3DH0A

Crystal structure of a sam dependent methyltransferase from aquifex aeolicus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
KFDPSKIKKLDDPSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDWKKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYAMIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM dependent methyltransferase
publication title Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 61
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dh0A00
3FUUA 3KQVA 3GDHA 4PIMA 5LQUA 2BM8A 2P1DA 4KIGA 1NW5A 3MTIA 4O29A 2ZTHA 4PGHA 4X60A 4YUWA 3HCBA 3HTXA 1HMYA 1ZGJA 5HIMA 4PYNA 4P58A 1NW3A 4V0QA 1JG3A 1O54A 2V74B 5LSAA 1M6EX 3DOUA 5ICFA 2CKDA 5E9QA 3KPUA 4H0NA 4E2YA 2B2CA 2IH2A 3GU3A 1RI5A 1TPYA 3CJQA 2NXEA 3C6MA 3KHKA 5E9JA 5EKXA 5HIJA 4C08A 2PLWA 5K0LA 1WY7A 4P7JA 3SX0A 3HVIA 4C06A 5DTQA 3Q87B 3ID6C 4KIFA 2PX4A 4A6EA 4R8SA 4AZTA 1UFKA 2EJUA 3PFGA 5LR6A 3LKDA 5DRYA 4DCMA 4E32A 4EKIA 5DXJA 1P39A 3TKYA 4HC4A 1FP1D 4E70A 3DMGA 1NKVA 3BXOA 3G2QA 3MHTA 2ZZMA 3FTDA 1G8SA 2EG5A 4LWOA 2OB1A 2PXAA 3C6KA 4PCAA 4PYKA 5BP7A 4M38A 2B78A 2P7IA 1R00A 8MHTA 5EIFA 1XCLA 3A26A 3G5LA 5IKMA 5DLYA 5K09A 2R3SA 1YB2A 1L3IA 4RSRA 1NW7A 4RVDA 2JG3A 1JQEA 2HV9A 4QQKA 3GRVA 5EMJA 2GPYA 2C7RA 3AY0A 3MB5A 1KHHA 3NDIA 5CD1A 3NMUF 5G02A 1RI4A 3G89A 3NJRA 5FTWA 9MHTA 1FBNA 3ELWA 4GBED 1XJ5A 5C9ZA 4PNEA 2VDUE 5EKUA 3R9XB 1SUSA 3CKKA 2IH5A 1WXXA 4DCGA 2IDJA 3TOSA 4IWNA 1I9GA 5CVEA 2IPXA 1IY9A 2OB2A 2PX8A 5FA8A 2G8NA 3TM5A 4CKBA 5LQRA 3FPEA 4E2ZA 5MHTA 4CKCA 3BGVA 3NTVA 2IH4A 3T0IA 3EVCA 2EFJA 3U81A 2OO3A 5DTMA 1SQGA 3NDJA 1VPTA 2GH1A 3DULA 3B3GA 3DR5A 3OE4A 5BXYA 2YXDA 4GC9A 1L1EA 5LQJA 5GWXA 3O4FA 1G38A 3LBFA 1VBFA 5IH3A 2AN4A 2XBMA 2AZTA 2OY0A 2CWWA 2OYRA 1G55A 3V8VA 2PWPA 2EJTA 4DM3A 1JG2A 4HH4A 1N7IA 3P2KA 3BKXA 3UA3A 1QZZA 2IIPA 1NW6A 2WA1A 5FA5A 1VP9A 3B7PA 1ORHA 2PT9A 3JWJA 4ER5A 1YF3A 1SUIA 5DTRA 5FHRA 3THRA 4HTFA 4X63A 2UYQA 2XYRA 4R05A 3AJDA 4RTOA 4A6DA 2O06A 5CCBA 4PWYA 1JSXA 2ZIEA 5DXAA 5HILA 4YV0A 2DPMA 2ZBQA 4M36A 3JWGA 3P71T 3QOWA 1D2HA 3B3JA 1QYRA 3KQOA 3MCZA 4HSGA 5FHQA 5FADA 5ICEA 4RTMA 2UYCA 2YXLA 1L9KA 2IDKA 2O05A 1FP2A 2ZZKA 3DXYA 2P8JA 4ZTBA 3GCZA 2ZW9A 1JSZA 3FPFA 3NW9A 3UJ9A 2C7OA 2Z6AA 3FTFA 2HTEA 4GOMD 3FPHA 3KPVA 4FT2A 4QTUB 1JG1A 4OQEA 3CJRA 3I53A 2Q41A 4RTSA 3DXXA 2VDWA 3A4TA 3KU1A 4OQDA 3SSMA 1G60A 3AWIA 1G8AA 3PS9A 3CBGA 3ELYA 1JQ3A 3PX3A 5DM2A 2WA2A 5EEGA 5ICCA 5EVJA 3AXSA 2C7QA 1R8XA 1XCJA 2BR3A 4GUAA 2VS1A 3FRIA 5CVUA 3A7DA 2P3OA 2FYTA 3KQMA 1TW3A 3G2MA 2QM3A 5GINE 2ZULA 3UJDA 2ZSUA 2B3TA 3NWBA 2JHPA 3EVGA 5DX8A 2PJDA 3EVAA 4MHTA 3MAGA 4DZRA 2FPOA 1QAQA 5D1NA 1X1BA 1NBHA 1P91A 3MERA 3FZGA 1XDSA 3HVJA 1YZHA 1KYWA 3EGVA 1L3CA 3I64A 4F86A 2O07A 1PJZA 1KPIA 4PYIA 1EJ6A 1ZG3A 4M7RA 1KYZA 4RVFA 3EEOA 3OFKA 2AOWA 4BY9E 2ZBPA 3FPJA 4X41A 3GO4A 3R0QA 3RIEA 4IV8A 1XXLA 3LDUA 4KVZA 2WK1A 2AVDA 5E1OA 5EOVA 5E8RA 5HIKA 5K0NA 3SMQA 2ONYA 2ZWVA 3H2BA 5F2OA 3O31A 3E8SA 4LG1A 3KQSA 1DL5A 4XUDA 1O9GA 2K4MA 5EC8A 1PRYA 1JTFA 1VLMA 3LDFA 3LGAA 5KVAA 5CVDA 3KQPA 3TR6A 2KW5A 5EHGA 1YFJA 2R6ZA 3OZRA 4DQ0A 2PBFA 4RX1A 1D2CA 4HGZA 3FUXA 2AVNA 5E8JA 4AZWA 1JR4A 1SG9A 4AUKA 1Q0TA 2IBTA 1EG2A 3NVKI 1BC5A 4U7TB 4ER0A 5DX0A 4XUCA 5ERGB 3PLAE 3K0BA 5EMKA 2G70A 3P9IA 4U7PB 4EVIA 3HA7A 1I1NA 2YVLA 3GXOA 3G88A 2AN3A 5T64A 3OPNA 1KPGA 2VDVE 2XVAA 3IEIA 4ISCA 4MWZA 5KQRA 3HVKA 2ONZA 3EVBA 2PKWA 3GIWA 3HCAA 3LL7A 3M4XA 3BT7A 5EEHA 2YTZA 4GEKA 5BW4A 1YUBA 5EPEA 1AV6A 3B89A 3EVFA 3FPGA 4WVLA 5GIPE 2XVMA 4G56A 1IM8A 3L8DA 5DX1A 2F8LA 3HVHA 1F3LA 4RTLA 2NP6A 3DTNA 5H02A 3JWHA 2AOVA 2O57A 3TMAA 3CVOA 4C07A 5EZQA 1ORIA 2AOXA 5EMLA 4POOA 3KR2A 1RJDA 1M6YA 2NNWB 4QVGA 4QVKA 1X19A 1WXWA 4X61A 3T7TA 4E2WA 2NYUA 3CJTA 1VE3A 4ER6A 3PB3A 4Z2YA 4BLWA 3LDGA 4FR0A 2ERCA 4YMHA 3G2PA 2P3LA 3CGGA 3GNLA 2YR0A 2YXEA 3C3PA 1R8YA 1RJFA 2JHCA 1WZNA 1KPHA 4XUEA 3KPJA 5E2AA 2FHPA 1X1CA 5FUBA 4RV9A 4KW7A 1YFLA 1B42A 5E1MA 2I7CA 4PYQA 5E2BA 3UZUA 1KIAA 2PT6A 5LQCA 3CC8A 2C7PA 2OXTA 3HA5A 3LHDA 3OU2A 1P1BA 3BWMA 1JQDA 3A7EA 3KR9A 3BZBA 5E9WA 3DMFA 2ZIFA 3KQWA 3R6TA 4PYJA 3HM2A 4AZSA 1G6Q1 2PY6A 2ADMA 4EK9A 4L7VA 4RTJA 1R18A 3EMBA 2GA9A 4FT4A 3IV6A 2ZCJA 3BUSA 4MIKA 3GRUA 3IYLW 4RVHA 4OA8A 4CTKA 4PYLA 4RYLA 4F84A 2VZ9A 3LBYA 4YV2A 1Z3CA 3I5UA 2I9KA 1XDZA 2DULA 3KKZA 2V7EA 5JUWA 1Q0SA 5T67A 4PONA 4LWPA 5EIWA 3P2EA 3GRZA 3PX2A 4C05A 3P9CA 4DA4A 3BKWA 3EEYA 1L3BA 3IHTA 5EG5A 1F38A 5HZMA 3OZSA 2B25A 3ANXA 3G5TA 2JH8A 1ZGAA 2BM9A 1M0EA 3E7PA 2CMGA 3OCJA 2NXJA 2H11A 2BZGA 3NVMB 1R6AA 3GGDA 3A25A 2HMYB 3QV2A 1RI1A 1NT2A 1P1CA 1R74A 3I9FA 4WXHA 4P7FA 1KXZA 5KQSA 4DKJA 3TQSA 2UZ4A 2AOTB 1N2XA 3DMHA 4B17A 5U4XA 2YUIA 3G7UA 5DWQA 2UYOA 3SR4A 1UWVA 3JWIA 3AXTA 2BR4A 1ZQ9A 3GJYA 5GM2A 1X1AA 3LECA 2AS0A 1VL5A 5D1HA 4EQZA 5ICGA 2ZLBA 3ELDA 5DRTA 2JJQA 3LCUA 4IKPA 1DUSA 1O9HA 2ESRA 2ZIGA 4OBWA 3KR0A 3T7SA 4ATNA 3UJCA 2Z6QA 7MHTA 3EMDA 3DXZA 3EGEA 2BH2A 2EX4A 3BWYA 2H1RA 4GC5A 3REOA 2YX1A 3PT9A 3VYWA 4DF3A 4KDRA 1XTPA 3C3YA 3S68A 5EZSA 3ME5A 1OR8A 4CXMA 2JH9A 4GQBA 4FP9A 1FJXA 2A14A 