2AKAB

Structure of the nucleotide-free myosin ii motor domain from dictyostelium discoideum fused to the gtpase domain of dynamin 1 from rattus norvegicus
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
299
structure length
299
Chain Sequence
MEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the GTPase domain of rat dynamin 1.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Contractile protein
molecule keywords myosin II heavy chain
total genus 99
structure length 299
sequence length 299
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2akaB00
3CRRA 4TMZA 1JALA 3MJHA 4DDUA 2O8BB 1KK3A 3L8ZA 2E1RA 1U8AA 2R44A 2P65A 4V02A 4LWZA 2QTHA 1FNMA 4JVNA 3RWOA 4OHXA 2BEKA 3M6AA 1XWIA 4B73A 2V1UA 2HJVA 4QKQA 1RFLA 3TK1A 1GSIA 5EE3A 1YR6A 4M9QA 4QG7A 2QMOA 2A3RA 5AJXA 4Q9HA 5DI3A 2C2HA 1E2KA 5CK4A 5B2ZA 2RMKA 3U2QA 1AGPA 4NCKA 3ZZUA 1JR3A 1N3BA 2DFTA 4KO8A 1X6VA 3B82A 2J3EA 3ONWA 4CIDA 4CEIA 3MWLA 1N6IA 4M1MA 5B64A 3K9NA 1QZXA 3MRSA 2FV8A 1CBUA 3BE4A 4CVNA 2ZE6A 3CRW1 4Q00A 4EUNA 1EWQA 4KBGA 3CX8A 4L16A 4UJ3A 5DHAA 3I8SA 1GL9B 2FPLA 2AN9A 2HLDA 3OFNA 5HE9A 3IO5A 2XOKD 3LDAA 4H1UA 1IN7A 1QHHA 4DSNA 1C4OA 1NF3A 1OFUX 1N5IA 2CJWA 3LFUA 4BLTA 4ZIRA 1UDXA 3B7GA 4X8HA 3WMFA 1GAJA 1NG9A 2ZJYA 1UEJA 1G8PA 3NEJA 1DAFA 4TMWA 4EQ6A 5FI1B 2H17A 4QBIA 1PV4A 1U8YA 5BYJA 4JS0A 1ZVQA 3KL4A 2XXAA 1XEWY 3CX6A 1W0JA 1Z28A 4PX9A 2P2LA 3RS5A 1IBRA 2CVHA 5E3HA 4PC7A 1MO4A 2DFNA 2P0EA 2R2AA 4HAVA 2CLCX 2GTPA 4W5HA 4R2IA 1NN0A 4QHYA 1OPXA 2GHIA 3ASYA 4JKIA 3CX7A 1JJ7A 2CK3A 1II9A 2WHXA 4KVAA 3NDBB 4DC9A 1I4TD 3W3ZB 4A82A 1S2MA 1K5GA 2AKYA 1SVLA 4Q4AB 3X2SA 4X8LA 3GP8A 2J1LA 1ZD9A 1V5WA 5F98A 4B34A 1G8GA 3IILA 4NCNA 1E2EA 4O25A 1DAMA 1FQJA 2QNRA 4Q18A 1Z83A 2XTMA 4PPFA 5HE8A 4ZDJA 5EZ6B 1HV8A 3VU9B 1YR7A 3HDTA 4DBLC 2AD5A 3AKDA 3TSWA 3CNOA 3WBJA 3W8RA 2WKPA 3AP1A 1GL7A 4B32A 4LSGA 1KKLA 1Z0FA 4C0LA 1F2UB 3R9WA 4DEXA 2JDID 3KB2A 4RKEA 4E07A 4XOIA 4QHSA 4BZPA 1OH7A 1E0KA 4LYFA 1VCOA 4D4KA 1DAKA 4D6PA 2ZRAA 2WWFA 3NTUA 1RRGA 2O8CA 5H70A 1XMVA 2BBSA 4PQRA 1GILA 4NDZA 2XNDA 1II0A 3RSOA 3EPLA 3BFXA 1Z0DA 3OIYA 2GCPA 2A2ZA 4TYYA 3B6EA 3U7FB 5FPHA 1NBME 3R20A 1OKKD 3UG7A 2X19A 1IN8A 2O8FB 2HEIA 1ETUA 2KI5A 5DI3B 1NN5A 3U7GA 3ZQ6A 5KDOA 2EU8A 2D7CA 4ZO4A 4ESVA 4QNMA 1ZUNB 3X1ZA 5JCPA 1XEXB 4B3CA 2PZGA 4B6FA 4HB0A 3O8RA 1GVNB 1RYFA 2VYFA 5TY0A 4CZ2A 1VHLA 5F2EA 3AF3A 3I5YA 4DIEA 2A7QA 2GJAA 2XJ4A 2Z6VA 4WA7A 1G291 3PXGA 4G0NA 3GEIA 4NE2A 5CLQA 4LBVA 1E32A 3ZQJA 4EAQA 4NCHA 1ZM3A 1XEWX 4BASA 1JI0A 1RRFA 1T0JB 3H2YA 2W83A 5IDVA 4BFSA 1G5RA 1QG4A 2WV9A 4HI0E 1DOAA 5FOWA 4AKEA 2G0TA 3T1TA 4L5BA 1LVGA 3FOZA 1R0YA 2R6CA 2IBMA 2ZRDA 3F5FA 4TTRA 1COWA 2F9MA 2FN4A 4Q9JA 1W0KA 1GRRA 2ZI9A 4FXPA 1M2OB 3SU8A 4EPYA 2J5XA 2D2EA 3B1WA 3GFPA 1Z07A 5A5GA 4A4DA 3NH6A 3QXJA 3L0IB 2J59A 5JS8A 2YVUA 4DDVA 1Z63A 2I1VB 3KKMA 1WBDA 1SVSA 4D80A 1E9DA 3C7KA 2HXYA 3DEFA 1RRCA 1M7BA 1U2RA 3D8BA 4JVMA 4A2QA 4U7DA 4Q9KA 3EXAA 1UAAA 1XFAA 2ODWA 2OAQ1 2C5LA 3NC1C 4PTLA 4HLDA 3ZVRA 4PHTA 3SNHA 3TW8B 4R98A 3BFKA 4D81A 5EXPA 4IDNA 2ZEJA 4OYHA 2FGKA 4RD6A 3I73A 1II8A 2ZI3A 4I81A 5FL7D 3DO6A 1P2UA 2DY1A 1TTTA 2ZRFA 2O8CB 2YJTD 2B8WA 2WAXA 3AF4A 4ZKDA 4M0LA 821PA 3CW2A 1ZUHA 1Q1QA 1PJRA 2RCNA 1XF9A 4JLPA 1AIPA 4LOAA 1RC8A 2JLUA 1UKZA 2NQ2C 2XX3A 1E9BA 1OF1A 5C1BA 2ONKA 4IOJA 3AVXA 1SXJC 2IXEA 3HJNA 3GQBA 4Z1MD 1E2FA 2C9YA 4TLCA 4C0BA 1XMSA 2DFLA 4LYHA 2PLFA 5FUVA 1OB2A 4P4SA 4JT2A 2RB4A 4TMKA 4GOKA 2OBLA 4LHWA 4YQFA 2C8VA 4AYXA 4UNNA 4BFYA 4Z51A 1F3OA 1KGDA 4YXWD 2ZRJA 3CWZA 1T5IA 3FHOA 4IOMA 3Q8XB 4LK2A 4FWTA 1JECA 4Q9IA 3CR7A 1SGWA 3TIFA 4D4LA 2QBYA 4LDJA 1G8FA 4MITA 1P7CA 3BAFA 3BWDD 2DYKA 1XXHB 2NTYC 4AD8A 1WA5A 5CIQA 4KHZA 5ELXA 2CLDX 4Q4HA 4PAMA 4C3ZA 1NVUQ 4U00A 2NPIA 2UZ3A 1IN4A 3DM9B 1FW6A 4TT3A 4JLMA 3O47A 3L82B 3WYFA 1LB1B 2ZU6A 2WWXA 3VR1A 1SVIA 2CL6X 4NHOA 1NIPA 4PZYA 1XDBA 4V0MA 1LNZA 3KXLA 3Q7QA 2IYTA 4KFTA 3T12A 2H92A 1FP6A 2OFOA 1CULC 2Q9BA 1GKYA 1MABA 1G5PA 3P27A 2WPDA 4ESHA 2I3BA 2XZPA 5FPKA 1Z6YA 1E94E 1UKYA 3FPAA 2VPPA 1F5NA 3NKVA 5C46F 2ZS7A 4A6PA 3QEJA 4C0KA 1U94A 5B57C 2Z0MA 1X8KA 3ZGXA 3IEVA 1A1VA 4RY2A 3SYLA 2ZAOA 2JLVA 4HDCA 2QBYB 3RSLA 2QRZA 2H18A 2DPXA 1DS6A 2B92A 3W5JA 5DH9A 3ND8A 4LJ6A 2XZOA 2CHGA 2ZR0A 4I1OA 5AJYA 3GFOA 2P6RA 2CE7A 4A2PA 2C77A 3R7WA 2FDCA 4B6EA 2NG1A 2EFHB 4M9XA 3NBXX 5KSPA 2QP4A 2MMCA 2QZ4A 2B21A 1UKEA 1UPTA 3IDQA 2JAQA 3UWKA 4KVGA 4NYIQ 3WYAA 2W2TA 1XPOA 2ZRMA 1AQYA 3BJIC 4XD7A 5DI9A 1DAIA 2QM8A 5DGXA 1NN3A 2C9OA 2V8OA 1NLFA 4OHWA 2EFEB 1AS2A 4BFWA 2JJ1A 4RZ3A 3UG6A 1GNRA 3EAQA 4DLZA 5FFMA 4WOPA 1NJGA 1QHYA 2G3YA 3KTAB 2ZIAA 4BLOA 2J7PA 5FPSA 1G8YA 3REFA 4R71A 3IO3A 2OV2A 2ZYUX 4GP6A 1S0UA 4B2LA 5JSZB 3PEYA 3NHAA 2WWGA 3OF5A 1Z6XA 3T5DA 1LW7A 1G3QA 2O0KA 1GKUB 4C2UA 3EPJA 4Q1BA 2G1KA 4TQ9A 3IQWA 4JVSB 4OI2A 3QUSA 3PUZA 4AG6A 3GLHB 1GKIA 4B3BA 5GVSA 3TUZC 4LHVA 3CF0A 3U3KA 4ON9A 1G17A 3QSYA 2AK3A 1H8ED 4GNKA 3THOA 4ARZB 4B74A 4ZDIA 3U3JA 1Q1BA 5AJVB 4K46A 1TF2A 4V0ME 2XSZA 3I32A 4JBYA 1E96A 1S1MA 3T5GA 4YDSA 4EPTA 2GCNA 5EE1A 5AUOB 1EFUA 3TUJC 2GZAA 