 2BJVA 1W2GA 1T5LA 3GJ4A 2JLUA 2Q9BA 2CNWD 1U8AA 3W8NA 4YMVA 3V4RA 4HDQB 4EFNA 2FPMA 2WTUA 3EARA 1CBUA 4P4SA 4EFLA 4HZIA 1VYUA 3FOZA 2RCNA 4A2WA 3ASZA 2QNRA 2F9MA 3EZFA 3QKSA 3TNFA 2QAGC 1S9HA 3BC1A 4LYHA 4TL8A 4V0OA 2YOHA 4AYWA 1DBSA 4EPXA 1FPMA 2QAJA 2ZRCA 4Z8YA 2Q3FA 5G41A 4E07A 4QRHA 1IN5A 2ZRBA 4ACBA 4DLYA 3TQFA 4GNKA 2OO7A 1XEXA 5EP4A 4BRWA 2CLDX 1I4DD 4FI3C 3P26A 1PZNA 2IYQA 2VSFA 4LV5B 1R2QA 1Z08A 3A37A 4US2R 2QORA 2XB4A 4V0LA 4F4CA 2D3WA 1KK1A 4Q4AA 5J4LA 4YXWD 2PZFA 1US8B 3W6PA 2FZLA 1D2MA 2KE5A 3B5JA 2ECKA 2OLKA 3VR5A 1G7CA 1KO8A 2J0UA 3AF4A 2ZJYA 1XD2A 2C03A 3F8TA 3TH5A 2AHOA 2B7CA 2CJWA 3ONWA 1DVRA 1MO3A 2H57A 4WXPA 1E1RD 4EAQA 2JLVA 2OLJA 3EC2A 3KL4A 4KODA 3KXKA 3PQCA 4QC2A 5L3VA 5HTKA 1E2NA 1OFIA 2O52A 3B9PA 3HU3A 1KI9A 4XD7D 4CT4B 5HKKD 1FNMA 3EAQA 4YMSA 2QQ0A 3AVWA 3IBYA 4RKEA 2WWXA 4RD3A 2DFLA 3Q5EA 4TL7A 3RC8A 1MABB 4A0GA 1YZQA 2ZAMA 2ZSBA 5BQ5A 1E9CA 2J7PD 3AGQA 3K9HA 1KK2A 2JDID 5B2ZA 3EZ2A 3OE7A 2VHJA 1OW3B 1R0ZA 2QM8A 2ZI3A 4Q7MB 1G8PA 1F2TB 4BWYA 5CM8B 4JLNA 4TTQA 4DCNA 2OHFA 2Z43A 1NVVR 2H92A 3HWSA 2RH5A 1XEXB 2QP9X 3AGPA 1JEDA 3THOA 5FUVA 3RS5A 4A0RA 1XBTA 2FPKA 2GJ9A 4D4MA 3SC3A 4PQRA 3SEAA 5A0FA 4GOJA 2GXAA 4QJ5A 1P9WA 4Q4AB 2UKDA 3CKLA 3T1VA 2WSMA 4TSFA 3VR3A 1PLLA 1G16A 5BWMA 1L2TA 1KSGA 1WBDA 4YQFA 1SVOA 2NZ8A 3QVUA 3ZVMA 2HLDD 3GJ6A 3CRQA 3NEYA 3BS4A 4KO8A 1A5TA 4A2PA 2CJWB 1XMJA 1TF7A 3VMFA 1OE0A 4RZUA 1NY6A 2IXEA 2PCJA 5ANRB 1YHNA 4NYJR 4ZPXA 1TQ2A 4Q4JB 2WSSA 4HUTA 2GCOB 3HR8A 5IDVA 1HE8B 2H17A 3GJ0A 4M1MA 1G3MA 4QBFA 1N6OA 3TAHA 3EX7C 1R6BX 4ZIRB 3AVXA 1FL9A 1W46A 2WOJA 3R8CA 4HZUA 2ORWA 2P6RA 5JEEA 2FPLA 4Q9HA 5C4MA 2QQEA 5EP2A 3W3ZB 2IYVA 1NBMA 1NMZA 1QZXA 1S0UA 2F1JA 5AK0A 3RABA 3CBQA 2IS1A 3L43A 3C16C 1EX6A 2GRJA 2HYDA 1U90A 2ZVQX 2XOKD 3ZQ6A 2CVFA 5BYJA 1W2HA 5KU1A 2BM1A 1E32A 4MRSA 1E0KA 5B64A 1M74A 5L8VA 2W2VA 3FHOA 2CVHA 1P72A 1IN8A 3QNUA 1KO7A 4A82A 4DSNA 2EQBA 1H65A 1VHTA 2JA1A 4GMDA 4IOKA 1DE0A 2YOFA 1F6BA 1KZGB 3ZLJA 1SVWA 1SKQA 2VPPA 4MYTA 3BE4A 5JJIA 1P5ZB 2BKUA 3T15A 1NKTA 4QFMA 2A5DA 1S4QA 4CDGA 2WV9A 2PEYA 5JLJA 4XH9B 3CZPA 4HAWA 1WB9A 1CTQA 1TADA 4HAXA 2GAOA 4D82A 3RS4A 2ZYVX 2ZI5A 3EPJA 4HZUB 1XMSA 2BJWA 2QI9C 2FG5A 3EW9A 5KNDA 2HF9A 3QOFA 5D3MA 3AKEA 4LDJA 3RS7A 2QEQA 3PIRA 2XAUA 2QTHA 3SBEA 5HZHA 3CF0A 3T1QA 5FTLA 3GEEA 4HATA 3B9QA 3K9GA 5AUNB 1NI3A 4OL0A 2PEZA 4WOPA 1OV4A 4MKGA 2DBYA 5GJCA 1VYTA 1ODFA 3GLFE 1NN1A 4HDOB 3CZQA 2XTZA 2ZJBA 4Q4HA 3GLGA 1NSFA 2EVWX 2QPTA 5FPYA 2QG6A 4N3NA 1W44A 1U9IA 4TLEA 4Z1MA 2ZYWX 2YWHA 4KAXA 3ZD7A 1M2OB 1YR9A 1ZM3A 4BASA 1GM5A 1UJ2A 3BH0A 2X8AA 4LZZA 3VQTA 2HXYA 1E79A 4NPHA 3GLIE 1UKYA 4HYYA 4DDWA 3AVPA 1Z6AA 2H8KA 2RGGA 1P2VA 3NTUA 3WBKA 2DB3A 2ZPTX 3B82A 2FF7A 2FZ4A 4B34A 1VG0B 1ZD8A 4B6FA 2ODNA 3A8TA 1LTQA 2FFBA 3THWA 1E2IA 5LBIA 1A2BA 1VMAA 1OXTA 1FTSA 1ZU5A 3I73A 4LJAA 1CEEA 4DLTA 2DFNA 2QRNA 3Q7QA 2IYLD 2J7KA 3WY9A 5H8WA 1QBKC 5BW8A 3FMFA 4JT2A 1T9HA 4PSVA 2HDNB 4ON9A 2R6FA 1XPUA 1B23P 4GT1A 3B1VA 4NL4H 5D3MB 1N5JA 3TUZC 4TYYA 3AUYA 1M1YE 5JFGA 3NC0C 5EP1A 4HAZA 4IJMA 3T34A 5GJVC 4ABYA 3A36A 3M0EA 2VF8A 3GQBA 3OF5A 4IDOA 4UXIA 5GJWC 2IS6A 1B0UA 5F3WB 3K0EA 2O8BA 1Y3AA 4C0LA 1W1WA 5K8LA 1XXHA 3BD9A 3U44A 5G40A 1E9SA 2EFHB 2IWRA 2B7BA 2DWPA 2FEOA 2QT0A 5J5CA 1COWD 1SXJE 3BH7A 1PV4A 1G20E 4IXMA 3K0FB 4TMZA 4BEBA 3ICEA 3NHBA 2FSIA 4FD2A 3ZD6A 4YLGA 4PZZA 3U3RA 2O8EA 4O3MA 2YHSA 2O8FA 1FUKA 2QTFA 5JSZB 4QHTA 2JJ2A 3ZVNA 4AG5A 2C98A 2QBYA 4URUR 3T5DA 2GEDA 5F98A 2VP2A 3KUCA 1X8LA 4OHWA 2CBZA 4QNMA 4IKEA 4YDSA 5AJWA 3S1AB 1I4TD 5TARA 3PEVA 1QVAA 2P2LA 1E2KA 4P0TA 4XOIA 1AZSC 1C1YA 3ECCA 3H84A 4JJZA 4MITA 4UNQA 4DLSA 2VP9A 3IQXA 4B3CA 2EFDB 3V4FA 4LBWA 4TL9A 3B13B 5JJKA 3AUXA 1E9AA 4JS0A 3H0KA 4DCVA 1TUIA 3AKDA 4UJ3A 4PAOA 4B75A 4CEIB 1G8YA 3U3OA 4M1SA 1W0JD 4RFSB 4UKDA 3W6OA 4PC7A 2VF7A 1LF0A 1AS0A 3MJRA 1GSIA 3KXIA 4M1KA 1IN4A 3Q7PA 4M9ZA 4RZ2A 1VDZA 1JECA 1Z6GA 3U44B 1E2HA 1KO4A 1FUUA 3OEHA 2OBNA 1D8TA 1JALA 4GL2A 1ZRHA 2WICA 1PLKA 3GPLA 3KQUA 4ZKEA 1GWNA 2YYZA 2A5FA 4B33A 