1VCHA

Crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
168
Chain Sequence
ETYPITVGGVTRHVPLIEPLPGRRIPLVEFLGDPEFTRAAAEALRPLVPKEAEILFTTETSPIPLTHVLAEALGLPYVVARRRRRPYMEDPIIQEVQTEVLWLDRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVFRQGTPGLAVDTVAELPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Phosphoribosyltransferase-related protein
total genus 48
structure length 168
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vchA00
1NONA 1MZVA 4IJQA 4P84A 1VSTA 1DKUA 1A4XA 1ECBA 4MB6A 4RHUA 1I14A 1A95A 1I13A 2XBUA 4RANA 1I5EA 4P81A 5HKLA 1HMPA 4WMLA 5BSKA 1VDMA 2FXVA 1G9TA 3MJDA 1G2QA 4F8EA 1UPFA 1IBSA 4RV4A 3DEZA 1QK5A 2H06A 4LYYA 2E55A 1BD3A 2JI4A 2DY0A 3EFHA 4JITA 3H83A 4RHTA 1R3UA 5IAOA 2EHJA 5ESWA 1V9SA 4QYIB 1OROA 1O57A 1I0IA 4QRIA 1VCHA 4PFQA 4RABA 4P80A 4PAWA 3M3HA 1L1QA 1ECCA 1NULA 4JLSA 1XZ8A 3GGJA 4RADA 5E38A 5K51A 1FSGA 2PRYA 4ZFNA 2H07A 3NAGA 1ECGA 3S5JA 1UPUA 5IPFA 5BQOA 2PRZA 1ZN9A 3HVUA 3OHPA 4RAQA 1QK3A 4RQAA 5ESXA 1A3CA 2AEEA 1DKRA 4M0PA 1QCCA 3KB8A 3DMPA 1OPRA 1U9YA 2JKZA 4Z1OA 3OZGA 1GRVA 1A97A 1U9ZA 1G2PA 4LZAA 3ACCA 4RACA 5JSQA 5BQPA 1ZN8A 1GPH1 1DQNA 4P3KA 4WN3A 1DBRA 1Y0BA 1AO0A 1TC2A 4LZOA 4RHXA 1G9SA 2WNSA 5KAPA 2JBHA 1J7JA 1DQPA 4LYGA 4S2UA 1QCDA 1O5OA 3O7MA 1QK4A 1JLSA 1STOA 4M0KA 4RQBA 3G6WA 3OZFA 1ZN7A 1P19A 1HGXA 2IGBA 1CJBA 3LPNA 4OHCA 2GEBA 1W30A 5JV5A 2YZKA 4FYMA 4RHYA 2VFAA 4RAOA 3GGCA 4P83A 2HCRA 3DAHA 1P17A 1A96A 1ECJA 1XTUA 1YFZA 2C4KA 3LRTA 1BD4A 3MBIA 3N2LA 2H08A 4KN6A 1P18A 1I0LA 1OREA 1A98A 4P86A 4X45A 5BRNA 1XTVA 5EUCA 1D6NA 1UFRA 2PS1A 1TC1A 4X44A 4M0UA 1ECFA 1PZMA 4P82A 1JLRA 3GEPA 4QYIA 5KAMA 2JKYA 1WD5A 1QB7A 1XTTA 3QW4B 1BZYA 1Z7GA 2P1ZA 1P4AA 1L1RA 4LZNA 1QB8A 1XZNA 3ACBA 4TWBA 3ACDA 5HIAA 1LH0A
chains in the Genus database with same CATH superfamily
5F1KA 2E9SA 4MS4A 2VSYA 3PD7A 4AKTA 1OX6A 3MB8A 5JASA 2ZUDA 4Z4IA 5SV2A 4I1VA 1IZYA 1DXOA 3BGIA 3GJ0A 1DO8A 1BXGA 2NSJA 2ZAOA 3ZCPA 2BSXA 5ELMA 1U81A 3PXEA 2VEOA 4BMDA 2VP3A 2OZLB 5LC1A 1E8MA 3DBIA 4K05A 1HSOA 5M3BA 4BYGA 4ETMA 1N75A 3PQEA 1VLJA 3AI2A 4PBRA 3LLSA 1SXJE 2IPAB 4LDAA 4RPLA 5HW0A 2NX2A 1K3UB 2EARA 3R24A 1R16A 2Y93A 4H08A 4J2TA 5JOQA 1L7BA 1B73A 2GZSA 1VE3A 1RW4A 3K1YA 2YINC 5ALRA 1AKVA 1N9GA 2XVYA 4ZGGA 2QX8A 2CV1A 1ZNWA 2QX7A 2IKQA 3AEZA 3OQ6A 2XR1A 3EW7A 1RWVA 3OJLA 2CMFA 3Q7EA 4OIMA 4U63A 1SCDA 2IHUA 4RADA 1IRXA 4GM1A 4M9UA 1I1NA 1AGPA 2HU7A 1FYVA 3TSZA 3VI4B 3WKDA 5DYNA 4C5AA 1M72A 4KNVA 2CWWA 3F6RA 4PQGA 5E6UA 2PSDA 3E27A 4M86A 4FGLA 4G86A 1N4AA 1O6CA 1MMFB 3C6ZA 4FLMA 1EUCB 1PGQA 1TUGA 3BJIC 4FR0A 2FJPA 2R8YA 2Y92A 3MJTA 3SYTA 3BXPA 1TIBA 3DDSA 1BHSA 1Y1QA 3HL0A 2XRFA 4U6NA 5EKXA 4RF5A 3VR3D 3UXHA 1YI0A 2QVXX 2IU6A 3NFYA 1R4AA 4KB5A 3I05A 4FFWA 2VR1A 4TT8A 2RK3A 3CZ4A 4QM6A 3OTHA 1XHFA 2H85A 4NENB 1ZD9A 2YCBA 1Z6ZA 3SDZA 3I2KA 2G83A 2I33A 2O07A 4FE7A 2GA9A 1R6XA 4XX0A 5JEDA 5KTYA 1E6KA 3GY0A 3AM1A 1I1HA 5GQSA 3CRRA 2J5QA 2E4WA 2Z9CA 3NVMB 2BFEA 1VKJA 2DR3A 3D6NB 2AXNA 3GFSA 1J7JA 3GEIA 3E9NA 1CUUA 1SCIA 2HHCA 2Q5QA 1KAMA 4YGYA 4JI4B 3GAMA 1R15A 4IDFA 1JDBC 2JI7A 3V48A 1G1MA 4YCLA 1KH2A 2OSBA 4RGQA 4R1TA 4DCMA 2P0AA 3FGPA 4Y2RA 3T95A 4E46A 3PFHA 4QARA 2FMIA 4LJ6A 4G5RA 1KFBB 3ITDA 4HZUA 1Y3IA 4IS2A 2OORA 1U6KA 4Y9SA 5H9VA 3JR7A 3T5BA 3MCWA 3VKVA 5A4MS 2HD4A 2P9GA 4I55A 4BOYA 3VZDA 5L7WA 1KI6A 2FWMX 3OOEA 2JGNA 1NOKA 5ED4A 3T4XA 1Z4MA 3VZQA 1YA8A 3QPCA 2YMQA 1GILA 3OEED 2ZKLA 4OXKA 2REBA 1PZNA 4WCFB 5JO9A 2UYQA 3A3KA 3W8EA 4MI1A 4JQZA 1O0SA 2PPLA 2WJAA 3GCXA 2GCOB 5I5EA 1WXQA 3FSGA 3G8BA 3H11B 3HV2A 5JLAA 1ANKA 4CCYA 4GRDA 5TQ0A 3ZWNA 1C0PA 1BE6A 1IJKA 2F67A 2I29A 5DULA 3RRFA 5KHOC 3D6JA 3SHQA 3RFXA 3G0GA 3V6MA 3HVRA 2PGJA 3BF7A 2JC3A 1BFUA 1CT9A 1K4KA 1QP0A 1X80A 2GZ2A 1ODLA 1XZPA 1EK1A 1YIDA 2RHJA 3I01A 3QKSA 1KMMA 4L8GA 4RIFA 3VR6H 4BLTA 1MENA 4EARA 3FMIA 3SC6A 2NTYC 2OMKA 3QU5A 3T7RA 4AJ1A 5BP7A 4J76A 2CNNA 3OESA 1Q1QA 1CD5A 1NNLA 1P80A 1X86B 1X1TA 1GZDA 1D2NA 1YHZA 2FHPA 2H1RA 2ZJ7A 4TQUS 2RHDA 2WSBA 3SK0A 3EUAA 2R5FA 3BD7A 2P4UA 1DKMA 1DXQA 2WU8A 3CRNA 4IX1A 1ZI6A 3QITA 3HFJA 4LMRA 4LMBA 5JADA 4KFSA 1BRTA 3KPUA 3NIFB 4F5DA 4HAOA 3PCXA 2AFIA 1VECA 1TEZA 2IV3A 2OLJA 1ICEA 2WSIA 1SIUA 2UXDB 4CT0A 4GZMA 1IN8A 2V3WA 3IVRA 3CF6R 1HWYA 2BFBB 4EUNA 3VDMA 3NHUA 2WF7A 3ZBTA 1MC8A 3RS4A 1W87A 3ILHA 1N3BA 4JIMA 4C2TA 3DXYA 3BMCA 1M7GA 3B1YA 1BXRA 5ESWA 3W79A 5IHPA 4B87A 4FZ5A 4M0FA 1RBMA 4JOCA 4C20A 3NEPX 4PFQA 2KYRA 1E9DA 4RLSA 3SMVA 2VWQA 3E9EA 3E3NA 1D6SA 1DAGA 2XLCA 4BNXA 5GONA 1QWOA 1WCIB 2J4CA 2R44A 1E1CA 3H3JA 3JS5A 4IH9A 2MINB 4LDZA 2CCJA 5FLYA 5PGMA 4X5OA 3L8CA 2C58A 3N0WA 4HRXA 4EY6A 4B6JA 1I01A 1ZAYA 621PA 5HX7A 1XQ6A 2C31A 3REGA 2VJPA 3TJRA 1KEEB 3LO5A 2Y77A 5J4HA 5L40A 3MJFA 2A0WA 1TVCA 4DB4A 3GJ3A 3SYKA 1I4WA 1CRPA 1F6WA 1KNQA 3E7DA 1M74A 1DKRA 1YQEA 2RGWA 4JJIA 3EPRA 4NE9A 3AOEA 4Q3OA 1X1AA 4TOIA 3O4RA 5IEJA 4ZTBA 4JVOA 4XLLA 1BQ3A 4E5UA 2Z04A 5JSQA 5MDHA 4Y67A 4FP9A 3DBRA 3DAYA 3IJPA 2QK4A 1OLUA 4GP9A 1KR2A 1ULBA 1GDHA 1W25A 2IE8A 3K0BA 1XKXA 3A3NA 1XKLA 3OEEA 3PUXA 4YMLA 3S1SA 1JB1A 