3DH0A

Crystal structure of a sam dependent methyltransferase from aquifex aeolicus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
KFDPSKIKKLDDPSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDWKKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYAMIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM dependent methyltransferase
publication title Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 61
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dh0A00
4C07A 2EJTA 2UYHA 5HIMA 2NXNA 3LCVB 1NE2A 2ZULA 1P91A 3GGDA 1WS6A 3F4KA 3P9IA 2O57A 4OQEA 3CKKA 3EGIA 3DP7A 3V97A 3MCZA 2P3OA 1X1BA 1EIZA 10MHA 1JG2A 4PWYA 1RJEA 5DTQA 1YF3A 1F38A 4LG1A 5C9ZA 3MHTA 3LKDA 3A7DA 1XTPA 2AOWA 4C08A 3FUXA 2XYRA 2YXLA 2V74B 3L8DA 2P40A 1H1DA 2YQZA 3DUWA 3LSTA 4GF5A 2HR1A 4BLUA 4C06A 3FTCA 3SX0A 4RTSA 4CTJA 2Z6UA 1R18A 3DULA 1I4WA 5P8WA 4RTQA 2BM9A 3P9KA 3RW9A 3HA5A 2XYVA 1EJ0A 4MWZA 3G2QA 4X63A 4PYOA 5EEHA 2ZWAA 2AOUB 5CVDA 3PTAA 4HTFA 4E32A 3PLAE 4PYJA 5DX1A 1VQ1A 4MHTA 1KYWA 3G2PA 5FCDA 5LQNA 1YB2A 4HTFB 1VP3A 5CUQA 2VS1A 4BP1A 1N2XA 2PWYA 3LX6A 2IGTA 1G8SA 1FP2A 3ELWA 3EVZA 4ISCA 5E2BA 3T7TA 5DPMA 3FPHA 4PIMA 3DOUA 4FT2A 4R8RA 1KYZA 5LR6A 5EKXA 3HTXA 2ERCA 4UOEA 2VP3A 4RVGA 5DM2A 4BLWA 2PKWA 4MTLA 5FTWA 3UA3A 2GLUA 1RI4A 5DSTA 3P2IA 5G02A 3M6WA 1N7IA 4OBWA 4WXHA 3CCFA 4EKIA 3G89A 3I58A 4P7FA 1VL5A 2G72A 2QYOA 3OU2A 1B42A 1JTFA 1EG2A 2CWWA 1JQDA 3CJQA 2NYUA 2PT9A 2PGXA 5ERGB 5BP7A 4RTMA 2PY6A 3I9FA 4IV8A 4HGYA 1XDZA 3CJTA 4FGZA 3QV2A 3KR9A 2YXEA 2XBMA 2P41A 5ICEA 5E8RA 5FQOA 2EX4A 1SQFA 2XVMA 3C3PA 3OZSA 5DSXA 2UZ4A 4C03A 1KP9A 3FUTA 4YUVA 4AZSA 4YUXA 3PT9A 1L3BA 5D1HA 1NW3A 5DXAA 3KPUA 1QAQA 3ELDA 1FJXA 3GXOA 2EG5A 5LQKA 5E8JA 3BWBA 2JHPA 2GPYA 1VE3A 3C6MA 4R05A 2AR0A 2B3TA 2WA2A 2CMHA 2ONZA 2NXCA 3E23A 3HA7A 3P8ZA 3BZBA 1YUBA 3KQTA 3K0BA 3DXYA 4MIKA 4U7TB 3UFBA 3VSEA 3KPJA 4L7VA 5FA5A 1L1EA 4E2XA 4AUKA 3EVFA 4ER0A 1X1CA 3AXTA 1YZ3A 2V7EA 4KIFA 4RTNA 3HEMA 3GRVA 2C7QA 2ZCJA 4H0NA 3FZGA 1JQEA 1NT2A 3FUUA 2IDJA 3NMUF 3ELUA 2PJDA 5GINE 4G56A 2AVNA 3EPPA 3TKAA 2KW5A 3GO4A 4GBED 4XUCA 2P35A 2JJQA 3KU1A 3CGGA 3KPVA 1ZG3A 3JWIA 3EGEA 5F2NA 3GRRA 3EVCA 3GRUA 3LDGA 2JH9A 2ZZKA 5FWAA 4HSGA 3TLJA 4PYQA 1XVAA 1Q0SA 3KHKA 4QVGA 3LCUA 3LCCA 3KQWA 1TPYA 1KXZA 1P1BA 2VDWA 4IV0A 3ANXA 3GJYA 5CVJA 4ER3A 4E30A 3HM2A 4KDRA 5LQCA 4DM3A 5F2OA 3KR0A 3P71T 3TM5A 1NBIA 4X1OA 4YV2A 3P97A 2AVDA 2IH4A 5KVAA 2PLWA 1JG3A 1L3CA 1N7JA 3G88A 5DLYA 2VDUE 2HWKA 4EVIA 2HNKA 3NTVA 1NW6A 2ZW9A 3TKYA 3I64A 3I53A 1WXXA 5B1SA 3AXSA 2PXXA 4P58A 3PX3A 5EHIA 5HILA 3SMQA 4RTPA 2G1PA 3LDFA 4PCLA 2OB2A 3MERA 2IBTA 4IWNA 5DM4A 1RI1A 3MTIA 4LWOA 3SVZA 4LWPA 4CKEA 5LQJA 1X1AA 4FSXA 2R6ZA 5KQSA 1VIDA 3A7EA 4YV1A 3R6TA 4RTRA 2O06A 3B7PA 2P3LA 5GM1A 1R74A 1L9KA 1AQJA 1G55A 3LPMA 4PYLA 2HTEA 4A6EA 2JHCA 3FTFA 2A14A 5K0JA 3FTEA 3NVMB 4RWZA 5D1NA 3UJ9A 1R8XA 4PYNA 1ZKDA 4E2YA 4GQBA 4HRAA 1RI5A 4CKBA 3SXJA 2AN5A 3REOA 5KYGA 2P1DA 1BHJA 2B78A 4YV0A 2I9KA 1O54A 3BKWA 3EEYA 3LKZA 4QDKA 5T6BA 5M5BA 5K03A 5E1DA 4X60A 5K05A 3HVKA 3GDHA 3TM4A 3FYCA 3NJRA 3U81A 3BKXA 3BXOA 2AOTA 5EMKA 4YUYA 1DCTA 4YUWA 1EAMA 1L3IA 2PBFA 1ZGAA 4ZTBA 3T7RA 2P7HA 5GIOE 3MTEA 3SM3A 2C7OA 1F3LA 2HMYB 2AS0A 3MB5A 4GOOD 4EK9A 3HVIA 5K0FA 2GAFA 2IDKA 4PIPA 5BXYA 4RTOA 3EEOA 1M0EA 3BWCA 2BR4A 2IPXA 1SVUA 2P3QA 4HGZA 1HNNA 2F8LA 3R24A 4RSRA 2UYQA 4R6XA 1JQ3A 3THSA 3V8VA 5CCXA 2PX5A 3KKZA 3OU6A 4FR0A 4QTTB 4JXJA 5EPEA 4RTKA 1OR8A 1QYRA 3ME5A 5FADA 3G7UA 2N47A 4OQDA 1D2CA 3CC8A 3QOXA 5DTMA 4M7RA 3FPFA 3UJAA 1UIRA 2ZFUA 5EIFA 4GOLD 3DMGA 3SR4A 3G8BA 4X61A 5E1BA 3KPYA 5JUWA 3TRKA 3KPWA 1KPIA 3PB3A 3HCCA 2O0LA 4PNEA 1AV6A 1RJDA 4FP9A 4PYIA 4BY9E 5FQNA 5EOVA 3GRZA 2IH5A 3NWEA 4AZVA 3S68A 1JSZA 3IV6A 2YUIA 1M6EX 2FPOA 3VYWA 1U2ZA 3OZTA 4GUAA 4KWCA 3EVEA 4B17A 3ORHA 3DLIA 3HCBA 5EMJA 1G38A 5F2KA 3FRIA 4V0RA 2B9EA 3NDIA 3FRHA 3UJ6A 3C3YA 4RVFA 3KQSA 4GC5A 5IKMA 1ZQ9A 1XXLA 2AOTB 1WG8A 2I62A 3E8SA 4RTJA 1SUSA 5K0BA 4KIGA 2O05A 3UJCA 1WZNA 4DCGA 3EMDA 5ICGA 2ZZNA 3SSMA 4ER6A 3IHTA 3CVOA 3O4FA 4GEKA 2OB1A 1SG9A 3BGDA 3MGGA 4AX8A 3C6KA 3EVAA 4RVDA 3ID6C 5EVJA 3KQMA 2PXCA 2FK8A 1IY9A 3UA4A 1JG1A 2EJUA 1NV9A 2C7PA 4GOND 5GP1A 4YMGA 4KW7A 4R6WA 4Z2YA 1TW2A 1NKVA 3TQSA 2FHPA 3M4XA 3T7SA 5FWDA 4C05A 2VDVE 2HV9A 5GOZA 2CL5A 2GB4A 2H00A 4QQKA 3LBFA 2ZVJA 2FCAA 3GRYA 1QANA 2QRVA 3AY0A 2JH8A 3R3HA 4XUDA 2ZIEA 1SKMA 2Z6QA 4HC4A 3B3JA 2OYRA 2JG3A 1I1NA 2R3SA 3BUSA 3FPJA 3LHDA 5T67A 5K8VA 2OO3A 4DCMA 4OX9Y 3KQYA 1XDUA 2PX4A 4LECA 1WXWA 4F85A 1IXKA 2G71A 5DX8A 2P7IA 4QPPA 3MAGA 4E2WA 3X0DA 3SSOA 2ZZMA 1FBNA 2PXAA 3RODA 2ZWVA 5C1IA 4IKPA 1YFLA 3G2MA 8MHTA 2ZBPA 1O9GA 4FS8A 4PYMA 5DRYA 2OY0A 2QE6A 1SQGA 2YVLA 1Z3CA 3BGIA 5DXJA 2DPMA 1RJFA 2GH1A 5DT2A 3TMAA 3KQQA 1KIAA 2WA1A 5CD1A 3JWHA 3UJDA 4EQZA 2K4MA 1BOOA 3LGAA 3OFKA 4KDCA 2BH2A 5EGSA 3G2OA 3Q7EA 4M36A 1QZZA 1G8AA 1VBFA 2JHAA 3AWIA 5CM2Z 2O07A 4RYLA 3FPGA 5EMLA 3G5TA 2YTZA 5CIYA 1HMYA 4PINA 3TOSA 4POOA 5BW4A 3LL7A 3HCFA 5BW5A 4U7PB 1P39A 5E2AA 1QAOA 5EMMA 1P1CA 4CKCA 4RVHA 5DX0A 3DR5A 