3KB1A 1NIPA 5FOXA 4HB0A 1UF9A 2W0MA 3AKCA 1MKYA 4GOXA 4UJ5A 1BO6A 2V9PA 2FH5B 3PUXA 5FL7D 1V5WA 2Z6VA 1XTQA 3N2EA 2IYUA 2Q9AA 5EE1A 3QBVA 2A78A 1G9XA 4M2LA 4WBSA 4WW0A 4TYWA 4EJSC 3GLHA 3SZRA 3P27A 4GSYA 3U6BA 1E99A 3R7WB 5A5GA 5AUPB 2C8VA 4N0DA 3EC1A 3LXRA 1YZKA 2VLIA 2ZRDA 2B8TA 2I1QA 4JKIA 1R5OA 2C77A 1QG2A 2ZYUX 5H70A 1UKEA 4P4UA 1JXOA 5E7IA 1N6KA 2V3CC 3LBHA 3TMKA 2ZU6A 2R6DA 5FI1B 1IN6A 4LV6A 4UNNA 5F2EA 2RGEA 2QMEA 4I81A 4PZLA 2R62A 4QNRA 1GL7A 3OFNA 2P0EA 2PL3A 1GVNB 1DAEA 1Z06A 1MT0A 1WRBA 2IC5A 2GA8A 1RYFA 4BLTA 2PT5A 4OK6A 4FMBB 3EZ7A 2ZE8A 1XFAA 4W9MC 3V9PA 1XZQA 4L4UA 4IDHA 4HB4A 5FOWA 3THXB 2RGBA 4CEHA 4BFXA 2QRZA 3CX8A 3VU9A 2V7QA 4HI0E 3KKQA 3BH6A 1GILA 3B6EA 3OESA 3W6NA 2WPDD 2WM9B 2Q3MA 2ZTSA 4HLCA 3UG6A 4PPQA 3DDCA 4Q1DA 2IHYA 1W36B 2ZIAA 4PHTA 1HEIA 1WMSA 1XJQA 4PPFA 2OAQ1 3SOPA 4Q5IA 1YE8A 4ZCMA 4RY2A 4NZYA 1N6PA 4KFUA 3WMEA 5KPJA 1NY5A 1P2SA 3CNLA 4RCYA 2O0JA 1O3YA 1ZIOA 2J87A 4AYXA 1JJVA 1D6JA 4FMDB 2BCGY 4DRZA 3B1YA 3EIEA 2G77B 4BZQA 3NBFA 2R6GA 4C9BA 3AVYA 1A2KC 3TUJC 1JQLB 2BMFA 4LBYA 4TLAA 3IEUA 5FTMA 3C8UA 3GMTA 3O8RA 3SYNA 3Q8XB 1MRNA 5CM9C 3FFBA 1F5NA 4RCZA 4W5WA 2ANCA 1VCIA 3HPQA 1GTVA 3LA6A 2E87A 1SULA 1T5IA 1E1QA 2AWNA 4N1AA 4D4JA 2VYFA 2ZRGA 4QL3A 4WXRA 3A4MA 3CONA 2NMVA 1G3IA 1E0JA 3BXZA 1NVVQ 3LQRA 1WP9A 4JKYA 2BBOA 4GRAA 2PZEA 1IONA 4MRPA 2C5LA 2ZRJA 4Q47A 3F0TA 4C7OB 4B73A 1X1SA 3NH9A 1XMIA 3CR7A 4I99A 521PA 1LY1A 1D9ZA 4R2HA 1OH8A 2R6CA 3REGA 5L3SA 5FPSA 1XEWX 1I2DA 1HUQA 4Q1FA 2ZJ2A 1OYWA 1ZP6A 2KSQA 4DDUA 3BK7A 1KAGA 2Z5FA 2ZRPA 2P67A 1HV8A 2ATVA 3A1TA 5E7JA 3R9XA 1RRPA 3SJZA 2ODEA 3VKGA 2IHBA 1JPJA 3VR1A 5JMTA 1G7RA 3T06B 1NMXA 3IUYA 5J4KA 4M9SA 4RD6A 2JIZA 1NBME 4JLKA 3RSLA 2Z0MA 1A7JA 3O47A 4NYJQ 4YMTA 4P31A 1Q0UA 1NN0A 2IF2A 2CHVA 2ZUDA 1Z63A 1PJRA 1GKYA 1KI7A 1W4AA 2JJ8A 1OH7A 1CRPA 1JPNA 3TAUA 4EIWA 5EUQB 5J4VA 1KNQA 3CUEF 4QJ3A 2VP5A 2GXQA 4KXFB 4G5OA 4QBHA 5SZJA 1UFQA 5KDDA 1OJLA 2EW1A 5FFMA 2IEZA 5K8TA 4TN1A 3V00A 3TBKA 1KKMA 3NH6A 3KZ1E 2GKSA 3ZZTA 4BFYA 1MR3F 5M04A 3GP8A 3FKSA 4B43A 2J0SA 3L0IB 4DDVA 3ADBA 1W36D 2XSZD 4KFTA 3WRXC 2NO1A 5KO2A 4F91B 1UEIA 4NCNA 1TQDA 1GOTA 2YJTD 4LY6A 1CLUA 3KXLA 4C3ZA 1TQ4A 1L8QA 4CGZA 2OUKA 3OEED 3K9LA 3B78A 5D3QA 5FR1A 1GUAA 2F1HA 5EXTA 2I3BA 4Q7JB 3CF6R 1IXZA 2VTKA 1N6RA 3U4QA 4CEJA 5LDDC 1YKSA 2DYKA 4G5GA 2ZRNA 1W36C 1T0JB 1VG9B 1VKJA 1TEXA 4D0GA 3F3YA 2MSDB 2OBLA 1OYYA 1VCNA 4HB2A 4PX9A 5FTNA 2CL0X 2OXCA 4QBGB 3RWOA 4TZ6A 3IEVA 2VHTA 1NF3A 1G5PA 2ZS9A 3SQXA 4IW3B 4CYMA 1LS1A 1LNZA 2H5EA 3G0HA 1Z22A 2N46A 1OXUA 2W2XA 5DI9A 1S1MA 1KAOA 2NO9A 3H2YA 1P2TA 2GILA 2OCAA 4PSAA 1IBRA 1E3MA 5CJ2A 2BM0A 4KYUA 1KDOA 4KU4A 4KSCA 3HJNA 1ZC4A 1XCGB 1JR3A 3RVBA 5C18A 2YOGA 3GLIB 1CJVC 3PEUA 2GZDA 3OAAA 1IXRC 3MWYW 2FE4A 2QPAA 1II8B 5KNCA 2FFQA 4LHWA 1CJKC 1U8ZA 2C99A 1ZBDA 2WBLC 3BB1A 1QDEA 1HE1C 2ZR7A 3B2EA 3K09C 4LJ7A 2IS2A 3OIWA 3R9WA 4OK5A 4CT5A 2I4IA 3SU8A 4I4LA 3I92A 1Z0FA 4YDHB 2BHRA 2ZE5A 5FOTA 3TIFA 4N0EA 1M7GA 3LNCA 1NMYA 4MA4A 4DUGA 4NHOA 1ESNA 3OIYA 3WYFA 4MKHA 2ZJZA 4O0MA 3ZDQA 1YR8A 3QQ5A 4DBLC 2C96A 3U4QB 1AQUA 1DAKA 2F6RA 3CRRA 4OYHA 4EPRA 5EJEA 1SKYE 3AF0A 2FGJA 3QY0A 1G8HA 2GF9A 4QHYA 3IPXA 4F4JA 4B3DA 1GIAA 3W3AA 5GADl 3QBTA 4V0ME 1T6NA 2BKEA 4R9UC 3LO5A 2GEVA 4XTCS 1FTNA 3NC1C 1G18A 2ZE7A 3F5FA 4KBGA 4IDNA 2ZJOA 3IQWA 4LC1A 2YV5A 2NZJA 1MRSA 1E2MA 4DT1A 4A8JB 3QKRA 5AWFC 4DWJA 4GI7A 3TVDA 2Z4SA 1ZNXA 3W9YA 3I62A 1T3LA 4RKFA 1CXZA 1QHHA 4HLUC 4PPGA 4V0KA 3J81k 4V0NA 421PA 1YZLA 2GDJA 3SYKA 4S2EA 1NVXQ 5DE3A 1G4UR 2F43B 2RGNC 1NVUQ 3LBNA 2C78A 1XX6A 4URZR 2XX3A 2GZAA 1VG8A 2AWOA 2ZI7A 3LLUA 1VIAA 4KLZA 2IW3A 1W4RA 1E69A 2QSYA 1H8HD 2XJ9A 1GRNA 1KJZA 1P2UA 1II9A 3K70B 3MWJA 3TSWA 4PR0A 4Q1BA 1TF5A 1EFCA 2SHKA 3FMPB 1T8TA 3TGPA 3SJAA 4K81B 2ZS7A 3KJEA 4MUAA 4BFSA 3KDSE 3I4LA 3H86A 1WDTA 1DO2A 1N0VC 3C7KA 1OXSC 4HLQB 4PHHA 2WJVA 2QN6A 4JL8A 3FGNA 4B32A 1G3RA 5TY0A 3QUSA 4DT1B 3CF2A 3WRYC 1MO5A 4I1SA 1Z2AA 3WNCA 3CNOA 1U0LA 5DHFA 4TT3A 4B3FX 1UEJA 3EA5A 3DZ8A 1M8PA 3QPUA 2GVDC 4XVUA 