1VCHA

Crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
168
Chain Sequence
b'ETYPITVGGVTRHVPLIEPLPGRRIPLVEFLGDPEFTRAAAEALRPLVPKEAEILFTTETSPIPLTHVLAEALGLPYVVARRRRRPYMEDPIIQEVQTEVLWLDRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVFRQGTPGLAVDTVAELPVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyltransferase-related protein
publication title Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 48
structure length 168
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vchA00
1DQNA 3GEPA 5IPFA 5KAPA 4RHXA 3LRTA 1W30A 1DKRA 1QCDA 1U9YA 5JSQA 3ACBA 1BD4A 1ECFA 1L1QA 1QB7A 4RQAA 4RABA 2E55A 1BD3A 1ECGA 1A4XA 4M0UA 4RANA 1ZN7A 3O7MA 1MZVA 2JBHA 1ECJA 1G9TA 1DKUA 2DY0A 1ECCA 4M0KA 1I0LA 4RAOA 4JITA 4P80A 1IBSA 4RADA 1U9ZA 1Z7GA 2HCRA 4RQBA 3KB8A 4RHTA 3ACDA 1I13A 4WMLA 5K51A 5KAMA 4KN6A 4IJQA 1ECBA 4RACA 5HIAA 1QB8A 1VSTA 2EHJA 5BSKA 4P3KA 4TWBA 1UPFA 1A95A 1JLRA 3S5JA 1J7JA 1XTTA 4RHUA 1BZYA 1GPH1 1TC1A 4WN3A 4PAWA 2GEBA 5ESWA 1JLSA 1WD5A 1P17A 1DQPA 4M0PA 2FXVA 1GRVA 2AEEA 3LPNA 1P18A 2PS1A 1R3UA 2XBUA 3QW4B 1A3CA 1YFZA 2VFAA 1VDMA 4P81A 5JV5A 2P1ZA 1ZN9A 4ZFNA 1I0IA 4FYMA 4S2UA 3DEZA 1CJBA 3N2LA 3GGJA 2IGBA 1V9SA 4P84A 4JLSA 3H83A 5E38A 5ESXA 3DMPA 3NAGA 1STOA 5IAOA 1A97A 5HKLA 2JI4A 1XTVA 4RV4A 3MJDA 4LYYA 4X44A 3MBIA 1OREA 5BQPA 4RAQA 3OZFA 2JKYA 1PZMA 1XZ8A 1Y0BA 4P82A 5EUCA 4OHCA 3ACCA 3OZGA 4Z1OA 4LZAA 1AO0A 1A98A 1HGXA 1O5OA 1TC2A 4QRIA 4LYGA 1DBRA 4P86A 5BQOA 2H08A 2C4KA 3EFHA 1P4AA 3G6WA 4MB6A 1VCHA 1I14A 1QK4A 2YZKA 4QYIA 2WNSA 1NULA 1P19A 4LZNA 3HVUA 1XZNA 4QYIB 1I5EA 4PFQA 1UPUA 1NONA 1G2PA 1QCCA 3OHPA 5BRNA 3GGCA 1L1RA 1G2QA 2H06A 1LH0A 1OPRA 1G9SA 3M3HA 1OROA 1D6NA 1ZN8A 4P83A 3DAHA 4RHYA 1XTUA 1O57A 1A96A 4X45A 1UFRA 2PRYA 2PRZA 1QK3A 4F8EA 1QK5A 1HMPA 2H07A 2JKZA 4LZOA 1FSGA