3LBYA 4QQNA 9MHTA 2IFTA 4RX1A 3SSNA 2IIPA 1MHTA 2AN3A 1JG4A 1KR5A 1ZGJA 3ER8A 3A25A 3ERCA 4YMHA 2G70A 3K6RA 5EIWA 4AZTA 2QRVB 2ZTHA 4C04A 3UZUA 3UJBA 1DL5A 2ZIGA 5HFJA 4XCXA 2PV0A 3HCDA 2B2CA 5DM0A 3DXXA 3MCTA 5JR3A 2ZBRA 5K01A 3A26A 3DTNA 3EGVA 4PYKA 5C0OE 5K09A 2UYCA 1XCJA 3DH0A 3H2BA 2ORED 4O29A 1G60A 3FUWA 3THRA 1NW5A 5FULA 5GM2A 1I9GA 2ESRA 3FUVA 5K0GA 5KS2A 4PCAA 3IEIA 4WVLA 2AN4A 5E9WA 2OBFA 4M38A 4QPNA 5EC8A 4E31A 4C4AA 4PGGA 5FUBA 2XVAA 1KPGA 3EVDA 3NWBA 1BKYA 1UWVA 5T64A 4CXMA 3HCEA 3UBTA 2CMGA 3HVHA 2GS9A 3R0QA 5HEKA 3P2EA 5K0EA 2YX1A 4BLVA 4CWAA 3UWPA 4DKJA 2PX2A 5KQRA 3M6XA 4AZWA 4E33A 3P2KA 3IYLW 1EQAA 1NW8A 2OPBA 3O7WA 2OXTA 5E9QA 3B3GA 3P9NA 3LECA 4GOMD 1D2GA 4PONA 3Q87B 3TFWA 4F86A 4PGHA 2H1RA 2AOXA 3CJRA 5LQRA 3OU7A 5LQAA 3P9CA 4BP3A 4X41A 4ATNA 2IH2A 2WK1A 2E5WA 2FK7A 2BZGA 3GIWA 1RI2A 4FZVA 4KRGA 4MQ4A 1AF7A 3CBGA 1VLMA 3M33A 2BR3A 2ONYA 2YXDA 3NW9A 4Y2HA 3RIEA 3VC2A 3EMBA 3HCAA 4RTLA 3OE4A 2GA9A 7MHTA 3JWGA 1JSXA 4M37A 1DUSA 1FP1D 4OBXA 3ER9A 1D2HA 4YUZA 5GIPE 1X1DA 3OCJA 4RV9A 2Q41A 3BWMA 1FPQA 5HOQA 3WSTA 1BC5A 1EJ6A 2H11A 5DM1A 1JR4A 3DMHA 1INLA 2Y1XA 2AZTA 3OE5A 2ZSUA 3HVJA 5EZSA 1X19A 2PT6A 5DTRA 5CCBA 2OZVA 2VZ9A 3NDJA 3OZRA 5DRTA 5HIKA 1KHHA 4FSDA 3SGLA 4ER7A 5K0NA 4QTUB 1ZHFA 2AOVA 2YR0A 4EKGA 5MHTA 2NXJA 5FHRA 2ADMA 4FT4A 1YZHA 2QY6A 3A4TA 3KR1A 5CVEA 1G6Q1 2XYQA 1R8YA 1PJZA 4P7JA 4A6DA 3KQPA 2IBSA 4OA5A 5ICCA 4HH4A 5EG5A 4DF3A 2BR5A 2NNWB 5DWQA 3B5IA 1MJFA 2I7CA 3A27A 4DA4A 2G8NA 3AJDA 3DMFA 1RJGA 3M70A 2EFJA 3HNRA 3DXZA 1M6YA 2P8JA 3M6UA 1NV8A 3R9XB 2ZIFA 2C7RA 1JTEA 2QM3A 3B3FA 1WY7A 2PX8A 5HIIA 5K0LA 4HG2A 2FYTA 3FTDA 5EHGA 1PRYA 3E05A 2NP7A 3NVKI 5ICFA 3BWYA 3KQVA 1O9HA 4K6MA 5HIJA 3PVCA 4DQ0A 3PFGA 5LQUA 2BM8A 3HA3A 1VPTA 2B25A 4R8SA 5FA8A 1IM8A 5K0CA 3KQOA 5E9JA 1NBHA 2PWPA 3ELYA 1ORHA 3I5UA 3TR6A 3EVBA 3UJ7A 4EMSA 3T0IA 3PX2A 3GNLA 4E2ZA 1RI3A 1T43A 1Y8CA 3OPNA 3JWJA 3UJ8A 4QDJA 2UYOA 2PSSA 3O31A 1AQIA 1VP9A 2CKDA 1KPHA 1TW3A 3M6VA 5H02A 4DZRA 5HZMA 3VC1A 4P7KA 4Y30A 5EZQA 4XUEA 3GCZA 2NP6A 3OFJA 1V39A 1R6AA 2ZBQA 3TPZA 3LDUA 3QOWA 4QVKA 3BT7A 4F84A 3G5LA 1XJ5A 2I6GA 3HP7A 3G8AA 5E1MA 5E1OA 5EEGA 4E70A 4DMGA 1XCLA 2PVCA 4GC9A 3EVGA 1NW7A 1QAMA 2LD4A 4NECA 2Z6AA 2AOUA 2IP2A 3BGVA 1XDSA 2NXEA 3C0KA 4V0QA 1UFKA 5IH3A 5CVVA 4CTKA 3GWZA 1YFJA 3E7PA 5U4XA 3FYDA 2ZLBA 5EKUA 5GWXA 3FPEA 2Y1WA 1R00A 4KVZA 4ER5A 1ORIA 1Q0TA 2DULA 3DLCA 2OKCA 3D2LA 3PS9A 4OA8A 3GU3A 1SUIA 3MQ2A 4P7GA 5FHQA 5LSAA 3B89A 3KR2A 5EQJB 5CVUA 3PFHA 2FRXA
chains in the Genus database with same CATH superfamily
1GZHB 5TX7A 3EY9A 2XWJI 3I61A 5BMOA 2D7JA 4WOPA 3K6SA 3BJEA 3E9MA 1GZ4A 1ZHHA 1E4EA 2ZYHA 3C41J 1M34A 4H1UA 1PD1A 3RUCA 4ALNA 4DC9A 3L0SA 3EA4A 3DZHA 3IV7A 4LXQA 3WNDA 3X1YA 1TXGA 4ZVOA 1PL6A 4BZWA 3G0IA 5CLQA 3SBDA 4MUBA 1PJQA 1WF6A 1M3SA 2DYKA 2YWBA 1IHUA 1WB6A 3C7AA 5KNCA 3ISVA 3C70A 4OEHA 4QWWA 4R1NA 4ZZIA 1O58A 1KS2A 1U0GA 1R50A 1ELOA 2HHLA 1ZJ6A 1PR3A 4JLOA 4WFJA 3SX0A 4EARA 4ZALA 4EENA 4RTQA 5IG2A 5JMTA 2N9UA 4EG7A 1X7DA 4NMXB 2A1TS 3PXAA 3L6RA 2A1TR 13PKA 2EP8A 3FSRA 4G5OA 4ITUA 4E32A 5CDFE 1YA4A 1PQYA 3KUKA 2OV4A 2EL9A 4NMMA 4N41A 3G2PA 2H4HA 3CWQA 3I37X 3Q0EA 2N0SA 4GWLA 4G85A 4H7DA 1PNQA 1QGYA 2VS1A 4NCHA 3HK2A 1VKJA 3H6HA 5A5GA 3CA8A 5U9CA 4EUFA 5D5QA 2WM2A 4AD8A 4R01A 4WW0A 1B6GA 1JH9A 3K9FC 4ZP1A 3DOUA 4LOIA 2E4YA 1G63A 3DNFA 4I9FA 1ILWA 1FXWF 5A4MS 3Q8MA 5LA6B 4ZYZA 1FNBA 2C31A 1K86A 3MILA 4UOEA 4RPGA 4UOZA 2RHLA 1EUQA 3RTEA 1Y6FA 1Z29A 3NHBA 2QR3A 1W0KA 2NZWA 1IDOA 1EFLA 1W30A 1CG6A 5K5EA 2I3AA 1GU0A 2IZ5A 4JUAA 3CCFA 3F7TA 3WBKA 5CT5A 5I7UA 4IFBA 4W7HA 2G72A 2WJ3A 3CSUA 1WX1A 3EVTA 4LFBB 1M9NA 3N8HA 5IBCA 3IUSA 1IAQA 3LLSA 2NYUA 2VWQA 3KWJA 3L7MA 4YH1A 3KEOA 5CDHA 4BO3A 5JSUA 2PRYA 2XMSA 3LA8A 4FJ0A 1KXJA 1G0NA 3D7RA 2C2WA 1KYYA 3GRCA 4DRXB 2UZ4A 2K2QB 4YCAA 3VPXA 4DSZA 4XR9A 5KSPA 1TQ4A 2XMQA 3I5MA 1BSVA 3ONDA 2EX1A 4B82A 1JI3A 4XM2A 2FPIB 3N9IA 1DRWA 1GP2A 2EG5A 2GJ9A 2QN9A 2DBYA 2JHPA 3IPAA 4NATA 4BQIA 5EINA 4M99A 2EJWA 4LGCA 2O2ZA 2GZDA 4CMIA 1C1XA 2WA2A 3LTEA 2Z2YA 4TVBA 4EHKA 3CVXA 3LY7A 1ZBDA 3O92A 4MWEA 3VSEA 1E2FA 3FVTA 5DB4A 5DTEA 4C14A 1EFAA 2A78A 2V7EA 4A0SA 4CM4B 3L1UA 1PWZA 3OQVA 4KH0A 1JXQA 3DGEC 3P2YA 1QTNA 3TTSA 4AO6A 3U4QB 3UO8B 3T4EA 2CF5A 5EHXA 1AOXA 4YP0A 2YCLA 4N8SA 4JI4B 2IPLA 3G2NA 2E87A 2DGDA 3PQ7A 4A4DA 4EAQA 5F9FA 4F38A 4AUNA 2BTOA 1LSJA 2DBVO 4FTWA 4QDXA 1BFDA 4GBGA 5LYJF 3A10A 3QLJA 1XQ1A 2DR3A 5B3KA 5FWYA 5KWIA 1FRVA 2O0JA 4GMGA 3ANMA 5FWAA 2ZVDA 1ZRNA 2ILTA 2QNRA 3CPJB 3Q9UA 2QJWA 5EJ9A 1NYTA 2XDWA 3LCCA 3DBOB 3MS7A 1Y9ZA 4AN1A 4D3SA 4ER3A 3QUBA 3PP8A 4MVJD 3AKCA 3O0TA 1RW4A 1HZZC 3LWNA 2WTXA 4RJJA 1IN6A 1FFYA 1U3TA 1RLJA 4X1OA 3ZD9A 5KSZA 5KTYA 2IH4A 5HS4A 2R9VA 3FJOA 3EIFA 2HU8A 3JQ9A 4GICA 1EK5A 1UP6A 1T0BA 2HWKA 3L1VA 3U4CA 5GJWC 2AFIE 4QM7A 4TZKA 2BDUA 1NW6A 4UQPA 4D0LB 1CXZA 3A9SA 2PUDA 1BEUB 1L5HB 1XZFA 2QTVB 4DZZA 4XWAA 2J3IA 3SMQA 2ICAA 3ZI4A 4EG3A 1SCNE 4Z8XA 2JLRA 2OB2A 1S6YA 4PZDA 4ABYA 4GL2A 5KC9A 1ZM7A 3AW9A 1ESZA 3BMNB 3SVZA 1XV5A 5DLQC 4G36A 5D6NA 