3DH0A

Crystal structure of a sam dependent methyltransferase from aquifex aeolicus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
KFDPSKIKKLDDPSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDWKKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYAMIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SAM dependent methyltransferase
publication title Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 61
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dh0A00
3PX3A 4ER7A 3ELDA 5K0JA 4PNEA 1WXXA 1KYWA 5DTRA 3BGDA 2ZTHA 1Y8CA 4FT2A 5CVVA 2I9KA 3GRYA 5E8RA 5FUBA 3UJ7A 3EGVA 5DLYA 2PWYA 2YR0A 1AQJA 3ELUA 1O54A 4XUDA 3HM2A 4YUXA 4UOEA 1KPHA 2XBMA 3JWJA 5DX0A 3UA4A 1XCJA 5T6BA 1N2XA 1O9HA 2P41A 3AJDA 3EGIA 3MERA 4M38A 3OPNA 1RJEA 3KHKA 5DM2A 5EQJB 3UZUA 2OBFA 3SSMA 5LQAA 3AWIA 4IV0A 4E33A 3BKWA 2Z6QA 2NYUA 4YUVA 2Z6UA 2PX4A 4YUWA 5EOVA 2NXJA 2JH9A 1JQEA 1KPIA 3OZTA 2VDVE 2VZ9A 3P9IA 3SMQA 3IV6A 3NW9A 4WXHA 4C06A 4A6EA 1D2CA 3RODA 2G71A 1D2HA 2BR5A 2B3TA 2ZVJA 4FGZA 4KVZA 2O06A 4YV1A 2AOUA 3TOSA 5HOQA 4DM3A 3NDJA 3E8SA 3G8AA 5DXAA 2KW5A 3THRA 2AOWA 1ORHA 3ELWA 3G7UA 3SVZA 1KR5A 4PIMA 4DF3A 3TQSA 1L3IA 5H02A 1VL5A 3EGEA 1M0EA 1YF3A 3FPHA 1SKMA 4HTFA 2H1RA 1XVAA 1JTEA 1NW6A 4HC4A 3MGGA 3LPMA 4MQ4A 5LQKA 2O0LA 3P97A 3A7EA 3FTDA 1WG8A 3Q7EA 2AVNA 2AOTB 5DXJA 4M36A 2GB4A 3GRUA 1OR8A 4OA5A 4AZTA 5DTQA 4X61A 1JG2A 3MCTA 4P7JA 4ER0A 5EPEA 5BXYA 3KQOA 3BGIA 5DM0A 2BZGA 4DKJA 1XDUA 4P7KA 3PVCA 3I53A 5LR6A 5EEGA 1SVUA 1XTPA 2V74B 1NW8A 1XCLA 2QE6A 3QOXA 1UWVA 4HSGA 4LWPA 4RVHA 5C0OE 2P35A 3BWBA 4ATNA 4YUYA 1L3CA 4RTNA 2CMGA 3T0IA 2XYQA 2YX1A 3M6UA 1MHTA 3SM3A 4PYQA 2HR1A 3DMGA 4QPPA 5EHGA 2AOVA 3VSEA 5K03A 5LQJA 1IXKA 2JJQA 1FP1D 2YUIA 3LBYA 5EGSA 4X1OA 3C6MA 4PYLA 3V97A 2B78A 1VIDA 3CJRA 4PWYA 4R8SA 3FTEA 3AXTA 1JSXA 3TRKA 3NMUF 4QTTB 5KYGA 1X19A 2Z6AA 1R8XA 1RI4A 1P39A 2OPBA 2ZLBA 4R8RA 2NXNA 2OKCA 3PT9A 4E30A 2ZBQA 3HA3A 4OX9Y 3HP7A 3LDGA 4HGYA 1L3BA 2GH1A 1KPGA 2XYVA 5HIMA 3REOA 5C9ZA 2JG3A 2JHCA 2GA9A 3HCAA 5CVDA 1I4WA 1BC5A 3HCBA 3CCFA 4RSRA 5CIYA 1YFJA 2EX4A 3M33A 2NNWB 1G8AA 2FK8A 2FK7A 4GOMD 4RTJA 2ZZNA 5HILA 2EG5A 5E1MA 3BWMA 2P3LA 3M4XA 1YB2A 2IH2A 2YTZA 3BGVA 3GO4A 4KIFA 3IHTA 5DWQA 4MHTA 4K6MA 5DPMA 2BH2A 3KQMA 3LL7A 2JHAA 1DUSA 1I9GA 2AN5A 2ERCA 2VP3A 3X0DA 3CGGA 3FPGA 2QRVA 3HA7A 1VP3A 3KPVA 3KR0A 5BW4A 2ZIFA 3M70A 1RI5A 3DXYA 4C07A 4DZRA 3BT7A 5EEHA 5HFJA 3FUVA 3C3YA 5T67A 3DUWA 3MTIA 1ZGJA 1HNNA 3LHDA 4AUKA 3AXSA 3FTFA 3NTVA 5DRTA 5B1SA 3B7PA 2ZZKA 3LECA 5DX1A 5LQNA 5D1NA 1F3LA 4Z2YA 3FYCA 4C08A 2UYCA 2ZIEA 2VS1A 3BWYA 4R05A 1ORIA 4CWAA 3FRIA 3G2MA 1N7JA 1RJGA 1U2ZA 1HMYA 4Y30A 2P40A 8MHTA 2OB1A 2IPXA 2AN4A 3D2LA 2P1DA 4QQNA 4DCGA 3HEMA 3B89A 4JXJA 5DTMA 3ANXA 2OO3A 4E31A 5F2NA 9MHTA 2AS0A 4HH4A 2YXLA 3A27A 2G70A 5G02A 5ICGA 3HVIA 1T43A 3OE5A 3DXXA 5E1BA 4P7GA 1DL5A 3I5UA 1QZZA 4HTFB 3R24A 2OXTA 1MJFA 3KQSA 4LWOA 3UJDA 3DMFA 2HMYB 2PGXA 1NW3A 3HVJA 3OU6A 4MTLA 2AN3A 5E1DA 3GXOA 3LKDA 3FUUA 2HWKA 2F8LA 3MCZA 1XDZA 3OE4A 5FQNA 3P9CA 5EMMA 3BXOA 4AX8A 1ZQ9A 5K0NA 4RTKA 2ZBPA 4XUCA 3OZSA 4F85A 3G5LA 3OU2A 4DMGA 4RTRA 3P9KA 4QQKA 4CXMA 2C7OA 3B3FA 3KPJA 5F2KA 3KR2A 2IDKA 4V0QA 3UJBA 1EG2A 1RI2A 2CMHA 3LX6A 2EFJA 3FUXA 2GAFA 4KIGA 4ER5A 1KHHA 5FULA 5KQRA 1NV8A 3LDFA 2WK1A 3KU1A 2NXEA 3ER9A 5CVEA 3GCZA 4LG1A 5GINE 3BZBA 2HTEA 4B17A 5BW5A 1YUBA 4FZVA 5FTWA 5EMKA 2C7PA 4KDRA 5EZQA 7MHTA 2IH4A 2DPMA 2IDJA 3KPWA 3LDUA 3EMDA 5FQOA 2ONZA 4DCMA 5ICCA 4BLWA 1R74A 5HIJA 3ERCA 4F84A 1SQGA 5DRYA 2ZIGA 2Y1WA 3UJ8A 4GOND 5DSTA 3FZGA 4OBWA 3FTCA 5EHIA 1TW3A 4CTKA 3RIEA 4ER3A 5FA5A 3DH0A 5E8JA 1ZG3A 3EVAA 1G8SA 3S68A 2PV0A 3ME5A 4GEKA 1AF7A 5CM2Z 4H0NA 2BM8A 4QVGA 3G2OA 2N47A 1JR4A 1BOOA 1V39A 1VQ1A 1NKVA 5CCBA 3SSNA 3GRVA 3OZRA 1P1BA 4E32A 3DTNA 4C05A 3I9FA 1NBIA 2UYOA 2ZULA 3CBGA 2IP2A 5E2AA 5LSAA 4X63A 3C0KA 2PLWA 3T7RA 3KQQA 2YQZA 3LKZA 5CVUA 5CUQA 2HNKA 1AV6A 1O9GA 2OY0A 1JTFA 3DLIA 3FPEA 2IH5A 4KDCA 2OZVA 5K0CA 4X41A 2B25A 3F4KA 2ZZMA 4IV8A 3H2BA 5JR3A 3FPJA 3UWPA 2QY6A 1PRYA 3LBFA 1SUSA 5EVJA 5K01A 1ZKDA 3Q87B 5EKUA 3MAGA 2XYRA 3O4FA 4M7RA 1NBHA 3MB5A 1VE3A 4GQBA 2FCAA 3MTEA 4OQEA 3TM4A 2ZCJA 3B3JA 2DULA 1D2GA 2H00A 2I62A 3EVBA 2PKWA 3A7DA 3LGAA 4E2XA 3EVGA 2LD4A 4GUAA 3EEOA 1QANA 4BY9E 4KRGA 2C7QA 3EVCA 3TR6A 4F86A 3EVDA 2OB2A 3M6WA 5HIIA 3C6KA 4IKPA 2P3OA 4QDJA 3FUWA 3NWBA 3KPUA 4GC5A 4RVGA 2I7CA 5CD1A 4NECA 2WA2A 5ICFA 2PT6A 2R6ZA 4RTOA 3IEIA 2IGTA 3ID6C 1XJ5A 5DT2A 2B9EA 5FWDA 3GU3A 2UYHA 3B5IA 2FPOA 3KQYA 4GF5A 4GOLD 3LSTA 2ZW9A 2CKDA 3P2KA 3SX0A 5CCXA 1B42A 3CKKA 2V7EA 3TKYA 1EJ0A 3CJTA 3TPZA 2PJDA 3G2PA 4FSDA 5D1HA 5EIFA 2BM9A 5K0LA 2AOTA 1AQIA 5E9QA 3KQTA 3OCJA 3PX2A 4E2YA 2CWWA 5E1OA 2ZFUA 3VC2A 5C1IA 4QTUB 3M6VA 3RW9A 4YUZA 1XXLA 2Y1XA 2PT9A 3P2IA 5M5BA 1QYRA 2NP7A 2UZ4A 4ZTBA 4BLVA 4EKGA 1P1CA 2JHPA 1PJZA 4BP3A 2GS9A 3PFHA 4FSXA 2VDUE 2AOUB 1L1EA 4OA8A 2G1PA 3HCFA 4G56A 5FHRA 3CVOA 2ZBRA 2CL5A 2ONYA 3LCVB 1X1CA 2PVCA 4RTQA 4L7VA 4AZWA 3I58A 5U4XA 3P8ZA 4QDKA 5MHTA 4EK9A 4Y2HA 5GWXA 4CTJA 3CJQA 3G2QA 3MQ2A 