3M6UA 4YUYA 1QANA 5HFJA 5DM0A 1TW2A 3TM4A 2O0LA 1INLA 4X1OA 4YUVA 2P35A 2QE6A 1T43A 3KQQA 5DM4A 2E5WA 4K6MA 5BW5A 4YUXA 5F2NA 2PX5A 2PWYA 3I58A 3M6XA 1NE2A 3FUTA 5T6BA 2Y1XA 3SGLA 2P7HA 3HP7A 5CVJA 5K0CA 5K0BA 4XCXA 5GP1A 2YQZA 3FYDA 2G71A 1MHTA 5KS2A 3EVDA 3DLCA 4BLVA 4BP1A 1XDUA 3UWPA 4CKEA 4E33A 4RTQA 3UA4A 5LQNA 3ERCA 1BOOA 4GOLD 1X1DA 2NP7A 2GB4A 3DP7A 4RVGA 2ZWAA 1Y8CA 3DH0A 3TPZA 1FPQA 3SVZA 2QRVB 4GOND 4V0RA 3EPPA 3HCDA 1DCTA 4EMSA 4P7KA 1NW8A 4PIPA 2ZBRA 3HEMA 2HR1A 4OA5A 1EJ0A 4PGGA 1VP3A 5HEKA 1SKMA 3SSNA 3FTCA 4NECA 5DM1A 2P3QA 5FULA 2I62A 5HIIA 1I4WA 2PX2A 2ZVJA 3K6RA 5K0GA 2UYHA 2G72A 4LECA 1MJFA 3LCCA 4PYMA 3SSOA 2AN5A 2VP3A 3VSEA 3OFJA 5JR3A 1NV8A 3C0KA 3OE5A 5EGSA 4FGZA 3TRKA 3VC2A 2OKCA 1YZ3A 1N7JA 3GWZA 3BGDA 2P41A 3R3HA 4YUZA 4QPPA 2GS9A 1QAOA 2CL5A 5K0EA 4Y30A 5HOQA 3QOXA 3B5IA 3OU7A 4FSXA 2QRVA 2OBFA 3EVZA 3GRYA 1AQIA 4QTTB 3MCTA 1IXKA 5GIOE 3MGGA 3G8AA 2ZFUA 3DLIA 3M33A 2H00A 1WS6A 3OZTA 3KPYA 4R8RA 5CVVA 3LSTA 2PV0A 3FTEA 1JG4A 4FZVA 2HWKA 1RJGA 2B9EA 3F4KA 2P40A 5K01A 4P7GA 3FUWA 3HCCA 4KDCA 3TLJA 4ER7A 2Z6UA 5KYGA 3P9KA 3T7RA 4HTFB 4YV1A 2GLUA 2OZVA 3UBTA 2FCAA 4OBXA 4QDJA 5CUQA 4RWZA 4DMGA 3HNRA 1QAMA 1VQ1A 1ZHFA 2NXNA 3KQTA 1RJEA 4IV0A 2I6GA 2PXCA 3UJBA 4EKGA 4YMGA 2IP2A 5DT2A 2PXXA 3E23A 3LX6A 4HGYA 3PVCA 3RODA 1KP9A 3SXJA 4AX8A 1EIZA 5EMMA 3LKZA 2AOUB 2IFTA 3MQ2A 1UIRA 2CMHA 3P9NA 4FS8A 1SQFA 4KRGA 4Y2HA 3UFBA 3UJ8A 1V39A 3FRHA 3LPMA 4BLUA 3OU6A 4QPNA 3TKAA 4CWAA 4ER3A 5K8VA 1KR5A 2PSSA 4AZVA 4C03A 4RTNA 2JHAA 4C04A 1HNNA 3NWEA 4HRAA 3PTAA 1RI3A 1JTEA 5FQOA 4MQ4A 3KPWA 3ELUA 5CIYA 2ZZNA 4RTRA 2IBSA 2BR5A 3P2IA 4R6WA 5GM1A 2FK8A 3WSTA 5K03A 5FWAA 3ER8A 3P8ZA 3M70A 3UJAA 2QYOA 4QDKA 1NBIA 1EQAA 3UJ6A 5DPMA 3FUVA 3M6VA 3BGIA 3SM3A 2PVCA 5EHIA 4PINA 1AQJA 4RTKA 3UJ7A 4KWCA 2OPBA 5E1BA 3RW9A 3FYCA 3B3FA 3DUWA 1D2GA 5FCDA 2Y1WA 2AOUA 2XYQA 3P97A 5DSXA 5M5BA 4PYOA 4E30A 2ORED 3VC1A 4F85A 1BKYA 1U2ZA 5FWDA 5C0OE 5K0FA 2QY6A 5P8WA 10MHA 5K05A 5FQNA 5K0JA 2GAFA 4C4AA 4GOOD 2HNKA 3PFHA 3KQYA 3MTEA 5C1IA 2IGTA 4QQNA 3THSA 3ER9A 4OX9Y 3CCFA 4BP3A 2G1PA 1H1DA 4HG2A 1EAMA 1AF7A 2PGXA 4R6XA 1BHJA 3BWBA 3D2LA 4M37A 3TFWA 2N47A 4RTPA 5CCXA 5GOZA 1ZKDA 4UOEA 2XYVA 1NV9A 4E31A 2FK7A 3E05A 3G8BA 3A27A 3G2OA 3HCEA 2NXCA 4FSDA 5DSTA 3O7WA 5E1DA 1WG8A 3HCFA 5EQJB 4MTLA 1XVAA 3HA3A 4JXJA 3R24A 3X0DA 4PCLA 3ORHA 2FRXA 3GRRA 3EGIA 4CTJA 4GF5A 3V97A 3EVEA 4E2XA 1VIDA 5CM2Z 1SVUA 5F2KA 2AR0A 3Q7EA 2AOTA 3KR1A 3BWCA 2LD4A 3M6WA 5B1SA 1RI2A 3LCVB 5LQAA 5LQKA
chains in the Genus database with same CATH superfamily
1P1FA 1YR7A 1Z12A 4ZGWA 1TIKA 1XO1A 4I36A 3R7FA 3W9BA 2R1UA 1V7CA 3PR2B 1UWCA 1VKZA 3IBCA 4IZ6A 2B1RA 2UVQA 2V55B 3JR3A 1TAQA 3IE2A 5JYDA 2FKNA 3PEYA 2H2IA 5FBRB 3RREA 5HIMA 1OB2A 1ENOA 3GIDA 4AWAA 2C61A 3UB2A 4Y1EA 3VX3A 1MB2A 1GCUA 5L3RA 3BB3A 3GT7A 3PNPA 1N8KA 2P2DA 4K0KB 1MIOA 2F62A 2VHEA 1WHTB 4EJSC 3AIMA 3LZCA 1DCFA 3FNIA 4KQKA 4RVUA 2GMWA 3TG8A 3PKJA 4OIFA 4TXMA 4YBRA 4ZDJA 5EKXA 1TFRA 4UCWA 3VJKA 1AMUA 3DR3A 3VC3A 2QT1A 9ABPA 4WDRA 1HF3A 2LZ0A 3FCUB 3GRCA 4BJHB 4KITB 1ISGA 4KBFA 2I65A 3J7AC 3EEQA 3ETGA 3IVGA 3WZLA 7AT1A 1YDWA 3RWBA 5F1PA 5L7YA 1OXVA 3ZHOA 1BXGA 1F9EA 5HBGA 5H83A 3ZU5A 1LVGA 2AZMA 1ODLA 2B8EA 3J81k 1VGVA 5B1IA 2FAXA 4ZOBA 1IG3A 1V3UA 1C8LA 4XASA 1YC5A 4P35A 1ENZA 4E5SA 2CLDX 2A57A 3A26A 4A36A 1OY1A 1YTUA 1JQKA 1L3IA 1DV2A 2VUHB 3ZK7A 1OZ0A 4NK5A 3GRVA 2CN1A 2OXEA 3F67A 5BT9A 1A2OA 1ZM9A 5BR1A 5G02A 2JI9A 3NC1C 1HQCA 2V6JA 4DC1A 4BP8A 1R0SA 3VH1A 1EB9A 2IYOA 3TMYA 4OHUA 2Y0PA 3AI2A 3DAFA 4CM9D 4RC9A 4MGKR 3FETA 2NGRA 3I2HA 3UK0A 1RAIA 1AG9A 2I2DA 2Q9CA 3EZ2A 5BSHA 4NV1A 2GJ8A 1SOMA 1VI5A 4OTZA 5ELMA 3TQQA 3ZWKA 2OB2A 4QTXA 4E2ZA 3WO1A 3JVUA 4PZEA 5K45A 1ZD1A 4LFAB 3EPRA 3F7TA 3H1EA 3KSDO 5DTMA 4TXJA 1I1QB 3WNVA 1EVIA 4Q16A 3UHAA 4B4DA 4BECA 1UQTA 4IIYA 5MN4A 1NVWQ 2XB8A 2CXUA 1XP8A 3DR5A 1QIIA 3D3JA 3N2NA 2OLJA 3RYTC 2VVTA 5BNIA 5F9FA 2PGIA 1RCUA 3GFOA 4KR0A 3S0JA 2Q0XA 1Q1QA 1MEEA 1VJDA 1T36B 2AZTA 2JFZA 1KYVA 2JGAA 2W6CX 3NBYC 1N6LA 3U3XA 4ZHSA 4A0QA 2JLVA 1UM9B 2VP9A 2WABA 3ZWMA 1JG2A 1V6AA 2QTRA 4I5EA 5KJEA 3GUCA 1S9HA 1H1LA 1U90A 4IOJA 2YJZA 3IOEA 2PT9A 4B31A 4PFQA 5EESA 2B5VA 4D9IA 2RCYA 1WV1A 4L08A 4J0KA 5JPIA 4OQQA 2OHVA 1C0PA 2UYQA 3BPSA 3HPRA 4UE2A 3IBFA 4DXAA 2E5LB 1EK0A 1NIJA 2O9JA 2ZIEA 3WHKA 1V1RA 4QECA 5CIWA 3B3JA 2GNOA 1GR0A 4ARZB 3NBUA 2O05A 4OGFA 2P8JA 2DY0A 3A9RA 3PDIB 4I4LA 4JD5A 1TT5A 1NUPA 3CRQA 3O2SB 2DBQA 3OIFA 4RFLA 1YB6A 3IO3A 3ZV7A 4FDUA 2H4JA 3I2FA 4F6RA 2X40A 3SC2A 2X8AA 3HC7A 1YR8A 1TQHA 1M8PA 2AZXA 4OQDA 2P4HX 4XGIA 3CX7A 4L22A 4TV8A 3L4JA 3V1YA 1K98A 3JQAD 3U3DA 1KZ4A 2JAPA 4C7OA 1QC5A 1Y3FE 3ELYA 1JEAA 2B8JA 4B3JA 2OG1A 1O6GA 2O2DA 5HJ5A 3FW1A 2ZIXA 3H5AA 3OECA 5B58T 1MO4A 4UCXA 1JHUA 1THGA 1M2GA 2Z6VA 4GZMA 3SIPA 3NBMA 2DPXA 5H80A 5C8YB 2ZULA 2PN1A 3INYA 3MILA 4YRLA 3D4BA 5FOSA 3V4VB 5I4BA 2YJ6A 3IOMA 1VE7A 3KJIA 4DW8A 4DEVA 2FPOA 1QAQA 4ZOEA 2SICE 2QD1A 3EXIA 2ZOSA 1U0LA 3T3HA 5CLLA 2RHHA 5DOZA 4F86A 1E1YA 3FUCA 3ZC3A 1A97A 1NN1A 3SNHA 1EJ6A 4BXOB 2HF2A 