1WMAA 3R3SA 3QEBZ 4WBNB 3K6RA 3AUFA 1H69A 5AI4A 4PZAA 1SBYA 2WF5A 2FR1A 3IQEA 3AZQA 3N70A 2NYUA 2WUVA 1EGAA 1FTNA 1G5IA 1NOIA 2YZNA 1JIIA 2WM9B 5IZCA 2NYRA 3PC4A 3HKCA 4PGGA 5DHTA 3LPAA 5T4EA 3ZH2A 3T9AA 4LXGA 1LTKA 4HNAB 4UUPA 4BV9A 4C0LA 1U7ZA 4O3MA 4YASA 1VRVA 4D0SA 3LVRE 1GGEA 1AUPA 4GT1A 5DIFA 4CV1A 3LWZA 5JZBA 3BREA 3C3CA 4JLUA 4H7KA 1H4QA 3DHVA 1R6BX 4GXTA 4W8OA 4FXOA 3VX3A 1K5DA 3MIIA 4RY2A 4K5QA 3KT0A 4YRZA 2WUEA 2FF7A 4RGBA 2AYXA 2RGXA 3L1JA 4G1EB 5AHWA 4PHHA 2M6RA 5JRJA 3O4VA 1G8YA 3GRFA 1KC3A 3EGXB 2C77A 2B0JA 5KYYA 2Z5GA 1SC1A 3ESDA 3BF8A 3CIOA 1ETUA 5E6SA 3B3GA 1JDNA 4IDQA 2DP4E 2FW7A 4FE3A 3I32A 2BJVA 1ULUA 1LV8A 2PUHA 2O9JA 3N2GB 1G7RA 1KJNA 5IXJA 4QVIA 3CKLA 2C2KA 4J8PA 1ADFA 2ZTLA 1EXDA 3HMKA 2G72A 1MR3F 4UBNA 3K4QA 4LAFA 2PLFA 4A8JC 2WT4A 3IHTA 4RJKA 2IPOA 4BX3A 3OCYA 1G3MA 1QH8A 3LTNC 5DHRA 2BFWA 3WR5A 1YZ3A 3T41A 3X1MA 5I7UA 1E6EA 4HP8A 3PLAE 1I5EA 3TEJA 1MGOA 4P81A 5CYPA 4DV5B 3TR6A 3WY9A 1E7WA 1JKJA 2CKDA 3NKVA 4L57A 4ZIRA 1W6UA 3DZHA 1KDOA 3DV9A 3H9GA 5AOBA 5EMMA 4COKA 5LLDA 3OE7D 3WGOA 4RK7A 1BD3A 1TJPB 3MWFA 4JKIA 1UZUA 4EUEA 3UA4A 3PSAA 1XUOA 4FBGA 3ZJTA 2VS1A 3G17A 1KMHA 5E9JA 4MGYR 3GYGA 5DM1A 3LXXA 3TUIC 4UM7A 1YAHA 1DTSA 2F1OA 5AM4A 1N5OX 4DNFA 2G0AA 3C45A 3HGMA 5A3VA 3H42B 1NDHA 3T3OA 1NUQA 1S2DA 4EF4A 1KI8A 5A0VA 5CCBA 3U7QA 1P72A 2J3QA 2ZR0A 4BVJA 5HG0A 1LI7A 1GFSA 1W85A 2EDCA 3HUFA 2I80A 1W2WB 4M53A 4CM4B 1UMBA 4BAGA 4BMPB 2XMBA 3HZOA 5KC8A 4BCBA 4KLAA 5H82A 2QUZA 5DTIA 2XTZA 1Z17A 3ZXUB 1YR9A 4E09A 1QIIA 3ESCA 1EWRA 3A05A 2E4ZA 4UUAA 4UVEA 4YJDA 3UWMA 3FOWA 4ZVLA 5TRTA 1Z5VA 4E22A 3IIEA 3QE3A 3I9MA 1G9SA 3L77A 3UOWA 3FYTA 3T5GA 4HYYA 5D8DA 4TL7A 3SM9A 2QDKA 5E1MA 4YVFA 1KDZA 5BUZA 4LC0A 2G1AA 2AGVA 1JNXX 3W3AD 1FFDA 1G8JA 2YWRA 2GJ8A 4JD5A 1AMNA 3B51X 3ELWA 3ZV3A 5KDLA 5HFNA 1MIOA 4TKUB 3FHLA 2JA1A 2JGKA 3OD5A 4E07A 3VA7A 1W4BA 1KYZA 1MOSA 1V16A 3IPYA 4X1YB 3TTXA 4YECA 2WR8A 3MWLA 3O8QB 3ZV7A 5BR4A 4L5BA 1W9MA 1D6MA 1ZWKA 4TKMA 4L02A 4CR6A 1NQAO 1CHDA 2ZITA 3STTA 1OLSB 2D13A 2R4QA 1EI9A 1GRRA 3GELA 1T8SA 3GJSA 2AJTA 2NUBA 1U2SA 1IBMB 1XTVA 3INRA 5FULA 4W6ZA 5EUCA 4G1UC 4HEHA 3U40A 1K75A 1QKJA 2KS6A 1KO5A 2C84A 4UU8A 2WT9A 2YWCA 1H6CA 4EZIA 2IHYA 2XB4A 3QBTA 4PWYA 3QHAA 1XQVA 1DFHA 1S3IA 1A7KA 3FG9A 3L49A 3IFSA 4E70A 4IVQA 1K2WA 2CXQA 3M6WA 1KMCA 2F1KA 3T1NA 5BN4A 2WTAA 4R7GA 3A26A 4KWIA 1W93A 4PQEA 5FUBA 3UUFA 3M2PA 3ZHUA 2Y66A 2FE4A 3C41J 1EX1A 2G9VA 3H2YA 3IOYA 1EVEA 1R7RA 3L43A 3CNOA 2Z3ZA 3G5MA 1Z45A 2F3PA 4FOLA 4PZLA 1T1SA 4BFLA 4QNNA 5DM4A 1XZEA 3ZWMA 1U5AA 3D7RA 2LVBA 3DZFA 2X13A 1XMSA 5JMPA 1UEJA 4IJQA 2WWXA 5EJ2A 5ESRA 2EBUA 3BFJA 1H2ZA 1A4XA 2JKVA 3FN4A 1T8YA 3G5AA 1W9HA 3EXHC 3O9MA 4UUOA 1M0TA 5DBIA 4XOUA 5GGXA 3VJMA 4E30A 4M22A 5CIYA 3HM9A 3IA7A 4NEHB 4QELA 1QZ3A 2O8FB 3SQDA 2H5JA 4HLUA 2OFXA 1TTPB 1U3WA 5DBHX 3TRJA 3UMYA 1JIXA 3ZY3A 1ESCA 1P7WA 3QYPA 4CE6A 4FJ2A 1JAYA 3KUCA 2GZRA 2A9RA 3KIPA 1JFSA 4LOJA 4YALA 1U7PA 4CKCB 2P75A 3H8WA 3MJVA 3AI3A 1HYGA 3DDNA 4R51A 3X1DA 2DWCA 2H7CA 3W5IA 1L7RA 3CO5A 1K4MA 5C34B 2BGRA 5HHTA 4ABTA 1TI7A 2DCMA 4IJMA 2PT5A 2ZM6B 2JG3A 1QTIA 2RHCA 3FPHA 2XECA 5K3DA 1Y6FA 2CDNA 4YUVA 2P4EA 4DOMA 2G9ZA 3C1OA 4NSNA 1FDSA 2BRUA 5FBKA 2D1RA 1TCUA 4GUAA 3HABA 3T1OA 1XOIA 2QRVA 3VR0A 1RBYA 1YIAA 1LBQA 1JS1X 2UZ1A 4R6WA 3VPXA 4YAKA 3K94A 5MF6A 2YNMD 1N78A 3L9XA 3QFCA 1V4VA 1X14A 4DBLE 4S0XA 4Z53A 4MGZR 4ZCMA 1F60A 3ESYA 5K6AC 3EGOA 5JSZB 4X60A 5C52B 1AH2A 1ND6A 3ZWQA 1Q84A 1WZUA 4NMLA 3C3JA 2GRJA 4K2AA 2R5NA 3HYTA 1NUAA 3C16C 1QX3A 5AP9A 1BE8A 1WXWA 5F9HA 3C15C 4JVNA 3AEKB 1W581 3A4MA 3FVQA 3RANA 2C96A 1WABA 4PQRA 3BA1A 4DV7B 1E3TA 4D26A 1I9GA 4WACA 4BUCA 4L5CA 4GP7A 3QV2A 2XE8A 3IEUA 5AKEA 4BS9A 3L6DA 2HO4A 1E9RA 4Q18A 3NHLA 1FRQA 4JCCA 3MW8A 2LIPA 2C4VA 4A92A 1J06A 3ESRA 3ST7A 3ND5A 4PLWA 4RQBA 1TRHA 2IUUA 2YJGA 1P19A 1OW3B 1MB0A 2QU7A 2PM8A 2Q3HA 3KJEA 5EWJA 1SVIA 2BEVA 4X24A 4B75A 1LBHA 1Z0SA 3HU3A 4DE5A 2H57A 2EW8A 1QYVA 4FYMA 4KG7A 1Y1PA 2HM7A 1FE8A 1U7HA 1UDCA 4E4RA 5K2MA 3QLUC 1M6NA 4NDAA 1VGVA 1IJEA 2J5BA 1G8FA 4C0QC 4OLBA 1YHNA 4N5HX 1Q0PA 5EJ8A 4KTTE 4P86A 2ZT7A 5H70A 2JLVA 2FXIA 4GI7A 3IVAA 5CFZA 4JC5A 4ETWA 3DZBA 4PS0A 1U9IC 2WU1A 2QAIA 4OXRA 4RK1A 4B3TB 2J5RA 4EHIA 5FI3A 3MT7A 5C5DA 1TO2E 3JXEA 4URZR 2PBZA 5KVQA 3JVDA 4KQ9A 3RLFA 4ES6A 3ORRA 5CFLA 2FSSA 1OXTA 4JEUA 5JWRA 5LPNA 1YC5A 1CFJA 2PYZA 1AQIA 4QYXA 3T7DA 1AA6A 4OLAA 1XPOA 4MUHA 1V45E 1FDIA 5LJIA 2P1ZA 2HYIC 1C4WA 1LLDA 2F62A 4LRTB 3UEOA 4HS4A 2RGDA 2WQ6A 3V5NA 4IFBA 1K3FA 2MDTA 1LH0A 4J2HA 1E7YA 1Z6TA 2UVPA 5F5XA 2ZIUB 3TE6A 1PW5A 4J29A 4XD7D 4B35A 5LBUA 2XOKD 3L6BA 3ONEA 2ZB2A 5JSFA 2B61A 1IXRC 4BHTA 2HMSA 2WD9A 2PSSA 2QAGC 2O2CA 1XMQB 4KXVA 1B6TA 2O7NA 2Z5LA 4QGBA 3PA6A 3R3XA 4W7SA 3DT6A 2NO9A 4ETIA 5AKLA 1YNSA 4YRJA 4GPTA 1TFRA 2AR7A 2HQOA 1TJYA 3RTDA 4UXHA 5JNUA 3R40A 1HEUA 1JDSA 4EP1A 4TXHA 3KQYA 4B2PA 3G5TA 1TUEA 4DV1B 1YVRA 3CG0A 1XVTA 3LQ4A 2LKCA 5KWVA 2B4RO 2GARA 1CY4A 4BAUA 2IKSA 3C8DA 1GLVA 3FYHA 2PV0A 5IULC 2DTXA 4RKQA 5CHEA 3ZCXA 5BSFA 1DE0A 2QUBA 1JSXA 2R8RA 3UW3A 