2N46A 3H86A 4TMXA 1KY2A 1MR3F 2X8AA 3CUEF 2ZYTX 4Q47A 4Q48A 1N6OA 2GDJA 3ZS9A 1G3RA 5KNDA 2GJKA 5FPTA 3JVVA 3NXSA 5KNBA 5E7JA 4URWR 2O8EA 2QROA 4NPHA 4UXHA 1ZW6A 2F55A 1D2NA 1E79D 1V43A 1IXRC 1Q3HA 2ODEA 3CNNA 5CB8A 3U60B 2ZYWX 1XZQA 1G6HA 1WE2A 4B2IA 2WKQA 4XSHA 2FG5A 3A37A 3GLGA 1FMLA 3WP0A 3OEHD 2OO7A 3VHLB 2A78A 3WMEA 3WRXC 5M04A 1JPJA 1NVVR 3QXSA 4C0SA 3DKPA 4IXMA 3I62A 4OJKA 3SBDA 5JZVA 1WF3A 2FA9A 1E9SA 4B3FX 5KSOA 2VIIA 4J0QA 5FUXA 3W34A 1II8B 1YZLA 2J7KA 2QRNA 2VHQA 5KSYA 4IVRA 2QAJA 2CL7X 1Z5ZA 2GXSA 3K0FB 3PUXA 4DT1B 4P4SB 2NO1A 4MRRA 1Z22A 3DMNA 3AGQA 4FMDF 1GFIA 4KFUA 4CEJB 1P9NA 1OIXA 5G41A 4EDHA 4D0GA 2NOAA 4EFLA 3SFZA 2PEZA 2ZQ5A 4QJ3A 4EJSA 2CNWD 1W2GA 3QF4B 4A2WA 4UNRA 5FR1A 3SOPA 3PUYA 4ZCLA 3OEEA 1KI7A 4Y0AA 2Z4SA 4BLPA 1FUKA 3T35A 2RGNC 1VIAA 2YZ2A 3AKEA 4C0AC 3TGPA 5JJLA 1KTVA 1PLLA 3W5IA 1EWRA 4GBMA 3VKGA 4A0RA 2AL7A 1BO6A 1CP2A 1XXHA 2O52A 2YWHA 1TUIA 1S4QA 4HDQB 4JL8A 1XMIA 4DIDA 4EPXA 4ZKEA 1AZTA 3HR7A 3A1SA 1EX7A 2ZRIA 4DDTA 3KQNA 2FFBA 2PJRA 4AI6A 2VP5A 1FZQA 3GCGA 1T6NA 3TE6A 1XMJA 1L2TA 1FTSA 2VSXA 1M34E 1AGRA 4CRWB 5L3VA 1EESA 1VG1A 1P4SA 3LH5A 1KZ7B 2QAGC 2VLIA 2XTZA 3BC1A 1ZBDA 2V7QA 2VO1A 3DHWC 5F3WB 2W0SA 3PFIA 1ZC4A 4A0FA 2V55B 3RS7A 1OFHA 2F43A 4II7A 1U90A 4BEJA 1NKTA 3NBYC 4EPRA 4V0OA 2YYZA 2ODBA 2R6FA 4M1SA 2GESA 4TL8A 2GAOA 4RZ2A 4OJQA 3V4RA 1H8HA 1P2VA 1CU1A 3LLUA 2FWRA 2QM7A 2QMHA 4TLBA 4DB4A 4LJ7A 2IUSA 2VHCA 4HLCA 3S1AA 3FHCB 2CLSA 1QBKC 3LVRE 1OXVA 4BRWA 2XSZD 3GLHE 3DOFA 4A0HA 3NIBA 5BN3A 1WRBA 3GLIE 2CCKA 3A1VA 4ZDKA 5B58C 1MOZA 2YWGA 3BERA 3ICEA 2FPKA 4NCIA 5F9HA 2PEYA 3G0HA 1TF7A 5KDDA 3GJ0A 1EFHA 1KHTA 521PA 2AWOA 2DWOA 3TQFA 1U8ZA 2MMGA 4PO9A 1OH8A 5JSZA 1NN1A 3ADCA 3LX8A 1N2CE 3SR0A 3CO5A 1CJUC 1EG7A 2EYQA 4IW3B 1MO3A 2R6AA 3KJHA 4M4SA 2V4ZA 4E22A 5KOYA 1D2EA 1K5DA 1CR4A 3IUYA 1X8JA 2W00A 2J0VA 2ZM5A 2OSBA 1DAHA 4DLTA 3D7MA 2IYVA 1KI2A 2EYUA 4G3XA 2MSEB 3IKJA 4QFMA 4K81B 1IONA 4LV8B 2ZSEA 1CRPA 2BKUA 1XCMA 2NZ8A 2XAUA 4MGKR 3RRNA 2WTUA 1GDDA 3K09C 2ZANA 2JATA 4BWYA 2CK3D 5SZJA 3VAAA 4TL7A 4IFBA 1AKYA 5HZKA 4Q03A 5DYIA 2NO6A 2DCUA 2JLRA 4D0NA 3EZ7A 5FBRB 5B30A 3HU1A 1GP2A 2WZQA 1CR1A 2OG2A 5HKKD 2D06A 2EQBA 4GI7A 3CNLA 3WNBA 3GLFA 3LVQE 3AVOA 2YWEA 2ZRGA 5IHPA 4IRUB 1RVDA 2ZJBA 3JVUA 3AVPA 4HAWA 2GXQA 1BS1A 1CJTC 4M2LA 1S9HA 2JIZD 3PUWA 4PZLA 4OI1A 1E1RD 1P60A 1MO6A 3ETLA 2ZJ8A 4ZI3A 2ZE8A 4FCWA 1KK0A 4Q7KA 5JWOA 1GM5A 1OXXK 1CLUA 1SKQA 2RGDA 5CDFA 2HV8A 4LY6A 3I1FA 1CS4C 4X8OA 2FSFA 1G9XA 3MMPA 4EPWA 4WZ6A 4MUBA 1ZD1A 3TAUA 4GP7A 1P9WA 1PLJA 1R8QA 4OBEA 5JJIA 4DRZA 1L4UA 4BPBA 3CR8A 3KTAA 2G1JA 3AF2A 1K8RA 5GVRA 3HU2A 2CE2X 4PQYA 3X1YA 2BV3A 2IUTA 3SN6A 4XVUA 4DLVA 3VR6A 5L3QB 5A4JA 3TVTA 1KMQA 1ZMXA 5CM9C 4WXRA 1AJEA 1KI8A 4GSYA 5FTKA 1M74A 1HT2E 2DBYA 4PXAA 4HUQB 2F1IA 1Z6GA 5K8TA 4DWJA 2ZSAA 4JLAA 2A5DA 3QXCA 3KQUA 1YR8A 2Q3FA 2R62A 2VBCA 4UNSA 3EA5A 1KOFA 1DELA 1G4UR 3SJAA 1M7GA 3NBZC 2BBWA 1X1RA 3O8BA 2FPMA 3CPEA 3FKSA 1ZINA 1E1RA 1QG2A 2WBLC 3LAWA 2NO9A 1VG8A 1G20E 2QSZA 721PA 2JLQA 2O8BA 2A5YB 1GRQA 2VQSA 1KI1A 1KO7A 5P21A 1HH4A 3C15C 4TSFD 1CF4A 1ZM4A 3Q9LA 2QTFA 2MSCB 2ZRLA 1XD2B 1LS6A 2J45A 4KYIB 4OHVA 5SZKB 4XWKA 5KNCA 1R0XA 3A1WA 3LQRA 2H8KA 1WB9A 1FTNA 2IC5A 2QGZA 3UANA 1AA9A 1H65A 4GMXA 3AUXA 1QRAA 1UBEA 1Q12A 1E98A 3DOEA 1OIVA 3DVLA 4HAXA 2O8EB 2BMDA 3FDIA 1E0SA 1L8QA 1KDPA 4FN5A 4RFSA 2W2XA 3QPWA 2GETA 1MO5A 2WJVA 4CGZA 2REXB 2JEOA 4HLQB 1OIWA 4S35A 5KU1A 4AK9A 1GNQA 4RCZA 1D8TA 4CEHB 2GAAA 1QHHB 3EASA 4D26A 3B2EA 3SZRA 1HT1E 2H5EA 1J70A 4GRAA 1N5LA 1ZIOA 2G6BA 1Q1ZA 4IFEA 4Q4HB 3K0AA 4IEIA 1ELOA 1AM4D 1RJ9A 5FUYA 3IBYA 4A8JC 4XWAA 3I92A 2H7VA 4US0R 2Q3HA 5AUNB 3BOSA 3WYGA 2Z5FA 4TQUS 1S8FA 4XWOA 4EIWA 1P3JA 3SFVA 1XJ0A 2ZRHA 2WMOB 5FPYA 4FD2A 2LWIA 1TUEA 3PENA 3VNUA 2IS6A 3R9IA 1M6NA 2V9PA 3TSZA 1U9IA 3QG1A 4MKGA 2E87A 4GMDA 4C0JA 2VF8A 4GT1A 1S1CA 2OXCA 1KDOA 1G6OA 2SHKA 3H84A 2DR3A 2QI9C 2YOHA 3Q5DA 4B33A 2QPTA 1ZM2A 1NIJA 4FCTA 1J8YF 2MSDB 3OEHA 4UXJA 3EX7C 2ZVQX 2PZFA 4KLZA 1T5LA 4MRSA 2GXAA 1MV5A 2F7SA 3IHLA 3KUDA 4PFSA 5J47A 4G5QA 3OZXA 4JL5A 3VX4A 1S9DA 3C5HA 4MGIR 3QKUA 4YDHB 1XRJA 2JGNA 4D4MA 3I5XA 1XEXA 1XZPA 1XTSA 1W4BA 1W49A 2HDNB 4KI0A 1GL6A 2YHSA 2BBOA 1E9AA 3GLGE 5JJKA 3VR3A 5CYOA 1DEKA 3FVQA 3EIEA 1DE0A 3UPUA 5JEDA 1IN5A 1CTQA 3JZMA 1SXJA 2PMDA 4GZLA 4QHTA 1W46A 3U5ZB 5KYKA 4DLRA 3H0KA 3GJ5A 1IAQA 2RGCA 1T8UA 3A1TA 4AY2A 1XTKA 2VRWA 2A5GA 1N6HA 2PL3A 5SZHB 3HWSA 4HB2A 4KBFA 2CJWB 2OLJA 4TTPA 1SULA 5EUMA 1E2NA 1ZC3A 4JJZA 4M21A 1RKBA 4ZCMA 3I8XA 4AYTA 2IF0A 2LKCA 2FFHA 1MT0A 4EJSB 1XJQA 3CKLA 4ABYA 4PSKA 4WVFA 5BW8A 2KB0A 4EPVA 5KHOC 1T91A 2IXGA 2O5VA 3KDSE 4I1VA 2GF9A 3LX5A 4OHZA 3FMPB 5DLQC 3K0FA 3WHLA 3A6PC 2P5SA 4DEYA 3BBPA 4CYMA 4YMVA 2D7DA 3PEWA 4JBWA 1Z2AA 2FF7A 4LV6A 1GRNA 4Q4JA 1QVRA 3HYTA 1HQYE 3QKSB 2C96A 2QN6A 3OIWA 3QG5A 3DKVA 2ZI6A 1TNDA 4PC6A 3ASZA 4BUJA 3LQQA 4HAZA 4O2LA 2OEPA 2OM2A 3LY5A 1JR3E 4OK6A 3PCRB 5JFGA 4BLRA 1ZCBA 4MQBA 5JCZA 2PT7A 3HYRA 3CPHA 5DHFA 1OB5A 2IA5A 4V0NA 4ZCIA 3PITA 5HKKA 2Q9AA 1O87A 3CRQA 3TVDA 2OE2A 5A0FA 