3NXSA 1Z5GA 1IULA 4X41A 4YIKA 1RHJA 4BO2A 4FJ1A 3BORA 4KV9A 4O59O 3JQEA 4HAWA 2BMFA 1AQLA 3ZS8A 3R7WB 3OIYA 1BFDA 5BVHA 1TK3A 4HDNB 1AGRA 3U0BA 1ULTA 2WJ6A 4M22A 1AB6A 5K3AA 1K2VN 1QMGA 3LDFA 3LGAA 4MVYA 3RS4A 1YQWA 5C5IA 4XD7D 2OPHA 2HX1A 3C45A 1J70A 3M8KA 3MSCA 2O0MA 2ZPAA 4A3SA 1SUWA 4FMDF 2FU5C 2YWJA 3THOA 2JEZA 3E9EA 3TB6A 4CM4A 5JDIC 3NVKI 2DERA 1PGNA 4P54A 2ZBFA 1DEXA 4BX9A 2HJWA 4A2PA 3VPBA 1RD4A 2DHDA 2RAPA 3A2MA 4BNLA 4AUMA 2IXAA 1I1NA 4EAAA 2FMIA 3GZNB 1UMBA 5E3IA 5T64A 3VPDA 4EPWA 1M1NA 4X7MA 3PJEA 4AF7A 1NAHA 1DAOA 2H29A 3BVPA 3UNXA 4MKHA 1IN8A 4IIJB 3EVBA 1LGYA 2JFFA 4WT7A 3PPVA 1GPJA 4DLXA 4YJ2A 1UKAA 3M4XA 1SRQA 3KD2A 3KAPA 3BT7A 1FDSA 3HADA 3G23A 1STOA 4Y2XA 3JATB 2QUZA 3Q7SA 1UP6A 2V5AA 3FPGA 4WVLA 3NBXX 1M67A 1G7SA 3ZIAA 3M4NA 1SKYE 3Q88A 4G4SP 2WU0A 1GSOA 4KO2S 1D03A 3UCFA 3CVOA 1Z0ZA 4BNMA 1Y3HA 2GRUA 4QVGA 1S9DA 1VMKA 1X19A 3G2JA 1EWQA 4UVHA 3A8TA 5SYAA 4KNWA 1IWBB 1D5CA 1FTWA 1ICIA 3PTLA 5JARA 1XZLA 2I4NA 2CJPA 3OJCA 3G9QA 3UCXA 4B3MB 1C7QA 2C84A 1X7HA 3WL7A 2WNSA 421PA 2ZB3A 1N5OX 5LD2C 2PFGA 5ALKA 3WICA 2LCIA 5IM4A 4TLMB 1U1GA 3HY4A 3IMGA 1NAIA 4Q3OA 4XTRA 4ZAZA 3V4PB 3QEBZ 1SUPA 3KZNA 4S1PA 3DHWC 1ID8A 2W6QA 3C6ZA 4RV9A 1AS0A 3NHFA 2JIZD 4MI1A 5JJ5A 4P83A 2WF5A 4DAOA 2COUA 3SD7A 4E4YA 3O4VA 2DSTA 4F45A 2YFYA 5FI1B 2XB6A 3HJAA 2HWXA 4D8TA 4I5DA 5TC4A 3NTLA 3QNWA 1R0RE 5JTTA 4DPKA 2IX3A 3O8CA 3IDFA 1CJUC 2ADMA 2FW0A 1X92A 1ECLA 3SS8A 1DO2A 4CTKA 4P5DA 4PAGA 5KYNA 4RYLA 1QUEA 3SZOA 4KSBA 1BMTA 1EP2B 1HNXB 4HI0E 3JQ9A 3QMVA 5JG7A 4DC0A 5IF9A 3IIIA 1FFWA 2ZTVA 3O3NB 4UU8A 1XDZA 2C7VA 2BVNA 2J9ZB 4EI8A 4CGYA 4F93B 2PRZA 1WCV1 4G25A 4O4IB 1AN9A 2EF0A 2D1QA 3N2LA 4IJUA 2EYUA 4EPTA 5I7EA 2R97A 4WCDA 1BHQ1 2ILTA 2HQSA 4OGGA 5GVRA 3W04A 2FSSA 3N0VA 1O5OA 1F38A 1X80A 1GVHA 3EPHA 4B73A 1RYEA 2CMGA 2NU7B 4RU1A 3T0GA 1B73A 3WIEA 1EA5A 2PR2A 1E99A 3DPUA 4KO1S 3SYLA 5E3HA 5DEOA 5CXUA 5HWSA 1R6AA 2ZRHA 1YRLA 5KX5A 1DKRA 3I9FA 1LQTA 1P1CA 2IYXA 3RPEA 3SSAA 3DTYA 2FZ5A 1Y5LA 2GEFA 4ZHQF 3MTQA 3KRTA 1PR6A 2QQ5A 4U6QA 4DIKA 2FSFA 3H9JA 1EXVA 1VBKA 3Q7QA 2GJAA 1R2QA 2LXNA 2YUIA 3G7UA 5EWMA 4UPVA 3RT7A 3RRYA 3EQ6A 3I3SR 3UXHA 4EAQA 7YASA 2YZ2A 3RV3A 2ZRJA 1NZFA 3LUDA 3PFIA 3LECA 3AM5A 4MYSA 3FY4A 4MTCA 3I2YX 3ASUA 1XWIA 4RACA 3BN3A 4FGUA 1GP2A 1HE3A 4J3FA 5EE9A 1ONBA 4QBHA 4Z4HA 2EW1A 1T8WA 4OP1A 4ARIA 4FBMA 1GPKA 3DXZA 3EGEA 3PUJA 3VBEA 1C30B 2QJRA 4N7BA 3T1HB 1AIPA 4ZCTA 2XOEA 3L7LA 5ALJA 1TJPB 2R96A 5EZSA 4WECA 4ZU6X 3F5QA 2Q2NA 2Q1UA 2ZYTX 4YUVA 4II3A 4PLFA 1T43A 3E61A 3JAWB 1ISSA 1KFBB 2QF7A 4ILKA 4EYOA 3L7AA 3R77A 3U4AA 3JZMA 1MTOA 2JAUA 3GA5A 4LZZA 1L7NA 3SGLA 2JAOA 3DO6A 1C0EA 2GPBA 5DNEA 2W2LD 4AJ9A 4DT1A 3TJMA 3DWGA 3WQRA 3WWEA 1ZNYA 4B4OA 4OMDA 1JV2B 4E22A 1O6ZA 3TMKA 3FMVA 3TW6A 3BD7A 3PHCA 2GXUA 3R0ZA 4OI2A 5K2OA 1TVCA 4RVGA 2PMCA 2B6NA 4EYEA 4XTCS 1VXOA 5HSGA 2IYWA 3DYBA 3R41A 4L95C 4B48A 4PGGA 1T2EA 2BCEA 4RE6A 1XMSA 5FL7A 3JQ7A 1VRCA 4JU8A 2FV8A 2UZAA 4HLNA 4JJAA 4O4JF 2I7VA 3V9PA 4JI2B 4A8PA 5IDYA 2CUZA 3UT5B 2ZJ5A 3OZ7A 3H2KA 3MUEA 2CGEA 1C1YA 1XCGB 5DYGA 4CKCB 2JIMA 3O1IC 2X2FA 1P81A 4OK3A 5LQSA 5PNTA 4EG0A 4LBYA 5JECA 1QV9A 1NLZA 1T4CA 1YQEA 2X9GA 4ZYVA 4K28A 1N7JA 1OBHA 2YWEA 1P5ZB 4UUAA 3COPA 1CEQA 2Q6OA 5DHSA 3B1ZA 2G0TA 1X87A 2GS9A 4CCSA 4EB8A 4H18A 1PQUA 3C6XA 4FFOA 2IZ0A 1IK4A 1DELA 3MCTA 5AI6A 1CJSA 4H4DA 4K9KA 1U65A 2QTZA 3D6MA 4I1RA 5JVDB 4TKUB 4O4LB 3VTFA 3P5BA 3HFGA 5C5CA 2G9VA 4HNTA 3F4KA 2J9XB 4KGDA 4FW9A 4ZVKA 3NALA 2C8VA 1EINA 1MB9A 2YZNA 4R8VA 3W9YA 1G63A 1JMVA 1GT91 1I01A 1PI3A 1WEHA 3OTGA 4Z9BA 3N58A 5FOXA 4YRIA 4JXXA 4MRMB 4LDRA 2AV6A 3HKBB 4K9PA 4EY3A 3FZYA 2ZUBA 5H70A 4OHKA 4JI1B 4HGYA 1T5HX 1XHFA 1EIZA 4N5MA 3D3WA 3PGKA 4Y2HA 1WKVA 3OEHA 2J31A 3K2QA 4FK8A 4PG8A 3OU6A 5B64A 1UT5A 3SIRA 5DBGA 1SBHA 3PUIA 2ZI6A 4AZVA 5BMVB 1GEEA 1Z4QA 1GKUB 3R3YA 4IHJB 4IWXA 1T8UA 4WWHA 2YJ5A 2Q5EA 2PCLA 5I7UA 5LB2A 4Y1FA 5JH7A 1E79D 1WSBA 3OZWA 2FK8A 1RXEA 2R6CA 3PUKA 3T3GA 3I45A 1QONA 1H42A 1RHQA 1KDZA 1U7XA 1VRWA 3V34A 2X7XA 4XM1A 1XROA 2H63A 1WNFA 4LJ5A 3D3QA 3UMYA 2EZ4A 5LC1A 3H6HA 1L7MA 1T9HA 4WNYA 3WYGA 1UC9A 3A9UA 3F4BA 3IGFA 4ZJYA 1DKUA 3TBHA 5KSPA 3NOQA 4C3VA 3FLMA 1JHAA 2P3SA 4G8DA 4AULA 3VC1A 4KLNA 3EIHA 3O21A 4Q1FA 4Y2UA 1USIA 4ZT2A 5EERA 5JXHA 4GZ5A 4C6SA 5FQNA 1CTQA 1X9GA 5KNDA 5J2UA 3BH6A 3MTEA 1REQA 1J56A 1D9XA 1ZR4A 4FR5A 1XNGA 4RXTA 1TD9A 2LP4Y 3BWBA 3K16A 3ZEIA 4D3DA 2ECQA 5LOVA 1JFTA 1LQ2A 3N59A 1XCBA 3B51X 2QAJA 3VYSB 1DIHA 1Y3DE 5DHPA 1HX7A 3G2OA 1OX6A 2IYFA 1E69A 2PS1A 3IXMA 1QO7A 3JARB 3HCFA 3W5JA 3W5VA 2E85A 2WSSA 2EU8A 2AFIA 2BBSA 2Q27A 4R2JA 1G59A 4NYIQ 2Q28A 2GGSA 4CV1A 2MSEB 1H2ZA 4IDAA 1UDXA 1ZHOA 3NIFB 1NWHA 3MWYW 3KDSE 4QGFA 4YFVA 2VHTA 1RI2A 3MMNA 3DD5A 4YTEA 3H8SA 4DVGA 4IEIA 4MCHA 1J1IA 1V41E 4PIMA 3NDPA 2BM8A 4WL0A 2QQGA 1IB6A 4CF6A 1NW5A 3AUSA 1OPXA 3JVEA 5KQGA 5TSDA 3W8EA 5ITZA 4AN4A 1KO7A 1NUUA 3EOBI 4A16A 3T54A 4DABA 1Z82A 3WV4A 1QFJA 3JD2A 3U1BA 3ADBA 3IAXA 4TN5A 1VBNA 2VYNA 4DIOA 4G8BA 3D8BA 1PT7A 1OU0A 4H0FA 1JA0A 2UV8A 4W9NA 3ONEA 5E0KB 4KGZA 2B2CA 3BQNB 1II8A 