3PS9A 3UFBA 2IIPA 3HTXA 4PGGA 2UYQA 5LQRA 1P91A 2EJUA 10MHA 5K09A 2O07A 3KQVA 3OU7A 3EEYA 3R9XB 1EIZA 2PX2A 3HCCA 4CKEA 5JUWA 5GM1A 1RJFA 2QYOA 3BUSA 3G88A 2XVAA 1EAMA 1WS6A 3QV2A 1M6EX 5K0EA 3EMBA 3PLAE 3DP7A 2PX5A 4KWCA 2QM3A 3CC8A 3GDHA 4YV2A 3HCDA 2OYRA 5ICEA 1G6Q1 3G5TA 3KPYA 2PWPA 3T7TA 3VC1A 5KQSA 4PCLA 4U7TB 1X1BA 1H1DA 2B2CA 2NP6A 3KQWA 3PB3A 2O57A 4HGZA 4OQDA 4P58A 4RX1A 4XUEA 3QOWA 1Z3CA 2C7RA 4ISCA 4O29A 1KXZA 4U7PB 2YVLA 4GC9A 4PIPA 3B3GA 3BKXA 3NWEA 1ZGAA 2A14A 3DULA 3KR9A 3E7PA 1UIRA 5DX8A 2G72A 5GM2A 3P9NA 5IH3A 2HV9A 5BP7A 5LQUA 2P7IA 3P71T 2AZTA 4E2WA 1INLA 2ORED 2FHPA 1JG3A 3HCEA 5HIKA 2FRXA 1VBFA 1RI1A 1DCTA 1FBNA 1JSZA 2PX8A 2XVMA 2BR4A 1G55A 5E9JA 5K0GA 1SQFA 2VDWA 5CVJA 4AZVA 3BWCA 5K0BA 3UA3A 1R6AA 1RI3A 3FYDA 3GRZA 3K0BA 5T64A 5FA8A 3UJ9A 1R18A 3HNRA 4RVDA 3NVKI 3NJRA 2YXDA 4PYIA 3T7SA 2BR3A 1VPTA 1JG1A 1NE2A 3SXJA 3R0QA 4YMHA 2E5WA 1G38A 1L9KA 2QRVB 2Q41A 1TW2A 4RTSA 4CKCA 5DM1A 3U81A 1SUIA 3OFJA 4FR0A 4YV0A 3MHTA 3DXZA 3THSA 1FPQA 5GOZA 4C4AA 4POOA 3P2EA 1F38A 2PBFA 3O31A 1BKYA 5EG5A 3ORHA 4R6WA 3GJYA 3TFWA 4DQ0A 3GRRA 3EPPA 4HG2A 4FP9A 2PY6A 1YZHA 2NXCA 5FADA 2P8JA 2ZSUA 5DM4A 2O05A 2JH8A 4R6XA 4E70A 4EKIA 3SGLA 3WSTA 1SG9A 3NVMB 2I6GA 3LCCA 5E2BA 4C03A 3ER8A 3NDIA 3O7WA 1FJXA 3SR4A 1JQ3A 4C04A 5KVAA 1WY7A 4DA4A 1EJ6A 1XDSA 4RV9A 5EZSA 2ADMA 4BLUA 1QAOA 4PYJA 2K4MA 4YMGA 2PXAA 5P8WA 5EKXA 3AY0A 4X60A 4FT4A 1VP9A 2PXCA 3R3HA 3L8DA 1WZNA 1ZHFA 4HRAA 4PYKA 3GIWA 3R6TA 5IKMA 1Q0SA 3GGDA 3TM5A 5GIPE 1N7IA 4KW7A 4EQZA 5F2OA 5EMLA 1TPYA 2GLUA 3DR5A 5K8VA 3DMHA 3PTAA 1YZ3A 4E2ZA 4QPNA 4FS8A 4M37A 5EIWA 1YFLA 2IFTA 4PONA 5HEKA 3V8VA 2FYTA 2AR0A 3FPFA 3LCUA 5GIOE 4PINA 3UJAA 3UJ6A 3FUTA 4PCAA 1KIAA 4A6DA 4IWNA 5LQCA 4MWZA 4XCXA 5KS2A 2AOXA 1JG4A 1NT2A 5EC8A 5HZMA 3ELYA 4EVIA 2WA1A 4V0RA 4PYOA 5ERGB 1X1AA 1FP2A 3JWHA 3M6XA 3E23A 1Q0TA 2ESRA 3EVEA 3TKAA 4LECA 3TMAA 3DLCA 4RYLA 1R00A 1RJDA 3PFGA 4QVKA 3EVZA 5EMJA 3G89A 4PYNA 3TLJA 3HVKA 1G60A 5GP1A 2P7HA 1X1DA 2R3SA 4RTPA 3OFKA 3G8BA 3GWZA 4EMSA 3A26A 2ZWAA 1QAQA 1VLMA 4GBED 1EQAA 4MIKA 3KR1A 5FHQA 1UFKA 4RWZA 3FRHA 3KKZA 4OBXA 3SSOA 5FWAA 1IM8A 3EVFA 4RTMA 3I64A 1JQDA 2IBTA 4P7FA 3UBTA 3E05A 1QAMA 2H11A 1M6YA 1NW7A 1WXWA 1IY9A 1KP9A 1NV9A 3JWIA 4GOOD 3A25A 2EJTA 2PSSA 3KQPA 4CKBA 2IBSA 3IYLW 3JWGA 2P3QA 4RVFA 3VYWA 5K05A 4ER6A 1KYZA 2ZWVA 3HVHA 3GNLA 5FCDA 1I1NA 2GPYA 3HA5A 3UJCA 4WVLA 5K0FA 4PGHA 3DOUA 3A4TA 2AVDA 1R8YA 2YXEA 2PXXA 2G8NA 1BHJA 4AZSA 5DSXA 4BP1A 3K6RA 1NW5A 5E9WA 4RTLA 3C3PA 4PYMA
chains in the Genus database with same CATH superfamily
5TEWA 2R66A 3ECCA 1KYWA 3GCDA 5KIAA 1GCIA 3VR6A 2QPAA 4BQPA 5IJAA 4FBMA 2ODWA 2HDNB 1TO2E 4NCIA 3RJ9A 4DLRA 3V1YA 3COJA 4E6PA 1A8IA 1BMFD 1NR7A 3UMGA 4PNHA 1C8VB 5EZ6B 3HU2A 3IEPA 4Q1EA 1QMPA 1CJUC 4EMBA 3E3LA 1KPHA 2WU0A 4EPYA 4JT9A 1CUUA 5T6BA 3O2SB 3RHSA 1HNWB 1XI2A 4IDHA 3ZZNA 3VR6D 2JGDB 3BD6A 2XWSA 4RXUA 2NSDA 1MMFB 2D62A 1T4DA 2ATVA 2JK0A 1EDDA 1OLUB 4WBSA 4BB0A 4EUHA 4F2WA 2XHZA 2XX3A 3L6EA 4OIFA 3U4DA 1YB1A 2R8RA 3A6ZA 3UCXA 4GQIA 1NJFA 2RGGA 1WAMA 2Q4RA 4X00A 1SQ5A 2YY7A 4IGIA 3ZE0B 4ZHQF 5B1YA 2AK2A 1RFGE 5C2JB 4EFDA 4KVZA 2IF0A 3VX3A 1YV9A 1VIVA 3HCNA 5HOQA 2JGRA 3H5NA 3FXAA 1GQOA 2AOWA 5A02A 4HVTA 4NL4H 1N2EA 2VI5A 2AMFA 3C6YA 4LYAA 2V03A 1EDEA 3DEYX 1KEWA 3WGZA 1QRAA 5F3DA 1YB7A 4X95A 4OKNA 4MQ4A 1I3CA 4MRAA 2BHLA 4BO8A 4DW8A 4FOTA 1O87A 3UMMA 3A6EA 4LKRA 4WADA 4X1KB 1C7FA 2PZEA 4RK1A 3BD9A 1D6NA 3V8PA 1UCFA 2AW3A 1KI6B 1ODSA 5C0OE 4R0NA 2FZLA 1WA5A 4DJ5X 4YUYA 4RTNA 4NIMA 4PG5A 3R75A 2ZJ0A 1VCMA 3COPA 4PVCA 2Q0QA 3CE9A 3SXUA 4YRMA 1OWLA 4F04A 4JQYA 2VNHA 3OP1A 4JOCA 1QQAA 2C0CA 4C9BA 3PFCA 4EJSC 1NY6A 5KWEA 2Y6UA 3O0DA 2QZSA 2WIGA 5AW1A 3IHKA 1HDOA 1KJWA 1JFFB 4XYEA 4ZOLB 4Z1OA 3LBAA 1PJTA 5BR1A 2C96A 2QGNA 3DKVA 4NWIA 3BMQA 4XASA 5I9IA 5G41A 2HU7A 4G8DA 1L5HB 3U3OA 4GKBA 4OX9Y 3KCNA 4TVKA 1UMDB 4HGYA 1GEGA 4NS1A 3TD2A 2GEFA 1USIA 4HNQA 3RC7A 5BSKA 3E5NA 2QU7A 4EI7A 5IVPA 5TPWB 5D5HA 1PR1A 1FJGB 4S12A 3JQ6A 2FK8A 1A7JA 3HB9A 4R3UC 1ST2A 5C8DA 5E1MA 4AJHA 3SOZA 2G9RA 1B8VA 5ECGC 1Y8AA 3ZVNA 2X3UA 3JX9A 2HU2A 1XLUA 3OJWA 4RF4A 4S1OA 4MHTA 3U4QA 3EGWA 2HM7A 4Q4LA 4KN5A 1JL3A 2X4DA 1ICIA 4ZJZA 3RGWS 2G6TA 1QNLA 5EESA 1AURA 2HADA 1F9EA 2XNKA 3Q9LA 2CDCA 1VKZA 4B6PA 3RFVA 1G64A 1V3UA 2ZSKA 4R81A 4OLAA 5EMNA 1NP3A 1I4TD 3LHDA 4EFMA 3AU9A 2REXB 3VOBA 2FW1A 4MKZA 1HH4A 1CW2B 4RPIA 3BA6A 3ZZ0A 5CW2A 5AVYA 2X1HA 1XTQA 1OZ0A 1CDZA 4M0FA 1QYVA 1TXGA 4IMJB 5D1NA 2AYYA 4Q15A 1ZIPA 2OD7A 1ORIA 2E4XA 3CSDA 1ID1A 2B5OA 1RJGA 3EC7A 2Q3CA 2GK6A 3NHUA 1EVYA 2G5GX 2OB1A 3ZCVA 2WHQA 2SNIE 1J4AA 2VNKA 3M3HA 4FDUA 4IRUB 1AO0A 4BNLA 3B89A 3OG9A 2CVFA 4JNKA 4E31A 4OI4A 3TXXA 4XIYA 4D41A 1KKMA 4FNMA 3O38A 1ZUD1 4YK7A 1CULC 2A35A 1R50A 4Q7EA 3W2IA 4LWOA 2C0PA 1LS6A 2CVOA 2HUNA 2WNIA 4R1MA 4G26A 4Y7DA 2J3MA 3ON5A 4XCVA 2FMFA 1KDVA 1GPUA 5LB4A 1U2PA 1GL7A 4ENVA 3ILVA 1TOAA 3QWAA 4U9HS 4BB5A 3MWEB 3V00A 1WB4A 4RZ2A 5ARCA 1LK7A 3PT5A 3AVPA 3GFRA 2FX2A 2V4ZA 5K0NA 4M8NE 1J07A 3OZSA 5B3AA 4XTCS 3ESRA 2ODQA 5DCYA 4NBSA 1O6ZA 4YGXB 