1KI6A 1Z6YA 4W5JA 3X1DA 3THYA 1BKDR 2ZREA 1G291 2F9LA 4PC6A 3QIAA 4O2LA 1N5IA 1JXMA 3FKQA 3TQCA 4P4SB 4BQSA 2OG2A 3R8FA 3QKSB 1F60A 4MGYR 1NG9A 3RRYA 4LK2A 1LS6A 2EFEB 1WF3A 3P32A 3AKYA 2RGDA 1JNYA 1VYVA 1N6NA 1NLYA 4HUQA 3CWZA 3LAWA 2XNDA 1MOZA 3GLHE 1XJCA 4DHEA 3IO5A 2IK8A 1SXJD 3DL0A 4M4SA 3IO3A 4E09A 4KCGA 4F38A 1JAHA 3BB4A 2FSHA 2FN4A 5CYPA 2D7CA 5DNYB 5DHAA 3GEHA 4DLVA 2KWIA 4C0JA 4PO1A 4PQYA 2J0UB 3RS2A 2P5SA 2ZYTX 4IRUB 1XD2B 4FCVA 4LHZA 3VFDA 3W8RA 2ZXUA 2DY1A 3D3QA 2Y8EA 1R7RA 1CR2A 1UKVY 4JSTA 4CW7A 2RAPA 2GXSA 5EQTA 5FPHA 3SNHA 4PTLA 3WP1B 3SJBA 1SXJC 1YZGA 1DARA 4IDPA 1R5BA 2ZU0C 4TQ9A 4BFTA 3B60A 4LUCA 2DCUA 4LWZA 4A8JC 2AK2A 2ZRHA 3BORA 4OQNA 4LV8B 4Q1CA 3NXSA 2WOOA 5FOVA 3B1ZA 3K70D 1UDXA 2AX4A 1XD9A 2DFKB 1T4GA 3R20A 1X6VA 2CEAA 2ZRIA 2J45A 5KNBA 4ASUA 1AQYA 2IYTA 4GOKA 1KKLA 3I5XA 4KFSA 4J0QA 4Y0AA 4EDHA 2XNSA 3AM1A 3LRPA 3U3KA 3EZ6A 4ESHA 1E94E 1ZCAA 2ZI6A 4ZDKA 3K70C 4XSHA 1ZNYA 3FYHA 3QF7A 4B3GA 2DHRA 1EFRA 1NJFA 4JYCA 4DKXA 4LCBA 5JCZA 221PA 1OIWA 2GJKA 3PCRB 5EUMA 1Q1QA 1TAGA 4B48A 3KFXA 3BFVA 1SHKA 3CRMA 3JVUA 4TYNA 4Q02A 4B74A 1FQKA 5G3YA 1ZVQA 3BOSA 3VX3A 2QROA 4OI4A 2R6AA 2IF0A 1NJGA 3T61A 4JBXA 2XXAA 1NRJB 3K9NA 1ZM4A 4RFVA 2VQSA 3BB3A 2VSXA 3ZH9B 2CHGA 2NQ2C 1DS6A 4NBSA 4PQFA 4IDQA 4MGZR 4JLAA 3SFZA 3WMGA 4TYQA 1KI4A 4II7A 1YU9A 1OHHA 5KSPA 2WKPA 2W6IA 3WXMA 3VKWA 1KO5A 2ZRKA 4AD8A 1E4VA 4DB4A 4JLJA 1WXQA 1Q21A 3PFIA 3RNLA 1XZPA 1XB2A 3FHTA 1JQJC 1F2UA 2BBTA 4US0R 2OZEA 2ZVPX 3GJ7A 2GHIA 3CLVA 2JLXA 5EXPA 1G8FA 2PLFA 4PANA 1BMFA 3EASA 5KDLA 4G01B 4O25A 1U99A 4QGFA 2F55A 121PA 4UQOA 5BN3A 2D06A 1X1RA 4AC9A 1XDBA 4TMXA 5EZ5A 2I1VB 1GL6A 5CLLA 1CULC 3BAFA 4G0NA 5SZKB 2EU8A 4DLRA 4NYMQ 3UXMA 4C0AC 4B3BA 4HB3A 2AK3A 2ODBA 2JGNA 2O0KA 3A6PC 3RYTC 1DPFA 1EG7A 1P6XA 2ZS8A 1R0XA 4JYBA 3UKDA 1I2MA 3LVRE 4IVQA 1GP2A 4KLNA 4H9GA 1Q1ZA 2DWQA 4NDZA 3OE7D 2A3RA 4X8LA 2WJGA 4B2IA 2Q0HA 2O8CB 5FTJA 1Q1BA 5CK5A 3CB4A 2AR7A 3DKPA 3H4MA 4AKIA 1EFHA 1QHIA 5IK2A 4B2LA 6Q21A 3QE0A 1IQPA 4ILEA 3DOFA 5HE9A 2QMHA 2ZR9A 3TKLA 4NU0A 1AA9A 5AJXA 5JEDA 1GRRA 4MRRA 2W58A 1F2UB 3B85A 3X1XA 3LH5A 1D9XA 4NCIA 1N6LA 4YONB 2HCBA 4AWXA 3KKPA 4QG7A 4A6XA 1XTJA 3FDIA 2A9KA 2VHUA 4IOLA 4TSFD 4OQXA 3B7GA 2HCJB 1YRAA 1DEKA 1H8EA 3W5IA 2CMKA 2D74A 2EWVA 4QBIA 5B30A 4L9SA 3RRNA 3NDPA 1FFHA 1WE2A 4XJXA 3K8YA 3VR4A 4LJ9A 4PAQA 2AN9A 2QA5A 4D4KA 3I1FA 1BOFA 3H1TA 2PBRA 2ZI9A 1W4BA 1IJFA 4G5SA 4ACAA 2FV8A 3PUVA 3Q9LA 4M21A 3WHKA 4MUBA 2ANBA 2QMUA 1ZU4A 4Q4HB 3GLGB 3D6TB 4WAUA 3ICQB 4K46A 2WSSD 1TNDA 1IY2A 4D81A 5CJPA 1J99A 1AZTA 3HYRA 5CDFA 1M7BA 1PLJA 2C2HA 4FINA 3VHXA 2GCPA 3HU1A 5ELXA 2D7DA 2AD1A 1T8UA 5J4HA 1JI0A 2ZSEA 1JR3E 2H7VA 2MMGA 2OE2A 3AVQA 3O8BA 4TTRA 3GJ8A 2FSGA 5FTKA 1Z5ZA 4KYIB 5EP3A 1XF9A 2XTNA 1NBMD 4ZI2A 5HPYB 3MGCA 1N3BA 4TQUS 4QXAA 3CW2A 3GFOA 3THWB 2Z83A 4XVQA 1BH2A 2CLSA 2GBLA 5G3ZA 2X77A 1VPLA 3AH8A 3IKJA 3ZIAA 1SKYB 2DPXA 2JEOA 4AKEA 2IS4A 2RKOA 3MUFA 3X2SA 1YR6A 1XTSA 1KI2A 3TVTA 3K0SA 1F3OA 2D2EA 2GWHA 3D7MA 3LQQA 3GJ3A 2GK6A 1N25A 1NNEA 1R5NA 5EE5B 2R44A 2O8BB 1XXHB 3LW7A 1SHZA 4UNRA 3M6AA 2BMJA 1AJEA 4A0FA 3RS3A 1AS2A 4AY2A 1JB1A 4FCTA 4C0BA 3K0AA 1S8FA 1IY0A 2GTPA 4JL6A 4OK3A 2JATA 3KQHA 3ADKA 2FOLA 3W5JA 1TU3A 3EXAA 4LOAA 4DC9A 3EPLA 3VNVA 3DZDA 1G7SA 2GJAA 2O8EB 2O8FB 4FW9A 4KFRA 2ZM5A 1DG3A 4JLDA 4TL6A 3MAAC 3KUDA 1ZUHA 3AV0B 2QBYB 2CK3A 1L7VC 1D5CA 4LJ4A 1Z83A 1KY2A 1T3SA 4UNPA 1JJ7A 2G1JA 1UBEA 3BGWA 1EFUA 2G88A 2PX3A 2YKGA 3AVOA 2BBWA 3JVVA 1G64A 1O87A 2F7SA 3VR2A 5KDOA 3C14C 2ZSAA 2V55B 1RRFA 3MCAA 2C9OA 4WZ6A 4DXAA 4PO9A 2P3SA 4IOMA 4POAA 3Q85A 2H16A 3ZS9A 5F9HA 5LD2B 2NO6A 3UMSA 2D2FA 4XWKA 2ZRFA 4KJZA 1YZUA 1OSNA 1N2CE 2ZJ8A 4P3YA 3GCGA 5AJYA 1HYQA 2JJ1A 4WA7A 5FUXA 1GKUB 4FMDF 3ZJYA 1W0KA 4Z1MD 3TLXA 4L15A 1NN5A 4FN5A 3LDAA 5DI3A 3EZ9A 4LYAA 2B8WA 4C0SA 4ZKDA 1G4AE 2G6BA 1TMKA 3K0AB 1E79D 3MMPA 1OB2A 621PA 3FPAA 1Q44A 2YC4C 3KTAA 3ZZUA 1N5LA 1CR4A 4HSEA 5LB2A 1AM4D 3TUIC 1NIJA 2BBSA 3AP1A 1S1CA 2HV8A 3KKMA 5FBQB 2ZI4A 3CWQA 1OF1A 2ONJA 5KSYA 