5FR2A 4N48A 2VJLA 4A8JB 4YRMA 1GADO 2W6ID 2N3ZA 3GLTA 3NNNA 5HIJA 5IP5A 2PLWA 5D5PA 1OT5A 4F4DA 3B5JA 2I7TA 5KOHA 5DTQA 4Q7QA 1JWLA 4KIFA 1TUBB 1MH1A 3AF3A 1OYOA 3HB7A 5TPWA 3LKDA 5AIBA 1SEVA 4OMUA 1H69A 2PKRA 1ZNZA 3RAPR 4ZIRA 3Q1LA 2BZ1A 3UGTA 4KREA 1KZ1A 1N78A 4ETNA 1UBTS 3DW3X 2PXAA 4PO3X 4EIWA 2XNSA 1W2GA 2NXWA 3JD4A 4HNGA 2ECOA 3QMWA 4MV9A 2GZRA 4OHZA 5FBVB 2HDHA 1RQ7A 5HKKD 1AZTA 1R0WA 5BSKA 2JJ1A 2A0FA 4O4HA 1LI5A 1ZRHA 3COVA 1M6HA 1BDBA 2G83A 2R3SA 3BB1A 1P4SA 3UMFA 1Y1LA 1JQEA 5AW9A 3B7WA 1GNLA 2L2QA 2RGUA 3AY0A 3ESBA 3L8CA 4JC8A 2I7XA 4OKSA 1N1GA 3D64A 3IIEA 4QJ5A 1QVWA 4EZEA 9MHTA 4O0LA 1U1FA 3ELWA 1VGRA 4JLMA 4ZCSA 2GLTA 4M8IA 4XQ9A 1U8AA 2WJ4A 2R4QA 3PYLA 4RK0A 1QO0A 5AK3A 2C0CA 4PNEA 4DCGA 3Q10A 1JL3A 1QZ3A 2LDBA 5BN3B 2HMTA 3U31A 2EBFX 1OXUA 3PNOA 1PWHA 1TCUA 3MBOA 2Q1SA 4JNKA 4JH0A 4MCIA 5H16A 3Q85A 1IEVA 3QNUA 3RASA 5MHTA 4BCBA 5HQ3A 3H87A 2DM6A 3W5BA 1JDPA 2I33A 3AERB 1KE2A 2RGYA 5H82A 1TO1E 2OAP1 4R40A 4O5OA 3B3GA 3IAS1 5E4FA 2YHUA 4G2TA 2PMBA 1G38A 2DHQA 1DRUA 1FX0A 5ALFA 3VNRA 4BFLA 2VK1A 3OAAA 4ZK2A 5BQ5A 1MPTA 1L4FA 1P17A 1RYHA 2AN9A 3S55A 2XYPA 1EFLA 1G55A 3EGXA 4LA4A 5C7YA 3FCEA 4DM3A 2MSKA 1JJFA 2LW7A 1I30A 3DWFA 3LBIA 5H3CA 3VRHA 1L7BA 4XR9A 2Q5OA 4LVOA 4RENA 4ZK6A 4AXXA 2ODQA 1RFLA 1PWYE 1T1EA 4JYAB 2BKUA 2V7GA 3RFXA 1CXZA 1V5IA 2C03A 2PKQO 1SUIA 3IR5A 4QUKA 2YFQA 5LFAA 3L04A 3OKAA 2QV0A 3VPSA 2XYRA 2I3AA 3N0WA 5TV2A 4QULA 5FP0A 3TNJA 2I4OA 1I4OA 3V1UA 2BV3A 1HEUA 3G8DA 3K8QA 4Q9JA 3JWGA 3AYZB 5FADA 5A2QA 1L9KA 5KNBD 1TEHA 3MJCA 1FMLA 4G0OA 1D1TA 3JTMA 1BS9A 1SKQA 1WJGA 2NSLA 2J7PD 5K3DA 2IHTA 1IXYA 1IUKA 4YX9A 4GMDA 1G4UR 3EGOA 3JTEA 1B3RA 2AI3A 4LOLA 4MDYA 4YASA 1YK1A 2C78A 1KQOA 3E2MA 1DAGA 1R8SA 2ZIZA 2EIHA 3AWIA 3JW8A 3LQFA 4FQ7A 4Z9XA 3UUEA 3PS9A 3UHOA 3NV7A 3PX3A 5DK6A 2EZ9A 2XUHA 3I0NA 5ICCA 3OQMA 4MP8A 1E6EA 3A7DA 1OI2A 2A1UB 3ANMA 3WK8A 4CDNA 4L74A 3GCWA 3GLHB 1EGVB 3M89A 4MI6A 2ZSUA 2RGCA 1IVNA 5DX8A 2I34A 3VGJA 3BSFA 1IM2A 2P69A 1EM6A 1HRKA 3MAGA 3IAEA 5I9MA 2CC2A 4ZQCB 3LHFA 5DW0A 3H1TA 4BZPA 1BKDR 3QKRA 1E1KA 1P91A 4CR6A 1JR3A 3EH2A 3AUFA 3KZOA 4LXGA 2EJBA 3I62A 5CYGA 5IT9A 2C4NA 1CS0B 4TRNA 3T8YA 2C2XA 5L3ZA 1ZG3A 4DUYB 2SNIE 1V5GA 3REFA 4AO6A 2V3VA 4DFDA 1YU6A 4XE5A 2HEIA 3ZDQA 3FKSA 1I8TA 1XXLA 1X74A 3O0DA 1G17A 1NBMD 3C3AA 2J0VA 4UZEA 4D9MA 5ER6A 3EAQA 1DQYA 1RJ9A 4YJGB 1HDCA 4BNZA 3QVOA 3BRQA 5D3QA 3IRUA 3DB1A 1L6RA 3PNSA 1DLJA 4IJWA 5DCYA 3TDKA 1W0KA 5LZ9A 3VDMA 4MW7A 3KQPA 1YFJA 3RSLA 3T4PA 1VIMA 3DP9A 1JPUA 1NQAO 5KDOA 3GRPA 4DXHA 3UY4A 1SOVA 4EQ6B 4A15A 2PL9A 1H22A 1I3NA 3OLZA 3T7EA 1GZ4A 1SG9A 2QGNA 3NIWA 1QH9A 3FSEA 5TNXA 1F7UA 2D5CA 3EJWA 1CSEE 3WNBA 1AHPA 1GUDA 2EP7A 3OFNA 1ESDA 2Z4RA 2VHWA 5J9FA 3A6FA 5BVGB 2JW5A 3GXOA 4PAMA 4TV8F 4P4UA 5H9WA 3KXPA 2VDVE 4QG3A 2CFSA 3I37X 3P9QA 4BKMA 1I7QB 4D0SA 1WHTA 3GIWA 3HCAA 1XD2B 2G04A 5A0FA 3AB8A 3AVUA 1QPBA 2GAAA 1XELA 1RZRA 5GJBA 3K72B 1UT6A 4DQUA 3U40A 2XUZA 3BILA 1WB4A 3FJ1A 4U5QA 1PT5A 4D79A 2H4HA 3FZQA 5EP4A 3HVHA 4EB0A 2ZCVA 5P21A 2O57A 2O8DA 1F8GA 1QNFA 1YV9A 3OA2A 4FZ5A 4YMVA 3KR2A 5KJ1A 1OH8A 1M33A 1UBOS 2Q3BA 4H3VA 4J7UA 4CQLB 3JSXA 3OH8A 3W2TA 2V6BA 1WXWA 2ZSFA 3EF0A 1I14A 1NXQA 1SXJD 4MP3A 4NVRA 4BNFA 1DKOA 5JYEA 4K3UA 2PU5A 2W2NA 3D2BA 4IL5A 4FR0A 4TL9A 3PNYA 2ERCA 1EE2A 1FDIA 1GL7A 2IYEA 1NXTA 3EA4A 2BE9A 3Q8WA 4L3VA 3ROXA 3HP4A 2ZR8A 1O0CA 2XTAA 1U0TA 2YXEA 4R2LA 1Y4DE 3IAFA 5EE5B 3JALB 1CG6A 1F2VA 3LRXA 3CO5A 2XA1A 1JWBB 3E82A 2PX3A 4FQ8A 5EUBA 3VPCA 2YFKA 3KPJA 4YP6A 5KNCD 3MW8A 1DC3A 1G21E 1TUIA 1NBME 5E2BA 2XKJE 1QLJA 1KXJA 3WJ2A 1A7UA 5CH8A 2K5UA 2FVYA 2L69A 1N0WA 4QBGB 1YZKA 1QIDA 2OCDA 1RWPA 2Q4OA 1NJ8A 2HKIA 4PPFA 5DHQA 3VVMA 1I7SB 1KTIA 5A02A 5NLLA 2O4CA 1J1ZA 2JH3A 3OT1B 3HM2A 1OYYA 3TWOA 4YFYA 2QAGB 4RABA 2ZCJA 3QOFA 3V1NA 4BRZA 1VKJA 1Q11A 2EJCA 2C5EA 4PYLA 4YMUA 1M5RA 4YRPA 3HWX1 2QN2A 1B74A 5AUPB 3C43A 1IY1A 4YJ2F 4QXQA 6GPBA 3V6MA 3PRHA 2W58A 3NEYA 1L7OA 3F5MA 2W8ZA 3LIPA 1UM9A 2ERYA 4BO7A 4GVPA 3THYA 2QM0A 2JA2A 5IANA 2FW7A 2JAHA 5HDQA 3OM8A 3IHTA 3QBTA 4JJGA 3VU8A 2GFHA 3I8OA 3OZSA 1AK1A 3HYRA 1JEOA 2VTEA 4WINA 1U3DA 5AM5A 1WKCA 2NZ8A 2R6R1 4BVLA 1PF7E 1M0TA 2H11A 1JMYA 4K6HA 1PJRA 4Y2GA 4CMEC 1RQRA 2HA4A 2XDQA 2QXYA 4B3DA 5JFOA 5E7MA 5E7IA 1D3AA 1P4GA 4JMPA 5M3BA 1RP7A 1N2XA 4B4WA 1V4BA 2PQMA 4LOKA 3ZWNA 4ARZA 4D4JA 4W5TA 3UWKA 2W22A 3DMRA 4JQSA 2FPIA 3STWA 4OAQA 4DQKA 3PDIA 5AXAA 1E0DA 4ENVA 1W36B 1K6IA 2QP9X 4G97A 1VL5A 4F6CA 1T6NA 5CDUA 2UZ4A 2ZRCA 1ZH8A 3OP1A 1SXJE 3AI1A 1FYWA 2DR3A 4IQ0A 4CKEB 4X7RA 5KDLA 5IJAA 1JEYB 4KFUA 3AQ4A 5K51A 3S6JA 3TNYA 4CVNA 2B1GA 2BH2A 1AZWA 1G20B 3K53A 3DONA 1U2DA 4A2WA 3HMQA 2WSLA 3REOA 4B5LA 2Q3MA 1UJ2A 4GS5A 3H5VA 1VL6A 4P53A 2QK4A 1LA2A 1EDDA 4GQBA 3MSXA 3A1EA 3ZLVA 4G1BA 1M2HA 1R1DA 5C8YA 3DE3X 3I6IA 3ORYA 1FDUA 4BEVA 2C2YA 4R7ZA 4MOWA 2YOGA 3CLKA 2I2CA 3GMDA 3PF9A 3F6CA 4WK4B 4KFCA 3KTFA 1HT3A 1GLGA 3KKLA 4XVRA 2DKOA 1D7OA 4YJFB 4WGGA 3W78A 4JJFA 4XCXA 1COZA 5K9ZA 2CL0X 2A5FA 5EIHA 3WYDA 5FYDA 3O2QB 5AI8A 3QEMB 1MO3A 1GA1A 4WN3A 4XYEA 2IBMA 3UA4A 4Z4QA 