chains in the Genus database with same CATH superfamily
3KZVA 4AJPA 3ESRA 3ZHVA 5KJ6A 5HM6A 4KAJA 1IHPA 1YE5A 1EX6A 4NVRA 2OXFA 3FJOA 2HLNA 3IOEA 4D56A 1JEEA 3NU1A 1C14A 4X62B 3FSJX 2OV6A 5I9TA 4L4XA 4B3CA 1TT7A 1T5LA 1DJOA 4KIGA 1YCHA 2P9CA 4TVKA 4F0JA 1SM4A 4K40A 1DLIA 1QVVA 1AURA 2B3TA 2COUA 4JN6B 1P3Y1 3Q9UA 4JYPA 5L95A 1MD9A 4KI7A 5ALNA 3SFTA 4O2BB 4OHWA 4P58A 4B0PA 4CF5A 4OLJA 1D2AA 2XI4A 2AWNA 1NMYA 1X13A 2BONA 5A06A 4UMFA 1EFVB 1GFSA 1Y6QA 4WZAA 3HEBA 1Q50A 2LRHA 4IV5A 4BO6A 4ZAXA 4NJMB 2Q5QA 1KXZA 4I50B 1MC4A 2Z4SA 4HK4A 3T3NA 1G5TA 3BMQA 4E94A 3U5TA 4JLNA 3HFGA 4OJTA 4UMVA 1XP8A 3EGIA 3ETGA 1TZJA 1UWVA 3GMDA 4IR7A 2X41A 4M0CA 2O8NA 1ZNYA 4OIMA 4Y8VA 1YMUA 4HRXA 2V5UA 1RU3A 2YZ2A 3H18A 3SYKA 1G8FA 1MB2A 2HU7A 4L9AA 5AM3A 1E3TA 1OBFO 3C1AA 1YR6A 1YC2A 4B3FX 2BWJA 4TTIA 1EJ0A 2XUZA 4FB5A 2O0HA 1I0IA 5DCUA 1VYUA 5HJ5A 3S2GA 2DQZA 1E1QD 2AKYA 2O3QA 3NHLA 4OJNA 1I1QB 1C7FA 1FFAA 1NI4A 3I6ZA 2ZSIA 1VLHA 5DNEA 5T57A 5MGBA 3LF1A 1KNXA 1RJGA 1Y33E 4NMWA 1FZQA 1G20B 1N7JA 4LZLA 4NFLA 5IM5A 3SDSA 1Z73A 4U39A 1GU7A 3ISVA 3VPXA 4RL6A 2XCSB 3OCUA 1PJZA 4ZYLA 4PZZA 8GPBA 5IVHA 3ZK8A 3QVTA 5FWAA 2OSVA 3VOTA 1Z2NX 1B6SA 4ZVOA 3BKXA 3DMTA 4OFWA 4R1LA 3T7TA 4W6ZA 2ECPA 3R3HA 3KXDA 3AOGA 3I04M 3LHSA 4KG7A 4M6WB 3W8RA 4DVJA 4HN2A 2P5YA 5IWAB 1X7ZA 2WLTA 3N2NA 2VZLA 3QA3E 4HAZA 3BJMA 4UUQA 1E63A 3RBAA 1S8OA 2X6QA 1ZAKA 2M2IA 4FONA 5ALVA 4OLAA 4ZV9A 1D2RA 4HGNA 1OGYA 5A4IS 3KYCB 1FW6A 3LWZA 4J8PA 5BR8B 1AXEA 1AKEA 1ULSA 3BERA 3GD5A 1L1EA 2IEBA 4HZUB 4XE5A 3IT3A 1Y5NA 5ALGA 4WV3A 1IN7A 3PB3A 4KNVA 2L2QA 4QOGA 2VJMB 4ZEXA 4K46A 1YI1A 2R1VA 1RAEA 2YBEA 