1VCHA

Crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
168
Chain Sequence
ETYPITVGGVTRHVPLIEPLPGRRIPLVEFLGDPEFTRAAAEALRPLVPKEAEILFTTETSPIPLTHVLAEALGLPYVVARRRRRPYMEDPIIQEVQTEVLWLDRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVFRQGTPGLAVDTVAELPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Phosphoribosyltransferase-related protein
total genus 48
structure length 168
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vchA00
1TC1A 2H08A 1G2PA 4QYIA 4WMLA 4PFQA 1DQPA 1P19A 1VSTA 1MZVA 4RQBA 2AEEA 4M0KA 4IJQA 1ECBA 1ECJA 1A3CA 1G2QA 1A98A 5JV5A 1UPUA 4LYGA 5E38A 4P80A 5BQPA 1FSGA 4PAWA 4Z1OA 1L1QA 1D6NA 4LZOA 4S2UA 2JBHA 5KAPA 4RABA 2H06A 1HMPA 1I14A 1A96A 3HVUA 2P1ZA 1XTVA 4RHUA 1OROA 1STOA 1HGXA 3ACCA 1DKRA 1QK4A 4LZAA 1GPH1 4RANA 3GGCA 1UPFA 2JI4A 5IPFA 3KB8A 2WNSA 3OZFA 2DY0A 1L1RA 4MB6A 1VCHA 1XTUA 2IGBA 1P17A 2C4KA 1ECFA 4QYIB 5KAMA 1BD4A 1A4XA 3GEPA 1U9YA 1A97A 5BQOA 1XZNA 2H07A 3DEZA 1QB7A 2GEBA 4RHXA 3GGJA 2VFAA 4RAOA 1YFZA 1ZN8A 1Y0BA 4KN6A 4LYYA 2JKZA 1GRVA 3N2LA 4LZNA 1ZN7A 4WN3A 3S5JA 1O57A 2E55A 2EHJA 1R3UA 4F8EA 1DBRA 1QCDA 5BSKA 3ACDA 1G9TA 4P83A 1CJBA 3EFHA 1Z7GA 1IBSA 1VDMA 1WD5A 5ESWA 4JITA 5EUCA 2PRYA 4M0PA 4P84A 2FXVA 4X44A 4RV4A 4ZFNA 4OHCA 1I5EA 1XTTA 1J7JA 1JLSA 1XZ8A 1ZN9A 4RHTA 4X45A 4FYMA 5ESXA 1QCCA 1U9ZA 1W30A 3M3HA 4RAQA 5HKLA 1ECGA 1BD3A 5IAOA 4P86A 1I0IA 1QK3A 2HCRA 3DAHA 5JSQA 3MBIA 3DMPA 4P82A 3NAGA 3OZGA 1QK5A 4RHYA 5HIAA 1V9SA 4QRIA 4P81A 1NONA 1I13A 1DQNA 1LH0A 3H83A 1QB8A 2XBUA 3MJDA 3O7MA 4M0UA 1O5OA 2JKYA 2YZKA 3G6WA 1OPRA 1ECCA 5BRNA 1DKUA 3LRTA 5K51A 1JLRA 4RADA 3QW4B 1OREA 1UFRA 1P18A 4JLSA 1I0LA 4RACA 1NULA 4TWBA 3ACBA 1G9SA 2PS1A 1AO0A 1A95A 1PZMA 2PRZA 4P3KA 4RQAA 3OHPA 1TC2A 3LPNA 1BZYA 1P4AA
chains in the Genus database with same CATH superfamily
4GLLA 2XDQA 1KZYC 1C3EA 3RSGA 1FDVA 2EFDB 3BCSA 1FFGA 1ZP6A 1GDHA 3JWJA 5E6SA 5BN4A 2ZUTA 3CIOA 3L5KA 1F6WA 2B8TA 2GSWA 2PTGA 3E48A 3EQ2A 2CNOA 4N5IX 3RROA 4XB2A 1M7HA 3ABSB 2JW5A 1RP7A 1HT2E 3LBNA 2QTBA 1EGQA 2G06A 4Q3DA 1K75A 1YRQA 4S3MA 2Q0QA 5AW3A 3DBLA 4LHVA 4A10A 2W9XA 5KOJA 3QHQA 4A36A 3MB8A 5JMOA 3E5RA 4WERA 2A1IA 1XCPA 5ERYA 3PHBE 3WLQA 4I9FA 3ESBA 3L1IA 2NU9B 4NATA 4GP9A 4ENTA 1N2IA 3WRVA 2VJLA 3NYQA 4F6CA 3THXA 1OIWA 2NZ2A 3CB2A 1JF8A 1GTL1 1AOXA 3OQPA 4HBGA 1UPBA 1G8AA 1WHSA 2HK7A 1IEXA 4P3PA 2EW2A 4WWHA 5GV8A 2C0PA 1FW8A 4HEA1 4RD4A 4WNAA 3IR6A 5FBHA 4A2PA 4FD2A 4EHFA 3L02A 4MR8B 1VPEA 3R20A 1J20A 1RRFA 4EYSA 3NIBA 2FMXA 3LKVA 3OZFA 4NYJR 3HN6A 1SWVA 1LW6E 3JVIA 2WINI 4H59A 3H9UA 4C0AC 1VE5A 2G1JA 3AH8A 2VYVA 4MGKR 5EJ9A 1CEYA 1CZRA 7GPBA 4DIOA 2FUEA 1SHTX 3E3MA 2VNHA 4B4VA 4C5AA 1G5HA 1Z35A 3SYRA 1CD5A 4UUPA 2AQIA 1TQHA 2G8LA 3GD5A 2EHJA 3DXFA 1V6CA 3LBHA 5MN6A 1SZJG 3ZNPA 4IYJA 3FXAA 4RIGA 1JLKA 2BSQA 2I0FA 2QW0X 5TMBA 3ZKWA 1H1LA 2FEWB 3VU3A 1D1QA 1P2SA 1SD5A 2M1XA 3RC3A 1GL3A 2QZ4A 1JKJB 3ID6C 3Q10A 3WRYA 1MT0A 4RHTA 1PR5A 5JXGA 5KYTA 2C5EA 4IKOA 3OAAD 4OL0A 1N1DA 1SQ6A 2ZI9A 1OBFO 1WUHS 3FNIA 3H86A 3K9LA 4CLDA 3ZV7A 2FJUA 1IE3A 3NETA 4UD6A 3KB6A 3R6GA 2BZ1A 1PL8A 4KAFA 4BVFA 3AXTA 4UBIA 1H85A 1I2BA 3QV1A 4PLWA 1J2RA 5EWLA 2ZR8A 4M6WB 5SY4A 4EMUA 2ZIEA 3DOJA 3DFKA 4DDMA 1IJEA 2HREA 1U4OA 2CMHA 4YDQA 1H3EA 3MVEA 4KI0A 2PVPA 5C8YF 1DQSA 3T99A 4NU0A 1RD4A 4I0WB 1T5LA 5AH0A 5LZ4A 5J59A 2WW8A 2A5JA 2PGLA 2CL0X 2Y0EA 3PNOA 3P9IA 4NNJA 4EZIA 1XXHB 3CH6A 5JADA 3WLMA 5AHOA 4GXNA 1U0GA 3KQYA 3H9BA 4ITVA 1DINA 1PQYA 4LRQA 3C8MA 3UAWA 4FFOA 3ZHTA 2PUDA 4N5NA 4YS6A 1U0RA 1NOKA 2O2EA 1P0CA 1QE3A 4OMFG 3HDTA 4G5RA 2XNJA 1U8AA 2IXAA 2WJZB 4TZ0A 3GBPA 2FPRA 2RGYA 4PYRA 4O4LF 1SUEA 5HUJA 4YMTA 3GFFA 4NIMA 3VKGA 4WFKA 4HGPA 2HT6A 3D7KA 2D5CA 4CR7A 5BN1A 3EEOA 3KG2A 4IAOA 1YI1A 1NMEA 1QLJA 1F14A 2YJZA 2CXUA 1OZ0A 2R4UA 1A76A 3RANA 1IY8A 3GD7A 4MGEA 4ZOLB 1ECLA 1ATIA 1R8JA 3OEED 2WBLC 3DDOA 2WU1A 3HFJA 5FI5A 4U2GA 1OLOA 4MA0A 3ETEA 1DV1A 4DSAA 5CCBA 4W9NC 2V9ZA 3KX2A 1Z5VA 2EV9A 1AHIA 1GFZA 3FDZB 3WDMA 5BR7A 2XJ9A 3V8VA 3DMTA 5CG2A 3LCMA 3OFNA 3KYCA 4E94A 2QG9A 3LKBA 3BIJA 1ZGHA 1HMPA 1XHLA 4M7PA 4X62B 1HT0A 2HSWA 4BO4A 2AX3A 1Z15A 3GQBA 3UMBA 4YPFA 4RLFA 1A72A 1ATZA 1FMJA 1GAJA 1V4NA 2K2WA 2YFYA 3I6BA 3UB3A 2O8CB 1YRHA 3PHHA 2GN9A 3CQ9A 3DDWA 3B9RA 5IPFA 3A8TA 1H4QA 3NC0C 1Y89A 4HZUB 4INJA 1MABA 2DGDA 2ZT7A 1SXJC 5ALLA 4K6MA 5I5GA 3DGEC 4E2YA 3ZTWA 3WMRA 3U44B 1WB5A 2C5BA 2JNWA 3IT2A 1PTJA 2NUPB 1PR6A 3HO8A 1G8SA 4C08A 4F86A 3EXHC 3ZY5A 3CRRA 3C3DA 3DEYX 1EE9A 1PX2A 1E2BA 4I1RA 2BL4A 3ISJA 3DZJA 2PZKA 4LWPA 3RYIA 4C6SA 1LQ2A 3UYKA 4UM7A 3F98A 4MV0A 4Q4HB 2RARA 3V3KA 3ITDA 3C3AA 2NSYA 2OFPA 3TPZA 1AMUA 1UMBA 1FDSA 4BVHA 1GZDA 4K46A 2G5GX 3VZSA 4PC2A 3AI1A 2CB9A 1YB5A 2J0UB 3W05A 4HRAA 3ZV3A 4GPIB 4JX8A 4OXQA 1W44A 1Z0FA 1VA5A 3WGGA 5KHOC 4OSEA 2LUOA 3TSAA 4B7ZA 5KVVA 2QD3A 4JI7B 2ODBA 2EXXA 3ZCQA 4LJKA 5CH8A 1S96A 1NIJA 4IWYA 4P82A 5SYAA 5LP6A 3JZIA 1GV1A 4Q48A 3HN7A 2BE7A 1R0BA 1OFUA 3OOWA 1Y8AA 1JDBB 3R3VA 1E2QA 4G1MB 1E7RA 3PWZA 4YMGA 3L77A 2EP8A 2FEAA 2Z5LA 3P9ZA 5HQTA 2IS1A 4BZXA 3Q8KA 2VAWA 3O4FA 2IYRA 4RGYA 