5LFAA 2O54A 4BJ5A 2AQ8A 2WZBA 2WW8A 3SNHA 3U3OA 4MVYA 2Q8QA 1A50B 1E6CA 4QAJA 3KXDA 2ZUFA 4HEJA 1CF9A 1T1EA 3MSXA 1EZ1A 4N0EA 4MUXA 4R83A 4WW0A 4ZXFA 2WWWA 4QUBA 4Q3KA 2P69A 1F20A 1V3VA 4YRIA 4V03A 1GITA 5DXJA 3WGTA 4RM3A 1YL7A 4DAOA 5EXPA 4EABA 4XFKA 4CF3A 4UTPA 1BYUA 1W4LA 2QTBA 3C8HA 1JI3A 1PTJA 5EJAA 5B58C 2ZXUA 3USZA 1E2QA 2IHVA 1RI5A 3W4IA 1RLMA 2YV3A 3I09A 4JT9A 2G5CA 4PCLA 1SCUB 1E5VA 1JHQA 2I6SA 4DA7A 1UBUS 2VJQA 2ZBDA 3HUDA 4M0KA 4TUYA 1KOLA 4C3UA 4ZAZA 1IBCA 2Q2OA 3UNXA 5JALA 2XWPA 2DG2A 2VRWA 4RPHA 1OWNA 4HXYA 4W7IA 2EP7A 2ZSKA 3RU7A 3E05A 3BA6A 3WAGA 1TM1E 4RAOA 4YAEA 5FO1A 2I4LA 4C4TA 4DHEA 2GBFA 3LVBA 1O5TA 2Z57A 4NYJQ 4Q00A 1GV1A 4R1QA 3UWSA 1EQUA 3QUQA 1VG0B 1TUBB 5DYIA 2WHRA 1UBCA 2ZRJA 4A36A 4YAJA 2UVDA 2FTKE 2HA6A 4ND2A 5A5EA 1NZFA 4IIXA 4KH0A 1OBCA 1BHQ1 2FOXA 4IH4A 3M1AA 3S55A 3K6KA 2OCIA 4N3AA 2DFNA 2IHNA 1H1DA 3E2PA 4JJZA 1H0RA 2GZMA 3IPLA 4XLTA 2VHYA 1H2WA 1WSDA 2HIAA 2ONYA 3ABQB 3UKDA 4A6EA 1JLMA 4D9GA 2D1FA 3A4NA 1CUYA 3F46A 3TFWA 5KAMA 1DSSG 3TM4A 1MF7A 1SVLA 5EE5B 3WIUA 4DLSA 2J0VA 4XGNA 4ZHQB 4RSMA 2BGTA 1XWIA 4F6RA 1H1TA 3D64A 4KVGA 1M2WA 3K5PA 2FJ0A 5B3JC 4X1KA 4BO0A 1T4DA 4ZEWA 3I6BA 1T2CA 3EWAA 3U9LA 2IIQA 3DJFA 3PQ8A 4S2EA 5AD1A 1EZ4A 2JFPA 3SZMA 3QVGB 1DP4A 2WJIA 5AKZA 1H9AA 4AJLA 2C5HA 3HR7A 5LQMA 2CK3A 1NT4A 5EIBD 3U3MA 3PR1A 5TQ2A 3EMVA 1HT2E 1P5FA 1TAQA 2V5AA 3HKBA 3HV0A 4H27A 4LYJA 4QJ5A 3OUUA 2F43A 4N5NA 2GJ9A 3R76A 3V7WA 3VBEA 4FX2A 3MFQA 4UW9A 3JWPA 4EQ6A 3E2MA 4GI5A 4EJSA 4LI3X 4C7VA 1N3YA 4D79A 4DXDA 3ZV6A 4P31A 4JLMA 1FMCA 2FPUA 2GJSA 3NHWA 3IAM1 3BHJA 3VPDA 3NNSA 4RD1A 2SCUB 4BVHA 3S8YA 3CLSD 1G8KA 1Y89A 4UU1A 5DB4A 1X7XB 4ZJZA 2XGOA 3UT5A 1L7NA 3Q1KA 2JLUA 2ZRGA 2AV6A 4YXWD 3G0CA 1GZ5A 1DRUA 1Y3BE 3FIUA 3I73A 1RKUA 4HDQB 3S1AA 4HEQA 5KJFA 5KNDH 2A9QA 1SFRA 1FU4A 1U0TA 4G4SP 2OV2A 1NR1A 2WYOA 2FRVA 3JASA 4BCCA 3ICQB 1D2EA 1JHAA 1U2EA 4Q4AB 5HS6A 1OTYA 1UDBA 1C8VB 2PGNA 5C8YF 5AW4A 1G4AE 1KZYC 1OB2A 4F06A 2IH4A 3TIIA 2CBZA 4ZO4A 3NEAA 3ROKA 2PGAA 3O1HB 1NR5A 5KNCH 3IV9A 3G2NA 5ER9A 1L5KA 3C6XA 1YACA 1OASA 1NVXQ 3AFIA 5J4VA 1TLTA 3IQXA 2EF0A 1CDEA 3SXJA 2A3RA 1UKAA 4NEQA 1O96B 2KSQA 4XJVA 4U7HA 3ZHQA 1CE8A 2CLSA 1QK4A 1RWPA 5CA0B 1QZUA 1YZHA 2SKCA 5C8YB 1BS9A 1YRWA 4CLEA 1PTKA 2G1KA 2I22A 3RYIB 2XF8A 1IAQA 4K8RB 2W6JA 4NRDA 1DX9A 1BXGB 3C6KA 3DVQX 2OBMA 5FPKA 3IMKA 3B5JA 4I2VA 3VVMA 4W5NA 3P7MA 3SFVA 3UN1A 1SC6A 1YC2A 1ZD1A 4WOCA 4BMYA 4KYIB 3JQ7B 2G7MC 2ZYHA 4NCAA 5EJMA 1M1YB 2XRMA 1WS6A 1AZWA 1FX0A 3E1KA 4KHZA 4PSAA 1YQGA 4LZPA 2VK1A 1PHRA 4GECA 4Q1CA 5BNFA 3DHYA 3G8AA 3ZU4A 4HVCA 1AZSC 1TTTA 4CQLA 2D1SA 2FKNA 3MQ2A 1ZNQO 4IG4A 4RZ2A 4BB9A 2HJ9A 3GLIE 2BFBA 1KYXA 2OYCA 2XZPA 3W90A 2R86A 1T9GS 4ZVSA 1MHTA 3N74A 3HBAA 3WGUA 2MTBA 3TRDA 1WDMA 4UQLA 4R16A 2DT5A 2ZANA 2DUJA 3C97A 3LBYA 1I24A 3P4XA 3IVXA 4GPBA 5E6UB 4ZPXA 3V1TC 4OQFA 1S8FA 2C5EA 2YIVX 1C9JA 1U99A 1Z7GA 3ILSA 4ZO6A 5H0IA 4MIEA 3KB1A 5I9MA 1H85A 4F38A 4TTQA 4R8VA 5KDDA 1NNEA 4UUQA 4FZJA 2Y1GA 4X1IB 5H4GA 1XKTA 2IF2A 4G0ZA 4ZGBA 2DPGA 1BCRB 1BWSA 1G6HA 2W98A 3B9RA 5BYBA 4ZK2A 1PJRA 4P84A 4MLPA 4Q0MA 2FDXA 1SCQA 2WWHA 2XE4A 4CMJA 5K05A 1NXTA 3A6ZA 1EK2A 2OBNA 3C5CA 4Y98A 3RYHA 5FWXA 4Z7NB 1RYYA 1YL5A 5D7NA 4TTTS 2FZLA 3CX7A 1YVPA 1XVIA 2QLJA 2X0NA 3CRW1 1GPLA 2VXYA 2JVJA 4DQUA 1VKHA 4ZCSA 3AL2A 2ANCA 3A9RA 3DLAA 1EFTA 1QK5A 3RYFB 1SPBS 2QM0A 3UXMA 4CRWB 1DO0A 1B0PA 3QFHA 4IOLA 2B6HA 2BI7A 5G1NA 4AZTA 4HAYA 4XYGA 3Q9UA 4JI3B 2WU0A 2H4FA 1J0BA 1BKYA 2HCJB 3LT4A 5FLXA 4RABA 4ZARA 3GRVA 3ZKAA 3GGJA 5L9AA 4JC0A 1BH6A 3CSUA 1U63A 1BDIA 3UA3A 1U80A 1HT0A 1U9JA 3DCYA 3ZWKA 1FTGA 3CLVA 3Q6IA 7ADHA 4LTDA 2VPZA 2NO4A 2W8BA 3O2JA 1W7AA 3BM5A 1SAYA 3IUJA 4G01B 1ULAA 2Q3LA 3D0OA 1GKIA 5D86A 4QM7A 1Y8RB 4CG1A 4N82A 3HCEA 5C5IA 3EXG2 2JNWA 3FETA 3ETCA 4RIIA 3D1LA 3BWVA 3M3DA 2Y68A 5BWOA 4EHJA 2I0FA 3CURA 3NT4A 3C8UA 2H54A 2DPLA 2FVXA 2I6TA 5TT0A 4FFBB 4B4WA 3MCUA 4MRMA 3LUBA 5EINA 2HBYA 2Y05A 3THXB 3GQBB 5ALEA 2FP4B 2VOJA 1QHHB 3COYA 1R10A 2QZPA 3MM4A 1IXYA 3JYLA 5L7YA 3L8HA 4DLWA 2LW7A 3QW2A 4MRNA 4MYHA 2WTBA 3G6KA 2XQKA 1FTSA 3LV8A 4P9NA 3I45A 3JQRA 2Q4RA 4I7EA 2Q4BA 2W7TA 1KQFA 4HQOA 5TVKA 3E7PA 4IQ8A 3O8RA 3ZGXA 3SBXA 1T91A 1XHLA 2W0SA 3KKKA 1E5DA 3L4BA 3NTXA 3Q3IA 4PYJA 1TAUA 2G5TA 2R9VA 1H2XA 1YKFA 3B6EA 4DCJA 1MUUA 1IFXA 2HA5A 421PA 3FTQA 2EF1A 3HCDA 1OYVA 3I64A 3DQPA 4G5QA 4RKEA 5DTRA 3U4DA 3RHFA 3T3EA 5IKEA 4FYIA 3GPCA 4UJ3A 1MJ5A 3L1VA 2DFDA 3LUGA 3KTFA 5LMNB 1QG4A 4GQIA 1P2FA 1EGHA 1GARA 3FHOA 1QRTA 2B7LA 2X15A 5IK2A 1S1CA 3ODGA 2QSJA 5JJLA 1T1IA 3DE6X 1Z2DA 1DC8A 2J5XA 1D1SA 1IB6A 3ELUA 4PIMA 4WFIA 5CM9C 2NXEA 1D7OA 5ALOA 4Z49A 1DCTA 4NYIR 3RARA 3QEAZ 1I1QB 5K4HA 3CW8X 5AKGA 3O91A 4BQPA 1ND5A 3SGLA 1L5FA 3G8DA 4G2TA 1DB3A 1SBQA 2B98A 1NVUQ 2CHEA 3FOBA 3SC4A 1AN9A 3CZAA 3WYDA 1P4AA 3TIXB 2G4CA 2ZWAA 3F7OA 4XGKA 2WM3A 3HDVA 1VKOA 1I6LA 4PXSA 5B12A 1SG6A 3CPSA 4DMRA 2V1UA 3KHKA 4R9SA 4DPKA 3N8DA 4FOTA 4GE3A 2QMYA 5B7PA 2PUGA 5F2NA 4WXPA 3BMQA 1UANA 1PEKE 3SYMA 4TRJA 1DKLA 3U44A 1DKUA 4H7HA 4I6JA 4UOZA 3JSAA 1X9IA 1P6UA 