1QHNA 4QGGA 3LBNA 5KPDA 2YKGA 4PHGA 3J81k 5JRJA 2RGAA 1TAGA 4OK5A 4A6XA 4F93B 1RYHA 5BWMA 5L3SB 3ECCA 3IGFA 2J7PD 3I3SR 2AK2A 4HEJA 5DYGA 5UKDA 3ZIAA 3FHTA 5DN6D 2FSHA 1YZQA 5KUTA 5E4FA 2ERXA 3V4FA 2GRJA 1E2HA 2QQ0A 2AKAB 2J0SA 3RDPA 1OFTA 5EE0A 4B3DA 1G8HA 4PPQA 1E2DA 1KZGB 2QSYA 1F2TA 1FFHA 2RGBA 3PJRA 4M53A 3LBHA 1E4VA 4P0TA 3K9GA 4QGFA 2KJQA 4KAXA 4AC9A 3H1TA 4G5OA 1P9RA 1XCGB 2EFDB 3IHWA 4HZIA 3K70B 1KMHB 5JI3E 5D3MB 3SQXA 2F1HA 1CJMA 3NC0C 4D0LB 2B7BA 1YRBA 2QMUA 2FZLA 1SXJD 221PA 3LXXA 5GJBA 2GKSA 1UDWA 3WY9A 1JEEA 1EX6A 3CRVA 4D2IA 4B43A 2ANBA 4GFDA 4QOSA 4P32A 2JA1A 4F7WA 4O0MA 4Q1AA 5AWFC 2I4IA 2RGGA 3RS2A 2CNWA 4C4PA 5LD2B 5JEEA 1WXQA 2QE7A 3MGCA 1CJKC 1E2JA 1G19A 1JR3D 2EWVA 3A4NA 2V6IA 1KSHA 1XNJA 2F9LA 2JCSA 2B8TA 3GLHA 2G83A 3C16C 4I99A 4NU0A 1ZNWA 2ZRNA 3EWAA 3PEVA 3ZVLA 3QBTA 2GEUA 2ZTSA 2JIZA 3SJCA 5KPJA 4MDEA 1DAEA 1E9EA 3W6OA 1E99A 4POAA 5TV2A 1WDTA 1COWD 4TL6A 3WRYC 2BWJA 1E4YA 2WMNB 1T3LA 1XD2A 1I2DA 3GLFB 2RKOA 3QKTA 5G3YA 2BM1A 4QM6A 1LY1A 1EK0A 4DUGA 2FZ4A 4RSGA 2GBLA 3K8YA 1CEEA 4TLEA 2QAGB 3C8UA 4M9ZA 4W9MC 3SJBA 4NYJR 4XTRA 1G7RA 3I72A 4Q1DA 2QTVB 4NYIR 3NH9A 4LJ9A 1OFIA 4BGDA 3RLFA 2PMKA 1J90A 3FMIA 3BK7A 4EKDA 2QQEA 3R9XA 4YLGA 5TARA 3BS4A 1VDZA 1Z0KA 5G40A 4RD4A 4OQNA 1JBKA 3CZQA 3NBFA 1YZNA 1UBCA 2OAP1 3QF7A 1G16A 3BH0A 3F0TA 1FQKA 1AZSC 1GOTA 2HJGA 1YJ5A 1N25A 1NVXQ 3B1YA 3M1IA 4IDQA 2QU8A 5L3QA 2W6IA 3PV0A 1U99A 2BMFA 4MKFA 5KSZA 1RJ9B 4W5WA 3KJIA 3OE7A 1G21E 5AJWA 3KB1A 4LC1A 1D9ZA 5C4GB 1FPMA 2R9VA 1AQUA 1NL3A 2L0XA 4M8NE 1E79A 4DLXA 4DLWA 3QOFA 1AS3A 5KTYA 2PJZA 1SKYB 1NI3A 4RFVA 1TMKA 2XITA 4JSYA 5FBLB 3ND9A 4QJ5A 1QHXA 1W44A 2CXXA 3E1SA 1FP7A 2VSOA 1TADA 4LI0A 4R7ZA 1OXUA 4URVR 4P31A 4TYWA 1IOZA 3EIHA 4YMUA 3EZ6A 1E1QA 2WPDD 1SXJE 5GJVC 1CR0A 2ZSBA 4YXWA 4W7SA 5BYKA 5K8LA 2QE7D 3HPRA 1KI6A 2FFAA 3VQTA 5EXTA 2FU5C 2QT0A 1GIAA 4B35A 3CIOA 2ERYA 3ZZTA 3P1JA 1O3YA 1E2LA 4BZQA 4BE7B 4ZIRB 2ZREA 3AV0B 3KZ1E 2Z43A 2GEVA 1US8A 2PH1A 2F3RA 1FX0B 4DCUA 1ZU4A 2N42A 2Q3MA 3MLEA 1L7VC 3R8CA 2CL0X 4NCJA 4URUR 3EC2A 2J41A 2ZI5A 1QF9A 4DLYA 1ANKA 1YQTA 3SI7A 5EP4A 1OH6A 5SZIA 3ICQB 1NLZA 2CVFA 2GNOA 1LF0A 2QPOA 2J9RA 4JVLA 3KQKA 3KKQA 3TBKA 4DCSA 1W2HA 4BRUA 4C0QC 1C1YA 1HQCA 2XNDD 2QEQA 3NVAA 3QNUA 4Q7MB 2ZRBA 3SYNA 1XXHE 5FI0B 5J40A 2WJYA 2C78A 4CDGA 2WIAA 2RHDA 4A36A 2KWIA 3RRYA 4DCTA 4MYHA 3KJEA 1E0JA 4LPKA 2GVDC 4IJMA 3B85A 4DZZA 3M0EA 4GL2A 2BC9A 4V0LA 1E3MA 3TR5A 1EFRD 1EFTA 4L8GA 4Q4JB 4DCVA 4FW9A 2GJ8A 4WW0A 1VG9B 1KI3A 3VMFA 3IPXA 4PHFA 5C2JB 4LCBA 5CJ2A 2R8RA 2P6UA 3W8NA 2ZETA 4ITRC 2IK8A 3QXHA 1NG1A 2R65A 5EP1A 1R5OA 3A36A 1KO4A 1MRNA 5D3MA 3VU9A 3BORA 4M1YA 1A2KC 5BN5A 1XD9A 2ZUCA 2IYSA 3CPJB 1W0KD 2QL6A 2AD1A 1KO1A 2EFGA 3LV8A 5JECA 1IXSB 2FX3A 1N0WA 4HZUB 4KFRA 3CRMA 3C4JA 3HPQA 4KSCA 4TYQA 4JKYA 5ANRB 4DHEA 3QE0A 4B3GA 3U6KA 2PT5A 3TR0A 2DWPA 1HUQA 4GOJA 1SVWA 2ZR9A 4Q5IA 2ANCA 4PANA 4BFTA 1IY1A 1BYIA 4NYJQ 1CJVC 1QHIA 1VG0B 1VYTA 2F43B 3I61A 3LWNA 4N1AA 5EXSA 2YWFA 1R8SA 3GEEA 2Z4RA 4KLNA 3VR2A 4DCNA 2IYWA 1N6KA 3TSOA 5LBIA 4LBZA 3P32A 4H1VA 1W1WA 3FMFA 1BH2A 1KDRA 3BB3A 3IIJA 4L4UA 3B78A 4AWXA 4PZZA 3Q5EA 5HPYB 1ZP6A 1KNXA 5CLLA 1PVOA 1Z0AA 5LB4A 5EZ5A 4Q4AA 5CITA 3B9QA 2VHTA 2FOLA 3DMDA 3MG9A 4RD2A 5JS7A 1FOEB 4OI4A 4PC3A 1N6NA 3QKRB 5FL7A 3THWA 1IY0A 1Z29A 1E2PA 3GFTA 3ZJYA 2ZROA 2W58A 3RABA 3LRPA 3MSXA 2YC2C 4UNPA 3U3MA 4JLKA 4HYYA 2BJWA 4Q7JB 3SE0A 4QM7A 5TVKA 4RJLA 2PCLA 4QBFA 1KKMA 4YMTA 2UZIR 3KUCA 4TT3D 2GWHA 3FFBA 1SVKA 1D9XA 5HR5A 1NJFA 2Q21A 1G41A 2GILA 2W6JD 5JMTA 2VA8A 3RC8A 1LS1A 5K8IA 3KJGA 3P4YA 2WIBA 4FINA 1WP9A 2AWNA 5EP2A 2WJJA 3L0PA 3SJZA 1ZU5A 1Q44A 1JAHA 5L3RA 4C7OA 4QC2A 2C98A 3GJ8A 4TTQA 3U4QA 2REBA 1SQ5A 1E2QA 5J4HA 2BCJQ 3U61B 4XVQA 3U44B 2QP9X 1UFQA 4LC0A 4Q4LA 3LXRA 3KQLA 4JZKA 2IYUA 1IXZA 3AP2A 2CCJA 4BLQA 1OT3A 2DFKB 3FYHA 1U0HC 3PUVA 4A15A 2ONJA 1AKEA 3MWYW 5FOVA 2EFCB 4A1FA 2IYQA 3EWSA 2IYRA 2BEJA 3CH4B 1T9HA 3K0EA 4HAYA 1IN6A 4PO8A 2CMKA 5H68A 4IOLA 3RAPR 4ZI2A 2OCYC 4DVGA 2IYLD 1N0UA 3LW8A 2X1VA 2JJ2A 1DO0A 1TEXA 1L4YA 1EFCA 1RRPA 1KO8A 1YRAA 4Z54A 4MRNA 1XD8A 4HB3A 2ZXUA 2FEMA 3B9PA 4OQFA 5GADl 4F38A 3TJZA 2OZEA 2LCFA 1YKSA 2IF2A 1OW3B 2YV5A 2AXNA 2FE4A 5AR1A 2D74A 1ONBA 2AFHE 2VP9A 1OH5A 4M1WA 2CCGA 4IDOA 2WWWA 1KSGA 4L15A 3U3OA 3I4LA 2N1BA 1JQLB 1Q3TA 2O0JA 3NDPA 4D25A 4P3YA 5DSZA 1KMHA 2WM9B 421PA 1T8TA 1UKVY 1VYVA 4TSFA 4BECA 1BYUA 2BM0A 3C5CA 4M1KA 4WIAA 4LGMA 4NBSA 4JJKA 3RHFA 1R0WA 5CYPA 1R0ZA 2JDIA 3RVBA 3THXA 2FEOA 2ZAMA 3BIFA 1Q1EA 1JB1A 1G1MA 1UF9A 3FMOB 4IXNA 2XJ9A 2KE5A 4PO1A 3N2IA 3CLVA 4U5XA 3SHFA 1VIYA 2WICA 2IX3A 1VKJA 1KI9A 4HLUC 3VX3A 2IHYA 5JHHB 1Z8FA 4G5SA 4E03A 4GOXA 1WQ1R 1OHHD 4LV5B 5TB5A 4O3MA 2GBLC 3B13B 4ASUA 1DADA 2P5TB 1S96A 3Q7PA 2O8DA 1E1QD 1R4AA 1W47A 3FWYA 4NONA 3GEHA 4DKXA 4F4CA 4AKIA 3O8CA 2BBTA 5CB6A 2IHBA 4DXAA 3PG5A 4GDFA 2C03A 5D3QA 2ZR7A 2R6GA 2HCBA 3K09A 1XEFA 1KNQA 2XTNA 5G3ZA 3TW4A 3K70D 1VMAA 1TPZA 3AF1A 5TDHA 1FMJA 2BMEA 2OBNA 2ZRCA 1G3IA 1JR6A 1GTVA 1IJFA 4ARZA 3B1XA 4M9SA 2NZJA 3K53A 2H16A 3DZ8A 4LHZA 3PVSA 3AKYA 