1U9IC 5JWRA 4LYFA 1UBFA 2V6IA 5H1YA 4Q1AA 4M9QA 4D4LA 4AK9A 2H1LA 5IHPA 1XJ0A 2YZ2A 4AKHA 3U7EB 4OHXA 3RRMA 3GLHB 2QGNA 2ERXA 5J40A 3TSOA 3PEWA 4F4IA 1KI3A 1UPTA 1K5GA 3A4LA 4IHQA 2R2AA 5DSZA 4EPYA 4M8NE 4A36A 1UAAA 3WYAA 2FSFA 2YC2C 2CE7A 3IPYA 2HYIC 4A92A 2GESA 2X2FA 5HE8A 4Z51A 3CRW1 1OKKA 1KNXA 3QI2A 1G3QA 5JS8A 4KSBA 3LWNA 3UK6A 1Z29A 1YZNA 1NVWQ 4Q21A 2YWGA 3NWJA 2W6JA 3QEOA 3RHFA 2QE7A 1KI8A 1XU4A 2F1RA 2B21A 1ZW6A 2BMDA 1T3HA 1ZNWA 4AYTA 2DFTA 1Q3TA 3QXHA 4AG6A 2GCNA 2BEKA 1MH1A 2XEXA 1CR0A 2BC9A 2NG1A 3UPUA 3VHLB 3U2QA 1Y63A 4X8OA 2JJ2D 1RC8A 1P7CA 3DHWC 4AURA 2UZ3A 3K0CA 5CYOA 3OIUA 4Q48A 3T12A 3UWOA 2KBEA 4WIAA 4CEHB 2NTYC 3FTQA 3U7GA 4NYMR 2NO7A 5CIWA 3VU9B 4F92B 3SHWA 4PHGA 4OKSA 2HT6A 1GZSA 2QTVB 3HYTA 1E2PA 3SS8A 4R2IA 1KK0A 2RGAA 3QKUA 2BIFA 5JHGB 4DLWA 2QAGA 2VP0A 4FWIB 2NPFA 2KB0A 4UNSA 5DN6A 1DADA 5JZVA 2IA5A 3AP3A 4MQBA 3QG5A 4FWTA 4NKRA 4TYPA 3GFPA 4NP6A 4BZPA 1FMLA 3A1UA 5J4YA 1DAFA 3I32A 4M22A 2IUTA 3I3SR 4R98A 2FGKA 5TDHA 2WAXA 2C9CA 3QSYA 2CNWA 1D2EA 2PX0A 4JLMA 5HCIA 1TTTA 1BYIA 1FNNA 3OEHD 3T1TA 3WMFA 1RJ9A 2ZR0A 1KSHA 5LPNA 3NHAA 1GAJA 1M34E 1R0YA 4Q9LA 3W90A 1CRQA 2FEMA 5LD2C 4HEJA 5GVSA 2XGJA 1X8JA 1KZ7B 4M1TA 4ZDIA 5G53C 4Q9JA 2ONKA 4K8OA 1U0JA 2W00A 1E9DA 3A1WA 3FB4A 1TU4A 4RSGA 2FDCA 1N6IA 3QF4A 5DIFA 2A30A 2AL7A 4G1UC 3MLEA 1AKYA 3T5GA 5AR1A 3I8SA 3X1YA 2OM2A 2IEYA 4LGMA 1HY3A 1NLFA 3D8BA 4GP7A 4LHVA 4AIIA 1OFTA 4DEXA 4A6PA 4FMCF 3DMNA 4M9XA 1ZD9A 4YXWA 1ANKA 1Z07A 3RAPR 4IVPA 2J1LA 2YNMA 5L3SB 1KGDA 4KHZA 2LWIA 2IXGA 1ZCBA 3EIHA 3KKOA 2X1VA 1NSTA 1HA3A 3QKTA 2FNAA 3CX6A 3U7FB 2KI5A 1E1RA 4JBWA 4HLDA 2VEDA 1Z0DA 4HAYA 2BMEA 1KI1A 3TR0A 3SYLA 1E2DA 2D62A 1J2JA 1P62B 4P33A 5KOYA 2HJGA 1FX0A 3I5YA 5HKKA 2A7QA 2V1XA 3PG5A 4XD7A 5C46F 1E96A 1QHGA 2BWJA 5C1BA 2J0VA 2O8DA 1SGWA 1TPZA 1IAQA 5JWHA 1ZUIA 3RLFA 1W5SA 4LJ6A 2ZEJA 2J7PA 2P6UA 2JDIA 1HQCA 1Q1EA 3L0SA 3OFND 3KQNA 5FI0B 1JAIA 1SQ5A 2WIAA 3IHWA 4FCWA 1L4YA 2GZHA 4I1UA 2REXB 2GVZC 3MSXA 3EWAA 3RSOA 1PUIA 4L9WA 1J70A 3GLGE 1M7HA 2OAP1 4P32A 2OT3B 5TVKA 5JWOA 1YR7A 1X8KA 2V7QD 2YVUA 4JIMA 1HQYE 1XTRA 2AXPA 1WA5A 2WMOB 3KFVA 3DM5A 4Q18A 3KQLA 3WNBA 2V54A 4U02A 2O5VA 2UVQA 2B6HA 1XTIA 1UADA 3MD0A 4BE7B 2H18A 3ZVRA 4PXAA 1U81A 4TLCA 2IUSA 1MO4A 1SZPA 3PEYA 3HP1A 1E2GA 1E2FA 1KMHA 2EFCB 1XCMA 2HLDA 3PUZA 2HT1A 5JECA 4EFMA 1LB1B 4PPNA 1IJEA 4CRWB 4DCSA 5FUYA 1ZC3A 1E2EA
chains in the Genus database with same CATH superfamily
3GXBA 4FIDA 2NPIA 2IZ0A 1OB5A 5CT4A 3WGUA 4CEJB 2X2EA 5BT9A 4UULA 4BLRA 5B6JA 2AJCA 2Y67A 4PAMA 3KQKA 4OQMA 5FEUA 4Y9DA 3A6HA 5KYUB 4PFSA 4INAA 5IS2A 3G0OA 1AY0A 4KE8A 1U2ZA 3NYQA 1DWQA 4KR9A 3CRVA 3ZDEA 1NNUA 2HI0A 3VSBA 3DF9A 1YMQA 4RTSA 3N58A 2DETA 1E1QD 3UH1A 2G5CA 1HWYA 3MMSA 4D6XA 1Q22A 3OCUA 1KH2A 4MH0R 5I9SA 4YI5A 3TZKA 2J6HA 1J9EA 2JIMA 3HFRA 4TTSA 4BLSA 3L1HA 3QWBA 4G36A 3CNNA 1IZYA 4OQLA 4E0BA 4C1NA 1E4EA 2H51A 2AGVA 2CYBA 4OAOA 1XA4A 4QFBA 5AMXA 5UKDA 1ST2A 3DVAA 1EE9A 4NLLA 1OZ0A 4CMEC 5LSAA 4QGAA 3FRHA 1RM3A 3RC2A 3L7LA 4OFBA 4DLAA 3NZEA 2I1LA 4DQXA 5A2GA 1GGMA 3O26A 3FJYA 3VRHA 2OEPA 3T3OA 2XOKA 1FXUA 2Q1TA 5IT5A 1KK3A 4BTEA 3RHZA 4Z4EA 1NW3A 1XTKA 2NO5A 4DMUB 5JCPA 1Z5VA 3EVEA 2VPXA 3IIMA 5IABA 5KTMA 3J81A 2FQXA 3ND8A 3KQWA 2OHIA 5LP6C 3PXGA 4EHBA 4RQTA 5AXCA 5K0NA 1Z0ZA 3REQB 4EL0A 1CUGA 4DKJA 3T4XA 2WUFA 4DIFA 4BVBA 3I72A 1AUVA 3QITA 4IVNA 3ONNA 2FU5C 1LRJA 2VJAA 2FLKA 3UICA 5KSZA 3KSBC 1OH6A 1CB7A 5EPUA 2UV8A 4JYAB 5DTMA 5D7NA 4BU0A 3PGXA 2KJQA 1MABA 3IURA 3Q41A 4Q19A 3AHIA 4D2IA 3ZJTA 2YL2A 3U1VA 4C6RA 2PWPA 2X8WA 2XUAA 2AQIA 3OHPA 1Z7GA 2QTLA 4IF4A 3TKAA 3GGOA 3ZU3A 1F2TA 4I4TA 1UK6A 4J6FA 2EKQA 3OETA 3L0OA 1MPXA 4WDRA 4WNYA 3UIEA 3R5XA 1O6FA 1EIZA 3UMRA 1K08A 1H2RS 4PVDA 1UMDB 2FG6C 2SNIE 4GEGA 5AVQA 3PV0A 4ME6A 3QKRB 4FS3A 1CZOA 1H1LA 2JH8A 1I4LD 3F4KA 1X7WA 4G0MA 1LZLA 3M4ZA 3AWDA 3W04A 4A2CA 4EJMA 4A03A 1IN1A 5I7UA 4MI3A 2DBRA 1FVOA 1QO0D 1QHHB 2K7FA 3DMTC 3FI9A 5FOSA 1U1GA 1MXFA 5F9FA 1VA5A 2NPOA 2R1VA 1FSFA 3PUIA 2B5VA 3Q15C 3AX6A 4YJFB 2O05A 