1LK7A 4RETA 4ZMBA 4HZGA 2HHCA 1MO2A 4Y18A 3ANNA 3L40A 5DTIA 3ZY6A 3SJCA 4CG2A 4ZGBA 3G1UA 4U6NA 1QBKC 4DA9A 1VG1A 1XAGA 2Z2KA 2MINB 2D8MA 1YFJA 1QRUA 3NDRA 4OQNA 3ZLBA 1L5NA 5BNWA 2ZPAA 2E1PA 1PYDA 4WNYA 4YACA 2C5SA 3CCFA 2JJ1D 3VJRA 5TIIA 4Z86A 4JL8A 1VIYA 1WL8A 3FYTA 2P0AA 3SC4A 1TC1A 1JQ3A 3MINA 4EI9A 2ZIAA 3BORA 1RKBA 3HBMA 4ZPXA 5D84A 3BOSA 2YXNA 4R1NA 4OCZA 1M6VA 5JHGB 4Q7JB 1W5BA 4HLUA 5DTJA 1RAIA 4E7PA 5IM4F 3G5MA 4N40A 5K3FA 3H5WA 4X1IB 4TL7A 5E0OA 1UDXA 1NAIA 4LDZA 4OI2A 1EX1A 4UE2A 3STHA 3ZIDA 1C5KA 3C3KA 3O31A 4IUBS 1HYHA 1U1GA 1W9MA 5AW1A 2HW8A 2QRUA 3W0LB 5BV2P 5JUWA 1Z6GA 5EQFA 5EYPA 1CHDA 3FVQA 3F6EX 3L5OA 3NORA 5L6MB 1DCKA 2B61A 2EERA 4XSVA 4OBXA 3RDPA 1RAGA 2NXNA 3EZ9A 3OX2A 4TN1A 5EQJB 4DM3A 3RK1A 3MG9A 4WXYB 3GY0A 4HC4A 3A4TA 3VGJA 1OC4A 2Z1DA 3I6QA 3VU9A 4ZK6A 2B7CA 1H05A 1F0KA 1X3SA 1TX4B 3DVSX 3QW2A 4DY4A 5FUQA 3DD5A 1AUQA 1VP3A 4JEHA 2QOEA 2XOKD 4Y2YA 1W47A 3OVMA 3TNJA 3ZLUA 5MN4A 3U7IA 2ODQA 1U2PA 1BCRA 2HRQA 4MW4A 4LZAA 3FNFA 1KKUA 1R6DA 3KTFA 1R64A 2C88A 5K6RA 3INYA 2WNSA 4I4NA 1O4WA 2GBPA 1ZI9A 3V34A 5LP1A 1RWPA 1C9DB 1ORRA 2VNKA 3CPHA 2H18A 2AL7A 3F46A 1E9EA 3AUUA 3MRXA 4UHKA 1U8XX 1DU4A 3THWB 3ER6A 2HO5A 1JZQA 2WTNA 3C3JA 4MRSA 1NAHA 4Y6LA 3H6GA 5ER6A 1Y0BA 2G70A 3NBMA 4FW9A 4KQFA 1N32B 4KKXB 4EKEA 2X8JB 3K0CA 4LE2A 1G16A 4D4JA 4RTJA 4DOMA 1U3TA 3CG0A 4MYHA 5GV7A 4HZUA 5HUQA 4IJWA 2XZLA 3RD5A 1KVSA 4N54A 2GHTA 2NO5A 1DPFA 2P1DA 2BRUA 3RIYA 2BMEA 2VJAA 5HQ3A 3R0JA 1FUKA 3NG1A 1ZH0A 2BFCB 3DBVO 1YCHA 5CT9A 4MUIA 2AF4C 2KQUA 5KTTA 3THSA 1ZITA 2L69A 4O4JA 3TFWA 2JVJA 2D59A 3BSYA 2JJQA 3DVLA 5L40A 2Y0CA 5COAA 1GAQA 1PD1A 1WDMA 2YWDA 1NLMA 3K72B 4F2DA 4W6ZA 3F5MA 2IXDA 4TS3A 4QULA 4C3ZA 4DQLA 4EAQA 3OQJA 1KMHA 5FWYB 3BWXA 2HMUA 2HU8A 4KR0A 1VGVA 5KNCH 1V8OA 1Z6YA 1S3GA 1XDBA 4MKHA 1ML3A 4YJ3F 2H1LA 3UPTA 5FWXB 2C4WA 2DQYA 3AETB 1FK8A 2WWVD 4UM9B 1R16A 2IY9A 4TLEA 2OFFA 3RFCA 1L5FA 3DTVD 1WQ4A 4V1CI 3JQAB 3UKOA 1ARZA 4OHRA 2OQ2A 2JLVA 1FFHA 2EFCB 2JRLA 4CLHA 1FIUA 3LUHA 3Q87B 2AOTB 3C4JA 3H42B 1SUSA 3TTWA 1WIWA 1VIMA 3HJGA 3K20A 3STXA 3GUVA 2ZWPA 1TEZA 5ALYA 5F7OA 5J4LA 5JDCA 3I39X 4CDMA 4HYEA 1EZ4A 2XITA 3M9WA 4Q15A 1YR8A 2XLCA 3RVSA 3WYBA 2A1UB 4IMRA 4FP9A 2I2XB 3FYUB 4MINA 4MICA 4BB5A 5I6DA 5ITZB 3DTVB 4DPLA 2VSYA 3G88A 2ZZNA 1Z0JA 1Z06A 3LKZA 3PQ2A 3FGPA 3T5TA 2OESA 2VUTA 3OA0A 2FRXA 2J4CA 5EMLA 4Q7EA 2Z58A 2UZ4A 1J2EA 2GN8A 1NVVR 3T3DA 2GYWA 4D0RA 2O9JA 4KFUA 4Z9FA 1S02A 3IMGA 5AHKA 2V3CC 5J40A 3L0DA 1F4VA 2V6GA 1AMOA 3DZCA 1X8XA 4CFSA 2UZ1A 1X80B 2EGGA 2JIPA 3MPUA 4NDNE 4B6QA 5L3RA 2IU0A 1DX6A 1K66A 3BGOS 2GDJA 4G09A 5CGZA 3LIPA 3OIFA 1CVIA 1BHO1 1MBZA 1NXSA 1KAEA 2ZS9A 5EIHA 3V4LA 4BXOA 2NU7A 2GPTA 1WUKS 1Z29A 3NXKA 3QH4A 4IZ6A 3ICQB 1SVSA 2QB5A 5DE3A 3GPBA 3W5VA 3AUKA 5JARA 1FMLA 3AC0A 3PHCA 2C1ZA 1NKVA 2B9VA 4GSKA 1GTG1 4UC0A 3O1JC 4UAJA 5LBIA 3VYUB 4BNYA 4EPWA 4QG3A 4I7EA 5HF9A 3AHGA 1PK9A 4GP6A 4OHFA 2G28A 1PD0A 5BOVA 3I04A 4HP8A 2CMKA 4RZIA 3GRCA 1BD4A 4K87A 3AEQA 3ZBUA 1ZSYA 3MHTA 2H3EA 2XODA 3GEEA 4HX2A 1Z63A 2J3JA 2DTDA 2J07A 3QBTA 2XBLA 1T5OA 1KHTA 1T29A 2EZ8A 4WI1A 1EZ1A 4FGWA 3EPLA 3HUDA 2WF5A 2QKYA 3O0DA 3SWWA 1JFSA 4M21A 3ZOZA 4E4RA 4EGSA 1A5SB 2IT1A 2XUGA 4HDAA 4WNIA 4NAVA 1CJBA 2P2NA 3D3WB 3EFHA 3X2SA 1RRPA 2D0PB 1XF9A 2L82A 2PKWA 2RHCA 2HCBA 3GDWA 1KMIY 5K8JB 5GVSA 2OYRA 3R7NA 1QFMA 2TSYB 3H8VA 2FXVA 2LPMA 3B1YA 4XOIA 1GTJ1 2QMOA 4GEGA 3PRHA 1CUFA 1V35A 3BRWD 1PEDA 5BXQC 2O3SA 3CU5A 5GJVC 2XE7A 4MQ6A 3TLGB 5IWAB 5A0TA 1YJXA 3N0RA 3SC6A 4NKRA 1CR2A 4X3PA 2A67A 4LTMA 2V8OA 3OCWA 3RS5A 4AN1A 1I6KA 1W75A 1C8BA 3EEIA 1VCMA 4CRWB 1I1OA 3C98A 1TUEA 1IEWA 1L9XA 1GUYA 1VLMA 2CSUA 2HU7A 3LK7A 4BCBA 2WSYB 3BHNA 4E30A 4ME6A 2XXJA 2H0QA 1ZU4A 2AJTA 4Q93A 3KSDO 3JWGA 2VK4A 2A92A 3A6DA 4AUKA 2YWJA 4IIVA 3MTIA 2B21A 2AMYA 5IXYA 2ERYA 3M5CA 5GTDA 121PA 3B1FA 2CY0A 1LRKA 1Y8ZA 3K6RA 4OPMA 1UXKA 2EU8A 4JLUA 2OPBA 3X1DA 2R8PA 2I4TA 3GHHA 5ALQA 2RI0A 1U1DA 2V7PA 1ISMA 3FH0A 3K09A 2FRVA 4PZLA 1L8OA 2E49A 2PXCA 4PX9A 1Q0PA 1SBCA 4GC5A 4L2IB 2DSTA 1X1QA 4M1ZA 3USCS 2K4MA 5IKOA 4DAOA 1V3TA 2PGIA 1X15A 5F4ZA 4G41A 5A2GA 3E18A 3NZEA 4TRMA 1GGJA 4I9UA 1XJ0A 3QVGA 3VZCA 2YV5A 4YGXB 4PYMA 4TN5A 1RZRA 4OI1A 3N0TA 4QGAA 5GONF 4B3BA 2GJSA 2XQIA 3KSUA 4HFJA 4EKIA 4Y9TA 4B8ZA 2P68A 4OGFA 2POCA 5JO0A 5AKKA 2CBXA 4B74A 3GPLA 1A8UA 4Q39A 4ZJUA 4DV1B 1T0IA 4YR9A 3QA9A 4K9LA 3CUWA 1SUPA 1LDMA 2LKDA 3KKOA 3RH0A 5I7AA 3LU1A 4YH1A 2H0RA 2HH9A 4YQZA 1AQUA 3ROTA 4B09A 4OL9A 3B9QA 5AWFC 2P1RA 4MZDA 4EFLA 4F8JA 5IT9A 4TQ9A 2J9YB 1FSGA 5IT4A 3TR6A 1UPTA 5FA5A 1AT1A 2V7XA 5A7GA 3T5GA 3ZCSA 1JEYB 1T6BY 2C20A 4MRVA 3DKRA 3QGMA 5HFNA 3H4IA 5B3JA 2A3NA 1NV9A 2QXYA 3N3AC 3RK0A 5MHTA 2I1LA 3N2KA 4N8DA 3K0AA 5EPUA 3TB6A 5TVGA 1KY4A 1GCUA 4P4LA 4U9UA 2UUAB 4I99A 3SMVA 3BMQB 3FGOA 4E15A 2UYCA 3O92A 2FVYA 3DVQX 1X14A 4FVTA 4HUQA 4OX9Y 3KT8A 2PBRA 2GPJA 1J5EB 4RTSA 2JZOA 3OOSA 4XRRA 4Z4QA 2DWPA 1W1WA 1D6MA 1W4AA 2BTQB 4X20B 3BCUA 4Z4IA 4DADA 1X39A 4GFDA 2EWVA 3BAZA 3E7DA 3PE3A 4J1NA 5EJFA 4IQ8A 4BLSA 2YN2A 3CNHA 3IYLW 1LTKA 3LP5A 