2RH5A 4ALIA 3GLHE 1DZ3A 4FSXA 5ALKA 2WF6A 1FNCA 1ZXBA 4KQ9A 4XQ0A 5AKZA 1RRGA 1EGQA 1QR2A 4H17A 4Q00A 3UW1A 5AW2A 1E2NA 3HFJA 4TZ6A 4URHA 2Y8EA 3HG7A 2QXTA 3FFXA 3CEHA 2YZNA 4MV5A 2ZE5A 3MBKA 1W46A 1XWFA 4XPIB 5D1NA 3DE4X 4XPZA 1IVYA 2RCNA 2J0VA 2H2HA 5EE9A 1RI5A 2GN1A 4BO7A 1ZGZA 1WXIA 4A15A 1CE8A 2QM8A 1O3YA 1L7PA 3BKWA 3OLZA 1NFRA 5GGYA 4OLFA 4QRIA 5NLLA 5CFNA 3S1AA 3GDHA 4JLKA 1QS0A 4M8IA 3FYCA 1IY1A 2XADA 3D0OA 1S0UA 4O4HB 1Z5PA 2HRBA 4IH4A 1EP9A 1C1HA 5FBKA 5KOJA 1GPH1 2C84A 2P7HA 4CMJA 2OBXA 2HMYB 2QZ9A 1MQAA 3ASUA 4KHZA 4DEYA 1E92A 1TJYA 2RJ3A 1U7OA 1YZNA 2DBRA 2JLBA 1LK0A 3OTQA 4NK5A 5B1YA 5BXYA 2WSIA 3IHWA 4KWHA 3WDKA 2UYQA 1EVKA 1JQ3A 1M6HA 2AA3A 3FSGA 5FT9A 2AXPA 3KKZA 4RKRA 4FCTA 5I01A 4Q7MB 1A9SA 2NYAA 3RUFA 1OW3B 2GKSA 4KIUA 2NU9A 3A1VA 3LC7O 3VX4A 2GN8A 3B1ZA 1F06A 4IJ5A 5KNDD 3NUQA 3RT7A 5BN5B 1XVUA 3MTAA 5KQPA 2P1RA 2PR7A 2IT1A 3FVVA 4X6XA 2HH9A 1XU9A 4MLCA 4D96A 1DADA 1HMPA 3FJYA 3OZBA 2QENA 2HOQA 2DKFA 3L8GA 5KMGA 4RD0A 1KEKA 1SFRA 5K3AA 4CIDA 4BO9A 2ALJA 1Q7BA 2FPOA 1KORA 4FYHA 1EZZA 4D6XA 3TB6A 2Q2VA 1AUOA 4KN6A 3RSQA 4BE7B 2WAXA 3CX3A 1LH0A 3M8KA 4KQKA 5JSFA 1OX5A 3JQ8B 3HC7A 3SQDA 1IB0A 4AZ0B 3PWSA 2DHDA 3VYTB 1O6FA 2I4MA 3EXEA 4V0RA 5KNCD 4TUYA 2GXSA 4JBWA 3P0IA 2P9EA 4RFLA 4BTVA 5EJ5A 4MRSA 3JY6A 1JMKC 1W9HA 1WUYA 1YS1X 1CVLA 3K5PA 3I72A 3PNSA 4LJKA 2XTNA 2Y1FA 1FJGB 5F12A 5G3ZA 1CZOA 3N2EA 1MG0A 1JQLB 2OQRA 4JOSA 3ZLVA 3ZXXA 1WZNA 2BRUC 1PJ3A 2Y76A 2ZAIA 5JAQA 2BKLA 4AX8A 1SG9A 1Z2DA 2GAJA 2JLYA 4KNVA 4RVDA 3RYFB 3VPHA 4FYWA 4NJEA 3KQMA 2A9QA 3MINB 3ETLA 3EFOA 1ZD3A 2D7CA 4Z5XA 1CUHA 1GILA 3B9QA 3L49A 4M7WA 4ZCQA 1P6QA 3G1UA 1THTA 2DHQA 2HK8A 1WSDA 2C1ZA 2IHVA 2Q1SA 3DEAA 1S2GA 4BNWA 2FWRA 2AB0A 3THWA 4EX6A 4XQGA 4OGLA 5C18A 4JCCA 2BCGY 5AKXA 5J4KA 3D0QA 5JW6A 1W0KD 2O5VA 4C01A 4NHOA 1QONA 1WPQA 5TVGA 1KE1A 1R9JA 3LBIA 4FDTA 5REQB 4CG3A 4FOSA 4OLHA 1A9PA 2FWNA 3MFYA 3KLBA 4ECEA 2Q0XA 1C0EA 2OORA 1LZLA 2XR1A 5B3LA 4D44A 1CZHA 2G9UA 1YE3A 1PDVA 5ALVA 1PWYE 4HT3B 3F7OA 5ADHA 3W5BA 1A1VA 5CB4A 1TLFA 2XECA 3QOYA 4UHFA 5DXFA 1JEQA 1ONSA 5JJLA 1WA5A 1O9GA 4MJLA 5LMNB 1H9AA 1N0VC 1WV0A 3LV8A 4AO8A 5JYDA 4R71A 1V3VA 2O3TA 3EQ8A 5A3VA 4QM6A 3QKUA 4D9IA 4JGBA 5B53A 3M7IA 2ZUDA 4JVOA 3T9EA 1YUNA 1EUCA 1QZXA 5AHWA 1ISHA 3Q7IA 2ZYAA 3NBXX 4WEOA 3TXAA 4I4TA 1FBTA 1U9ZA 3ZYCA 1AT1A 4QDUA 2WI8A 1D4ZA 1YKGA 2MINA 2D4HA 1Z74A 3F5DA 4PINA 5DHTA 1L4YA 4HMQA 1BXZA 2VPWA 1JSRA 3OCUA 4N6OA 1JNYA 1MDFA 4C89A 1ZCFA 4X7PA 5AM2A 4EG6A 5K8CA 2RGGA 5EZ6B 5TNXA 1T24A 9MHTA 3THXB 1MHTA 4GXNA 1I2ZA 1BRTA 1NNLA 1CR6A 4O8ZA 3QMVA 3A25A 1PO7A 2AHOA 4CQMD 5LKAA 3K6RA 2G9VA 3UXYA 4EA6A 2QUZA 2P1ZA 2GHIA 4KUHA 2FMTA 1HH4A 2G5GX 5LQMA 1BXGB 2ZIGA 2XZTA 2RGWA 3NT4A 4TTSA 5IJWA 2ZJ4A 4JLMA 3NWJA 2BSXA 1S9HA 2B4RO 4H35A 1BZYA 3HN2A 1SXHA 2QD1A 4AMBA 4BWVA 5JDIC 4HFMA 3TMKA 1RZVA 2CMFA 3SLRA 1SPBS 1W34A 2ESRA 2GJSA 1KI3A 2J67A 1T29A 3U1TA 1SVIA 3K0FB 3KWMA 4PCAA 4WVFA 5M04A 1XG5A 1QE5A 3DOIA 4XE5A 4DQDA 2X1VA 5CYFA 3AB3A 4OQQA 4MS1A 1UWVA 5BRJA 3JSXA 2HMTA 5E6UA 2QJRA 3VPDA 4O2AB 3V55A 1NR1A 3D8NA 4RSMA 4OKSA 4Q9KA 4WXPA 3D9QX 5JVDF 2PZGA 3AUFA 3NNDA 4W5OA 1W7AA 3MN1A 1HUQA 4L9WA 5K3BA 3UMJA 4JBHA 5KQGA 4PTZA 1OBVA 2Q3JA 4JB3A 4ZI2A 1E9SA 1OXMA 3C8DA 3HQ4O 2H1RA 4G1VA 1KEEA 1VXRA 4YDQA 3NB0A 5KTRA 5BSMA 1NRIA 2V5VA 4ZA2A 3P9CA 5DOZA 4UFNA 2VYCA 1IM2A 1B0AA 3E35A 3URKA 3W3ZB 2W43A 1P9WA 1M6VA 2WWIA 6REQB 5IHPA 4XQ9A 3B52X 3HLKA 4PQRA 1P0MA 4ARVA 1TJPB 4G67A 3HCAA 1KMHA 1ZU5A 3MWKA 5CA0A 5BMVB 2NPOA 3FE2A 5CPBA 1CW2B 1DG9A 2V58A 4RH3A 5EXDA 5FORA 2V7UA 3FYTA 2PA0A 4JT8A 4W7SA 3IP8A 3ULKA 4YUZA 4CM8A 3B5JA 5B1DA 4G8CA 2R11A 4Z1OA 4HATA 1C8KA 3BILA 4BVKA 3LWZA 1LD3A 1FP4B 3D4OA 4J16C 1Y8QA 1U7TA 4N0QA 1BW9B 1L4FA 2OMKA 3A2LA 4KJXA 4KU4A 4L9AA 5I7RA 1GY8A 1KJNA 3P9ZA 1SVWA 2ZIWB 1L4HA 2Y9MB 4MGIR 4DTIA 3OJEA 4MV6A 1WF3A 2AOVA 2C5EA 3HE3A 4OHMA 3N1UA 3SDSA 1JEEA 2NX2A 2QAGA 4NV0A 1DOHA 1MO6A 4N0DA 4LHEA 4BMCA 4IS2A 4F1KA 3A4TA 5IK2D 3NASA 3IEXA 1QYWA 1E5XA 1U6JA 4Q4JA 3OE1A 3GB9A 3H0EA 5CYOA 1I94B 3A05A 1NNI1 3Q85A 1AU9A 1UPCA 1JKJA 1PJLA 1JEDA 1Y4UA 1UINA 2IX9A 2QT1A 1VJTA 5SYMA 4IJUA 1FDUA 1NNSA 2D8AA 1DIGA 1W1IA 3FR7A 1P17A 2XNDA 1QF7A 2I66A 4RZSA 5DN6A 3PXEA 2XE6A 2XUOA 2M98A 4IDAA 3H75A 3OHPA 4RFSB 1E1QD 2XVZA 4HZGA 1L5ZA 4NZZA 3FOAA 4M8KA 2VCYA 4WCFB 5KWVA 1RRVA 4PR3A 2O8CA 1O77A 2FYTA 1OT3A 4FPXA 1CQIA 3I9V1 1J2TA 1S5PA 1ZL0A 3UTDA 1TYEB 3PPVA 4B3XA 2GTHA 2BKVA 5JV5A 1RPNA 4PBTA 1SUFA 1TRKA 1ZC4A 2PKRA 1VPTA 3GFPA 3W8EA 1K8RA 4NESA 2YC2C 3OZFA 2IY8A 3WGGA 1RBMA 3T5BA 3PX2A 1N25A 4ZZ0A 4TTVA 5EVCA 1T35A 2VYFA 5DCWA 2OCYC 1FFCA 3O31A 4Y2JA 3ZHRA 2RJNA 4WBXC 4DZRA 4W5RA 1QH1B 3JQDA 4DSTA 1DPGA 3PR3A 4Y2SA 4WZBB 4NH0A 2CZCA 4DY6A 2OCPA 1PV4A 3OH8A 1IB6A 2I6GA 3F3MA 2H4WA 3T7IA 2G5CA 3MTDA 4LJ6A 5FBZA 3RE1A 4EFLA 2ZKLA 3LGSA 3U3KA 1N1GA 4KPFC 4C7KA 3VZBA 1ZMTA 2CZQA 4K86A 4MA4A 3N8IA 3MS4A 1TIPA 4W8HA 1OYVA 1U1FA 2R751 5M7EA 1F7VA 1FS6A 4M1ZA 4MI6A 5LP1A 4EI8A 1WNTA 2COUA 5FP0A 1L5SA 4DJFC 5HZHA 3ZI7A 1GR1A 4GRAA 4A1FA 3IAHA 4C3VA 4CT0A 4CUKA 4LYDA 