1FDTA 1YRWA 3IUJA 4FTWA 5EIHA 1X92A 3I42A 5FH9A 1I3NA 1YJ5A 5IZCC 1XVVA 4YAEA 3WXBA 4ER5A 3UM9A 1TNDA 1YMQA 1JIJA 1JSLA 2YWDA 3A3PA 4CIBA 1T2DA 2W11A 2WWTA 3FTQA 3LTEA 5A62A 1NWHA 1CHDA 1Q0ZA 3OPYB 4CTMA 4YUWA 3DE6X 1U0OC 1YQUA 3BYZA 2PD6A 4H0FA 4H6WA 1E0JA 1PEAA 1Q7BA 4MQFB 3NWJA 4YAJA 5CXUA 4DV5B 2V9PA 2KLBA 2QN7A 2VPYA 2P5UA 3DL4A 3MTJA 3R9IA 1VZ2A 3W79A 2ZYDA 3AILA 7MHTA 2IDJA 3GNSA 1IN7A 3GFOA 4W7IA 4GRIA 4FC7A 4Q4AA 5KYUB 5BSHA 4TYPA 4UHJA 3ABRB 1GFIA 5TT1A 4HPXB 3TX6A 1SU4A 2DPYA 4J7UA 5DSTA 4EHIA 3LRTA 1P19A 1A8UA 4HGQA 4BVEA 1SELA 3AUKA 1DELA 3FZYA 4NFLA 2IPLA 1W34A 4CMBA 4TSRA 1E1QA 1Q44A 4AWAA 3O0TA 3C1UA 1WMSA 2YBEA 3GFTA 1L7VC 4GP7A 5ELLA 3BIJA 3ETHA 1PTJC 3LOQA 4K6CA 2PZKA 1SFRA 3NFRA 4N7JA 1Y5LA 4JYPA 5K8JB 3N2KA 1L5FA 1Z38A 1QM5A 3RC9A 1JR4A 1BOOA 5AOVA 4I5IA 2AI1A 2JFQA 1BMQA 3QKSA 4E32A 2BTEA 4II7A 4YCSA 2PX3A 1IWOA 2Q4OA 3L1VA 1E1QD 2AI3A 2G28A 3IBFA 4I1SA 1E9FA 3RKUA 3DCIA 1IG0A 3STXA 4ZEWA 5LMUB 1P3JA 2WTXA 1TO6A 4DLTA 3V42A 4LCJA 2WP0A 4AS1A 2B8WA 4EB6A 1AKEA 1EFCA 1XLWA 2O1EA 2ZJ5A 3HYSA 4HKTA 4XAQA 5AVKA 3B6MA 1B76A 1C3EA 4LXQA 2HSZA 4M9RA 4IZHA 2V7TA 1TB4A 3AR7A 3LBFA 4G1CA 4IXNA 4QFDA 4ZCMA 1FS5A 2WB2A 1O77A 3V1UA 4DMRA 4IJWA 1VCIA 2HHCA 2O2XA 3HYCA 3A1VA 1VLLA 2O8CA 1CWUA 2FFBA 2H00A 1OX6A 2GVDC 3LGAA 1JHVA 1BVYF 2UXBB 3TTSA 3LK6A 3AKCA 3C45A 3GLVA 4EH1A 2C7QA 1P4AA 1VYHA 2IPNA 1ZBDA 3ZC3A 1VHLA 3OPMA 4US2R 4KQJA 4KX5A 3KSDO 4IKPA 1W85A 4QDJA 3BMOB 3U6KA 1X6VA 5AXBA 4ZK6A 5HBRA 2V3VA 2Y1FA 1XEFA 2HYDA 1VFPA 3OZVA 3PXUA 1BE0A 3GBPA 3IJEB 1RZVA 3DE3X 1CETA 5J5AA 3FDZA 2FPOA 3JQDA 3PKIA 4GF5A 3RUIA 4B80A 2CKDA 5HSGA 1B42A 2OP0A 4JA2A 4ZP1A 3H86A 2G9NA 4CM9A 1R88A 3ZLVA 4XWAA 4JXXA 3SU8A 2P8SA 1ZC3A 2JB9A 4LE0A 2ENUA 3PX2A 5FR1A 4HWRA 3ZBQA 4C3UA 3OZGA 3IUSA 4ZDJA 1IEXA 2V1XA 4C14A 3RW9A 4OH1A 1D03A 4OQLA 1W581 4PGFA 2CDNA 3MMSA 4HEA1 3X2FA 1SVLA 3IIEA 3H83A 2UZ4A 3KAJA 1UXGA 2CD9A 1N1DA 2L69A 2H29A 2HOQA 1OLOA 4KB5A 2IOQA 4RV5A 4CM9D 5IBQA 2PLFA 5LNK6 4AN4A 3HGMA 4BKQA 1NQOA 1S96A 3K0KA 5B2EA 1U7OA 5D6OA 4R01A 4W63A 3AY6A 1AGPA 3KJNA 1KSJA 4HK4A 5AW7A 3K0SA 4GW3A 1ZK2A 2E6UX 2GN0A 3OZEA 3GGGA 2QTMA 5LZ5A 2J6HA 1UDCA 3EQ7A 3QPBA 4XRGA 3DAPA 3AQIA 3ST7A 1B43A 2BDUA 3PA8A 3OHSX 1Q0PA 2WWWA 1FC0A 1NT4A 3VUEA 5HE8A 2J4DA 3VKFA 3JAKB 3O4IA 4WDRA 4WH0A 3T9CA 4CTJA 1PS9A 1L4KA 3G2QA 3NT5A 3G82C 7YASA 5BSWA 4PGGA 2UYQA 3SEQA 1J0CA 1P91A 4NCAA 3QP9A 1TGYA 2PRIA 2XQVA 4BO2A 3IEUA 4B76A 3CIFA 3JALA 1TT7A 3SYTA 1M5TA 4C76A 3ZU2A 2HCFA 1U8CB 2JBAA 4CKEA 1T0UA 2J33A 3N2KB 2DP4E 5CFZA 1T5OA 2C84A 4EZBA 4LQDA 3BRWD 2BM1A 4QNRA 5IABA 2RGYA 4XDGA 2ZIXB 1D8AA 2E4AA 1ULSA 2X6RA 3BK7A 3VBCA 2PX0A 2IXTA 3ZLJA 2P9FA 1V8BA 1Q5PA 1R9JA 2VYFA 3HB0A 2QUKA 3NTXA 2C7RA 4W1RA 3HBMA 2JGAA 4JT4A 2PR7A 1QIDA 1CY8A 4KYUA 2DPXA 2ZWIA 3FFWA 2IPAB 4HB2A 4K03A 3L82B 4NMMA 4RF3A 1R8SA 1YBVA 5EHQA 2P4HX 2V58A 2YWCA 1LRKA 2GPAA 3NIGB 3P71T 5FBKA 3W6UA 1MTOA 1DX6A 3H99A 4YH1A 5EJAA 4LXGA 2EWMA 4YRTA 2Z08A 4ZZ3A 4PN7A 7REQA 2AUMA 2V6GA 1NYLA 3NM6B 2H1FA 1U3TA 3OX2A 3PL1A 4RMJA 4AY3A 3TG8A 5C5DA 4HH0A 4I6EA 1Q0HA 5KNCA 3UJ9A 1O08A 3M8KA 5AM5A 4CCWA 1F14A 2AFVA 4MW6A 3TS1A 4O0LA 2C5AA 2LW7A 2RKBA 2JIOA 3I6BA 2MYPA 3BEDA 3EXIB 1GKLA 1NY5A 2I4IA 2B34A 2VRBA 1PX0A 1R0XA 1BG6A 2IZOA 3RIMA 1QDUA 4ISBA 2V65A 2HU8A 3MT7A 5CGQB 2EARA 5KNCD 2WT4A 2QZJA 3LI2A 3QMPA 3ZCRA 1PW7A 3RQIA 1HKHA 4POOA 1TMOA 2P90A 5ADVA 1VPEA 1VTKA 4KQEA 1W36B 1FFWA 3IQFA 1K4YA 1OVGA 1K98A 3LHKA 4TTTS 2QJTA 3AI3A 3C7KA 4IXWA 4KE6A 5J5CA 3ZWOA 2I3DA 5AD1A 4LXTA 2AXQA 3IBCA 1C3LA 4BNFA 2H7VA 5DULA 3IMKA 1QZUA 3GWGA 3HO6A 2ZUFA 5FFNA 3W0LB 5DE3A 2DUMA 1UDBA 4ALLA 5KVAA 1M2GA 3K15A 1AK2A 3U44B 2X6TA 4UBMA 2ZSHA 4DREA 1GGMA 2ADMA 3OMWA 5JVDB 3K70B 2VTKA 2K4MA 3GLHA 4QGGA 1DBVO 3BE6A 3FOWA 4NPAA 5AUQA 3STYA 2GPWA 4Q6BA 1N3LA 1L5KA 4FFRA 4U5XA 1AX9A 2Q99A 4OV6B 1WW8A 5SZKB 1EVEA 1LBQA 1OBOA 4CL8A 1Y6JA 5JSQA 2BI4A 2OV1A 3WLFA 2J85A 4XDZA 2FLWA 1NC3A 4KW7A 5DOZA 5F2OA 3TK1A 2HT6A 3VKVA 1P4HA 4G5GA 4F4FA 2VHUA 3NEYA 4O2BF 4OHPA 2IHVA 5SYNA 4ZI2A 4JL8A 1WHSB 4GGMX 1GAEO 4K9NA 5IVIA 1ZH8A 3L4KA 2IDMA 2UXDB 2CL0X 4E5DA 3Q5EA 4EI9A 1Q1QA 1U9IA 1JG4A 4YJ3A 3RK4A 2C4KA 4PS1A 4MV3A 1Y3IA 4IIUA 4B34A 4CPDA 3S2SA 3VVMA 3QFHA 3P45A 4BTEA 3W3AA 2O2SA 1FFXA 1SKYE 2JCBA 2O3RA 2X40A 3DEZA 4M1MA 5BN5B 3EVEA 1JA0A 1BEUB 1YK0A 4UVGA 2FY8A 3MW8A 2YCLA 1QV7A 3PXAA 1O57A 5G0SA 1XMVA 4RESA 4RTPA 4CEIA 4JSYA 1MORA 2JVKA 2ZWAA 1KZGB 2DGDA 3A26A 4Q1FA 3VV2A 3OE7A 3W3AD 3WK4A 1QLHA 3N86A 1ITZA 5DHQA 3KKZA 4U2CA 2RAVA 4EW1A 3QMVA 4JXZA 3I64A 3FMGA 2XWPA 4YRSA 2VG8A 2BGGA 4QOIA 4OG2A 1V5FA 3PA6A 1U6JA 4IUDS 4OSEA 5CITA 3N8NA 1MJHA 1EA5A 4D81A 4ER6A 4MW7A 3OE7D 3OPYI 4JGBA 3LPNA 1A9OA 2E48A 4UE2A 2QMYA 4UUBA 4XQ0A 3AY7A 4DSTA 3CUWA 3DOUA 1Y5RA 1E94E 4Q9AA 1XK7A 1XRSB 3U09A 4YACA 1D0VA 2FR0A 2GLXA 3C3PA 2NVOA 4PYMA 4YGYA 1K0UA 1X8LA 3H6GA 4IIHA 4XVUA 4YCBA 4PNEA 2XLCA 2WVGA 4OL0A 3D3WB 2AQKA 4P36A 5K99A 4F2GA 5ICSA 4QBIA 1PGQA 1QE5A 2FZ4A 1H4QA 1EFHA 2RHWA 3OM0A 1G8PA 2I8LA 1Y4AE 4YRIA 1F12A 2BD0A 1B6TA 2IHJA 2IQIA 