3HFRA 3Q2OA 4RJTA 4WV3A 1E62A 4J3JA 1I13A 1VBFA 4QYMA 4W6QA 3WNQA 5MHTA 2C2WA 4AF6A 4WMLA 2BKXA 1DQYA 2BW0A 3DYIA 1J23A 1Y8QB 3NEYA 4B6EA 2Z8XA 5C8VA 3MUNA 1XRLA 2NVBA 1B3BA 3KDAA 1YR6A 2X4GA 1R00A 1QX4A 5BUCA 5ENDA 3QNUA 1IHPA 4GOMD 1MEJA 1QFYA 2B82A 3UJ3X 1Z83A 3G79A 1YS6A 1PJZA 1A5AB 2OCGA 1MAAA 3OQOA 4OA5A 4IYJA 5IYZB 4MAMA 5A3RA 3PIRA 1AKTA 1KORA 1N5IA 3L8DA 4DLPA 4FVTA 3JARA 3EVTA 3F1LA 4K2HA 4RHTA 4YO8A 1RC8A 1D4ZA 5KNDD 4NK4A 5KX5F 2OBXA 2ZE5A 5DRYA 1EUZA 3AHDA 3I9V6 4JYPA 2NO6A 4L9AA 1RACA 2FFRA 3OU7A 4BFVA 2VSOA 2PZBA 4KK4A 4L6CA 2F4VB 1N2HA 2BV3A 5HIKA 1CS0B 2F8SA 2OAQ1 5JNWA 3DMHA 1NQOA 1AS2A 2ZUSA 2FLKA 4FWIB 2KHZA 3E3LA 1PLKA 4KQ1A 2ZPTX 4JFRA 4LRQA 4Y6LA 1E99A 1Z2NX 5J40A 5BQPA 3WGKA 3NAQA 2XHZA 4HDAA 3KS9A 1LLCA 4KFTA 1TYAE 1NFQA 4IZHA 4HDOB 2XAAA 5AVRA 3ITKA 4Q24A 5JECA 2EC5A 2ZAGA 2VNAA 2R6DA 2VTBB 1NBMD 2QUJA 5BSHA 3U3DA 1TU4A 5HF6A 1E3WA 4RZIA 5E2AA 2LCQA 2VATA 2VC2B 4KRYA 2BLLA 1N3IA 4ZA2A 2JLZA 3K0FB 3KTDA 4R0NA 2CXSA 3S2ZA 2XKKA 4RXTA 2A5DA 2YY7A 1E7QA 2YWHA 5K0ZA 1XZDA 3AJEA 2OWEA 3PJFA 4K6OA 3U7RA 4JXZA 1UKVY 4D8YA 3D4OA 4OXXA 3KOYA 1LRLA 2ID4A 4LQCA 1CR0A 4WY2A 3UUGA 1BDHA 3MBIA 4LJAA 2XUZA 1NBIA 4QHSA 4RQUA 2XBMA 1CJTC 3EZ9A 4ESEA 3IVCA 1RJWA 3VM6A 1PI3A 4K1XA 2IXFA 3GNTA 3QPDA 5J1TB 5CEFA 3UYLA 4KP7A 4PYKA 2BHTA 4LFBB 2PN1A 1F3LA 3FVVA 3L7OA 1YD7A 3GD5A 2EGHA 3JQGA 3L84A 4DC0A 4AP5A 4GLOA 1U2DC 4XR9A 4BFCA 1SWWA 3PL1A 2CLIB 3KYJB 3EPKA 2ID7A 3SXUB 3IPXA 3C5EA 2P9FA 4OJMX 3WIVA 2DQ4A 2NIPA 2OV3A 4BNGA 1U7TA 4GWKA 2J9GA 1CERA 2YH2A 3CLKA 4BVKA 4MR8A 2JLSA 2C7VA 1N6PA 2UZ1B 3PF8A 1KTIA 4P4SA 2BGIA 4QFCA 1XNHA 5BVHB 3IALA 1M8JA 1F2DA 2C9OA 4M9XA 4BLUA 5ALIA 4DCSA 4IWXA 4HDNA 4O2BA 4I4TB 3GV0A 1AK2A 3U4GA 3W2HA 4ED9A 5A4DA 2O3RA 2JHFA 5CAEB 3D3WA 4JQOA 1KZHA 1GAQA 2O6HA 3GZNA 3WLPA 2VKQA 2EJTA 2YBDA 2GWRA 3H11A 1JJAA 2FLVA 1UIRA 4HFMA 4RELA 1TIPA 2FETA 4ARCA 1XL0A 1BIFA 1L8XA 4IAOA 5FTWA 3HS3A 4D0GA 1I3KA 4XVUA 1U90A 3LX8A 3K96A 3C3BA 4MKRA 4WLFA 4PSDA 1WQ1R 1HFJA 3VYSB 1LJLA 2KLBA 2NG1A 5IM4A 2BBWA 4YI3A 5K7SA 1PBTA 5D5HA 2B4YA 3H2JA 5A4IS 4QASA 1OXKB 2A9FA 1H5UA 3NI2A 4I5EA 4AN4A 4C6SA 1PFQA 2P0EA 3T52A 4C87A 1HNWB 1KOJA 3IEXA 2F3RA 3Q7SA 3M7IA 4R9RA 5F5NA 2PKQP 3IHWA 1J7KA 2V74B 5BWNA 5K6RA 2PGXA 2ZSHA 5EZ6B 4KXXA 5G4KB 2DBYA 3B7WA 4MQUA 3P4YA 2WIFA 5AW7A 4BNZA 1YAJA 4YH1A 4AJ2A 4B43A 1DFGA 2Q5CA 1EDDA 2MINA 2JI9A 3MJEA 4POAA 5ALYA 1G5PA 3WMEA 2WJWA 3C3AA 3WTBA 3M89A 1TECE 3T3HA 1TC2A 1TQ8A 3RK0A 1UP4A 4G1CA 4UHJA 5LD2B 3AHHA 2Q9AA 3RRMA 3MOGA 1Q77A 1OI7A 1E0KA 5AW2A 2Z09A 1PNTA 2JJ1A 4BQQA 2ZRMA 3HA2A 2HMVA 2WIGA 1OHHD 3I0ZA 4KKVA 4B8ZA 2BE7A 2H1IA 3EGDA 2P5SA 1CZOA 2W37A 2OM2A 3GFTA 3FUUA 1PJBA 3N2KA 5E0KB 1RWWA 4MEJA 5A7GA 5HUHA 1W36C 2ZCJA 2CEKA 1CUEA 4E2WA 2WJYA 4ESOA 1AF7A 4DCOA 2AI1A 1G8PA 2VHEA 1YI1A 5EESA 5DK6A 4B3GA 3MOSA 1SH7A 2WLSA 2QZSA 3MPOA 3MRTA 4RETA 3BIJA 1JEEA 1P1RA 4URVR 4PRLA 1I7QB 1JQDA 2FCAA 2ZTMA 5AHRA 2V98A 3E58A 5AHKA 4YX9A 4NCKA 5C32A 2FN4A 2BMFA 3FRHA 2I7TA 3FW1A 3GEBA 1WHSA 1U2DA 3S7ZA 2WWRA 3IO3A 3ZHSA 1OYYA 1YS1X 5FQOA 4KQXA 4UCFA 3CX4A 4A6XA 1V3UA 4D02A 3SF8B 3ASYA 5L95A 2ZCUA 1KHTA 4EYKA 2Z3VA 3LBAA 4B4DA 3I2GA 1O8BA 3EJ6A 3C85A 2HMUA 3EN0A 4RX1A 1Z6GA 1EJBA 1KJ8A 1MU0A 3ZD6A 2MMGA 4EI9A 3CPHA 1EMDA 1LU9A 4ND4A 5AQ1A 2V65A 5DMXA 4DR6B 2R97A 1OWPA 3T1YB 4WKOA 2QTCA 3UOGA 5J63A 1PEAA 1QCZA 4RSHA 4CNBA 2ID9A 3HYCA 3IRVA 1PV4A 1F51E 4WLNA 1GTZA 3Q6NA 4HH4A 3ZWPA 1PK9A 2A35A 1OXVA 1EINA 1FFCA 1UKCA 4ZALA 5A04A 3AG5A 1F14A 2FR8C 3L7NA 3N6VA 1DTEA 3NP7A 4AJ9A 1DDOA 4E1VA 4R0MA 2NU8B 4I2NA 2XB8A 1CKEA 1G16A 4C3OB 3N2GA 2SICE 2J3DA 5EIEA 4BRUA 4Q1DA 4CYMA 1E4YA 2X8BA 2YXDA 4YJHA 2Z83A 1KJZA 2YV5A 5JCJD 1ZVVA 2A67A 3ISTA 1AB5A 3D4IA 2QGNA 2QROA 3ABSB 1Q91A 1VHLA 4MVWA 3IBSA 4QTTB 4NYJR 4HPXB 1U9IA 4Y0VA 1U31A 3GL9A 1RE0A 2HL6A 4H60A 1IQPA 4YA6A 4N47A 4E2FA 4M9ZA 5DM0A 4XQ0A 3TKLA 3OTOB 2IEIA 2R7LA 4XJSA 2YV1A 4ZRMA 2O2XA 4DMUB 1D0IA 1SOMA 2XJ4A 4F12A 2UVQA 3KTAA 2CYAA 5J2TB 1HE8B 2P7IA 5JO0A 2BGLA 3DWFA 1YUBA 2MOKA 3C6YA 5E6RB 4QU0A 4EY8A 1J90A 1WF6A 221PA 3HBLA 5DCUA 5E2IA 2PS3A 3UK1A 4OOFA 13PKA 3E0XA 3MWEB 3P2YA 2C8KA 3VTAA 4BO5A 2QSZA 1NAIA 2FSFA 2XT6A 4JC4A 5F7JA 4NV1A 4ZPJA 2VF2A 5I7EA 2C7BA 2J1LA 3E53A 3GYBA 1K2VN 1R74A 1FUEA 3GA0A 3QEOA 1ES9A 1V96A 1ZD8A 5I8WA 2DUWA 1JJIA 1R27A 2VSNA 1WPQA 2J46A 3EVGA 5E7MA 1PS8A 3CRZA 4KLRA 4NC9A 3KALA 3WGGA 4BLSA 4DCVA 4B6RA 3STXA 4NMWA 2BR5A 4X9XA 3M6MD 4WADA 1WDTA 1UMBB 2CFCA 5ICMA 1AXGA 4LXHA 2GO7A 1GV0A 3HKEA 3QVWA 2VK4A 3JQFC 1SKUA 1GVNB 3D9QX 2VJAA 3Q7IA 4PN3A 4UQPA 1HZJA 3TZBA 1HPLA 2WAYA 2DRIA 5IAKA 2BGNA 5HTKA 4B7ZA 2B1JA 1UAGA 1XDZA 1XPRA 2WMYA 1M54A 1JEDA 3CO0S 4Z4FA 3K15A 2QI9C 3T0FA 1ISHA 5L3VA 1LBEA 1D2CA 3IJEB 1NAHA 5ARDA 4PINA 1NW6A 3NXSA 3HKDB 3RIHA 1NM5A 5K0GA 2Y4OA 4J3FA 4RJIA 1E2PA 1LBTA 2PL1A 5LQJA 2C9DA 3HQ4O 4LHXA 5DTJA 4F9GA 5C80A 4ZQIA 1GFWA 2AJ8A 1PNVA 1WRBA 4YAIA 2DAPA 4M83A 1D6NA 3KWFA 3TQHA 3COZA 3JATA 1R4NA 2VP2A 2R00A 1ZLYA 2FUCA 2Q6TA 3DCNA 3FNRA 5CBKA 2QYTA 1USUA 1NIPA 1J1IA 1ATZA 2HC9A 1G7CA 