4PPYA 5LA6A 1OJ7A 3BWXA 3KKMA 4GECA 1UJ4A 1VRCA 3LCVB 4FFRA 5F98A 5INTA 1R64A 1OHHD 2EKZA 2O57A 4OL9A 4P22A 4WZAE 4H7JA 2JAXA 4P3YA 4UM5A 2GILA 2C2GA 2J8ZA 2EWVA 4UUPA 2PUGA 2DKOA 4YMVA 3EW9A 3U56A 2G76A 3I83A 2FV8A 3RH0A 2B34A 3ET4A 5KSWB 3OESA 4JSTA 3F6CA 5JOQA 3OZEA 4UC0A 1Z7YA 4DRXA 5TMBA 5JNLA 2QQ0A 3A2NA 3RC1A 4IEEA 2P40A 4FZ3A 1SBHA 4J91A 2Q5JA 2ECQA 3QFFA 1MN6A 3T3EA 2OHFA 2FPIA 4C0BA 1V6AA 1I4WA 4JUCA 3OOYA 2OFPA 3CY6A 4LGVA 3WMGA 4D9NA 8ADHA 5IARA 2XYVA 2O7QA 4B34A 1XLVA 4ZKDA 2C54A 1Q83A 4OHYA 4PEVA 4WQMA 2WB2A 2VHTA 1QLWA 4PC7A 2NVOA 2C42A 1K7XB 3GVCA 4FC7A 4GYWA 4MLPA 3UWKA 1ZOPA 2VXCA 3L40A 4B6EA 2IU4A 2DP4E 4QSMA 4WLNA 2PIAA 2EFYA 4CM4A 1SKUA 1WUIS 3EVZA 3FHCB 1LQUA 1TUIA 4XYBA 4GLJA 1I2AA 1Y5IA 3H5AA 4M4SA 1A7AA 1YHNA 4PIMA 4Q1DA 1P2FA 3OJLA 4WJZA 4YASA 4YQZA 1Z17A 1NMEA 4EVSA 1OXTA 1L5LA 4PGAA 3EXHB 1J25A 1M0SA 1RM4A 2Y99A 4MQMA 3SZGA 1XVTA 2QUBA 4H1TA 4ACBA 2QQGA 2FG5A 2UYYA 4P38A 4P32A 2HHCA 1S89A 3G0DA 4PHTA 2ORWA 4ZRMA 5JTTA 4QT4A 2O8EB 1TU4A 4LY6A 3LDAA 1BYUA 1VIAA 4RKYA 3SPXA 1W94A 1JQJC 2WD7B 5IZCA 3RARA 1XI2A 1VJGA 3S5JA 5AI6A 5DU2A 3SJUA 3FLAA 1Z5WA 1U81A 5ICEA 3E82A 1DEHA 2XVMA 1H2RS 1YVUA 4K26A 4QFDA 3H1FA 1UC5B 2G4VA 1QM5A 1C41A 1YZVA 3H8JA 1J2EA 2BTEA 3AF1A 4NICA 4YUXA 5SY9A 1FTYA 2GK3A 2IZ1A 2ZRAA 3QEKA 4IDNA 4LJ9A 5DXAA 1UAYA 4N76A 4DDKA 2VR1A 4LTDA 3DO6A 4I3FA 1I10A 1E59A 1G2QA 3C6MA 4UVGA 2QTVA 1L5HA 1L6RA 2B3TA 2PKCA 3PIDA 3H3FA 3E23A 4BMZA 4P98A 2EJVA 3P19A 3D5QA 3IP6A 3K32A 3U26A 3ONVA 5HKKA 3BMNA 3LS2A 2HF2A 4ER0A 2AEMA 3VV2A 1ZU4A 1CU1A 1T9AA 3CPEA 4NNPA 1TECE 2NSDA 1FVOA 3UK2A 2C58A 1NT2A 5LKRA 2GF0A 3UG6A 4CEIB 2X6RA 4QNNA 2IYYA 3C8UA 3EIWA 3A3OA 1AS3A 1FA9A 3CSDA 4M76B 1KI7A 4UPDA 4M0DA 4XSHA 5FRDA 4WBNB 3BPSA 2FPLA 4ZHQB 4CF4A 1I3LA 2ZJ0A 3RADC 1CJUC 3GOHA 2DFKB 3U37A 4QTZA 4DR5B 4UAVA 1KETA 1XVAA 2L19A 4IV0A 4NCNA 3X1DA 4BNLA 2GLTA 3GJYA 4E30A 3VZDA 4JI3B 2HSGA 4RQBA 1GQOA 3AUUA 1ZAKA 2OZLB 3VVCA 2UXDB 5SYAA 1JHUA 1OKKA 1WTCA 4O4HA 2FAXA 2ZTUA 3V7NA 4Z4GA 1OFVA 5TS2A 3ZE6A 1S96A 4O4JB 1N7JA 4KRXA 4MVJF 4E15A 1DAEA 4BGIA 3HSKA 2ZW9A 3WI7A 5CXXA 2C7BA 3OQHA 5B1SA 2R96A 1Z4PX 2PXXA 3EEFA 3DB2A 5AHOA 3V00A 4H08A 5HHTA 5EHIA 3CG4A 4L0CA 3WMXA 3NXKA 2HMUA 2LP4Y 4PCLA 1G18A 3GRPA 1Y7IA 2XNDD 3BB3A 3D3WB 3I9OA 4GMKA 2O5CA 1U1GA 1GFSA 3MYYA 4PCUA 5I8ZA 2MMGA 4CKEA 3SN6A 1T2FA 3ZE1B 3IR5A 2XRMA 1RWPA 3F8TA 2J0EA 1E0DA 5BN5A 4AROA 4J9VA 4KUGA 2HLDA 2CSXA 1XN1A 3BE4A 3PCTA 1I7PA 2Q1XA 3MLEA 3I12A 4U3JA 1SUEA 1W48A 3KKKA 4DILA 1CWUA 4DXHA 4KLNA 4BU0A 1JJIA 2G4LA 3FTEA 2H1SA 3LYLA 4BECA 1GPYA 5BW6B 3U7FB 1DUVG 4O2LA 4RY8A 4YXFA 1YOBA 3BH6A 4DWJA 1AC5A 3SXJA 2IUYA 1LF5A 4B3RB 1PR4A 4IHJA 1IMOA 1G17A 1RBQA 1T26A 2ZRHA 4FW8A 4LRYA 3JQ8A 1JPUA 4J0GA 5ICSA 4L02A 4M8SA 4IQ0A 4AZ0A 5B7PA 2DFLA 1EYZA 2Q6LA 4TQGA 2R00A 4YRRA 4F5WA 4RJIA 1T8RA 4X44A 1DKRA 1IUOA 1Z34A 2EBWA 2R25B 3UHPA 4DNOA 4MINA 1I7QB 2HU5A 4XEHA 5I8PA 2X4LA 1QDEA 5FBVB 1UJ5A 3KLMX 3MPOA 3ZJVA 2C7OA 2Y0PA 2W6CX 4F60A 3WLIA 2BTQB 4JEMA 4JT4A 1M0EA 5IFLA 2NU7B 4BHTA 4HGZA 3RYFA 2NYVA 4UM7A 3H6GA 4KQHA 3MINA 4TTIA 3F46A 3OSZA 5DFAA 1M5RA 4ZMSA 4RMIA 4UNSA 2YVKA 5HCNA 1RIIA 3E9YA 1EE1A 1QFYA 1RZ3A 1Z9BA 3MCWA 4OQDA 1KKUA 2XQJA 5AVJA 3DMNA 2P2ZA 2JI6A 4LE1A 3VO1A 5EIFA 4K7JA 5IBRA 4C0QC 1J97A 3PICA 1PSDA 2Z4SA 2IHYA 5BUQA 4V39A 3WRXC 2W6OA 1GLNA 2BV3A 4QYSA 1T9CA 1EDZA 4QD3A 1Y8RB 4P5DA 4FP9A 2GXAA 2IH5A 3L07A 5D3KA 3CT4A 1SN7A 4GZ6A 2PWZA 1TM2A 1WSBA 1YR1A 3RTCA 2XTJA 1HG1A 3TIXB 1WSAA 2O2XA 3V8RA 2W2KB 4CKBB 2V7VA 3A6EA 1DC3A 1N5IA 4GX2A 1YXMA 5TV2A 1XKTA 3C3CA 4MAFA 1JJAA 2GEBA 4F2HA 1Z6XA 2Q5EA 1QLHA 2RBEA 2PUFA 3A06A 3D8UA 2QAIA 1BXRB 3FRHA 5I4CA 4IVRA 4BFUA 4OU5A 2J5QA 1HE5A 1HYBA 1T4BA 4HXEB 3AHGA 2Q3EA 1GQYA 3COPA 1TJNA 3EC7A 3VHQA 1A82A 2XBUA 1BS9A 2QMQA 4XRRA 3F47A 4K40A 2Z3ZA 5ICGA 2FVXA 2YBDA 4F2PA 1FYWA 4Q39A 3M6FA 3U09A 1KYTA 2I2DA 4TTRA 1H2HA 1N2JA 4ZPJA 5H7XA 4C6HA 3SZOA 1XLTA 5LWHA 5JPCA 1U6KA 4TVSA 3ZPXA 3HUFA 4B47A 1QIMA 1ATZA 3QVOA 3CT6A 5AP9A 5SZIA 3THXA 3MBOA 1ZRHA 4TWJA 2O7VA 4MSUA 2PSDA 1NI4A 1JQ5A 2DG2A 5JYBA 2FCAA 1X1EA 1QANA 3MGBA 1FDSA 1OF1A 1R0KA 3HBMA 3GBSA 1BXGA 4HC4A 1ENOA 3M1LA 2O7SA 1MEOA 1VG0B 1GTMA 3DP9A 3K2IA 3EWAA 5FF9A 3M82A 4BWFB 2K7FA 3B2EA 2QU8A 1TM1E 1TDJA 2AC7A 2M6SA 3L8ZA 3P1JA 1TO2E 3SOZA 1D5CA 1RNLA 2PX4A 4PZCA 4WA7A 5A5FA 4XGKA 2VJCA 2ZI4A 3PXXA 2YQ4A 4F85A 1DCMA 1Z68A 2G71A 4OG2A 3PUZA 2ZZMA 2XCOA 4EW3A 1EQ2A 4TKVB 1Z0SA 3DV9A 5EJGA 1R7RA 3K0FA 4JYZA 1I9CA 4FS8A 3A4NA 5CK5A 8MHTA 2L42A 5E3IA 3NV9A 5DXJA 3N0WA 2A57A 4MEJA 1RFLA 3N2LA 4CI9A 4O2AA 2WA1A 1ZNYA 4FGJA 2QGZA 5KDLA 3OFKA 1H2XA 2ZTLA 1DELA 3BERA 1IRIA 1WR8A 4P83A 4KREA 3ESQA 4XWTA 4HY3A 4RYLA 1QQBA 3GUYA 3BMOB 2DWUA 4X8MA 2MT9A 5CFPA 1XNRB 5HKKD 3HCFA 2YWGA 3PEVA 1T9KA 2XW6A 4U7PB 4EYQA 4PTYA 3IEKA 3A6KA 4KX3A 1LS6A 3HH8A 2FW8A 2ZREA 1XZEA 1R0ZA 2HJ9A 2CHUA 3G9ZA 4WLVA 6REQA 3RJ5A 1HDOA 1HORA 1XNJA 3WB0A 6GPBA 1O95C 3WVNA 4AC9A 3TTYA 4YMHA 5BMVA 5J4VA 3VKUA 3T1HB 3H1EA 2GK6A 1M2VB 3HJGA 1OAOC 2OLEA 4GGMX 1JLMA 5BYBA 3QKWA 4PTLA 3RT9A 