5LDDC 1P62B 1ZCAA 3K1JA 1MABB 3A8TA 1G64A 4JYBA 4Q1EA 2WSSA 1N5KA 2A30A 2JJ1D 2R6DA 1NY5A 5DE3A 2OFWA 3R7WB 3R8FA 3OAAA 1KIMA 2JJ2D 4Q7LA 2IW3A 4NTZA 3AF0A 3OESA 2AR7A 1NLYA 1KAOA 2RGXA 3BB4A 4C2TA 3TLXA 5CIWA 1MH1A 1X8LA 3P20A 2X2FA 2EW1A 2HUPA 1XCPA 2XNSA 4JLBA 4PAQA 621PA 1WCV1 4KV9A 1ZD8A 3PQCA 1SVOA 1JAIA 1LV7A 5C18A 4HATA 4EFNA 2ZS9A 4URXR 4EFMA 4K8OA 4KODA 3ZLJA 5J4LA 3GMTA 2KBFA 2IS2A 1E2MA 4UXIA 1P72A 1Q57A 1Y3AA 4QXAA 3L0SA 1LTQA 5IK2A 1DVRA 3W6PA 1NMYA 2HCJB 1Q0UA 1W36D 4TQAA 4WAUA 2FNAA 3A58B 4A8JA 2BCGY 2Q9CA 1A5TA 5F9FA 3GJ3A 1Z0JA 1SVMA 4CF7A 1UEIA 3GJ7A 3FKSD 3UMSA 4JLDA 1Z6AA 5TXGA 2AX4A 2QPAA 2Q0HA 2FJUA 4LUCA 5J4KA 2G77B 4LYJA 2P6NA 3RNLA 3KFXA 4JLNA 4ACAA 3L43A 4HUQA 4LX0A 1HEIA 2JASA 2W0MA 1ODFA 1JEDA 1VTKA 1R6BX 5AUQA 2OBMA 3EARA 2XB2A 3QEOA 4DSTA 1H8HD 1UM8A 1P75A 3AVQA 2ZJZA 4L9WA 2NIPA 1W4RA 1OKKA 8OHMA 3B5JA 1F48A 1TQ4A 2ASEA 1BMFD 4JLJA 2GF0A 4P4UA 1OJLA 3GJXC 2DWQA 1JXMA 2V7QD 3ZYCA 3SEAA 1XJCA 2BIFA 2GXUA 3BFVA 4IVQA 4FI3C 4F4IA 2ORWA 4CEHA 1KJWA 3FGNA 1CXZA 3THYB 3GLIA 5L3SA 2YINC 2IS4A 4RD3A 1ZRHA 2FH5B 3CB4A 3CM0A 4PQFA 1Y63A 2WJHA 5EUQB 4C7OB 2FSIA 3TKLA 4ASUD 1W5SA 1DG1G 5H1YA 4AIIA 4CEJA 1ZNYA 4P33A 1YHNA 1NP6A 1J2JA 3N70A 1N6RA 5JHGB 3KKPA 3UIEA 3BXZA 2TMKA 4C9BA 3F3YA 5BN4A 2ZPTX 4JT4A 1RW4A 1Q20A 2D2FA 5DN6A 3EW9A 4W5JA 1G3MA 2VP2A 4TWZA 1ZYUA 2RGEA 2KSQA 5FTLA 1E9CA 2VP4A 1D6JA 4NYMR 4OL0A 3KKNA 2ZSFA 3UK6A 2G9NA 4JYCA 5EE5B 2ZSDA 4UKDA 4WXPA 1JXOA 2OUKA 1NMXA 5IF9A 1JPNA 3O8DA 3BH7A 2J0QA 3RYTC 3Q3JB 2VEDA 3QI2A 1TL7C 1FL9A 1MRSA 4DJTA 2DB3A 1U98A 1X3SA 4B71A 1NNEA 1KAGA 1KJZA 1G7CA 5EE9A 3QPUA 3D3QA 1JNYA 2EVWX 3PIRA 4URYR 4TZ0A 2OT3B 1ZJ6A 2CEAA 5FBWB 3T1QA 2GVZC 4B75A 1LFDB 2OFXA 1NKSA 5E7IA 4MGYR 4TYPA 4XJXA 1KJYA 3MFYA 4LBYA 4TLDA 5C4MA 1TQ2A 1XU4A 4R2HA 3TNFA 4DLUA 4KU4A 2GZDA 3C41J 4PSAA 1E9FA 2JJ8A 1IHUA 3B60A 3L0OA 5K8UA 4KYUA 3AVYA 4FMBB 4NZYA 1ESNA 3SS8A 4KSBA 5JI2E 1XBTA 2WWIA 2VP6A 1Q22A 4OK3A 3WNDA 4BLSA 4HDOB 1F2UA 4OQXA 5JBQA 1I4DD 2NPFA 4ZPXA 1RZ3A 2QUZA 4U02A 4LJ5A 1OE0A 1DTSA 2KBEA 4Q21A 4BFUA 2WOJA 4XD7D 5LD2C 1MKYA 4TMTA 1KK1A 3IBGA 1YR9A 3TQCA 4DT1A 1BOFA 3N5CA 3IIKA 1R7RA 3MD0A 2PCJA 3AEZA 5J4YA 4MH0R 4N3NA 1W0JD 1RPZA 3LA6A 1Z6TA 4TN1A 4LJ8A 2F1JA 1T3HA 4RZXA 3K70C 2ZE5A 5L8VA 3TMKA 1US8B 2QG6A 3T61A 4LYAA 4A0GA 3E2IA 4YONB 1RIFA 5FTMA 1P2SA 2J87A 3N2EA 3PEUA 1SZPA 1S3GA 1K6MA 4IDPA 4KJZA 4XIGS 1SHKA 3AVVA 4KXFB 2HYIC 5CK5A 3SYKA 4OI0A 2VF7A 4RZUA 2ORVA 4RCYA 1KDTA 4KITB 1ZNXA 3AVTA 4YC7A 1G3UA 1TU3A 4LJ4A 1XTJA 2UKDA 5FL3A 1U0JA 4M22A 1WMSA 4N0DA 2PLRA 3L2OB 4ACBA 3OFND 1M8PA 3ZIAD 4E09A 1W5TA 1WBBA 3T34A 3QKRA 4ZDWA 1W7AA 2GCOA 3FTQA 4JBXA 3WXMA 2QY9A 4OQLA 1ZM7A 3RS0A 4JIMA 1KY3A 4M1TA 1PZNA 3QJYA 4HUTA 2BOVA 4Q66C 2ORIA 3EIQA 1TEVA 1W48A 3MAAC 4TZ6A 3HU3A 1NVWQ 4DSOA 3MWJA 4YMWA 5J5CA 4PPNA 4AKHA 2RGNA 2EWWA 2WSSD 1W4CA 2UVQA 2A5FA 2QORA 2BDTA 3CZPA 3GD7A 4JLOA 3ADBA 1CIPA 4NL4H 3MWKA 2GZHA 2V1XA 4MA4A 4Q9LA 1XPRA 3KXIA 1TQ6A 2RH5A 1PUIA 1ZUIA 1HURA 1CR2A 2D62A 2XEXA 5EP3A 5FTJA 1U9IC 3M4YA 3W90A 2DHRA 3GLIB 4KFSA 1G7TA 2WJIA 2QAGA 4Z8YA 4BFZA 4FCVA 3TUIC 2G0NA 2VHJA 3ZVNA 1NVVQ 1PUJA 5J4VA 3X1DA 1OXSC 2H1LA 1XPUA 4CT4B 2LKDA 4OKSA 3B1VA 2NMVA 3T15A 1Z2CA 2GA8A 1HE1C 3U6BA 1R5NA 1W4AA 4RVCA 3IEUA 1C9KA 4MYTA 3RRMA 4H9GA 1AS0A 1KK2A 3AGPA 4IHQA 4B2PA 4HAUA 1EFRA 1G7SA 2ZJ2A 4PR0A 2Q6TA 3RANA 3TH5A 1I4LD 5JWHA 3RC3A 5CJPA 3UKDA 1RE0A 4AG5A 4HB4A 4D4JA 1QHSA 1E69A 3NG1A 1XX6A 5HCIA 3THYA 4DUGD 3VR4A 5FOTA 2PX3A 4XH9B 2HF8A 3X1XA 2AXPA 1CKEA 1N6LA 5IRCD 2K5UA 4ILEA 4DB2A 5AUPB 3W3AA 4NP6A 1A82A 4Q1FA 3AB3A 1QHGA 3U3RA 3EG5A 4CW7A 1XTRA 5FOUA 4MUAA 1YZTA 2OCBA 3BGWA 4DSUA 3ADDA 4LBWA 1KI6B 4MGZR 4QL3A 4UNQA 1IJEA 4C30A 2Y8EA 4IDHA 5BQ5A 2GK7A 4A92A 3WP1B 1ZNZA 2IUUA 4RFSB 3T06B 1UBFA 1P6XA 2ZJ5A 3KX2A 4QGHA 1IQPA 3SHWA 3EZ2A 2GK6A 3OEED 4Q01A 1KSFX 1DAGA 2V54A 4D82A 1J7KA 2WAYA 2OCAA 2W6JA 5KO2A 1YZUA 2J0UB 2QA5A 2W6ID 1HY3A 3HR8A 1BMFA 4LHYA 4G5RA 1X86B 1NMZA 2OXRA 3KQHA 2OESA 2REOA 4KCGA 4BFVA 1YZKA 4OHYA 2RHMA 2PBRA 4EJSC 3MJRA 3EPHA 2P3SA 3OIVA 4A8JB 1Z06A 2ZJOA 5FOXA 3RWMB 4F91B 1T0HB 2XZLA 1GG2A 3DDCA 3LBIA 3V9PA 3ZZ0A 4B76A 2H57A 4G5GA 2V3CC 4I1SA 4US2R 3GLFE 3IPYA 4JL6A 4BFXA 3CONA 4I4LA 3L8YA 1E2IA 5FOSA 4F4JA 2ZRKA 1HE8B 2C9CA 5EQTA 1LF5A 121PA 2X2EA 1H8EA 1S3SA 5KDLA 3H4MA 5JWRA 2CHVA 3OE7D 1J99A 1F60A 2ODNA 3ZD7A 3GLGB 2IYYA 1E6CA 1PLKA 3NHBA 2J0UA 3UXMA 3QY0A 2NO0A 2FFQA 4MYUA 1TQDA 3NEYA 1G18A 2AHOA 4LHXA 3G82C 2W2VA 1J8MF 3QBVA 3WHKA 2B7CA 2RAPA 3U7HB 4QBHA 5DIFA 4DLSA 1NBMD 2CDNA 1Z0IA 3VR5A 3AH8A 1E9RA 2XB4A 3K0CC 1ZM9A 5DO9A 5LB2A 3PR1A 4FMCF 5HCNA 1ZAKA 3LO5A 2IEYA 3P26A 1DG3A 2CHQA 2IL1A 1HYQA 2IYXA 3JZAA 2ATVA 2FGJA 4LZZA 4PSVA 4HLUA 3BB1A 3ADKA 1FNNA 1I2MA 1OHHA 1FX0A 3DM5A 2JLZA 2OCPA 2YC4C 2ZI7A 3K0AB 5FR2A 5FTNA 1A2BA 3ZVMA 1NSTA 1EGAA 1ESMA 4MYCA 5GJWC 3SC3A 1VCMA 4B44A 2FMXA 4MRVA 1R10A 2ZJAA 5TMPA 3VKHA 5HTKA 1GITA 4UQOA 3B8HA 2D3WA 3CF2A 4N0EA 4Q1CA 1NSFA 5CM8B 1U81A 3QXXA 4CT5A 1SXJB 2WOOA 2HXSA 1A4RA 4PC2A 2CBZA 3KKOA 3QIAA 4TL9A 1T4GA 