2PNFA 3HM2A 3VZPA 4LJ7A 2XMPA 4YUXA 3KAPA 3G1TA 2CJXA 2RIPA 3JWJA 3WJ7A 5JNWA 1CQIB 4D0GA 5JYCA 2R11A 4QUDA 3AJDA 4HLDA 3MUFA 5CBPA 4JP8A 5DM2A 4ZXFA 4DLLA 3F96A 2H18A 4RGQA 1L8AA 4K6HA 1ZKMA 3WFJA 4F6LA 2J07A 1UPCA 1U3DA 2G36A 4NABA 1IXZA 4P4TA 1HDXA 1PK9A 2PL1A 4F60A 1VPVA 4ZVUA 5AVUA 4NU6A 2DJ5A 1REQB 2ZRHA 5KSPA 4YR7A 1YA6A 1SVNA 4PV7A 2BR5A 3FE2A 4HCJA 1C1XB 1NHGA 2RG1A 4KCGA 1N2BA 3R20A 1I1HA 4JMPA 2C58A 4UM9D 4MA4A 4PLTA 5E6RB 3TBKA 3EUAA 4HBZA 2NU9A 5C8XA 1A4IA 1M1YA 4JY7A 4D45A 3RNOA 3V7UA 4DGSA 4CIDA 4G0XA 3D3QA 1GV0A 2H63A 3HFJA 3P97A 3FTDA 1WG8A 2F48A 3CZ4A 3PQ3A 4KUHA 4N0MA 3HJCA 4DY4A 4KQIA 3ZWWA 5TEVA 2O8FA 4YJ3B 2C4HA 2IZ7A 3K9NA 4IX9A 3PPIA 1XZMA 2KBFA 1RJWA 3HYLA 1OE0A 3MCTA 4P7JA 5AI9A 4YAKA 3B36A 4CT5A 4BNXA 4RZ3A 3NHWA 1ONPA 4MHSA 4QD3A 1I5OA 2BP7B 2XQGA 4IIDA 4ND8B 3IAUA 2GAJA 3KKEA 2WWFA 5B1DA 3UWOA 5AM1A 1YZYA 3TIIA 3MWYW 5EWJA 2PUAA 3NAMA 3GNQA 4MIOA 1U9JA 3WADA 4B8ZA 1KBQA 4G1VA 3C5CA 3L92A 3MVEA 2DFPA 3TQHA 2IHTA 4PWYA 1WUHS 2WSSD 2WYWA 3CRW1 4R4JA 1R64A 1U3GA 3DNMA 3PWZA 3AXTA 2UZ3A 4YJHA 3TLKA 3W6NA 1Z83A 2IEBA 3FYHA 4G0QA 4LBWA 2XWBF 3CLTC 4WDQA 5IAKA 1OV6A 2FCRA 6PFKA 1BW9B 3E6AA 5I9NA 2PFSA 3PT9A 1MRSA 5C8YF 3FETA 2XQFA 1GM5A 1GTSA 1J2UA 5I6DA 5IWAB 3CRRA 1YH3A 2A0WA 3WKBA 5JBQA 3DMRA 5KTOA 1L4BA 1TIBA 4TWJA 4UULA 2J1LA 5AYVA 1PUXA 2GA9A 4DM7A 4ARCA 3D3JA 3GHHA 3K9FC 1S2GA 1G8AA 2NNWB 3D3KA 3OWHA 4G5HA 4F9EA 5KJ1A 2R6JA 1BZYA 3FR8A 1M83A 2P3LA 2ILVA 4HQOA 1FF9A 2YHUA 5K5EA 3N07A 5GPBA 1G8GA 3VNSA 1CS4C 4XWOA 4KO4S 3VMFA 3W8EA 4TRRA 1LDNA 4BE4A 2BEWA 1ZCJA 3KQMA 2GLTA 5GMOA 4AJLA 1JVSA 3IUNA 3DD5A 3O4HA 3OZCA 3DEAA 2VFAA 1XRMA 4YRZA 2W2VA 1THZA 3KPVA 4HEHA 5BW4A 3N0WA 4OL9A 2QN1A 1NBWB 4LGMA 2PYDA 1SVOA 4U8HA 3BSYA 1LRJA 5CBPB 2ZDGA 1IAQA 1WJGA 3CRZA 3KEQA 3T35A 2IWRA 4YT4A 3Q3HA 2J5QA 3F5QA 2A8YA 1TJ4A 2BY4A 2PGDA 4G01B 3REGA 2QDXA 1JWLA 1YZVA 2Q3DA 3I01A 3RJ5A 3TCXB 5CDUA 1QZTA 3LNCA 4LK2A 1Z6QA 4FJ1A 1DAIA 1SCNE 4F4IA 3RUPA 3RT9A 1XTZA 2VS1A 3BWYA 4URZR 3WHPA 3KYDA 2AX3A 3WRVA 5KWIA 3G02A 1WMFA 3FFBA 3N8IA 1Q0LA 2GBPA 1SKUA 4MVJF 4OAQA 5D6NA 1GAJA 1Y98A 4QLOA 3U26A 3WO0A 3PITA 3GMDA 4YJ2A 1KDPA 1BCRA 3GFQA 4P34A 4M3NA 3U17A 2CUKA 5IFKA 1NOKA 3PICA 1P1KA 3A27A 5G02A 4E13A 4ETIA 2H85A 1JMKC 5L53A 3INGA 1EFPA 1M1YB 3H11A 4FEYA 3GJ4A 3E0QA 2C5BA 2P9BA 1U7XA 2FA9A 3H05A 3L06A 3L6UA 5REQA 4DUGD 2JFHA 1HBJA 4DCNA 3F73A 1MOSA 1QLWA 3PD7A 5L4NA 3PNMA 4PBTA 2BZ0A 1HUQA 1MDBA 1Y7HA 4ARBA 5B7QA 2C92A 1GKYA 4DIUA 5FKJA 4Z5XA 1RHKA 4OHFA 4QEDA 2GOYA 5EMMA 2CVHA 5KVVA 2Q1XA 3HXLA 2WD9A 1PWZA 3RCBA 1OFGA 2KE5A 5T4FA 2FOLA 3HBNA 4YJKA 4DSAA 4V1CI 4OHXA 5BR8B 5EWJB 5LDDC 4LJ6A 3NC4A 2DOKA 2AMJA 4RQTA 3CUYA 5EE5B 4D8VA 4TV8F 3FUXA 1A7AA 2QHXA 2ES4A 1RQLA 1VSBA 3L0DA 1ZIOA 3SEAA 4D02A 5CHEA 2NXEA 4YJHB 3H2YA 5D3KA 2XUAA 1RLUA 1VKJA 2ZRAA 4PX9A 3O84A 5LP6F 2PMEA 3I1YA 4WZBE 3TLBA 3ZHUA 4CDNA 4EI8A 2B69A 3K6KA 4YRKA 1S5PA 2ZB4A 3CGWA 4L0MA 4HNVA 3T06B 2NU7A 2AT1A 5HRAA 4EENA 1SHUX 1ZMBA 2AFRA 5AJXA 4MUEA 1U8EA 4AX8A 3BIXA 4KXLA 5EMHA 5I7OA 3F8TA 3SJZA 2B8TA 1X1RA 1YHYA 1ZG3A 2I1VB 4R1NA 1C7QA 4PAGA 1BQ3A 5TR9A 3TO5A 2J3HA 3OIVA 4ZZ0A 1X74A 2JFUA 2WC1A 1N2ZA 3OT1A 5F5XA 5MN4A 4H0NA 1DEKA 2ZJYA 3ZR4B 1NSYA 3FOFC 4LF7B 1GQ2A 3Q7RA 2HMUA 4KXMA 3ZHTA 3RWBA 4WPGA 3S99A 2AG1A 3F97A 1UQUA 1XZNA 2B6HA 1MHPA 3FOBA 4N39A 4OREX 4BO4A 1CF4A 1ODFA 4X24A 1Q0QA 3M83A 1E6EA 3R5FA 1F9AA 3G2NA 3DL7A 4WGFA 2PLWA 1YVRA 4Z1MA 1OCEA 5NULA 5K6RA 5F51A 4G37A 3ZEIA 2X15A 4Z7OB 1UEXC 2FRVA 2IV3A 3N2YA 3P27A 2RHHA 3G49A 3RASA 2XRFA 3BAFA 1NQUA 4IJQA 2A1TS 4RJKA 4Q7KA 1IBCA 4FW9A 1GT6A 2ZSJA 3B78A 3H2BA 3FROA 4QYIA 2V7PA 3KYDB 1L7BA 3EDYA 1A82A 3C8UA 4OIMA 4X0EA 4OOFA 1P31A 2VA8A 1VB3A 4B6SA 4HY3A 1VE3A 3Q85A 5DYTA 2ABWA 1DC8A 5A9SB 3EX7C 1WZUA 2I2XB 4FGKA 3HB5X 4TWAA 1A8HA 5EHZA 1G20B 4MO2A 4P9NA 3ZD7A 4UTZA 1GG5A 4FFBA 3FCAA 4QPDA 2IITA 1U2DC 1SUDA 1SNYA 4RW0A 3EEOA 5KTSA 2EAUA 1FFEA 1KY3A 5GONA 4NAUA 1E3LA 1JHAA 1ODIA 1O4WA 1BYUA 1ZI8A 3AT1A 4KGDA 4Q18A 5ELMA 2OB2A 5REQB 4BFSA 4JUDX 3AW9A 3QLUA 1BQ4A 3DHWC 4JU8A 5D5PA 3IERA 2D2FA 2QVGA 5A7HA 4HYTA 3N2ZB 3IS3A 4CHGA 2XUIA 2GJ9A 4UAUA 3U3DA 3F6YA 3SWWA 3OFNA 3TW8A 4OYHA 1GARA 2I7XA 3GU3A 3B5IA 5CFOA 4DMLA 4LY3A 1JQBA 2NUPA 4HWGA 3P2KA 1IOZA 2ZKLA 4HL6A 4JLPA 1EWYA 1T8TA 3EVTA 2ZEJA 2V7EA 4MOWA 3U39A 1CVRA 1HL3A 1X1EA 2XB9A 2ZRKA 4QREA 3O8DA 3ZH9B 4FSDA 2P30A 1O3YA 4FZ3A 3PKZA 5E9QA 1M2HA 3QI2A 2PSJA 3UIEA 2CWWA 3VC2A 5FNVB 4KUGA 4DSOA 3CCBA 3IFSA 5ESRA 2CV2A 3C7DB 3L18A 1U7HA 1OFHA 1PSZA 1YRLA 1SUBA 2VF8A 3FPKA 4RIGA 5ETJA 3U9SA 1DQRA 3CT6A 2HGSA 4EPVA 1SXGA 3PR3A 5AKXA 4OHVA 1EHYA 1VZ3A 3KTFA 3U4IA 4FFDA 1TAGA 3K1ZA 2R1UA 3GZ4A 4P86A 3IO3A 3HACA 4DR3B 3SFZA 4CF4A 1D8TA 2Z8XA 4AM8A 1LPBB 4FYXA 1URPA 4Y18A 1D9ZA 1CS0A 1Q1NA 1WR8A 4YT2A 5IJ9B 5JXWA 4MPTA 2CBXA 2J6BA 1IC6A 2GUGA 2EBUA 1CUZA 1UDRA 4I6JA 5CX1A 4GX0A 1E1YA 4PLYA 4KU4A 4CR7A 5KTKA 1QPZA 5F23A 5HS4A 2Z9BA 3UUEA 4CIYA 5ECYA 5HFAA 7ABPA 3CJQA 1QH8B 5L9AA 3GLGE 3HTXA 1HX7A 1TO1E 1GQQA 2I7DA 4JYAB 1WCIA 3EH1A 2VXYA 5ALXA 2W70A 1GYPA 