3DH0A

Crystal structure of a sam dependent methyltransferase from aquifex aeolicus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
KFDPSKIKKLDDPSRLELFDPEKVLKEFGLKEGMTVLDVGTGAGFYLPYLSKMVGEKGKVYAIDVQEEMVNYAWEKVNKLGLKNVEVLKSEENKIPLPDNTVDFIFMAFTFHELSEPLKFLEELKRVAKPFAYLAIIDWKKEERDKGPPPEEVYSEWEVGLILEDAGIRVGRVVEVGKYCFGVYAMIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a SAM dependent methyltransferase from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords SAM dependent methyltransferase
total genus 61
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dh0A00
4MTLA 2I6GA 1NW7A 3FUTA 4E70A 4KW7A 2EG5A 2B3TA 1M6EX 3FRIA 4HG2A 4WVLA 4C06A 4E2ZA 2QE6A 4QQNA 1KIAA 4QDKA 5GM1A 5EOVA 3BUSA 3LPMA 4OQDA 4MWZA 3TKYA 2HV9A 4RTSA 3A7EA 2JH8A 5LR6A 2IBTA 4IV0A 3BXOA 5EHGA 3OU6A 7MHTA 1IXKA 2WK1A 3AY0A 5CD1A 2GAFA 4YUWA 5CVEA 1Y8CA 3BKXA 2PVCA 5HOQA 1G8SA 5E1DA 1Z3CA 4YMHA 3T7TA 1L1EA 5HIMA 2FK7A 4CTKA 4ER0A 2PGXA 5FQOA 4AX8A 9MHTA 4OBXA 4AZVA 3GWZA 3FYCA 3P9CA 3THSA 1VP9A 2OBFA 2QM3A 4ZTBA 1P39A 2VDWA 3OE4A 5KVAA 4RVGA 5DM4A 3BGVA 3WSTA 4RTMA 5E1OA 4YUZA 3EVBA 4E31A 3AWIA 1KYZA 1RJDA 4WXHA 2YVLA 5EQJB 4ATNA 4C08A 4OA5A 1AQIA 5DRTA 2H11A 2HR1A 5K03A 2NXCA 2YX1A 3HNRA 1NW6A 1JR4A 4YMGA 2YXEA 1NBHA 4PNEA 1INLA 2BR4A 3G5TA 5GP1A 4FZVA 1P91A 2ZTHA 5GINE 5HEKA 2ESRA 4PYNA 1SQGA 1KP9A 3BWBA 1YFJA 3HCFA 4O29A 3ELYA 3K6RA 1KPGA 3GCZA 1BC5A 2PJDA 1N7JA 4CKCA 3R3HA 5EKUA 3UJBA 3IHTA 3LCUA 3O4FA 4LWOA 3ELUA 3QOWA 5FCDA 2ZBPA 5T67A 5K8VA 5BP7A 1X1BA 4HGZA 4KDRA 3P97A 2QYOA 4DZRA 3TRKA 5E9QA 3ELDA 5CVUA 2YXDA 5LSAA 2OY0A 5EEGA 3KR1A 1NE2A 3GNLA 3M33A 5K0LA 3E05A 2O06A 1IM8A 3KQSA 2JG3A 3LBFA 2C7RA 4OA8A 2QRVB 5EVJA 3DXXA 1I4WA 3G2PA 3P2KA 4P58A 4P7FA 4BLUA 2ZZMA 2GPYA 4PONA 4PCAA 2VS1A 3BGDA 4AUKA 3M6UA 3P9KA 2ZWAA 2KW5A 2P7IA 3B89A 1JSZA 2IPXA 4C03A 4RVFA 4E32A 1FJXA 4MHTA 3ID6C 3KR0A 1PRYA 3PB3A 4DF3A 2NP6A 1NW3A 1R8XA 2B2CA 1B42A 1NW8A 1JTEA 1YUBA 3OU2A 3FUWA 5EIWA 3TR6A 3GO4A 2XVMA 1EAMA 4ISCA 5CVVA 4GOND 3DMGA 3MQ2A 3U81A 3UJDA 3Q7EA 2F8LA 3HCBA 3IYLW 3SSOA 5HZMA 3EEOA 3NMUF 3DLCA 3R0QA 5HFJA 2O05A 1OR8A 4IKPA 4PYJA 1XDSA 2BR5A 3DXZA 2ZULA 4XUCA 3G89A 2CWWA 1G6Q1 4RVDA 4LECA 4PYIA 4NECA 3AJDA 2DPMA 5K0CA 5P8WA 2XYQA 4V0RA 2BR3A 2AN4A 4PWYA 1R00A 3B5IA 2ADMA 3E23A 2PKWA 3BGIA 2O0LA 1VLMA 4LWPA 1BHJA 5IH3A 2ZW9A 4QPNA 3X0DA 5GIOE 2R3SA 2ZBQA 1NKVA 1V39A 3OPNA 1MJFA 4XUEA 5DX1A 3G2OA 3GU3A 2PXXA 3CJRA 2OXTA 4R8RA 2VP3A 2FHPA 4U7PB 4RTRA 3M6XA 1RI2A 5FHRA 3DTNA 5E2AA 3C6MA 3SSNA 3OZRA 4QVGA 3SM3A 4CKBA 5KQSA 5EC8A 4E2XA 1YFLA 1RJGA 3LL7A 2XYVA 5H02A 3VYWA 3EVEA 2OYRA 1QAQA 4BLVA 1R6AA 3JWGA 4YV0A 3BWCA 2BH2A 5KS2A 4DA4A 3OZSA 1ORHA 1L3IA 1N7IA 3KQQA 3NW9A 3M6VA 4QTUB 1SUSA 1ZHFA 3TKAA 3HCDA 1L9KA 5EG5A 4QDJA 4Z2YA 4RTQA 3EVZA 1KYWA 2OB1A 4GBED 3NWEA 4B17A 4RSRA 3R9XB 3DR5A 3GJYA 5C9ZA 2HMYB 1D2CA 3SMQA 2O57A 3FPHA 2GA9A 3BZBA 3KQOA 3ERCA 3A25A 1AV6A 4X60A 3MERA 3EGVA 2JHCA 1AQJA 3PS9A 3PLAE 3OZTA 2JHPA 3NDJA 4PYQA 5DX0A 1X1DA 3IEIA 5CVJA 4RYLA 5EIFA 2FPOA 5LQNA 1SG9A 3DOUA 3B3JA 3E7PA 1EQAA 5FUBA 4DCMA 3VC1A 1UFKA 3I53A 4X63A 3CVOA 2AOTB 2P7HA 3KQWA 2WA2A 1RJEA 5DRYA 2C7QA 5B1SA 1QZZA 4R6XA 4MQ4A 1VP3A 5CUQA 5DM1A 2CMGA 3TM4A 10MHA 1FPQA 5E8RA 4XCXA 5G02A 3EGEA 4C4AA 1ZGJA 4RTPA 1H1DA 4JXJA 1VPTA 3HTXA 3HEMA 2DULA 4FSXA 1RI1A 4E2WA 2R6ZA 3HA3A 5ICCA 5K09A 2QY6A 4CWAA 2G70A 5LQKA 1SVUA 3E8SA 5GWXA 3A7DA 3SVZA 1QANA 4R6WA 4PIPA 3LCCA 4HSGA 4P7KA 5E1MA 4MIKA 1SQFA 3C3YA 1NV8A 4HGYA 5CM2Z 1SUIA 3UJ7A 3CKKA 4GC9A 1PJZA 1ZKDA 3G7UA 3HM2A 2VDUE 5K0GA 3NDIA 2PT6A 8MHTA 5T6BA 4DM3A 4P7JA 5DSTA 2N47A 4RTJA 4R8SA 3BKWA 3HVKA 1DCTA 2PX5A 3NVMB 1IY9A 5EHIA 2Y1XA 2XBMA 2IFTA 2AOWA 4IWNA 3T7RA 3O31A 2G71A 3C6KA 3HA7A 4OQEA 3PT9A 5KQRA 1TW2A 1VL5A 2ZVJA 3OCJA 1JSXA 3G8BA 4G56A 4L7VA 5DTMA 5FULA 1Q0TA 1X19A 4C05A 3LKDA 1EJ0A 3KQPA 4PGHA 3SX0A 1ORIA 2G72A 4XUDA 1MHTA 3NTVA 4PYOA 5DXJA 3REOA 1KPIA 4GOMD 1NV9A 4HH4A 1T43A 4YUXA 2JJQA 3MB5A 3KPWA 2BM8A 3SSMA 5JR3A 1P1BA 5DTRA 5K0EA 2IDJA 1JG3A 3H2BA 1EG2A 5FWDA 1AF7A 3SXJA 4DQ0A 4EK9A 4ER5A 1TW3A 4GQBA 3K0BA 3T7SA 1WXXA 3PX3A 5MHTA 2ZLBA 3ANXA 3BWMA 1G55A 2PXAA 3G2MA 3LX6A 2AVNA 3TFWA 3HVIA 1L3CA 3G2QA 1BKYA 3DH0A 3JWJA 4RTLA 1M6YA 4HC4A 3UJCA 1XJ5A 3FPGA 1I1NA 2Q41A 3EGIA 3FUVA 3GRRA 3LBYA 3R6TA 5HIKA 3ER9A 5K0BA 4EKIA 4CXMA 3AXTA 3GDHA 2AZTA 1FBNA 1KXZA 2NP7A 4EVIA 5E8JA 2QRVA 2YXLA 1M0EA 3GRZA 1D2HA 1KHHA 1WG8A 2LD4A 3DXYA 4PYKA 3UJ8A 2P40A 2PY6A 3FYDA 5FADA 2NYUA 2ZBRA 3PX2A 1JG2A 3HCCA 5LQJA 5EEHA 3AXSA 5CCBA 2AN5A 2AOXA 3ORHA 3OFJA 5DX8A 3KQMA 4DKJA 2C7PA 5K01A 2IH5A 2XVAA 1F3LA 2ZIEA 4FR0A 5CIYA 2B25A 2XYRA 3KPJA 3CJTA 2YUIA 3RW9A 4BP1A 2EX4A 5LQRA 1UWVA 2ONYA 3BWYA 3D2LA 3LGAA 5EZQA 3UZUA 2VZ9A 3GXOA 2JHAA 3F4KA 2NNWB 3NJRA 2UYHA 3EEYA 3QV2A 2AOVA 5EKXA 5DSXA 4AZSA 5M5BA 4PYMA 3KQTA 2Z6AA 1O9HA 3DMHA 2IIPA 2FRXA 2I7CA 3I64A 2IGTA 4IV8A 1R74A 5E9WA 5FWAA 1R8YA 4YUYA 5EPEA 2ZFUA 3FRHA 2B9EA 3JWIA 4EKGA 3UFBA 2HTEA 4ER7A 5DT2A 2AS0A 1KR5A 3P9IA 1EIZA 4RTNA 1RJFA 4PCLA 5E9JA 2FYTA 1HMYA 2ZWVA 2AOUA 5D1HA 2IBSA 