3VPCA 3ADCA 1QANA 3D6VA 4KGVA 3CBQA 2J0EA 1RLUA 4LGYA 2GKOA 3N76A 3DCIA 1FRNA 3TBFA 3QPBA 3DKVA 2ZBEA 2KLBA 5GJWC 1J2EA 4RH1A 1P44A 1N0UA 1AIPA 3R5FA 4MPJA 2PQ2A 2IYOA 2Q3EA 3VZRA 3H4MA 1Z4IA 4B48A 4RK0A 4ROSA 2VBIA 4QXPA 3FBWA 3IP3A 1KH1A 3AOEC 2BM9A 2AHRA 3MLBA 3TE7A 2DULA 1GAJA 2B6HA 4J3JA 3ZKWA 4C89A 4D25A 2NZJA 4E51A 3IRVA 3KKEA 2O3JA 4CZ2A 5C7IO 1THTA 4DRXA 1LNSA 5U9CA 2R96A 3KOYA 1OIWA 3O4FA 4M8IA 2AHOA 5K2MA 1L5MA 2LXNA 3N0TA 4XYMA 4B31A 1XROA 2OP0A 1CY1A 1N5JA 1V39A 3EXEB 4CMEA 1O9BA 1R6BX 4KQ2A 5FKJA 3WK7A 1PAUA 3ZYCA 1GL7A 1COZA 3IOYA 2EFEB 4AG5A 3OQMA 5CXXA 1M6NA 2VTBA 1L5ZA 1KSGA 2IH4A 3H84A 4OJKA 2B1QA 1Z35A 3AR3A 2AC2A 4C2BA 3A6HA 3T5AA 3UHPA 3L6OO 4GMHA 2H29A 3OEED 3GT0A 3ZCPA 1OLXA 1US8B 3WIBA 5KYUB 2FPSA 2QRGA 3J81A 3AVVA 2YVKA 3OEHA 1U0OC 1KXJA 2ZP1A 2Z95A 5DP2A 1R5BA 2AK2A 3F5MA 3WA7A 3DZCA 3QUSA 1KQPA 4FWTA 4MR8A 3EPHA 1H5QA 3IBTA 4DREA 1JIUA 2RGNC 4NV0A 3UGQA 1WIWA 3ZHUA 4YV2A 2QR2A 4N40A 3AVTA 4Z54A 3AFOA 4G1MB 3AHFA 1EK5A 4ZAGA 4C4XA 1C8BA 1TK9A 4YRNA 1PWEA 3EXHA 2JD1A 2LCQA 3RVNA 1LRJA 4OHUA 3O2QB 3KB2A 4EPVA 3JPWA 5HOQA 5CP8A 5GIPE 2VKQA 2MT9A 2Q7XA 3OH8A 2HDWA 5C2JB 3JPYA 4XEHA 1S3GA 4ZFNA 1NHWA 5HF9A 4HQ6A 1XZGA 1UMDB 4BNGA 3NB0A 4L4YA 4F12A 1NQTA 4O5AA 1U7HA 3WLIA 3GUZA 3D8SA 4R1TA 1E99A 1NR7A 3QWHA 3M82A 4JLSA 3ZG6A 3DMPA 5KX5B 3B82A 3BTOA 1MMFB 5CW1A 5ES4B 1QV6A 3JWPA 3ZWQA 3K9LA 2OFFA 4ASUA 3N8DA 1SVKA 2W2LA 4PIVA 3HYLA 2RGRA 3A4VA 1P5FA 1YB4A 4R2MA 2YFHA 1DUIA 2CXXA 3MGBA 4OUDA 5GQSA 5A5GA 4KV7A 1Q1AA 2ZIEA 4C0KA 4CEHA 1DBSA 1PSDA 1OD6A 2Z8YA 2A33A 4ZO6A 5LQSA 2IV2X 3WWPA 5AD1A 2ZAMA 4C43A 2HU2A 3BTSA 4IZ6A 2FNAA 4NSNA 4QXRA 3ZS8A 2QM7A 1VLJA 3H6GA 3GRAA 3I61A 4YRPA 2DT8A 5CJPA 1XTIA 4DE5A 