2IEZA 3K9HA 1XB2A 2BKEA 3A1UA 3AUYA 3AKCA 4FWIB 4X8MA 3D31A 5FBQB 3AP3A 1VECA 2VL7A 1IM2A 2F3TA 3ZD6A 1E0AA 1B0UA 3UMFA 3Q72A 4QNRA 3EA0A 3BH6A 1DO2A 4PHHA 1YVDA 3TAHA 5IK2D 3KFVA 3QVVA 4L9SA 3EZ9A 3THWB 2AFIE 4AKGA 2QMEA 1Z3IX 3ZDQA 2YNMA 4TYNA 3QKSA 4V03A 5GJCA 4PAOA 3VFDA 1OYWA 2ECKA 3NWJA 4FMCB 1HA3A 4MDFA 2PZEA 3VNVA 1Z08A 4YMSA 2O8FA 1P5ZB 4Y0VA 3FE2A 5IT5A 2NGRA 4G01B 2QENA 3MUFA 3SQWA 1OSNA 2C95A 4B48A 1OYYA 1M1YE 2OLKA 4WZBE 3AQ4A 4NH0A 2ZITA 3X1WA 4QJ4A 3W9YA 3K0CA 3GJ4A 3LLMA 2A5JA 4HSEA 4IOKA 1G4AE 4MKIA 1SHZA 3RS4A 1HTWA 5EXXA 4Q19A 3EC1A 4RKFA 3IQXA 1JQJC 4Z1MA 2O0HA 3U44A 1KSJA 3VKWA 1OLOA 1VPLA 5H8WA 4GZMA 2HYDA 2E9SA 1G5TA 4JSTA 4TLAA 2WWHA 4CEIB 3ZS8A 2ZYVX 4Z8XA 4XVRA 1TF5A 3CWQA 4P4TA 2ZU0C 3RRZA 3P4XA 2C04A 4O2RA 2GEDA 4Q02A 4BZXA 1P2TA 3REGA 2ZS8A 3K0SA 3EPKA 6Q21A 4US1R 1QVAA 3CF6R 2VTKA 1KO5A 1VCNA 1KYIA 2ATXA 2ZUBA 1XTQA 4BQSA 4F92B 1Q21A 5E7MA 1DARA 4M1OA 2GJSA 2IXFA 1N6PA 3BRWD 1AK2A 2JLYA 4WBSA 1W36B 2WWYA 2NO7A 2IYZA 2WVJA 3U4QB 2VP0A 3E5HA 4QBGB 5DISB 2OILA 4MRPA 1F6BA 4B47A 1NBMA 4FIDA 4XSGA 3HP1A 3W6NA 1OXTA 2BHRA 4R9UC 3QF4A 3QQ5A 4URZR 1KI4A 2G88A 3AM1A 5BXQC 1GZSA 1UADA 2BJVA 2J46A 4TMVA 3CH5A 1XTIA 1UBGA 4BEBA 3QENA 4IEEA 3G5UA 4LRWA 1OV4A 1W36C 2BMJA 4A9AA 3D6TB 4B3XA 2HT1A 3AVUA 3LW7A 2YOFA 2IS1A 5FUWA 4E5UA 1F2TB 1P61B 3S1AB 3T1OA 2PX0A 4LJAA 4AURA 3K9LA 3CBQA 5CDFE 2JLWA 1E2GA 4MKHA 3SBEA 4RD1A 2XGJA 4C0HA 4AYWA 3AVWA 1EXMA 3OIUA 4QRHA 3DPUA 3KXKA 4RD0A 2WKRA 3WNCA 2XOKA 1R5BA 3DZDA 4V0KA 4QGAA 2ZUDA 3IIMA 1P73A 2Z83A 5FH9A 1QDEA 5LPNA 3RS3A 2C99A 4OQMA 2VSFA 2O8DB 1YE8A 3BD9A 3ZH9B 1U0LA 1IY2A 2I1QA 2VHUA 2YOGA 3QPVA 1VCIA 4XTCS 4ERNA 1VYUA 1YZGA 1YU9A 2V6JA 1FUUA 4JMPA 1DBSA 1SKYE 1XP8A 3LD9A 1N5JA 4DDWA 3F8TA 3WBKA 1BIFA 1TU4A 2HT6A 4JLVA 3A4LA 1JJVA 3DL0A 3QVUA 4IVPA 3UMRA 4IKEA 3SDZA 3THXB 2ZI4A 1D5CA 4FMDB 3EZFA 3WMGA 5AJZA 3UATA 3FKQA 2WSMA 3U7EB 3Q85A 1NY6A 2P67A 5DNYB 2XXAB 5HZHA 4LPSA 2IT1A 3UWOA 3T1VA 5EJEA 2ZVPX 4EQ6B 1UJ2A 1GNPA 3TRFA 4WZAE 2BVNA 5JRZA 2JLXA 1DPFA 4I1UA 3FB4A 2QP3A 2X77A 3E70C 3B1ZA 3MCAA 3V00A 3OHMA 1AN0A 4LJYA 3C14C 4GPTA 4UJ5A 1ZIPA 2F6RA 5G53C 1B23P 2ZRPA 2IWHA 2GCOB 4S2EA 1GUAA 1TX4B 2QT1A 2B6HA 2HF9A 3LNCA 3GPLA 3A4MA 4PPGA 1NRJB 2HLDD 2QGNA 4HZUA 4NMMA 4G1UC 1Z47A 2FSGA 2D4HA 1T3SA 5AK0A 4PC1A 1X1SA 3VHXA 1VHTA 4NYMQ 3GJ6A 3VTKA 2IWRA 2A9KA 4ZV4A 5FBVB 3OAAD 2GJ9A 2F1RA 5E95A 5JLJA 1GWNA 1BKDR 1M7HA 3FFAA 1CRQA 1A7JA 1D2MA 2JLSA 2VH5R 2WJGA 2ZE7A 4NKRA 1N0VC 1R2QA 2OHFA
chains in the Genus database with same CATH superfamily
2H52A 3LY7A 3AJAA 3GCWA 3ONDA 3L8ZA 3RIHA 1U8AA 5JARA 3RJTA 3SXJA 4LWZA 2RKWA 2QTHA 3ESDA 5HSGA 1NBEA 4A0QA 4E11A 3IUQA 1XWIA 3H16A 3UENA 4AJ4A 4AY3A 3UN1A 3TK1A 5EE3A 2JGJA 1MB3A 1YR6A 2W6ZA 4Q16A 1T9ZA 1IB0A 1N1MA 2C3PA 2A3RA 4BZWA 5AJXA 4RL6A 1R0BA 5B2ZA 1E2KA 3EMDA 4OJYA 1DAOA 3C3EA 3MNFA 5KU7A 2BGGA 2NZVG 3DFMA 3ZZUA 3EFEA 4K6FA 5C5DA 4CEIA 1KBQA 4N76A 1SCJA 1I4WA 2WB4A 1CBUA 3W5HA 1OA0A 1YBMA 2ZE6A 3GRCA 4MP3A 4R05A 3EEIA 5THXA 2E3JA 5DXJA 1I5OA 5IN5A 3AETB 5BW4A 3C4VA 3CLRC 3RUHA 5AVRA 1FEZA 3GVHA 4B6OA 2Q27A 1N9ZA 2VHEA 1DNPA 3LFTA 3VMFA 4TRMA 3ZWOA 1FDSA 1KQNA 1DO8A 2OBBA 5IJ0B 2UYHA 5HDBB 1Z38A 2IV2X 1PRYA 1RM4A 1SKAA 2FPGA 3B7GA 4BLTA 3FAZA 3JCZA 4ZIRA 1KOGA 1QFJA 1DQYA 1PR1A 5JNLA 3I9OA 4EHDA 5BNIA 4TMWA 1K08A 1VHDA 3EXG2 1QP4A 5ISMA 1XCBA 1QQ7A 3ZD8A 3D7LA 2RBGA 3G8BA 3NXKA 1ZRNA 3RUIA 4N7JA 4MW5A 1PV4A 1ZVQA 3LHIA 3E4CA 3KL4A 4UVEA 2X8JA 3G88A 2IGBA 4R0NA 3HJFA 2XKKA 1XK6A 4OF4A 4FDVA 4CKWB 1EB8A 4Y2TA 1M6VB 3UMJA 4PX9A 2ZYSA 2CVHA 3UVEA 3BDAA 1RI1A 1TZJA 2P0EA 2DQ4A 3TDKA 1WCWA 2XDQB 4UU8A 1TIPA 1UBJS 1YT5A 4QHYA 3ZWPA 5DSTA 4PYIA 1JLRA 2VWGA 3HG7A 3WGNA 3R44A 2P9GA 4JKIA 2H4YA 3CX7A 3BQNB 4KVAA 5BOSA 3NDBB 3W3ZB 4A82A 1S2MA 3ZCTA 1CP3A 1Z8DA 3IVMA 4X8LA 3H6GA 4D8WA 1ZD9A 4D41A 4CNBA 4HWRA 4NCNA 1RLOA 1E2EA 1FQJA 4OH1A 1Z83A 2P68A 4MWEA 4PPFA 5L7YA 1NI4B 4BUCA 4ZDJA 1HV8A 3HGTA 5BN5B 4DBLC 1U2EA 2DPHA 2BFCB 3PD1A 2I99A 3PIDA 1RZVA 2ECPA 4N40A 3A6LA 4RS4A 3TSWA 4X1YA 1OXKB 4INPA 1NT4A 1LK0A 2EKPA 2INGX 3AP1A 5DV9A 1Z0ZA 4B32A 4XFJA 4BNJA 3PX3A 2Z57A 5K3BA 2C07A 1S8NA 1UJ5A 1C8KA 3A1NA 3IAEA 3PKZA 1UM9B 4X1KA 4RKWA 3NX4A 3R9WA 3W5SA 1WL8A 3QLTA 4LCEA 2HFJA 5G1NA 4QHSA 1HZZA 2DHEA 3K2IA 3FBWA 5ED0A 1YRQA 2WE8A 4UVIA 4D3FA 3KVVA 1DAKA 2UXBB 2X3FA 1VJCA 3OVMA 1RXCA 4EW2A 5ITZB 3WNQA 4B44A 4GKKB 1IHOA 3S44A 3QJGA 5FNZA 3AUJB 3H5LA 2XNDA 4JX9A 3N8KA 1GEEA 3BSYA 3OIYA 4RKRA 4CWAA 1M5TA 5L4SA 4X6XA 4DQ0A 4ZD6A 3UG7A 2VPIA 3TBFA 1EXWA 1OKKD 3WWCA 1JDSA 3LBYA 1Q7GA 2X19A 2YY6A 2G7MC 2O8FB 3SSNA 3VZSA 1UIRA 2HEIA 5CCEA 4EMBA 1KJJA 1PK7A 1VL6A 3ZQ6A 5KDOA 2D7CA 2NNWB 1QMGA 3LQFA 3CZAA 4OU5A 2O5CA 2FW0A 3ELBA 2DF8A 1RYFA 4IS2A 4LX8A 1L1EA 5B3JC 1CZUA 4PS1A 1J9ZA 1J5XA 2GFIA 2VKQA 2A0KA 2I3GA 4FFMA 3MWFA 3V2HA 1D6NA 4FGUA 4CM7A 1XQWA 1IXYA 4Q4DA 1L1FA 5AVVA 1JBEA 1V11A 2AJBA 1E32A 4LBVA 3G17A 2ZJ3A 5CLQA 1ZM3A 5IC5A 1JWLA 4R83A 3T95A 4DJFC 5FD8A 3SYRA 3H2YA 2W83A 4O2AF 1E2BA 4BFSA 1DOAA 4F6CA 1JFRA 1HXHA 3ZOKA 4L5BA 5CD1A 5DB4A 1VE7A 