2NXEA 2NXJA 3UJAA 3FPEA 3IV6A 2FK8A 4KWCA 5CVDA 4C04A 4U7TB 2YTZA 3UJ9A 3KPYA 4PYLA 4X1OA 4OBWA 2AR0A 5DM2A 1KPHA 1FP1D 2FCAA 4PIMA 3FZGA 2C7OA 4RWZA 3EVGA 2OKCA 4KVZA 3MTIA 2AN3A 1YZHA 3DULA 2P1DA 3EPPA 4FP9A 5GM2A 5ICFA 2OO3A 5DTQA 3EMBA 5HIJA 3G5LA 4QVKA 4AZWA 4GC5A 4EQZA 2AVDA 3LDGA 2PV0A 1YZ3A 3PFGA 2OB2A 4C07A 2EJTA 4DMGA 3MGGA 2H00A 3FUXA 3PFHA 3UA3A 1G60A 3HA5A 4FSDA 5DWQA 1ZQ9A 3CCFA 3RODA 2GB4A 3CJQA 4E30A 2ZSUA 5JUWA 3UJ6A 1G8AA 3FPJA 3LCVB 3MAGA 5EMJA 1NT2A 1ZGAA 5FA8A 3Q87B 1G38A 3MHTA 2NXNA 4RTKA 3FTFA 1ZG3A 2V74B 3EVDA 5GOZA 3NWBA 4HRAA 5DXAA 3OFKA 1R18A 5DPMA 2G1PA 3L8DA 2OPBA 5T64A 4P7GA 2GLUA 3DMFA 4UOEA 4FS8A 1HNNA 1I9GA 1XDZA 3KKZA 5DM0A 5CCXA 3KR2A 3B7PA 4CKEA 3KPVA 2Y1WA 3SR4A 5DLYA 3TMAA 2K4MA 3GGDA 1O54A 2B78A 3GRVA 3C3PA 2BM9A 4HTFA 3NVKI 2YQZA 2HNKA 2ZZNA 3THRA 2EFJA 1DL5A 4BY9E 3GRUA 3FPFA 2V7EA 3I58A 4R05A 4RVHA 4FT4A 3BT7A 2WA1A 3LHDA 4RV9A 2E5WA 3TM5A 2HWKA 2H1RA 3PVCA 3P9NA 2UYQA 1JTFA 4M38A 5EMLA 2GH1A 3TPZA 3LSTA 1UIRA 3RIEA 2I62A 1VBFA 4K6MA 1X1AA 4FGZA 2BZGA 3QOXA 5EMMA 4X61A 3TLJA 5ICGA 5K0FA 1QAMA 2P35A 5C0OE 3TQSA 1XVAA 4FT2A 4QTTB 3KQVA 3LECA 1RI5A 5HILA 3FTEA 1EJ6A 2P3LA 1P1CA 1JQ3A 3C0KA 5K05A 5K0JA 5E1BA 1JQDA 4F86A 4KDCA 2PX8A 4Y30A 2PLWA 4KIFA 4GOOD 1D2GA 4PGGA 2Z6QA 2P3OA 4A6EA 3A26A 3B3GA 4M7RA 4QQKA 3EMDA 3OU7A 5EZSA 3P2IA 4RTOA 3KPUA 3ME5A 2P8JA 2A14A 3R24A 1YF3A 2ERCA 3G88A 4F85A 4YUVA 5F2NA 4KRGA 5ERGB 1O9GA 3FTCA 3HVHA 3ER8A 2AOUB 1QYRA 4M37A 4YV2A 3M4XA 5FHQA 4BP3A 1XTPA 2AOTA 2PBFA 3TOSA 3HVJA 4KIGA 4RX1A 3VC2A 3VSEA 1RI4A 2PX4A 1YB2A 5K0NA 2PWPA 4Y2HA 5LQUA 2GS9A 3M70A 3V8VA 2ZCJA 3I9FA 1JQEA 3SGLA 2PXCA 4PINA 4E2YA 4BLWA 2PX2A 2Z6UA 3OE5A 3MCTA 5IKMA 2ZIGA 4QPPA 2CL5A 2UYOA 3MCZA 2ONZA 1NW5A 1QAOA 2OZVA 1X1CA 4HTFB 2ZIFA 3JWHA 5FQNA 4F84A 2IH4A 1WZNA 3ELWA 2I9KA 5EMKA 5LQAA 3KU1A 2P41A 5F2OA 3CC8A 2YR0A 4A6DA 3HP7A 2ORED 4DCGA 2ZZKA 5EGSA 4YV1A 4ER3A 2UZ4A 5BW5A 1Q0SA 1XCJA 3M6WA 3EVCA 1DUSA 3O7WA 5BXYA 3P2EA 3KR9A 5HIIA 3FTDA 4X41A 1FP2A 1XXLA 4E33A 3KHKA 5BW4A 2EJUA 4EMSA 5C1IA 3PTAA 2P3QA 2IH2A 1JG1A 1N2XA 1WXWA 1RI3A 3P71T 3CBGA 1TPYA 2IP2A 3I5UA 3LDUA 1VIDA 4LG1A 1L3BA 3FUUA 1XCLA 3A4TA 4M36A 2PSSA 5F2KA 2PT9A 5KYGA 2PWYA 4GUAA 3GRYA 1F38A 4V0QA 3KQYA 3DUWA 4GEKA 4GF5A 4GOLD 3UA4A 5LQCA 3UBTA 5D1NA 3GIWA 4CTJA 3HCAA 5FA5A 3DP7A 5ICEA 2CMHA 1JG4A 5FTWA 3LDFA 4POOA 3LKZA 3MTEA 3V97A 5GIPE 1VQ1A 3HCEA 4ER6A 4H0NA 2UYCA 2IDKA 4OX9Y 5E2BA 1WY7A 1NBIA 1XDUA 1SKMA 2JH9A 3B3FA 3UWPA 2VDVE 3CGGA 1BOOA 3EVAA 3EVFA 3A27A 3DLIA 2G8NA 1U2ZA 1VE3A 3T0IA 5U4XA 4AZTA 2O07A 3G8AA 3S68A 3P8ZA 2CKDA 1WS6A
chains in the Genus database with same CATH superfamily
2I6GA 1ILEA 1W29A 2R9VA 3HKBA 1Z2CA 5L3SA 5D3ZA 1M6EX 3AYZB 3GP3A 2V5UA 2HT6A 1AHIA 1W25A 2Q9CA 4QQNA 2WHRA 4R7TA 3W6PA 3A1TA 2FW1A 3TKYA 1N3BA 1SC4A 4NTZA 4UQLA 3B1FA 4J2TA 4N0DA 3RI3A 1J00A 1B8PA 4UZEA 4WW0A 4A5OA 4PQYA 1FNSA 1LQTA 2NTEA 2HIAA 4MV9A 4XPZA 3RT1A 3L93A 3GA0A 4PICA 3EH1A 4RHXA 4TLDA 1KDZA 3OOWA 1US8B 4J76A 4PRYA 4CTKA 4D41A 5ICSA 1H2YA 1VZ3A 1Y6QA 2HF9A 4I8DA 1FYVA 2IEYA 1L5WA 3PEEA 1YRBA 3AX6A 2IU3A 2VJKA 4BFXA 1DP4A 1VP9A 4RF5A 3VUEA 2IW3A 1P8JA 2AK3A 4B2YA 4IXDA 1HH4A 3A6ZA 1ZM7A 4ZMRA 5AJHA 2AN9A 5KQLA 3CT6A 4NBLA 3UT6A 4W1PA 3ZD9A 7ADHA 4B73A 4X84A 1CU1A 3CCCA 5G40A 3ZH9B 1NW6A 1JR4A 4YMGA 2BFBA 5JAIA 2YXEA 5EQFA 2E55A 4TLMB 3OZVA 5AW6A 2ZQYA 4K9MA 1VOTA 1XZAA 4FZVA 4KXQA 5FDFA 4F84A 3FWPA 2VTKA 2O8DB 3NOXA 4LRYA 3R1IA 4GP9A 1YQ9A 1KFBB 4KFRA 3THYA 4R9RA 4F9FA 4DCNA 5C7OO 1ECPA 3LPAA 2PZ8A 4Y6LA 3M3HA 1RM5A 5AHRA 1EVIA 4NOJA 4IHJB 3H3XA 4M55A 1OVMA 2WUFA 1C0LA 1PK9A 1PL0A 2CDNA 1UPTA 2A3NA 3QXXA 1PS9A 3HGMA 4Q02A 1CY6A 3AR8A 4WNAB 3RYCA 3SFVA 4WUVA 4DDTA 1HX7A 1CF9A 3BCUA 3U7JA 5LJLA 3IKTA 3O8OA 5A6SB 3VTFA 3UXYA 1G20A 1JEDA 2Q5QA 2RHWA 3ELDA 4RFLA 4EG7A 1I7PA 4M8KA 4Z54A 1VG9B 1IJKA 2MSEB 4N5NA 4X8MA 1T0JB 4CIWA 3WA6A 5LLDA 4WOCA 2O8CA 4P58A 5M34A 2WPNA 4RJTA 1VLVA 1FY2A 3I6ZA 2J0SA 4AUKA 2ZWAA 3VR0A 2R85A 3RSGA 1JSZA 1NC3A 1WUTA 2CNDA 3I9V6 4HMQA 4EQ6A 1GR0A 2ZSJA 4HX9A 1H2EA 2F59A 3GBVA 4FUTA 4LDAA 1OH6A 2C99A 2AN1A 1Z0DA 4IXTA 4UUAA 2PS0A 5DYYA 1H2BA 3ZJUA 5LU8A 3TR6A 2A0WA 1X13A 4EOGA 3GO4A 4U2DA 5BR1A 3K73O 1KZ1A 2BYTA 2XWJI 4UNQA 4H7PA 4A0QA 3SDBA 2YJNA 3MQ2A 3TQIA 3N8NA 5HF9A 1K5GA 1X7XB 4EPRA 5ALMA 3A9VA 4JITA 4J2OA 4OKNA 1YVUA 4NICA 4MPRA 4ZOLB 3SLKA 2XXJA 3A3OA 4B71A 4BZQA 3T5AA 2XUPA 3K0FA 2EX0A 3UAWA 2C8JA 4CIYA 1GKUB 2GXQA 3PRKE 3SOPA 1CQIB 1QYXA 1XZQA 3PDCA 4J0JA 4B83A 1KEZA 5JBNA 5MGNA 1DCMA 1ONSA 2XCQA 4MMXB 3WK6A 3GLGB 2ID7A 4KQ9A 1R8QA 4G8CA 2ZJYA 2NT3A 5MN6A 1T13A 4J0QA 2QV0A 4II3A 4TYNA 4MJ7A 4M0MA 3RIGA 1PJQA 4LY9A 4QPNA 5JROA 2BH2A 4KVAA 4CIBA 3V8PA 1FS6A 2OD2A 4BX3A 2ZYIA 2BMVA 3VH3A 2H4JA 4U7PB 3ROTA 4ZVMA 2PMDA 2BDTA 3VYVA 3ABRB 1JV2B 4L5AA 3GMTA 3NC1C 4Q1BA 2M6KA 4IYJA 4JLPA 5H59A 5CBPB 1DXOA 2QJOA 1J8YF 3SXUB 2XAUA 5C1BA 3QKRA 3QX8A 1OZ0A 1R6AA 1U0OC 3CKLA 3QVKA 4DA4A 4BP9A 3T5GA 2AX3A 1WDWB 2DPYA 1CJBA 1F9EA 3A2KA 2VSOA 5CIWA 3EDRA 1YMQA 4EHHA 1G20B 2OB1A 1LLFA 4GBED 4KPGA 4ZQCB 4RULA 1DKMA 