5EAIA 3RFXA 4WT7A 4D6XA 3OHMA 1U8ZA 4B3SB 3NDIA 4HVAA 4GT1A 1IIRA 3KDPA 3D4PA 3HYLA 4JP1A 2JCVA 4R0NA 4PHHA 7YASA 1R9GA 4ND8B 3VO1A 2I6TA 5JCJA 5TJ9A 3BFXA 5HILA 1LS1A 3EW7A 2PWZA 4X7BA 3MWDB 5C8DA 5AVUA 1FLVA 4IIEA 1DIAA 1G4HA 3B5EA 1A4RA 1MVLA 4U3JB 5EKXA 4F11A 5BWLA 3NTUA 1OV6A 5JECA 3FOZA 4AROA 4KU4A 4LYEA 4UM9D 2PBLA 2GAOA 4B4UA 2R5FA 1GZVA 4TMTA 3AXSA 3NCHA 4LZWA 1ENOA 3EG5A 2IYTA 3VVMA 3CVJA 1J99A 5G3YA 1XZKA 4RV9A 1G20A 1QYRA 3E9RA 4IDGA 4DA7A 1E66A 5CJ2A 5KTNA 3O03A 4CV1A 2VDPB 4QFMA 3DMFA 1KO8A 3KFLA 4UU8A 1UINA 1E6LA 3R74A 4LHYA 3VR0A 1IBLB 1XLVA 3DVRX 2CF5A 4M1YA 3ZEIA 1QF6A 5IBRA 3JAWA 4P5DA 3QEJA 3W78A 3WWYA 5BT8A 4RZQA 4RLSA 5BNFA 3CEAA 5K8UA 1D0VA 1CSEE 2OFXA 4Y2XA 4RW0A 5G0UA 4ZYWA 5BW5A 3OTIA 1RNLA 4ILEA 4OB8A 5FPQA 3RR2A 1P5JA 5TRTA 4XQCA 3U3JA 1KVUA 3GI1A 3MS2A 1L7QA 3E9MA 5T3YA 1U7WA 3QU5A 3T5AA 4NX2A 2HRCA 2VHZA 1I0LA 3E9QA 1XQVA 4G37A 1KY3A 4AVYA 4B83A 4I1PA 1RWNA 4BFUA 1E0AA 1CY6A 3VRHA 4KPFC 1P9RA 4HL6A 4Q3BA 3MCAA 4EKNB 2FV8A 3RYIB 2XYVA 4KO1S 5IN5A 1PE0A 2OL4A 5I7OA 4H6XA 1JAXA 2UVPB 2YL2A 3EVTA 4J1TA 4L6IA 4WMLA 4EGCB 4NOMA 4JB3A 4G5YA 4PG6A 2OB1A 4TT3A 4Y2GA 3TXXA 4YT2A 4ZCIA 3PNPA 4RY0A 2XUZA 2ZTMA 4JK3A 4ARAA 4B2LA 1Y3CE 4X63A 1WUTA 4Q03A 3BA1A 1QG6A 4GWLA 5ENDA 1JHPA 1QIMA 4RD6A 3U9LA 4QGGA 3WLOA 2Q6TA 1JHUA 4F84A 1PHRA 4WJZA 2OO5C 4YGYA 2UUOA 4XQEA 1H23A 1UC8A 2P2LA 1RXWA 2JCBA 3JZAA 4QTYA 5L4SA 1LDBA 3K32A 2C03A 1E96A 4MRNA 5DSTA 3EOBI 4MZXA 1X42A 2IZ7A 1BH2A 3SEAA 5A4FS 1DIGA 3I01M 1Q74A 3PRKE 3DMNA 1LPSA 2LR0A 2YFQA 4QYMA 3VR5D 1ADFA 2QV0A 5KC8A 5H68A 3IO5A 4IWXA 1SXGA 2WD7B 3K0KA 4JL6A 5DRTA 4B47A 4CM9A 1GV0A 1UT6A 3FTEA 5IDXA 3QKUA 2VZEA 5IKXA 1JYFA 2HBRA 3QVLA 2E4AA 2HN9A 1NPDA 4RDXA 3WK4A 1GZ4A 1N0VC 2ZE8A 5I7SA 2J5QA 2NUTB 3DV0A 1UPFA 2JI4A 1XEFA 1J25A 3GYBA 1BEEA 1JEDA 4OOFA 3U7QA 1T13A 4FS8A 3HDJA 2DJIA 4HXEB 1VKJA 3EVGA 3E23A 3IP7A 4Y1GA 2AXPA 2OG2A 2JIZA 5DEIA 3OX3A 5HMLA 2VIIA 3PFKA 4QU8A 4HGZA 3VOBA 5EE5B 4M9SA 621PA 3CTMA 4ZU6X 1QQ7A 5EG5A 3QI2A 2HPVA 3URMA 4KCGA 4U7DA 1WZEA 4BQQA 4PU0A 1WRBA 2G8NA 1N9KA 2A35A 2DY1A 2JJYA 3GB9A 3HKCA 2NG1A 2X7HA 1ZONA 4JI0B 3ORSA 1KORA 4OQMA 3PFWO 1Z88A 3IJPA 2NU8A 3VC7A 4OJKA 2AFIB 4ZKEA 1ZMXA 4DG8A 3GJ5A 3GPIA 3E9ZA 3D4IA 1EZZA 1YA4A 3TJRA 3P9SA 2OP1A 2E89A 3I42A 5FORA 5GY7A 3WHKA 1V8FA 2CXSA 1OHHD 1Z33A 2TMYA 4HWTA 1Z2AA 2IYUA 4OHXA 5GJBA 1UEJA 3NHMA 1VHJA 5IRCD 1WV1A 1GO2A 2HI0A 3K0CC 4WADA 4HEJA 3OAAA 1XZPA 5C8YB 3FKSD 5C81A 1DZIA 3WJAA 1ZIDA 4F4JA 2PGJA 1UH5A 1IZZA 2C2HA 3K6SB 3CZ9A 2OHXA 2PX4A 1L5HB 1N2JA 2SECE 5FYDA 1L7AA 1P6XA 4OJYA 5HZGA 3S81A 2AFHE 3C5WP 2CXPA 5K8VA 1AZTA 5ALMA 5K3EA 1DX4A 1RYDA 3BRCA 4H17A 3W3ZB 4L95C 2IOFK 1WR8A 3FDFA 2ZROA 3SF8B 3ECAA 4ZVSA 3VH4A 4ZIRB 1EA7A 2Y3IA 3NNDA 4PICA 4PRLA 1FXWF 1Q7RA 2WYUA 3B7WA 4QOFA 4YJGB 5LUBA 4YCNA 4KDCA 1LDYA 1GNPA 5IYZF 1EUCB 3O8OA 4MDHA 3F6CA 4AG6A 1AE1A 3V2HA 5EKSA 3WXMA 3GBVA 4P92A 4D0GA 2RSLA 1LX7A 4QXQA 4JOCA 4CG0A 3LKDA 5CA0B 2VOJA 1YQQA 2I3AA 1A88A 3NVDA 1U2QA 3KP1A 2NZXA 2HEIA 2Z6AA 3HR8A 5C34B 2HSJA 3OIWA 5AHRA 2PZLA 1LCIA 1YGPA 4LY0A 1SURA 3PQ6A 3DFIA 3CO5A 2ENUA 3V32A 3FTDA 4RDCA 1RP1A 1UC5B 2O0HA 5F21A 4IVRA 5HKAA 1TK9A 1LTHR 3KKMA 1DEHA 3DZBA 4OH1A 5BW6B 1CB0A 5LXTF 3BXHA 5CT8A 1ZJ5A 1UPCA 3BB1A 1BCRB 4IP0A 3V00A 2QLMA 4V1CB 2I5PO 2GESA 4X0EA 4OXKA 3WMEA 2AJLI 5L7TA 4WKPA 2DJ5A 1V11B 4MKFA 4QGFA 1P4JA 5E38A 1DFIA 1UZUA 3JQBA 1QHYA 4Z1OA 1PFQA 5FTWA 4EOGA 4L75A 3UG6A 1UUFA 2C92A 2VL7A 4EK9A 4PO8A 5TY0A 2QUBA 3TCNA 1GRCA 2Y2VA 3DEKA 5L7WA 4NCJA 5D1HA 2IPNA 4ALNA 1WPXA 2JJMA 4MA5A 1P7VA 3WLNA 3HK2A 2P1ZA 1QTIA 2P9CA 3L05A 4D8XA 4ZJPA 4OHYA 3GGPA 2X42A 2W37A 3GDOA 3B6ZA 4KQCA 4XDYA 4YYEA 4K9SA 5DNVA 5JJKA 3T8YA 3KVNA 5IFKA 3ZCTA 4DWOA 4LXHA 1BWRA 4R1PA 1NYTA 3CX4A 2WUWE 2HTFA 2I67A 2LCIA 4GMDA 4GNKA 1VHLA 1FP4B 4EKGA 4DQVA 3W5BA 3TOXA 3JYHA 3OY7A 4LXXA 4V39A 1N25A 1W88B 4D45A 5LXTB 3DYIA 1TYCA 2RGDA 3D7MA 4BJ6A 2XIQA 3BL6A 5AM3A 1RMTA 4FM9A 4L6CA 5AOCA 2O2IA 1Q7BA 2E55A 4FJ1A 5CK5A 4I50A 1P74A 4JLJA 3H84A 3HXMA 4L07A 3QSYA 2BV3A 1BVHA 1I7PA 3HDGA 2E6UX 2VZ0A 1WXXA 3LCVB 3QG1A 4O63O 1U04A 5IK2A 1RYNA 3ZDZB 4CU5A 1SVNA 2V3VA 3C8UA 2DH6A 4ND7A 2VRCA 1X7YA 4C14A 1AZWA 1U2DC 2HBZA 2DLNA 2WF8A 1T8WA 3AB7A 3MQ4A 4M36A 6Q21A 1W5SA 2QN8A 3A9RA 4G4JA 2VK8A 1W5AA 1WKBA 2R5WA 3RBAA 4HGRA 3IP9A 2PZ8A 3OF2A 4CMHA 5AKEA 6REQB 3MBIA 3TX6A 1UDCA 2PR2A 4DXAA 1OU0A 3OPQA 4W1SA 2O8EA 3PDUA 4UCXA 4XWGA 2GK7A 4EFMA 1U3VA 3PD7A 3QKRA 3EE6A 3ANXA 4A7PA 5AW7A 1CEEA 4PCLA 3R3JA 4WHMA 1C41A 4DT1A 2X4DA 3VKWA 2AUNA 2DBZA 4M7OA 4B6SA 4HVCA 3ZDYB 1WPRA 1CLEA 4FT2A 3ZZ1A 4PIPA 2I3BA 1K7EB 5AKIA 1BEZA 3V42A 4PZZA 3CXUA 3HYTA 1G8GA 1JQBA 4LRYA 4ZDIA 1GNRA 4D9IA 4RZ3A 5G0TA 1KF0A 1VG8A 1VHTA 3OPYA 4RD3A 4TWJA 2ZRHA 1RACA 3BXXA 4IFBA 1M5UA 2QG6A 1WXWA 2BEUB 2XYHA 2OHHA 3IDAA 1Y81A 1QC5B 3GNLA 4P3KA 2X8AA 5LQMA 3OHPA 2VT3A 5IUKC 2H3HA 3RSOA 3W1WA 4C0LA 1CV2A 2CXNA 2Q4DA 2W6ID 5LJIA 5CCXA 4QICA 1XVVA 1GG8A 3WBBA 2HOQA 1U8EA 2GBLA 4CIXA 2GXAA 1PCXA 2JH9A 3HA5A 4HRVA 3VM6A 3SIWA 4TTAA 3A0RB 5L95A 1JTVA 