2DHEA 2TSYB 3NAMA 2JFGA 1CC1S 4J90A 1T29A 2C8VA 2XWQA 5TIIA 2VYNA 4A2PA 2C5SA 3P4UA 3TH5A 3WOHA 4UU8A 2Q6OA 4Q18A 3TIIA 4FYJA 3PQEA 2O0JA 4URFA 4WVLA 3VVCA 1RADA 4AROA 2H5JA 3PJRA 5DX0A 2JVIA 1J56A 3FOCA 2LNDA 3LX8A 3R5SA 2GLXA 1X42A 2HWUA 4BFSA 3UV7A 2B92A 3QU4A 4EBFA 3MHPA 2DFNA 3PI6A 2PLWA 3PKJA 4BEBA 3JQBC 3KEQA 5B12A 4A8JA 2F6RA 2AXPA 3JD4A 4RIFA 3H11A 4G0WA 3DO8A 2O7VA 1FF9A 4OF4A 1BGXT 4HLQB 4GBMA 1RYYA 2GDJA 3IB6A 4ME6A 3M8KA 4C6RA 4N5MA 3B13B 2JZCA 2R8EA 1UXGA 2C7PA 1G21B 3OT4A 4JI8B 2DFDA 2DHCA 5TT0A 5TX7A 2DPXA 3LG2A 2ZZKA 1D5WA 4AX8A 3X1ZA 2Y77A 3ZDAA 1AQYA 4BJ3A 2WE8A 1WMEA 2OZEA 4N8EA 1QIDA 4LBYA 4X41A 3TNDA 3DC7A 1T5SA 2EU8A 1KY2A 3NLLA 1T4CA 1AKNA 2P4SA 4M38A 4U2GA 4M21A 2E1RA 2ZYWX 4LTNA 4Y0VA 3SQNA 3P27A 1ZGAA 2ZSKA 2Z1NA 1YH3A 1P3DA 3RUCA 1OU4A 2WFZA 3VH4A 4RK5A 3ZCXA 3ZWBA 5JDCA 2QGZA 1ZRHA 1GQOA 4RWEA 3ZU3A 1IHUA 5TQ2A 4ACBA 4AI6A 2IP4A 3M6WA 3U26A 1BHO1 1JIKA 2PCJA 3JXEA 2PUTA 1NQVA 5ERGB 2IYWA 5K51A 4EYGA 3CR8A 3ABZA 3UGKA 1HC7A 5A6VA 1NJGA 3C14C 1RTTA 2OP1A 4A73A 4ES6A 3A2LA 3FD8A 5CFPA 3WGOA 5H9WA 5LOVF 5JIBA 3HXPA 3R9IA 1TMKA 4Z3DA 4XD2A 2R8XA 2H8GA 3H5AA 4WE3A 2A78A 3WRYA 1K4MA 1Q2UA 1YTUA 3QX8A 1U99A 5LC1A 4S1PA 3UK0A 4RDXA 1F8XA 1IK6A 3E61A 4TQGA 4Q1EA 4RQUA 1T8RA 4LZJA 1YHNA 4V0QA 1RYEA 1NW8A 1SZJG 3BZUA 3D54D 1EDBA 4OI4A 3E7WA 2JHCA 3R7BA 3FG9A 3GVXA 2NT4A 1RHQA 1YCDA 3LM8A 4KDEA 5BMVA 1ZD2P 5AIAA 5BYAA 3O91A 2I62A 1EFAA 1IJEA 4FLMA 4FOLA 4TZ6A 4DAEA 5BQFA 1QP7A 5LCXA 3LDFA 3WNCA 1KMQA 2GILA 1TUEA 1Y1PA 2KHZA 1KPIA 3GCZA 4QGHA 4W9RA 4ZVMA 2ZBRA 1HQCA 5JSKA 3T9CA 5A04A 2F4VB 5KINB 1NI4B 4XCXA 3BXHA 4DR7B 2H1RA 1NVMB 2OD7A 2PGDA 5JZSA 4WERA 4M1QA 3V33A 2C7GA 1KQFA 5KDDA 2OBFA 3LX4A 4FZRA 2GCPA 