3O73A 2VF5X 4Y0VA 5DX8A 3F6EX 4R9SA 1PKEA 3N8NA 1EGVB 1XCOA 3OZTA 1CUVA 4GI3A 1TF2A 2XH8A 1WLSA 3HXKA 3T3NA 5E1MA 4G1VA 1E58A 2JGLA 1QMGA 1KYQA 1L5FA 1TUEA 1Y4AE 3ETCA 3N05A 3QBDA 5COBA 3C41J 1M66A 1DO0A 2PZKA 3MK31 3U4GA 4IZHA 1T5OA 5IAEA 4Q4JA 4P80A 1DAIA 1JN0A 1G5TA 1BE8A 1NMQA 1OREA 3KR1A 5IYZA 1UZUA 2QRUA 4MR7B 3VUEA 3CCBA 3LC7O 2I34A 5KHOC 2VP4A 1RPZA 3OLXA 1TFRA 4I1VA 4ZIRA 3FF1A 3UATA 3DV0B 3EVZA 3UH0A 4OGFA 4D5EA 5AW5A 2DBVO 4BAGA 3IA2A 5ICMA 3JAMA 2E4ZA 3KQYA 2VRWA 1F3LA 5DHPA 4IV5A 2FJUA 3NTRA 1KPIA 3TQIA 3ZGZA 3OJCA 4LBZA 3I01A 1ZRNA 3MCWA 1U7DA 4L4YA 1GAEO 1AF7A 3KVRA 3WIVA 2I6FA 4HXYA 4W5HA 2XUQA 1Z8DA 3IQZA 2VKQA 5AM5A 1NOKA 2REBA 3IV7A 4PS0A 3SF8A 2PYZA 1Y7LA 1ENOA 1KGSA 1UANA 3FTPA 4TMTA 1J2EA 4TWJA 2BSQA 2PPLA 1UPXA 1PZXA 3EDYA 1ZM9A 4GZLA 2B36A 5E1OA 1NNI1 4FE7A 1GTL1 4HNQA 4X7BA 1W6RA 4ONEA 4BO7A 4PINA 4CHTA 4URXR 4I5EA 2PGIA 3FYSA 1SURA 4MYCA 2A1IA 4EL5A 1WCV1 2OBBA 5FX2A 5ER9A 3WV4A 1N0UA 3G6WA 3D0OA 4PZUA 5AVTA 1EPUA 1YUBA 4ARIA 3L8YA 2EX0A 3FAZA 2IYEA 2XIJA 3HDYA 1IOVA 4JR1A 4G4JA 2C3YA 3D8UA 1FRFS 5B58C 4N3CA 4JLOA 2O2IA 3KQMA 2Y77A 4IDAA 1BS1A 2NIPA 2Z2IA 4HUQB 2YMPA 2R47A 2XVMA 4KRYA 4JI3B 3VM6A 4REMA 2XMZA 3CB2A 3CPHA 3KC2A 4JUCA 4W9NA 3AI7A 2FPGA 2JLQA 3B6MA 4J16C 4I8DA 4QSMA 1SBTA 3WLJA 5AJZA 2JLXA 3L4KA 4KR6A 5EE0A 5EKSA 3AB8A 4CL8A 3UV7A 2R7KA 4Z0HO 1FDVA 8GPBA 2VBFA 4HDSA 4AW9A 1ND5A 1BTOA 3F90A 4GKBA 2GPTA 2W2KA 4EHHA 4YR9A 1DMRA 3E35A 2JFOA 4B6EA 2VRCA 2QW1A 3CY6A 2WHRA 2WIBA 3B6IA 2BGTA 4W4TA 1OD6A 3IE1A 4DJAA 4ISCA 1JJBA 1P33A 1T2FA 3K7EA 1K3FA 2QR2A 4D4IA 4ZOBA 3GMIA 1GPWB 1IHUA 3W5BA 1IPEA 2AMFA 2JARA 5HKLA 4CFYA 5JARA 1P18A 3DFFA 2X0NA 4D4GA 3IHLA 1Q57A 2WHQA 1TZKA 2LRHA 3LHDA 1J8VA 3NV9A 3WBJA 1STOA 3D1VA 1KJYA 2CZGA 3KJNA 5COQA 5AT1A 1KPHA 4P8RA 2GLXA 4DA6A 1Z0KA 4JEIA 2Z2KA 3GFVA 1VL1A 2CL7X 1YRBA 2WM2A 2AN5A 1ZGAA 1J2TA 2WNIA 5AJVB 2BEVB 1EWRA 3OLYA 5B57C 2B1GA 2Q21A 4H1TA 1G8JA 5LB4A 4LYJA 2FMXA 4Q00A 2IUEA 3U17A 2ZJ4A 3MPUA 1L1RA 4AZWA 5AM2A 4C2UA 3JZDA 5CT6A 1CZUA 2QP4A 2RARA 3CCFA 3DULA 4JZKA 2G9UA 3PDUA 3Q9SA 1QFZA 2GPBA 4PG4A 4EPTA 1UKCA 5CEEA 5HOEA 1N0WA 3EXHC 3NBXX 4CTMA 1RMYA 4WBXC 3V1YA 4JVLA 1Z4QA 3EPPA 3TNJA 4ARZB 4ALLA 4C1BA 2JFPA 5ESXA 1OXXK 5FL7A 3C4VA 2NVOA 3ZDFA 4C4OA 2TS1A 1J90A 4TLBA 3V46A 3RC1A 1IM5A 1Z47A 3B6KA 4JP5A 1UK8A 3DAPA 3HB9A 1QO9A 5D1NA 5BQXA 3L0BA 3MW8A 2VDWB 3M1IA 1MU0A 3TTTA 3WL6A 3ZDAA 2J08A 1SH7A 2R8RA 4HH3C 4PIMA 2YXNA 1VE7A 2DLDA 2IH2A 5CGZA 2FFHA 3E5HA 2X19A 1B2LA 1XI2A 4NENB 1IWOA 4G8CA 2OO5C 3SOZA 1FUEA 3H9JA 3D8SA 4FFVA 2OBYA 2E9SA 1TEHA 1K06A 4Y6RA 1M6VA 3T9CA 1RYYA 4RTMA 4A9AA 1N7HA 1GLGA 3SSMA 4GP6A 1IHOA 5ALSA 5JSYA 5B3JA 4GGMX 4GR9A 4PSKA 4HK4A 2V8OA 1MORA 1FMJA 3IOBA 4GPEA 5LQRA 2QX9A 3P5SA 1B15A 3C5HA 5L51A 2B83A 3GN1A 4YRRA 3O84A 2VBGA 3U49A 1KDVA 3TEMA 2XNDD 4XJVA 5LVAA 3FOCA 2R4QA 3NHWA 1PJSA 1PP4A 1XD8A 3K0FA 3LRXA 2C95A 1HURA 4N5DA 5B1YA 1LI5A 3T1YB 2V6MA 3F2IA 1P5RA 2NTEA 4HGYA 3IR6A 3NIBA 3ZBUA 2B1IA 4CLDA 4NZZA 1F6WA 1Y89A 4I1OA 4LKOA 1V6AA 1U11A 2PGLA 1EGMB 4TSKA 4XYLA 4DV1B 3NWOA 1K5DA 3S1AA 4L50A 5FOQA 1SZDA 2P91A 1E0SA 1GFIA 2SCUA 3WYGA 1APBA 3CT6A 3KZVA 1EJ0A 1QIJA 3PJRA 4X1YA 2CNNA 1Y34E 1N6HA 1T8PA 2RB4A 4XOUA 2VJQA 1TK3A 2AS0A 3C5EA 3CLUD 3CUUA 4FOTA 4WVLA 5E7QA 4CNBA 2H2DA 1AKVA 1N7IA 2QP3A 3EBLA 4LMRA 3JPWA 4W7HA 2O0MA 4GHWA 2FW8A 4FHGA 4IIEA 1AQLA 3S7TA 1RZRD 4DUYB 3ADDA 3FSJX 1BCRA 3MG9A 2AUMA 3TDNA 2FDRA 1PJ3A 4HAIA 4XWOA 2OHVA 4MYSA 3OIVA 3NKVA 1Z6XA 1GKIA 3RVQA 2OL4A 3QJYA 2VP6A 4IAOA 2WW8A 3PHLA 3JYPA 2JPDA 3SNKA 2E6KA 1OA0A 4JJ6A 2IT1A 2VOEA 4DJFC 2DEUA 3DXYA 5KS2A 1UZAA 1EUCB 3BULA 1SUDA 3HKDA 1Q0ZA 2W2NA 4AN1A 2YHIA 3EXFB 2R9VA 1QYRA 3RADC 2ID4A 4J8PA 5DXAA 2HJHA 3QYJA 5J1SB 3OMXA 5IZ4A 4LXXA 4J94A 3BRWD 2C1ZA 1FFAA 4FC7A 2HRQA 2K2QB 3U4MA 1FMTA 5KQPA 2O1EA 3OZGA 5EVJA 5BN1A 4G8DA 4EA6A 1FP1D 3GAFA 2TRSB 4K6FA 4KYTA 3I05A 2ZPAA 3DAFA 5ICSA 1GNQA 4TTTS 4BVLA 3BFJA 4JHLA 3GD7A 1OIVA 1EWKA 1C3XA 1Z5UA 4IOJA 1YS6A 5C4GB 4RD1A 1GCGA 3LVFO 1S3GA 2J5XA 3BBPA 