2BEVA 3FYSA 3H2ZA 3OLYA 1G55A 3K9GA 4W63A 4CXMA 1RWOA 3LXUX 4S1WA 1JQJC 1MIOA 3ZU6A 2YV1A 4DTCA 4KGZA 1K2WA 3P9PA 4KG7A 3FUCA 5JNSA 4B31A 4Q1AA 3ZNOA 4GKBA 5TSDA 3L49A 3TVYA 1KH1A 4QDZA 1ZD9A 2BR5A 4EHHA 2I3ZA 3L8CA 1Z2NX 4TZ6A 3LNTA 2ZYUX 5JDCC 1P44A 1SQFA 1LEHA 4BBZA 4UFOA 2WG0A 4HMOA 4UVEA 3K8QA 4MQBA 1IL0A 3GHYA 3O38A 2PWYA 4BQIA 2H06A 3K1ZA 1L4EA 3SJAA 3MAGA 1O6BA 4YT5A 2ID9A 3CCCA 1MB4A 2ID4A 4I8XA 4R2JA 4LZZA 4RELA 4PBRA 3JAKA 3VNSA 2YN0A 5FIUA 5CX1A 1HDOA 2VEOA 4WAUA 3UZUA 2RAFA 2VDMB 3PKJA 3FCUB 4YHBA 1M3SA 1NW4A 2YZMA 1XZLA 2X0JA 3E82A 4J0GA 3VV2A 1PGPA 4CF5A 4KYVA 1QMGA 1B42A 1SKUA 1BSVA 1FFEA 1TRHA 2YN4A 3CZPA 3UWMA 3I64A 5DI9A 3SQMA 3I6IA 5FOQA 2XZTA 3NWEA 4FYVA 2CUTA 2O2CA 1WETA 1DARA 4DIEA 1BVYF 1KFEB 1ISRA 1YS1X 2J45A 2EIHA 1XTRA 4L85A 2BFEB 1S8FA 1XPUA 3IOBA 2KE5A 1JFLA 3CZAA 1ZRNA 4V3BA 4LIPD 4DGSA 1KO5A 3LCCA 3U56A 4BP8A 2B6NA 4N5LA 3EISA 2JIDA 3QE9Y 4FGZA 2OGTA 2EBHX 4KVZA 4RNDB 3FOFC 3GJZA 4NYMR 3EMDA 1D5WA 1KEWA 3AM5A 1MX5A 2B4TO 2FR8C 1EP1B 2CVFA 2G6BA 2OV8A 3GA7A 3IBSA 3PC4A 4KFTA 4PO9A 4BKRA 1XN1A 3DF9A 2WPDA 1NI4B 3PXEA 2VDNB 4ZN6A 2ZTHA 2QTTA 2O8CA 3R1IA 3RSHA 3EZGA 3DQQA 2J48A 5KYGA 4P31A 1AQLA 2ZWOA 2IHUA 2VHJA 1EFVB 3PBKA 2P0YA 3DMPA 3E05A 4CHGA 1G41A 1JJ7A 4DQ0A 1MPTA 1B8UA 4HLCA 4L4UA 4M9CA 4KXMA 1N4DA 4PYKA 4V3CA 3JQRA 4EVSA 2PIAA 3KKKA 5JCPA 5EKTA 3DAFA 3B36A 1YC5A 4UHBA 2IW3A 1A4IA 3SBEA 5SY6A 1K98A 1NQXA 4HGYA 3T3HA 3HXLA 1ODLA 3H16A 3R0ZA 4PHFA 4ZYLA 1YR2A 1KARA 1CULC 4IGIA 5HTOA 1ZQ9A 5JYEA 5T57A 3ZYZA 4KWCA 2GNAA 1R18A 2QZPA 2FKAA 2GWHA 2WKPA 4RQTA 3OEYA 2FDRA 2Z2ZA 2WRZA 4Y1FA 4TVOA 3GLFE 4ZQBA 2ZATA 3REQB 1E63A 2PSHA 3N2EA 3KAQA 5E1OA 1SH7A 2GGSA 4CBVA 3E9YA 3AEQB 3QA3E 3R3WA 4HEHA 3V4FA 1I36A 1FQOA 3K9QO 1FOEB 3QTTA 4U7HA 2PNJA 1YS7A 1DBWA 2W8ZA 4MDEA 5JJIA 1DCMA 3F97A 3LC0A 4XVCA 3HKBA 4XD7D 3CA8A 4TPKA 4IX1A 3I5AA 3M8KA 1C7IA 1G8FA 2IHKA 4G0QA 4JEMA 2Z43A 2PN1A 1TU0A 2WF7A 1CIPA 2JJ2A 3B5JA 4UATA 5SZKB 4DQUA 1KEPA 2A4MA 3IMCA 2YNMC 2X19A 8ABPA 1VKNA 2R6AA 2FW9A 1PJCA 3EWSA 5EJAA 2DQ4A 2X0EA 2RC6A 1TZJA 5F2KA 2H4JA 3CGWA 3F7TA 2EKDA 3H1TA 4C3OB 4FXOA 1USKA 4LI0A 2WJAA 1TVMA 2QVGA 1WP4A 1JE1A 3D6JA 1V1MB 4X94A 3WSTA 2PD3A 5F3DA 5CA1B 3PQCA 1MAUA 2JAXA 1VPLA 1XQXA 1DJPA 2XZDA 4XYMA 4LVUA 4Y9UA 1TCCA 1PJAA 4FFWA 1E3QA 1DO8A 1S2OA 3GAAA 3MRSA 2RJOA 1YVRA 3J81A 3OUTA 4MRAA 4IEIA 4AUEA 3UGTA 3FCSB 5BV1A 5HKKA 5LYYA 2G36A 3RIHA 3UYLA 4ACBA 4UZEA 4AMUA 4D4MA 4JUCA 1XU7A 2O8FA 1UIMA 4R41A 5C3UA 1GR1A 1OBOA 3UWOA 4C7JA 2J32A 3IPYA 3FNEA 1WXHA 1HUQA 4LQLA 4Q9NA 3U39A 5AW4A 4PZEA 3ZCXA 3IQZA 3IJRA 2BT4A 4H1HA 1J2UA 5DN6A 1CS4C 4FDUA 2QMUA 5HCUA 2IWRA 3V4OA 3WIUA 4AO7A 4RHXA 2O3UA 3ZHRA 3QEMA 4EKYA 1GTSA 3K53A 1JSCA 1T5SA 2GYYA 4JL5A 5EMNA 4I3HA 3A1DA 1MFPA 3FF4A 4Q05A 1A9XA 2WKRA 1VE7A 1ZGCA 2JGFA 2ZRMA 1TYZA 3KYIB 3LT4A 4RPJA 4YLEA 5LLSA 2JC3A 3AWDA 1UEIA 2JK1A 1T3HA 1Q0RA 3OEWA 3TIGA 1COWA 1S5PA 4EENA 1M6NA 4N65A 1XCGB 1YB7A 3HLYA 4XLTA 2Q07A 2R68A 1Q1EA 2QX7A 4PTYA 1OVMA 1Y1LA 4XCXA 3UEOA 4LF8B 2F6RA 3L7KA 2H48A 4QELA 3HUTA 1S2MA 3TH5A 2HCTA 4TM8A 1U3GA 2I6QA 3UUFA 4I8IA 4F1JA 3G2KA 3LTNC 3LOQA 4GE3A 4JP8A 4NZYA 4JWKA 4AY5A 1NGSA 2GCNA 3BGVA 4BLQA 3ICCA 3BAFA 3GUZA 5CJJA 1VQ1A 5DFAA 4IL5A 5GWXA 1UT8A 5TQ0B 2RH4A 2BHNA 4MLPA 1UZLA 3HGQA 3OG9A 3FYDA 5EHZA 1HWYA 4UUQA 3IILA 3QOWA 1W1UA 1K6EA 2VDJA 3DUFA 1VL5A 4KIUA 5HK8A 4YXWA 3V97A 1W96A 5KEIA 4IDHA 2BY4A 1OWMA 3O7MA 4QOHA 4DV3B 1Y3AA 4L0DA 3GGOA 1UXJA 4XM1A 2PUVA 1IY1A 3IALA 1FP6A 2COKA 3WK6A 1YS2X 1FJGB 4I1IA 3PUKA 1M8JA 5CYFA 3URKA 1T35A 4M37A 5AK5A 2YWRA 3MNFA 3LLVA 4ZCPA 5CM9C 2RGAA 4IRMA 4L9WA 1W19A 1QG4A 2F3SA 2PM8A 3AVQA 4RM3A 4TMVA 1GG5A 4KXNA 3M3DA 1XPRA 3LT0A 3L8GA 2I91A 3HU2A 3WTCA 2GJ8A 1UFVA 1A2QA 4FNAA 1FFSA 2WFLB 3TAXA 1OH7A 1FP7A 5AOAA 3VTFA 4CQJA 4H7JA 1NVVQ 2O5CA 4ZZ0A 5JQGA 1Y9JA 3L7DA 5DEOA 4CQLA 4DMRA 2E48A 4WZ6A 3ZHUA 4LHEA 1WXFA 1NDHA 2AZMA 2D1YA 2ZU6A 3R5HA 1MNQA 1XNGA 4AUNA 1UR5A 2F3RA 2JAWA 4IX9A 2GM3A 2Z2YA 3FFAA 1X1DA 4TKVA 2BSAA 1TAGA 2CHUA 2YHSA 4LQ4A 2HQBA 3LX5A 5KB3A 3ZDDA 2QU8A 1SQ5A 2CZCA 2X2EA 2ZJOA 3KJQA 1ZOSA 1VMAA 2PZJA 3OZSA 2AZDA 3S1LA 5EIBD 1A5AB 3AOEC 3EPRA 3TOCA 4ZI7F 3CM0A 1ZLXA 4BNGA 1JMYA 4H60A 1GSOA 2EFHB 4OHBA 2PRSA 3CLKA 3MAAC 2BCEA 3WIEA 1XRLA 3RSSA 4JHXA 3U9SA 3NFYA 3E84A 4OUDB 2I2BA 2EJBA 3BF8A 4PLCA 1U9JA 1RPNA 2OWDA 4JJ6A 4AKEA 4DYVA 3IEKA 3ZUPA 4B48A 1QKJA 3GLIE 2ZIGA 5FR1A 4PZCA 4L78A 1K08A 1TQ8A 2C77A 1IDOA 2A1UA 2RHRA 2C83A 5ITZA 1QZUA 5D51S 4EW6A 4FMDF 4IHKA 1QS0B 1E79A 2BHLA 4P8RA 4RCVA 2XJ4A 4NU6A 2W2PA 3EC2A 1AB5A 2H54A 1MJFA 4BAZA 3WL5A 4KGXA 4BZPA 3HDQA 3B3QA 1SPXA 5HBGA 4GWGA 1NYRA 3BKWA 5KYWB 4WQMA 4QRDA 3FPCA 2W6ZA 3FDIA 3FLBA 2KB0A 4EM6A 3Q0IA 3X44A 3VZQA 4C3UA 2H7VA 3LT2A 2HLDD 5DU2A 3M4NA 1QR6A 3KNZA 1ZZGA 2ZXEA 3GLKA 2XSZA 3R23A 5DTQA 1ES9A 3QY0A 4N48A 4BB6A 2EJWA 3HRKA 4CUZA 1K8YB 4ZJZA 4NBSA 1X7ZA 1JJVA 2PT5A 3JARB 1IUOA 1TU3A 1E2DA 1SCKA 5DGCA 1CQIA 4GZMA 3QITA 3C74A 3WWCA 2I4NA 4YJFB 3V8MA 3MJFA 3OM0A 2XF8A 2JFVA 4OYRA 1XZQA 4L0CA 3EG9A 4GYYA 1E6UA 4F2GA 3LOUA 