3GLTA 4IDBA 3JR7A 5EZYB 5LD2C 4MXDA 3H5TA 3U80A 1OF1A 4AUNA 1H22A 5KYYB 2RJNA 4RJJA 1OFVA 3RG2A 3A25A 2BW0A 3PDHA 2B30A 3Q2IA 1UBJS 2CN1A 3CUEF 4C30A 3WGIA 3JVVA 4RPJA 3WNVA 4FHFA 5EIBC 1J5PA 3ESAA 4AJ2A 1EVYA 4IWYA 3IEIA 4GX1A 4NMHA 2FPOA 3PE3A 1OWMA 3E7PA 4O1MA 1CUYA 1P1JA 4YECA 1ZIXA 5D6OA 4B3BA 1DWQA 1YKFA 1X7HA 3TTSA 4DJDC 2J3QA 4L0MA 3H19A 4PLTA 1J0BA 4Q3LA 2PYDA 1ZJ6A 4BMCA 4LRSB 1I1QB 5BMVF 1SU6A 4KR6A 1RWQA 1FPQA 4EGCB 1EX9A 5LYJF 2XQGA 3BB1A 2WLTA 3R0IA 1EKXA 1QVVA 5T4EA 2JARA 1R4NA 4D99A 2ZUFA 1GGKA 2YJZA 2DFTA 2BY4A 3EA0A 4OQMA 4L22A 4ZYWA 4M6WB 1QQTA 2FG7C 3O4VA 1BJTA 4ZOBA 2CC2A 1DJLA 4FIDA 1XLVA 3ADOA 4HSGA 2FWBA 3LO5A 3WBBA 4RK0A 3CEAA 1YXMA 3D7LA 5JG7A 3L0SA 1NV8A 2J9FA 3GVCA 3PQ3A 4EY7A 2B92A 2K7ZA 3ORRA 3BMQB 3PKJA 4QX6A 5HIAA 3CEMA 4AY6A 3ECCA 4KLZA 2QD1A 2DPHA 3IQGX 2ATVA 2GPBA 3AC0A 3PFFA 3V32A 4GVLA 2FMFA 4E3WA 2JFWA 4RAQA 1K6IA 2Z4RA 3TSAA 1KBOA 3D7KA 3WAGA 1ZN7A 2P9QA 3VR6A 2PX5A 2JNWA 1Y9JA 2W2PA 3B60A 3WIUA 4NAUA 4U9HS 7REQB 1PDOA 1WQ4A 3QY9A 4IVQA 5JTUA 1XTZA 3VKUA 5C8ZA 2Y05A 2QP4A 2XT9A 1UBSB 1PU2A 4ZU1X 3ZY4A 5JMOA 5JWRA 4QGHA 1PCXA 1EHCA 3WISA 3KQPA 5BR4A 2IXTA 3RS9A 3GFRA 2E5LB 5DXJA 3TE6A 2EFGA 1VGQA 3F6RA 4KWEA 4AJEA 5FWXA 1U5CA 1ISPA 4LF4B 4HNGA 4ZTUB 4QJ3A 3IL2A 4CFSA 1D0VA 2Q3HA 3C70A 3A9WA 2CL6X 4E2FA 3DONA 1FZQA 4ZJPA 1DTEA 4PRKA 4PTZA 3GYGA 3FNHA 4EJSB 1TT7A 1ABBA 1V11A 1QP7A 2BFDA 1P29A 3GCGA 2C95A 2X23A 1WMEA 1ONPA 4IIJA 4DOMA 1JNYA 2XWPA 3HVIA 3ET4A 5AJZA 5J40A 4XYGA 3IURA 3BREA 3KYBA 3QU9A 2C2WA 4RO0A 4XGQA 3RD5A 2HYIC 5HIKA 2XH8A 2XA2A 3F78A 4BE9A 2RGDA 3QE9Y 2GOYA 2TMYA 4US2R 3BTUA 1Y1QA 2R6HA 3TECE 2G4VA 4LCJA 1XK6A 5E8JA 2YXLA 4LSWA 3PFWO 2DZDA 1F0KA 4XIYA 4CLEA 3ZCRA 3F98A 2DPGA 3QFCA 4BQQA 5BWBA 4KREA 2VDMB 1P9OA 3D6TB 1QGYA 2DFNA 2MSKA 2OFWA 1TM2A 2AOXA 1YR3A 1K1EA 4DCVA 4HVCA 3FHJA 2P2SA 1FBTA 1ZNWA 1FTWA 3IUJA 4AZ3A 2ZIEA 1HQDA 2XQFA 3B6ZA 3FDJA 2JEYA 3OJXA 4IO1A 2D5CA 1TTPB 2BKUA 2MYNA 3R5XA 1UWVA 3INTA 4HHEA 1N5OX 3DHVA 4IZOA 4O59O 1OZAA 4DDUA 2YQ4A 1DWUA 1WULS 3CMMA 4JQZA 4O4JB 3FFAA 4TVKA 4V39A 4HATA 2R96A 3O93A 4DEYA 3G0BA 3RHFA 3RBAA 3AM4A 4M1YA 1AJEA 4BNNA 1SK8A 3Q8MA 3VVCA 3ZIAD 2I7CA 3UQZA 3D0OA 4RLHA 4EPTA 2BGKA 3H1TA 1R8YA 4OHWA 2OPHA 3TOVA 3VQTA 1R3UA 2DJ5A 3ZY5A 2NUAA 2VTBB 1N32B 1Z28A 1ZWKA 2YMQA 4GRIA 1ABFA 1SG0A 5HJ5A 1YK0A 4RETA 2WAAA 3H7AA 1TRKA 3PUKA 4ZAXA 1EIZA 1UKZA 1ZGHA 3HR7A 3ZZ0A 4UM9B 2VYCA 5IXSA 2E6KA 1EFDN 1RPJA 4FHCA 3OIWA 3AW9A 1M72A 2RIRA 2J85A 3GJZA 4OHXA 4R1SA 4Z4FA 1SFRA 1XZJA 1V48A 1J2JA 1W2HA 3BERA 2XMBA 3PRJA 1Q19A 3TQCA 4JI0B 2J45A 4YCAA 1KOGA 4TMKA 5ETJA 4A6XA 3DLAA 2B21A 4HLUA 1MKYA 4EG6A 4G1BA 3GT3A 1EFTA 2QRJA 3EPPA 1CULC 3PENA 5LDGA 1EB8A 2BBSA 5DBOA 2AUNA 2HGZA 5JQGB 5HQTA 4NSNA 4DJAA 4AZWA 1A2OA 4YP7A 1R8JA 2HA3A 2Q4TA 1U1FA 4PXAA 1G9SA 3ROGA 1XX6A 4W8GA 2H4YA 4KUEA 4CIAA 4TTRA 4CR6A 4HNRA 3Q6NA 1FU4A 2Q29A 2HJRA 3EXFA 3BK2A 3MGAA 4CI0B 4CQMA 3L77A 4MDEA 3BEDA 3UJ6A 2OENG 5EMJA 3K8ZA 3VYRB 4EFDA 4I5GA 4R1QA 3AMVA 5FA8A 3V80A 3MTJA 1J8QA 1ZGCA 2HA4A 3ZVLA 5GOZA 1T0PA 1CK4A 1MO2A 3KDSE 1M73E 1SKAA 2Y0EA 4NIMA 4Z6KA 1QGED 4NBWA 5AWFC 1A9SA 2H0RA 1J0DA 4RCZA 3L8DA 1UPAA 4MKGA 1TD1A 1HNNA 2O1XA 1BQ3A 2MU1A 3N9IA 4XR9A 5HG0A 1PW5A 2B8NA 2GM9A 1HC7A 2BGWA 1R0SA 1KO7A 1YUMA 2XRFA 3DEHA 2DBVO 5B7QA 4A0FA 2ZIZA 2AT1A 1RAAA 3I5XA 5LMNB 3BWEA 4K3VA 4MWGA 4KPFC 2HK8A 3AM3A 4XYBA 4MUIA 3C3PA 3VM6A 3WMWA 2JLBA 2YQZA 1R1DA 4ICIA 3ZGLA 1IN4A 2W4MA 1WCV1 5C1OA 3PJEA 1OB5A 4XDYA 5YASA 3BT7A 3BMXA 3LJKA 4WNYA 1KARA 2PWZA 1Q0ZA 2IHUA 3PD7A 4UTPA 3OTHA 4ZVQA 3RYFA 3FNBA 3X2FA 1B6SA 4CCAA 1FP4A 3K4HA 4L0CA 3KU4A 5CJ2A 4OKSA 1LPSA 3J81k 2OZLA 5HQ3A 1H23A 1HDXA 5J2UA 1WB4A 3U3MA 3ZV3A 2XTJA 1UAGA 3BH7A 3KHSA 3PZRA 4X61A 2MTBA 1PE0A 4H60A 4BUCA 4YN3A 4CQMD 3PFBA 1DAEA 1FXWA 2IHBA 2ZANA 1TU3A 2DCMA 2PD4A 2P90A 4XGIA 4FN5A 1E6KA 1U2TA 4R3UC 1SEPA 1GL6A 1SQ6A 5FOUA 5C2JB 3REGA 5L3VA 5CX4A 4F86A 3U1BA 1CJCA 5IKOA 4C2TA 3AHEA 5JD4A 2WYOA 4MP3A 2J3KA 2R68A 1DIBA 4I1PA 2W2NA 1CNFA 2AE2A 3GZNB 3PCRB 1SVLA 4BWGA 3AM1A 3AUKA 2ZR0A 2ZJOA 1CZNA 4Y9UA 6REQB 1CQZA 4Q7JB 2AXNA 3QVTA 4OUDA 4RU1A 1YDFA 4YAWA 3K9FC 5AVXA 5TC4A 3T3NA 4BP3A 4Y67A 3WK4A 2PBFA 1BRMA 2PQ0A 3RIMA 3TMYA 1XMXA 2QB5A 1RI4A 1K4MA 1UJ4A 3A4LA 3AHIA 3GEBA 1DRJA 3MELA 4US0R 3LUHA 4Y2HA 3L04A 1GQ2A 3KZMA 4EJ2A 4YLGA 2OYCA 3M0EA 4HEHA 3SIXA 2DR3A 5CB6A 4E2YA 1G6KA 5AHKA 2N42A 3VNQA 3U09A 1MT0A 4A1FA 1T3TA 4X1IB 2CL5A 3ACCA 1KZ9A 3MCZA 4JIMA 1E0JA 2CHEA 1XTQA 3H75A 2WWRA 3D9QX 3N2NA 4K9RA 4LSZA 2JEOA 2QR2A 1O58A 1XEFA 1ZD2P 2FFQA 4BQIA 1NRWA 4N9WA 1DAPA 2JFGA 5EMKA 5FR2A 2QTZA 3DEAA 4MVJI 4NU8X 1NDHA 2YWHA 1WF3A 3EZFA 3R4CA 4MB6A 4UVDA 3IIMA 4KQMA 4YJ2F 4RH0A 5DHSA 1R9MA 3G9TA 3EVCA 3JYQA 4PXSA 1E8DA 4BNDB 2FFHA 3KJHA 4QUGA 5CB8A 1A9ZA 3RRFA 1SBTA 3LC1O 2P3QA 1M7BA 3IOCA 2ZSDA 3HHPA 1JG1A 4YC7A 4AQYB 4J3FA 3RYHB 4CNBA 3KVVA 4BQNA 2IP2A 2JGFA 2ZJ1A 3KZXA 3LDUA 1IN1A 2DEUA 1ZUNA 2WNSA 3SIRA 1M1YB 2H92A 2ZR7A 3DT6A 5DBFA 2GWRA 2I2CA 4IJMA 4M54A 2VBIA 3RUAA 1W5BA 4IUYA 3CU5A 2Z3ZA 4CTJA 3UVEA 2PS1A 4AKSA 2OXEA 3JR3A 