1HYBA 3ADPA 2H51A 5AJUA 5TNXA 2YV5A 3HCCA 1K3TA 5DYGA 1EAMA 2EIHA 1Z6GA 1ZJJA 5JS8A 1HPLA 1QG0A 3NTOA 4JI0B 3DP7A 3P0FA 4M1KA 4H35A 3LQRA 3OJOA 1Z0ZA 3EIWA 2Y1OA 3A32A 3O1IC 4U7TB 2JD2A 4YXFA 4D9KA 3NG1A 4IW3B 3VR2A 5BT8A 1DE0A 1LLUA 3BPSA 3MAJA 3P94A 2I34A 5E0OA 5F3RA 2FHSA 3LFUA 4F5ZA 3AM5A 3DWFA 1N33B 4G0ZA 3NRCA 1P9OA 5M2QA 1ONOA 2XDWA 2ZI3A 2WUEA 4OSOA 4UE6A 1Y3FE 3KOXA 2ZIUB 3N8KA 2ID7A 4MR8A 2W2KA 1JKMA 2Q3LA 1XL0A 4K81B 1NKTA 4ZGGA 1DKMA 1XTKA 3VR2D 4Q82A 1FP6A 2V3WA 1L5MA 2HF8A 2Z04A 3VR6H 4CUJA 3RUFA 4EEXA 2FPXA 3RFFA 1JQLB 4FFBB 3UJPA 4OCZA 3COZA 1W36C 4NZYA 1Q14A 1ODCA 1V7QA 3RSOA 4QM7A 4PZ0A 1G55A 5FOQA 3QFSA 4M8LA 1W0JA 5GONB 2XRYA 2GT1A 5DDIP 2JZNA 3SHFA 5K0BA 3R76A 4II3A 1CE8B 4BJ1A 4JUIA 3UAXA 3H1BA 4L5AA 2AL7A 3GQBA 4JP1A 1AE1A 3WV4A 1N2OA 4D56A 2UU9B 1CP3A 4OB7A 4MUGA 4RXMA 2Q2WA 4BGUA 4X3PA 3SIWA 2NUPB 4MZXA 3HC7A 3F4LA 1B8UA 4FB5A 1XF9A 1CB7A 4I4IA 2WIAA 1GCAA 4LZOA 3B1YA 2GM5A 2R86A 2A57A 1X80A 3GJYA 4R6WA 3X1DA 1GOTA 2ECQA 2ZI9A 2JZOA 5HZKA 4ANFA 1WSBA 5JASA 3HKEB 4A36A 2O8BA 4E70A 3WNBA 5CJPA 4EJFA 4IMIB 3UXHA 4MVYA 1G21E 4DC9A 5JOQA 4XLZA 4Z4GA 4R54A 1N2HA 3BVPA 2D74A 2I3BA 4REMA 5KTPA 1SQ0A 2ILTA 1N78A 1MNAA 3KKQA 3VTFA 2V7WA 4DA0A 1KI8A 1XYYA 3EQ8A 1R0CA 5EKXA 3WL7A 3RYCA 4LF5B 3AM3A 3OY2A 1VP9A 1T3TA 3D7SA 3I2YX 4KJXA 3U62A 4D8YA 3L8DA 4YJFA 1G7SA 1ZH4A 3N9IA 3CINA 4L22A 3WWEA 3OIDA 4U7JA 1XJQA 1N7IA 3IVCA 3MQFA 2JVJA 4OLBA 2JD1A 4RAQA 1TPYA 1KS9A 3KJIA 5IEJA 4ZU1X 2XXJA 9LDBA 1E18A 2NNLD 4E5UA 3BIOA 4ROSA 5DYNA 1TF5A 2QTZA 4HXEB 4N6GA 3ENVA 4L5CA 4PONA 4QFCA 1PD0A 4YP1A 4G5QA 3LUGA 1RADA 1AN9A 2HJHA 2C5EA 2QG6A 3GDOA 4PINA 2CV1A 3L0SA 3IUEA 4OGGA 2V6FA 1KFBB 2PGNA 1ZUNA 4ABYA 3INNA 4N0PA 1IQRA 1DPFA 4G1MB 4IFIA 4L8FA 4V0SA 3RSZA 4EUNA 4B3RB 3P2MA 1MP0A 2ZSDA 3KBOA 2PYZA 3IPXA 3SFVA 5HQJA 1X1AA 2B61A 1IOVA 2Z57A 4J43A 3PIDA 2R1VA 4P32A 2XAAA 2QI9C 3TMAA 4P6VF 1NM5A 1IZ9A 4NBRA 4N8SA 1CFJA 5AWFC 3I72A 4Q7LA 1I4LD 3D4IA 4Q03A 4XD7A 1PZFA 1UBJS 2J3QA 3AKDA 3KFXA 3RYTC 3S8MA 2NZYA 5HIAA 2O7RA 2Y4NA 4HNGA 4ZHQB 2L17A 1I5RA 1JG6A 3H4TA 4DUPA 1IN4A 3VM6A 3BEOA 3QHQA 2PBRA 2E82A 5TQ2A 2PIDA 2LIPA 2Z5GA 1JQDA 1EZ1A 1Z4MA 4TZKA 4WVFA 3KXDA 5COQA 1RMTA 2H11A 1NI3A 4XD7D 4ZVLA 1DQPA 2D0OB 3C1AA 5I9BA 1Z6ZA 3PPVA 2C7GA 1R9MA 5TVKA 3R9WA 5JV5A 1LBEA 1D04A 4D9EA 2NO6A 1ADJA 1I4OA 5IAJA 4OXRA 4AUNA 4KR0A 1ANKA 4LW8A 3A4TA 5TQ0A 2XCTB 2WYHA 3GQBB 1DTWA 1MQ9A 5DTJA 4HVCA 1VA4A 2FSSA 1NNSA 3NTRA 3C3XA 3ZE9A 3A4LA 3PX3A 3SJAA 1V45E 4MGKR 4B75A 3PJRA 3RU2A 4CG2A 1JVBA 4MR7B 4J9VA 1PLLA 1W4ZA 3NHRA 2EC5A 2ZJ7A 2IEAA 3B6KA 3DFUA 4C88A 4R51A 1JFTA 1NPTO 3I9NA 1H2WA 3K0FA 4HJXA 3UJ7A 3ZIUA 4BTVA 2CCJA 4YPFA 3CQ9A 5AJTA 1ELOA 2Q5JA 4X91A 3GJ0A 3MLEA 4MVWA 3VYTB 3DHEA 2Y0DA 3OAAD 4ZMSA 4KACA 3G5MA 4CMKA 3DAGA 4UBOA 3LDAA 3O8BA 3K30A 3OPNA 4XUGB 3DF9A 1L5NA 3HCRA 3L1HA 4TQAA 4QEZA 2OSVA 3DWIA 3ECSA 5LLDA 4FBLA 1E6CA 3VC7A 1WDTA 4M88A 1PDVA 1U9IC 3GUCA 4RPCA 3HKCA 1G9XA 4WZAA 1XF1A 3DDNA 1TK9A 2VPWA 3C85A 3CFYA 3KDSE 4PO3X 2WPDA 1MGPA 1UKVY 1I2ZA 1P7ZA 2KW5A 4XX0A 1OV4A 1FFSA 1K88A 3IMCA 4U2EA 5IKOA 3F47A 3N3BC 1LPOA 3TLGA 1W46A 2G82A 1NR5A 3A9WA 1UKAA 1ZU5A 1WL8A 3I2JA 1QKJA 4DG8A 2YOHA 4OAPA 3ZZTA 4EYSA 2QUHA 1WBBA 2O4UX 1LX6A 2PM8A 3ZXYA 5C4IA 1OX4A 4CF6A 5LD2B 1S7GA 2QXTA 4MS1B 3CU5A 1STOA 1EEHA 2AZMA 3FM9A 3HADA 3MWJA 4N40A 4CV3A 4PGAA 1JG2A 1DCKA 2Q9BA 3IPLA 3UKOA 2BISA 1BDBA 2BM0A 2QSYA 3D2BA 3PVCA 1ZINA 4LNUA 3R40A 4V38A 5H4HA 4O6VA 3ZE7A 1NW8A 4P92A 3E9NA 1UWVA 2W37A 4HXFB 4BMDA 1EFTA 5CIWA 1Z0FA 2G5TA 2PFKA 2VJKA 3DMGA 5BUQA 5JC1A 2X42A 1QX4A 3H1PA 4I3GA 4QELA 1Z28A 3DPSA 4P0TA 3RUDA 1VIDA 2AG5A 1FMLA 3QU5A 4XCQA 3NDBB 4NOMA 1M7HA 3FWKA 3VGJA 5BMVA 1QQ7A 2RC6A 1R8XA 3D7LA 4FYIA 1P6XA 3P0HA 4N65A 4LF4B 3T4PA 4R8RA 1L5QA 3WFIA 3QI7A 2GCGA 1ZOSA 3BH0A 2CNBA 4FZRA 4WI1A 2B8EA 4X1YB 2IIQA 4Q47A 5IAGA 3WYDA 3ZXIA 2X19A 1KPGA 2XYVA 3ANTA 4JB3A 4JI3B 3GJRA 3U4AA 1YO6A 1Z0KA 2OV3A 4IDGA 2PJZA 2G17A 3SHOA 4BQNA 2JLRA 1N2JA 1L8XA 2Q6KA 2EQ5A 3PQ7A 3EGXB 1K89A 2VN8A 3IR7A 5JMOA 2IEIA 3EHDA 4MCJA 5DEIA 4MARA 3RS3A 4B82A 4BN0A 2WM9B 5KYKA 2IP4A 5E4YA 3CR8A 4UQLA 3AR8A 5DP1A 4WJLA 4DR4B 1BWQA 1I5EA 4WN3A 3AKYA 2WG0A 1VHTA 1VLJA 4M49A 5DNDA 2QVBA 5GZ6A 3W4KA 1N5IA 1NQTA 5BV7A 2WJPA 2ZIFA 1DC6A 2OCPA 3I0MA 1LLDA 5U4QA 4C07A 3O4GA 4WXPA 4M89A 1XQWA 3GP3A 2DRIA 3AZOA 3CZ5A 2I4MA 5CLHA 2GO1A 2ZAOA 3EBOA 3E22A 3BCRA 1U0TA 4TXHA 3B7PA 3CRQA 4QU8A 1PBTA 2LGJA 4HS9A 4W5QA 4YFYA 1YKSA 1C81A 5EPOA 2G1JA 1SVIA 4NE9A 2CLKB 4UAVA 4WZAB 3V55A 4ZTUB 1EIWA 3U7JA 3VR1A 4YIHA 2AIRA 3GH1A 1PYOA 1QP7A 2CZQA 4LMPA 3GGSA 1KO1A 3GRAA 2OO3A 9MHTA 3EXAA 2ZGVA 4FSHA 1H23A 2WG2A 3RC3A 2AA3A 5FRDA 4FB4A 3DXXA 4DJEC 5DXFA 1C30A 1T1RA 2V6JA 1FQWA 1DXQA 1G9TA 1N3IA 1NBEA 1Q12A 2A58A 3CWQA 3UWSA 1SWVA 4LZZA 2HKIA 3UMBA 4OQPA 4JODA 2QL5A 5AH0A 1T13A 2ZPAA 4IL5A 4EO9A 2QM0A 1TIPA 2Q8NA 2VCEA 4B4OA 5AW2A 4M6WA 3FKSA 5DGTA 2WUGA 3OE4A 4BNJA 3MS4A 3P9CA 1E2LA 5JMWA 5BV1A 4DYDA 4CNBA 2WMNB 2XCUA 5ES3A 4LNUB 3TPCA 1JIUA 2ANCA 4MMYB 1IUNA 2WOOA 5AK5A 5AVJA 721PA 2YMLA 2RONA 