2LZ0A 4MI1A 1PQPA 1CYDA 2ZRDA 4DABA 1CUVA 2RIPA 1RLUA 2FN4A 3ZXUB 4Q9JA 1C41A 2ZI9A 3SVLA 1M2OB 1ZLYA 4QUEA 4RETA 5AXCA 1DX4A 3BD8A 4OP2A 3WNVA 1NYTA 2AH5A 1PX2A 4A4DA 4Z2AA 3NH6A 4G0MA 4ND8B 2BHLA 5MGNA 4GHWA 4PLZA 5JS8A 5FNVF 2FP4A 3A6HA 3I53A 1CDDA 4MICA 3G9QA 4U2KA 1Z63A 3C3KA 4D74A 4GM0A 2J6HA 1SVSA 4D80A 1RRCA 5ALIA 1JVSA 1VLHA 3B3AA 1U2RA 5TRTA 3HKBA 4G65A 4JVMA 2O9JA 2TSYB 3NHYA 3GEBA 4PEVA 2Y66A 5HQ3A 2A94A 3LT5A 4OHKA 2QN9A 2C5LA 3HI4A 3PQDA 4CCYB 3NYQA 2H54A 4FGLA 4QEKA 5LQMA 3BFKA 4D81A 5LIPA 3RIEA 1BEUB 3IXQA 4CF3A 4IDNA 3CVXA 2FGKA 3G5LA 4XLTA 5JYBA 1II8A 2W7TA 2ZI3A 4HYTA 4CTJA 1ISFA 5FL7D 4UBJA 3KTFA 1NF2A 2R8XA 2DERA 3RBZA 2B8WA 1RZUA 4X61A 5ALYA 3AF4A 1E3JA 1M67A 1A8IA 1Z4KA 3FUVA 4M0PA 2GAFA 3FPLA 5ALVA 2LE0A 3BT7A 4KYVA 1W5BA 5LUAA 1UKZA 2NQ2C 2XX3A 3V6LA 3ZHUA 4C7MA 4POOA 5DTIA 3MUOA 1CY8A 4X71A 4QYTA 2OGSA 3WYNA 4LF6B 1EM8B 2H85A 3GQBA 2C9YA 4HDMB 2SBTA 2HRCA 4RE5A 2I4NA 2DFLA 2CEKA 4LYHA 1TJ4A 2PLFA 4YLEA 4ZP1A 2XNCA 4KQFA 3WV5A 2IIQA 4W5QA 2VTBB 1YKGA 4PYMA 5FWYB 2X0JA 1CE8A 2P9TA 4LHWA 1J5PA 2C8VA 1XLTA 4AYXA 1KIFA 2PR7A 3ENZA 4UNNA 1EGMB 3K1YA 4Y2QA 2ZJFA 4QT4A 4W9NC 4QNNA 3HTXA 3CWZA 1T5IA 3BHJA 2W2MA 2FW6A 3G0CA 5ALLA 3E2MA 4D4LA 4LDJA 1TE2A 3A3OA 1TYBE 4CM1A 3EZYA 2J09A 2NVUB 3A1DA 3DQZA 1Y4ZA 1WA5A 5CIQA 5DBHX 1T2EA 3WFJA 4JJ6A 4O4JA 4HLNA 4PAMA 1NVUQ 4JP5A 1MNQA 4R1OA 5ERGB 1OB5A 1ENPA 2PUWA 3BF8A 1BCSA 2XF2A 2PVSA 4TT3A 4WNCA 2P4UA 2P2SA 2JAPA 4FOPA 3WYFA 1LB1B 5JANA 2ZU6A 3VR1A 2NTVA 1SVIA 2AF3C 1XO1A 3LNTA 4PN3A 4PZYA 3JWEA 3L46A 3Q7QA 1Y8QB 1XN1A 1FP6A 1RMQA 3RHTA 2DEUA 2FMUA 1CULC 4QUDA 2Q9BA 1GKYA 3CMCO 3P27A 3LYUA 1FYEA 1K2VN 5B1DA 3RFXA 3WLEA 5KTKA 1VE1A 4IV8A 5CGZA 5BRJA 3SWWA 2XZPA 5FPKA 3AEXA 4ZCPA 3BTVA 4UM9D 4ARIA 1STOA 1E94E 3FPAA 2J9YB 2VPPA 5F7OA 3SC6A 3Q3IA 1CNFA 1ZHHA 2WRZA 1UXJA 4P5EA 3QEJA 2P30A 3GMDA 3RVOA 3N07A 1O8BA 2AMVA 1U94A 4CL8A 1XHEA 5IKXA 3GLUA 5U9CA 2D5AA 2I6SA 5AT1A 3IEVA 4Q15A 3SYLA 3N9IA 2FJ0A 4NBVA 4PG5A 2X5OA 2JLVA 2WINI 3EOZA 3TVYA 1X0XA 2H18A 2NQ8A 3B6ZA 3CEPB 2DPXA 3SEZA 3Q10A 4NOMA 5EPUA 5DH9A 2BZ0A 3N2GA 1K6EA 2BFBA 2HAEA 2R6JA 2R8PA 4MV0A 4YWJA 3L01A 4DMGA 3NUGA 1FDRA 2C77A 5JSFA 2NG1A 4IUCS 3N6RA 5EEHA 3UUFA 1MC4A 4IIFA 4PBRA 1GNLA 5IYZF 4JGGA 1K68A 2X8JB 3FNGA 4OLJA 3UWKA 3F5QA 1JB9A 2GFQA 4F06A 1RLIA 5DI9A 2SKCA 2QM8A 2WJAA 2NSDA 5E1BA 1P8JA 1SKUA 4IO0A 1TLFA 3GP3A 1AS2A 3EVTA 2YR0A 4BFWA 2JJ1A 3UG6A 2I7XA 4BN0A 5KKAA 3LUFA 4MDYA 5HZMA 3OO0A 4WOPA 1QHYA 1JYEA 4D3YA 1EP3B 2ZIAA 3AX6A 1F06A 3FOCA 3GC6A 2JFOA 4MR9A 4PZ9A 4BLOA 4P0PB 3W78A 4R71A 2VDVE 1OMOA 4LRYA 1Z7GA 4QRIA 5F7JA 2WIKA 4GP6A 5AW2A 1A9XA 1OLUB 4B2LA 4LWPA 4YAWA 5TB5A 4I9GA 2E1PA 4HFNA 3PEYA 4QOFA 2ES4A 4MUYA 1YB4A 1PGPA 1A8SA 4RTRA 3ZDRA 1V7CA 3CE9A 1GKUB 5AKLA 4E7PA 1ZS9A 1YDHA 3PYLA 2G1KA 2CUZA 1VHJA 4S1WA 2PGIA 4JVSB 1GR0A 3G8YA 5EY5B 3QUSA 4OHBA 2OHIA 1FX1A 3AB8A 3P5SA 4RZHA 4WZAA 1QFZA 4AG6A 3KZXA 2PR2A 3JARA 1U04A 5LYJB 4BKOA 3U3KA 2XRYA 2NV6A 5FTWA 4CCWA 2HRRA 2NYRA 1H8ED 1SB8A 2E5FA 4YP1A 4ARZB 3WLFA 2FWNA 4B74A 4AQYB 3U3JA 1R37A 3BD7A 3JTEA 3WK9A 4EB0A 1U3TA 2HDOA 2XSZA 1B4DA 3I32A 3OLCX 3TDNA 5LA6F 4DPKA 3AY0A 1TEZA 4IF4A 4UM5A 2CDRA 1AK1A 4YDSA 1CT9A 4MV7A 2BFNA 2CMGA 3VPHA 3L8DA 1EFUA 4UM7A 4BVBA 5AUOB 1QGAA 2H0RA 1A76A 1ECJA 3QVGB 4XM2A 4A0SA 3M1AA 2ZYTX 3QWFA 2XUFA 1HLGA 3L7CA 4MYSA 1CVRA 3JVVA 2FN9A 2OZPA 3AUUA 3NXSA 5E7JA 5IKEA 2R8BA 2P11A 2O8EA 3EZXA 1P19A 2Q5EA 2VJPA 2X41A 4GYKA 1DIAA 2D5LA 3VOSA 1SXHA 4GW3A 2EP5A 2F55A 1D2NA 4NJMB 4GI1A 1GZDA 1FS6A 9ABPA 1CUDA 3U60B 2GHRA 1HG0A 1XZQA 1G6HA 3HBJA 5E8JA 2WLSA 2Q6OA 3K9BA 4XSHA 2HDHA 1E3TA 1GLVA 1NUAA 2C4UA 1XE3A 3A4IA 3SBXA 3OKFA 2J5RA 3OU7A 4GEKA 3ZG6A 5BQOA 5BWNA 4IEFB 1RMTA 1A50B 1G8AA 1QPGA 1L5OA 4RLSA 1H2EA 3QXSA 3DKPA 4MP8A 4OJKA 3RAFC 4LE1A 2C9DA 3W34A 1II8B 1YZLA 5HFJA 1W85A 3ZDYB 5L4NA 3O5AA 3HXOA 5IP5A 3H9JA 3BMNB 4IVRA 2B3DA 3JVDA 1V16A 4HTFA 3TNDA 3RT9A 4FQ5A 4MRRA 4FMDF 5EQDA 1M2VA 1GFIA 3IKMB 1ORIA 1K4YA 2HPVA 2I71A 4ARVA 2NOAA 2H2DA 4EVSA 1SVNA 2QRGA 2CNWD 1EEXB 1W2GA 2LR0A 3AERB 4OBBA 4UNRA 1ECFA 1SUCA 3PUYA 4FFDA 5DX0A 3ACCA 1KI7A 4PFQA 1M73E 1U0NA 4G07A 4BLPA 4NV0A 1RRVA 1JHOA 1PLLA 4FDTA 5E9WA 3W5IA 1AU9A 1BDHA 2HQBA 1CP2A 4FC6A 2FMHA 4ND8A 2W90A 2GZ1A 4RPJA 2H5LA 4QBKA 1AZTA 1TVKB 3T7CA 2CWDA 2WPNA 1EX7A 3KVOA 2ZRIA 2XT9A 4DDTA 4G81A 3AEYA 1T6NA 2QKYA 4II3A 3TE6A 4AIRA 1X7ZA 2W2QA 1NMQA 1X39A 4FE4A 2Q5LA 2PQ2A 4IV0A 4OFZA 4YPFA 5ITSA 2VSXA 4DRYA 5BSFA 3QPBA 1C9DB 5L3VA 1XZCA 1C9MA 1Y8CA 3LH5A 2A1IA 3BC1A 4PGMA 1ZWLA 1ZBDA 2PKYX 3O8OB 4JOQA 3R09A 4TOIA 4ZPJA 1WIWA 1JHPA 3IV6A 2I6FA 4WV3A 3V7WA 3WL4A 1OFHA 2F43A 4A0FA 1T25A 4MRMA 3SBOA 4BP8A 4BPBA 5I4KA 2XMZA 2PH3A 3RR2A 4KSYA 2YYZA 4V0OA 5IEBA 1IWOA 4EYEA 5HNKA 1JXQA 4Y9TA 4TL8A 4COKA 2GAOA 2H7CA 1VPEA 2UVPB 1R9NA 2HX1A 3M7IA 4OJQA 3AYXB 4HXEB 3V4RA 1H8HA 1UBKS 2VNJA 4DB4A 3LT1A 2JAWA 3P9SA 4TLBA 1ZLXA 1LK5A 3WX0A 4I50F 4YRFA 5D5HA 4AUNA 1Z33A 2VHCA 3OCXA 1C7IA 2VJLA 4R3WA 3AG5A 3RADC 1QJ4A 2HJRA 4A0HA 4QBTA 5BN3A 2DVMA 2HJ9A 3GLIE 1ETHA 3LUHA 4ZDKA 3N28A 3L1HA 