5LFAA 1E9EA 2YC2C 4RGBA 3UGTA 2Z2XA 3DD1A 1YHYA 3HYLA 3QKWA 5A02A 1JMVA 1PGQA 1AO0A 2CFIA 3IEMA 4E3ZA 4M7WA 2HCRA 1CP2A 1ST3A 1GSOA 2V7WA 2VDVE 2PX0A 1C9JA 3UWPA 4XIJA 4X93A 2R2AA 3GGOA 5C5IA 4IMPA 2GAIA 1JDTA 2W2KA 2F48A 3LPMA 4ZZ1A 1GFWA 1Z29A 2QLMA 3U4IA 2M6LA 3WSWA 1M83A 3TLMA 3V4FA 5T8KA 1VA5A 4UBLA 4E2ZA 3HSKA 2C59A 4EYKA 4QDKA 4YI3A 5JDCA 4Q16A 4A36A 1CZOA 2D1SA 2QMOA 3ECAA 1ECBA 4ARBA 5FBWB 1OVGA 1AQNA 4MWOA 4B6EA 1YRLA 1XSEA 2HHAA 3QEOA 2DPXA 4BNIA 3IAXA 1FXUA 1E59A 1W87A 3IVRA 4LWQA 4PWZA 2K2WA 3NAMA 5CVEA 3OCXA 5ESRA 4E1AA 3BRCA 3DEZA 1AS0A 3T7TA 4XOUA 2JI9A 5HA5A 1CJSA 4EG0A 3NUZA 4GMHA 5INTA 1RDFA 2XF2A 1XF9A 2ZYDA 4WZBB 1K3UB 3FYCA 3QRWA 5EXXA 3NKFA 3OIYA 4NNJA 3CSUA 2K6GA 3OOHA 3QKRB 3EAFA 3Q2OA 5SV2A 1SO8A 3CTMA 1TZJA 3KKMA 1QWOA 2UV8A 3DMTC 2YZGA 1Q1BA 3T54A 1L7VC 4B81A 3TNDA 1G7TA 4K1XA 4EYQA 3D4BA 2OBLA 3WRXC 2NVUB 5K03A 4AJIA 5DYWA 1MP0A 2BSQA 1TVCA 4ZCQA 1TFRA 5AVJA 5T5QA 4JXZA 1JBEA 3VPBA 1OXMA 1MG5A 2C4NA 2E4WA 3ABZA 3ZKWB 4PW0A 1QZXA 3P96A 2BAGA 2O3JA 4GLLA 2RGAA 2H17A 5DN6D 3CPEA 4X65B 1BA3A 4ML3A 2VH1A 4GKVA 2H52A 3A2MA 4DCTA 2O2XA 4DR1B 4UNNA 2OV1A 4K6KA 2I65A 1P31A 3A11A 3CUWA 4OHVA 4MVJG 1V2GA 3VOSA 3E5RA 2L82A 4NR0A 2I1VB 1FRZA 2Z1DA 4MUXA 2AKYA 4MV4A 4ZP1A 5K8LA 1QH8A 4QWMA 3LCUA 1P17A 2GAOA 1BDMA 5FCDA 3O5AA 1P0FA 3D6JA 4DRYA 1T5SA 2Z4TA 1E18A 1JBQA 4BNWA 2YHBA 3WIVA 1SCQA 2Q4DA 4H7HA 1JPVA 3JQ8B 3LX5A 1MVLA 4PAMA 4XR4A 4YJDA 5G3YA 4G0PA 2J41A 3EWNA 3TRKA 4BVGA 5EEGA 1QCDA 3QU2A 4I4LA 3HP1A 3LBFA 3RHTA 4P54A 4CIVA 2BTEA 3G2PA 2VSNA 4LX8A 2ZYWX 3H5IA 1V7ZA 3RAGA 3SIPA 1Y8QA 1TTHA 4Q3BA 4TT3D 2EKQA 1I2CA 1OFUA 5C46F 1ZFNA 1HDGO 4LRTB 4EA6A 4QAQA 3JZDA 4Q3DA 1U6IA 4Q3EA 2QA5A 3DOOA 4C0WA 3C39A 4F2DA 3GPCA 4UXIA 4NBUA 4XJSA 2XLBA 2UUOA 4PGAA 3GVXA 3SM9A 3L6RA 1Z4LA 5TIIA 3UBMA 4EJ0A 1HK7A 5E4TA 4ZI3A 1C1HA 3QE0A 4U7DA 1TGYA 4IV5A 3P19A 5F33A 2EARA 4DLWA 1HOXA 4KQ6A 1OJLA 5IDQA 4FFSA 3VR5H 4J0FA 3CUVA 2XB8A 5FFFA 4IKPA 3GRFA 2A86A 2C2YA 1KVRA 1CQJA 3U37A 1Z17A 2R8YA 5AQ1A 5JFGA 2R1VA 3K9HA 1D4ZA 1O96B 1X8KA 2UVPB 4HAUA 1GKYA 2UZAA 2YWDA 1FSFA 2DPMA 5AI6A 5SY6A 4KN5A 1ZD4A 1Q7CA 3TB6A 3EUAA 1UZMA 2IVFA 3NBZC 1Z73A 3D3KA 3QWHA 3RWBA 5BT8A 3MJFA 1NXPA 4CFZA 4D4LA 4TYYA 1V7CA 1VJCA 2EQBA 1IXZA 1IK6A 1COZA 1E2GA 2GF2A 5HKLA 2R7KA 1CUXA 3BYZA 3ETNA 4XUEA 1G4UR 1MFPA 2RI1A 3NIBA 4W8HA 1S3SA 4RF3A 3AOEA 1U2DC 4YWJA 3LPLA 3PKIA 4WZBA 2DKFA 1NFQA 2VBGA 4Q7KA 2BFEA 1M2VB 3KJXA 2F1JA 3LA6A 1W93A 2AE1A 4NE9A 4WNIA 3X1MA 2EF0A 3UYLA 1RRCA 1PR6A 4AD8A 1NXVA 5GTDA 4F45A 3U4DA 1KO4A 1R7RA 3L8FA 4X7MA 2VWQA 4YV0A 5KS2A 1TAQA 2DLNA 2G9NA 5BNIA 3G85A 1ADBA 4X1KB 3KT3A 4OP1A 1GEEA 1T5OA 4A8JB 2A33A 4Z9YA 3EG5A 3PFIA 3I6IA 3BQNB 1CS0A 3G1WA 2SKCA 1FEZA 3UV7A 4DB2A 2I7TA 1QFJA 4GE0A 1DRWA 1L4MA 2VQSA 4BQPA 4EWLA 4FN4A 3WJ1A 2PHZA 1T0HB 2GEUA 3QYFA 2GA9A 2L19A 2BKVA 4GL2A 1N5KA 1OPXA 4X60A 1GA4A 1R16A 3DMPA 4RD3A 2ORWA 1LSUA 3D6UA 4PYQA 1ZRHA 4LISA 4BFTA 4DC1A 4WL0A 1R0YA 3FB1A 3C7TA 2OM2A 1HKHA 1A2BA 1EDZA 2R4UA 2ZRMA 2YYAA 3B3JA 3I1YA 4I2NA 4MR8B 4MRVA 4JJGA 1R0CA 2P7HA 3LUAA 3WP1B 1RJEA 2C88A 2OQIA 1N6PA 4LJ4A 1A7UA 1QZZA 4BQRA 3VC3A 3MG9A 4DA8A 2WLSA 1DKPA 5A4JA 4OK6A 5B1DA 3P9YA 5EY5B 2BJWA 1G291 1IJFA 3EXHA 4DIFA 3HTXA 4D45A 5LIPA 3IUMA 1U65A 5A5FA 4W5OA 1Z06A 2LUOA 1GTMA 2QPTA 4M9CA 5FOWA 3CH7A 1QLHA 1DMSA 1YZGA 2GZMA 2ZP1A 1RWVA 1CS4C 1SCDA 2C94A 4L07A 4Q5IA 1Y98A 2OBBA 3OZBA 2Z2YA 3KALA 3F7OA 4D57A 1VMAA 3C3YA 4KVFA 1T6YA 4ZO6A 3CKKA 3GT7A 2VUSA 3CNEA 1ZOOA 5HDBB 4PC2A 3FYHA 5KTTA 4QYWA 4YXWA 1TT5A 1VKNA 4OOEA 4YFYA 3SJBA 4BNMA 3NDPA 1T2DA 2YBEA 2D6FA 2CF6A 2ZS7A 4I8XA 1VDZA 2F90A 3FYUB 1RAFA 1MC4A 1R0BA 1NHGA 2P79A 1KL7A 2JD2A 4MCIA 5DSTA 3MT8A 1G5PA 4BZPA 1GGHA 4QJIA 4HDRB 4UHJA 2LGJA 3IVMA 3TW8A 4D3FA 3PGXA 2V0GA 2WG1A 5ULLA 1GZDA 4PG7A 5ITSA 1UOPA 5I7HA 1UQRA 2EYQA 3DE2X 3RUDA 4BO7A 1ZL2A 3OLCX 2WV7A 4H1TA 1AB6A 1MHTA 4HXGA 2NU6B 3WYNA 4PYOA 4P3XA 3AU8A 1ZCZA 3AGPA 3M1IA 3U2QA 1MX1A 1YL5A 3KPWA 4MLDA 4RH3A 1NM5C 1TEVA 5CJJA 1X6VA 4PHGA 4UMFA 5FA6A 3ZC3A 2WB2A 2AEEA 3E9YA 4D8XA 1Q1ZA 2I4MA 4NY1A 5FWDA 1EPUA 3DZJA 3BD9A 2QTWB 3LQYA 3LVBA 1KI9A 1QIHA 4QQFA 2O8EB 1KIFA 4K3UA 4E5MA 1HY3A 1YIOA 2IEBA 2B1IA 1G55A 1QQ7A 2JZNA 2YV4A 3T7DA 4PC7A 1E20A 4L28A 3W90A 4BJ3A 3DWFA 5JBQA 2ISSD 4HFJA 4DMLA 3UMVA 2V59A 1G1AA 1Z2AA 4NATA 2BBOA 3ER9A 1FS5A 2JFZA 5EIHA 4B2PA 3Q5DA 2HO4A 2HFJA 1YC5A 3HSSA 3FLBA 4IRMA 4EVIA 1Y6FA 4URVR 1M0EA 1BS1A 1U4SA 1BX0A 1D2HA 3CLUD 3FY4A 3VI3B 2R8ZA 2R11A 3ZZNA 1JALA 3KJIA 2NYUA 1O6ZA 2O4CA 4FVTA 4PFSA 5I7RA 2X2EA 2H7YA 5LQJA 4IHKA 4GL4A 4IOLA 3SC2A 2C7PA 4X0EA 1V26A 4FDVA 3ZWDA 5LBTA 5K01A 2VQ3A 3A0RB 2ZAGA 2ZYRA 4OFBA 3V4OA 3ZQJA 3KEFA 3OLYA 2XNCA 4RK1A 4MR8A 2A92A 1OH8A 5JOQA 3A58B 3MK31 1H3FA 1P33A 1ZDMA 1ID1A 2ZROA 1YR2A 2IY8A 1WM1A 4L8GA 1DMRA 3ZYCA 5JS8A 3GDWA 1MAUA 3H0EA 2VZ9A 4GZ5A 4DLXA 5FUQA 3EFHA 3TNFA 2JHAA 2ZIXB 4KPUB 2G9VA 3JQRA 5GADl 2CHVA 2YWRA 1VLLA 2AOVA 5EKXA 3ZD8A 2JHGA 3RSSA 3K9CA 1FYEA 1Y7PA 3OZEA 4LS3A 4CL8A 3TI9A 3I64A 4N49A 1A77A 5AVWA 1R74A 1XYVA 3ZCSA 2WJAA 3KB2A 1T5LA 1XQWA 