4CF5A 1Z3IX 3T7AA 2BKEA 1FP4A 3GJ0A 1TK2A 1BW9A 1L4NA 2BGNA 3A26A 3GMSA 3DDCA 1N57A 2AR9A 1GVHA 2HSZA 2D1FA 3QI7A 1EDBA 3OURA 4OXNA 1C50A 4S35A 4DMMA 1P4HA 1SVLA 2A30A 5IT5A 1SCKA 1WOYA 3NGLA 2IWHA 4AW9A 2ZRQA 2YS7A 2GGSA 3BIXA 4A6PA 4X54A 2FDCA 1VL1A 3X1KA 1NDQA 2ZRJA 2IIVA 1Z18A 3QZUA 5DI9A 1EXVA 3IC5A 1OREA 2YFKA 3BXXA 1Z62A 4FYMA 2VJDA 1RXIA 3V4ZA 4FLMA 4AQYB 5H80A 4YUAA 3M6XA 5IYZA 4ERNA 3OTGA 4B9EA 2JLUA 5EESA 3WKDA 1NF9A 1KMQA 4NOKA 4A3SA 2H63A 2VC2B 2C0CA 4D42A 3I04M 3I9JA 2OESA 3VDMA 1KHTA 3ETEA 4RFSA 4DEXA 3D6MA 3IT3A 3IS3A 4WCFA 3IE1A 4CF3A 5BWLA 1WEHA 1D0SA 4HLUA 1VLMA 4RVUA 1A69A 4KYTA 2G1AA 2HLDD 5H59A 3GLHA 1T4MA 2IELA 4UEKA 1WVMA 2V7QD 4CL8A 1PX0A 3L7IA 3RDPA 1FP1D 4OI1A 1HFKA 1TI7A 1X1DA 3CRW1 4A8HA 1NW4A 1W6RA 1P1HA 2WFZA 1F4PA 2DRIA 2HBYA 1V35A 1DWOA 4G9GA 4X3PA 3JR7A 3HNPA 1HEYA 3ZWQA 2VF4X 1F0NA 3FFWA 2AZTA 3PC8A 4B46A 3BTVA 2VBGA 2RGDA 3RS5A 3D4IA 1NUTA 3ZD8A 1P2SA 1I1OA 3NDJA 1QH1A 2BD0A 3UMSA 1RWQA 4C7BA 5HWSA 2C78A 4MPPA 4W9MC 1D2NA 3REQB 4EI2A 3Q9NA 3H5NA 5HRUA 2M6KA 2FDXA 8GPBA 4CF6A 5JHHB 4IKEA 4FMDF 3T35A 2OAGA 3HJUA 2VPZA 2G08A 5CEEA 4OBBA 1O4WA 2CNDA 2H31A 2P8JA 2VJQA 4AAYA 3C3XA 3W34A 2B0CA 2E89A 2WJIA 4IIDA 1O0BA 1A5TA 1GNTA 1U90A 3DO8A 3M2PA 4FWBA 4HG2A 4TL7A 5TARA 4YGYA 4PICA 4MP6A 4ADSG 4A0QA 2HCRA 2KLBA 3COJA 1QYCA 1XKXA 3FH0A 4K6MA 1V1JA 4FXOA 3FI0A 3UAZA 3TW6A 5C8ZA 2XQKA 1NF3A 3PLNA 4MCIA 4KBGA 4X93A 3GA5A 1NJ5A 4YI5A 3IUBA 2IYLD 4JQYA 4LBZA 4UASA 2L2QA 2OP0A 5ARDA 3GNLA 1ODFA 1RI3A 4M53A 4PX5A 3OPNA 1GZ7A 2VZ0A 1DKPA 3DLTA 3UYKA 2GD6A 4IIFA 3VUFA 2RGNC 1PR5A 3M3DA 3M6VA 3Q8XB 3VNRA 4BATA 3MS2A 1PF7E 4N5IX 1NLFA 2ODWA 2VZEA 4TWBA 2C7RA 1QP7A 1M1YE 4M1QA 2HIGA 3CX8A 1Z7GA 3N2GB 2BMWA 5ALOA 4ZT7A 3GJ3A 3LVRE 1USUA 2X2FA 2IYWA 3NIFB 2QTCA 1A5AB 4YT8A 1NASA 3OFND 3S1LA 3DHYA 5AIBA 1OTXA 3GXBA 2KHZA 1ZRSA 2B5OA 3FYDA 4ZWNA 3U6KA 1JEYB 4QBFA 2QM0A 3MWDB 6NULA 2EZUA 5JALA 3QEMB 2AMFA 2XQVA 1A96A 5DNAA 5ESWA 3S7ZA 4BCBA 2C2MA 3WP1B 3NIGB 2IE0A 3MSCA 1FFXB 4JNKA 1M74A 4ZI7B 6YASA 3E70C 5FOQA 4W4TA 1P5FA 3EXHA 2QDXA 3EIEA 4C07A 2X9LA 2A0FA 3PUKA 1U0SY 5FEUA 4A5OA 5IS2A 1YZUA 3IQFA 4RPCA 3GGDA 3QKTA 4GXRA 4BB9A 2O8EA 2P4QA 2B8WA 4G63A 3FOBA 2B1QA 3VSAA 3QLUC 3A9WA 2K7ZA 2WD7A 1NBME 2NSHA 3WGQA 2P6MA 4K1LA 3VVLA 4ZYYA 1R4NA 1L7VC 3WLFA 3W9UA 2KWIA 4C08A 4CM6A 2C9OA 1T3GA 2XYRA 1FQOA 4BJ1A 2V74B 5CVTA 2NVWA 1CDZA 1H1DA 3DUWA 1IJEA 2HJWA 3IUMA 3MT7A 3PLRA 2XVXA 5CTJA 1SD1A 2GD0A 3P9KA 3RW9A 4M1OA 1PR0A 1JP7A 2WAYA 1XRNA 1NN1A 4U6NA 2D00A 4MUFA 3AZPA 2G80A 1RXUA 2DUJA 2QY9A 2VNIA 1CQXA 1RZRA 3QVUA 5JI3E 1DJOA 1KU0A 4JWTA 4P86A 1SBIA 3UMGA 3ESRA 5EE3A 1LDBA 4PWZA 4D8WA 2WJ6A 1WCYA 1Z0UA 4N7BA 4R9UC 4EHAA 5LIRA 4N5LA 1G8SA 1FP2A 1TJ4A 1LWNA 1Y1LA 2WE8A 3AEUA 1ENPA 5JZBA 1ZUD1 4Q1VA 4AQDA 2B30A 4TXJA 4CEIA 3VR6H 5EKXA 2Z8ZA 4PPFA 1SURA 1GPLA 2FB9A 2P5YA 3IEUA 2VP3A 4WIAA 4AMZA 4QU8A 2XF8A 3OZDA 3PNQA 1R10A 2WKWA 4Y2XA 1YZLA 4C22A 4WBNA 1N8KA 2O7NA 3P2IA 4ZHQA 3LHKA 4WXHA 1ZOLA 4DA7A 2XT6A 4RIIA 4ODIA 4F91B 4JLJA 5JFTA 4A0HA 2LXNA 3OU2A 5HF9A 1IJFA 3UXMA 1YS9A 3V6MA 5LDHA 3CJQA 3Q4GA 3I30X 1AZWA 4OK3A 4NIMA 3ZIUA 4IV8A 2IYSA 3C6ZA 1AGPA 3Q10A 4YREA 2OZLA 3GVHA 4OHOA 3X1XA 1D6JA 1XTQA 1O03A 1XTJA 1ZOIA 2RGAA 3N86A 4OGFA 2Q2NA 1G19A 4OV6B 4C03A 4AZSA 4O4JA 2GZHA 4KR7A 3ENWA 3H7IA 4Q18A 3KPUA 1CZKA 1XZIA 4OAQA 1TZCA 5LQKA 2PH7A 5CAEA 1L4LA 2AYZA 1B6SA 4OGWA 5KTKA 1RBYA 3JXEA 3IIJA 2N1MA 2FN9A 2ADOA 4O0MA 1RWXA 3EFEA 1U80A 4R2KA 2Q6OA 4RQTA 1NOJA 4HNUA 1HQYE 1FYVA 3FI9A 3D3WA 3HB9A 5EJAA 2C2HA 5E7IA 2J3EA 3TAXA 3VHXB 1Z0DA 4EYGA 2FOLA 3AXTA 3DEYX 4Q24A 4CR6A 3PJRA 3GRVA 4MB0A 3W7VA 1GA4A 2D2IA 1EVZA 2EFDB 3AR2A 3WISA 1GYRA 2IDJA 1YRBA 2WIFA 3LP5A 3ELUA 1CF4A 1CUXA 3DPSA 4ZOLB 3ADKA 3ETDA 4YALA 3RYTC 3TNJA 1WU7A 3NVDA 2CXTA 4W1PA 5ENZA 1XCMA 4QUAA 4MI9A 4AJ4A 4F71A 4G1EB 3VA7A 3D1JA 4WK6A 3UGJA 1V8DA 1FFEA 1YOVB 1FP7A 2H9IA 2ZI3A 1ZG3A 3KKNA 1A7JA 4RJKA 1VKRA 3GRRA 4U2KA 4BL5A 3CZMA 3BK2A 4RK4A 5L4NA 4DCCA 3I9V6 4L8GA 1QPGA 1U4OA 5DNEA 1HQCA 5CH8A 2CL6X 2BHLA 1HNXB 4BNXA 3KSBC 1USIA 5CLLA 4L07A 1P18A 1CQPA 2I8AA 2DUUA 3WDLA 1LBEA 1Y6JA 2ATEA 3WLEA 2OQVA 1NSFA 2PS9A 5I6DA 4XX0B 2PLWA 2WT8A 4D0NA 2AYYA 3TKLA 1NYLA 1GNQA 2YNMA 3JYHA 1RWBA 2ZB4A 3NU1A 4BO8A 1UL1X 3TKYA 4OVKA 5DHQA 5ED0A 2BTQA 3RS8A 1TYAE 4P58A 2NU7A 1Q1AA 2P65A 4Q03A 4IL5A 5JWOA 2XSZA 3QK7A 3PX3A 1ULBA 1ZC3A 4LDAA 3FLEA 3GDWA 4NE2A 4OSEA 2G63A 3FPKA 1JZQA 1N3LA 3JQAD 5BSHA 1PCXA 1UPTA 3KZKA 3NHYA 1KDOA 4TT3A 1XHLA 1T8TA 1G64A 5BSFA 2D7DA 3OF2A 3SQNA 3A7EA 3CR8A 1JKIA 4RTRA 2Y1KA 1X1RA 2DX7A 2OXEA 3L77A 4KFCA 3IVGA 3U4HA 5K7SA 2GEKA 1QSGA 2ZSFA 1C7FA 4TM7A 3DBIA 2VRWA 1Y8RA 5AVYA 4P0PB 2GBLA 2W2MA 1E2BA 1KOJA 4C7VA 2Y05A 5K0JA 1Y1QA 1U1EA 2F55A 5D00A 1JH8A 1T25A 2QHXA 1L1QA 4IZIA 4AU1A 3S55A 1SZDA 4N3CA 2W2KA 4YJ3A 4B0PA 5DYGA 4CKBA 3QNMA 2R97A 2VNSA 1I3KA 4Z7OB 3FDZB 3C85A 3FXAA 4MWSA 4B3CA 3UNXA 3USZA 5KYTA 4FBGA 2GAOA 3MIIA 4PLTA 1BXRA 2R6HA 2Q21A 3R7WB 4RK0A 4BBZA 4MUGA 1A4XA 2E1RA 4WK0B 4XB6B 5E6RB 2VF7A 4QOEA 3SFVA 3QELB 4B6RA 3N0TA 3GJXC 