3AOGA 4BXOA 1NF3A 1SR8A 1GKKA 4KOAA 2JGFA 3EDCA 2OXCA 2DCUA 1YUMA 4PNHA 3C3JA 5DNYB 1FDRA 1DS6A 1RMQA 4RIHA 1QYCA 3R7WA 1U2TA 2JLCA 2Y1KA 2FH5B 2K2QB 3QTBA 4HDNA 2XDAA 3R44A 4UZSA 5DP1A 3HEMA 1PT6A 4DM7A 4J1SA 1DAHA 3G0IA 2Y4NA 4V02A 3VU9B 3RSCA 1IBCA 3Q3EA 2G88A 4CIVA 4DCCA 5K0GA 1TFUA 2QRPA 4KLAA 5KI6A 5DO9A 1VKRA 3QLVA 3DAYA 4HK4A 4DSOA 2FY8A 2INGX 3CEMA 1ZICA 1NV8A 2GOYA 1R64A 2XNKA 3ADPA 1YOBA 2GHQA 4NH0A 4N41A 1BW9B 2OKCA 3HDYA 5IAEA 4ARAA 5HP4A 1QYXA 1XZFA 2HGSA 2IXGA 2WF7A 2FWIA 3LA8A 3SR0A 1OI3A 3GZNA 5BUZA 1YC2A 2FZWA 3S5JA 5ECGC 5FI0B 3V33A 2OMKA 2QE7D 4UAJA 3GJ8A 2A0UA 4IIJA 4Y7CA 1Z0FA 1SA0B 2OBNA 1BXRB 5DEIA 2A5GA 2YV3A 3CCCA 2H5EA 2W2MA 1RJGA 3JATA 3MVEA 1IHDA 3F3MA 1PDOA 3CLVA 4WACA 4BO9A 4ZVQA 3TOCA 4F71A 1IFXA 4IUDS 1UOPA 4RK1A 4ZYXA 4TUYB 1GZHB 3DOIA 4ABYA 2BFBA 5AM3A 3LUAA 5BWNA 2FCAA 3PD1A 2PKCA 4HN2A 4F3RA 3LQ4A 2EX0A 2ZJ2A 5EJ6A 1XMVA 2O2IA 1U8XX 2B94A 2ACVA 3KAJA 3LK7A 3LVQE 1E3JA 1XLUA 2P2YA 1SKAA 2WHQA 1HE8B 1XK6A 5EL0A 4L4SA 1ODSA 3E81A 5MN6A 1UIRA 4D42A 1WPRA 3DAGA 2HSGA 1HLFA 3ADOA 1BD4A 2IXDA 4TV9F 3DBLB 5EHNA 2GTPA 5EPOA 5TPZA 3TKAA 4AVYA 4BLUA 4EL5A 4F4FA 1YS6A 4HH3C 1ZA2A 3KKKA 4Q6BA 4C03A 5IDQA 3NOOA 2WMYA 3DEZA 3LC0A 4Q9AA 1KOLA 3UW1A 4EA8A 1U0GA 4V03A 1X94A 2WAAA 4Q4LA 2Q0QA 4XLZA 5K03A 2WJZB 1PFQA 8AT1A 5LNK6 4Y2SA 3RJZA 4KMRA 3D43A 3LBNA 4YP0A 4M0EA 1NBIA 4UBJA 4YC7A 5AHWA 4DCOA 2I6XA 1KVQA 1NM5A 3ZUGA 3RSZA 1ISHA 3HCRA 2VK8A 4ALNA 2Q1WA 5J43A 1NOJA 1NNSA 2FFQA 1UMDB 4N8EA 1NN0A 3NH6A 4UUPA 3GFVA 3QXGA 2Y1EA 3W6UA 1XZ8A 3OQPA 2PPLA 2C2OA 2V7PA 5SY6A 4QICA 2IK8A 2EERA 4OUKX 4PLHA 1PFVA 5K05A 5M04A 3QGMA 1ETHA 2QROA 3FLAA 3MD9A 1FRZA 2VRCA 3V6LA 4KXMA 3DFKA 4NK4A 4BKQA 1JZTA 2KB0A 4O1IA 1AF7A 4NU8X 4O4IA 4RF2A 1Y8ZA 3WQBA 2WUEA 1U2QA 2DX7A 2FEAA 3BRWD 3EISA 3N7AA 1UAGA 2WG0A 3ZWXA 3ZZNA 3IP9A 3IUMA 5JD3A 4WZBB 3TSOA 1M6NA 1QKIA 4Z4FA 2GN6A 1Y7TA 1HYQA 1XEWY 5C4IA 2IU3A 1E6KA 2JNWA 3CQ9A 4MQUA 3RTCA 1XZJA 3TQRA 4JASB 4HB4A 4YRZA 2NU8A 4AU1A 2QAIA 4LHZA 4OI0A 3BWCA 4QXOA 3H2ZA 3FA2A 1A5AB 4UAGA 2B4RO 2HK8A 2BFDB 4JUBA 2V5UA 1J0BA 3R0VA 1OGIA 4Q4JB 1TX4B 1LNQA 1MU0A 1T9CA 1VSQA 2YY5A 4PBTA 5WRFA 1WCXA 4FMCB 2PSJA 4QPCA 4TQGA 4C78A 1P2TA 2OQ2A 1TU3A 2HMSA 5JH7F 3SM9A 3ILXA 3HLTA 5DJ5A 1JQAA 1C30A 4ECEA 2WD7A 3K92A 4FWTA 1TCAA 2AR9A 1Q92A 1H23A 2PQ0A 3R6WA 1NJFA 1EQUA 3BIJA 1ZVVA 2QNIA 2IH2A 5GPBA 4A8TA 4RK7A 2XUIA 4MYHA 4OKNA 3ENVA 1O95C 1I5EA 1TUGA 1UBSB 2QD5A 2FF5A 3K4HA 3KWMA 2FETA 3QM1A 5DI9A 3WTBA 3VOAA 3ZWCA 4BNHA 4MJ3A 3SX0A 1OASA 1ZAKA 4IEFB 3RHZA 1G5PA 3JAWA 4NOLA 1QORA 3KQHA 4GHWA 4TL8A 3NB0A 4HDSB 5H1YA 3SU8A 4ZZ1A 4CIDA 4N18A 3ETLA 4LE2A 4TSKA 5FPPA 2R6JA 4CL8A 2GQ0A 2BEJA 5LOVF 1UCFA 1X9IA 4GXTA 1TIPA 1XQ9A 4MV4A 3VMFA 1KYQA 3CLTD 5IKMA 1XHEA 5K09A 3GLFB 1E3TA 2X3FA 2PH3A 3AVWA 4CV3A 3C16C 1FNDA 3UKJA 5CA1B 2GPYA 5KEIA 3L93A 4Q9LA 1A9YA 1F4LA 3IA7A 1DFGA 4XLLA 3TQIA 3FZEA 5BNFA 3SF8B 4EO4A 2RBEA 2VBIA 6PFKA 5IKEA 3T3MB 4NYMR 5LMNB 3ON5A 2CXQA 4JK3A 1KAHA 5CVEA 2AC4A 1DC4A 3V2HA 2GF9A 1YKFA 3U7HB 2V1UA 4HXGA 4J7AA 4M1KA 1N57A 1IZZA 4MA5A 4CKCA 4O1HA 4KRFA 5JS7A 2Z8ZA 4RHCA 1F20A 3VFDA 3PHHA 2WB2A 4R7GA 4ZEXA 1O7JA 4BGEA 2VJAA 3UQZA 5FLEX 1JDBC 1NT4A 2J85A 4HJXA 3R8XA 1Z8HA 1YR3A 2QBYB 1DUIA 1QGOA 2ZM6B 4IR7A 1QTIA 2FFBA 3CLUC 1JZQA 5F33A 1UUFA 2OYRA 1PZEA 3V8VA 4B34A 5HG0A 4F5EA 5JVDA 2OOKA 2RHJA 4IS3A 1POXA 2DQSA 4O4LA 2FX3A 4TKUA 3K8OE 3UA3A 2Q4TA 1EHYA 3HH8A 3RU9A 1YF3A 1DFIA 5IDWA 2JFOA 1QK5A 2OFPA 2BI7A 2VAXA 1FY2A 1BX1A 1ODFA 2ODPA 4E07A 3LGXA 1DO8A 2AE1A 2C3YA 4JGIA 4MRMA 2AZDA 2Y0BA 3EBLA 4FCWA 1J25A 3M2PA 3ML1A 4RXMA 2HCJB 4U7GA 5BOVA 2IQIA 2B83A 4B2YA 2C29D 2DPMA 4EG5A 2ZRMA 1G16A 1AKUA 2ECFA 2VUIB 3MCZA 4JZKA 3ZNNA 4CM8B 1N3IA 4O4HF 1BXZA 1MQ8B 2CKMA 3Q7TA 2CZGA 4JP1A 4DTCA 3P2MA 1K9VF 2GD2A 1SVLA 1WBJB 1EK6A 4QFDA 3JQAB 4GMKA 4XYGA 2NUAB 3VR5D 3SK0A 4GOMD 4CTOA 3O38A 3SP1A 3IBGA 3JQRA 3ANSA 3KKEA 4N54A 4AYWA 2QTGA 2NSJA 4KAXA 4L27A 1LPBB 4IHJA 1NJSA 1UWLA 4G26A 3TTUA 1FTSA 1G60A 2ENUA 4KIUA 3RR2A 4ZO4A 4BV3A 4F1KA 2P5YA 1GRCA 2I76A 3YASA 1JDJA 5HNKA 4XEHA 1QYVA 1E58A 4H1UA 2SKEA 4I1VA 5I7WA 1D0SA 1YA4A 5AW6A 5EEGA 1CD5A 2PRKA 4YXFA 3R74A 4RD2A 4BNGA 3PJFA 3TO5A 2AQIA 1BU8A 4O2LA 3WYAA 2QRQA 3ZZUA 4D6PA 1Q1NA 1OTHA 2HLDA 2NUBA 2W4MA 2CBGA 5I3ZA 4J8PA 2PZMA 2IJGX 4ZT4A 2RFLA 3BJRA 2A7XA 4ROTA 5LBIA 1XXHB 1HL3A 2GAOA 1L5MA 1VB5A 2VHXA 3Q2OA 4H7JA 3SQMA 4FVTA 4HAOA 2A84A 2DQ4A 4MUXA 4LDNA 4UOQA 4D82A 4DMUB 5EXDA 3GGSA 1L3CA 3ZU4A 1EXDA 4AN0A 1TOAA 2H0AA 2PZ8A 1T8TA 1X7WB 1NVVR 3IIJA 4G5SA 2XYHA 4KXUA 1NJ5A 1JFVA 2MYNA 3OX4A 3P9RA 4RFVA 5C1DA 3BOSA 1G5FA 1FS5A 4J49A 5E1OA 2BLNA 1Y4AE 3T9FA 4HDKB 3JARA 4J4HA 4FC6A 4P32A 3HCWA 2VP2A 2ZSJA 2D2XA 3GJZA 3N5KA 2EFCB 3GYGA 4P84A 4HLUC 4ZEMA 3DB2A 2Z95A 5C2JB 1SZJG 4KODA 4L9WA 2IHBA 2GVNA 5IULC 3GXBA 4QPDA 2O5CA 2PBFA 3E8XA 1U4NA 2WJGA 2HNAA 4CLHA 4EEZA 5AUNB 4DNOA 1QB8A 5TLSA 2VHJA 5I8PA 2BHLA 3A2LA 3KWFA 3FPBA 1PDVA 3UMBA 2O6LA 4CQMB 2BN4A 4BDTA 1EG2A 2UUBB 3QSYA 2FZLA 3ZLUA 3EVTA 4RQAA 3FPSA 3GRAA 2IDZA 2XV1A 4H08A 2AW5A 2Q2WA 