3UB4A 3PYMA 4QO8A 2EX0A 3PFBA 3DJYA 3B6IA 3O2JA 3JWPA 5A02A 3A9TA 4Y2QA 3F8TA 1FPMA 2R6JA 5F1PA 4PLHA 4XM0A 2H1OA 5B7QA 4DJFC 2FZKA 4QM6A 3K70B 1CJMA 1U8CB 1UZAA 3LYAA 4IW3B 5IAGA 1XD2A 2O7SA 2V7QA 2V0NA 4MVJI 5L3SA 2C3UA 3EQ8A 2CEAA 1CVRA 1I80A 2JEZA 2R00C 3PC6A 4N7MA 3O3NB 2EL9A 3FPBA 4HWKA 4N6OA 4PLPA 1W88A 3D3WA 2VJNA 5D3MB 2Z8ZA 1N2OA 2B1RA 1EFRD 3PP8A 3TQCA 5FFNA 3GBSA 5TGDA 3PFHA 1FFBA 3PNSA 4IS3A 3VZRA 2QE6A 1UKAA 1PWYE 1U6JA 1TC2A 1X7GA 2I4MA 3HEBA 4KV9A 1PJ3A 4TROA 3S0JA 2FPOA 4D9KA 4F3YA 3TS1A 3L8YA 3G0DA 4GX0A 1D9ZA 1U28A 2V5VA 5JDIC 2BEJA 5L45A 1Z34A 1U0NA 1ULAA 5K0BA 2HSEA 4LK2A 3WFIA 3ZZ0A 1EUZA 1RHKA 3IPXA 2H2IA 2VLBA 1XHFA 3ELYA 4IVNA 4NOLA 2G08A 4O33A 4OHWA 1IOWA 2C4HA 2J31A 2BKEA 1RI3A 3VDNB 1E1KA 5E4TA 2UXDB 4NFHA 4PQFA 5IC5A 1QV9A 1WXQA 2Q45A 4JHLA 1AN0A 3ZOKA 3LHDA 3WJ1A 3RYHB 7AT1A 2DKFA 3OE7A 3AOEA 2IPAB 2IBMA 1F2VA 3PICA 1ZGAA 4S2UA 4WFIA 3LHSA 3JXEA 1A9RA 2TYSB 4PQGA 5JXJA 2EG9A 3NO4A 3AERA 5DYIA 2I8AA 1ZIOA 1KI6A 2ATIA 1SUAA 1XT6A 1CRZA 1Z07A 3OPVA 4OO3A 5D5PA 1B8PA 3EPJA 1EM8A 4KQXA 1KJYA 1O87A 1XTVA 2H1HA 3EGEA 3OZIA 4HTFA 3VGPA 5KNCD 3M6FA 2QYOA 3D0QA 1L4LA 4W1PA 5IKPA 2Z1MA 3OPYI 4P9NA 4XIYA 2GKSA 4DUZB 1ZR2A 4FQ5A 1GPDG 4MYDA 2YRWA 3L92A 5KQSA 4E09A 1XFAA 1E3DA 4URVR 1AS3A 3BMXA 1VHDA 2XNKA 5CDFA 4DV5B 3W9YA 4F12A 4Q24A 4GKKB 3AUAA 1N6HA 1RLOA 1HEYA 1XNJA 4LBYA 4D26A 1ZKDA 2ZAGA 4HWPA 1VSQA 2RK3A 3UN1A 2AXQA 3WK9A 3TMYA 4PYJA 3FMGA 5LOVF 4J3JA 3C1TA 5ENVA 1JKIA 5SYMA 3C1AA 4ZI3A 1ILWA 4U5XA 3QMPA 8GPBA 1R3DA 2ZBPA 2BBWA 3LT1A 3OSUA 4Q47A 4KC0A 3RTGA 4KQEA 4LY9A 1Y8RA 4UOEA 1N2CE 4MS1A 2QLLA 4NSNA 2DC1A 4PBTA 2YWBA 4O2BB 3EAFA 2O8DA 5LA6F 1W4CA 2HA6A 4EH1A 5LZ2A 4JIMA 4P86A 4D3YA 3FROA 2FLVA 1BCSB 1U7TA 2R6CA 5E1MA 5ALEA 2PRIA 3CNBA 4W7IA 5IVKA 4GZ5A 3ABQB 5TPWB 4B81A 3LY5A 3R09A 3KQPA 5G0SA 5MF6A 721PA 3ZE8A 2B98A 4XM2A 1L8AA 2O7VA 2MIIA 1G18A 1QUEA 1RS0A 2CLHB 3H18A 3DR3A 5IANA 2WIKA 4J0QA 3DP9A 3KLMX 4ZVVA 3BDVA 2RB5A 3LHFA 3WGQA 5CFPA 1N78A 2ASEA 4D41A 2MMCA 1LNSA 1Z08A 5DLYA 3RABA 4QVKA 2ISQA 4DC0A 2BVNA 3PITA 2O3RA 5LOVB 1FTNA 4QWWA 2J3DA 1FDOA 2IS4A 2WTUA 2B3TA 3LLSA 2QRKA 4R8KA 4B32A 4ZT4A 3Q7SA 3RS8A 2Z6QA 5IJ9B 1L4KA 3ILHA 3RLFA 1O77A 3ER9A 1YQWA 1WCV1 2R1ZA 1A5ZA 3DZKA 5EJGA 2BGNA 2AA3A 4NZZA 2YINC 1G8PA 1HQYE 3KFVA 1NQVA 1FZTA 2D74A 3GCZA 4B44A 2ZYDA 4YROA 5TC4A 3JD2A 2VI5A 4KBFA 4LGCA 4QYIA 1LGYA 2YTZA 3V5NA 4Y2JA 1FX1A 2SICE 1T4DA 2RH9B 5CP8A 1O96B 3CZMA 1GPJA 4LV8B 3RU7A 1QVRA 3G8CA 5EIBC 5BYJA 1A1VA 3LXMA 1ZDMA 5IXJA 1GAEO 1QFJA 1HORA 4KQ2A 4HDKA 1C8LA 4COKA 4Z7OB 4G1BA 2MR5A 2RONA 3EARA 3JAWB 1KMHB 1U3FA 3B2NA 3EWNA 3I4CA 1SKMA 1OXUA 1I6LA 3AKDA 4L4SA 2X3YA 5K45A 1C9YA 2QSZA 1IG0A 4FFMA 4G5SA 4NMLA 4OHMA 2IVFA 1OX6A 1N5JA 1O6ZA 2E5WA 2GCGA 1TA9A 2ONYA 2OOKA 2WWIA 3ECCA 4IOMA 1CUXA 1NVUQ 3JATB 3ZWKA 4E5PA 4QYXA 1L7OA 1N33B 3W5UA 1MB2A 3P9QA 5HR5A 4HDSB 1NTOA 1DCFA 5ULLA 3DKPA 1J2JA 2QJFA 2FSFA 2VQ3A 1L7DA 5E3IA 1B2RA 3QOYA 4ZVMA 3RUPA 3V33A 4QDKA 3GFQA 1S2GA 5BSUA 2X3UA 1WVMA 2BEWB 3M0EA 5HGXA 2PUWA 2ZE6A 2JLYA 3D4NA 1MF7A 4LYAA 2ZI6A 2WMNB 1DLJA 4DMFA 1NF3A 4XCVA 2YHIA 3RBZA 1KAMA 3LFHA 1PEKE 2J3QA 3C5EA 5LP6C 1ZCBA 1CJTC 3HI6A 2X0FA 3SLRA 5ALZA 1QHFA 2JI6A 1JPVA 2CDAA 2FFAA 3GFOA 4JA2A 5DK6A 3W7BA 2YVKA 3QXCA 2PGXA 4W1RA 4F8EA 1SRQA 1H4SA 2HADA 5KDDA 1PZFA 5DBIA 4R40A 4DDTA 4UMFA 4QC2A 4Y6SA 1VJ0A 2DWQA 3PC8A 6GPBA 3T9BA 4M0MA 3GMIA 3Q4GA 1DAOA 1R50A 1ORVA 3TD6A 1Z56C 3VR4D 3W6OA 3BKXA 4M8KA 2ZJ4A 1LPPA 1ECGA 1EJ6A 1JH9A 1RMYA 4NRDA 4TTVA 5JCXA 3AESB 3MWFA 4UARA 3OJWA 1Q1BA 1IZ0A 4UQOA 1IRIA 1RLTA 2C94A 2EFYA 5AVKA 4KJZA 5IBCA 1PV4A 3ZE0B 3NAGA 1N5DA 1X1TA 2PNFA 2Q21A 4FSXA 4CHTA 1E8DA 1NBWB 3ZXYA 1F0YA 3ZV6A 1G3QA 3LQRA 3PUJA 3USES 4PC7A 1RMQA 4PO3X 2WEKA 3CN7A 4DREA 3NOVA 2GA9A 1SEPA 1L5MA 2QDKA 3BILA 4KIWA 1YRBA 3TI9A 4EF4A 2A5LA 3F5DA 1RU3A 4OK6A 2G77B 3WL7A 2EARA 4UTNA 1LD3A 1BOFA 1B0PA 2NUPA 1X92A 5CT4A 4ER6A 1EVYA 4TWRA 1VMDA 2F3TA 3FRHA 5EZ5A 3ZQ4A 1YIAA 1ZEJA 4CL8A 1C2YA 2CV2A 1G4AE 5CMLA 5EJ8A 3ACBA 3R6TA 4LNUA 2VSFA 3V1MA 4WZAB 4BX3A 5KYYB 1ZH4A 1KZ7B 5GQSA 3IV7A 5ALFA 3TFQA 4A0GA 4CMIA 2HU5A 5FDFA 5JYDA 4LRUA 3HCWA 4IPTA 1BTOA 3U26A 3WDSA 2XNSA 3VH3A 3I0MA 3KYDB 5IP5A 4J0EA 4JI6B 2VJOA 3CNQS 1R4NB 3MJRA 4Q3LA 4BNDA 4DWJA 4ND4A 2G3YA 4NJEA 2RIRA 4L5YA 3WRXC 1TJPB 1S2DA 2CXRA 4ZT7A 3LHIA 2CMGA 3IKJA 4FEEA 1HTTA 4Y2RA 5BSRA 3D4LA 3DHVA 3I8XA 4FXPA 4M8SA 4J16A 1DKQA 5FTLA 2W4IA 1XJ5A 3G2MA 3MWGA 1G6HA 4GKVA 1KY2A 4CMCA 3EUAA 4RKRA 1Z6QA 3LWZA 4Q34A 5DHUA 4AWXA 4WN9A 4EELA 1WS6A 3REGA 1OC2A 1QG0A 1KPIA 2B3DA 2C5HA 1C7EA 2PH7A 4OQQA 4P3YA 4YAUA 5IEBA 3GQBB 5B1YA 1R9MA 2XCLA 3ACCA 4RK6A 2BGMA 2G5CA 1G63A 3UV3A 1PR4A 1RM0A 1WXGA 4AZWA 1J7KA 1EFRA 3SE7A 1JDZA 3OH8A 1TQ6A 1CZNA 3K16A 4B0PA 2RIPA 3OO0A 3V4ZA 2Z3WA 1IEQA 2D2IA 1VGQA 1QZTA 3IURA 2PAAA 3BC1A 4OK5A 2ZAMA 4JNCA 3NVMB 2H1FA 2J0QA 1FNNA 4MITA 4RH1A 4BUZA 1OWPA 1P1JA 4CCWA 1A71A 4I66A 1GADO 1NQTA 1CP3A 1GDDA 3FZEA 4P35A 4TQUS 3U80A 4BMPB 4HNUA 1H9AA 2J3KA 3EXAA 4CT0A 1BU5A 4MWSA 2ZDGA 1WXDA 3DWGA 3EJWA 3ENWA 