2FEOA 2FF5A 1LSSA 1AG9A 3DAYA 1Z7WA 1SVWA 1KFCB 3PDCA 1XHEA 2DTEA 2XUQA 5BUCA 3I62A 1FDOA 3JZDA 2HWWA 5FPPA 3PNQA 4INAA 2D0OB 1Q0LA 1ONPA 4DLUA 3K5IA 4O2LA 3WB0A 1FNNA 3RLFA 1NUAA 2WSMA 2VSYA 1CDEA 2ZSUA 3LHIA 4YWHA 2OUIA 2VNAA 1JT2A 4IUCS 4U0JA 4GG1A 4P22A 3FUUA 3BIJA 1P72A 1ML4A 3TQCA 4Z53A 1KGDA 1UJNA 3TOXA 1FZTA 2I80A 4LOJA 2HPVA 1DO0A 1T8YA 1H8HD 3O8RA 3E9ZA 4WJKB 3A9RA 3PHCA 3EIWA 4CW7A 2QV7A 2AG8A 4WASA 3N28A 4HDKA 2WJIA 1WXXA 2F1KA 2R1VB 3ZIDA 1BMQA 1R5NA 5EEHA 5LQRA 1X3SA 3IP5A 2PUHA 1ZU4A 2G06A 4TN1A 2V1UA 4E33A 1I7DA 2NP6A 1CY8A 1U0HC 3GAAA 2CC2A 1ODFA 4FW8A 4FYXA 2AFVA 1L5HA 1D1PA 3TB4A 2FPUA 3EB9A 2MTBA 4L78A 1N9ZA 5ARDA 4AUMA 4AECA 4PIMA 2NX2A 4S1NA 4U7FA 4GZ6A 3TJMA 3QE9Y 5G4LA 4PO8A 4B7UA 4BX9A 4P7BA 1P1JA 2WHEA 1FXWA 2YNMD 4PC1A 3H4VA 3OQJA 1FUUA 3MJFA 4E1BA 1I6KA 3ZKWB 3A6ZA 2GAAA 1YCFA 4KDFA 1F20A 3AB8A 3L0SA 4D96A 1XNQB 1JG7A 3GFBA 4BBZA 4HTFA 5AJHA 3Q98A 3DQPA 1OT3A 4AMBA 1Z0SA 3SS9X 4TXNA 1M2OA 2CT8A 2Q2NA 2X9NA 3RYHA 2GYUA 3HO1A 3C3AA 2YVUA 1G7CA 5H82A 5HF5A 4L3VA 3NKLA 1RAAA 5HUJA 1MJ5A 2VTBB 5JNSA 3ETHA 1UZUA 3F5QA 3NJ8A 2O2XA 4Q3AA 1GFWA 3W5CA 3KKQA 4ZU6X 3JAMA 1CQIA 1U4SA 2JI7A 4Y2XA 2ZPTX 3DBLA 3DE7X 1QXSA 1UQRA 3EZ9A 3O1HB 1UAYA 1LFDB 2GN2A 2YJ3A 4FI3C 3QMPA 3KQQA 4I1SA 1FTYA 4UULA 4YMWA 5ICGA 1J5PA 1GPJA 5BSKA 4I19A 1XF9A 1NW6A 5AI9A 3S8MA 4J0KA 2VBGA 4OLHA 2XVZA 5EJ7A 4MR8B 2JJYA 3IOMA 4J0CA 4Q93A 3GLHB 1NMEA 2IIBA 3DPUA 3GDWA 3LQFA 4KJZA 4IQ0A 4XH9B 5FUWA 6LDHA 4QD3A 1W5EA 3LECA 4HQFA 1AKQA 4J0EA 5DHQA 3HKBB 3QX7A 3JX9A 1EWTA 4FS3A 5BT8A 2Q27A 2CUTA 2WWXA 2C98A 4BNXA 3EXHB 4PO3X 5LUAA 4LXYA 3AUKA 3RC7A 3QEJA 3UOWA 4U8HA 1VDMA 2O3RA 3D6MA 3BDIA 3WK4A 2WFAA 4Z4FA 2G9QA 2BMVA 4FQ7A 4FYYA 4R1NA 