3LZCA 4L1KA 2HIAA 4M7OA 3W6OA 3N74A 4GGPA 4MQ6A 3PFFA 3ZOZA 3PQ2A 3DM5A 5EVCA 4RSMA 5EJMA 5B2FA 1J20A 4BNGA 1HQDA 2BBOA 3LZ6A 4D25A 3PGVA 3KU1A 3ZKWA 3AG5A 1U8ZA 3CXRA 3D2CA 3QVTA 1WXDA 3WOVA 4RIEA 4ZA2A 3T8YA 1E2PA 3FG9A 1XZFA 1S3GA 2TMGA 5EZQA 2Z4RA 3OIGA 1MOZA 2WLTA 3WWDA 3FA2A 2VSNA 4BLWA 4HGRA 2OBBA 1TZCA 2HWXA 1R16A 2C7BA 3IQGX 3R3VA 4P08A 1IVSA 4DLKA 4NYJQ 1FUYB 4P22A 2VNSA 1JA9A 5EHIA 1MX3A 3UJ8A 3CX6A 5BORA 1ESMA 4F4CA 1HDRA 4DLZA 1JUDA 3K16A 4IPTA 1I94B 1WV1A 2GFQA 2J4FA 4F5DA 5F73A 1G8SA 5JD6A 4J1SA 1DI0A 2BGJA 1JSCA 1PVDA 1MX1A 2YNMD 3PUXA 2O4CA 4GEKA 4LJRA 4FW8A 4AN1A 4CMIA 1Z34A 2HMAA 3L93A 4UCWA 5ALSA 3DO6A 2N47A 4XVRA 3ZDEA 3GLFB 3CO5A 1ICEA 3AF3A 2V6MA 3L01A 4C6RA 3FJYA 2A0YA 2V96A 3AONB 3GGCA 3L8CA 4OMFG 4QHYA 3HSYA 1O97D 1WU8A 3CZMA 3H1AA 3KTAA 3B6IA 2WV9A 4X90A 3HXMA 5JU6A 4AQ7A 1KOJA 2Q2OA 4IHQA 3T7RA 3LO5A 3INYA 3B38A 2H0QA 4XSHA 1AV6A 3DO8A 1PIWA 1GRQA 4FNGA 4EA6A 2VHWA 1ZM3A 3E22B 4ZQBA 3WDMA 4AD8A 4G0OA 4BZWA 1G1MA 1Y6FA 4LFAB 1OZAA 1P6QA 4MRRA 4XZ3A 1KU6A 4IV8A 4DIMA 2OHOA 4BPBA 1E2BA 2N1MA 3OZ7A 1ZL0A 3Q3EA 5K01A 2D2XA 1JAYA 3P4XA 5FL3A 1OH6A 3ZY5A 4M7RA 3H2GA 3QVOA 3B1FA 1BS1A 1ZZGA 1R4MB 2QTHA 1A2KC 3NHKA 3EVBA 3PEFA 5HG0A 5K8UA 2R6FA 4JU9A 4B3IA 1KYIA 1BO6A 1L6RA 3A7DA 1FSPA 2CBGA 3WZMA 3IPYA 4CCYA 5IXYA 5TGDA 1TUGA 4S2UA 1RM3A 2I80A 4BO1A 5JRDS 1DV1A 2ZWOA 4O2BA 1UEIA 1XJCA 3MUNA 2C3UA 2QMQA 4NESA 4EAAA 4R2XA 4MV7A 3VU1A 2D5CA 2WVJA 2ZYUX 3H6KA 4I4NA 2I7CA 3LYAA 1SN7A 4WASA 4H6XA 3T3EA 5CD1A 1O8CA 1AHNA 3ZCTA 3AF0A 1RKXA 5KYWA 3DOEA 4H7EA 1G291 1N2CA 1AV7A 3FSGA 5INTA 5DM60 2EZUA 1ZH0A 1C4WA 2HNBA 3TKYA 1VMDA 4NDAA 1IXRC 1ZRNA 2FQWA 2XYGA 4L8YA 2IYEA 2V4UA 2Z9DA 4LK3A 4NOLA 4ZV4A 2RHDA 4Q34A 3KQTA 4U7HA 1MZVA 3EEIA 3D5QA 4GBMA 5DNAA 1VKNA 2PGLA 1Y7IA 1VSTA 5F7ZA 3PNPA 3FSGD 3U16A 2PPLA 2R6R1 1L7OA 4G6ZA 1BGXT 1QYRA 4HSEA 3V4VB 1UDXA 4BP3A 4ZEVA 2GS9A 3A9CA 3UEOA 2PUDA 4WNIA 2RH8A 1OX5A 3V33A 2YZKA 4O4JA 1Q1BA 1XNRB 2JAUA 1PQ4A 3UNXA 5K6TA 4IJ5A 5HX7A 4EG6A 1RR6A 2NO1A 3Q7IA 3CW2A 2YKGA 1EK0A 2CLEB 2VKQA 3GB9A 4LC0A 4GMKA 2WWXA 2H31A 4L3OA 3W3AH 4C6HA 3KFLA 3P8ZA 4K9LA 4E21A 4RMHA 1LNSA 4H18A 4DCCA 4MI6A 2VZLA 3NALA 4BCCA 4ZYZA 5D7NA 3PJEA 2CB0A 3EIHA 2I4LA 3P1JA 4MHOA 2R65A 5DBEX 2NYVA 3OU7A 4P80A 2JC3A 3U4HA 2VDQB 4B0PA 2PX2A 1DAPA 2PRKA 5JUWA 5JY1A 3G88A 4CMIB 2XVAA 5LA6F 4C7VA 3F3YA 2HSEA 4IIJF 1ISRA 3DE0X 2AE2A 4MK4A 2QN6A 4QULA 1X1SA 5LCXA 2C2XA 4ALKA 3H5WA 4K9MA 4Y6SA 2G3YA 1Q20A 2XECA 1JHUA 1T34A 4BRUA 4RHXA 3P2JA 1E2KA 3V80A 4BFYA 1XZHA 4ZAYA 1CBUA 3QLUC 1ZM7A 2DG2A 3RB8A 4TYYA 4N0DA 2KLHA 2ORWA 4MV6A 4NJEB 2YV4A 4KK4A 3PQ8A 4BDTA 1H69A 1EFRA 3NV7A 3W9UA 4QG7A 1H8HA 3OTIA 2V3CC 4X66B 1NVVQ 1GGFA 3BWVA 1WDWB 1O8BA 4DA9A 3JYQA 5CIQA 1HNXB 1XHLA 1X87A 1G5PA 2PEZA 3LY5A 1EUCB 4U7WA 4JT8A 5ALUA 3K3PA 1VRVA 1N0WA 5CNJA 5KYNA 2CYCA 1SVKA 2BR4A 1P0PA 1I7NA 1LDMA 2ECOA 2EBHX 4O2BB 4G0YA 4MB6A 1H8HD 1IAVA 2F43B 3F8SA 1T25A 3SP1A 2P0YA 5HYVA 5IRCD 1AHIA 2DBRA 3SDSA 4W7HA 1M34A 1U94A 1ZI6A 1ZRMA 2DHDA 1NBAA 1IRXA 2Z4TA 3B12A 4RFVA 4FCCA 1C3XA 1N2CB 1XRRA 1ZN7A 4RDIA 4EF6A 2GZAA 5I3CA 3NP7A 4RNCA 4K1LA 5GOZA 1QPBA 4BOYA 1P9WA 4ZYXA 3ITDA 1WB9A 3L8MA 4R8KA 3UWMA 4HEA6 2PY6A 4JLKA 4CM4A 2HZBA 2ZSUA 3VHXA 5KYTA 1U04A 3HDVA 3WOHA 1NF8A 2IYUA 1Q2UA 1MC8A 4C0BA 4K9KA 4N6OA 5TSDA 3X1ZA 1ZN8A 2HLPA 1W29A 1ZGCA 2WF6A 1XR3A 1ZGGA 2XITA 1B26A 3IUMA 2H2IA 3O8OA 4WOBA 4C04A 2OAEA 2ASEA 1GIAA 1JNYA 2YFHA 1N2IA 4PYJA 1VSVA 3H2SA 3CM0A 1FW8A 3AYZB 1HE2A 2D8MA 3HR7A 2WTBA 2PXAA 5C8YA 1J70A 1FRNA 2EZ4A 2HL6A 4JR2A 4ZOCA 4X54A 4L0DA 3V3KA 3DHVA 1WPQA 4PYKA 2ERYA 1ZOIA 4B85A 3SHTA 5M7EA 2GN1A 3UAVA 1Q0SA 1A95A 2V7VA 1M67A 1U9YA 1W25A 4Q7MB 5EQDA 3R8CA 4EQZA 4JQCA 4WN9A 1DXYA 2E1PA 3QKUA 3MS2A 3GN1A 4IM7A 4C4RA 3CG0A 1UZMA 3TF5A 4L6IA 3MJRA 4I7EA 5IWCA 5KZMB 4B3MB 1W8DA 4OQFA 3FPFA 4HB4A 5GIOE 1G4AE 1MAVA 3LBNA 4LRSB 5BWOA 1W2WB 4GFDA 1CP2A 5DH9A 4YDQA 3CBQA 5DISB 1IUPA 1T6ZA 4Q9NA 1J8MF 5JIBA 1GRCA 1KVSA 4I14A 1SOUA 2P2NA 1FU4A 4C1BA 4EEZA 1PS0A 2I29A 3B2EA 5ALNA 3E23A 1UODA 2P9HA 3MWFA 4RJ2A 3ENKA 3TKAA 4KQXA 4FNAA 3UENA 4QVKA 1Y4DE 4NFYA 1JALA 1QHIA 1TD9A 2Z2JA 3G89A 4DADA 2F3SA 2GZRA 2H06A 4RM2A 3A2LA 4RVOA 1E3TA 4WACA 1LDBA 3ZDXB 1TYCA 1YRQA 3M0EA 2WZQA 4LRUA 4MVJA 1IIRA 4OK3A 4AF8A 5KREA 2W22A 1MCZA 1WHTA 4MQMA 3CNNA 4LOKA 2QD1A 2YJ5A 5A2QA 2HLHA 3OF5A 2VK1A 4R7TA 5A4FS 3QY0A 1J0DA 1KS2A 2FQYA 3HDTA 6REQB 4RTMA 1QAMA 1LFDB 3JQGA 4DNPA 4NV3A 2HRRA 3KQPA 2BEJA 1SU6A 4TUYF 1FK8A 2JCYA 4RVFA 5DASA 1L8QA 3I9OA 2NZWA 2OZKA 2YIVX 2HK8A 4YC7A 2GPYA 3HA5A 5JPDA 5KTRA 2C3YA 4F1KA 1CZRA 4AO8A 4J49A 4W8HA 5LUAA 1W9HA 4NF2A 4C0QC 3KLNA 1XTIA 4UHFA 4BP1A 1XRPA 1KY4A 3E1KA 1LSJA 2BGUA 2B4RO 4TMTA 4B3JA 2DZDA 3QXJA 5CVVA 4I3HA 4AUMA 4LSWA 5E8RA 1SPBS 1Z7GA 2MWMA 1GT91 1FTQA 3LX8A 2YV3A 1A2QA 1V41E 2D1QA 1SQSA 3ZGXA 4EG3A 3PENA 1UK8A 1D7AA 1NN3A 5FORA 5KQMA 3V9AA 2Z56A 4TV8A 3NS7A 4L50A 2XBMA 1Q17A 3UA4A 4CEJA 4HI0E 4GD3Q 2Q3JA 7MDHA 4ZQGA 2PAAA 3UZUA 4ZAVA 2I4NA 3KVOA 3O8OB 4KG7A 3TVYA 4IDBA 1IN8A 1EX6A 3KB2A 4QA9A 5JS6A 1B8OA 