3P9CA 1EVJA 3SQXA 4G8JA 4E32A 1OV4A 5LC1A 1NVEA 4QODA 1L8LA 2QG4A 2AN1A 5HE9A 1MO5A 1IMOA 3A9UA 3KT6A 4ZFNA 2OZPA 4I9NA 4KXVA 2V7GA 1J70A 1KI4A 4PCAA 1JFFA 3KUXA 3IEIA 3AFOA 1MNAA 1ORWA 2WVAA 3B7GA 2LZ0A 3NM5A 1J39A 2I66A 3RAGA 1OZHA 1CZLA 2PJZA 4ZV9A 1GUZA 1Y37A 5F12A 5HIKA 2EKBA 3TXAA 2VYQA 4CL0A 1R15A 3W6UA 4PSDA 3O4JA 4EWLA 1NUUA 4QTZA 1V1MA 3BMQA 3HCPA 2AI1A 1QUFA 2Q5CA 2Q5FA 3DT9A 4JYCA 2EJUA 2GO7A 3VV3A 3ZDFA 3HRIA 3C3EA 3UOWA 4KPGA 1DTSA 2D1SA 2AH5A 1YZKA 1GPMA 1Z8DA 1NDUA 2F17A 1KIMA 1JQEA 2C5FA 1QONA 3GJ4A 4GXRA 3ESRA 4I4TB 3T1HB 4E5SA 1AA6A 1RYEA 2YWCA 3Q85A 1K92A 5JS8A 2D06A 1CJCA 2FWMX 2GZ2A 1VCIA 3MGBA 4XUEA 1FVHA 4ARSA 5KQPA 5TDHA 2VT7A 3OIVA 2GZSA 3RYCA 1XNQB 4BMZA 4W8GA 5IC4A 2QQFA 1POXA 2EATA 3E0QA 1QYIA 4R1OA 2WLSA 1MJHA 1P45A 3AI2A 5EQDA 4ZEVA 1QO7A 1E5LA 2E1RA 2GUWA 4F3RA 3SKYA 1XX6A 3UUEA 1CRPA 4K88A 3SSOA 1H1TA 3LPLA 4EJSC 2C96A 3FIUA 3U1BA 1YIDA 4PY2A 4DLXA 2Y1FA 3BMOB 1SXJD 1XVIA 1XYYA 5M3BA 1Z8NA 3QBDA 5K8CA 1GGKA 1GN9A 4DNPA 3A6PC 1F6BA 3AFIA 4BWYA 3BBLA 1Q84A 2D2XA 3DBIA 4NCHA 4DT1B 4AICA 1NW3A 4UAGA 3SC3A 1B0ZA 2JEYA 5HZMA 1WKCA 5J2UF 1JFRA 1THMA 3DOEA 1JR4A 1E2GA 1NHWA 4UJ3A 5G53C 1NDQA 3OC6A 4GKAA 3EVEA 3MILA 5CEJA 1ZD2P 4CM3A 5B7GA 4IH4A 3D81A 5MDHA 3KM0A 3KXLA 1VI2A 1UBGA 4UTZA 4OHZA 2QTHA 1B41A 4GYJA 2VHXA 3PQ5A 4IJ5A 4P4SB 4C43A 4LOJA 3A4MA 2BYTA 2O8BA 1E60A 4ER7A 1VLVA 3JYNA 3UCFA 1SXHA 3WK8A 3QG5A 3PD0A 2FW7A 3HNRA 2XNCA 3BRQA 2RG7A 3OT1B 3Q5GA 3ZY2A 5IH7A 2C4NA 4GLBA 2A9JA 5JCOA 2VRWA 4YRQA 4Z0TA 1G38A 2W2TA 4DZTA 2P40A 2AOUB 1XZMA 1DTWA 2PCJA 4CMGA 4LF4B 1WBDA 2SCUA 5J3JA 5FWAA 3PDWA 3EDMA 1Y7PA 3LXRA 4X24A 3UOGA 2G88A 1HOXA 5I9SA 3MFYA 5MGNA 1K3TA 3KXIA 5HW0A 3THYB 1GL9B 1M7BA 5CT5A 1XFDA 5M7EA 1X7WB 4CETA 2PL5A 3T34A 5DCYA 3PWKA 4HN9A 1E6WA 1EI9A 4GMHA 4RFSA 4TT8A 2XE6A 4XIIA 4AQ7A 3SX4A 4JYAB 3QPAA 3IQGX 2P9QA 1KSGA 1IQUA 1M2NA 3BQMB 9GPBA 5JS1A 1XC7A 4ZO4A 4ASUA 4YIHA 2EDCA 4LJ4A 5HKKD 2DAPA 3E81A 1JSXA 4I19A 1HC7A 1I5EA 1YZGA 1B76A 1WMFA 1QO0A 3JQFA 4AW9A 5FO0A 1YJ8A 1T6NA 2I7CA 4NK4A 4OFWA 1HTBA 4BRSA 1R88A 1NN0A 1Q44A 2E4WA 5K3DA 4B4WA 2V54A 4I8DA 2V45A 3N8NA 1PWEA 5CX1B 2I2AA 1LPNA 1N7IA 1Z0ZA 4JR0A 1IATA 3HA7A 3O3MB 5JU6A 4EG5A 2J7PD 1EB8A 3L7OA 3KJEA 2ISCA 2HFKA 4DV4B 2Y76A 3W1VA 4ZCMA 1QXSA 1P60A 1TZKA 1ZWKA 4C0JA 2GR9A 1CLUA 1JX6A 3V1LA 4D6PA 3N6VA 4PVDA 1W4RA 2J6HA 2XMGA 1KJ9A 3H5AA 4WK4B 2YZNA 3UGKA 3ZW9A 1ONOA 1NQ5A 2CLIB 4L9RA 3QEAZ 3N0XA 3JQEA 1MHTA 2YMQA 3IEVA 3MUNA 1S4MA 5JG7A 4MVJG 3U19A 1SG9A 3AUTA 3V8BA 2XZPA 5LDGA 3PF8A 4D2IA 4LTDA 1RYFA 4ZU3A 2JA2A 3QMWA 5K8TA 2C9OA 3TOSA 4BUJA 3E9EA 1J0CA 1CT9A 1SCDA 3A36A 3COJA 1U0JA 1X9HA 2RGEA 4V03A 1IAVA 1UJCA 2WT8A 3HSSA 3IULA 3S5UA 1MZVA 1WEKA 4QECA 1PZXA 3EUWA 4WOJA 3BJMA 4ZDKA 1U2ZA 3D3QA 1QHNA 5FLYA 3F3MA 4YY3B 3ND5A 2ONKA 3HBLA 1VP9A 2D62A 3OQHA 4FCWA 3FKQA 5HGJA 1K4KA 1HDZA 2N75A 1VG0B 2E18A 1VSVA 2VJMA 3O4GA 4I4CA 3ZGZA 3O8BA 2JIBA 3CEPB 5CDHA 4X84A 5A05A 1PDWA 3TQTA 5KNBA 3EH2A 1HNXB 2IVZA 1KQPA 2P0EA 3X0DA 3V6LA 2PT6A 1SOWA 1VL6A 4CTJA 3HCEA 4CV3A 2FW6A 3BERA 4XUGB 4AN4A 3KEMA 1M2WA 3VO9A 3ZCVA 1BDIA 5G40A 4BKUA 1SO8A 4OQZA 2WJ6A 3L0YA 3PHLA 1GQQA 2GT1A 4AN0A 2JLZA 3FSGD 2ZR7A 4FGLA 1QH1B 4GXQA 3RRNA 3R0VA 4R9RA 5F2EA 4BIIA 4URHA 1N5MA 1YZ3A 3PDIA 3BMNA 5GVRA 4A8PA 3RK4A 1DRWA 5BN4B 1C81A 2IRWA 3LQQA 4IO1A 4UPDA 4XWTA 4AJPA 4BX0A 5A4JA 3TRHA 3DZIA 3R77A 2JATA 2OUIA 3M2PA 5C35A 2IZ5A 3H5IA 1W4ZA 4ES6A 1DWQA 2PH3A 1ZN8A 5I7UA 2HHAA 3VI3B 3OTWA 4LZNA 4MW9A 3CRNA 3UC9A 4A26A 2XQFA 5EHQA 1M2GA 2RGCA 4QUAA 3R3ZA 1C7RA 1IY0A 4ZCRA 5HM6A 5JNTA 1WCIB 1EX9A 2PMDA 4LMPA 5FNZA 4BKQA 1AZSC 2I4RA 4HRYA 3L1JA 3TQFA 2J67A 1HBJA 2R8EA 3A1FA 2ZVJA 4HWOA 1S9DA 3M3HA 1HL3A 1JQDA 2FA9A 1M8GA 4INOA 5CNIA 1CR6A 3SGLA 4EBBA 4YLYA 5IAOA 1F06A 1RHJA 4AF7A 3ZWNA 2ZSKA 3HNOA 4GR4A 3SHFA 1KQFA 1JIIA 3QLEA 4PBSA 1CC1S 1GU0A 2CEKA 1PJSA 3DHNA 3TZ6A 1U7ZA 4KXFB 2N3ZA 4PZDA 2Y99A 1O95A 2IX3A 2QUJA 5L3QB 4V02A 2HYDA 4H08A 1E6EA 1E2FA 4GR5A 1E3LA 5BO5A 2IQ5A 2VSXA 3HU5A 5CVCA 2W6JA 3AT1A 2EJTA 1FPQA 1N2ZA 4LKRA 4IH1A 1HF3A 1PNQA 2ZB3A 4GOJA 4GHWA 4J0CA 1SXQA 4Q1BA 3LRTA 3DSRA 4FI3C 4U7PB 2I2FA 2CFRA 3CNLA 2Q41A 3FPFA 4Y2HA 1JLRA 1MMFB 4DQXA 4II7A 3O21A 3P20A 3VPFA 4WESB 4WKBA 3CF0A 2BBTA 4Z5XA 1P18A 2OZLB 2V6FA 5DHPA 3FHOA 2VH2A 2X0IA 1Z73A 1QYVA 4QUGA 2ZVQX 4WFJA 4LFAB 2PS1A 4B3HA 3KQUA 3JZMA 1A2OA 1BJRE 1FYXA 3TQOA 1G9XA 2GD2A 2P65A 4QFDA 2G5TA 2BMVA 3KC2A 3L0OA 3NHAA 3UAOA 1JDPA 3ITEA 5KQLA 1VJTA 3UCXA 4YRMA 4II3A 4PZYA 4B33A 1NXWA 3MERA 2NYRA 4LDRA 4H4DA 5BRJA 2YQ4A 4BEVA 1EUCA 1D2HA 4KNYA 5ILOA 4GLFA 1CUCA 4YUAA 2AEEA 4GG1A 2ZCJA 5JEEA 1X19A 4QPJC 3ILVA 2OENG 4L72A 1L4HA 2ZJAA 4QDOA 4ZCLA 3QWHA 1SHKA 5A6VA 2IP1A 1ZVKA 4QYWA 4FPXA 3A27A 1JECA 1B26A 3HGMA 5KKAA 3I2HA 1X6VA 5GJWC 4K1XA 1O97D 2G0TA 1I3OA 3QYPA 2H5EA 2XHZA 3F8WA 4RH0A 4TSKA 1H0SA 1P2FA 1U99A 5COBA 4YMLA 3RVMA 4O3FA 4EQZA 1JHXA 4MB2A 3CXRA 2P69A 4IIGA 5I45A 3BICA 1Q0QA 3H5VA 1DXYA 2ZI3A 4PZUA 4BGEA 4HOYA 4DJJA 2QUKA 3PL5A 4N49A 2VBFA 3GNTA 3SFZA 1R6BX 3H9QA 3I9KA 2IH5A 3D8BA 4FN4A 