4OM8A 2PRJA 1OT3A 1FLAA 4MYDA 3LOPA 1WD5A 3HCNA 5TQ2B 1FMFA 5GY7A 1NHWA 2DWOA 1UJ2A 2J3KA 1KZ9A 3E9DA 2FV8A 3MWKA 1G3UA 2ATXA 1QS0A 1X7XA 3A1VA 4JWKA 4Q3EA 3OMWA 3TJZA 2GLXA 4JB3A 4AFNA 5HRCA 2OV4A 4K9KA 3R5JA 1V8DA 3RBAA 4QICA 4M37A 1K7CA 1Y7IA 3RJ9A 4UBKA 3K9FC 3W34A 3N86A 1T8RA 3GRAA 3W6UA 4LF8B 1K66A 2BTEA 1Q0HA 2BDTA 3WSTA 5EFZA 2GEKA 4XEHA 4XPIA 1VL1A 2VNSA 3ZDFA 3BK7A 4URXR 4L3OA 3PYMA 3L0DA 4D4KA 1T1GA 4QPJC 4P98A 3R0VA 1T3LA 4NDNE 4TZTA 5ALWA 3VZBA 2RI1A 5EGSA 1HC7A 5IEBA 2ACEA 2WFLB 2HH9A 3MJRA 3NUGA 4CMBA 2CHGA 3L1IA 1XAHA 1TMGE 2P9HA 1E5XA 3NHMA 4IM7A 4K9NA 5DP1A 3TNDA 4AN1A 4YV2A 1DRKA 1Z0AA 1QU2A 2L82A 4IINA 1M9NA 4R8RA 2Z9BA 3L6RA 1UP7A 2J3JA 4HDSB 4M8LA 1CU1A 3SJUA 1QFSA 3TLGB 4ALLA 3VNVA 4JMLA 1EA7A 1RXYA 3C3KA 1E7SA 2L18A 4G07A 2K2QB 2Q9UA 3AEQB 1HNXB 2JCVA 4BZWA 3ANSA 4X3OA 3RKSA 3UY4A 3F5DA 2B83A 2Q46A 2YRFA 2A6PA 3NC4A 4QO8A 4AZ0B 2RIPA 4IHJA 4BGUA 3H6GA 4BBPA 4RXMA 2WD8A 2QZ9A 4CV2A 4PZDA 1FYDA 5DH9A 5DX8A 2YFKA 4FQ8A 5THQA 4DDKA 3HCWA 5KWSA 3H99A 1KEPA 1HDYA 1WMDA 2GCIA 1PK7A 1Y8AA 2NU9B 4B6SA 2D74A 5FNVF 5DNDA 4DUGD 3EEIA 2DJIA 5IN4A 1RQ2A 1UF9A 1DBVO 4IY1A 4MRPA 4YMWA 1E1QD 4Q4DA 1T6ZA 3BHIA 1GPH1 3KQMA 4P3PA 4TTIA 3EIQA 5F7XA 2F2TA 2GHTA 3MZ0A 3UK6A 1XX6A 3PXUA 1XL1A 5DNWA 4HEA6 1UPBA 2HPVA 5AXAA 3WICA 3ZW9A 3MWYW 5I51A 3JPYA 3UJCA 1RWMA 3INGA 2OL4A 4RVFA 1PZHA 3HZZA 4WXHA 3ROQA 4DGSA 1WAMA 3ZIAA 3LNCA 4XSGA 1Z0DA 1K86A 3S2UA 3VDXA 1ENPA 2J33A 1DNPA 3T5MA 1C1HA 1JDJA 1XRMA 2PCJA 2J3HA 4V0KA 4LA4A 1S2GA 2FP3A 4H7EA 2OXTA 1LFAA 3WB2A 1MX5A 2P8JA 5CXUA 5GZ3A 2UUOA 3A6EA 2M6SA 3HEBA 4CEHA 3MUOA 1FFXA 4A27A 1D2HA 2XNJA 2YMLA 3KPYA 4A1FA 2AT1A 4W5TA 1ZBQA 4WXRA 1IU9A 5AK6A 3HXTA 2NMVA 1XC7A 2YWDA 4I1YA 4WUTA 1KVTA 2OK7A 2HX1A 3HUUA 3IAS1 2JAOA 4JA0A 3RS3A 4BQEA 1SQ0A 3K0HA 3PV0A 4X91A 3UC5A 1ZM3A 1L5SA 3WRXA 3DNFA 1LTHR 2Z08A 2VDWA 2NXJA 3CJRA 3OPXA 5EJFA 3G0DA 5IBRA 1FLNA 1S02A 2QJRA 2Z30A 3JYQA 2PFSA 3LYHA 4M1QA 3RWBA 2DJ5A 3UJ6A 1PD1A 1VE1A 5AKHA 5A1JA 4TX1A 4H7DA 4WJLA 4Y6PA 3Q87B 1O58A 1WXIA 2X1VA 1KYVA 2CDAA 2MSCB 3O74A 1EQ2A 4WDQA 2C9BA 2FEOA 3EIXA 3I9NA 4X6UA 4OGGA 4D3FA 1O3YA 3N39C 4UEKA 5C53B 2HCTA 1TOAA 2HA3A 4KQ2A 3NJ4A 2F9LA 4TWBA 5EWJB 4PICA 3EYAA 4DJTA 5HBRA 5CLGA 4B47A 3L4BC 3M82A 1SZJG 4X8HA 1F8YA 2WG2A 1E0SA 3DO8A 3P2KA 4UHEA 1V39A 5CH8A 4KNYA 4IP0A 4TYYA 4KSCA 1NNUA 4MX8A 2XVXA 5LP6B 1ZOPA 3VKWA 3NTQA 2OXEA 3CJQA 3VGJA 1VDMA 2V8BA 1YR2A 1I4TD 4YNBA 3OE1A 2VK2A 1P5RA 3DC7A 4GLBA 2WKSA 1YR3A 3B1ZA 5DASA 1RXIA 1CRZA 3ABIA 2IUTA 4DG5A 3TLMA 3L4JA 2DUMA 3K4PA 1KPHA 5FADA 1FPMA 1MABA 1Y8RA 1B3RA 1RWXA 1UWKA 3FLMA 1M75A 3HJCA 4Q7KA 2OAGA 4K0RA 2AQKA 2X40A 2H2IA 1M8KA 4V0MA 2ONKA 2QRVB 3AR6A 2FEMA 3MINA 3SEZA 3WQBA 5KU7A 2OYRA 1VMDA 4BJ3A 3D5EA 3A7EA 2FN9A 3QUAA 2BMAA 1FSFA 1R12A 4WD3A 4XDGA 1PT7A 4CT4B 3S29A 1F7UA 1GNRA 1WZ2A 3OC0A 4H31A 2E1PA 1OQAA 4LY3A 4B1FA 4PG8A 4KXQA 5T8KC 1H2FA 4MQ4A 1KI2A 4D92A 1RNLA 3CT4A 3K8OE 5DLYA 4UVDA 1G64A 2IZ5A 5JC8A 5DN9A 1GLNA 3P8ZA 3R0ZA 2CLFB 2DQSA 2OLKA 5ITZA 1O5IA 3U16A 1ZVJA 3QGMA 1COWD 2HXSA 2OZVA 2NGRA 2Q49A 2VHUA 1ONPA 5CDFE 3PPWA 2DF8A 2CMGA 7REQA 5COAA 2WJJA 5C3UA 2GILA 1J70A 4DLNA 2QTGA 2CB0A 2Z56A 3WDLA 4F2HA 3KPJA 3COWA 4X85A 1XDSA 5J1SB 2CBXA 3OPMA 4PYOA 1XT6A 1CY8A 4RD6A 1SXQA 2RHHA 3QVLA 4QRHA 3V4OA 2X0JA 3A2LA 5FB3A 1A77A 1JEQB 4KIJA 3V2IA 3JQCA 1BKSB 2IOHA 4DLVA 5LZ9A 2O8BB 3AR8A 1E6UA 1G9XA 4F1WA 6PFKA 3VJKA 3GAZA 3OZFA 2XDQB 2DOKA 3GJZA 2MYTA 4URHA 4RXUA 1XFAA 3ES9A 2WV9A 5JROA 3CM0A 1PWXA 4FD2A 2Q1WA 4HSEA 5ITVA 1XQWA 3EEBA 1PT9A 3HCFA 2J41A 2R6HA 1ZP6A 3MC1A 3D6AA 3DC2A 3C3DA 4OQNA 1T3SA 2RHBA 5AVJA 3G85A 5K3EA 4RW0A 1DIHA 1WE2A 3GPIA 2RI0A 2TYSB 2NAFA 4RPIA 1Z7WA 4PQYA 1ISMA 2O06A 3V34A 2YVAA 5A7HA 3WGMA 4EL5A 4YRAA 1W5SA 2IRWA 5FEUA 2AD5A 4RPCA 1LC0A 2ZBGA 3U4IA 1A27A 1H0SA 1YH3A 1RHMA 2WF8A 3C4QA 2JVKA 3NKFA 5L8VA 2DTDA 4JJ7A 3IAEA 3QEKA 2F59A 4MCHA 2ZI9A 5JI2E 1Z3CA 5LP6F 3GPLA 5JH7F 2QNIA 3FDZB 4QX6A 4BX8A 2PUFA 3QI7A 3FHCB 1VGQA 4V1CI 5H16A 4XWTA 2W2QA 2ZJ2A 4N8DA 5H59A 4E13A 3KKNA 2QVCA 2X2PA 4GFDA 4DG8A 1UC5B 3ZD9A 2A9KA 1KP3A 2C8JA 1KQPA 3ICOA 3ZGVA 4US2R 3B6ZA 4GC5A 3RUDA 3FLAA 1LSOA 3HACA 3UG7A 2K5UA 4DSZA 4AMGA 3GJ8A 4HZIA 1PDOA 4A7PA 1QGED 4DBLC 3GFPA 3GLUA 3LT2A 3QPWA 5DT9A 2VA9A 4I1IA 3TX2A 3OZCA 1LGYA 1V5FA 1J0AA 1XCGB 2EZ8A 2FPKA 3BE6A 3PGMA 1VLHA 4OJNA 4R1NA 4DCTA 4DEVA 5AI0A 4UARA 1KH1A 1NJGA 3F5SA 2QLFA 1DCFA 2CF5A 3AETB 3C1TA 1Y3CE 5KO2A 1H9BA 1PTJC 2RMKA 3AFHA 1JEJA 4BGVA 2PANA 2PT7A 1A2QA 1SOUA 3DFMA 2FPIA 3AUAA 3PNYA 1SIBE 2NO1A 3DP7A 4MZXA 4OY3A 1L7MA 2KX7A 4ITUA 3OQNA 1J8MF 4ARAA 2NQTA 3RNOA 2X6TA 1J99A 3AL3A 2HNAA 4L4UA 5TY0A 4JR1A 3SY8A 4CHTA 2O8CA 2FZWA 1V9LA 3ZWWA 5HZKA 2QENA 3T06B 3UFBA 2ZTVA 3IE2A 4EI7A 3IR6A 1JHRA 4ZHSA 5M34A 3THYB 1WSAA 3OMLA 1I3MA 2R96A 3CGWA 4U2EA 1SCBA 3G13A 3B7PA 1X7ZA 4GI3A 4M38A 1B7GO 4ENQA 2AMJA 1L9KA 2ZWIA 1R6VA 2ZIZA 5HIJA 1UPCA 5LCXA 1DDIA 2JGMA 5HCNA 4JI6B 4C88A 4QT4A 4ZYWA 3SS9X 2DFKB 5HQJA 5LZ8A 5JYBA 4M7PA 1XVUA 2HK7A 2LE0A 4IJWA 4M8NE 4X8OA 2P2NA 1AKYA 2Z1DA 1OKKD 