3RRJA 3IJ5A 5LD2C 3I9MA 9ATCA 5LP6A 3PQFA 4LE1A 3X1KA 3EK2A 4ECAA 1T5IA 2IZZA 5DHRA 5A1JA 4NCXA 1NC1A 3K73O 5FUWA 1Y34E 3ENQA 4AUEA 2AFIE 4DLAA 4A6EA 5DN6A 3HPRA 1G4UR 4FGZA 4GS5A 4U4AA 4GP6A 2AOUA 1V25A 3MWKA 1NM5C 3E8SA 3NHSA 1E3WA 3OMXA 1DO0A 1WDKA 1AUOA 2R60A 3ELWA 1BXRA 4KMSA 2GZ2A 1RRCA 1SZPA 3BBPA 3TQSA 4BRSA 4RPLA 4BVJA 5CLFA 1MG0A 3A1UA 3B48A 1YS6A 3P4UA 5L7YA 1PL0A 2WYUA 3F6SA 3KJZA 4HC4A 3TI7A 2IUUA 4AJEA 1XZCA 4J1TA 5EERA 4C87A 1ZNYA 2O50A 3A0RB 4E03A 2GXAA 4MWBA 4WLVA 3HN7A 1YJBA 5DTQA 2Z43A 1RACA 2H4ZA 3HUTA 4CMCA 3OLZA 1E2UA 2FDRA 3AJEA 3BE5A 2PWZA 2FMKA 4C4XA 1PJRA 4N41A 1HF3A 1P0IA 4BKOA 4AW9A 2WMYA 1IHUA 2R5FA 2ZJ4A 3FYUB 4FFMA 4HSGA 4N9WA 4RIFA 5DGXA 3UAYA 4DMUB 2RG7A 3PQ4A 5BOSA 1OLSA 2A9RA 1GTJ1 5HCNA 3ANSA 4ZC1A 2NVWA 3CO0S 4L6AA 4PSCA 5B4TA 2FETA 4HH3C 1ORRA 1RHMA 3I01M 3QM1A 2Y9MB 3C3CA 2J0EA 3VFDA 2B94A 1H4SA 1GPDG 2JJQA 2E5LB 4EUSA 2X77A 5JW6A 3I5XA 1Q1GA 1WHTB 3A1SA 2QUBA 4RK7A 3H9JA 4KTVE 3DKIA 2WW8A 4MVCA 2WTNA 4KDFA 4Q12A 4IRXA 4G0MA 5IKEA 5JAHA 3NAGA 3AKEA 4FINA 4H1VA 4PAWA 2WP8J 2NUBA 3S2GA 1I2DA 2QORA 4QXPA 2ZBQA 4KXFB 5CT8A 5FOXA 5EJFA 2HK7A 1N4DA 2Y92A 2GD6A 5C9ZA 2CDRA 1NAIA 2FSPA 3OFVA 3RFCA 1DC7A 1QHEA 1AZTA 4RPGA 3M33A 4FGLA 1X7DA 4EFLA 4R9UC 5HILA 3CWZA 2QXUA 4Y2RA 4ZQHA 5HJ2A 5JJBA 4MDEA 3VAYA 3O3OB 3M6LA 3GO4A 3D0OA 1QTRA 3IODA 1EWRA 5L6MB 5JMTA 4OATA 3VOSA 3CR7A 2I3AA 4FOOA 2A5FA 3ZTYA 1UC5B 4CFYA 3MYRA 4LN1A 1G59A 3QLVA 1OY1A 4FDAA 3TKLA 1VP3A 4TV8B 2FP3A 3KHUA 1UXIA 2DQYA 4QO8A 3Q6NA 3RHZA 1NBMA 4D4GA 2O9JA 3WB1A 4YMTA 1DG1G 2G80A 3BRCA 1XJ0A 1NJGA 4KGXA 5A04A 1WNFA 2Z1MA 3TLYA 2DQ4A 2ZVDA 2QRKA 1SB9A 4H7PA 5AHWA 1SA0A 1WW2A 2C9BA 13PKA 1KQPA 3AEKA 3UAWA 4AJIA 1OAKA 4Z2YA 3ZY2A 1FTSA 2HLDD 1B0AA 1TEHA 4ARZA 5JXGA 4BV9A 4KR6A 1CJCA 2OMKA 2Q9CA 3HI6A 2Z9CA 1U4NA 2VOEA 2W8ZA 3PDJA 2PJRA 1ZHHA 1JDBB 1XB2A 3T41A 3D2LA 4DQVA 3C48A 3R09A 1FDSA 1Z07A 3FLMA 3ZDQA 5C53B 4JXJA 5K0SA 3PWSA 2BWJA 1E3WB 1ECFA 1XTVA 1L5VA 2GPTA 1BXRB 1X77A 2Z95A 3GC6A 2R7LA 3HVIA 2NZ2A 4OHKA 3EQZA 4P7GA 1ECPA 3Q9NA 2JBWA 1CRLA 1KETA 4BX2A 1PCXA 3UJ3X 5K4HA 1I2BA 3CV3A 2HMYB 1SO8A 4KLNA 4EGSA 1E2MA 3HP4A 3I1FA 4JLUA 5E1DA 2B8JA 1YDHA 3FUUA 4AZ3B 5CA0A 1Y3BE 4F3YA 3SC6A 1GXSA 4NV1A 1Z5GA 1UWKA 1I2MA 1E4EB 5E4JA 3P32A 4QAQA 5AW9A 4RTRA 4JLAA 4QUKA 2QXYA 3MZ0A 1LPMA 3O21A 2H4YA 4QOEA 3UGTA 4P4LA 4DQDA 3IH5A 1L5RA 5FUMA 4KQ9A 1FBTA 3A70A 1SOVA 1XCOA 1H5NA 2JI4A 2XF8A 3CEPB 3JQ7A 3Q3IA 3LK7A 4RL6A 1A9TA 3DDHA 4B9EA 5B4UA 4GDMA 4ZPXA 3MNFA 4C78A 2N3ZA 2ANBA 3EAQA 1GZ7A 3GN2A 4J94A 1IHXA 2OBMA 2RGEA 5EQFA 2QYHA 4KN9S 1T29A 3GPCA 4JBIA 4Q1DA 3M5PA 1OHHD 3RFXA 4WX2B 4HB0A 4EHKA 5IM5A 2QROA 3GDGA 3R5HA 4H15A 3SNKA 2XMCA 1E7YA 4J1NA 4GOND 3ND5A 3NBZC 1OC4A 1JHXA 1RWXA 2O5RA 2OCIA 2E0IA 3IAHA 4YAOA 3URMA 4P54A 1CFZA 2PZAA 3DBIA 3DH0A 3DEFA 3PHGA 1ABBA 2VHXA 2BCJQ 2A3NA 2HJGA 4LHZA 5JQWA 4CETA 1DOAA 1KI7A 1XOIA 2HEIA 3RSSA 1ULUA 2E87A 1P7CA 2XD9A 4OX9B 4GM1A 2XHEA 4ZAZA 4JUAA 3ER6A 3P5SA 5EKTA 4HVLA 4A26A 5HUJA 3R0VA 1ECLA 1RXIA 3OPQA 1USKA 1L5ZA 1FSGA 1D07A 1L1RA 1SUPA 2OESA 2FPPB 4IDCA 2EBFX 1NL3A 3CBGA 4TT3A 1EK6A 2DTDA 4P2GA 3WSWA 3RUCA 1CUCA 5LSAA 1DDIA 2C78A 4IYJA 3FSRA 2IGBA 4TV9A 1I7PA 4C30A 3VH2A 4QU9A 1IK6A 2HNKA 4RMIA 2CHFA 2Q9UA 2OZLA 3CY6A 5JSZA 3AEKB 3F4KA 4FDLA 4JWKA 4N0QA 4TT3D 4CM3A 2XUZA 1NSTA 2OZPA 1AKYA 4CLRB 3VH3A 1FJ2A 3B2NA 4KGVA 2ZTLA 4OQEA 5AUPB 1BRMA 2PAFA 4LV6A 1JR3E 2Q1TA 3IXQA 5C37A 1BOFA 2F4NA 5BRAA 2PKWA 3HUEA 2JIQA 3ROXA 1XD9A 1RVDA 2Z5FA 1XMIA 3OEWA 1UBLS 2FOIA 4BMCA 4L4RA 2RI6A 2P3SA 3EA5A 4TKMA 2EHJA 4KRGA 1P80A 3I12A 4UHKA 1X13A 1XYGA 3AVYA 4U3JB 1OXTA 2BHSA 1T5TA 1PLJA 1BSVA 1XQ6A 1PHRA 4KQWA 4E5YA 2IEYA 1T3SA 4AX4A 1ULHA 3BM5A 4HUQA 2X58A 1WVMA 2ZE6A 1PW5A 2A5DA 3E53A 4RD2A 1QR2A 2Q1YA 4OUDA 3DUFB 3W2GA 3D64A 2W6JA 2OHJA 3BMXA 1YA8A 2P2SA 3KDAA 3N0RA 4PZ9A 4KYTA 5ERYA 4NOJA 4FM9A 4ZVVA 1GSHA 2NAFA 4D7AA 3WLQA 3LUHA 3KOOA 1FSSA 5E6UA 1RQGA 2BFDB 3LOPA 2ZTVA 4DMHA 1VB5A 2E6KA 2WHPB 4EITA 4YDRA 3T34A 5I8WA 5C46F 1ZVQA 3ZI7A 3JQ7B 1T2NA 3HKDA 3DZHA 4BX9A 3BXPA 5IMSA 2QL9A 3D6MA 1OTHA 4BNDB 3ODPA 2IYQA 4Q00A 3AKZA 3ZQ6A 4AQYB 4YP9A 3HJRA 2UAGA 3TSZA 5IDQA 4QHTA 1QYWA 1R6DA 2G1PA 1FDVA 2YICA 1PF7E 3CVOA 4NRDA 4EECA 4B3DA 4PSUA 1X1CA 1GYRA 3HXKA 3HB1A 3MM4A 3OCWA 4K9DA 1KQGA 2O5CA 4L2IA 3ZLBA 1KI1A 1MIOA 1TTQB 3BTUA 4Q3EA 3UXEA 2K87A 2FPGA 1N8KA 4M86A 2PQ2A 3M7IA 1QXSA 3NKLA 2W5UA 1CF9A 2W4MA 4LZNA 4PC7A 4Q37A 4DDTA 3K2IA 3UAGA 2R00C 3MMZA 3FLAA 4HDNA 1C1YA 4RJJA 3T7JA 3TQOA 3RVJA 4OF4A 3U1TA 4ZT7A 4F45A 1EIZA 4ETMA 5K4AA 3PC8A 1P4RA 4N5DA 2G8LA 1XA0A 1XO1A 2R1ZA 2VYVD 4QU0A 4ETWA 3BMCA 4EQ6B 3BDIA 1J5XA 1G6Q1 2P75A 1BXKA 3RS9A 3VZCA 4TZ6A 5KSZA 5LQMA 1QG4A 1NPYA 4TLMB 2D59A 4FYJA 1SBQA 5D01A 3AVVA 1BEEA 2WJYA 1DINA 4LGYA 3KU4A 1Y5MA 3NH9A 1Z3CA 1YZTA 2V7QA 3EXFA 1DUIA 4E5SA 1U7DA 1BFKA 2IBMA 2YVLA 4S3MA 2RAUA 4B33A 5JSZB 1W0KD 2Q5FA 3I09A 2VUTA 3ZQJA 2I2AA 4FYMA 3DULA 2Y8EA 4WK4B 3U6BA 1SVWA 2XE8A 4EVRA 3EISA 4BN5A 3NBXX 3AVWA 4H4CA 1IG3A 1O94A 4CIXA 2QTLA 2V7QD 5AVRA 3FWHA 2QENA 2W83A 5FUQA 