3TM4A 1MC4A 5K6AC 2ZYSA 3K0KA 1KL7A 4EUKA 1FP7A 1XMXA 2B92A 4QTZA 1EXWA 1P77A 3NDBB 1NWHA 4I1IA 3ZHXA 3AF2A 4OA8A 3L7YA 4MA5A 1B0AA 5C3UA 5PGMA 3S8MA 3LJKA 1IAVA 1P73A 4CKEA 5LOVF 5FUWA 3I64A 2B99A 2PUFA 4G5HA 4XFJA 4YMHA 5TRTA 5JRJA 4ZYXA 2IU3A 4MI6A 3IUMA 1L7QA 1AUOA 1FTYA 1ZH4A 4UCXA 3X0DA 1WPXA 4ENTA 3DBHB 4KI0A 1MV5A 1M2HA 1ST3A 1X2EA 1JR2A 2WVHA 4KLRA 3IAM1 3EGDA 3LQ1A 2REQA 4C6HA 5CT8A 3Q11A 1JE1A 1W5EA 4PEVA 2ASVA 3E3LA 3SSOA 4YRTA 1O4VA 4MW6A 3RUIA 4RD0A 5FKJA 3FHCB 3ILYA 3E7PA 5FR2A 4Q03A 3V2HA 3NBZC 3NJ4A 4NABA 4UBIA 1RVDA 3GLUA 1KH1A 3H05A 1L4KA 2ADMA 2C2WA 3P9NA 1TVKB 5KPDA 1GCUA 3Q3EA 1CJCA 3T9FA 3THXA 3ED1A 3H42B 2DG2A 2FI1A 1DV2A 3DE0X 2WF6A 2EF0A 1Y82A 2J9RA 2PT9A 3VNRA 1XMQB 2I2XB 3CMMA 1HRDA 4IUDS 1WCIA 4V0SA 3SFVA 1RRKA 1CZNA 3I9OA 4O59O 4Z9BA 4RJLA 3U31A 1SQGA 7YASA 2D1SA 1AF4A 1YVEI 1MIHA 5JCJA 4PSCA 4QGHA 4TWAA 2DJ5A 2TMGA 4KTTE 5K7SA 3ESRA 4H7JA 2GJ8A 1ZFNA 3B3GA 3L6EA 3ZQJA 1G1MA 3T4EA 2BHLA 3X2EA 3IPAA 3DW1X 4LX0A 3OX2A 2ISSD 4P7BA 3SR4A 4JI7B 3UUEA 1DAHA 1GR0A 1OXKB 1Q6YA 4M1OA 4AMVA 4JCCA 5KYYA 1DQSA 5EZ6B 2YDYA 2H07A 3O3OB 3BMOB 4HDRA 5EXSA 3QXJA 3VKUA 3F74A 1U8FO 2FWJA 3A31A 1MAVA 2QD2A 3TQTA 2PJDA 3E61A 2VZ9A 5KYVA 4G6ZA 4B3XA 4UBLA 3IIKA 1R10A 2C3OA 3Q5DA 4JU8A 1YGPA 3A1DA 4JFAA 5F7JA 1V2HE 4XWTA 3WVNA 5HP4A 2JIRA 3L92A 5DRTA 2OFFA 3ZEAA 4TV9B 5BR4A 3H65A 1ZN2A 4QG3A 1XU9A 4YAFA 5ADVA 1LJLA 4NJMB 1E7WA 1ZK2A 1OZHA 1C14A 4C4PA 1X3SA 4K6HA 1NN3A 2ZE6A 2QTCA 1W8IA 2PD6A 3CLTD 4OO3A 2HH9A 3RBXA 2IYAA 1G5QA 1M6WA 2C97A 2FXIA 2VJLA 4NCJA 1QP4A 4ETMA 821PA 1NF8A 1DAMA 2PTGA 4C7OA 1AIPA 5IH3A 3U1BA 2F62A 4LNHA 4OQFA 1X7ZB 4EMBA 4GYWA 2ZWPA 3D8HA 1V8PA 2VN8A 3I0ZA 4O4JA 4JJ8A 1T1EA 3IL2A 2JKVA 3NR2A 2VK2A 3NVAA 1NI5A 1NT4A 3HSSA 1E1MA 3LC2O 4TXHA 1DZ3A 3PR1A 3HVIA 3NKFA 4P4NA 4U7DA 3HBMA 1U9JA 3VSCA 5LDHA 5FF9A 2YJGA 4G25A 1LV7A 1WZIA 1E2QA 3R7LA 1BRTA 3SK0A 2BHNA 4XVRA 5DI3B 1BDBA 4YWHA 3PGLA 1H9AA 4IYRA 1S8AA 2GHRA 2XTMA 4CCSA 4A15A 1X1TA 2YHUA 1FYFA 4G3XA 4ZVKA 5K8IA 1LBTA 4K6KA 2C29D 3GNTA 5CUQA 2YV2A 1IOLA 4JUBA 4M1YA 2BFPA 3V4LA 2F67A 1YIAA 1TK2A 2BFDB 1DIRA 4IS2A 5K4AA 4BPBA 3VNBA 4LSWA 1KZ6A 1M2EA 2O7QA 1KOJA 3HJAA 4WCFB 5CVCA 4EMTA 5HJ5A 2A6PA 2OV2A 3O4HA 3WWDA 4PAGA 1IBCA 1DIBA 4D0NA 1MCZA 4FYXA 3EZXA 2VTEA 4JWTA 3NEJA 4KUHA 4TV8A 3F71A 2H1IA 4ARCA 2WYWA 4RJTA 3Q6NA 5A6SA 4QRIA 1D2GA 4B2PA 4XTRA 4BJHB 3D0QA 1DQNA 1O1YA 4DWVA 1A97A 1E9BA 4OEHA 1ADJA 1RVV1 2CL5A 3N76A 4GPTA 3UT5A 4D9MA 2RG1A 3GJRA 1A04A 2CBGA 1A69A 1YB1A 5LXTF 3T1OA 3NV7A 1FDUA 2NSLA 4BN5A 3HU2A 2ORIA 3BMNB 1Y8ZA 1WDKA 2MYTA 4QELA 5K0LA 3ER9A 3EH2A 4MKRA 3BGVA 3PXAA 4IEFB 4DV0B 1TCBA 4M83A 5G4KB 3K1AB 4QM7A 1OBHA 1USWA 2UVDA 2VL7A 3AQ4A 1L4UA 3CU5A 5B5SA 2ODPA 5IKPA 3OEYA 1Y9EA 3I2JA 1RZVA 1JHVA 2IUFA 4PNZA 3VDRA 1E3LA 2FWRA 4IXWA 3ZK8A 5JNVA 4PX3A 3PUWA 3O2QB 3TSZA 2ZR8A 3W78A 3P9PA 5L3QA 1ZH2A 1RI4A 3DOEA 3PDJA 2X8JB 1IDN1 3OE4A 4LDQA 4AJIA 3ZJVA 4J2OA 1XTTA 4XIJA 5MGBA 1KJJA 4EQZA 2QY9A 3DEHA 2AYYA 3CX7A 5DYIA 4HT3B 3O8QA 4BECA 2RH9B 4FLFA 4KE7A 1M1UA 2KPOA 2XKBA 5FHRA 2HNKA 1KMQA 3JPYA 3DPSA 4FE3A 1L9KA 2DHDA 5C7YA 1KBQA 2ZIXB 1LNSA 1W5AA 3NT5A 1CJMA 3OUZA 2CXNA 4IGFA 1GQRA 4M9UA 2H9AA 5DYYA 2CFIA 2XZOA 2JCSA 4IIJF 1UP7A 1V0JA 2AI1A 2W8BA 3DR5A 4RS4A 3U60B 1W25A 4OCZA 1XHEA 4ZOLA 4OBBA 4C5CA 2C3UA 3KSDO 1KYXA 3DLCA 2FZKA 4NE2A 4NZNA 2P3QA 1DT3A 4KBYA 2NUAA 2V4ZA 2I91A 1VBNA 3KEGA 3A27A 3B8HA 1J8YF 2VH5R 1SA0B 1ARZA 1KZYC 1OI4A 1T1GA 3FFAA 4KQ1A 4Q01A 4RM3A 4ZTBA 2O8NA 2OD2A 1OASA 1ODSA 2VIIA 1SJ9A 4ND8A 1SKUA 5HQ3B 2IYOA 4AO6A 4YCSA 5CA0F 2EFGA 4CKBB 3UANA 1R8SA 3MRSA 4ERXA 1E6EA 5FJJA 5DTQA 1Y6QA 1BQ4A 2E1PA 3UJ7A 3M5PA 5JBQA 2XZLA 2WYIA 2ON6A 4ZDWA 5ULLA 2I6SA 2PKQP 4Q37A 3X3HA 2BGLA 3ZLVA 1Y0BA 3OOHA 3B70A 3VNSA 1IOZA 2W93A 4OM8A 1T2NA 4V2UA 1NURA 4X91A 3TW4A 1XPJA 5EZYF 1T36A 1EJBA 4URFA 4YI3A 4IFEA 4ER3A 5J47A 3CLKA 2NO0A 5BNTA 2YJNA 3GLFB 3AJAA 1PT7A 4OH7A 1AUXA 1VCOA 4R41A 4DCMA 1BEUB 2A5JA 5EIEA 5IF3A 2CE2X 5JALA 4E4RA 1SELA 3T5CA 1PHPA 3BFXA 5B2FA 1FLVA 