3JR3A 2C7OA 1P0FA 3WZ2A 1DGQA 3OM8A 2F43B 2X8LA 3F90A 1KNXA 1I4EB 4L08A 4OP3A 1VDZA 1O08A 1FFAA 1N2EA 2ZBVA 3OZ7A 2A5LA 3CNEA 3T7KA 3TI9A 3WSWA 4AROA 2DXIA 3PLNA 1T8UA 3EQ8A 1CUDA 2ZQZA 4KQIA 4KIGA 3BKWA 1V26A 3BWEA 3DFZA 4NCXA 4L22A 2YJNA 3M34A 2R62A 1O9BA 3NMUF 1NXSA 4LHEA 1YK1A 3IYLW 2WKQA 3A32A 1ZSNA 1FNBA 2IY7A 3HSKA 2NLOA 2YNMC 1PJTA 3C6BA 3V8PA 4UAUA 2H7VA 3ZZMA 5CD9A 2LP4Y 3KOZA 1Y1RA 1SKYE 4EGQA 3TQSA 3ZYCA 3IH5A 4PZYA 2IEAA 2Z6UA 1K63A 1TUBA 1XCBA 2PZ8A 1YRBA 3OOSA 2O0HA 2P41A 1BVRA 1SHZA 1M2FA 3PL5A 3CRMA 4NARA 5FLKA 4DWWA 1Q11A 3OIUA 4PNEA 3VNQA 3DDCA 1CUIA 2V5VA 1CQWA 3ANYB 2G1JA 3VPBA 4UHBA 2O4CA 1A96A 2C0CA 3LKVA 3WGJA 1SC3A 5FWNA 3HJBA 1EFLA 3U81A 4BX2A 1QXSA 2BELA 1XDDA 1GQOA 1BXKA 5KX5A 2HMTA 3HCPA 1GPNA 2AN4A 2B20A 2VHWA 3P27A 2J0UA 3DVRX 2I4TA 2I2BA 3SX4A 4CL0A 1PZMA 4ZHQA 3WAKA 5ENVA 1XNRB 3MWJA 2IDZA 4ALMA 2GPYA 3VKFA 2W6NA 1OAAA 3SSMA 1IG0A 4U8HA 5TPZD 1PV2A 5TVGA 4PPNA 1RAGA 2JCSA 2BMDA 4O29A 4LF7B 2FSPA 5EL0A 1QAQA 1KAGA 4MGHA 3A36A 3RFCA 1VCMA 3HDJA 5KNLA 1GQQA 4RYDA 3PUYA 1XAJA 4ZT5A 5LQRA 3S27A 2NQ2C 4PXYA 3VNUA 4X6XA 3O1JC 1MEEA 1VMIA 3ZBQA 3E9RA 5F3DA 3T94A 5IVHA 1PNOA 3EFEA 1ZC4A 4QGGA 2ERXA 4KYVA 1G9TA 1AHHA 4KPUA 3IVGA 2QEQA 3QOYA 1X3SA 1J2EA 3CUWA 4FJ1A 4L8VA 4IOMA 4Y2VA 4ZU6X 3E9QA 1AUQA 2P79A 4R7ZA 4DMHA 4HUTA 5A03A 5DJ5A 5LL6P 1K4YA 4Q4CA 1DKQA 2PU5A 2XWBF 4PC3A 1W1IA 2MYPA 5NULA 1ACLA 1EKXA 4MINA 2XCLA 2FR8A 5G0TA 2WHYA 1QRAA 3D4BA 3S4YA 3OFJA 2IT1A 1J2TA 1HFEL 3D6FA 3EW9A 3Q15C 3VR4D 1A9ZA 2XNDD 2LDXA 3NOQA 2W11A 3LT5A 3NBUA 4A6DA 2EKQA 1UK9A 4F1JA 2PH3A 3LZDA 2C4NA 1M2VA 4JWTA 4AZVA 2VQFB 3EZLA 3PJRA 4LDJA 4U1RA 5PNTA 1XEXB 1M6WA 2LGJA 5IAAA 4MUMA 1GYPA 1A04A 1OZAA 2QE7D 4IQ4A 1VHDA 3A10A 3FH0A 4ARZA 2XQGA 3V6LA 4AXBA 2RJ3A 1II9A 2I3BA 2OHJA 3A9WA 4ZDWA 4KXUA 4CLRB 2NTJA 1UJ5A 3KT3A 1TT5B 3O4HA 2YJZA 1KXZA 1GQRA 2AE1A 5GINE 1FXWA 3PIDA 3SR4A 4BUZA 5ALQA 5K0BA 3R5HA 4N6GA 2OILA 2YUTA 3ZU5A 1WKVA 1M2GA 4IS3A 4N39A 4L75A 4JXKA 2M1ZA 3ND8A 1MAUA 3DZIA 1WHSB 2R8ZA 2I99A 1NN5A 1UUFA 2PBFA 4LHZA 3LBFA 1LPBB 5DCLA 3HBFA 4PSKA 1WBDA 3TTWA 5CU7A 4MUYA 4V2IA 1P1KA 4MSUA 3CX3A 3EGVA 1LLQA 2VFAA 3AZPA 4GZ6A 4BX0A 4E08A 4MHOA 2NSLA 4UCWA 4ZJYA 2UXCB 2Q0QA 4U2GA 4UPVA 3FWZA 5IWAB 5DHPA 3IKVA 1FTYA 4RL6A 2WYUA 1E1NA 3P9XA 1OREA 1S9HA 4AQDA 3TW6A 3B12A 3ZJVA 1S7GA 2XYQA 4N1AA 1J07A 2J3EA 2NVOA 3RIXA 2C9MA 3TS1A 2BL4A 5DSXA 1Z5UA 5FPTA 4DS3A 3ELDA 3KLBA 3R9WA 2D5CA 3DGEC 1BS1A 1T9ZA 1S9DA 1BDJA 2JEZA 1A76A 1PG5A 2BFCA 2DMRA 1HQYE 1FXUA 2PZLA 2ZJ8A 1JLLA 1IHXA 1NW4A 1XQ1A 4K26A 5EIOA 5CTJA 3U17A 1SVKA 2W6IA 4YDQA 1VKRA 1Z33A 1JIQA 4WIAA 5JARA 2MMCA 2DR0A 3DKRA 4NR0A 5ALLA 5LWQA 3UJDA 2I91A 4REOA 3U7EB 4F1KA 2AZXA 2QXYA 2GVZC 3EFOA 3I23A 5AOVA 3RWOA 1LTQA 5EJGA 3L9WA 4S0ZA 1Z4OA 3KQNA 2Y1WA 3EC1A 1GNLA 3HWRA 1OBHA 4Q4HB 5DPMA 5F7ZA 3AIOA 5ECDA 1XRRA 1AHIA 2ECFA 3WWCA 1Y5IA 3LQYA 3ZLJA 4I9UA 4WUVA 4N7JA 3K9CA 4GR9A 3ICEA 4N01A 2CJFA 1UKYA 4EH1A 3ZDCA 3V8EA 5DEIA 4L7QA 2HSJA 3HI4A 1BJKA 4UBMA 3KNZA 5AFSA 2C00A 3IXQA 4H9GA 3ZEIA 1XALA 1AGRA 3JRXA 3N2KB 1EGVB 2VP9A 3ZDYB 1VCIA 2X22A 5JAUA 3OTGA 4QSMA 3UG6A 1V25A 1A2KC 3DBVO 4P32A 3IP5A 1KGSA 1JG6A 1GFIA 3AR9A 4ZVQA 2QTVB 5EMKA 1CRLA 1B00A 3KYDA 4H6VA 3UMGA 2MJLA 4GM4A 4I5DA 5I7HA 1XZCA 2LWIA 2PUVA 4JB2A 1N8SA 4LJ8A 5AKYA 4HN2A 3MA0A 3A9UA 3NVKI 4KPYA 2GLUA 5T7BA 1RLUA 3R5XA 3NHSA 3PKZA 3BMQB 3IESA 4J1TA 4FI3C 2EX0A 5CVVA 2VJYA 2XUPA 5JD4A 3LH5A 1KKUA 2NU6A 4M8KA 4R1SA 1FP1D 1QK3A 1PNQA 5IMBA 2ONCA 3URMA 2C97A 2P78A 2YFYA 5CDGA 1LC3A 3UJNA 4HHEA 3EC2A 1TW3A 1AK9A 1H8HA 4D6PA 3NYRA 2RKOA 2QR2A 4D0RA 1X7YB 4IXDA 4OHKA 2QD3A 3IUSA 5CLHA 5AI8A 4AJHA 3KWMA 2OV6A 3ZGYA 1PL7A 4FI3F 3AY0A 3JATB 4ZAGA 3ICVA 3HJRA 3N0VA 5FTJA 4YIHA 2BFMA 1F0YA 2HQSA 2P90A 1WMBA 1IM8A 2UZ0A 4R40A 3R7NA 3BILA 2VWPA 1TPZA 2COEA 3EG5A 3LW7A 2R7NA 1Q74A 1L1EA 3AOEC 1IEXA 4ALKA 1ETHA 3MLAA 1OKKA 2G76A 3JAKA 2XNKA 2QS9A 1XZQA 1XTBA 2IYNA 1LLUA 3JARB 3LVFO 2G17A 5DW3A 3RK1A 4IDDA 1QLJA 3BS4A 4ER7A 2D1TA 1V47A 1VIVA 3G8CA 3G2PA 3I4LA 3VHXA 1NMQA 2GN0A 4BNMA 3FNBA 4OI4A 4CF5A 2P5YA 1UBSB 3B38A 2XTMA 1J1UA 2QRHA 4KVAA 3GAFA 4YHHB 1ZR2A 4LMAA 1XBTA 2DETA 2A5JA 1YZUA 2E21A 1K0UA 1WL8A 2EG9A 4QA9A 2NUTA 2WI8A 4ZC1A 3L7CA 4BDTA 4DM7A 3H04A 1YRAA 2CDCA 4HNQA 4E88A 4F9FA 5HJ7A 3KFLA 2K7FA 2JFGA 3H1PA 3U5ZB 4MR7B 1EHYA 4GPZA 1UQUA 1NRIA 1G0NA 5E3IA 1WB4A 4DDHA 2ZXFA 3BFVA 1O6GA 1WPRA 2IZOA 3IV6A 4EO4A 1YQWA 5DFAA 5KU1A 3TAXA 1N4DA 2P9EA 3OD1A 1BS2A 2I1QA 2ZLBA 4BJ1A 4FIZA 2Y0DA 1O94C 3ZGNA 1VG9B 2D1YA 5AK4A 4WLOA 4RTNA 2Q7DA 1Q7CA 1TK9A 1VLLA 3WQQA 4DWJA 1PGPA 1W2GA 5IW8A 1G7TA 1JT2A 3GLHE 4QDUA 5T57A 3M5WA 2ZP1A 4C4RA 5I9SA 3R3JA 4O1IA 5CA0F 3BCRA 4DZTA 1E1LA 1Y8QA 3LUPA 2EKZA 2XUDA 5JCOC 2HU5A 1KU6A 2IDKA 4HBGA 2A0YA 2VWGA 4C4PA 4ON9A 2GEUA 1L5QA 1DAFA 1Y42X 3L7MA 4QVKA 4LGCA 3MTDA 5A6SA 1KH3A 1VA4A 2W00A 5LA6B 1O6FA 4GH5A 1YZVA 3AOGA 1Z75A 3PQFA 4EEZA 1AMUA 1MH1A 1Y4DE 3B52X 4F56A 3GWZA 3ZCSA 2C7GA 3BGVA 3FJOA 3JQQA 4KQKA 2HIMA 1GNPA 2FDRA 3NBFA 2F8MA 3OEHA 2P40A 4OM7A 2WRZA 1HXHA 3OFSA 1SXJA 2AOUA 