4QX6A 1DU4A 2ORYA 1Q7TA 5A1TA 5ADHA 2R7AA 3BERA 3ICEA 1I9CA 2FPKA 2MINA 1BFKA 1S02A 1PT6A 1YS6A 5AHOA 1F0PA 2DKFA 1KIAA 1IU9A 1OCEA 2DWOA 5JSZA 1NN1A 3L7AA 5C7LO 2R85A 3L7OA 2IZ7A 1N2CE 3SR0A 4G1BA 5BT9A 3WA6A 3WSVA 5HW0A 5KZMB 3ANMA 2O3TA 1SHTX 3A28A 3PSHA 1KMIY 2C9BA 4RF4A 1AURA 2NUAA 3PNSA 1MO3A 3KJHA 4KUEA 4EGCB 5KOYA 3H05A 1WHTB 2KYRA 1K5DA 4S0XA 5CT9A 2DQZA 2J3MA 3AIIA 1YB6A 1F4LA 1ZVMA 4RM3A 3D7MA 4CI0B 2IYVA 4RXMA 2EYUA 3IVXA 3H5OA 3ZI0A 3A11A 4K81B 1ARZA 2PUJA 2OTCA 2JK0A 1JMKC 2GHQA 1VSTA 3CBGA 3L05A 3QA3E 4O4LB 4W99A 2XAUA 2YZMA 4DDKA 2XPCA 3E7XA 4RLHA 4BNWA 2RAUA 2RHBA 3F7TA 2CV0A 3QVXA 4D0SA 1ORTA 3G1UA 1FC0A 4BE4A 3OI7A 3GQBB 3SYTA 1CQIB 1TKAA 3RRXA 1FYFA 3S2UA 3VAAA 3W2FA 4IFBA 1AKYA 3U7RA 4PTZA 4QDJA 2DM6A 3QW4B 4JN6B 1JEJA 3PTZA 3TLKA 1TJYA 3AU8A 3LF2A 4NOJA 3RIMA 1JG1A 1AQIA 3HU1A 1BROA 5B30A 2WZQA 3K4PA 5C80A 3HACA 1L6RA 2ZK7A 1BX1A 2VWPA 4OD0A 1XP5A 3GLFA 1EBBA 1M5UA 1B42A 2CV2A 4JAVC 2ZRGA 2KS6A 1UFKA 4IRUB 3FZGA 4IIUA 4YUZA 4L3OA 3AVPA 3TTYA 1CNMA 1BS1A 4DCCA 1S9HA 2JIZD 4NU8X 2IPXA 4RHUA 2HY7A 4YVFA 4OI1A 3JD4A 5EGSA 3PNOA 1L4GA 2O2YA 3BL5A 5CVCA 2ZM6B 1D1SA 3GHYA 4DV3B 2P9ZA 4FCWA 1FRFS 2XRMA 1P1RA 2UYGA 1KK0A 1ZKDA 2JCVA 3DMHA 4ND3A 2R0QC 1OXXK 1LPSA 1F8YA 5DNCA 1QV9A 1CLUA 1QUFA 1KH3A 2QW0X 4MO9A 1PQ4A 4ESEA 1TLLA 3DJYA 1V25A 3VR6H 1X1TA 3T1NA 1I24A 2HREA 3I1FA 3K15A 4LMRA 4BMCA 2HLPA 2OHVA 5HJEA 2FSFA 4EPWA 4MUBA 2Z2IA 1P9WA 1UANA 2H3HA 2G9UA 2M6RA 4CUJA 2O0MA 1CQWA 1FU8A 3HU2A 2AQ8A 1HLPA 2JARA 1OLXB 2BV3A 1TQHA 4YCJA 2JAOA 5A7GA 2G5TA 2B37A 4XX0A 2PPVA 5FB3A 1C3EA 2PRKA 3CJRA 3JARB 4WXRA 2Y9MB 4BC0A 3JTMA 1KI8A 4ZYWA 4JC4A 1BU5A 2P7IA 3OJLA 4FYXA 5FTKA 1HT2E 3S55A 4QUKA 3N7TA 1T9KA 1XG5A 4B6GA 4D44A 1N7JA 3I6MA 2A9OA 3JD3A 4DWJA 2GM9A 2A5DA 2BUBA 3H1FA 3A2MA 2VBCA 2Q3FA 2G82A 2R62A 4UNSA 3HUEA 1CYEA 1DELA 1G4UR 3PXCX 1M7GA 3SJAA 5DYNA 2JLCA 3NBZC 4HNAA 2CXQA 3UC9A 3SZLA 3LQ4A 4IIXA 4WACA 9MHTA 1AKTA 1UQUA 4X65B 4YCLA 1UJMA 1NW8A 1OROA 3QIVA 2WAOA 2JLQA 3B2QA 4I9UA 2HD4A 3W2HA 2A5YB 2C97A 2XAAA 2VQSA 3JASA 3JPYA 3CEHA 4KXYA 1HH4A 4M87A 4NBRA 3TAXA 2FKNA 3ABSB 4D9IA 5KVVA 2F4VB 1ZM4A 3ROEA 2OBYA 2ZRLA 2JIRA 2J45A 3DUFB 4NESA 3TB4A 1FBNA 2AOXA 3PCXA 3I37X 1L7AA 3L93A 4EABA 1MG0A 4PLTA 2BE9A 3IUNA 4NJMA 4EHLA 4EKNB 4BN4A 1B8OA 1H22A 1L7QA 1J2UA 3AUXA 4H3SA 2O8EB 2O7NA 4HAXA 3DVLA 4N7RA 3EBPA 1RXUA 2IEDA 1L8QA 3NAZA 4WOJA 4RFSA 1V71A 2H3EA 2W2XA 3QTTA 5DF1A 3BXXA 4PZEA 2WJVA 4V39A 3R6WA 4CGZA 2REXB 2JEOA 4AK9A 3BFJA 4A03A 1P2FA 2PD4A 1DQNA 4D6YA 2GAAA 1QHHB 2LD4A 1Z82A 1KJ8A 1V37A 3EHEA 4MJ7A 4EBBA 1N5LA 4R9NA 1Q1ZA 4IFEA 1XZ8A 2HRZA 4ZK6A 1XZHA 2ZB4A 2VZ8A 3INNA 4P7GA 3E9YA 1T0PA 4IEIA 5KTNA 1GUFA 3TF5A 3ZDAA 1DC4A 4Q3BA 2H7VA 2ABWA 2OBXA 1N2CA 2Y2VA 3ABZA 4JB2A 5ARDA 1MX5A 1CY7A 1S8FA 4REMA 5BN4B 1HFJA 2PN1A 4IIYA 5FXMA 3SFVA 3W2EA 1USVA 2ZRHA 1EA5A 2YMLA 4FD2A 5FPYA 3FCYA 3OQHA 1QE0A 3PENA 1M6NA 2V9PA 3IVCA 3NIGB 4IX1A 5DSXA 1U9IA 3GT3A 1UBMS 3GWZA 4C3VA 3JY6A 4PLGA 1XNGA 4GT1A 2C88A 2RBKA 2OXCA 1G6OA 2C4TA 2SHKA 1SK9A 1YR3A 1F7VA 2K87A 3K05A 1DINA 5KNDH 2HO4A 4B33A 1RAAA 3A6DA 3WDMA 4YMLA 4HJXA 2NSHA 2XADA 3OEHA 4A26A 3ELDA 4IWNA 1QXSA 1U3UA 2YWJA 3PQ4A 4MCHA 3IHLA 4IH9A 3UAXA 5DCWA 4UARA 4Q93A 3H11B 4LSMA 1ZIXA 4JQYA 4REQA 3OZXA 5EIXA 1KMMA 2Q29A 2Q6VA 3A6GA 3P4UA 3I5XA 1XRJA 4EKIA 2IV3A 1XEXA 1NWHA 1XZPA 2P8JA 5DWDA 1HNWB 4Y7DA 3FMVA 2Q8PA 2X5KO 1Z6PA 3I39X 3EULA 2AZDA 2ACWA 3I2IA 2X13A 4X90A 4WN3A 2IBSA 4PRZA 1D4AA 4RTQA 2X3YA 5HKOA 2ZQYA 2ALJA 1G63A 3OPYI 2ONZA 2Q4OA 1SUWA 1DE0A 4J16C 1MORA 1Q0ZA 3KC2A 5JEDA 1Y7TA 3RT1A 5ADWA 2CB9A 3FR8A 4GZLA 3UY4A 2EG9A 4FGKA 3NIFB 1O6ZA 1QHEA 3AR5A 4DLRA 4IIVA 3H0KA 3WFZA 3GJ5A 1YNOA 3A1TA 5KKCA 4AY2A 1XTKA 2QUHA 2A5GA 2JKZA 2XCRB 5AM1A 1E7QA 4L5YA 1TD1A 2Y4NA 4WDRA 2JBHA 2O7RA 4PV7A 4MYDA 1SULA 2X0RA 1E2NA 4S1PA 1L1QA 1ZC3A 4JJZA 3DZKA 1RKBA 2RAVA 1H9AA 1X3LA 3E9MA 2Z3VA 3I8XA 4LTMA 3NOQA 3JD2A 3VSEA 2WDZA 4EITA 3B3FA 4JK3A 4ABYA 2C7OA 4Z53A 2Q3BA 4ZVUA 4W7IA 2MINB 4EPVA 4UM9B 1XZLA 3PLNA 2IXGA 4ZQHA 1J9EA 2O5VA 2QHXA 3KDSE 5DJ5A 3TLEA 4UTVA 3QX8A 3FMPB 4QLAA 3A6PC 3ZX4A 1WVGA 3RTBA 4CG2A 3QTBA 5JASA 4CYMA 1CQZA 5CNMA 5IH3A 4DWVA 1KZ9A 1M2GA 3WIUA 1HQYE 1R88A 3F6BX 4YRKA 4NHEA 3K9WA 2B1IA 3HN6A 2WTEA 2G36A 1Y3CE 3KBOA 1IJKA 4OXNA 1K89A 2EEZA 1JEOA 3Q8WA 1EA7A 4JLWA 2ZDQA 2J85A 3PD7A 1E7SA 4O2LA 2WFLB 5HUQA 4JD5A 5CB0A 1I36A 2OEPA 5I3CA 3LY5A 1R50A 3PCRB 5CXXA 4YRZA 4XDYA 4BLRA 3QX9A 1FJ2A 3PNLA 1I6KA 1E64A 1TA0A 2PT7A 5DHFA 3U5TA 2VXBA 4LF7B 4UULA 1EUQA 2H1RA 5AMXA 2FCAA 4N0PA 3CSUA 3GAAA 2OE2A 5A0FA 1P1CA 2Q2NA 1P2BA 1WSAA 3LBNA 5KPDA 3EVGA 5TS2A 1U8EA 5JRJA 2WF6A 2UVDA 3QVOA 1XRNA 4KIJA 4FILA 5L3SB 4EZEA 4OBWA 1NQVA 1V3QE 3TPFA 2HUNA 2C5AA 2J7PD 2FSPA 1R6UA 5I8ZA 4DILA 3ZIAA 2CMFA 4F4DA 3OQOA 1KQFA 3IUJA 2FSHA 4RXUA 2IOHA 2GRJA 2YXEA 4BQFA 1G2QA 1DXOA 1KYXA 1P45A 2X86A 2ZJ4A 4PPQA 4RVHA 4XIJA 3RUEA 5KJ1A 1K86A 4YYEA 5J2TF 3H13A 4CMIB 2H06A 3KALA 4M53A 1LBQA 1NSYA 4P0TA 1E4VA 3HZRA 3IQGX 5PGMA 3FLBA 1KC3A 1X2EA 1CUBA 2H08A 2KJQA 2RH9B 2VDWB 2VF5X 5B1SA 3CVWA 