2Q41A 3UJ9A 3Q7RA 2CFOA 4Q39A 1YJCA 1ZH8A 2PZLA 4A5OA 2LKCA 4CTOA 4HBZA 5LD2B 3ZU5A 1W1WA 2BEVA 2ZYUX 5C5EA 3QWBA 3FRIA 1SZPA 5AOCA 1PQPA 3LHDA 1KI9A 1QZZA 3KXLA 2YR0A 3ZXUB 1TL7C 1O58A 1E1QA 1OBCA 4B1FA 1Z4QA 3HCPA 4PTZA 3TLGA 3H5LA 2IOFK 1EFPB 1OJLA 2QNRA 4OUDB 5CDUA 2Y1DA 721PA 1CCWA 2M98A 3OMXA 3OE1A 5G3ZA 3GLQA 1YBMA 1ENOA 1Z6XA 4ER7A 5B64A 3CNQS 2HHJA 4C4YA 4YRKA 3HU1A 2W7TA 1FS6A 1NQXA 3D81A 2DAPA 3F1LA 5EPEA 1KK2A 2R25B 3A27A 1GEGA 1QF9A 2G08A 2VP3A 3SXJA 621PA 1XKLA 2OVFA 3LYAA 4QDOA 3WNZA 2DPHA 4LGCA 3NIBA 1N6OA 2JEOA 3AY0A 3FXAA 2R6FA 2CL0X 3KXIA 1HE8B 2IIVA 3UXEA 2YV1A 1MHPA 5IXSA 1ONSA 5K4GA 2WDZA 4N65A 3MUNA 5T5QA 1V5FA 2CMGA 4WKOA 3P97A 3X2SA 2UXBB 1N9GA 4AS3A 3GMSA 1TVKB 1CZHA 4OQEA 1XZCA 2GXUA 1KYQA 3K9HA 3QIAA 2HMVA 4HNHA 4G0PA 2REQB 4A8JB 2YL2A 2R6R1 3H11B 2LDBA 3MUEA 5SZJA 3ZS9A 3KM0A 4GP7A 2AXEA 3VSDA 2WF8A 3SG0A 4HXYA 4NV3A 3JWGA 2HRRA 1JI0A 2IPXA 1TEZA 4MUGA 1RD4A 2X5NA 5AKEA 3L0CA 3MWLA 5I7AA 3ZWMA 4JI3B 5DXJA 4DV1B 3ONDA 4BWGA 4HNTA 1XLTC 4CG0A 2ATXA 2WI8A 2XH8A 1XALA 2CB9A 1T4CB 5EKTA 1N0IA 1WZIA 5AOVA 3DFIA 4BZQA 4CL8A 4GI5A 4Q7KA 1SBYA 1ZCJA 1ECGA 4DLYA 4OSPA 1MOSA 2OT3B 5A3RA 4RKEA 2GH1A 1H93A 1RT9A 3KOUA 3E0QA 4F6RB 4ZIRA 5KHOC 3OZCA 3FFBA 1DKUA 1LLQA 2FKNA 2NLOA 2V45A 5H16A 3T3EA 2AR0A 1W46A 2XAAA 4DJEC 4ZOBA 2X5JO 3FPJA 3R9WA 4A2CA 4B6OA 4DNQA 2NN3C 2VXBA 3G2JA 5ALIA 3M6AA 1TVEA 4K9RA 2BSQA 1GPDG 4X94A 4E88A 5KI6A 1NFRA 2DZDA 3HB5X 1YTLA 3NHFA 1H4SA 4WXRA 5E6RA 4F96A 4AZ3A 3U4MA 4TLBA 4YMSA 2XJ9A 3JV7A 1A8UA 2B4KA 4LVNA 2NO9A 3OEEA 4DMUB 2ODQA 3VH1A 4F4IA 5B58T 2DFLA 1SUFA 2SECE 2ZOSA 3JQ9C 5D5QA 4EUHA 2BEJA 2I4MA 2W43A 4K9MA 3RHZA 1OFUA 5IAJA 1DX9A 5KQSA 2AN1A 1FYVA 1S9HA 2H5IA 3QEKA 