3DE5X 2FB9A 3JWIA 4C1NA 4YUAA 3GLGE 2HU7A 5KYNA 2CLLB 1T10A 2JZOA 3ND6A 2AS0A 4CEIB 1K7XB 2ZE8A 5HBRA 1GV1A 2ZBUA 3B6IA 4LOKA 1ENZA 4HVAA 3SYKA 3LH5A 1HMYA 2W93A 3PJFA 4E12A 3RM3A 2HRRA 3V6MA 2GPSA 5BVHB 5AP9A 1IN6A 3BHIA 4KWCA 1DIAA 2QDXA 4OJNA 3MVEA 4GSYA 2QL9A 2IYQA 3LF1A 2AYXA 3O3MB 4ZEWA 3G3EA 3NP9A 4QLOA 2VBCA 4C6HA 4U6QA 4TMFA 5DCLA 1WVIA 1S2MA 3WL4A 1PBTA 1Z7BA 4KMMA 2A9RA 2O5RA 5CYPA 5TF0A 1X8XA 3TQRA 4KXYA 4Y0AA 3KQKA 1QSGA 2DJIA 1DJPA 3IMKA 3LDGA 1CQXA 2W2XA 2FKNA 4XYEA 4EA7A 3T15A 2EX1A 4BXOB 2A84A 4INPA 1UMCB 4X9XA 3UA3A 4DLTA 4XLZA 3Q8XB 2GB4A 3AERA 3CJQA 2JDIA 1NUPA 5FOTA 1DB3A 1V6AA 2R8OA 4GP7A 2DPLA 4IOMA 3TSOA 2KLBA 1NQ5A 3LCMA 1EAYA 3BMQA 4OCZA 3EVDA 5JATA 1FTQA 1M5RA 3KYJB 1HXHA 3UAOA 4YA6A 3LFHA 2ZI3A 3GROA 4URYR 1P2DA 2W5UA 1QK5A 1Y5MA 4IDAA 5K4AA 3OIFA 3R8XA 2V4MA 4UOEA 1NMXA 2EEZA 1HQCA 2B6HA 1A9TA 4XJTA 1BVYF 2WSSD 1XDZA 2OCAA 3KKZA 4UE2A 5H4HA 3U40A 1MXHA 4V0SA 3VJMA 4AJPA 1ZKMA 4CTMA 2Y0BA 2H57A 3T9AA 1Z62A 1T4GA 3O2JA 1VPLA 5ESWA 1D7OA 1P0IA 1O54A 1WOMA 3C4JA 4YRDA 1D07A 1XWWA 2ATIA 1ZVVA 2J4FA 2JKVA 5F3WB 1IBCA 4DCCA 1THGA 3AFHA 2BCGY 2W6ID 4NBTA 3NVKI 4E88A 1T5HX 2NU8A 2BFAA 4D3DA 3I6YA 3HL0A 3RANA 3RFXA 1CVLA 4RVHA 4P4UA 4Q47A 5DBIA 1ZBQA 4GP6A 1XN1A 2QT1A 3ZKAA 4WCFB 1B0ZA 1PT8A 1WWKA 3RHZA 3EGXA 2VZ8A 4H31A 2HU5A 4KHPB 2EXXA 1JHMA 1MTZA 1UC4B 4OXXA 1ZM3A 4YP9A 1VFNA 5DLDA 4EG5A 4RHCA 1AO3A 4JD5A 5AI4A 2OV3A 1Q3KA 4J0IA 1QAMA 1ZN8A 2BFNA 3PR1A 4X90A 1O8CA 1G4HA 1G2QA 3CSSA 4WACA 3OPYA 2Z56A 2PT7A 3C41J 1Z7YA 2HXYA 2R6DA 4OX9B 2DFPA 5DYGA 4A0GA 4KIFA 1RLMA 1FLVA 2DP4E 2SBTA 1BO6A 3GJQA 1D2GA 1GNTA 2DWOA 1KAMA 2HDOA 2Q8PA 3GH3A 4A6EA 3MRTA 1X9GA 3KO8A 1FFAA 3OU7A 5IKEA 4LE1A 3ME5A 3JASB 3R24A 3BIWA 2AMJA 4CUJA 1E2IA 4ND8A 3WB0A 2BP7A 2F64A 4HDSB 5IM4A 2ZATA 1O9GA 1JHXA 1QYRA 2V98A 1JEEA 1OWOA 1VCMA 4PN7A 2ZYGA 2GXSA 3BHJA 3LHFA 3HVJA 4DN6A 3W04A 2XVZA 4MV3A 4P38A 3CQ9A 4UUNA 4UE3S 1SOUA 2QIPA 3FAZA 5C81A 4A15A 1PYOA 2DQ4A 4N4AA 1IL0A 1IOVA 1PKEA 1BCSA 4LC1A 4KOAA 2QL5A 5GAJA 3V1TC 3Q3HA 4LOAA 2IYRA 3ZGZA 5BR8B 3L07A 2KWIA 3T3OA 2HNAA 2WJ4A 4B47A 3D3QA 3WIBA 2Y1LA 3HRHA 2VUUA 3OT1A 1OV4A 3W9YA 5FQNA 2IH4A 5ECGC 3W9SA 3L2OB 3VR1A 4TRMA 1TQDA 1U5BB 1L4HA 1V3TA 1VMDA 3AF0A 3KTAB 3AOEC 5LQAA 2K5UA 3WZ2A 1AUOA 3E7DA 3ZE2B 4EITA 2X5KO 1VHDA 3FBTA 3S1LA 4D4JA 2DTDA 2B1JA 4BIIA 4DARA 2R1TA 4A23A 2CJFA 4NYIR 3QHPA 4QHTA 4WBNA 1YDMA 2EJUA 3ZHCA 1LRLA 3FJOA 3H0CA 3DDZX 4OAPA 4KITB 5JZOA 4KGXA 4ZQHA 1TADA 1MJGM 3AR4A 4G4SO 5JZMA 4M0PA 1L3BA 3IQFA 3BZWA 4K8OA 5T4HA 2C2ZA 3S0JA 2O7QA 2V9ZA 3K0HA 4UXHA 3R6LA 4JY7A 4KACA 5MN5A 1G2IA 1W4BA 3ZEIA 4DXAA 4P5PA 3KD3A 3OUUA 3ZWVA 1LI5A 1PZEA 3CNBA 4C0XA 1T9HA 5BWOA 2QG6A 4S2EA 2WILA 1T15A 4RV4A 3WRYC 3OQOA 2OBNA 2YVAA 2Z3WA 2Z5FA 4MKFA 3V97A 4B3IA 1IBSA 3HJFA 1XPOA 3OLQA 4EEXA 1YNSA 2Z8YA 1MH1A 2QORA 4EHLA 4S04A 1DIHA 1BDBA 3TXAA 3ZU2A 5DLPA 4CUZA 4B0OA 1U2SA 1MW9X 1PNVA 4HBZA 2C5AA 1OXKB 1MXFA 1AU9A 4FZ5A 2HNBA 2SKDA 3GJRA 1QPZA 2AL7A 4J0GA 4A2QA 3NHRA 3UK6A 3FXAA 3K20A 3RRJA 3WAKA 1D6JA 2HV9A 2CZGA 1DG9A 5HCIA 1TAUA 1ZIPA 4MW1A 4PO9A 3BXOA 5JC1A 4RDIA 1W4CA 2CJWB 3T4XA 5HOQA 4YAKA 1Y63A 2BKXA 1MH9A 1GA1A 1JVBA 3B1XA 5KUTA 2IW1A 2Y66A 5KTPA 2I71A 2QVBA 2XVXA 3RG8A 3F0TA 3HBAA 4DV6B 4LJKA 3SQOA 1NP6A 3DBHB 1NBAA 4UBMA 2AC2A 5DM4A 3QMPA 3QKUA 2ACVA 3EZGA 4DV2B 1U7PA 2HK7A 3GJXC 3E9EA 4CL0A 3EPLA 2PUEA 5CLJA 5M7EA 3JRXA 1K68A 5LN1A 2GYUA 4ZT5A 4S05A 3MSCA 4AF8A 3HY3A 1CT9A 1TK3A 3AUUA 1TZCA 1DO0A 4OAOA 4PNEA 3O4RA 5TEWA 1DBWA 2HYDA 3VHXB 4BO2A 3E4DA 1F0YA 3ROKA 4XWKA 5FXMA 3HBNA 2EW8A 2YYZA 1GYQA 2HSJA 2WAMA 1P62B 3GFTA 5PNTA 1T6NA 2VAMA 1KPGA 2JRCA 4LRWA 2JIQA 4Q3KA 2XECA 3M9WA 3WGMA 1SC6A 2IU4A 3X1KA 4FCTA 4RV5A 1CKEA 1V1RA 4G85A 4XA8A 4BVKA 3UF0A 4PG8A 2VPXA 3T61A 4KIUA 2HMVA 2C2HA 1O4VA 2NGRA 2WW8A 1RVDA 2XUGA 2IYUA 2Z43A 4KDRA 4QTXA 1ZSYA 4HWSA 4WK6A 4BQOA 3GLIB 3Q4GA 2MR6A 4M89A 3M5CA 1SULA 1M5UA 3B52X 4M8SA 3V2GA 3WGNA 4ZVKA 2P2ZA 1VSBA 1GVHA 2WAOA 3NRBA 4GAEA 4IF6A 4R1UA 4JNKA 4M0FA 5K6AC 4R2WA 1EGQA 3H9GA 1LJUA 1T29A 4V3CA 4YONB 1Z4NA 3IJ5A 1D4AA 2Q2VA 1B6TA 1TQ2A 3LZCA 4NABA 1UJ2A 1KS9A 4XX1A 1ZVMA 1Q21A 2GN1A 3R9IA 5KOJB 5LOVA 1OJ7A 2IE8A 1ZD5A 2IPXA 1NXOA 4ASUA 2DF8A 4CM4A 1HNZB 1YCHA 3PB3A 1Y8ZA 4IHAA 2W2LD 1E77A 4O5OA 4ZWNA 4AUEA 4IX9A 1QNFA 1L4LA 1U1CA 2WZCA 3FUWA 3P5SA 4RC9A 2I6TA 4UOQA 2M6SA 2IEGA 2YIJA 5U4QA 4EMUA 4YXFA 5DJ5A 5C7LO 1K8RA 3U81A 3X2EA 5EIXA 2D7DA 3K1TA 2HMSA 3NAZA 3WL7A 3WO1A 2ZYTX 3NMUF 1UBOS 3TCNA 1NOIA 2ZTVA 4OFXA 4YYEA 5BN3A 5HZGA 2O05A 3A28A 5AQEA 1EE9A 3PEWA 3X44A 3HGQA 2UVPA 1QGZA 1C41A 2AHOA 2SNIE 1S2LA 2AMLA 1JU4A 4MW5A 1Z36A 3MJDA 4O6VA 4DIDA 3MGKA 4L74A 3U3OA 2IYZA 1C8BA 1IM5A 5LD2B 2CHUA 2A0KA 1L4FA 2XA1A 3JAKB 3O47A 2GZAA 3OURA 3F6SA 1WV0A 4IIHA 3E23A 5FUVA 1OKKA 2Y0PA 3U9LA 3G2HA 2JFVA 3HACA 1VE9A 3HSYA 4O4HA 1VJDA 1YBHA 3CKYA 2ZW9A 4UDOA 4MDYA 5TEVA 3TXYA 3VSDA 4XWGA 3WLHA 1O5OA 4I66A 1GN8A 2NOAA 4XZ3A 2AUMA 3DZKA 4OHBA 5D2CA 2OXTA 3UB4A 2NUAB 2XNDD 1NDQA 1EVLA 5G4KB 4HRXA 5G53C 3TR5A 2O8EA 1PGJA 3FA2A 4UM5A 1JB1A 3MAAC 3PA8A 2ZKIA 4LDNA 