5DTIA 3OZUA 1MA0A 3S27A 1ZGHA 4BN4A 3WLEA 1ZNXA 1H9BA 2YZMA 1ZZGA 2X77A 5G2OA 5TQVA 4HRXA 3RUHA 5K20A 3KYDB 4DTIA 1BH6A 3IEUA 5JS8A 2FN3A 1YZQA 2CW5A 2IHYA 2B61A 3TBFA 3ZHBA 3GBSA 2VP5A 3GJQA 4WXYB 2C98A 1RC1A 3MRSA 4IGKA 4M53A 3RHTA 2PJZA 1N2IA 1JR6A 3SEZA 3L4BA 3ZXSA 1J24A 1E3WB 2FZCA 3PUYA 4A8JA 3GGCA 5FO1A 3UWMA 1Y1RA 1XTBA 1PV2A 2BYTA 1FVOA 1YAJA 1DQNA 3Q11A 1TJ5A 2OO7A 5K3SA 4INPA 4XVUA 4TQUS 2FN4A 3GEIA 4B32A 1PR2A 3VA7A 4I8IA 3MXOA 1YFZA 5EIXA 1L5VA 2YWGA 4LZWA 1V8OA 4WN9B 1P62B 5B3JC 1A5ZA 13PKA 4Z3DA 3UAXA 4EX7A 5ENDA 5JBQA 1G98A 2G1JA 4R9SA 2C57A 3OPXA 1JHMA 3BBLA 5CD9A 3GFBA 4FFSA 3GJSA 5E7JA 5F1OA 2CF6A 1OXMA 1K6EA 3LNTA 1ECBA 1RTKA 2CYAA 2Z2KA 1J9EA 3KHUA 1KVSA 4N3CA 3ZGVA 4BFYA 3O8LA 3DBVO 2J3EA 3MQFA 2RDMA 5T8KC 1RJFA 2LWIA 4CM6A 2VC2B 2DFLA 4XUEA 1P5RA 3WRWA 1ULBA 3OO1A 1L4GA 1NQOA 1D2AA 3I72A 1ZM2A 4MGIR 3C8DA 3ROKA 1X9HA 4DIEA 2VSYA 3ZHVA 1W0CA 3INNA 5K3BA 1IOWA 2JIPA 5M2QA 2DH5A 1KTVA 4NZOA 1OXBB 2ZUDA 3NV9A 4M76B 1ZK2A 1Q0PA 2CMFA 4TTPA 4YIHA 3AERA 1CY6A 3LY8A 3GEMA 1R50A 4XIYA 1XSEA 1PFYA 4UEKA 1I36A 3RADC 3FBTA 3UGJA 1O5TA 4OA8A 4TYNA 4M8LA 1YNSA 1HOXA 3ZJVA 2GNPA 5BSMA 4WEQA 2FZGA 3WBBA 2ZJAA 5IJ9B 2I9KA 4B09A 3PP8A 3BTSA 1GU1A 2ALJA 4P4SB 2P67A 2OV2A 3NHRA 4NMXB 4G0WA 5HCUA 1V8ZA 3FMFA 4BGUA 1X1RA 4PN7A 2WILA 3EEYA 1HTWA 5CNJA 1Q2UA 1ZSYA 3GPDG 3A6DA 1ZGAA 2YC2C 1NW4A 1Q7EA 1N6HA 3EDQA 4KVFA 4ZOLB 1KSGA 3QKWA 1Z7YA 3RVOA 4NENB 3K2BA 4H7EA 1GCIA 2HMYB 4MVJG 3TTWA 4Q7LA 1T10A 2ZAMA 4B3HA 3ADCA 1BTOA 2F9FA 1F4VA 1Q7GA 4NTZA 3ZDZB 1OB5A 1HDEA 1DBWA 1F8YA 1DC8A 2JI8A 4DCTA 5BXQC 3RTGA 4DQXA 4EJFA 3AXTA 2I80A 1X1SA 4HFJA 3OZVA 3ROEA 1AO3A 2AJLI 2I87A 3QRWA 3UHFA 1KO8A 2ZE6A 2RGEA 5HMMA 4W1QA 4DRXA 1L5FA 4RY0A 1DUSA 2ESRA 1P7YA 4I55B 2PPVA 1NVMB 2RGGA 4BNNA 3ENKA 5ALNA 4C6TB 4B47A 4GVXA 3AGQA 3FDXA 3A6ZA 2G8LA 4D9CA 4RV4A 1QS0B 2ISSD 4D4HA 1OAOA 4D5GA 1JXQA 3KXLA 3RC2A 3N0RA 3ILSA 5JLJA 3QE9Y 2CXHA 5HFJA 2A1UA 1E59A 1VCHA 2LKDA 1QUFA 2CVHA 2D00A 3GLHA 4HWKA 4RF5A 1G1MA 4YCNA 2B7BA 2YH2A 5GTDA 1RZ3A 2E5WA 4DLRA 3ESQA 4JXKA 3K0FA 5AVWA 4WQMA 3RKUA 5F2NA 4LHSA 2JB9A 4KHPB 4KI7A 1X7YA 5T6BA 2W00A 1UQUA 1EFUA 1F51E 1O5IA 4IAOA 5M34A 3OPVA 2HA5A 2G71A 1PV1A 1CS0A 2J9FB 2V45A 1Z15A 3EVDA 4KYVA 5DLPA 5F51A 4BLVA 5JZ9A 1V11B 3IEKA 3ZW8A 2ZM5A 1J7KA 3CY6A 3PXAA 4KUGA 4WLFA 4RMNA 1P80A 2CXRA 1TVKB 2YYYA 1Y6JA 3I1IA 5SY4A 1X1DA 2YOFA 4RCVA 1T2UA 1PZMA 4GECA 4QOJA 4UC0A 2X0EA 1FRFS 1LC3A 1QLWA 4LC1A 2HAEA 1FPQA 2OLEA 1J07A 3HYLA 1HT0A 2X8JB 3GHHA 1DCTA 4P33A 1NW8A 1CUDA 2GVZC 4GYJA 3OWXA 3KV3O 4FLEA 3RAJA 2WHYA 1MOQA 4HRYA 3TVDA 3USZA 1J00A 4XARA 1V7QA 1P7PA 2D2VA 4YP5A 1FB5A 5KYYB 4IYJA 4EQ6A 1WW8A 4LY0A 4YCSA 2UYHA 4WADA 5I7FA 4I99A 4D4IA 2CLKB 3GDOA 3USCS 4AJHA 4MLCA 5JR3A 1A8HA 1MOZA 4HLCA 1C81A 3TSZA 1N0VC 2E4XA 1A4UA 4QQ8A 5AMXA 1D07A 3M81A 3VJRA 4QJ4A 3V80A 2AX4A 3G3EA 4URZR 1MC8A 3H0EA 5K4HA 2WJIA 4OFBA 1FYFA 4PIVA 1E7SA 4MWGA 2P27A 4QJ3A 3C8MA 3BCUA 2Z9CA 1LSUA 4HV4A 4LRTB 1U81A 4QXAA 2OBBA 2OBFA 4QTTB 3MGGA 2YMQA 3VNSA 1CJKC 1V25A 1GV0A 1XD2A 1ESCA 2WJVA 3EFOB 2PZGA 3N05A 4RADA 4X94A 5JQGF 4BVKA 4DGSA 1JEJA 3PWTA 5L45A 4LZNA 3N8GA 3X2EA 3HCCA 3R3UA 2VDRB 1Z5ZA 4CMJA 5KYGA 1E6LA 1R5OA 5ESDA 3VR2A 1JG6A 4MSUA 4YA6A 2RH5A 4FXPA 1O96A 4F60A 1W8IA 4ZKDA 4TKLA 1DHRA 4Z0HO 4DMGA 5CFLA 4V1CB 3HM9A 4DDHA 2L19A 4BVHA 1JHOA 4CQLA 4EKGA 1CB0A 4RE5A 2YRXA 3C3DA 2YJTD 3TAXA 2X2EA 3LT2A 3M4YA 1Y8QB 2HBYA 3AGPA 3JCZA 3MQ2A 4FOLA 1FRVA 4RETA 3UFBA 3T5MA 1HE4A 1OU4A 3EODA 4XGNA 3CH6A 5AUQA 5CJ2A 1OZGA 1PZXA 2H5LA 3DO8A 3O3OB 1DXOA 3R3WA 4ZAFA 1C9KA 4H3KB 2IVFA 2VDWB 5IMBA 3JALA 1K4MA 4RPJA 3T5TA 1TRKA 3QVXA 4UXIA 4CG0A 4MZDA 4LXUA 3ELUA 3K9QO 4D0GA 1PYOA 2RARA 1NNUA 2EFHB 5JJCA 1M54A 2ZYVX 4E94A 1FNBA 1HG1A 3TDNA 1DRJA 2WUWE 2QN3A 1EQAA 1FQKA 4ZAYA 3SM3A 1N2EA 4AP6A 4FB4A 4QARA 4JLKA 1FYDA 3VZPA 1QGED 2Z58A 4GWKA 4C14A 3B3FA 2WNHA 3ETNA 3K09A 1IUOA 3OT1A 2AOUA 1D2MA 2QAGA 2XYQA 3X1ZA 4ZCRA 4RH3A 2ZSDA 3AF5A 3ECAA 3RABA 4F85A 5K0FA 1TLLA 1V8PA 5C0OE 1YVPA 5FUXA 1VHTA 2CWDA 2PQ2A 3FBWA 2G80A 2DHEA 2HPVA 3BMCB 2IEDA 2OCAA 5CBPB 2ISCA 3QKTA 4A0GA 1CQXA 4JB2A 3SYRA 1EX9A 2EATA 2WJAA 4WNCA 3NKVA 4Q1EA 2M6LA 3S2EA 1RYBA 2XYVA 2HIMA 1R3DA 3CW2A 3I0ZA 4GU5A 3E6AA 2XB4A 2X8WA 1PJ2A 3BJZA 2HDWA 2HY7A 2NXCA 4RJIA 5E6RB 4EA7A 3A6GA 3U3JA 4U0KA 2QJFA 3X0DA 3N75A 2Y6VA 4LMRA 2R8PA 3EEIA 4B80A 1JDZA 1KJJA 3TNFA 4EKDA 3PQ7A 2RHMA 5BWCA 1DGQA 5FOVA 2REBA 2WDPA 4L15A 1Q6YA 3V97A 4AZ3B 2WWHA 3D7NA 3ZU6A 2R7KA 5ILQA 4G8JA 1W48A 4MCAA 1V2GA 4MWSA 1U6JA 4ZANA 4IVPA 2QR2A 4KE6A 3EGDB 4KQXA 5JNLA 1UPUA 3WB2A 1QHEA 4E11A 1MMFB 3GDHA 1VHQA 3ZIUA 3EE6A 3GG2A 4AQ7A 2V7XA 3TLBA 2HRRA 1Z2NX 1RXSA 4BFTA 2OV1A 3EC1A 1C80A 3CSSA 4J9UE 1JDUA 4WFJA 1NVGA 3CRZA 1PL8A 2DU8A 1BOFA 4YWJA 3TIFA 1GPWB 2PZJA 2ZBVA 3E0QA 1G20A 3WGIA 4GX5A 3GDWA 1HSZA 2CKDA 3MQ4A 4EY6A 2F8TA 4FOSA 4TM8A 3HXPA 4R51A 4F1WA 1NDHA 2J3KA 3ZVNA 1BN6A 3C6MA 3L0DA 5FR1A 2OFWA 2MTBA 2W90A 4YB8A 3ZQKA 5J59A 4D3SA 1IUNA 1FRNA 3GUYA 3HABA 1NC1A 1AOXA 4I4IA 4DYVA 2FSPA 4X7PA 3FNGA 2EJUA 1C9DB 1OAKA 