2WKPA 1ZGAA 2QVCA 3AJRA 4RD3A 1SWVA 2HNBA 3E1KA 1QRAA 4P82A 1PV2A 5ALLA 3WGHA 2GAFA 1V16A 1LPAB 5G02A 4TTQA 4CKWB 3BFJA 3DEZA 4X62B 5JHGB 4FR0A 3DFKA 4DCJA 4JXJA 1GNLA 2ZAOA 1ZL2A 3MCVA 1U04A 4MPTA 4Q1BA 3QQ5A 2WNIA 4J4TA 2WMYA 2N47A 5FADA 3B7GA 4HNTA 1UM9B 3CC8A 4EJFA 4KMOA 4MW4A 4WT7A 5AVUA 5IWAB 3KQKA 4MULA 3NALA 4GOLD 3KLNA 4DXAA 1P9OA 3JQBC 4P8RA 1U8AA 2ZYSA 3TRKA 4LOLA 1DXQA 2HO4A 1S1CA 1UQUA 3I05A 5EHZA 2P9FA 1IXSB 2WIKA 1U94A 5KYYA 2XNHA 3EZ9A 2RARA 1KO4A 2Z3WA 2AR7A 2IEGA 2G83A 3VNQA 4URVR 3G7NA 2RC6A 4TYWA 5IM4F 2BISA 3A4VA 3TBKA 5JH7A 4JP2A 2VDOB 3WXMA 3D4PA 3GJZA 4CV2A 4TKVA 2AX3A 3RRBA 5ADVA 4PC2A 2CKMA 1V6SA 3ZQUA 3TW0A 4LZJA 1Z2CA 2R4QA 3UKDA 3EEIA 5CBPB 3ZYZA 1WVGA 4RVFA 5BPHA 3AHDA 5TQ2B 2PFGA 3PCRB 3DE5X 3E8SA 1XXLA 4AZ3B 1CRQA 1ZJJA 2C88A 5AIAA 5K0BA 1G9TA 2YVAA 2ZRBA 3IAUA 2QVGA 3FNFA 5CFZA 1M1YB 2CLSA 1H66A 3OQBA 1QH0A 1W6UA 2FPUA 3PGMA 4FNAA 4BMPB 2JCBA 5HYVA 3K71B 3ED5A 1JFFB 3LVFO 2R1TB 3BMOA 4IJVA 4UDNA 2QG4A 5EVJA 3S7TA 2Z08A 4JBXA 2I3ZA 2QR5A 3QV1A 1YH3A 4G0YA 1NTOA 4QBTA 5DEIA 2WWTA 4ETNA 1B6TA 1ZISA 5C8YF 4ZXFA 2A94A 5FWDA 1DCFA 2C98A 3KT8A 4HS4A 4H1VA 2WOJA 3TIVA 5IRCD 2W6IA 4PFQA 3QEBZ 5D5PA 3NHLA 1V5WA 3AY0A 3DL4A 2DWPA 1M2VA 2JEOA 4PSVA 2PX3A 4LE2A 5ALYA 4AWAA 4UCWA 3SR3A 2BHNA 1GKYA 3OPVA 4CV0A 5IKPA 5IFKA 4XD7A 3BCUA 4OX9Y 4OOFA 3EPRA 2H1IA 3QY9A 1LKZA 5TQ0B 5ECWA 3O4VA 4R3UC 1I30A 3A6PC 5ERXA 5G0VA 2PMWB 3MJEA 4C4TA 4DPMA 3O9ZA 3F9CA 3TZCA 3BK1A 4ES6A 2XMGA 4GPD1 1XL1A 2QX6A 4TXNA 2YL2A 3WAGA 2JFOA 4MVCA 1H4VB 4R0MA 1LX7A 2ZBUA 2YVLA 1H8ED 1WL8A 2WVGA 1Y80A 4KL8S 1NMSA 3FHTA 4Z7JA 3AO0B 3C14C 2WVAA 1EP2B 3A9UA 1P1IA 1HNZB 1E3MA 3KEFA 4LAFA 2CVZA 4RIGA 1C3XA 3QPWA 4IDFA 5EZ5A 5BV1A 1IPFA 5J2UF 1Y3HA 3AERB 3N2YA 3ZI0A 2PYZA 4YO8A 1G20B 2AJLI 3ZHVA 2Z9BA 3LKVA 5IJ0B 1LPOA 2E48A 4IHQA 5CA1B 1DLJA 3U4DA 3K9LA 4ITRC 1ZRMA 1UDAA 4HPXB 2H85A 2WUWE 2C4TA 4MW5A 4BS9A 3CLVA 2R87A 3E22B 5A04A 4D6PA 3GAMA 1MQ9A 2GNOA 3WBFA 3ER8A 1KOFA 1BQ3A 3C6YA 3K9HA 2O20A 4LISA 4MHOA 4LSZA 4RF3A 4AJ1A 2ERYA 4RQUA 4EW6A 2CJWB 1JPVA 3F1KA 3OE7A 2HGSA 2VNKA 3KVVA 5KI6A 3MYRA 4MQ5A 3BWEA 4DSAA 4YPFA 4IICA 3CZ9A 4AJLA 1SEVA 1HDRA 1XCJA 2Y4OA 4JT2A 3KWLA 3FUWA 3NBYC 1GNVA 3KD2A 1HRKA 1TAHA 3W5SA 1RAEA 2B0JA 2JJ1D 3FZQA 3QVVA 4JAVC 2Y6VA 3CO0S 3E0XA 6AT1A 1TC1A 1KMIY 2GWRA 4QPNA 2FPRA 2PS0A 4DPKA 5FUBA 2F3QA 4NS4A 3AUJB 2R8OA 3EVDA 1C0PA 4C4YA 3REQA 5HM6A 4Q34A 3W6PA 1K27A 3HCEA 4JY7A 5HEKA 3C24A 4H6XA 3CF2A 3OPMA 4XW2A 3TRDA 721PA 1WEKA 5ILGA 4AULA 2O50A 3VR3A 3HYLA 1E9AA 4ARBA 5GVRA 4B6OA 2OXTA 5JLJA 2EC5A 3GFRA 2WWHA 3H8WA 4S12A 3K72B 3WGJA 4QJIA 4B4KA 1GRCA 1K6XA 4Q3LA 1H85A 1IHYA 1NBAA 2Y71A 3WAKA 4TT3D 3ZWWA 4BP3A 3KQNA 1XXHE 4GPIB 1TT7A 2FZGA 2ZE6A 4FZVA 4H7KA 2BGWA 4GMFA 4XGQA 1W4ZA 3ESCA 4BNMA 2MSWA 3FNQA 1KYXA 1ABEA 4LZLA 1DKOA 2EJCA 3L0CA 5IVDA 2CBZA 5BSUA 4F8JA 3HHPA 4FE3A 4IFIA 5G2OA 1NSTA 4IIUA 5FOXA 1MAWA 3EASA 3RC9A 1W4CA 1EJ2A 3KJNA 3L4SO 3UGTA 5KX5B 4WDRA 3GLIB 1HDIA 4N49A 4JI1B 1WMSA 4RF2A 2LW7A 3AEXA 4N3GA 1ZD5A 4B7CA 4G4IA 3ZJTA 1BCSB 5FDFA 5DRTA 4EZIA 3KZXA 2Z04A 1E2KA 3F0TA 3WBBA 5ALGA 4MV4A 4QTUB 3ROZA 4WLOA 4ENPA 5FHRA 3H0KA 3HACA 2BFFB 2VT2A 2Q8NA 1IK4A 5CVEA 3D1LA 4X8HA 1XO1A 3N2GA 4A6DA 4UM9B 4ND7A 1GDDA 2Z4TA 3C3EA 4QU5A 4B3SB 2NNWB 5A0VA 2XVYA 2VP2A 4BQNA 2H4FA 2XOXA 5HP4A 2HJGA 3K9CA 2FPKA 3PVSA 1MP0A 1GITA 2H29A 3LCRA 1PNVA 1G42A 1KGDA 3O73A 1JEYA 1PJAA 3W7AA 3H4VA 3MWDA 3T9DA 2JGLA 3QEMA 3NG1A 5C5IA 2X13A 4JU8A 3UUWA 1QG2A 3FETA 4HNGA 2QM3A 4ALLA 5G1PA 3OZWA 5TB5A 3IKTA 1ZN8A 4EX7A 4QFBA 4ZI7A 3AF0A 2GCNA 1PRYA 3CEJA 2WZBA 1QHYA 4Z4HA 3JU3A 4L5YA 4DLRA 3F4BA 3KOYA 1BH2A 3OIFA 3IALA 3DOEA 2AG5A 1J09A 4C0XA 2J4DA 2J7PD 1ZVKA 2FR8A 3OJWA 3JW8A 4WFIA 1IM8A 3N28A 1QIDA 1Z2AA 4J7AA 4NYMQ 4J49A 3UJ7A 1VHQA 3GGOA 1S3SA 4EEXA 2W2TA 3EZXA 4YACA 4B74A 1P0IA 1IOZA 3CVJA 2AG6A 3L8MA 1AQIA 3O95A 4RPLA 1JBEA 5IWCA 4Q3BA 3VR5H 4RVNA 1RXYA 1UUFA 2G9QA 4FFMA 4LOHA 1ITZA 4LKOA 4E4RA 1JEAA 2Y9PB 3OI7A 3S1AB 2EBHX 1ISRA 1J0CA 4RM2A 5F1PA 3T5MA 4MWTA 3EDCA 3ZVLA 4C76A 1N8NA 1E4OA 1N5KA 3DZJA 1ZIDA 4H6WA 2CZGA 1GJRA 4L4RA 5IP5A 2C2YA 1AF4A 4CLDA 4Y18A 2LD4A 4DBLE 2ZT7A 1ST3A 3LDHA 1XDSA 3C0KA 2JDIA 4DABA 5CVVA 1T3HA 4IXNA 2X8AA 2Q6KA 2X8BA 2Q27A 4ZAYA 1UDCA 2KYRA 2QMYA 3F71A 4KN5A 2I80A 4G5GA 4MMXB 1SU6A 2Z1MA 4NABA 1A04A 5GOTA 1BN7A 3O38A 4WNIA 4N3AA 2NAPA 4ZOAA 1C7JA 1XRLA 3OX4A 4G01B 5GPBA 4DLKA 1TNDA 4EGFA 2VTEA 1GPAA 5DF1A 2D2XA 3JQ9C 3DVSX 3MMZA 3RTAA 1FRNA 2I7TA 4FWTA 1XNQB 3PFHA 4R7TA 4I6GA 5DTIA 2Q3BA 4DRYA 1XPUA 3MC1A 4ZD6A 3UAGA 4R9RA 3CZQA 1NJFA 1SC3A 2QZPA 3M4NA 3OWXA 2FTKE 4XQCA 4HMOA 4RCZA 4PF1A 3EGIA 3DP7A 4XD7D 4MJXA 2TS1A 3HJAA 3LYHA 5JNWA 3U7HB 4L8FA 1C7RA 1G3IA 2BI8A 1JDNA 3KZ1E 2IS4A 3H84A 1TVEA 4IAOA 5KUTA 3ONWA 4YXWD 2IODA 3K0CC 3LKDA 4FLEA 1N1MA 4QKQA 4M3NA 4ESVA 1DJPA 1NVFA 2CUNA 1WXQA 3P9RA 3SYRA 3VRHA 2ORVA 1I6KA 1X3SA 2PEYA 3G9UA 4B45A 2IS1A 3WFZA 3MTBA 4YAFA 3FTCA 4DG9A 1V3UA 2BY4A 4R9NA 1A4RA 2HCBA 2P2SA 4IX1A 3B1WA 4HGQA 3N3AC 4ZO7A 4ZCLA 1GV1A 2VHWA 1NL3A 1NJ6A 2WAAA 1P2TA 5B2ZA 