1HO3A 1OY1A 1SHLA 3I83A 4Z4QA 1Z4MA 2RHDA 1RPTA 3VO9A 1PYDA 3CLSD 3BM5A 1QAQA 2WG0A 2YV2A 1MAWA 1NVEA 3IJPA 1ATIA 1QTIA 4XSHA 3OJEA 1XN4A 1HUQA 3F97A 1DBQA 2GRUA 2VHVA 2ZB7A 5JV5A 1HYEA 1TO2E 2B8EA 2PMEA 1TX4B 4FKBA 3TZCA 1CXZA 4NONA 1Z16A 2H9IA 2V7TA 3C5WP 3D4IA 3MLBA 4Y7CA 5AK3A 3AK4A 4PHHA 3U0VA 3S7ZA 3DR5A 9ABPA 2ORYA 1JJAA 2HMYB 1D2CA 2RIPA 1J21A 2IYEA 3O1LA 4IMRA 2GYVA 2QN3A 4OHCA 5FUWA 1AV6A 4WADA 5BT9A 1XCBA 3EGVA 1JFRA 3Q7PA 1E6UA 3EGDA 4O02B 5C8YA 2Z9BA 3OZTA 2HZBA 4ZRMA 2QL6A 4Q4HB 2I2FA 4WSOA 3F4LA 1XQVA 1Q2UA 3TRJA 3O2SB 3DOUA 4KGVA 5I9TA 1ZZGA 5DWVA 1UFKA 4HAOA 3KXDA 2DECA 4Q24A 3UOAB 4KPUA 3KXLA 4P84A 5SYAA 2BGLA 2I87A 4B8WA 3P4YA 1E2HA 4FE4A 4P4LA 2ZYSA 3A0UA 5B36A 1EP1B 3QLUA 4EO9A 5ES4B 5JI3E 1W581 2YJ5A 2ZSFA 4TTSA 4X6LA 3TL2A 5DDIP 4MJLA 4DDHA 5G02A 3DCNA 2FQQA 4QYIB 2CNBA 4LQLA 2NO7A 3DLPX 4P1ZA 1QJ4A 3H99A 3PHLA 5IUNC 2ZB4A 4O4HB 3IQEA 3R6DA 4MWBA 4LI3X 1H5UA 1P80A 2ZBDA 3PK0A 4E2WA 5HJ7A 1UDBA 1Z25A 1UKCA 2AQ8A 2GLXA 1SVUA 4MVCA 4G23A 3PU6A 1F3OA 3K09C 1J97A 3SHVA 1YVEI 4R6WA 3QFTA 2I4TA 5JMWA 4ZJUA 5E1MA 1JU3A 1QG2A 2FX3A 4WKNA 3QI7A 4I50F 3HYTA 4GC9A 2EFCB 2WABA 3L82B 4R8KA 4EABA 4EX6A 2Q6VA 3G7UA 3D02A 1PT9A 4C76A 2OFXA 3DEKA 2NYRA 1Z4KA 4Y6QA 3V00A 4RHUA 5I5EA 1TGVA 1FP4B 3E9ZA 1TZMA 4CF5A 3U17A 3HHEA 1KI6B 3ZK8A 1CVIA 3KFLA 1N1EA 4UU0A 5EHIA 5BV7A 1EEHA 1JBKA 4H3HB 2I2XB 2BPOA 4OQZA 5CW1A 2NZYA 3JSXA 4DLSA 1EUDB 2RAPA 4P22A 3OCJA 4L7VA 3PC8A 3OF5A 3RAJA 2JI7A 2NQ2C 4GOJA 1IBMB 1LK0A 4WLEA 1Q7RA 1KJ9A 3KWJA 4XUDA 2P4SA 2WRZA 3KDPA 4FXPA 4LC0A 4PU0A 1L5HA 4E94A 5B6PA 1POXA 3K9QO 3OOYA 1NV9A 4GRDA 2KBFA 3A3PA 2A9QA 1FLDA 3FZYA 1T2AA 2GHRA 5IXJA 3O8OB 1FXWF 2I4NA 3LFUA 3G8CA 5A6SA 2P67A 2R4TA 4HNSA 3SXJA 3OAAA 1QUFA 5ALJA 4ARSA 5A6VA 5BQFA 1ZJZA 4R2KA 5EQDA 3K0BA 2CVPA 3K96A 1UEIA 4A03A 4URZR 2PJZA 3BH0A 4NYJQ 1DXQA 4HN2A 1AKWA 1L3CA 3A6JA 4XM1A 3IC5A 2F2TA 5L3QB 5AM0A 1A9QA 5CM8B 2GDJA 1U7HA 2XQJA 4Q37A 4TN5A 3M2TA 4K0RA 5DCYA 3INYA 3O9VA 2A0YA 4E5UA 5BUSA 1R6VA 1WV1A 1Y4UA 2H1VA 4EENA 4ZIRB 1KHHA 1QO0D 1WMBA 4GMXA 3F2IA 2P40A 3K6SB 2BGMA 5HNKA 2CJWA 4FX5A 1JFVA 2VYND 3H9JA 3VFDA 2B7BA 2ODPA 4AJLA 4OJQA 3WGJA 1UM8A 2O52A 4F8YA 1IZYA 5LP6A 3FYUA 2VT7A 3GEGA 4MQMA 3UOGA 5AOBA 1YQUA 5DGIA 1FTYA 3I30X 4K9QA 5IC5A 5HBGA 1TCVA 3CJTA 5HP4A 1EFRA 5IAOA 1ONNA 1UWLA 3HKEB 1K08A 2DHEA 4BZWA 2B37A 3HU1A 3QVSA 5EZQA 4G5SA 5HR5A 3SWWA 3Q7IA 1O4WA 2X42A 3F4KA 3KJGA 2GI4A 4RJLA 3TLGA 5AIAA 2X0JA 4QXPA 2UYHA 3CEHA 2VF7A 5J4KA 1EWTA 1N0IA 3GVIA 1OH5A 1TYBE 1CRPA 4NZMA 4DIBA 3PXEA 4P0PB 3LQ4A 4AQDA 3T1HB 1GCIA 4UVHA 5EPEA 4YUYA 1ZSVA 4B31A 2APJA 3DDOA 1NY5A 2BP7B 4HDSA 4HF7A 4QDZA 4R98A 4X85A 1RQXA 4BGUA 2JGRA 1BWQA 1K2VN 3UKDA 1MORA 4RMGA 5BN4A 4EG4A 2YFQA 3CRZA 5HQJA 1U0TA 3J81A 5EQTA 3SXUA 4QPZA 1LLUA 2NXEA 3K0AA 4KKXB 5B3LA 3OZXA 4B76A 4ZQEA 4Y9SA 1S02A 1UP6A 3EGWA 1HE5A 3UHOA 1ZO8A 3LVRE 4W7IA 3IAS1 2XZLA 4R3WA 4PXYA 5I8ZA 4EHNA 4F3RA 4UFPA 5ADVA 1Y1LA 2RHMA 2OKCA 1JIVA 2AGVA 4ETIA 1PQ4A 1VJTA 4JHXA 4GKKB 2PL1A 1BD3A 1D8TA 2Z04A 3QJYA 4YRTA 2NVOA 2QE7D 2XD4A 3SQXA 3VVBA 1R8SA 1U9IA 5ESXA 1RW4A 2AI1A 4JBGA 5CIQA 5CA0F 1Y0BA 5CXXA 2FWJA 3IDSA 4OEHA 4WOBA 4ZCPA 2QP9X 3HB4X 3NHYA 2FGKA 3AH8A 4XD7D 1YS1X 4DMRA 4F8EA 4BLSA 3FKQA 3R8FA 3WVNA 4KNYA 5GY7A 3MAGA 3FPJA 5KDLA 3B1VA 1T8RA 3DA8A 2VH2A 3ZE9A 1GKLA 13PKA 4LZAA 3OF3A 2Q5FA 3DFUA 1F51E 2IYOA 3G6KA 3I01M 3IGFA 4CRWB 5CA0B 5KZMB 3DLBA 5BWCA 1JDBB 2WYUA 4JA2A 3VOTA 1TMYA 1A5SB 2AK2A 4F5WA 1Q0HA 4L7QA 1OTYA 5H7XA 3G0OA 1JNXX 3MT0A 3RBZA 4WCVA 1I94B 1M74A 1JVNA 3RTDA 2KBEA 2PKQP 4RLSA 2YZNA 1KMMA 2Y99A 2Z2ZA 2VSFA 4E14A 5KYWB 3NHSA 2FPKA 4QWWA 4UBJA 1AMNA 2R84A 5DN6A 1C7EA 2JGAA 3CX7A 3U7QA 2X2FA 4YY3B 2CLOB 2H7CA 3HCWA 3JQBA 1OV6A 4F96A 4FMDF 2PSEA 5KJCA 4BY9E 1T2EA 3LXRA 3L02A 4UDNA 4C2UA 4GO1A 5CYFA 1EA5A 4KXLA 3KEOA 5LZ2A 3AQ4A 5LP6B 3D6NB 1L8OA 1NQVA 3WYBA 4KP7A 2BEWA 3LRPA 1FDWA 2X8AA 3D3WB 3LCJA 4PEVA 1MQSA 1CEYA 1JEOA 1SJ9A 2RJOA 5A9TA 3M89A 1XRJA 4C3VA 1X1AA 1KJIA 3JQFA 3IAFA 3LW7A 1WVMA 2EIXA 4F11A 1JXOA 4KLAA 4AKHA 3FTEA 2PFKA 4HNAB 1JXAA 4LIPD 1U04A 3JQ8A 4RHTA 5K0JA 4AULA 1JQDA 2Z83A 3CZPA 3EGOA 4YRJA 5IZ4A 2C31A 4X3PA 3NUQA 4Z3DA 3TE7A 3USES 4TZKA 2QTFA 1P60A 3QLVC 3IELA 5KTKA 5F5XA 1DQZA 2FFAA 4BCBA 1FTGA 2FEKA 4BGIA 5A5VA 2XUHA 4XWWA 2GXAA 2YDXA 4GECA 3C3MA 5AVQA 5B2ZA 2P9EA 2RK6A 1FSZA 1PHRA 2EJCA 5EWMA 4MYHA 5KTMA 5EHQA 5IAGA 5TQVA 3TRDA 1RWBA 1YB2A 3H4TA 3U5ZB 1I6LA 1KYTA 5G2OA 1DG3A 1KQGA 1GUFA 1EI9A 2GS9A 4HDCA 2CMDA 4MB0A 1JZSA 2ZIXA 4F56A 3GG2A 5CH5A 3EOBI 1L4GA 5IJ9A 1LK5A 3PXGA 4BGEA 1R64A 3ZXSA 4MZDA 4TYWA 1ICEA 1SBNE 3VYSB 1DJNA 1Z3IX 1M2NA 4L4RA 3I72A 3BCRA 2CMKA 3S2YA 4C7OB 1FK8A 1K75A 2NO9A 2VPWA 4BNVA 1XTTA 1KH1A 2G9ZA 2HPVA 2ZIUB 5CYGA 2V7BA 2KS6A 2JLQA 4HDOB 1BE6A 1K92A 4IYRA 4LJ5A 4QU0A 2GKSA 4KXNA 3ZWNA 1PNQA 3CC8A 3WO0A 1XMOB 1U8TA 2F3QA 2NV2B 1XNQB 1N2JA 4DDMA 2VP0A 2WQ7A 4H7DA 4KXXA 4D9JA 3I05A 3WV5A 1BYUA 3QLTA 1J0XO 1F2DA 1F6DA 1MOPA 2BELA 1TYCA 2I7XA 3F3MA 3TVDA 3ZUPA 4K6FA 2RDMA 3OBBA 1X94A 1DKLA 2LPMA 3M34A 3U3XA 4HAZA 2ZRQA 3TOCA 1DINA 