1XHEA 2VPZA 1M2JA 1YVEI 1GPYA 4DC1A 8LDHA 2XVMA 4HWPA 4UBNA 3W78A 4M0LA 1BFDA 5FOWA 4Y9SA 1BX3A 5CCEA 1OQAA 3ACBA 3R7WB 4ZOQI 1Q74A 1O94D 2QLMA 5J4KA 1VG0B 4PYIA 3T7SA 4TRJA 1GNSA 4Q3DA 2O5EA 1SXQA 3F5MA 4RCVA 4U1RA 1U9ZA 5I5EA 3PEVA 3CKLA 4XFJA 3NM5A 4JHLA 2QRVB 4QNMA 2B1JA 4A1OA 2FG5A 4QM6A 3DT9A 2CEKA 3SJUA 3U81A 3TJRA 1H0KA 1MUUA 2ACWA 3Q9SA 4QU5A 2XWQA 5TPZD 5JSHA 3L8GA 1TA0A 4BNWA 2PBFA 1C1HA 3DZGA 2DHCA 4TKZA 3ZXXA 3GK3A 1HRDA 3M5CA 4MUJA 2NXCA 2C3MA 5TS3A 3RAFC 5K1ZA 4X6UA 5CTJA 4DAOA 4EKIA 1CUAA 5JZMA 1MW8X 1H0HA 1HYHA 1RBMA 1T3HA 1YDEA 2IYSA 1H65A 2JIMA 3VPGA 4XLLA 4D92A 2R87A 3DTVA 4DA4A 2HRBA 2CXXA 1N4AA 4JJFA 2ZZMA 621PA 4MYHA 1IBSA 1RBZA 4YB8A 1B0UA 4OMUA 3C3JA 1J0XO 2E4UA 3KV1A 3A3KA 3QBVA 3KV3O 2MJLA 4S0ZA 1WQ4A 2H1CA 2YHSA 2BPOA 5COAA 5EP2A 3VZBA 3A05A 3V1KA 4R8VA 4HT3B 2FPGB 3L9WA 3PI6A 1MO4A 4W9MC 2XKBA 3JAWA 3R6TA 2II6A 1Q3KA 3DTVD 4FMDB 1D2EA 3ANLA 3GAAA 1KE2A 5GIPE 5H8WA 3WNCA 5EXDA 1IJBA 1OTYA 1L5OA 1YZ3A 3Q2IA 1UXOA 5EJEA 1G3MA 1YK1A 3P5BA 4J0DA 1BXGA 2WF7A 2XB4A 3ISTA 1DQYA 2PZGA 1SKBA 2QTRA 1ECGA 3RIXA 3ZNPA 2Z8YM 3UJ6A 4OB8A 5LQCA 3MRVA 4LSMA 2QQ5A 3D7KA 4BMXA 2Z5LA 4YRJA 3SMVA 5KS2A 3W5DA 1SBTA 4C7BA 1RHUA 2E4ZA 3SZLA 3T1TA 2XXBA 2PL9A 2VHQA 1XUOA 4JDUA 5DCLA 1ZJWA 5HF9A 5JCXA 4M54A 2PBZA 1EG7A 3RJTA 1C9MA 1YBMA 3R0ZA 1A72A 4W82A 4YCLA 5DZSA 4AKSA 2HLNA 5EMJA 4IKEA 3PFGA 2AN1A 3MYYA 4JLDA 2ZYAA 2JGEA 4DWOA 1L4YA 4PAQA 3T7KA 2KHZA 4RZUA 3U3JA 4RIIA 3LXUX 1MB4A 1LEHA 3H04A 4IFTA 4KOAA 4A8JA 4ZI3A 2XQIA 4A8HA 1H6AA 3H0KA 3PTZA 3WWZA 4US1R 3WGVA 1VLQA 4O4IA 3UF0A 4E4TA 2FN7A 2Q46A 2JLCA 5FPQA 5KOHA 3UBTA 2FFJA 3GT7A 2O8EA 1Q77A 1WXWA 2OOKA 3FN4A 5CDHA 2EG9A 2PSSA 3TQTA 4ZYUA 4IH9A 4DM4A 1C7RA 3EWNA 1KO5A 3FVVA 2PUEA 4ICIA 2DJIA 2UUPA 1I1NA 3AF1A 1P74A 1BGVA 3E9EA 5IJXA 1GCUA 1MO6A 4PF1A 1CR1A 1RJ9B 4NENA 1UBUS 3ROFA 4CEHA 1MPXA 2YXEA 5KOJA 4FI3F 2DUUA 3K6RA 1Z4PX 5BW6B 2WJWA 4XYLA 4Q66C 3I6YA 3KQKA 2ZWPA 1KJ8A 1ZIXA 3TOXA 3QEKA 2AC2A 5ADUS 2IYZA 3QELB 3ZDRA 1Z2AA 5B53A 1K8RA 3D54D 1BDIA 1FRFS 2ET6A 2PWYA 3BHJA 2BMEA 3TE6A 2AC7A 4IDNA 2VJOA 3HMQA 4TTQA 3Q4GA 4MW9A 2OV6A 1XCJA 1O9HA 2P41A 5AI0A 4RSGA 2F00A 5HDQA 1UMKA 3ZWAA 4AY6A 2AFHB 1YHNA 3PC4A 1QHHA 5DTEA 1Z82A 1FE8A 5LZ8A 3SNHA 1ZW1A 3TLZA 2CXPA 3R7NA 1EBFA 1SCUB 4CMHA 5JXHA 4WBNF 2WE7A 3KVYA 3R7BA 3CEHA 4FHEA 5C1OA 2E4YA 2CKMA 3FY4A 1QVZA 5EJIA 2VUSA 1KFJB 4H4EA 4AF6A 1F8FA 4I9HA 4YASA 2NO9A 3SD7A 4BFZA 1GG2A 5BVHA 2JLQA 3S44A 1WSDA 4Z9XA 1TQ4A 1WUTA 3Q6IA 3V46A 3EPLA 4V0ME 3EA0A 4LDNA 4PRYA 4CKYA 5KTTA 2EX1A 3DB2A 5EJGA 4J16C 1CUBA 4GZLA 4B43A 1JEJA 5A5EA 3CX4A 3WYNA 1VGVA 2JI6A 1MX5A 1YZNA 2D1TA 3G6WA 5EWLB 4Z0HO 2D4AA 5FWXA 1H2BA 1JDPA 4KFRA 1U7UA 2OFPA 1UOQA 3MRSA 2XW6A 4FYYA 4PQEA 1C7EA 5CHYA 3MOIA 5KTMA 2GVNA 2GRJA 3IRUA 4L73A 3UQZA 5LKAA 1J2RA 3N0VA 3K94A 1H0RA 3Q7EA 1SBIA 2HD4A 3SC3A 1C9DB 2QEQA 2RDMA 2FPIB 4NYIR 3MLAA 1VYVA 3PDUA 4OGLA 5AKLA 4CFZA 4I9UA 5EGNA 1ISJA 2VJQA 2V0GA 5EPEA 2YYSA 5BXYA 2VDLB 2C2ZA 3ABIA 4R8MA 3CX3A 1YC5A 1THGA 4MVJG 4MLDA 2P68A 5J58A 1SK8A 5H0IA 1JMYA 2C3PA 1YUMA 1SVUA 1JHPA 1O0SA 1YQWA 2I65A 2FR1A 4IXMA 2PUBA 2P0EA 4H7KA 1KOLA 5JYDA 3RABA 1YASA 3KBBA 4A8JB 5KWJA 3IBTA 4L76A 2GJSA 2X14A 4K9OA 3C6MA 3K05A 4HB3A 2F1RA 1YE3A 1QB8A 5KKAA 1J2YA 1Q6YA 1S4QA 3LY7A 3PR1A 4NNJA 1VYUA 4UUPA 3RU7A 3ZCSA 5J23A 3NMUF 4Z8YA 4YLYA 3IESA 1U0FA 3MELA 3LXXA 4II2A 2Z3VA 3N87A 5LB2A 1JTVA 2FKAA 2P1RA 2V5VA 3S1LA 4AZ0A 3RLFA 3HP7A 3DOCA 2ZSEA 3DE2X 1TUBA 1ZBQA 3MINA 1Z5UA 3F6PA 4W6ZA 5JC8A 5AIAA 4CEHB 3PD0A 1IVYA 4MUXA 3OZAA 1BC5A 2B6NA 1FDIA 3PUWA 4XB2A 4YALA 5E3IA 4PG6A 2A84A 4MWOA 1M6VB 4PZYA 4XXHA 5LP6C 4MMXB 5I9TA 1XEXB 4MWTA 3ZHOA 1II0A 4JI8B 1OJLA 4MWCA 1VFNA 4B3HA 2I22A 3GJ6A 3UHOA 2Q6IA 3VBEA 5DO9A 1JDBC 2HBZA 3VKHA 3OOHA 2GEDA 2XZPA 4KX3A 3RYIB 3JSXA 1TC2A 2WICA 1IMOA 3DFKA 4DDVA 3F2IA 1FYEA 3JYPA 5LMCA 4RVNA 4ZQEA 3WGQA 1RI5A 3ZHXA 3LQYA 1GNVA 4K3VA 2F3UA 1W8IA 5EEHA 3VPXA 2RE8A 3VISA 4AMYA 3LW8A 1QHHB 2P91A 3IPAA 3R0IA 3DUWA 2WIFA 3U5ZB 2MINA 1XEWX 2BFPA 5HKLA 2OQRA 3BGOS 4J1TC 2ZI6A 3T7AA 3TGLA 4W1PA 2FUEA 1SXJA 1K68A 1F3LA 3HHEA 1C3VA 1M8FA 1WXIA 1KK2A 1XQVA 2XXAB 2GBFA 3BJZA 4UU8A 3CPJB 1EQUA 4OLFA 2GM4A 1VL6A 1LV8A 1MEOA 2EOAA 1OZFA 3K4HA 3PJGA 2EL9A 4MS3A 3WWPA 5C52B 4UQOA 3UG6A 1KSHA 4IGAA 4P0QB 2XNCA 3BN3A 3B3AA 1XTRA 2FSUA 3B52X 1XAHA 2C07A 3PJDA 3RC2A 3K2EA 1G42A 1S2IA 1UMBB 4XIFA 1H0SA 3VR5A 5LA6A 5H59A 2AJDA 3O9ZA 2PUCA 1NUSA 1Z5WA 4UDOA 4NK5A 3JR7A 1ISSA 3IDQA 3A9RA 1G9SA 2FPLA 4EF5A 3SQWA 3JD2A 1Q3TA 4I1VA 4X7BA 1YI1A 5BSUA 1QJ4A 2P2GA 3VR5D 4R41A 1TKCA 5KAPA 3OCUA 2PZMA 3C8ZA 4B31A 2ATCA 2OKGA 1KH2A 4V0QA 3ZNQA 4F9TA 2O8DA 2PNJA 4UCXA 5FULA 1ZS9A 4LDZA 3TQQA 3Q2OA 1BCSB 4KE7A 1E8MA 3TB4A 1B23P 3IIJA 5J4YA 1RXSA 2QRMA 3GCZA 5H1YA 5JJCA 1X3LA 1B8NA 1F4VA 3GUHA 4YP5A 2D2IA 5EMKA 3PXEA 2BJWA 4Z0NA 3IP6A 4BU1A 2CSXA 3QLVC 4KMRA 3OTOB 2F3TA 1LFAA 3KYJB 3LLSA 4N9QA 4MS4A 5HJEA 1OWOA 2WQ7A 1R74A 5HIJA 3KDPA 2QQEA 3A9SA 1GP2A 2YWRA 1ZM4A 4PR3A 2BFFB 1R7RA 3AERB 3ZJYA 1GUZA 3TFOA 3N05A 4HLUA 4QGFA 2O7NA 2R6DA 4MULA