1M34A 1VC2A 2RJ3A 4DCMA 3NPAA 3IHLA 4YJFA 3WK7A 3HCOA 3PL5A 3DMGA 4IZIA 5K0ZA 1RWXA 4I7EA 3RFCA 2ZTLA 4FYJA 3ZNQA 2HEGA 3KT3A 3H4IA 4PYKA 3QEMA 2P7IA 1MZPA 4PZYA 1VI2A 5LDGA 4AC9A 4CIAA 3BF8A 3GGOA 3K20A 1GG8A 1BE0A 2AUNA 3AZQA 4LE0A 5T4BA 5MF6A 3CTMA 2CXXA 4X6UA 1OH5A 2C7PA 1KZ6A 5FEUA 3F78A 3ZIDA 3ZJYA 3JAKB 3D7MA 3G89A 2HRQA 4EPRA 1KI3A 3OKCA 5G0WA 2LTAA 1W4CA 3KT6A 2XT9A 3QVWA 4NCIA 3TL2A 3T7KA 3BQ9A 1PYGA 3HGQA 2IDJA 5COBA 3DKPA 2VI5A 3L9XA 1YS7A 3RF7A 3WLKX 4UHJA 1U3WA 1E2MA 2A92A 2AWOA 3A4YA 3IQGX 4JA0A 4QD3A 4EELA 2IH4A 4WCFC 2FMKA 1ZN9A 3AY6A 1KEZA 1U2SA 1YOVB 2AE2A 2VUSA 5F64A 5BYAA 4ARCA 1BW9A 3ZDEA 1PEYA 2IYRA 3OQVA 3QVLA 4INZA 4JELA 4JQZA 4TL6A 1WVMA 1N2GA 2KS6A 3VZSA 5A06A 5LQJA 4Z4IA 2PCJA 4MUGA 4QNNA 3R0IA 4V0ME 2LVBA 1WPQA 3O82A 3T5GA 3KP1A 3DNPA 2GZ2A 2AH5A 3TVYA 5HS6A 3MJVA 4RXUA 4LOIA 1A9SA 1ZXBA 1CDZA 3SG0A 1SA0A 2Z9BA 4Q39A 2GNAA 4TYQA 3JWJA 4F6LA 2YWBA 4ER5A 3P2OA 1GKYA 1WX1A 3PFBA 5DGDA 2WOJA 5C3UA 3VZQA 2FNAA 1S7CA 4GIBA 2DY1A 1A2KC 4KXLA 4TUYA 4UHKA 3BJEA 4OV6B 1ZJ5A 3MUNA 1X7GA 4N4AA 5DXAA 2HL6A 3LQ2A 3Q9SA 4FFNA 3S8MA 4LF4B 1LDEA 1IQ0A 2GJ4A 1YB4A 2ID8A 4YP7A 2HJVA 4O8ZA 1QIJA 3ED1A 1TA4A 1AV7A 1C1XB 1NU8A 1WW2A 4URHA 4AY2A 2JLYA 2CNKA 1GD1O 2OFFA 1GARA 3DBLA 1IY0A 4QTUB 1J8FA 1G2IA 1QVAA 2OAQ1 4ENSA 4RKRA 3WGOA 2Q41A 4RTSA 4ABTA 3TR0A 3OBBA 1LJ8A 4ZDKA 1T3HA 5A03A 4CKYA 3DOFA 1R4AA 4B3SB 2WTNA 4M9XA 3SX4A 1NIPA 1Z0IA 4YJHB 2X9LA 3KHSA 4EH1A 3DVSX 4F5ZA 4NNJA 1Z25A 2YVAA 4TS4A 5REQB 1TF2A 1XPJA 2J4FA 1W5TA 2Z5LA 3G2MA 1FXWA 3QFSA 1OHHD 2V8BA 5DYWA 2J4CA 3HJRA 4J2OA 4TWIA 2I67A 1SC4A 2PJDA 1YMVA 2AEJA 3SZMA 1UANA 3WLSA 3GHYA 1XRRA 2IS2A 2CVOA 5JSZB 3F97A 3F0TA 4OFWA 2JVIA 4UHBA 4KPFC 4JI3B 2BGJA 4AT1A 3RT1A 3FZGA 1YZHA 3IB6A 1XKXA 2WLTA 2X0RA 1G3MA 3RUDA 4C0KA 1VJRA 2KWIA 3AHHA 3IKMB 2I2AA 3Q3GE 2LRHA 1FLNA 3F4LA 4RVFA 1KBOA 2EWWA 2TYSB 2Y9PB 3F2VA 1SIUA 1PHPA 1LPOA 2Y05A 4TM7A 4FFMA 5FWXB 3DEJA 4LK3A 2VUTA 4EW1A 2VJOA 4COKA 3P5SA 3DQZA 1IJBA 1L5WA 2WLSA 4WZBA 5IS2A 4FN4A 2VQ6A 4KQWA 4U2FA 4HWOA 3E8SA 4Y9TA 4KUEA 3LWNA 4FGLA 3FOZA 4ODIA 4W8GA 4PPGA 5CVDA 5LCXA 3TR6A 2J3MA 4FDVA 3PQ3A 4M98A 2O8VA 1V8FA 2JFXA 4HGZA 4DLPA 1LBHA 4IIGA 1OZAA 4GXNA 2AVNA 1M2JA 1N6NA 2CLCX 4G0NA 2ZAIA 1ZH0A 4AZWA 3W5AA 1B23P 4L9AA 4ZAGA 2NAPA 3UF0A 5IZCC 2X5JO 1MX9A 4NHEA 5CX1A 1KC1A 2FX5A 1SCQA 3N0TA 1RE1A 4UTRA 4DR3B 1MG0A 3PDHA 2M6SA 4EI7A 4HVCA 2I3DA 3K0BA 4IHJF 1HFWA 1E2EA 2GN2A 3DAOA 3ZWQA 4DEXA 1O4WA 3IXQA 5DCUA 3G88A 3P0JA 4BWFB 2H1SA 3ZGNA 4JR0A 3RQIA 1YONA 4KH0A 2MWMA 1M7GA 5IAGA 3OVMA 2I4RA 2GM9A 4YMSA 5JJKA 1MFZA 1PS8A 4I9UA 4PSKA 1O97D 3WGKA 5AH0A 4E5YA 3FYSA 2OHFA 5BW4A 1WD7A 2WPDD 2H1FA 3B89A 4IMRA 5GIPE 3H4MA 2FWRA 2QR5A 1L5QA 1KEEB 2BJWA 2WIFA 3Q3VA 4Y2JA 4G9GA 2EQ5A 4C07A 4ARUA 4POOA 1T0UA 1VZ2A 4KQ6A 5TX7A 4X0EA 4H77A 5T41A 1QQAA 3KELA 4X61A 4CNQA 4NJMA 4NZPA 1KS2A 1QG2A 4DUGA 2CHVA 4D3ZA 2G17A 1T25A 1QCZA 2YIJA 1YHNA 2ATCA 1UFRA 3L1IA 1QRTA 2XQJA 3WMXA 4Z4GA 4X5OA 1UDRA 3GLFA 4CM9A 1M7HA 4PFJA 2JLQA 2IPOA 3GV0A 4ARVA 5CA1A 4M21A 1DNPA 1TTTA 2WUDA 1CRLA 1FNCA 1KHTA 1CBUA 2NN3C 3AW8A 2YCBA 3C3PA 4H1VA 3W3ZB 3LZDA 4KQIA 1KPHA 3KCQA 2YZGA 2NYAA 2F43B 3E1SA 1VKOA 1KFKB 3N8IA 3NEJA 5CU7A 3SF8A 2AC2A 4P4NA 5EJMA 3VU3A 4G1EB 4RMJA 3KG2A 4IDOA 4ZXPA 3Q72A 5CT4A 1X0VA 3HA5A 3LHDA 3NWJA 1OGJA 5JNTA 5K6TA 3DKIA 3FBGA 4PAOA 1TZKA 2XW6A 1Y4UA 2OCKA 3ZGXA 1LBIA 2VJKA 3QVJA 4EK9A 3MBIA 2BIFA 1XV5A 3DZFA 3GDGA 2DUWA 2GA9A 2FN8A 3HYSA 3RANA 1KI6B 2O3JA 4RVHA 3ZWPA 2CJWB 1VYUA 4Y1RB 2I6SA 1EFTA 2FXVA 3E7XA 4F4CA 1SXIA 1TC2A 1Q20A 3NBQA 3RSQA 2QBYA 4ZZ3A 1MGOA 2P5UA 3HBAA 3KKZA 3OHPA 3C7AA 3HRIA 1JHQA 4KWHA 4PZLA 4D46A 1T2FA 1DLIA 4M0KA 3DMYA 3IMFA 4CEHA 5F5LA 3LQQA 5SV2A 1ZONA 3V7WA 3VV2A 4D1YA 3ND7A 2XKKA 2BM9A 2OP0A 4DNXA 4WNIA 3MS7A 3H5OA 4EG1A 2NYVA 3QIAA 1R9MA 2V3WA 4R1PA 1W4BA 3HL0A 4MS3B 3KB1A 2DWUA 1R74A 4D43A 4XW2A 4P7FA 1DWUA 2W83A 2E4YA 2BFAA 3ESRA 1K89A 2Y2VA 3QJGA 5T4FA 3TEFA 3TOZA 1LK7A 3VR6H 3X1MA 4B8ZA 2Y1CA 4CM8A 3QFFA 1P6UA 2JI7A 3WKAA 2M6RA 5CB4B 2NUAA 1YL5A 3JQAA 1K7SN 3FGOA 3PVZA 5DHRA 3D1VA 4FJ2A 3ELDA 5CVCA 5B37A 2EFGA 3FM9A 1Y63A 1Y3CE 5B53A 4AYXA 1QG6A 4CEIB 3QX7A 4O2AB 3PR3A 3LF1A 1U0EA 3I4CA 1EVQA 2XD9A 3H1FA 4L6CA 1E60A 3H2GA 4CN9A 5CDGA 3WC4A 2ASEA 2I5PO 3MJ4A 3CVXA 1YVUA 3ABRB 1YDEA 1AKEA 4NZ9A 3PT9A 2XWQA 2GASA 4H3HB 4RNCA 3RBXA 3DG9A 3SQWA 2D3TA 2OEPA 4GGPA 3JQFC 3S8EA 1A72A 1QG0A 2O0LA 3ZQ6A 2UYGA 2A86A 3ZD7A 4WA7A 3CA8A 4FYIA 2HWUA 3OTIA 2BMEA 2Q2QA 2WZDA 4QEDA 3FROA 2WQ6A 3CF6R 3BC1A 3GMTA 5KIAA 5FBZA 1XXHA 6NULA 4YGYA 2W98A 2Y1XA 2IE0A 1Z5OA 2P5TB 1T4DA 3CU5A 4HBZA 3CF4A 3VVBA 4CT5A 2WRZA 3HP7A 1JDSA 1VTKA 5CVJA 3VVLA 3SXPA 5TDHA 2VP6A 1E7MA 1KBQA 5JRDS 3EXHA 1N36B 4CGZA 4N7JA 1TF7A 1X7WA 1BOOA 3CYFA 1US8B 1ZKMA 1JQBA 1Y0BA 1NKTA 2O7VA 4ID3A 3GRKA 4RKYA 1E6CA 3O0TA 3PHJA 4D3YA 4YMLA 3CEAA 5HDBB 5F23A 4GL2A 1VBMA 1HLGA 3O03A 1G8GA 2VT3A 4XD7A 1TMYA 3SVZA 1PN3A 2D2EA 2OGSA 1V45E 3NUGA 1R0YA 3LDHA 4HDKA 4P6VF 4DOMA 5KQMA 3LX4A 4HUJA 1NQ5A 4TMYA 3EZ6A 3MTGA 2IV7A 4Q18A 3TPCA 3VTZA 3QYFA 