1JMYA 2XUZA 1HYGA 2XRZA 3H17A 2X22A 3WGZA 4PPFA 4BB9A 5TPZD 2XMCA 4DQKA 1XCLA 4WZ6A 5H8WA 1M8FA 3O0TA 4ZREA 1QIKA 1PTJC 2Q6IA 2XKBA 3C24A 5KPJA 5CXUA 4OGLA 1TVKB 3HCAA 1J9EA 4M1OA 4TMTA 1D5CA 5ILGA 2EOAA 3ZN2A 1P1FA 3TKLA 3MWFA 2B4QA 2FVYA 1C4WA 1VG0B 3LKZA 4FBMA 4I55A 3W5VA 4A73A 4ER6A 5A9RA 1PV2A 5EYPB 1XTUA 3OMXA 4XXHA 2UYCA 3AP1A 3I9LA 3LC2O 4GICA 1SKMA 2I3AA 2J7PA 1E89A 1M0TA 1WAMA 1USUA 1UPXA 2ISCA 5IBCA 1WKVA 4D3SA 3WK9A 3G8AA 3WRWA 1T1GA 1WQ3A 2HQRA 1NVUQ 3ENKA 1A98A 2XTZA 3FX2A 2G0AA 1EK2A 1YS9A 1PF7E 2ZYHA 3L8ZA 3PHCA 4WVLA 4JUFA 1SKUA 5ALOA 1T8WA 3QPUA 4MWZA 3SSAA 1JPJA 1VPWA 2RHGB 3A7EA 1QYDA 1NF3A 3CLSC 5IC4A 5EJAA 1F2UA 1N33B 4CMEC 2JFOA 3ORQA 1JDJA 3AY0A 3UMGA 4FB4A 5KSZA 5KYUB 2RCYA 2QD2A 4G9EA 2DKOA 2F1KA 3UFXB 3HN2A 4IFIA 4D5GA 1J20A 2GCOA 2V6MA 4CQNA 1G16A 2R47A 2Y68A 4F92B 3EGCA 1S4MA 5IRCD 5NLLA 1XD8A 4I9FA 1Q15A 3ROZA 2OBFA 3O95A 4LJLA 4DPKA 3CR3C 3TOZA 1QFYA 3LKBA 4MR9B 4AP6A 4R01A 4PZCA 2PUDA 1RJDA 1RQGA 3KUCA 4MW7A 4EO7A 3NJ4A 1X0XA 4LA4A 2Y6UA 5DRTA 1Z6GA 2V5AA 5H3HA 1XDDA 2YX1A 1FNNA 1M1YE 2OCIA 4DA7A 1LB1B 1F1JA 4FFBA 5I7FA 4ENWA 1FNDA 1RLUA 3RW9A 2JJYA 4KZPA 2M32A 4WFJA 3ZJ5A 3R3WA 5GINE 4AP9A 5AO9A 1E1DA 2J3MA 3EZLA 2O3TA 4KYVA 1H0SA 1NI4A 4PYNA 1XZDA 3BWBA 4FX2A 1FYXA 1UPCA 3K6RA 4CG0A 1K2WA 1TLFA 1O2DA 4QRIA 1DX9A 3K8YA 4ACBA 1DQSA 2PJDA 3G9XA 5IVIA 3CRVA 2FMUA 2QN7A 1OGJA 1L4YA 5FYDA 5HKKA 1MQAA 5FWYA 3L43A 4HWPA 1JB9A 3ZQKA 9LDTA 4NX2A 1XNHA 5ARCA 3U31A 2IS4A 2C5HA 2OLEA 1KI7A 2JCXA 1Y5RA 3E3MA 4LTDA 1UADA 4DL9A 3SK0A 1HORA 1MNQA 3TWOA 1IB0A 2L69A 2OV4A 1VG1A 3H5VA 3RC8A 1P9RA 2HRCA 2BJVA 4D0RA 3IV9A 1RCFA 2Z2KA 3GD5A 5AVYA 1YVPA 1B8OA 1X7DA 1N5RA 2BFFB 3H5AA 3KHUA 4NZ9A 1ODTC 4CNQA 4E11A 2QRUA 4M86A 3C3DA 1YBAA 1KU6A 1AUQA 4D92A 1L1FA 1P81A 2QTTA 2OL4A 5THXA 5A5EA 1X92A 2HLDA 2OECA 1OLUB 2WU0A 3JVIA 3NNDA 4OHZA 3NEJA 4UM9D 1LH0A 4ISCA 2J33A 1P7PA 1XAIA 3DOCA 3FZNA 4OI4A 5CA0A 4ND4A 4YLEA 2VTVA 3Q10A 5TMDA 4ARUA 3A6PC 4ND1A 1RMTA 3EQ2A 5JNVA 1NMZA 2H1LA 4PYJA 1S2DA 2DWCA 1DAOA 16PKA 1BMTA 2ZULA 4WN3A 3G89A 4GPTA 1YULA 1JMKC 2P6NA 5D3KA 1U9YA 2VLBA 4RGQA 4BUZA 1ZL0A 2VDNB 1GSIA 5CG1A 1QHXA 1NVBA 5JH7F 5K0CA 5KCZA 4IDQA 5FOQA 5JZVA 1XEXA 1E6CA 1SIOA 4ZCMA 5K3BA 5CB4A 3K71B 4FDTA 1VLMA 4GG1A 4H17A 3ROPA 5K7SA 1YE8A 3CYFA 5GPBA 4NQRA 4IP0A 1N34B 3ZLBA 3OMWA 3ZE1B 3OPNA 4NG4A 2PG3A 1U98A 3VNUA 1FX1A 5EE5B 2PBLA 2Q2QA 3A8TA 3KTAA 1NYQA 1Z8DA 1SPBS 3KBOA 1CD5A 1FDUA 3V3TA 3L7DA 3VPHA 1RI2A 4RTRA 1UK9A 2GK3A 1UBNA 1AKTA 2HCBA 3OHPA 4AP5A 2IC5A 4DY4A 4W7HA 1SXIA 5L6MB 2P68A 3H9CA 4AJNA 2R6FA 3UUFA 5IN4A 4QM7A 1NJ5A 2EW1A 1ORHA 4QTUB 2AJLI 3TD6A 4KI0A 4FTWA 4B3SB 3DDSA 1RWNA 1E8NA 3A6GA 1NVVR 4RA6B 3FLEA 5HS6A 5KAMA 5IT5A 1TUEA 4K26A 2H4HA 4M76B 1G5TA 2G6BA 1PHPA 3ND8A 3MT7A 2CLFB 2G9RA 3K7EA 4EUFA 2G4CA 2Y92A 2VAVA 3OWXA 1LJ8A 1W2GA 2WR8A 3WXBA 1TEZA 4I19A 2AW5A 4BXOA 4C20A 2FSVC 1Q1AA 1R9GA 1ZUIA 2J32A 2OZPA 1THTA 3QF4A 4LZWA 5LQNA 5LLSA 5CEFA 1J09A 5F51A 5CGQB 3LLCA 5AVVA 3EMVA 3V4RA 3CR8A 1H1TA 3CVOA 1PJCA 3TS1A 4FOLA 3F5MA 4V24A 1F06A 1CR0A 2ZJBA 1DBRA 4LGVA 1DC7A 5AKLA 1RYDA 3RSZA 4RDHA 5C53B 1CLUA 2A7QA 1PR1A 2RHTA 3S55A 4XQ0A 3X2SA 4KXMA 2W2OA 3Q3IA 1S8AA 2Q8QA 4OQXA 2D8AA 3W5AA 1MT3A 2OGZA 3ESRA 2IDMA 3OKPA 3UPUA 1ZRSA 4HZGA 3ZJYA 3BZUA 4IDEA 3ZVRA 2W58A 4AY5A 2VPYA 3JQAA 4Y1GA 1E5DA 5FL3A 4AN4A 1SXJA 2VXYA 3SI7A 4FC7A 2DVMA 2W6JD 2XNJA 3LT4A 4C3OB 2QZJA 5BPHA 1Z4QA 2JGIA 1X86B 3I2JA 2IHVA 4RADA 4HFNA 5KYUA 5TVKA 1QE3A 1R6BX 4MPJA 1PJZA 1FSSA 4B7AA 1OKKD 5EFOA 1PT5A 4Z8XA 3BEOA 3NHKA 3QW2A 5FTNA 2Q50A 121PA 1BWRA 4BJ5A 2IZ7A 4DM3A 1KTVA 5K4GA 3IP3A 1T1JA 4HL6A 3ST7A 4UPEA 4OHYA 3O8NA 2WHQA 1H42A 1JR2A 3MRXA 1QNLA 4IWNA 2NUPB 3AG6A 2ERYA 1U8UA 3SX4A 5LVAA 1BWPA 3HA7A 2AFVA 4YCLA 3KQHA 1DAKA 3CISA 3H4IA 3KQUA 1MW8X 2G72A 5BSFA 1ENOA 5CDFA 3AILA 2M6RA 1C7QA 2RG1A 1XPUA 2BM1A 3O94A 5K99A 1ZI6A 4J1TA 3RUEA 2QV7A 3KS9A 4EZIA 5JR3A 3KETA 2RGEA 4ZAYA 3GEDA 1JG3A 2C8KA 5DNVA 4QYXA 1AQLA 4TKUA 1Z5VA 1PFVA 1RQNA 3HXTA 1WXGA 2P77A 3LP5A 5LYJB 2XYHA 1JR3E 3W4IA 1D0SA 4FMBB 1OH7A 2PGDA 3B20A 5KNBD 2O2JA 2X15A 3ZWBA 4DY6A 2XT6A 3DUFA 2XR1A 3ZWWA 1C9YA 3EGIA 4CIXA 5DNDA 4KE6A 3C85A 4BEWA 2BMWA 2BGRA 3I09A 1AN0A 2HPAA 1JKFA 1TOAA 2OWDA 2XNKA 3Q9LA 4AWAA 5BXQC 2CLMB 4YROA 3W1WA 4XVCA 4LKRA 5IAJA 2X5NA 5E0OA 3A9UA 3GY0A 5I9BA 4C7JA 5CFRA 2XUFA 3TB4A 2IGBA 2QN1A 1K7FB 1O9BA 4U6NA 5EEHA 5DX8A 3B48A 3GLRA 2ID8A 2D0DA 1P2FA 1OXXK 2GCNA 2E37A 4G81A 4UEKA 1Y37A 4CG2A 5K8UA 3ZDAA 1Y8RB 2VJLA 3EK2A 1NWCA 2XYRA 3KPJA 3RSHA 1UOOA 5J43A 4BX0A 2EX4A 4PF1A 4NC9A 2YXPX 3GZ4A 2IZ0A 5DCUA 3GFPA 3KZOA 1ZI8A 3GXOA 4Q3OA 5CGZA 1DELA 1VA4A 4MIOA 3F46A 4NESA 4NZPA 1UP7A 2CXUA 4QJBA 1AS2A 4RD0A 3C3XA 3RGGA 1BJKA 2FRXA 3LTNC 3UIEA 1SKYB 2JAOA 3KXPA 4BNKA 2VWGA 4DSOA 2IL1A 5B55A 2GILA 1O7JA 1C2YA 3A1UA 4YRRA 3ESCA 5A4MS 3E1SA 3GDGA 2UKDA 1I0ZA 4NJMB 3UFBA 2XEXA 2BM0A 4LYGA 5DM60 1GPLA 1IHPA 3HDGA 2G0TA 3DFFA 4HUQB 4LV6A 3SZOA 1UDCA 2ZWPA 3H1BA 5E9JA 3L05A 1MUUA 2E6UX 3IRUA 2HM7A 3WLLA 5JADA 4ZDJA 1FIUA 2ZRGA 3RYCB 1HLDA 3FPEA 4R5HA 2YTZA 3UJ9A 