4Q1EA 4BKOA 5L3SA 4YBZA 1SEPA 2BZ1A 1MTZA 4IIYA 1QIJA 3ID6C 2WT8A 2CXHA 5ITWA 4O02B 2JJYA 1M5RA 4INZA 3UGQA 2DWPA 3D6HA 4OGWA 3IUMA 1JHDA 3B6MA 3WIOA 3X44A 4M21A 3VOBA 4TMYA 2YVUA 1SJ9A 3I1JA 1PQ4A 1RS0A 4Q19A 3WHPA 5KTOA 4WFQA 1QUEA 3M4YA 3Q88A 3GC6A 3T15A 4BLRA 4UMVA 3GDFA 5F2KA 5HKOA 1JKMA 1CQJB 4U8GA 4NPCA 5HE8A 1HDCA 1AO3A 3L7IA 3ZPXA 2Y1KA 1W34A 3GFBA 4ZYVA 3TGPA 1DEKA 5KSPA 2I2DA 2VIIA 4NESA 3JZDA 3PC2A 2BBTA 2YBEA 4CKWB 1LI4A 4IICA 3KSDO 1N2ZA 3PICA 4HAUA 3H18A 4EGSA 3SQLA 3WGZA 5J47A 5KVVA 4KMSA 4BGDA 3ENVA 1C7QA 1D6JA 3D7NA 3OTWA 3TE7A 3A0UA 5J3JA 1YB4A 4EFDA 4EMUA 5JTUA 3ZCUA 1P1IA 4J6FA 3VVLA 3NT5A 3P19A 1LQ2A 5C1IA 1UDWA 3VR2D 1T5LA 2TMYA 3HK2A 3IP6A 4FNAA 1Q1GA 4PO9A 2HY7A 3HP7A 4B0PA 5AK3A 1U8TA 3TFQA 4LNUB 4N0PA 4ROTA 3FLBA 1MORA 1DWOA 1NLYA 2C83A 4DCPA 1BGXT 1CX9B 2CW5A 3C1UA 3KELA 2IBTA 2E82A 4HYQA 1Y8CA 3NUQA 3PNKA 4U4AA 3WGHA 1SCJA 4FSXA 5CT4A 1N2XA 2IEBA 3DAHA 3TX6A 2WUGA 5EHIA 3EDRA 4BZXA 3RVKA 2H4XA 3SCZA 4QDOA 3GLTA 4PYIA 3GLHA 4HR7A 1JV2B 1DIRA 2IWRA 3WZLA 5J4YA 4OXNA 2LXNA 3L2OB 4FX5A 4BVLA 3DA8A 1KP9A 3LA8A 4RMIA 1PYOA 1E8NA 1J20A 1KFCB 2AR0A 4O1MA 3QG1A 3RWMB 4RU1A 2PKYX 5T4BA 5F3WB 4HI0E 1PEYA 4I8XA 3ANLA 5KTKA 3FZEA 1NVTA 3I0MA 2H2HA 1M34A 3BWXA 3V8QA 2KB0A 5BWMA 2JJMA 2Z2JA 5IMSA 2ZB3A 3CVYA 8MHTA 4JYZA 2BFPA 2VZ0A 4IIJF 4MJXA 3VYUB 3IQIX 1R4MA 1VHWA 4GUDA 2V7QD 2UUCB 1QYCA 4MUFA 4LOIA 1SU8A 1E94E 4F4FA 5JAIA 3RFTA 1OSNA 4JI2B 2E5WA 2GGSA 5I4KA 1U8FO 1NONA 3AX6A 2QYOA 3HSYA 4PNHA 4X8MA 3BJZA 3PQCA 3O93A 4KZKA 2PU7A 3N59A 5EC8A 1XR3A 3RVJA 4RHUA 2QP3A 4Y6QA 1IAVA 2EKPA 4EPYA 5K8UA 1A95A 2BEUB 1QOQB 1ZRNA 4J7CA 1A1SA 3LY8A 1C0LA 1WXHA 3A6KA 3GDWA 3B13B 2WIJA 4LRSB 5IAGA 3V1UA 5I4BA 5DCWA 4EJSC 2B35A 4Y6GB 2H0AA 1BCSA 4Q9JA 1E64A 2QTFA 3CR7A 5ERGB 5GM1A 1O94A 5DNAA 2PGIA 1Z39A 3HU5A 3L1HA 4M98A 1UINA 3OCWA 3TNYA 4EHLA 1E2IA 3IOBA 3DVSX 3LPLA 2F3UA 1E9SA 5CIWA 1Z36A 3ON5A 2PMDA 3WMGA 3GT7A 1YF3A 5A0TA 4KV9A 3HB4X 5LWHA 5D87A 4MTCA 1WV0A 2OO7A 5T5QA 3TXYA 4WZBA 5DN6D 5JZVA 2PJRA 1L3CA 2I2WA 3H1TA 1G6Q1 1VL0A 2W4QA 4CKZA 5HSGA 1M6EX 1TA9A 3NT2A 4TV8A 4N7RA 4YJHB 5REQA 1TEXA 3QELB 4J1SA 4TPKA 4TXNA 1QZTA 2WUFA 3HGTA 4ODIA 5G4LA 5HTOA 1EFPB 2VXOA 2QTTA 1JE0A 2Z2IA 4UQOA 1TCBA 5ESDA 4E2ZA 5FLEX 1CY0A 2WWTA 1H0KA 2ZRQA 1GPYA 1UFKA 5FA5A 4N6OA 5BNTA 1E2BA 3FSJX 1N2CE 3UK7A 4YMVA 2K87A 4B71A 4RSGA 3L0PA 3I58A 1WUIS 2ISQA 4FILA 5FD8A 2XUKA 5SZIA 4HNTA 1NX9A 2Z8ZA 5GPBA 4R01A 3ZCQA 3WKCA 2QLMA 4UUMA 4U6SA 3ROEA 3EIOA 3PPVA 1RC1A 1PGOA 2QN3A 3P94A 3TB6A 4WK6A 1EVJA 4Q3BA 1F4PA 3IXMA 3PRKE 3QVKA 3GEHA 2IOFK 1TMOA 5BQ5A 2PUBA 3CHYA 1SK9A 1KVUA 3LHKA 4UVIA 3W0LB 3W8RA 4C0BA 3I8SA 4DR1B 4ID3A 2CFTA 3OJOA 4H4EA 4J43A 2CUTA 4CEJA 3I6MA 4L0MA 2EWVA 3H0KA 5JY6A 1EUDB 1U8ZA 4O2AF 1NJSA 4L5YA 4U3JB 1GU7A 2VQDA 3BEOA 3W04A 5JNVA 1Q3HA 3ORYA 1E8DA 1EP2B 1GPWB 4XH9B 3KXIA 1D2AA 1U7OA 2NPOA 5DXFA 1QVWA 2CE7A 2LBPA 3EGEA 4HAWA 4Z51A 5F1OA 1HA3A 3E9ZA 3QQPA 4TQGA 1C3OB 3DZ8A 1GPDG 1VA5A 2VUHB 3M9WA 5JE8A 1AKRA 3JQ8B 2XQVA 1D1PA 1ZNZA 2H63A 3NTVA 1FYEA 1GKLA 3PNVA 3NGXA 4RKRA 4Z7QB 3LDUA 2BE9A 4X97A 1KYWA 1SMKA 4QGHA 4PLGA 1CEXA 4BO6A 4DMMA 3KFVA 1W0JA 1ZMRA 4B0OA 2J85A 1WW2A 1GT6A 2ASEA 4OVKA 1IVNA 1R8XA 1JEYB 1XE3A 1HRKA 3X43A 2PMEA 3REFA 2HBZA 1YA6A 1TZKA 3AVOA 4IQFA 1IZ8A 3SIXA 1JLRA 2CFOA 3ONFA 2ZI3A 4EPXA 1P0QA 2GAJA 5CUQA 1JXAA 1ODJA 5IN5A 3WFZA 2PSEA 4EELA 1DEOA 2R79A 2ZJ4A 2WSYB 3U0BA 4EBBA 4BEVA 2O19A 1V1MB 3AO0B 3JCZA 4QOHA 4RC9A 4CGYA 3M33A 4W5HA 4XSHA 1M2HA 2VYVD 3LQFA 3DR5A 3K9WA 4TXLA 5DYWA 1J09A 2UZ3A 2XBLA 2IELA 2P11A 3C39A 5T6MA 3HRHA 4BLQA 5GGYA 4BB6A 4E32A 4JLNA 4DJDC 3ND7A 2Q1YA 1FU8A 2O2IA 3NIWA 1W44A 3V8MA 5JBNA 4BQSA 3BL6A 4C1NA 4ZO7A 2XZLA 1Y4UA 5CX1B 3T3MB 3FRJA 2C04A 3F5MA 1WQ3A 4K6KA 4HL6A 2ADMA 4AJNA 3W5AA 5I47A 2ZW9A 1HORA 5AYVA 5KHLB 2ORED 1SVOA 2ZRLA 3TKAA 2JI6A 3DMRA 4I8DA 4CZ2A 1CZLA 1U0HC 3ZTWA 2ODBA 3MS7A 3VZRA 2AC4A 4PYQA 4EPVA 1Y1TA 2EFDB 1L5OA 3PGLA 2NYVA 4Y9RA 4YP7A 3VISA 3ZU3A 5T41A 2FFHA 1FYXA 1M6YA 3L82B 5T4FA 3AVWA 4RPKA 3OZBA 1VSVA 4DCGA 1GAJA 1Y9EA 2RK6A 3PR3A 3URKA 4C6HA 5K09A 1RTTA 1D2GA 4BZPA 2PUEA 5JS6A 3DOFA 3NYIA 2QU8A 4OPMA 1T8TA 5EYPA 1ZHFA 2O3SA 1V35A 1DJLA 2DUUA 2QL5A 1I4LD 4B34A 4D96A 3PZRA 1IUPA 1HDGO 1IH8A 1P7ZA 1Z6XA 1SOWA 4XPIB 5JSKA 2DY1A 4BNFA 4D41A 3IKLA 1YV9A 3H4IA 4AB1A 1GQ2A 3T3DA 2A1UA 2EL9A 3NU1A 4QWWA 4HGQA 4BBAA 3CUYA 4ND8B 4BCDA 4Z4CA 1EVKA 3HLKA 4YK7A 3LC7O 2NU7A 1Q0LA 3HE3A 3W8DA 1OOEA 3FDXA 3WIDA 3IPRA 5BW4A 2VAWA 1R5NA 2GKSA 3NASA 1AHNA 3GPDG 1NP7A 3EPJA 1G3RA 3EX7C 4FIDA 1JR4A 3P9KA 4A8PA 3EIHA 2G9RA 4G36A 3D6TB 4CLDA 4R5HA 4FN4A 3S1LA 3UENA 3GHHA 2JAXA 1IG3A 3B9QA 4K6CA 3RREA 4QFBA 1TGVA 2TSYB 3HR4A 3KLMX 2VDNB 4RIGA 3DLHA 1WG8A 4OHCA 4TS1A 1CZNA 1T0HB 1QP4A 1Z4QA 2I2CA 5LBTA 2PR2A 2WAAA 3LQKA 1QYDA 3BKXA 4Q93A 5B4VA 1A9RA 4PZEA 3WLQA 4S04A 3HVJA 1T2AA 3DEIA 4P58A 1F8XA 2UXBB 2PKQO 2CJXA 1KPIA 2BY4A 2IUEA 3A1UA 4J1TC 3UYKA 1M2OB 3A4VA 5HRUA 3LL7A 4WXYB 2PWPA 2X23A 4DY4A 3SDSA 3C8ZA 3LCUA 3OLYA 3CUUA 4OHMA 4U7DA 3DKKA 2QAGB 3BQ9A 2FE1A 5JMOA 