1SKMA 4HX9A 2XNDD 4H27A 4TXHA 1RKQA 2VG8A 3DV0A 4OXKA 1QX4A 1N32B 1JLLB 4XXHA 3ROGA 1PAUA 2C9CA 4QIHA 3GZTB 3QHAA 2QD3A 2J5QA 1MJFA 3KSUA 3QBEA 4IKOA 1PNQA 2YNMD 5DKFA 3S1LA 1FXSA 3OFJA 3S7TA 3QKUA 5L3QB 4ICIA 2JBWA 3B13B 4NG4A 4NZZA 2UXCB 1RWVA 2AUTA 2QVYX 1U99A 3O93A 1A95A 1TVMA 3N74A 1EWRA 2WWIA 4X66B 1R7RA 2J8ZA 1Z6PA 2CL5A 2G9NA 3MCVA 2Z2ZA 1HLDA 3QOXA 4N0MA 4HEA6 2VT2A 1RCTE 1K08A 1WDKA 4YGXB 3X2FA 5LKRA 5DHTA 1Q22A 1YB1A 2RJOA 2R2AA 4OOFA 5BQOA 1AZSC 4IKEA 2C1ZA 1E3WA 4FZVA 4XOIA 1AUQA 2F3UA 4FC7A 3HB9A 1N3BA 2A9FA 3JD0A 1FVHA 3LPNA 2VL7A 4DLAA 3R0JA 4D7AA 2OZVA 5CK5A 4YAWA 1TTQB 3I9OA 3AC0A 1NRWA 3U1VA 5I01A 3NWPA 4CN8A 1SXQA 2WFAA 1PLLA 1W581 3DYIA 4FX2A 3N53A 2A59A 5AVRA 2WYIA 2DLCX 2B8WA 3K71B 1QYIA 4WN9A 3VPGA 1P9OA 1BNCA 3R1IA 3BD9A 2OT3B 2ZJOA 4DPLA 1ECGA 1LBQA 4NHOA 2IS1A 1EFKA 3LOQA 1H0HA 2W6JD 4OHRA 4DWVA 3JQBC 3WHLA 4OX9B 2JIZA 2NV0A 3A3OA 3C7KA 1KR5A 4IFIA 3GP8A 1X7XB 2FB9A 2C07A 2VXCA 3B7GA 4KFRA 3LKVA 3WAKA 4RHFA 4Z99A 2COKA 4S24A 1RQLA 4R6WA 1BQEA 1Z74A 4LC9A 4KQ9A 2NVBA 2F4VB 2HTFA 4J03A 3UJAA 4BMXA 1L4UA 1XDWA 2ZTUA 2ZSKA 3ANNA 4KLZA 4G4IA 3WX0A 1NXPA 1YR1A 1G5HA 1PX2A 1UWKA 1Z5UA 4GMFA 4QRDA 4UUQA 4YBZA 2BKXA 3IQZA 3N07A 4IX1A 3TE7A 4V0SA 2JFWA 3EYWA 1ZIPA 4MMZB 5CFMA 1LU9A 3AV0B 3DUWA 2Y1WA 3N6VA 3COWA 3MTAA 1YAHA 3AEQA 4OM7A 4HR7A 3TXAA 3IT1A 5LQNA 4RGVA 3GF4A 1UBNA 2ZP1A 4PX5A 4D56A 4LSMA 2OZPA 3PFWO 2HNKA 4CL2A 2V5VA 1N8NA 5IJ9A 1GU0A 1W5SA 4KQHA 3CCFA 1FEZA 4G09A 5AVJA 4BP3A 3O4GA 1U3TA 2ASVA 2VXBA 4P4SA 4HATA 4DKJA 3KJZA 3TGPA 4UOEA 1PVOA 1LF5A 2QSJA 5DW3A 3IX7A 5FWYB 3OI7A 5DSTA 1Q1EA 1DX6A 4FSDA 1GXSB 1B4DA 3SN6A 5EJFA 2FEKA 2IOYA 1P9LA 1DKPA 4BAUA 3EAFA 3K70C 1OH7A 4J2HA 1NN3A 4NENA 5L4LA 3AP1A 1EFDN 3PD0A 4KDEA 5IT0A 1IJFA 2TS1A 1YJBA 1N7HA 1JFFA 1VIDA 3P4YA 4BBZA 4CL0A 1D9ZA 1RKUA 4LJ7A 4BUJA 2GCNA 3OWHA 3S2GA 3L0SA 1S0UA 5L7WA 3MTBA 4O25A 4UU7A 5HM6A 3HUTA 1ATIA 2BDEA 3FUUA 5DOVA 3KQKA 3NIBA 2VJPA 1IOLA 2EGHA 3K0HA 4Q15A 5JRJA 1JKFA 4ZAWA 1QX3A 3NHMA 1KO4A 2ZUVA 4RLFA 2WVAA 3OLXA 4I55A 2ZG6A 1S4MA 4XI9A 4JITA 3DC7A 3SHVA 2NYRA 3GGPA 4C6TA 1DG9A 3ADKA 4JI6B 4Z54A 1YH3A 221PA 1CJCA 2H1IA 1QS0A 1GNQA 7ABPA 3TK1A 2Q49A 1FFAA 5AJUA 1LW6E 1LZLA 4V0OA 2Q3CA 1JFLA 1RI5A 3GEEA 1TPYA 3KHKA 1EGQA 3ONVA 4XD2A 5A0VA 1JLSA 1XKTA 1XTQA 2OV4A 3FYUB 3UT0A 3W77A 4D45A 2W2LA 4M46A 2JLUA 5EJEA 1Q84A 4MWOA 1TYZA 1UDBA 4R8SA 4PZZA 1PK9A 2WYHA 3L6OO 4EKIA 3OTQA 4CKBB 3LKBA 5J1SB 3DF9A 3KC2A 1C14A 4HNAB 4UUBA 1BVRA 1W88B 3CNHA 3L7CA 4B6QA 2J9FA 3V8QA 4YCMA 1U9JA 3ES9A 3DOCA 4GLBA 3EFEA 5KPDA 2GKSA 3WHPA 1R0BA 2PWBA 3ZJTA 1YB2A 2O2ZA 4RDIA 2DG2A 1C4XA 1UINA 3GVIA 3O6VA 2CCGA 2Z1DA 1AF4A 4CCAA 3RFTA 5I9IA 2D7DA 5H4HA 1AM4D 3PUZA 1TADA 3PRJA 3HXQA 1G291 4EG3A 2GBLC 3CNLA 1MOPA 5AM0A 2G1KA 4W5QA 1YE3A 4PO9A 1SUSA 3H3FA 5CDYA 1PG0A 2R84A 2WKSA 4BKUA 1YE5A 1RZVA 5KYYA 5GADl 1XJWA 3H0CA 5A3QA 5CT9A 1B15A 1GZ3A 2XGSA 2G9ZA 1Z6ZA 1YJ8A 2VJYA 4MUYA 4FNAA 4OLAA 2OO3A 4L0DA 1KZGB 3HU3A 4D4LA 5F7ZA 2JFHA 5C8ZA 5EIBC 4JOCA 2XE6A 1TTHA 5FJIA 5BXYA 5D3MA 2XSZD 3ZE8A 2PX0A 4MO9A 4Q19A 1A5BB 4Z3OA 721PA 3FZNA 4AKIA 1RQXA 3IE0A 1TZBA 3MAJA 4YXWD 4ZJZA 1KNXA 4IGFA 4HAYA 2OCPA 2X1HA 3BZUA 4AWXA 5IU6A 2XXAB 2WJ3A 3OEHD 2AB0A 1KQPA 3Q8XB 3L0OA 2VHCA 2DWQA 3RRZA 3EFOA 3OCXA 4BIIA 1F8FA 1MR3F 2PKQP 1E98A 1CUEA 2J3HA 1FFXB 1ORHA 1DQZA 3DZIA 3I28A 3WA6A 1RRPA 5BSFA 1A76A 2XE4A 4WY5A 1CVLA 3D4LA 3THRA 4PU0A 2JCGA 2XTJA 3LP6A 3MWKA 1GG5A 3D1LA 2PA0A 1Q0QA 2PKXA 2E82A 3B1FA 3DC2A 3KXIA 3KV1A 5CLJA 4LHWA 3RJMA 5KPJA 3DD1A 1K1EA 2F1RA 1J49A 2Q4DA 2WWWA 5AKIA 4V1CA 2QIPA 2ZBQA 3PUXA 5JAUA 3N2IA 3LGSA 1GAEO 3QLJA 1QYRA 3S29A 3V9AA 3VYTB 5AVQA 1N92A 1QF6A 3PHGA 1HZZC 3RBZA 3VR4H 4F21A 2P1RA 1ULUA 1Y8QA 2PM8A 3E9QA 3F3KA 1IM5A 1IVSA 1E79A 4KPGA 1KDRA 2XDYA 1E8DA 2X76A 3BTUA 4MPDA 3B82A 1XYVA 3FYUC 3HLYA 3ZXIA 2VDWA 2HSEA 2XPCA 3A4TA 3TJZA 4DMKA 2HCBA 2DUMA 1OF1A 2IUYA 4A82A 3ICEA 4MVJD 2WY2D 1G8AA 1VPVA 1NG1A 3QUSA 4U5XA 1WXFA 1ZI9A 1QJ4A 2WA2A 1G41A 2QKYA 3ACCA 2OHXA 3ICCA 3K2EA 2Q6VA 4HJRA 5EVJA 1M8JA 1U7OA 3B9BA 1PR9A 1GA6A 3IVMA 4XWGA 3VOTA 1L9XA 1YT5A 3G5AA 4Z4EA 1AA9A 5DI3B 2GXAA 3KVVA 1YZUA 3MCAA 4CTMA 3FMGA 1N2CB 3FCXA 1RMYA 3NXKA 3RS3A 2BMDA 2WSSD 3BH0A 1TTPB 4JDPA 4NBNA 4RANA 2ROQA 2CHEA 5D1NA 4YT8A 1MH9A 3DPSA 1Y7HA 3QVSA 4F56A 2P0EA 2GWRA 4XX0A 3ZNOA 2FGKA 3BMCA 1LNSA 2D0IA 3QIVA 5CBPA 5J4VA 1Z08A 2O07A 3DQPA 4TT3A 2ZJBA 3TKLA 2FMTA 1HM5A 2YV4A 4ZODA 1R6VA 4US2R 4X71A 1RBQA 1MG5A 1YZNA 2QMHA 3R0QA 2A9QA 3ZV3A 1U7HA 2WK1A 4ZT7A 1BHO1 1T13A 1T8PA 1TXGA 4BQQA 1WUIS 1QU3A 3EUEA 4IP0A 5AWFC 1F6BA 2KM1A 5F2OA 2PRJA 1YR2A 5I9BA 1JXAA 1NXWA 1OVGA 3GPBA 3N2KB 3THWB 4XUDA 1ZLXA 2HD4A 4BFZA 2C54A 3HNPA 2VYND 2IHKA 2AMLA 3DDUA 2ZIVB 1TEXA 3OZRA 4AZ3A 3K09C 4EYQA 4UD6A 4LF6B 3FWHA 4EL0A 1GL9B 1USKA 3DUFB 4YMWA 3EGDA 4GPZA 4JUDX 5A3SA 5H3LA 3VOBA 2NMVA 4PG5A 4KXQA 1XU9A 2FR8C 3CPHA 2JKZA 4MDHA 5CH3A 4PLTA 4DA7A 5BUQA 3PRKE 4RZHA 1C50A 4LX8A 1KYXA 1CY4A 3VUFA 1G2PA 4U7PB 2VXOA 4L5IA 2I9PA 3OOEA 1ZOIA 2AN3A 2OQIA 2QXUA 4TVSA 2ODTX 2LIVA 3KJGA 2W6IA