2DVMA 3BSYA 2RONA 4TLDA 2B4RO 5ALMA 1S01A 2ZROA 4JUFA 2Y6VA 3KKLA 3A7DA 1J7KA 1XELA 2CZCA 5B37A 3TS1A 3CO5A 1QHEA 4BO5A 2IYXA 3COVA 2JW5A 4C4RA 1LVGA 4ROSA 3TCNA 4Z4HA 3TBHA 5JQWA 3VPDA 1D1PA 1FFCA 3OA2A 4QVKA 2ZJ5A 4BUJA 2EHJA 2C1XA 5TB5A 3L02A 4GM0A 3WHLA 3ZWCA 2D1YA 2IHVA 5MFPA 3E84A 2DQYA 1TVEA 1ADYA 1NG1A 3E48A 4FLEA 4KVGA 1AGRA 3U3XA 3DUWA 2O2DA 5K3EA 3KSMA 4DR4B 4QHSA 4BLOA 2ZLBA 4W1RA 1TEVA 3C2QA 3O5AA 3K71B 2PQ6A 2OXTA 3AF1A 5IP5A 2FR1A 1ZMXA 4Y0NA 1XKTA 4C0HA 2ZULA 3AIOA 4ZICA 1TQHA 1ZZEA 3OPMA 5K51A 4YBRA 1SBQA 3CIFA 1RKBA 2HTFA 3HDTA 3BL8A 4G81A 5JS7A 4JQCA 3WFJA 1KTIA 3T1HB 2XMDA 1CQIA 2MMCA 3AEKA 2Q6TA 1E5LA 4YASA 2MR5A 5A04A 4N12A 4I5DA 1DKPA 4ZYYA 1BWPA 4UBNA 4EITA 3RSSA 4C04A 4E14A 3LM8A 4O2AF 1EGHA 1TLFA 1US8A 2FE1A 5JRZA 1CDEA 4EHIA 2VSNA 2J3MA 1U8UA 3G2QA 3OKAA 3WKEA 2BI7A 1Q16A 2N75A 5KX5A 1IXSB 1P5JA 4YRNA 3E58A 1YDMA 1CDZA 3K8QA 4L02A 4WRRA 2P65A 3AHJA 3V32A 4DIBA 5C4IA 1AGXA 4EI8A 4OX9B 1PE0A 3QPVA 2XMGA 1YI0A 2ZB7A 4KXLA 4C76A 2QF7A 3K0CC 4CCAA 4KE9A 1FOEB 3QOYA 1MAAA 2RSLA 3G59A 4NZOA 3O8NA 3DVRX 1GRQA 4LY0A 1W2GA 2Q9BA 1U8AA 1J42A 1LJ8A 4YMVA 1G0NA 4OQYA 2CUZA 4P7JA 3V4RA 4F4DA 2JVKA 1Y1RA 3EARA 1A7UA 1NUQA 3F6YA 3FGPA 1FPQA 3HB7A 2I4TA 1VYUA 3GDWA 1A2OA 3OQHA 1N4DA 4GLJA 3QKSA 1YVRA 4YAKA 3BC1A 4V0OA 4LYHA 2EL9A 2YOHA 3QUQA 4MINA 1FPMA 2ZRCA 4KLCA 2Q3FA 3CW8X 4BX2A 3VOSA 3OJLA 1IN5A 2GPNA 2Q4EA 3EOBI 3IJPA 4DLYA 1WXDA 4LQ4A 2OO7A 1XEXA 4BRWA 4IG4A 2QX8A 3MMXA 4KDEA 3QUCA 1IUPA 1XNHA 4K9DA 3BHNA 3ZY4A 2VHXA 5A9SA 3OM1A 1TAUA 3JVEA 1YB5A 2ODTX 1DBRA 1JJFA 3NHLA 4BN4A 4E2ZA 1WWKA 4LV5B 1J1IA 3DYVA 4OUDA 3MTAA 3I42A 8MHTA 3KWMA 1QB7A 2AOUA 1ZSVA 2IY7A 2RKBA 3LUGA 4JJFA 1W73A 1KK1A 2MCFA 1TJNA 4MMYB 4Q4AA 3RFVA 3GUVA 3L6UA 4LC9A 5IULC 2YVKA 1GPBA 2UYYA 1D2MA 4NULA 3B5JA 2BFCB 2FCAA 2WQZA 3GVIA 1BA3A 3VR5A 2FN8A 3JQ9A 3VI4B 4EF6A 1E5TA 3T9AA 3A3PA 1PBNA 1NUHA 3F9CA 4ZVNA 4TKMA 3TH5A 3VAZA 2B7CA 4EWLA 3GFRA 3Q8MA 1MO3A 2JLVA 1E1RD 3O92A 4OLAA 2OLJA 4GBJA 4OREX 1FS4A 2YIMA 2JGJA 3HY4A 3KXKA 2CFCA 2XMRA 2CW5A 1AVTA 3CVJA 3PQCA 4K87A 4CM8A 4CV1A 5L3VA 1E2NA 1EAYA 2VWPA 1ZS9A 2O52A 4CUJA 1KI9A 2EIHA 4XD7D 2FEWB 3S2IA 2UUPA 5J63A 3SIRA 4YV2A 5A3JA 1QU2A 4KWIA 4YMSA 3C3JA 4CMIB 2INGX 5J5VA 2YNMC 3Q5EA 1JZSA 2XE6A 4EX6A 1E9CA 3K9HA 1KK2A 1M76A 2G9RA 3HB5X 5EVCA 5IC5A 4F60A 3VBEA 4Q7MB 3BSWA 2QUIA 3P9SA 3GZNA 1I2AA 1QIFA 2ZQZA 4MS4A 4DMFA 3W77A 1S5PA 3AESB 3URKA 3F6RA 3FZQA 2D2VA 4EA7A 3P0HA 3KYIB 2RH5A 2WYHA 3BGIA 4BNFA 3ILXA 3OX1A 3RF7A 4A0RA 2XGMA 4D44A 1LJUA 1BU8A 3P45A 2JCVA 4EJ2A 4D4MA 4HVCA 4MMZB 3JU3A 3SEAA 3FCAA 1QRSA 4YJHA 1A76A 1DXYA 1P9WA 1WMEA 2P9GA 1AGYA 2UKDA 3RFTA 2F17A 2O2ZA 3T1VA 4ZI7A 1G16A 3OFKA 3SG0A 1L2TA 4FYWA 4AZ3B 5BWMA 2DHEA 1DTWA 2NZ8A 4YQFA 3UGTA 3QVUA 2NO4A 3DDUA 3EMDA 4JP8A 1PR1A 4UARA 5CB4F 5A5EA 1A5TA 1GFZA 5FWXB 2CLMB 3QKIA 3PFGA 3RVKA 4RZUA 5HFNA 3WKBA 2PCJA 1LDEA 3K2QA 1YRHA 1X13A 5EIOA 3X44A 3VJKA 1S4MA 4OIMA 4NYJR 5AI9A 1QOQB 2FPWA 3O4JA 1TQ2A 4MP6A 1X3LA 3BGOS 2P4UA 2PUVA 4RS3A 2H17A 1G3MA 4AMBA 3DAOA 3O91A 4QOJA 4RWEA 3UXEA 4DM7A 4XA8A 3PYMA 3HA3A 3FWHA 3LS2A 3AVXA 4HDKB 2R7LA 4RTPA 5KVVA 2GZ3A 3R8CA 1A4UA 2ORWA 3H11A 4JIGA 2FPLA 3DW3X 5AIAA 3WLIA 4B45A 1WV1A 3HU5A 4Z6KA 1NX6A 4IV8A 4HX9A 4I55A 4BCCA 5EKXA 1NBMA 3C48A 1ZPDA 1J8QA 1NVBA 1QZXA 2V98A 1S0UA 2F1JA 5AK0A 5BW5A 3A9CA 2Z30A 3CBQA 4L6IA 4P3KA 1EX6A 4RA9A 2G82A 3C0KA 3FHJA 2FMTA 2XOKD 4B4KA 5HFAA 3LTNC 2I6TA 4EG0A 2CVFA 4KQEA 4CR7A 5FUBA 4OSPA 1W2HA 4BLUA 1G8AA 5KU1A 3JQ8B 1TZCA 2R8EA 3N0TA 3M3PA 3PFBA 4KAFA 5CVDA 5L8VA 1LD3A 1E0KA 2CUKA 4G0UA 1YQUA 2BSXA 2J9XB 2W2VA 4PTYA 3QYFA 1TKCA 1L7PA 3NTQA 4BMPB 1QIHA 4YN3A 5DK6A 1SWVA 4ZGGA 1DIHA 2YOFA 3L7OA 4K9LA 1JA1A 1K98A 2ZBDA 1SVWA 1NR1A 3BHMA 4FC6A 1DQPA 4KVZA 4UM9D 5JJIA 4EG1A 1XQYA 3R8XA 2WSIA 1NKTA 2JFFA 5DP1A 4CKWB 3GUUA 2HO4A 4G41A 4BIMA 3JQ6A 1SO8A 4AJLA 3B51X 4CDGA 2VG8A 3HH8A 4MVJE 4HAWA 4XH9B 2IY9A 2VYVA 4HAXA 4D45A 4IMJB 2E4XA 4I50F 2XPCA 2ZI5A 4NDNE 4DA9A 1KRXA 2OGZA 3MCUA 2B4YA 3ANLA 3N8KA 4O4HF 