2XUFA 1ACMA 4TTQA 5JSKA 2P91A 4Y2UA 5LKRA 4JYZA 4J4TA 2JH3A 1EE1A 3PA6A 2JANA 2QTCA 2WVJA 2ZCVA 2FWAA 2RK4A 3W6ZA 2YIVX 3PTZA 2WYHA 4RJKA 3BHMA 3UV7A 1QC5A 1P2UA 3KAPA 4YCBA 1HSOA 4J1TC 4DBLE 2IP2A 2O48X 1UC4B 1Q20A 2CCJA 1JPNA 3MUFA 2GLTA 3W77A 3PSAA 3PEYA 1NW6A 3H1BA 2H07A 3N5CA 3X43A 3TKYA 4E88A 4QPCA 5KI6A 4H3HB 4LN1A 2JK0A 4LCBA 4NBNA 4B2YA 2W6PA 3D6NB 3N53A 2TMKA 2H16A 3RUFA 1Y48E 2FFHA 5F1YA 5EWJA 2CHVA 4X64B 4GXTA 3LUPA 2EKLA 2CNDA 4O2BF 4S12A 3DHYA 2W2OA 3V4RA 2FN4A 2NO7A 3P9XA 1QU2A 5EUCA 3IOEA 5JH7A 3MMNA 2LDBA 3RVKA 5KSYA 4XUDA 4BVAA 1Y5LA 2AMJA 3P2EA 1XD2B 4ITUA 3TBHA 4NFLA 3T0GA 2XRYA 3VBCA 4A23A 4BGDA 3QOFA 5LNK1 2R85A 5EKDA 4NNPA 4F45A 2JARA 4F06A 2X41A 3GVIA 3QU9A 3R7WA 3WTBA 1M0TA 5D3MA 2CCGA 5EESA 3I8OA 1YCDA 1U81A 2WC1A 2VSNA 3I23A 1J8VA 1XMIA 4QOIA 1FNCA 4IR7A 2FETA 1MRNA 1B0UA 2QW8A 1ZHHA 3PHJA 1AIPA 1QVWA 3Q9UA 3IE1A 4HNGA 2NUTA 4ALJA 1P72A 5DISB 4EHDA 2E4YA 1N2HA 4TUYA 4EITA 2VR1A 1ICIA 4MUJA 3MLAA 3M3PA 3VYVA 4DYDA 2AYXA 2QSYA 5JVDF 1CUZA 1CDOA 3MINB 1YBMA 4M3NA 1DHTA 4WLOA 5KS2A 1ZJ4A 2Z5GA 3T9EA 3ROGA 1RCFA 4HNVA 1BHSA 2D5IA 5TQ2B 3UAXA 2DT8A 4F93B 1MAAA 2O07A 3QF4A 5T6BA 1C9KA 1Z26A 3B7PA 3MBKA 4UU1A 2Y93A 4KEAA 1HOTA 1PKEA 3MTGA 4KE8A 2BR3A 4B5KA 2QMZA 3PQEA 4AWBA 1VLZA 1OFTA 1C3VA 1DAPA 5TMPA 1II8A 3RVNA 3E3OA 4F21A 1PZMA 4I1SA 1CP2A 2H4ZA 1T1JA 3S2YA 1MB0A 2AMVA 3FR7A 5JI3E 3EMKA 1SB9A 1M1NB 1YAHA 3O73A 1F51E 4HT3B 4AZSA 1Q17A 2H92A 4FFLA 4RY2A 1A8IA 4TWAA 4LYDA 3HBNA 3H4TA 3O90A 2OQRA 4MXDA 5FRDA 4ZAVA 3EZ2A 4E13A 4BGIA 2JCSA 4IINA 2QQEA 3O9ZA 1XZAA 2C3OA 3M1LA 1VL0A 5HIMA 1FF9A 3LUJA 4W5TA 2R4QA 2BMWA 2P8SA 3PCXA 5REQA 1Q6YA 1THZA 2PLFA 2IEYA 2VF8A 4YDRA 3WGKA 4B2IA 1KI7A 1RI2A 3B6MA 4BQRA 3MRVA 4BIMA 5HSGA 4BV2A 3MS7A 5HZHA 2AV6A 3AHDA 3DMTC 4NYIQ 2HMYB 2EFEB 4FYPA 4Q7KA 2EBUA 2E2WA 2OD7A 4ZQHA 4LFCB 3IMKA 2I1VB 4OMUA 3LQ2A 3JD1A 4O02B 1K5PA 4PRZA 1KRXA 4R51A 2NU7B 1ETUA 2QN6A 2VP6A 2ZKLA 1MENA 2VPYA 3E4DA 5KJCA 1Q6ZA 3F4LA 1ZMBA 2W90A 2VXCA 4FFPA 1PLJA 1Y9AA 2F3QA 3Q7QA 4CT4B 1JN0A 3GG9A 1I4OA 4DIFA 4EZBA 3K4HA 3Q3GE 4F91B 1DZ3A 2CHGA 5FH9A 2PXHA 3GDGA 5HQ3B 4TXNA 4IIFA 2ZWIA 2CD7A 2O14A 3INGA 3MWDA 4LAFA 4ZTBA 3GX1A 4DCUA 3WAJA 2OZVA 1V41E 1BXGB 4JC0A 3FCEA 5AXDA 1I7SB 3QWIA 3JTMA 4RDIA 5FV7A 2WICA 4GSYA 1HRKA 4GL4A 3NFRA 4JLVA 2Z08A 3JAKB 1RKXA 4URUR 4OQDA 4AMZA 2IPLA 3LSTA 4NQZA 4O4IA 2M1ZA 2GNPA 3EHDA 3KUUA 2YH2A 3ITNA 4MIOA 3RFUA 2WQ7A 1E5QA 1OA1A 4AKTA 1E3JA 2QTVB 4YAOA 3UJHA 5CVDA 1Z22A 5AI0A 3W06A 2OYSA 4BNIA 3U3OA 2IXTA 3OHSX 4KTVE 4KSYA 3NTXA 2H7CA 4L1KA 2WAYA 2O1XA 4C0QC 3U4QB 5H3CA 3E2MA 3RSQA 1C4XA 5CFRA 1KP2A 1XTSA 1XZ8A 2FZ5A 1ZN9A 4XEHA 2Q4TA 1SQSA 4D99A 4HPXB 3JD0A 3RJMA 4C4TA 1M9NA 2VXYA 1PZEA 2XUQA 5K4GA 5KNDA 4W82A 2BMAA 2E82A 2QQ5A 1GNTA 3SYNA 4QT4A 5JISA 2YYYA 1CKEA 2BKAA 2OCLA 4MRMA 1JKFA 3GJXC 5EZYB 1U63A 1QIIA 2WU0A 2ZVDA 1D2RA 4CQNA 2D54A 1YS4A 4J8PA 2ZU0C 1U5CA 2WAXA 1NE2A 1FFDA 3ML1A 4XFDA 4OLFA 4BL5A 3FSGA 1MEEA 3CF6R 3C41J 2PJDA 3R8CA 4YPOA 4FDTA 5KTKA 3DOUA 2ZJ2A 1TKCA 3OWOA 1Q7CA 3ESAA 1AKTA 4AS3A 5A6SA 5LL6P 2XQVA 3B2EA 3PJEA 3MWJA 4CKBA 1T5DX 3KB1A 3S2ZA 4YA6A 2PAFA 1YI0A 4ZYZA 3T7AA 4FCVA 4ZI5A 5KYXA 4FUTA 5JSUA 2KLBA 2V3WA 5KNBD 2OHOA 3U4CA 2O0MA 2ZJYA 1P61B 4JFRA 2Z56A 4LOIA 4DEXA 1U0TA 3OCUA 1H2AS 2OC4A 4UHDA 3OBBA 1RJ9A 4PQRA 5KYVA 3VC3A 1QP4A 3OOJA 4RL6A 3GPCA 4N0DA 4NG5A 1EWTA 1F8UA 4RQAA 3FVWA 3W3AH 3ZJTA 2PYZA 1YMVA 2HPHA 3B85A 3C5HA 5LR6A 1NI3A 4M4SA 4BRWA 4DS3A 5KTPA 3SK0A 1BA2A 3ETGA 3TWOA 4F9TA 4IDNA 3P0EA 3VPSA 2CZQA 1LK0A 4QLOA 4E3WA 2JFBA 3A7EA 4MWOA 3VSCA 3W9BA 5FWYA 1EX6A 4UUAA 3ZGOA 5BV7A 1E9VA 1IH8A 2WFZA 3ANMA 1NW5A 2CKMA 5EWLB 5FBRB 2MSEB 4LYGA 2FPKA 5E9JA 3UTCA 5IASA 3DZDA 3PU6A 4L8LA 2R0QC 1XRQA 3MGGA 5FYQA 5ITSA 3OQOA 4MQ4A 3OZEA 3ED1A 1GITA 3VR2D 2B5OA 4OAPA 3K0HA 1L7PA 4NY1A 3GVHA 4HAXA 3VR3D 3OQVA 4JUBA 1VPTA 3UATA 3FETA 1Q3TA 2DWUA 1EKXA 3VR1A 5KOIA 4ER3A 2RMKA 3OJXA 1BQ4A 3P0JA 1VRVA 4L7VA 1ABBA 5F9MA 4W7HA 1KQ3A 3KKZA 1I3LA 1L6IA 4K9NA 1NZFA 4OFZA 1TGVA 3U3MA 4MVXA 2H8GA 4MHTA 5GADl 4DSUA 3VI4B 4RULA 3ZJVA 3ASYA 4JBHA 1W5FA 1H2EA 2BM8A 2OZEA 3IT3A 4N9QA 1WU7A 3UK6A 5B2ZA 4WXPA 1NFQA 4WXEA 2OA0A 3W7VA 1RHMA 1UT5A 4OSPA 1O5IA 5A4MS 1S2IA 1P5RA 1ZC3A 1Y34E 3NDPA 5AXBA 4B1FA 1EIWA 1KO4A 3DO6A 3E9CA 5B55A 2XUKA 4MULA 2HWKA 3WYEA 4CKCA 1A69A 1I4WA 4J2OA 5EP2A 3COWA 2FI1A 2P27A 2AMFA 1U1IA 1QYCA 2JB9A 2VPTA 3OWHA 1RBMA 4ASUD 2H4YA 1XCMA 3K71B 3TFOA 2C8KA 3B5IA 2BFMA 2NVBA 4TMFA 3PD1A 5A0FA 1O0CA 3DOOA 3ZWAA 4K9QA 3DJFA 4UEWA 1DUVG 3Q11A 1YKSA 2IHZA 1Q19A 2XYRA 1GEEA 3C3BA 4IFEA 4P7FA 4XVUA 1M2VA 1TT5A 2DZDA 1JTEA 2PL3A 3IRVA 5CB4F 2OO3A 2QY6A 3EIHA 2VC2B 1FFXB 3DMDA 4Q16A 1JS1X 3P45A 4PC1A 1X70A 2AN9A 3NC1C 2B4AA 3F4KA 1YZFA 4JJFA 3V4SA 4ADSG 1T3SA 3BE4A 3KV3O 4OP1A 5ALHA 1D6JA 2YY5A 3GJ6A 2ATVA 1X9GA 5JAUA 1DV2A 2OM2A 3A32A 3IHLA 4O1HA 4EJMA 4D3SA 4OJQA 4QRIA 5CUQA 1ZY2A 2IE0A 2W2QA 3F9IA 2OG1A 4ND2A 1XDGA 1XGKA 1YR7A 4YWJA 1XQWA 2OFOA 5ELLA 5A62A 2J0EA 3U5ZB 1TM3E 3KZNA 3P0RA 4G5GA 1R4MB 2X86A 2ORWA 2UYGA 4YWHA 5KX5A 1GLGA 