1D4OA 1U8XX 2AJBA 1MNQA 1XHFA 1YS7A 3LP8A 4RABA 5CVDA 5EEHA 1V71A 3AY7A 3IBSA 4I1VA 3I0NA 5DX1A 3G13A 4BO6A 3FTFA 4KMRA 5EQDA 5A4KA 1KAEA 1VHJA 3VHXA 4E31A 1YB2A 3EK2A 2DU8A 4QC2A 4BMXA 1SZPA 2AMYA 2FPPB 5GQSA 5TXGA 3FHOA 1WXEA 1RYBA 2ZUSA 2EERA 2UVPB 3NBQA 1U65A 2HUPA 4YP7A 5FR1A 1RPTA 4B44A 3BEDA 1E77A 1F17A 2ISQA 3GGGA 5I7FA 3OMWA 3K16A 5G3YA 4RS3A 4DNQA 2V6JA 3HTXA 4ZOLA 3R0IA 4RVGA 2OR3A 2PKWA 3IMEA 1G291 3C6XA 3KYCB 1YOVA 3SJBA 4OJNA 1S8AA 3OE7D 3HRHA 5HIAA 3HFSA 1Z45A 4IDOA 5AUQA 3I58A 3UK6A 4C4XA 5K45A 4I50F 4LRXA 3NC4A 1OIWA 3BFKA 1IOLA 3QVXA 1EP1B 5AM1A 4LJ7A 3PGJA 4Q48A 5DHSA 5SY4A 1OV4A 3M81A 5CT8A 2I1VB 4AG6A 2BFMA 4G5SA 3GR6A 3O82A 1O5TA 1XDZA 4LQ4A 4UU7A 5DHUA 1F12A 3DTYA 3SFTA 2RHGB 4C87A 1BMDA 3OFSA 1MT3A 4F3KA 3A6LA 5JSHA 4IRXA 1DIBA 2X2OA 1IMJA 1Z33A 3IDZA 3M9XA 3MUFA 4XX0A 4BFVA 4BLRA 1RZUA 4UBJA 3D4LA 2UVDA 2YJ6A 1RACA 2GPYA 3QSGA 1DWQA 4U2DA 4MGYR 1AKNA 1LV7A 4GEKA 4ZYVA 3QFCA 2FFBA 2QTTA 3T5CA 2VPIA 1N5LA 5JSQA 1T3TA 5BQXA 4GU5A 1J9GA 4S1VA 3PPXA 3A58B 1L5MA 2VH1A 4WL0A 3C7DB 4ME6A 3I04A 3BRQA 3SHTA 4D9CA 1U7XA 2V8BA 3BEOA 3DEHA 5CM9C 3O21A 1G98A 4TROA 3Q88A 4M54A 4RF4A 3FUUA 5JAMA 3L7DA 3FDIA 2WTEA 3I6BA 4Q4CA 3HABA 4KK4A 5D3MB 3TNDA 4D92A 4BX2A 2XUAA 1JDVA 4W5NA 1D07A 2A67A 4WE3A 4Z53A 1PGPA 1RLIA 4HLNA 2OSBA 4JC4A 3KTAB 4HNAB 1ISIA 5I9LA 4DCTA 5IBQA 3VPCA 2O2SA 3KL4A 2XNKA 5HCIA 3GRUA 3Q0TA 4UHHA 3S2YA 4U9IS 1YQUA 4OYRA 5ABPA 4F5ZA 4LXGA 3ZU3A 5LU8A 2CLFB 3GPLA 2UYGA 2XB8A 2A35A 3LD9A 4UQOA 1LDYA 4JELA 4B6JA 5DOVA 5LQCA 1FUEA 2ZIVB 5A9TA 1Q0LA 3R7WA 1XZLA 3AR3A 3SM9A 3SS8A 3V8MA 4CE6A 3EF3A 2WKSA 5E6RA 3LT2A 4D9BA 1RMTA 3GCGA 3EFBA 3TVDA 4HWOA 4F4DA 1GN9A 1AK2A 1Q0ZA 3QELA 1Z4JA 4RL6A 2NTNA 2ZWOA 3OQPA 4LJLA 2HNKA 3KUXA 3ND5A 1Q16A 4HXYA 1PWXA 3ROKA 1GPBA 3NEPX 4C5BA 4F4FA 4TTJA 1DX9A 4BJ6A 1HT2E 1Q5PA 3AXSA 3F6YA 5IN4A 2BELA 3HP4A 2OORC 4CKWA 5HILA 2XEXA 5TR9A 3DWGA 1T2DA 3C3KA 4MARA 4ONEA 4KYUA 2XNCA 1YS6A 1J7KA 3SI7A 3RVBA 1E2HA 3B2NA 3B5EA 1UM9A 4NCKA 5HF5A 2OYCA 1RQXA 4L08A 4MDFA 3TIIA 2YJ4A 1DOZA 3E3MA 1JLHA 1P19A 4TTTS 5B7QA 1WE2A 4RDIA 4GKJB 4U7WA 3E7DA 1CJCA 3Q3JB 3GT0A 1HLGA 1KZGB 2BFDB 2QE7D 4MVYA 3AVVA 2FE4A 1B2RA 1YR9A 1ZY2A 2H3HA 2V03A 3NVMB 4D82A 1SUPA 1X42A 2JBAB 2NOAA 1ZKDA 3WHPA 5A4DA 4BGEA 4CMBA 1RWWA 2V98A 3DL2A 4F6LA 2G04A 4X91A 3ZHBA 2OD7A 3EEYA 1I7LA 4UD6A 1LC3A 4P6VF 1JSCA 2F64A 4KITB 4Q6WA 4IO0A 3RWOA 3CINA 1T6BY 2WV7A 3H65A 5FTMA 3SYNA 5BVHB 5CBPA 5JIBA 4PO8A 1IUPA 4PO3X 1O8BA 4DMRA 1QC5B 5TQ2A 4ZI5A 3BXOA 4AZ3A 4NK4A 4G5XA 3Q7TA 4W5WA 2J3DA 2INGX 2QDKA 4XIIA 1EM6A 2QD5A 1M1YA 1WHSA 4J29A 4R1QA 3BE8A 1AA6A 1J06A 3UMBA 3HVIA 5HFNA 4B2LA 2WICA 1JFFA 4MRMB 2R1TA 2O0KA 4C21A 4WDQA 1SVUA 2P3QA 2P8SA 3VR6A 5A0TA 3VNVA 3A1EA 3PIRA 3NJ4A 1RM0A 3PL1A 1CUSA 2I2WA 4QLAA 4FFSA 4ZYUA 1ABFA 5JS7A 1BU8A 1MXHA 2E21A 3I1JA 1V1MB 5DTMA 5IXJA 1FYDA 2DECA 4XDZA 3LX4A 3QF4A 2PO5A 4TV9B 5AJXA 3TBHA 1GL6A 1T1JA 1BDMA 2Y0BA 5C8DA 5E1BA 2IX3A 4KH1A 5L3QB 1K8ZB 3KAQA 5BR7A 2IW3A 1VSQA 3NTLA 4O4LF 3WLTA 1FZTA 3UJPA 3ZCPA 4PNEA 2XTAA 4J6FA 4M7OA 4K6GA 2CYAA 1F2VA 3K5IA 3TRJA 1C7ZA 3GRZA 2C1XA 5TMEA 4ZT2A 2ZJYA 4DJDC 1I01A 3L0OA 4LXIA 5TQ0A 3Q7PA 2NTVA 2PFKA 2AQKA 2WZCA 4K2HA 1QV7A 1L5KA 4NU6A 3R3ZA 2VAVA 2XLCA 4EGQA 1KKLA 2NSLA 2ZCUA 3TNYA 2QUIA 1DZIA 3HFGA 5AOAA 4DBVO 1KK1A 4ZV7A 2QPAA 3NBUA 2UKDA 1Y4AE 1DHTA 3TIFA 1DWUA 4BVBA 1ZVJA 2SKCA 1QO9A 1FSFA 4IZ6A 3QLTA 5CNIA 4XVHA 1SBQA 2BDEA 2OZEA 1SUSA 2QP4A 3WIDA 5ILOA 2XQGA 2CFSA 5CU7A 1XEFA 4KIGA 5K4AA 5KJFA 4KE9A 3THOA 2XOKA 1WTAA 4M9CA 3TZ6A 2UUAB 1KQNA 1G20A 3ID6C 5C34B 2Z95A 4FEAA 1WLSA 4G8JA 1QFZA 2HK7A 3N7UA 3PXCX 4IJMA 1JG1A 5CA1A 1HQDA 3L4KA 4D4MA 1K89A 4K6KA 2QAGC 3VI3B 4PN3A 1ODSA 1NKVA 4TWIA 1N5JA 1N5OX 3AI3A 2FHPA 1FLVA 1NJ8A 2GASA 4GZ3A 3DYVA 3JQRA 4Q7KA 5EXSA 4AN0A 3T34A 1ECPA 3U3RA 2H00A 5BV2P 1RPZA 3R9IA 1I6WA 3GQVA 2JARA 1CULC 2HA5A 2JH8A 3SS7X 2BAGA 1BTOA 2ZIEA 1D2RA 3PHHA 5H70A 3TFQA 2WHQA 3NOXA 2Q28A 3FMIA 3BYZA 2B2XA 1VJRA 4WV3A 3QU9A 3BJZA 3C45A 2ODBA 5BR4A 3HB4X 2O2DA 5ALMA 1T5DX 2A3NA 1VLLA 3IXQA 1LPSA 3V6LA 3L84A 3R74A 1CTQA 1X39A 4AT1A 3DHWC 1GZ5A 2OD9A 2QJTA 3BMCA 4QARA 1ZX1A 4RW0A 2OK8A 4N8EA 4RKFA 4LYEA 1M2EA 4C7XA 3CF4A 4HAOA 5EJ2A 4OQLA 4OHKA 4RTMA 3LUFA 1Z3CA 3O4GA 1JDJA 2DPMA 3QEOA 4OO3A 3G5MA 4CIVA 2IYOA 2CVOA 3OIVA 3OEEA 1W5FA 2R7AA 5TQVA 1E1MA 4CETA 1C14A 5MN4A 1YFKA 5ITZB 1AS2A 3FIJA 4QPJC 2BT4A 1QTQA 3DAPA 4F2DA 5LUBA 4HEQA 1P39A 2C3YA 3GJ6A 3LQKA 5DYIA 1KY3A 1I0LA 1ISGA 1L4MA 1OTHA 3LQ2A 1B74A 1FNMA 3W9YA 2IFTA 1E64A 3VR1A 3GLGE 2AN3A 3WAJA 2WP8J 1D6SA 4Y2UA 3WDSA 3N2NA 3ZEAA 2VQEB 3FWHA 1CY6A 2PANA 3G85A 3CNHA 4L28A 2XITA 3TVTA 2QRVB 2CFIA 3ADPA 3JQGB 4NX2A 1KK2A 2WHRA 2VK1A 3ILXA 5KX5A 3GLIA 5IX8A 1RYHA 3NWPA 3NEYA 3DXXA 3ANNA 4PSCA 2ZBRA 4CL0A 3DTNA 4YT5A 5C0OE 4F92B 1T4DA 4HKTA 3JQFC 1BCSA 4RA9B 3LI2A 4IY1A 4YJDA 3Q98A 4J75A 4BNZA 1L8XA 1M0TA 1MVOA 1FNNA 4MW9A 3C39A 1T3SA 3IEIA 1KMCA 2BFFA 2PZEA 3A1DA 3HV0A 1YB5A 1ZWLA 4ZVPA 3KVNA 5A4FS 1SXJE 3NWBA 1TTQB 3GI1A 1WWKA 1WB5A 1PVDA 2XUHA 3EZNA 2QMHA 4D45A 3P2EA 