3A3KA 4EZIA 1A0OA 1XMSA 2BJWA 2Q3JA 2QI9C 4IIGA 3TSCA 2PFKA 3L0YA 2HF9A 4R1QA 5ALGA 1TMOA 4AZ0A 4GKJB 1SG0A 3NDRA 5HZHA 3ADPA 1W85B 3CF0A 3T1QA 1Y81A 3H99A 1WPQA 3IUEA 3B9QA 1IMJA 3M5WA 4ND4A 1HSZA 1RHQA 1RMTA 1UPBA 5EJ6A 1R6AA 2PEZA 4LFBB 1JDBC 2QYOA 2WLSA 4XIIA 1GPUA 2XRFA 4BDSA 2EFYA 1V7CA 4WH0A 3L84A 4GQAA 3WLLA 3UTCA 1DX9A 3HFJA 5EIFA 2EVWX 2ZSHA 5FPYA 2QG6A 4Y6OA 3PPIA 2D3TA 6YASA 4TLEA 5HHTA 2VBIA 3DD5A 1EA5A 3G0IA 3SZLA 2CMHA 2JBWA 4U2BA 3JQGA 2QR5A 3RUFA 1N8TA 2VXCA 3JCZA 5K1ZA 3ZWPA 2XADA 3VC7A 4COKA 2QVCA 1GM5A 2VT6A 1PNQA 2X8AA 3GT4A 2JIPA 1E79A 4RADA 3KPWA 1ES9A 4HWSA 2IIVA 2VDPB 4HQ0A 4HYYA 5CJ2A 5ENVA 1TT5B 4DDWA 1MW8X 2X42A 5TPZA 3ZGLA 1SPXA 2DB3A 1RD4A 4R6XA 3B82A 2FF7A 3NKLA 3WK5A 4B34A 1VG0B 1NRWA 4LNUA 4B6FA 1XE3A 3A8TA 2ZB2A 1I4WA 1TGYA 2FFBA 1CCWA 3OPNA 4PXSA 4RTNA 1YBHA 3DLIA 1A2BA 1VMAA 3G88A 3ODPA 3KT3A 3I73A 5EPEA 3RLIA 4D8YA 2HBZA 3Q7QA 1QLWA 2J7KA 5H8WA 3HRKA 4QOIA 3ICOA 4EB3A 2HDNB 4ON9A 5KC8A 1UODA 4TYYA 1IJKA 4YHBA 5AVXA 2BGJA 3MJSA 4Z0NA 4YALA 1ISFA 3K2EA 4N6GA 1GV1A 4NQZA 2X6RA 5JFGA 1FJGB 1QKIA 2IHZA 3DFUA 5ETJA 1A88A 4QYIA 3ZWQA 4ABYA 3K16A 4NFLA 1MENA 2D1TA 1YRYE 1J22A 3GVXA 3HFSA 1NVKA 3R5FA 4MXDA 4R8VA 3WWZA 4C0LA 1W1WA 1SRQA 2JRLA 4HFMA 1C8BA 5D5HA 2EFHB 5B6PA 2DWPA 3A6LA 5J5CA 1MOPA 2DY0A 3FD8A 3W3AH 1X0XA 1J06A 4ZVVA 2A59A 1PV4A 4FK8A 1PEAA 4DNXA 1U2QA 1RPNA 1U02A 1Y6ZA 2O8EA 1Z12A 4D97A 2P3LA 1WF6A 3NYIA 4F86A 2J0EA 1TLTA 3ZVNA 4QHTA 4YJ3A 3L9XA 1E8MA 1TUBB 1I6WA 1Q1GA 2GEDA 3JSAA 2VP2A 3KUCA 4OHWA 2VRCD 4YDSA 3SYLA 4IKEA 2XV1A 4ZCTA 1L0BA 2EEZA 3PEVA 1QVAA 1R3DA 3LNTA 5IUNC 1E2KA 2RFLA 1ZH0A 2PA0A 4M76B 4Z86A 1F51E 1V26A 4XOIA 3OUTA 1GGFA 3H84A 2AR0A 3EBPA 2F8SA 1XRMA 4TXNA 2ZOSA 1AQNA 3N87A 3OJEA 5JJKA 4KW7A 1RRMA 4E5DA 5CXQA 4RL6A 3AKDA 2R8XA 3DTYA 3N0RA 3K6KA 5T4HA 3U3OA 4L85A 4ZALA 3W6OA 4HFJA 4M1QA 3ZPXA 2VF7A 4ARSA 1RTKA 2CN1A 1FFGA 2HA5A 2RHWA 3OJWA 1MJGM 1M9NA 1OZGA 4M1KA 4OPMA 1JECA 1P80A 1Z6GA 5G2OA 3DEZA 3PC8C 1K6JA 1P3Y1 1VXRA 3OEHA 1AC5A 2OBNA 4BNZA 1T2VA 4ZYWA 4QYXA 1D09A 1PLKA 3GPLA 5DBHX 3NEPX 2KLHA 3KQUA 5MF6A 4BCBA 1LQ2A 4B33A 4EKEA 3I6BA 4MP8A 1FNDA 1NIPA 4HB0A 5FOXA 1LXCA 2DPYA 4UHHA 2W0MA 2R68A 3AKCA 3PX3A 4XGNA 5E9WA 2QYTA 5GONF 1DC5A 4FFWA 1V2GA 2AFRA 1BO6A 2HMWA 4UJ5A 4B7AA 5FL7D 4DOMA 1V5WA 2Z6VA 4K9NA 1Y80A 4B87A 3N2EA 4INZA 5EE1A 2QOEA 3A4IA 3QBVA 5AOBA 5E2BA 1FMCA 5DSTA 2A78A 4Z4IA 1J6UA 1W30A 4MZXA 1DBWA 1E62A 4BNIA 3OWXA 4WBSA 2W42A 3L05A 1VJ5A 3SYRA 1QYCA 4OMUA 4ALKA 4EJSC 2IPNA 4FB5A 5LR6A 1N2EA 4AY4A 1EVJA 4UBOA 3LXMA 4PRZA 4W82A 4Y7CA 5LA6B 1CVIA 2VJYA 2WI8A 2HA7A 5IN4A 4KR7A 3L79A 4TS1A 1T3ZA 3LXRA 3SZGA 5BSVA 1YZKA 3WRWA 4I5FA 4MUKA 3O2SB 3ME5A 1YKFA 2I1QA 4GOOD 3UCFA 2HEGA 3H0EA 4S0ZA 1G5HA 1TA9A 2MINA 1QG2A 1V16B 1PYDA 4R9RA 1QOZA 4RJIA 4DILA 1VL8A 3AT1A 3I5MA 4QTXA 5AM4A 3D1JA 1CS0A 2GUGA 1Q19A 2HA6A 3BJEA 4IBOA 4XJSA 1I33A 2LW7A 4LXYA 3PL1A 3URMA 1MEEA 2O14A 2G07A 3OJFA 3NBMA 3H5NA 4PZLA 2Q8QA 1ODKA 3OCJA 4CMBA 1OLSA 1I4OA 1C9MA 3PE4A 1CEXA 5C81A 3RYCB 2P0EA 2PL3A 2WE8A 3LHIA 2I0FA 1MT0A 1WRBA 2IC5A 4FHDA 2C31A 4BLTA 2PT5A 3G5TA 4TWIA 3H2BA 1CT9A 1XFAA 1KOGA 4C4TA 1XZQA 3C6QA 2P4QA 2V7UA 2XVZA 1IC6A 3AFMA 2RGBA 3FPGA 2X8BA 3MTEA 5YASA 5EWMA 2V7QA 4UVIA 4DG5A 3KKQA 1GILA 2QTVA 3JARB 1Y4UA 4KMRA 3VJLA 4KQHA 2FMUA 2WM9B 3PNVA 3UG6A 5DNCA 4N7RA 4PPQA 2GF2A 2IHYA 3QX9A 4PHTA 4OQZA 3T7SA 2H4WA 4MR9B 1DDOA 4NZYA 2AVNA 4BVGA 3A2LA 4N48A 1P2SA 3RIYA 3TZBA 1QWOA 1ZIOA 2BTQA 1MG5A 2I78A 4X00A 1QQBA 4FMDB 1CHNA 2LIPA 2ZSIA 3NO4A 1M67A 4BZQA 1ZMTA 5J2UF 3G17A 3GVHA 3JWJA 3AOEA 3THSA 3VVLA 1RE1A 1RBYA 2CNLA 1WEHA 1DAOA 3LT1A 2BZ0A 4RIIA 5FTMA 3RKUA 3D7RA 5AK6A 4X6XA 3RHSA 3ND5A 1BFDA 1T9GR 2Q3EA 5FTWA 4D98A 1SUSA 4IWYA 4W5WA 2FPPA 1WDWB 2YFYA 1GTVA 3HPQA 2E87A 1T5IA 2WJAA 3ITKA 4N1AA 5KVSA 2BHTA 2HFJA 4GMKA 2VYFA 4Q6WA 1MJHA 4QL3A 4WXRA 3G2HA 1KQNA 1YJBA 3LQRA 1NVVQ 4QUGA 1D7OA 3LX6A 4AM8A 4AULA 2WIFA 1QGAA 2ZRJA 3LPCA 2O2YA 1R4MB 3DKIA 3LKBA 1L3IA 3NH9A 3LCMA 3LWZA 1H2HA 4TXJA 2GX6A 3HP7A 4I2VA 1GTMA