1CY7A 5F7JA 1F20A 3L0BA 4CKYA 5EL0A 4FYWA 2FCAA 1SHTX 5ISMA 2C7OA 3JQGB 1PIWA 3N2LA 4O33A 3LLVA 5AKZA 2HRQA 4NZYA 2OOKA 4L95C 3RLFA 3TJRA 3ZWKA 3CCBA 4E15A 1LC0A 3TTYA 1OQAA 4RK7A 1KJJA 1V16A 5ICFA 4QYSA 1HMPA 4CCSA 3T5PA 4CLOB 4CVNA 3PNPA 3ZUGA 3NTUA 2G08A 3PC3A 3R5SA 2QAIA 1X87A 3TX2A 1G60A 1GUZA 4KMOA 5KNCA 1ZQ9A 1B8VA 5D51S 3RODA 2NTVA 1E1MA 3WDSA 1LS6A 3A1FA 3TUJC 1PR3A 4TLCA 4OBBA 3OQBA 1FNBA 3D6AA 3MTGA 3R0VA 5F35A 3T34A 1ESDA 1ZLXA 2F43B 4DJEC 1G38A 1ONBA 2VA9A 4B3RB 2AJCA 3OE7A 5EKTA 5IJ0A 4G5XA 1CEEA 4MVJP 2BSAA 2OHHA 2XQIA 2VWHA 1YS2X 3W2GA 4H1WA 5IKXA 3VNRA 3JQ7B 2QLJA 3B85A 4YT8A 5T64A 3RO7A 1ZHHA 1P6QA 2ON6A 2G7MC 1Y5LA 2XEDA 4H1VA 1P1IA 4CKEA 3KYDA 1CYDA 1RAHA 4NDZA 1V41E 2D1FA 4HH0A 1XZGA 2AC7A 2JAPA 3T41A 3UV6A 2OZEA 4EI9A 3BQ9A 3VHRA 1WA5A 1NR1A 4QBFA 1BRTA 4BO4A 5TB5A 4CODB 3AO0B 1G3IA 1LBIA 3FJ1A 2BI8A 1J5EB 4CDMA 2CFOA 4DQVA 3V8NA 2AFHE 4RV9A 3FB4A 3UO8B 2Q5EA 1MEOA 3V4PB 3T3DA 4IXNA 1HQYE 4RD1A 3SZ3A 3N74A 4QD3A 5LWHA 1A50B 1CUCA 4QA9A 5F7XA 3BAFA 4MKRA 4BIMA 4P34A 5EMHA 1T2VA 4DCJA 2QRZA 2V7XA 4BL5A 3PNSA 4RKEA 3OA0A 3I76A 2H2WA 5EMMA 2NSYA 2ORIA 3IV7A 3OZIA 1NA5A 1WOYA 3EZYA 4GZMA 3FTQA 3GUUA 3O2NA 3Q11A 2LXNA 4EFMA 3PWZA 4HAYA 1P1CA 2C9CA 2E82A 5KNBH 2PA0A 1HE8B 2AEFA 1FP7A 1ZK4A 1PG2A 3GJ3A 2PLWA 5KYYA 4ZAFA 3STWA 2CUNA 3GNQA 3S1SA 3QUCA 1N2SA 5AYVA 4KXVA 1QLWA 5DGTA 4MVJA 4EB6B 5DI3B 4BVFA 4YCSA 1RWPA 1Y82A 4C1BA 5CT5A 1RZVA 4KPEC 1GT91 1BOFA 4YV2A 4H77A 5DGXA 1W0JD 2QPOA 4AMVA 1JKJA 1VIMA 1J22A 1QHNA 3RSCA 4AJOA 4DUYB 2HMAA 4DMMA 1YWGO 1KDOA 1OFIA 4V0NA 4MQ6A 4P7BA 5BSKA 2CYCA 1W0KD 4PS1A 4ZT2A 1H69A 4JNCA 3BFJA 5HM6A 3TLGB 3I1JA 4KB5A 1U3UA 2Z8ZA 4WKBA 3T9CA 2KI5A 3PA6A 4X8HA 1N5LA 4C3UA 4EGJA 2EU8A 2QU7A 3AWDA 3AI3A 4TV9A 2HXGA 5KJ6A 3C1UA 3N3BC 3KTOA 4L3VA 3ZJVA 2ECFA 3DE1X 3Q72A 4LPSA 1FFXB 1YQWA 2YWGA 1F8UA 1RXYA 3OC6A 2WB4A 1PQPA 1M2VA 1ICIA 3ZGXA 4R68A 2W9XA 4O2AF 1OTHA 2XD9A 4ZMBA 3PLNA 2HSZA 1WTAA 5AVRA 3RS8A 1O0BA 2OXRA 1E5TA 3JYHA 3NHBA 4YACA 2CDBA 1VRVA 4J3NA 4R2HA 2HRZA 4QBIA 1SBZA 2WIKA 2VP9A 1ZGZA 3OZ7A 4F21A 5A7HA 2QSZA 1PSZA 1H2WA 3U7GA 4R8MA 4GXNA 4IHJF 3Q2KA 2PSSA 1LA2A 1FNMA 3F5FA 3L6UA 1P6UA 5FFMA 3U4MA 3WGVA 4OL9A 1UMCA 4GUAA 2Y71A 3ZGVA 4MHOA 3ROFA 2VKQA 1TA9A 3L8EA 3KTDA 5BYJA 5C8YF 1X15A 2PRKA 3UBTA 3N0RA 1XCGB 1EBUA 3EARA 2JBWA 3GIWA 4LOJA 4DV7B 1QIDA 3G82C 4Z0NA 4DM4A 1A8SA 1JG4A 3PXAA 2AD1A 1SXJE 4FW9A 4Q4JB 2POQX 1J25A 1Z6AA 2BFPA 1E2DA 3CWZA 4K9SA 2CD9A 4IO0A 3B36A 3JCZA 4PCVA 1X8LA 4KSCA 5L7YA 3MYYA 4JLSA 1SD2A 3D7MA 4D4MA 4RIGA 4URWR 1A04A 3QJGA 3OJOA 4XW2A 4TKZA 3ZXYA 3GEEA 1Q91A 3OZUA 2PSDA 3C87A 2IPMA 5C5CA 2EG5A 1N2IA 1JI0A 1II0A 5B7NA 2Z2IA 4DV3B 1D9XA 1WW8A 2X4LA 4C06A 2QE6A 2D54A 4AMBA 8OHMA 3WMGA 1E5QA 1EFCA 2GN2A 4B9AA 1E1RA 1RWKA 4C5AA 1A27A 4XWTA 4DVGA 1Q6YA 1WUJS 7MHTA 2DFDA 4QBKA 1IXKA 2GBLA 2H0AA 2Q5HA 1J39A 3EFOB 3FH0A 3NGMA 4I6GA 4K9OA 3BKXA 2NV6A 1O5IA 1XTIA 2PZGA 3MTBA 3QFRA 4OM8A 5E1DA 1W35A 4YMHA 4X00A 2PJUA 2OHJA 1XKTA 1TJ5A 3LWNA 4GMGA 4MV7A 1C3LA 4JYCA 2QM3A 3NC4A 1YB7A 3EQZA 1J2RA 3WSTA 3IFSA 1ZK1A 4BTVA 2HEGA 2NTNA 2BUCA 3WWPA 1QFXA 1Q3TA 3LOPA 1KHTA 4GR5A 3ZTTA 2RB5A 3VO2A 4IJ6A 4NXMB 2H2AA 1F2VA 3EBOA 4G89A 4DGQA 2NXCA 2PH1A 3BFPA 4DA9A 1JIXA 4HEA6 1TB4A 1G6HA 1UDAA 2G5PA 2Z5GA 4NOKA 4RA9A 2XHZA 3D3EA 4QXMA 4UHCA 3JD0A 6PFKA 2FUCA 3LP8A 3UAXA 1K5PA 2JBHA 3C4VA 4MUBA 4B3CA 3H3JA 2DFVA 5EE0A 1QGAA 4PZ9A 1V1JA 1JYFA 2GEFA 1T36A 2MSNA 421PA 5B5SA 1VJ1A 2OCGA 4ZO4A 2PIDA 4YRKA 1VC2A 4HR7A 4ZRNA 3PCTA 4KAJA 4ND6A 4UZFA 2XY4A 4JP5A 5FF9A 3ZW9A 3BB4A 1X7YB 1O87A 1E3DA 3G17A 4MYUA 3ZLUA 3GRAA 3IKMB 3PR3A 1BDHA 5ERYA 2ZBPA 3D4OA 4J4HA 4YP5A 1YC2A 3WBJA 5JD6A 2CVFA 3CZMA 3FOCA 1EFRD 4JU8A 4LMBA 1J70A 4J1TC 4NYMQ 5K8CA 4DV1B 5LL6P 1FOEB 4XPIB 4R7ZA 4RVUA 1RXUA 2B7LA 2QX7A 3KJNA 2JI4A 4G5YA 4EY3A 4LF5B 5AI8A 3LQFA 1XELA 2IP4A 2P9YA 3DE3X 3T3PB 4LVCA 3VDRA 1Y1SA 3QXJA 1PNRA 3GHHA 1WF6A 4YX9A 1T2CA 3KSZO 3NVAA 3PNOA 1SXJB 4U1RA 1GZVA 4BMOB 3H8SA 3ZU3A 2EFEB 1U7ZA 4IIFA 3RYIB 2NWQA 3RRZA 4MI3A 3RVSA 5IK2D 1B42A 2AG1A 1M1YA 1JTEA 3DEYX 1HSOA 3FCEA 3INRA 4BVHA 4DPLA 4FEAA 1E4OA 1QTRA 2Z09A 1PFUA 4Q4LA 3FI0A 1QE0A 3C3AA 1GL7A 4RHYA 4N7RA 5D3QA 2FR8C 1HE2A 2W43A 1W1UA 3IMFA 3LFTA 5T4FA 2HSWA 4BO1A 4R9UC 2FSUA 1CP3A 2F8LA 3HCBA 2BRUA 2QBYB 4RPHA 2QYSA 2FSFA 3R0QA 4DREA 1GKKA 1SCUB 4QATA 2GHTA 4LYYA 4WK4B 3L4EA 5ALYA 4ARCA 2F3PA 3F8SA 3QM1A 2C03A 4PAWA 2YRXA 3DD5A 5B4VA 5DK4A 3NBQA 1ZR2A 1PBNA 1TC1A 3AJDA 4PYIA 2ZI9A 4HNUA 3G1UA 1HT3A 2ZM6B 3LD9A 4J29A 3PX7A 4H0CA 4JB8A 1P9NA 3RUPA 5BUQA 4DRXA 2VJYA 5MGBA 1TUBB 4MWCA 4LWPA 4C7OA 3MTQA 3EUFA 4Z51A 4EB0A 5ECYA 5KINB 1J23A 2GZHA 4G86A 4X20B 2GEDA 4YDRA 4WNAA 1A1VA 2ZIAA 1GGFA 3D1VA 3TTUA 1J0CA 1ZM9A 2CLEB 3E70C 2OORA 2CHFA 1FFXA 1UJ6A 2XOEA 3FTNA 4MROA 5CURA 1YS6A 3LL7A 1FMCA 1QQ5A 3QXGA 1W7AA 2QJTA 4RZSA 3NW9A 1XZNA 4D02A 3IA2A 1ZHFA 3QVWA 3TKAA 1NNSA 2IYLD 5AM1A 1E4YA 1XNGA 3HCDA 4LBZA 1HZZA 5A7FA 2ODBA 4RTQA 3WBKA 4HN4B 5KEIA 1JHUA 3KWMA 2HBQA 2QTLA 3R2JA 5KVVA 4A8PA 3E22A 5BYAA 5G1OA 1DIGA 4PGFA 3UY4A 3ERCA 3C8HA 4AZ0B