1ECCA 2C3PA 2YC4C 4JYPA 3B70A 5IVDA 3HVHA 3SZ3A 4EA8A 1QGYA 3M6UA 1Y9EA 3IVGA 3QX8A 3OC0A 5ALXA 2DUNA 2UV8A 2HCFA 3IAM6 5BT9A 4JBGA 4MVJF 1NULA 5AJWA 5BV8A 1XRJA 3S8YA 5LMUB 4M22A 2QSJA 3K2BA 2JHCA 5FPSA 5KNLA 1JR3D 2GZ3A 3G2IA 3ONWA 5K0CA 1YNOA 3ET5A 2HXYA 3FZQA 3KQTA 9ABPA 3CLRC 5DRYA 3TJMA 3KRTA 3NIWA 2AB0A 3MXOA 3K92A 2FDCA 1W581 4H27A 1ITZA 1X2BA 4XVHA 1UMKA 1DX9A 1WMBA 4DCSA 5I4CA 5F23A 3WKBA 1MXHA 1XRPA 4BGUA 4MI9A 2UZIR 2HMAA 1NNSA 1JAIA 1Z6AA 1ZGJA 3JX9A 3MUOA 3PTAA 1Q21A 3N2GA 3KT0A 1E5DA 4XR9A 1RPAA 3DNPA 1TMKA 2PYDA 4PS1A 3HBJA 3CSDA 4AP9A 5BSVA 1FMFA 3ZIAA 1VIVA 1YS6A 2ONZA 4QAJA 2I6FA 3IJ5A 2VCYA 5FI1B 3RUCA 5JSZA 1XKQA 3TUJC 1E2KA 4M53A 4JR1A 2GFQA 2C54A 1ADCA 4OI4A 1KQNA 4ZI7A 1GL6A 2OAGA 5G3ZA 2OKGA 4NONA 4E2ZA 4DLLA 2GWRA 3IUJA 3GLTA 4HH0A 4Z2YA 3ZU5A 1HT1E 3MZ0A 4FMBB 4DLBA 2MR6A 3OKAA 4G8CA 4FU0A 3HBFA 2RD2A 5BWOA 3JQDA 4PLTA 4EI7A 1F8GA 3AU8A 3KHKA 3M6WA 4HCJA 4FBGA 1MOPA 4XCQA 1YGYA 4N3GA 5DXAA 5F1OA 4BO8A 1CQZA 3SN6A 3S2GA 5EC8A 4DMCA 1G6Q1 5HRUA 4HLUC 4KMSA 4NV1A 3MYYA 2ONCA 2VJDA 3JVUA 4WOBA 3PX7A 2WI8A 3HXKA 1ZIXA 4JJ7A 1SIOA 5AJXA 1IRXA 1W4LA 3LC2O 3P2IA 3ONEA 3HKBB 3KTOA 2Z98A 4MVJA 2QUHA 3HDYA 4NP6A 1XXLA 3G5LA 3IP1A 5WRFA 4NS4A 3WWOA 5CM2Z 1T9GR 3FA2A 1E9FA 3Q7RA 4LC9A 2DR3A 2ZYHA 2NLOA 2NXCA 4Y6OA 5F76A 3QMMA 4M9XA 2X9NA 4R2LA 4LF9B 5JAMA 1H2ZA 3Q9LA 4OQFA 3SZLA 1I9GA 2RKWA 4GECA 1Z7BA 1O94D 2E4VA 2BFWA 5K6AC 3CLHA 3QNWA 1AXRA 2PUBA 3EGXB 4YUWA 3BBPA 1OFVA 1M7GA 1K86A 2HY7A 2DYKA 4N8SA 4PSCA 3HMQA 4NH4A 4FCCA 2PBFA 3V8QA 2IDJA 3AVXA 1FY2A 2ZJ8A 4O2LA 4CNQA 2RGRA 3P2OA 4D74A 2VQ6A 4QG7A 1QCCA 2XYPA 2BGJA 1N6PA 4HJRA 1MW9X 5BMVB 3WGYA 4P0PB 1AS0A 1T0JB 4KQHA 2FEMA 5D3KA 1I4TD 4PZ9A 5FT9A 3UMRA 2EC5A 1UP7A 2B35A 1E98A 4ZQIA 4MA4A 3T7SA 2FEPA 5DJ5A 3OWXA 1NW9B 3PNYA 5H9VA 9LDTA 3L1HA 3IJEB 3LPMA 1ULHA 3ONNA 4BC1A 4GBGA 1NBAA 5FOTA 2FGKA 4TQGA 1Z5WA 3N8GA 1Y1TA 4XWOA 4QPPA 1ST2A 3CYFA 5I8WA 4MJ3A 3QYJA 2JCGA 1FNBA 3AEXA 4Y6GB 4A4DA 5K0JA 1TLLA 2XY4A 4C4XA 4PNEA 3E0XA 3O3OB 5CYOA 4EBFA 3A14A 2B37A 2C9MA 3PXGA 3AW8A 4X91A 1O3YA 1QFSA 2WILA 1J0BA 4MEBA 2Z4SA 2Y2UA 3MOIA 3S1SA 1UP4A 1NM5C 3OMXA 1PFGA 1DO0A 1Z0IA 2QJRA 3DW3X 3LAWA 1DC4A 2JZNA 4UBMA 3U7FB 4FNMA 4X41A 1AO0A 1C1DA 3AHCA 3AF0A 3REFA 1XNRB 3HN2A 1KAHA 2FLKA 3DL4A 5AUQA 2I3GA 4MPDA 4DUPA 4GU5A 3LOPA 1SQ0A 4KHZA 1KZ9A 1USVA 2H08A 1G2PA 2PO7A 3S8MA 4LHSA 1VKRA 2QJWA 3LUFA 3KJZA 3PX2A 4Y3UA 3LC1O 2V7UA 4LW8A 3GLGE 1CEXA 4NVRA 2CNNA 1DAHA 5CXUA 1NU8A 4AF6A 2C07A 4L6AA 3ND7A 3OT1A 2TMGA 4M6WA 4GSLA 4OV6B 1MOQA 4WCDA 5LQKA 1MUUA 5BMVF 5CIQA 2K87A 1B8VA 1PX0A 1NQOA 3JD4A 4NWIA 4OU4A 5DP2A 4CDRA 1JLLA 1RJEA 2X5NA 4V0RA 5K0GA 2ZFUA 3GLHE 1V9CA 1U31A 2GEUA 3AJ9A 4N6GA 4A0HA 3PFCA 3C16C 3IT1A 1OWOA 1S01A 2PSDA 3P8ZA 3EXIA 1R74A 1N92A 4KFRA 2BZSA 4NQRA 1Q0TA 1CZKA 3A1EA 1GPWB 1MOZA 4JUAA 2V55B 1CE8A 1LSSA 2FJ0A 2P75A 2FB9A 2W2NA 3JQ7B 4Q9KA 2AI2A 2FMUA 1CNMA 2Q46A 1XVTA 1I2MA 1QGDA 4HQLA 1ZMOA 1DLIA 4ZOLA 4DLNA 2JIMA 4WRRA 3GNSA 4K9MA 4UD2A 3RYHA 3DCYA 1SU8A 1YL5A 2JDID 3H1EA 4R2MA 2ZZKA 4ZOCA 3QXJA 3G0HA 2YJ3A 3BG5A 3X1XA 3EIWA 3GOQA 1LLFA 2RCYA 5AW2A 2GCPA 3CJTA 2WSSA 5IBPA 1CUWA 1RE1A 4PLVA 1U9YA 1ZM2A 2ZW9A 1Z4JA 3A1SA 2OR3A 1OPXA 1K8XB 5CU7A 4H0FA 2GRUA 2XVAA 1N7JA 3HCBA 1JAZA 5HMMA 1V1JA 5C8XA 5JD6A 1SBZA 4QBTA 5J5AA 1V16B 1GNVA 1PFUA 2JG3A 1ADBA 2GPAA 3U4DA 3I01A 1KPHA 1R6VA 5DX8A 3V9AA 3T1QA 5PGMA 4C4PA 2CT8A 1N8NA 1QGUA 1EG7A 1YA6A 3MT7A 1RLUA 1IVYA 1N2GA 4IJ6A 2WM2A 1F2DA 3ANTA 4K6FA 4RGQA 4GRAA 1U2TA 3DAGA 4MUGA 5DW0A 4YONB 3SX2A 3WFJA 4E12A 4G4IA 1EFCA 2G17A 5C2JB 3VYWA 3FCXA 3DKIA 1SUBA 4QXRA 1FXSA 1GTVA 1IUNA 1P3JA 7ADHA 2Q8QA 5JSQA 421PA 3VMFA 3M4XA 2ZE7A 1QVZA 1H3FA 4JQCA 1YE8A 4EL0A 4AJNA 2BPOA 3K9FC 2B4YA 3D8RA 2QXUA 3GJYA 4FOPA 1T43A 3Q88A 4RVDA 1DG1G 4XIJA 4J29A 3QTBA 1H22A 4Q4HA 3LQKA 3OOHA 3ZZTA 2Y1OA 3RO7A 2FHSA 2PUAA 3BREA 4E5UA 4MMXB 3PQ4A 4G0NA 1YQEA 3OZWA 4EYQA 4DRXA 1KP3A 4QSHA 4XB1A 1E2EA 3OESA 3LF1A 4JBNA 3ZGVA 3ZWQA 1I33A 3GFGA 3MMZA 1M67A 5E95A 1Z38A 2JFFA 4WSOA 1RHUA 1T5BA 1DJLA 1YHNA 2X1VA 4AO6A 4XVQA 2GASA 5FLEX 2XMZA 2C8VA 3CURA 3K0FA 4GVLA 4CR6A 2GEFA 2WFLA 3NAZA 2ZB2A 3C8ZA 3IE2A 1VIDA 3WZMA 1C0KA 1L5ZA 1YO6A 3K15A 5LQDA 2BTQA 4GC9A 4BNXA 3NYIA 1DEOA 5DO9A 1ZVVA 2B36A 3JQQA 1D04A 2XECA 2XW6A 5TT1A 4BE4A 5CVTA 2O3TA 1Z13A 4AJ1A 6ADHA 5AK6A 4WDQA 4MQFB 4EB6A 1XWWA 1ZH6A 2E6KA 3R76A 4X65B 3BWMA 3PUWA 2VT2A 4JLAA 4DB2A 4R3UC 1P2DA 3GP5A 1G2QA 1NW7A 2PUTA 4BQFA 2ZQ5A 2XGMA 5CJPA 1T1IA 1PT5A 1AUOA 5IABA 4RFLA 3M33A 4BBPA 3I76A 2KYRA 3MPOA 3H9JA 1VA4A 4B6PA 3D4OA 4POOA 5IJ0A 4PFJA 3Q41A 5KKCA 4KN8A 4NCKA 1BN7A 2GFIA 2I1WA 3EXFA 1VI5A 3VUEA 1YZTA 2AJBA 1G0OA 1H93A 4UUMA 2FSVA 3AR3A 4BV9A 4ERNA 3J81k 3KZ1E 5ALTA 5DWQA 2PU7A 4CI9A 3RS4A 2GPBA 2QROA 2JAOA 3TKLA 4EVRA 3IQIX 1G20B 1X1BA 4MR7A 3DDSA 4O4JB 1IJFA 1NJ5A 1M2EA 1Z5GA 3IP6A 4H16A 4NZOA 4ARZA 4ZEMA 1JLLB 1OYVA 1X7DA 4LNUB 2VYFA 3H04A 4NJOA 5JPDA 2P6OA 3K8OE 5EE9A 1CBUA 3E1GA 1E5VA 4HNSA 2AUTA 4U7TB 5DM4A 3GLGB 4YP9A 2PD4A 2V9CA 1Z3CA 5ITWA 2BMFA 1WWKA 2GEBA 3G0IA