1NBAA 3EISA 4I9NA 4IY1A 1KMHB 4ESOA 2CVPA 1WZCA 2F1HA 4TM8A 2CGEA 2R79A 3I9KA 1M2VB 4MB0A 1FNDA 3CNQS 2DCMA 3W8DA 2QMUA 2N0SA 1SXJD 1WSWA 1CUYA 1Y0BA 1N2IA 1VSUA 2ZTMA 3PDJA 4UATA 3X0DA 4D2IA 5JBNA 5LQNA 4RTOA 4CR6A 5JC8A 4KIUA 2ZSHA 4ZOEA 2C3YA 2QVXX 4GFDA 1QVZA 2O2ZA 5KNBD 1RQNA 2JA1A 2XCUA 3FVTA 4O0MA 4QQFA 1U3CA 2RGGA 4BO6A 3SPXA 5JRDS 1CJKC 1E2JA 2VJYA 1AN9A 1S7CA 1WXGA 3V8EA 4AP5A 3ND5A 2J30A 1KQGA 4DMKA 5C8DA 2F9LA 5CT5A 3G9ZA 5F7ZA 2B8TA 4RYLA 1FFGA 4F72A 5DLDA 1ZNWA 5I01A 3EWAA 3D8RA 3W5UA 1T9BA 2PXXA 5KPJA 1DAEA 2WNIA 1D7OA 5AHWA 4HMPA 4S24A 3W6OA 4E70A 4F6RB 1N8NA 4EENA 2CXUA 1WDTA 1COWD 1KEZA 4TL6A 2MOKA 2EQAA 2XVMA 5GM2A 1E9VA 4Y2PA 1T3LA 3I0NA 4CLXA 2H9YA 4L57A 2RKOA 3EMBA 2IZ5A 2BM1A 5G3YA 4DA4A 4REQB 4Q6WA 4Z0TA 5DHPA 3RS4A 3FI0A 2OQVA 2ZIGA 3DZHA 1D8AA 1WDLA 4KVFA 4CKXA 3SZMA 1LJ8A 4XTRA 4CBVA 5FF9A 3CG4A 3R3SA 4J6EA 3C3JA 4JT9A 2XQGA 3FMIA 4UU1A 1JWBB 3PPYA 4RMIA 1ID8A 2QRHA 5A6SB 1J06A 2ZDGA 1NBHA 4UASA 2Q6KA 3UEOA 1USGA 3M4NA 2QQFA 1M6VA 3LPLA 4IDAA 3R0VA 1DV1A 4J4BA 1UBCA 3IUSA 5LKRA 1NZDA 3BH0A 4FXOA 2OD2A 1AZSC 4ZVQA 1NVTA 5B1HA 3R3UA 1YJ5A 1Y5LA 3SZUA 3UWDA 1N25A 1NVXQ 2RGYA 1GGKA 1E60A 3M1IA 4IDQA 4LSWA 4UHDA 5KYVA 1KWGA 1IB6A 3C3YA 2ZULA 2W6IA 1U99A 2X0FA 1V5EA 1QH8B 3FTNA 4B3HA 4ML3A 3GJSA 3OE7A 2P90A 3KB1A 2XIJA 4KC0A 4P81A 4YCAA 5LR6A 1FPMA 4CE6A 4ZJPA 2XVAA 2YV3A 4BJ5A 3SF0A 1BXRB 4XCVA 4DLWA 5FV4A 4CQNA 1Y7PA 3FI9A 4AUKA 1G5QA 2WYIA 5HHTA 1AF7A 1AQ6A 1Q17A 5AICA 5AW6A 4MQ4A 3ND9A 4QJ5A 4WI1A 3GBPA 1QHXA 1L7OA 2CXXA 3REQB 3ZKWB 4G67A 4ZEMA 1FP7A 1G6KA 1TADA 4L2IA 4URVR 1A5BB 3PT9A 1UBLS 2GMWA 4H7PA 2Y1DA 1L8AA 4YNBA 3ETEA 1G66A 1BXGB 1IEXA 1ORWA 1WTAA 2XD4A 3D6FA 4E21A 1D4FA 2YNMC 1E6MA 1C7JA 2WPDD 5FJJA 2EX1A 5K8LA 4BGVA 5K0SA 3FH0A 1NXWA 1DBRA 1GIAA 1A04A 3PF8A 4B35A 3CIOA 3V8QA 4P4GA 3HXLA 3ZZTA 2Q3LA 4A8PA 4C4SA 5L7WA 2JFVA 1E2LA 4NZ9A 1S6YA 2ZREA 3AV0B 2Z43A 3KZ1E 3DNFA 4OAOA 4PVDA 1FX0B 3AZQA 3AJRA 4ZHQA 4CXMA 2N42A 2Q3MA 1ZX1A 3E0XA 3QVSA 4Y9RA 5WRFA 4M0KA 4X1KB 3W2IA 2CBGA 2GOYA 4NCJA 4I3HA 2J41A 4P54A 3A9TA 1QF9A 2VYND 4KN8A 4DLYA 4WLFA 2QUAA 3HDHA 1HYGA 3GZ4A 1V6CA 3ICQB 2X5JO 3P2KA 4RVNA 1KJIA 2CVFA 4AZ3A 5LP6B 4MWBA 1GSAA 3TLZA 3TE7A 1IPFA 4LVNA 3KQKA 4QPNA 4BRUA 2OD7A 2JHPA 3AHFA 4YDRA 4C0QC 3W1EA 3M34A 1HQCA 3A26A 5BUQA 1WUYA 1EMDA 2Y0CA 3FM9A 3RVSA 2PMEA 4CN8A 3ZY3A 5K3CA 3SYNA 1FDOA 4D42A 2X4IA 4YY3B 3EEQA 2QRVA 2JZNA 2JGMA 3TBHA 1R3UA 1U3VA 1WM1A 3R6DA 2BGRA 4MYHA 1NWCA 1GFZA 4QQKA 1SBCA 4I9FA 4HF7A 1VSBA 2CNDA 3Q98A 4DAOA 4DZZA 1LDGA 2H9AA 3M0EA 2AEEA 1ACMA 4GL2A 4YRSA 1GZ3A 1O9BA 3AETA 1LSOA 4YJKA 4YX9A 4BKRA 5C3MA 4CIBA 3TR5A 1E3MA 1EFRD 3R5JA 5FLXA 3VPSA 1FDTA 3JRWA 3PPIA 4WW0A 1VG9B 4YAOA 4JODA 1HLDA 3VKVA 3IPXA 3LQ2A 2OZKA 4NVRA 3FCEA 5ICFA 1UPBA 3FAKA 3OHPA 3W5VA 4ER7A 2FWMX 4FGZA 2R8RA 5AKKA 1GEGA 5CFRA 2ZETA 3OQNA 1M0EA 4EHAA 3AFNA 5EP1A 1R5OA 5FA5A 5BV7A 1V5GA 3QHPA 1P0PA 4ZWNA 3VU9A 3BORA 4Y1FA 1Q83A 3UOGA 1XD9A 1YQUA 4AECA 5SY4A 2NVOA 2AD1A 5IULC 1YBHA 1TRKA 3DBOB 3WL7A 1N0WA 1EGVB 2C1XA 4AN4A 3A1CA 2CUKA 2JHGA 4QOGA 3I2GA 4HZUB 3L7KA 3CRMA 3HPQA 1J0AA 3MSCA 4M7OA 4X92A 4JKYA 5ANRB 3RODA 3QE0A 3TCKA 5ITVA 3K0HA 4LAFA 3TR0A 2Q4DA 1J0XO 3DF9A 4L85A 5GONB 3UV7A 5JAZA 4FR2A 4U8HA 3FOFC 2WM3A 1BYIA 1M2OA 3MT7A 1NQUA 1VG0B 3IBSA 4UFOA 1VYTA 4X41A 3DLBA 5EXSA 3WRWA 2YWFA 4FCCA 3M9WA 1R8SA 4QU9A 1FSGA 1YQXA 2B9VA 2IYWA 4C4YA 4KRXA 5DP2A 2M6LA 1NKVA 2G6TA 5J59A 4C4OA 1JEQB 4HBGA 2PSSA 3MTIA 4H1VA 2GLXA 4Y2GA 1W1WA 2GCEA 4NBTA 1KPHA 2H5IA 5AESA 3VPFA 3IIJA 2XGOA 4NABA 4R8MA 1EK2A 1SA0A 4Q3DA 3MS4A 4XQ9A 4CI9A 1EINA 1YJQA 3LUBA 3OTIA 2A9RA 4HDRA 1P18A 1KNXA 3D3NA 1RWPA 2Q5FA 1Z0AA 1VA5A 3C1OA 3I9V6 3OF3A 4FBGA 3B9QA 2VHTA 5LB4A 4CCYA 5JMOA 4YP5A 3MG9A 3DMDA 4RD2A 5TQVA 1FJHA 4PC3A 3FXAA 3TMYA 2NYVA 2FHSA 1EFPB 4R6WA 4TUYF 3IAHA 3IE2A 3HUTA 1M76A 3ZJYA 1P33A 1ML3A 2H2AA 1FXSA 4X00A 4MUGA 2YC2C 1BJRE 1HE3A 2YIVX 3CW9A 3IMKA 4X20A 3U3MA 1GSOA 4JLKA 4HYYA 4CF4A 3KWJA 5JXIA 3OPQA 2RI1A 3SE0A 3F6PA 5TVKA 4UFNA 1QP7A 2CDBA 1U9JA 3R5FA 4MMZB 2GWRA 4FJ0A 4XAQA 4I4NA 2UZIR 1U7DA 1ZXXA 3KUCA 4ZARA 5IXSA 4IZOA 1DZIA 1D9XA 3WGGA 3FPHA 3TRKA 2JGKA 2GILA 2WT8A 1RTTA 1A5AB 5DVZA 2ZTUA 4IR7A 2HFKA 3PHLA 1R4MB 1TJPB 2FUCA 2HMWA 2H4FA 4AZ3B 1WKBA 5I7WA 5JISA 4DR1B 3F9CA 2VDLB 4E32A 1XK7A 3VAZA 1ZU5A 2NT4A 3AESB 5H5JA 3W3AH 3YASA 4DNXA 2G08A 1K4KA 2WWRA 1T9GR 4TTQA 3GJ8A 3U4QA 3AG6A 4KPGA 4INOA 8ATCA 1E2QA 2CF6A 4MIOA 3AM3A 1L8XA 1SQ6A 4W7HA 2CD7A 3OLWA 5C8YA 3ADPA 2QP9X 3OTOB 3CVUA 1B74A 1UFQA 2H2GA 3IAAA 5A4DA 3KQLA 4JZKA 2YRWA 4INJA 4BLQA 1OT3A 1QFYA 3FYHA 2LBPA 3O31A 2OZVA 2YJGA 3PUVA 5CLIA 1ZJJA 5TT0A 3MWYW 2EFCB 3DBVO 2P69A 1C30B 2PX5A 1CQXA 1K7CA 3F49S 5I7RA 2PFSA 2X23A 3CY6A 1MXFA 2IYFA 4LOHA 4OSOA 1IN6A 4PO8A 4X7BA 3G2IA 5H68A 4E3WA 1JQDA 3EXHA 4IOLA 3KR9A 4UZEA 1X42A 5CLGA 2CJXA 4EARA 4GQIA 1W96A 1M66A 2WUVA 1MRZA 1UT6A 3DV9A 5F78A 1E77A 1RRPA 4GE3A 1KO8A 1L5NA 1YRAA 4ZN6A 5AW8A 4MRNA 1Y1RA 4EA8A 1QTNA 1YDEA 3CZCA 1ZGZA 5A3SA 1KBZA 5E4YA 3GDGA 1SOAA 2E48A 3ZC3A 5KOHB 1SOVA 3H6HA 3IT0A 4FN4A 4YAIA