4O2RA 4IEEA 5DV9A 1OX5A 1G21E 2ET6A 2IP4A 4EX6A 4WI1A 3RUIA 5CB8A 1SZDA 5G0VA 3BB3A 1GNVA 4GL4A 5B3KA 3H6HA 4XIFA 1D4AA 1GGJA 3BTVA 4IHQA 3TMKA 3OCUA 4B74A 4D9MA 4H7IA 1MLDA 2AFIB 4I4LA 4M89A 1C8BA 1QGYA 1RU3A 3S6JA 3F3MA 4EA8A 4FLFA 2O2ZA 2GF9A 3U3ZA 4H6PA 4F3YA 1L7EA 4OQEA 2A86A 2EOAA 1YCGA 2ZRCA 2G40A 2HIHA 1GNQA 3WK7A 1ODSA 2WE8A 3MCZA 1EFKA 2ZRKA 4BLOA 5BUQA 3Q12A 2WFLA 2PQMA 3QFRA 5A4FS 4WLEA 1JQAA 1X8KA 3UGTA 3SSNA 1OI4A 4B3DA 4PLTA 4X65B 4Q9HA 1ZGZA 4FM9A 4L76A 2FWNA 4P36A 3EZ2A 3E7XA 2HAEA 1AKMA 3CLRD 3WYNA 4BGEA 3CZMA 1F2UB 1TT5A 3OJ0A 4DLZA 3BMNB 1WW8A 2AH5A 1XZFA 2VPWA 3B6IA 5LQDA 1J1ZA 4O08A 1Q14A 4B7AA 4MO2A 3KE9A 2R2GA 2VYCA 4KK3A 5I7FA 3FYUA 3QUCA 1IM2A 4ENTA 3RTGA 4C0XA 2I34A 4ZU1X 1PWHA 2N42A 2B3TA 1DPGA 5G0WA 1JMVA 1Y9AA 4P08A 2PE5A 1JQEA 4MW7A 4KRXA 3KB2A 4DDUA 5KPDA 1N8NA 2H65A 4OXIA 2Q1UA 4DV2B 2XRZA 1PR5A 2H5LA 2PS9A 1DRVA 2IH2A 5EEGA 1Z5ZA 4E12A 3JAMA 1KP2A 1G8MA 4DQVA 1T0UA 2FPPA 4DV3B 1IB0A 2I6FA 2QUKA 3AP1A 3KAQA 5I3ZA 1ORRA 4WFKA 1PQWA 2EXXA 3F7MA 4FOOA 3QKWA 5FCDA 2AZDA 4OP2A 1OHHA 4B3IA 2QMEA 1KYQA 1FDOA 1TM5E 4LOHA 5EWMB 4C2AA 2RH5A 3HCAA 3UWDA 4G6ZA 4OQMA 4LXUA 3RVMA 4B6OA 1HFKA 3NHKA 4JJFA 3CNNA 2A1IA 3IAUA 4V2UA 2NV0A 1MABB 2BP7A 1ID1A 2VBFA 3AHJA 4HX5A 2DGDA 3KOOA 3HWX1 3NORA 2V55B 4CNQA 1EFRA 4ZGWA 1FY2A 3O8DA 5ES4B 4XW2A 4DV4B 1HDIA 1XRJA 2JHCA 3KD3A 4LVCA 4WDRA 4DRXB 3H9UA 2F7SA 3O4JA 3O38A 5E9AA 5B4UA 1NI4B 1GGMA 2GD1O 3BMOA 3D7MA 3NHYA 3OQVA 3QE0A 3QXHA 3ONDA 4TKZA 3D5QA 5JWOA 3EQ9A 1AKQA 4FZ3A 3X2EA 1HDXA 2VLIA 4JYMA 2P30A 1QO0D 1C9YA 2I03A 1Z08A 3EHDA 4R1LA 4EGAA 1HT3A 4TWAA 3IBFA 2AN1A 1KQ3A 3R8CA 1VE7A 1GGHA 1QR6A 2XIJA 4TTPA 1YB5A 3Q3EA 1X70A 1C7RA 4MV6A 2H08A 4HMQA 4BWGA 2AK3A 1DX6A 3WK9A 4XYLA 1UJCA 2XDQA 4FGJA 3BD9A 4EA7A 3I5MA 1A8HA 2BWJA 2ZGVA 4JI7B 3H1EA 3O8OB 3CVVA 4KFUA 1YZYA 5DVZA 4D3DA 2DU8A 5BVGB 1HUQA 2YICA 3H5NA 3L8EA 4PG7A 2ZVQX 4RA9A 3T7CA 4A6PA 3FVTA 4YRFA 3IGFA 4PIPA 2DYKA 2NT4A 1P29A 2VPXA 3G49A 3GGSA 1E20A 2W6CX 2VZ8A 2V7VA 4Q15A 4YJGB 3OFKA 4X61A 4YEDA 3E22A 2J9FB 4MJ7A 1L5RA 3AV3A 1ZC3A 4FEEA 3EWIA 1DT3A 3R3VA 1JAHA 4EB0A 4FDTA 5HDQA 4NL4H 3O3OB 4Y1GA 4MQEA 1GDDA 2FPGA 3JALA 3GJYA 2NU6B 1JFLA 2R3SA 2ATCA 1E79D 2FB9A 4ZAVA 1KMHB 2JCBA 4U7JA 3EVEA 1SHJA 3P20A 4GSYA 1KO7A 2H51A 2RK4A 3ICCA 3VPCA 4AMVA 3DLBA 1UBNA 2HFKA 1LZLA 3RU2A 4F8EA 2WK1A 1FBNA 2JHPA 1IBSA 5DGIA 4GPAA 3TVTA 4DN6A 2VA8A 4MP8A 3WLTA 1OA1A 3IAS6 5FQNA 4CMIA 1IWOA 3HYNA 2PUCA 2O5RA 4JBGA 4ZVKA 1NASA 1EFDN 5C5EA 3GRUA 1UT5A 3AR3A 1SCNE 3PE3A 2E4YA 2M98A 2OGZA 3OQIB 3SX2A 4PLCA 1A9TA 1EHCA 4XI9A 2VTVA 4KXYA 4QRIA 2N75A 2WTXA 3EVDA 3FCSB 1SD1A 2IYWA 4KWHA 3ENQA 2RGEA 2E49A 4QIHA 4QYTA 1ZONA 3ILVA 3CX8A 3W2FA 2WAMA 4D46A 1XRQA 1AQNA 1RXEA 1IOZA 3VTFA 4MV5A 3TSOA 4EOGA 2WHXA 1JFRA 1G291 2YHIB 1GTMA 3F49S 4GZ5A 3SEQA 1QTNA 4CDGA 3GUVA 3JQAD 1GL7A 4UAGA 1RR6A 2AFHE 3FNFA 4RQAA 5FBRB 3M1LA 1SVUA 2B3DA 3RHTA 5EMHA 1OV4A 3PGA1 3OA2A 4DLUA 4PF1A 5ALUA 2J0SA 3RIGA 3UWPA 1C3EA 3RSQA 1NBMA 1CEEA 2BFCB 2AG1A 2Z98A 3DV0A 4DV6B 4TKUA 1L7QA 3F2VA 1LPSA 5LDDC 3N75A 4WN3A 1K9VF 3CKKA 5TEWA 1ORHA 3RG8A 4LZOA 2GNPA 4CT5A 2FG6C 4E5MA 2XADA 4YCAA 1D7AA 1E7MA 2V03A 1D3AA 3GUHA 1NL3A 1G4UR 3LWDA 3DE5X 4LYGA 4O3FA 5EQDA 1ZUHA 2HA7A 2PY6A 2A8YA 4J1NA 1U9CA 1KVQA 4KC0A 4MA5A 3LQRA 1HQDA 2BI8A 2CHQA 4J07A 5CP8A 3B85A 3I1IA 1RXWA 4LPKA 3E15A 4ZAYA 1G20A 3U3RA 4BLVA 1BG6A 1BN7A 1PKEA 1VCNA 1VHJA 1ZVMA 1KZ7B 1IDN1 1RKVA 1W4RA 3ZU2A 2IYRA 2PLNA 2A94A 1F8FA 3JQEA 4NNJA 1FP2A 4RE5A 2YRWA 4L3VA 3WLIA 3N7AA 4X7BA 4ZJPA 4TMVA 3SWWA 1Q19A 4HLUC 4ZMRA 3ZI7A 2X77A 2I1WA 4FCCA 3V9AA 3E4DA 4OUDB 4O4HA 4ZI5A 3WLMA 3NBYC 1M7BA 1Z15A 4IDNA 3AKZA 1C1DA 1I7NA 1TC1A 3T7SA 3IOCA 2P2YA 4BZZA 1QM5A 1JAXA 4Y2PA 4I55B 2Z8YM 5JWHA 3LK6A 5DGTA 1AN0A 2XI4A 1NQTA 2R8PA 1E63A 1QRSA 4LYDA 3QYFA 1BE0A 4PPGA 1WEHA 3BWMA 4RMJA 2NZVG 3DULA 3EXAA 3M5DA 3BIXA 4LRXA 4S1OA 2XT9A 3SD7A 5IJ9A 3FPBA 2GK6A 2OR3A 4PWZA 1OV6A 1AQ6A 3BOSA 4RESA 5KEIA 3FWHA 4YI5A 3SP1A 3ROXA 1MOPA 1WXFA 5EJEA 4FW8A 3BE8A 1SOVA 1T3GA 2XCIA 1O6ZA 3T61A 5IJ0A 2P9CA 2O0JA 2Q1XA 2CSXA 2VDKB 4F60A 1HL3A 1HE2A 3LHDA 2FGKA 1HOXA 5KPJA 1PJAA 4ZTUB 2PKEA 3I2HA 3T5TA 3IAAA 4O4JF 3GT4A 2D2VA 4QBKA 4RL4A 3K05A 4N41A 1B23P 3EFBA 4BFTA 4AMYA 3DL2A 3K35A 3ZY5A 2GQ0A 2W6ZA 4D9IA 2R1TA 1YJ5A 3N2IA 1U7XA 3CH7A 4MDFA 3R5SA 1QMPA 1RRFA 4GBMA 7MHTA 2X2EA 2JEOA 2Y8EA 1ESMA 1I7PA 1U0LA 4JUAA 2H0RA 3LFTA 3EZFA 10MHA 2JFUA 1DEHA 3QF4B 2CNOA 3WC4A 1ID8A 4CUZA 1EP9A 1Z4PX 5AMXA 1B8VA 3CN7A 3DUFA 5IX8A 3ED5A 3FKSD 5K0EA 3TPZA 1PLJA 2GBLC 3KVOA 1EP3B 4MTLA 5K8CA 2H7XA 1W5BA 2IYXA 3ZTTA 4KFCA 2HK8A 4W9NA 4FB5A 4EY3A 5JFOA 3GCZA 4I50F 2WTUA 3RVDA 4ZHQF 4IUYA 1EB9A 1EP1B 1WD7A 4NBUA 1K68A 2A5GA 1JIUA 4LBWA 1WMFA 1OX4A 1I10A 3O92A 4X63A 2ICAA 5L6MB 3RADC 2NZ2A 5TXGA 2GTIA 4FYWA 3MFYA 2ZYVX 4LZAA 3CBQA 3OPVA 3T1VA 3V4FA 5A06A 4BRWA 3TAUA 3B6JA 1QIGA 3FGZA 1ZH2A 2YRXA 4US0R 2D5AA 2Q9BA 3KZMA 4Z7JA 5HQ3B 4OUKX 1BXRB 1MX1A 2O2DA 3RSOA 1XJWA 3L4EA 5A71A 4AULA 4BQOA 3TQFA 4BNJA 3ZZ1A 1RE1A 3EQ2A 2YYAA 2R48A 1DIGA 4S1VA