4G5HA 1JU3A 4JODA 2PS1A 4MQUA 1R3UA 2KM1A 2DHQA 3FVQA 1WXWA 4O5OA 4YCAA 3WG9A 1E7MA 2DBQA 1TTPB 4AO8A 4B3JA 1J21A 1R5OA 5BMVB 1HDYA 2DY1A 4RVSA 3TNJA 3RFUA 1YR8A 5K3OA 1XQVA 2HEIA 5D5PA 2R8PA 1KOFA 3FM9A 3OCVA 1NUUA 4D82A 4G5GA 2ZYIA 4KREA 4AJHA 2JZNA 4RPKA 5FHRA 3RAEC 3C87A 5IH7A 4ZA2A 2DQ4A 4X7BA 3W90A 2PGIA 3ZJTA 2BKAA 3CEPB 4MGKR 4P6VF 4G01B 3I05A 2HFJA 2ZIZA 1B6TA 3GPIA 4JJ7A 3MRXA 3BE5A 3EBLA 3MWFA 2WTBA 4MVCA 4RMGA 4RJKA 1G16A 3ELWA 2RGDA 4F4JA 1P4RA 1QHEA 3LC1O 4URZR 5KOIA 1KO4A 1NUPA 2BZ0A 3CX8A 4Q21A 2HADA 3O1LA 2P3OA 5CDFA 3RIMA 1N8TA 1U0RA 2KWIA 4S35A 1TD9A 3ER9A 3ECSA 1QJ4A 2ZZNA 2DKNA 3SIRA 2GAOA 1QU3A 2CKDA 3G6WA 3BH0A 4EG0A 1I14A 2C07A 1MORA 3L77A 1PWZA 3NONA 3UAWA 4IIDA 4W9MC 3W6ZA 4HRAA 1A1VA 1P6QA 4LZNA 2A35A 4MNTA 4UU7A 1JR6A 1Q77A 1CUIA 4OBXA 4HDKB 1N0WA 3MOIA 1PS9A 1R5JA 1L7EA 4LA4A 1S01A 3HN6A 5HJ7A 4YHHB 3KBBA 3RJ9A 1WUIS 4IGAA 5DNDA 1D4OA 4ZZ1A 1TU0A 2GUGA 3QHQA 4JQZA 1FA9A 2KQUA 3RSLA 4O4IF 3HWSA 4H3SA 2HJVA 1K8ZB 4P4TA 2RHRA 4YQEA 4O33A 4JYZA 2FWJA 1S02A 5JH7A 2FRVA 4LOKA 3ZUPA 2POCA 3IAXA 5FR1A 4CG2A 5BV2P 2Z5FA 3WRWA 5E8RA 2WIJA 3MELA 1TI7A 4GMKA 2GD2A 4PLWA 3CKLA 3U49A 3V46A 1P61B 4NYIQ 3HJBA 4HTFB 2XVMA 3H1FA 3KPJA 1QF7A 2OBXA 3ROPA 2OY0A 3WDMA 1D8AA 1M2OB 2G9NA 3I9V6 3I2JA 2JLYA 2YICA 1J0CA 3TZKA 4R8SA 1OYVA 3ANSA 3T9AA 3TW8A 3BD7A 3OFNA 3KV1A 3A7DA 1ZKMA 4MA0A 2WHRA 4IP0A 1V7CA 5KREA 1JQDA 2AJ8A 2ORYA 4I6GA 2QT9A 4A23A 3WRXC 1CQIB 4KTTE 3U1VA 4R9NA 3HBAA 4M87A 1NG1A 1TU4A 3FMFA 1KYIA 4A0SA 4D9HA 1IXZA 5C4MA 2W0MA 1KPGA 3AQ4A 5H3HA 2DBVO 3I5AA 3PFBA 5JROA 2HYIC 3SJBA 4ZMBA 5GGYA 3OIWA 3ZHXA 4E7OA 2DB3A 1KDOA 2J4CA 2ZWIA 1EM6A 1IJBA 1C9EA 1GKKA 2W93A 3P1JA 4PAOA 4PSKA 4EDHA 1BKSB 2GESA 3QOWA 