5CFOA 1NUSA 2REQB 4TRNA 1E1CA 3LVQE 5HOEA 1GAXA 3YASA 1C2TA 1NXOA 4UNPA 3WL5A 1FCJA 4JQOA 3TL6A 5LOVF 1J22A 1TAGA 2G0TA 1RQNA 3P9NA 3NHAA 1ML3A 2XKKA 2DEUA 2KI5A 1WCXA 1O0CA 2AOXA 3CJRA 4PIVA 1EP3B 2QA5A 4IG9A 2AFHE 3KB2A 4S0ZA 5JWHA 3ZV4A 3ZV7A 1DG3A 2MMCA 1NX9A 3NHRA 3AK4A 4IZHA 4A9AA 2WNHA 1RAIA 1W9MA 4KDFA 4LOAA 3AVQA 4MXDA 4QOJA 2XMBA 1M2FA 1P45A 1VJDA 4N47A 2R1VA 3SBXA 5LZ9A 1OFGA 3QBEA 3EMBA 3H13A 3QPBA 4FOTA 2ZUVA 3WKCA 1I2MA 4BKPA 4CLRB 4CEHB 4Y2PA 3LC1O 3ER9A 4OBXA 3NHPA 2AX4A 2GF2A 3OHSX 4Q5IA 3BWMA 3BK7A 2I7XA 2Q0QA 2QL5A 3GLQA 2GN4A 3DF7A 4KO2S 1S1MA 3RK1A 2BOVA 3TF5A 3UHAA 2ZSUA 1P31A 4D9KA 4J0JA 5CCBA 4HLQB 2D62A 3E5HA 1HE2A 4M0KA 1Y4ZA 3ZN2A 2Y2UA 1W36D 4YRCA 4CZ2A 3BAFA 5ILQA 4B6GA 2QSUA 4P4TA 1QCDA 4QQ8A 2ADMA 5BQPA 4FT4A 4FOPA 3LUGA 5EGNA 1RD4A 2GM9A 3KR1A 2ID4A 3SD7A 2IBSA 4P7JA 5CITA 3CVWA 3LH5A 3R5KA 3ZQJA 1OH5A 1UEIA 2IYZA 2K6GA 4JYMA 4TQAA 2C8LA 3LOUA 4DF3A 1PP4A 4NYMR 3K1AB 5T4BA 2KLHA 3N8DA 2F90A 2A9FA 2MSDB 2XMPA 3BQMB 3Q5GA 3T3DA 1HZJA 1SVOA 2BFCB 1S01A 1E89A 1FUKA 1CNMA 5K6RA 2JD1A 2HWUA 2BFPA 3TUIC 1BKDR 4IX9A 1PT5A 4US1R 3GLRA 5J4YA 3ZCQA 3Q1KA 1PS8A 3T1QA 5DI3B 1MC1A 2NP7A 1CYEA 1PGQA 4QGSA 5ICFA 2CDAA 5AXDA 5CLJA 3PFGA 1B4DA 2HPVA 2PBZA 3HDQA 3X2EA 1ZVVA 1KQPA 3C48A 4C78A 1VMDA 4HB3A 2CNOA 2GQ0A 2YV1A 5DGIA 3DCNA 2CXSA 2JJ2A 3MOIA 3WGNA 1ODJA 2XKBA 4ICIA 3KXLA 1ESNA 9LDTA 2OA0A 3IDFA 3DLHA 4L4XA 4Z1MD 2PSSA 1QIIA 1ZDMA 4JX9A 3ZY2A 1E6LA 2A5GA 1XQVA 2CXOA 4Q7JB 4R1OA 1HWYA 1SOWA 4MHSA 5FBRB 3R7LA 3EJ6A 3E3LA 1NBMD 1Q1NA 3ROPA 1W25A 2ZYRA 3G9XA 1WM1A 3JSAA 3UH1A 1GAEO 3EIOA 1VCHA 2QX8A 2XUFA 5FB3A 2P6UA 5LM3A 4E70A 5CP8A 2AJ8A 3FVWA 1JR2A 2GARA 3DE2X 3P9YA 4YRTA 5FD8A 4DMGA 3JPWA 1E9RA 3UIEA 3HUUA 1FQWA 3QE0A 4GSKA 4KG7A 1YMVA 4H3VA 3U39A 4CLEA 3OX2A 3OD1A 1N2HA 1G41A 4I08A 4G1FA 4X97A 1G21E 1P7YA 4F6RA 2FPPA 3LRTA 3V33A 4I55B 2O8FB 3L7NA 4LGYA 3SDZA 2Q4OA 4TVKA 3QHQA 2UVPA 3H5OA 3ZWCA 3INRA 4NZPA 2VI5A 1EFRA 1DAPA 3O8NA 2R60A 5LSAA 1JYEA 3AEQB 3KR2A 5EQJB 5H5JA 5HKLA 2H8GA 3ASYA 3DOCA 1SZCA 1V26A 3CUUA 2GA8A 2AN1A 4MCAA 3KYCA 3JQ6A 1U9IA 4RA6B 5AUOB 2FPWA 1QKJA 2OUKA 3N0VA 4Q02A 3ETGA 4CU2A 4LFAB 4L3VA 2F3RA 1JJFA 2JFNA 1RJEA 4EGSA 2SKDA 3I52A 1YF3A 4BFSA 1BIFA 3OZ7A 1YCGA 4ROTA 4ZFNA 3QXGA 1W2HA 3OM0A 3DEIA 2IZ0A 3AF5A 5IAOA 1JAIA 1UMKA 2YXLA 3K53A 3SY8A 5AD1A 5F5LA 2J3JA 3GCWA 4D2IA 3SQWA 4GF5A 3AFIA 3E03A 4JBGA 1I4OA 4HRYA 2GJ4A 3DULA 3UM9A 2OHJA 3L41A 1VBKA 2O3JA 3OEED 1C3VA 1NNEA 1Z8FA 4FXPA 3TZKA 3PTAA 4Z0NA 3B12A 4GE3A 3ZWXA 2Q2QA 2YCBA 1CLEA 1K5HA 4KUEA 1VP3A 2JGJA 5AM5A 3GH3A 5ER6A 4EOGA 3ITDA 2C3OA 1N2XA 4MMYB 3VHLB 1U9CA 1DRKA 2R00C 3WWPA 4QU9A 2BGGA 1PKEA 2ILVA 5KJ6A 4KO8A 3ADBA 3CZPA 4KPUB 4R8RA 1SGWA 4HZIA 5D3MA 4BLSA 2JFUA 3FCXA 1X7ZB 5EP1A 3KB8A 1CJVC 1MX3A 1X6VA 2E1PA 2GZ3A 2ID9A 2LKCA 2PLFA 3ELBA 3MD0A 4UU1A 4AF6A 3VNUA 4UCFA 1SCJA 1QR6A 3D5TA 3DVRX 3KG2A 4HNAA 5DSTA 4DCUA 3AX6A 3DFUA 2ZIAA 2EU8A 4EKIA 4L85A 4HJRA 4YWHA 4YMTA 4P7FA 1LA2A 4MRPA 2QYOA 5AXBA 1DOAA 1LDEA 4FUQA 3ZJ4A 5EJFA 1X2BA 1DJMA 1UPBA 1DC6A 2YXEA 5IBPA 3V46A 4BFLA 1H2YA 5E8RA 1U2PA 1BFKA 2WAMA 4BB5A 4ZOCA 1KTIA 3A4YA 3TFOA 1JDUA 3OCWA 1FFDA 3QYFA 4IJKA 3FKQA 4NBLA 2QLTA 4IEFB 1PNTA 2GEFA 4UM8B 3W5JA 4BCCA 2XUIA 3DT8A 1CVRA 1QIEA 2GOYA 1L8OA 2HRQA 1NM5C 4KQXA 3WYNA 3C6BA 1FFWA 1I7NA 4DB4A 1KJQA 1I5OA 4PHGA 3HXMA 3ANLA 1DKUA 3NHZA 3HA7A 2CMHA 2OO7A 3PUXA 4IGKA 4EB6B 5F51A 3E5MA 3QUSA 5AJZA 2ORYA 5GV8A 3KSUA 4OQFA 5EJ8A 2BGTA 3PKJA 2G1UA 5IULC 1RBZA 4UTPA 5T8KC 3HDGA 4OXKA 4YECA 3WGMA 2DQ4A 3FB4A 2H6EA 2PAAA 3DQZA 1PZHA 4U2EA 4G81A 3RV3A 5CB6A 2C7QA 1GVNB 1PE0A 3E3NA 4MI1A 3PC4A 4IIBA 4KSCA 1PZEA 3V9PA 4OK5A 3VJRA 4PVCA 3S8EA 4BLOA 2HO5A 3HWWA 5GONF 3EB9A 3TKAA 2DJIA 5IVPA 4YI3A 2BFDA 3AG5A 4QXMA 3TLYA 4C43A 1UXKA 1PSZA 1ZOOA 1BA3A 3VR5A 4AK9A 2JBAA 1KI8A 1TUBB 1P81A 4UEOA 5JO9A 2IEBA 4J94A 4NR0A 3I1YA 4B6PA 1IQRA 1XLTC 2ZJ2A 1KDRA 4FC6A 4BJHB 1FQJA 1ETHA 3MQ4A 3Q7SA 4LMAA 4MWDA 4TL8A 2PWAA 2Y1DA 2W0MA 1U3UA 4PY2A 5AKKA 3ZBUA 3A3KA 1W4AA 2ZRDA 5K6TA 4GLBA 1CKEA 1AVTA 1Z0AA 4NAVA 5EKTA 3TQCA 1RWMA 4B4OA 3RFCA 1QP8A 3IEPA 5BVHA 4Z4IA 4EA9A 4PLGA 2B7CA 2DQYA 1LDMA 3X1ZA 3B13B 4F1WA 3VR2A 3QLEA 5BSWA 4BQFA 3DTVD 1JIIA 4YLYA 2O6LA 3Q72A 3QEJA 2HJSA 3L1KA 3O9VA 4WLEA 1CNEA 3I64A 1QH9A 1RQRA 1IHPA 1WXXA 3P45A 4MRMA 4ENQA 2A9KA 2WBLC 3PFCA 1UBKS 3L8EA 3SEQA 2VQFB 2PUBA 3D59A 3S81A 4HLCA 4OHBA 4RTPA 3F6SA 3QVTA 2YOGA 3KK0A 1IBLB 4QYXA 3MERA 1G7TA 2O8DB 1WHTB 1SU8A 4IJ6A 4RM3A 5JADA 2QRPA 2YJGA 4QO7A 1SXQA 2FX2A 1NN3A 1OJLA 1G5TA 4WWHA 1VHLA 1V1MA 5A7FA 4HEA1 3QFHA 4TV9A 5EKSA 4XWOA 2WABA 2V9CA 4AJIA 2Y0DA 1MG5A 2P78A 5L3QA 1XCOA 2DH6A 2VTKA 3KV3O 3JQ7B 4AY4A 5JQGF 4O3MA 4Z99A 2NV2B 2X76A 2Y1GA 4FFVA 3SXPA 3W8NA 2I1QA 1I7SB 1P4GA 1X13A 1B2LA 4P7BA 1FFBA 1OU4A 3OIWA 4E2YA 2VEOA 5DH9A 4HDNB 4HYEA 2A1IA 4BP8A 4FKBA 2VP0A 4X00A 4ZT4A 1Z16A 1DTSA 1YMUA 2FZEA 3FOCA 1S8NA 3I9NA 4BDTA 3OM1A 1GU1A 1R3UA 3WA7A 4RZIA 1DTEA 2E0IA 3U81A 1B43A 5LP6F 1T5TA 1G9XA 2ETVA 3KSDO 3CU5A 2JK0A 3RASA 4E1AA 2AG8A 1VCMA 3JRNA 3VHRA 4L6AA 4N4AA