1PJLA 4HWPA 5A05A 4AQYB 3QEBZ 1GJRA 5KTKA 3G9UA 3PZRA 3L7AA 4HNGA 1NNI1 1TYDE 4HB0A 2UYHA 4WDQA 3ADKA 3IESA 5FWYA 1D2HA 1QYCA 1W88A 4G1BA 3AM5A 3HGTA 4XD7D 4ENUA 1CUCA 1Q7BA 5F7JA 1JBEA 4JP3A 5BQXA 2DR2A 3IEPA 3HU3A 4Y67A 3V2HA 4UM5A 5CYFA 5EZYA 5LZ4A 3FOFC 4OI0A 3ORQA 1ZLXA 5BSTA 5H68A 2PK3A 1XVUA 5C46F 4EFNA 1LCIA 2W2KA 1H94A 2GZRA 3N0WA 4QC2A 2FPXA 4RL4A 3TL3A 3ZY4A 1X1CA 3O6VA 4YCNA 2IF0A 5TQVA 1Z6GA 1KJIA 1OU0A 1E0KA 1V71A 4AZSA 2QMUA 3H5VA 1GCGA 1U02A 4RLHA 1G8JA 2FK8A 3TLGB 1E2EA 1GT6A 1KEVA 4KR0A 5JI2E 2JAUA 1KSJA 1NX9A 4GEKA 4M7RA 3IQZA 2QP3A 2X13A 2YFQA 1XZ8A 3KC2A 4B76A 1L5GB 1E6MA 2C9BA 3F6BX 1CY6A 4AJJA 4JU8A 5A5EA 5ALXA 2G4LA 3AUUA 3NT2A 3ND7A 4COKA 3M49A 4YRBA 1MU0A 1ZDMA 3T35A 3FCSB 2WG0A 1JR2A 2Z1DA 1U8YA 4OCZA 5F52A 1N75A 1FDIA 4LHYA 5DCLA 1TEVA 5AKJA 3UK6A 2G6TA 5B3JC 5KYYB 2PUAA 3R40A 4HLDA 4HFNA 4IDPA 3BWCA 3K35A 4XWKA 4OBWA 3A1UA 2YHAA 4Y2TA 3SBOA 3IR6A 3C3EA 2P67A 3LIPA 2A9PA 1U2DC 1AUOA 1REQA 5FA5A 2H51A 3VI4B 1DJPA 4LXXA 2JCVA 1N9GB 2O7NA 1H8HA 3KX2A 2RD2A 1WZ2A 2BP7A 5FOWA 2WDPA 3OTQA 4EL0A 1F0PA 1U1DA 4EG8A 3TD6A 2C58A 3P9YA 5BXQC 4WXEA 3HM9A 4IJKA 1B8NA 3TVYA 1CWUA 2PRYA 2J87A 3KDAA 3CF4G 1QX3A 4YXWD 4LHWA 5DK6A 1PQ4A 4EX6A 2AG1A 2GN6A 3CCFA 4XDYA 3VDRA 3MA0A 1RE0A 1DBQA 3W2FA 1K8RA 4NOLA 4D4JA 1KH3A 3THRA 3DMFA 4KPGA 1XMQB 3EPPA 1F1BA 1I6MA 3WIUA 4AKSA 1ST2A 3CO0S 1I4EB 2W4MA 1P9LA 2YNMA 1RXWA 3I1YA 4B7ZA 8LDHA 2W48A 3K9GA 3T41A 3THXB 4N48A 2Z58A 1N6LA 2FSVA 2BFDA 1GTSA 3IJPA 3L2OB 1RPJA 2AN9A 4NZ9A 2P6PA 1HDZA 4PICA 1T8SA 4LF8B 4LHXA 2WUDA 1SA0B 3QNUA 1S8AA 2MINA 2W0SA 3FMOB 4QHYA 4FYPA 4KPUA 5CXQA 4HXFB 3VNRA 3G1TA 1WS6A 1SXQA 3IYLW 3RBXA 4MMXB 2WAMA 1M6WA 4ZU1X 4LRTB 4Q1CA 1KQ3A 2PGNA 1E1NA 3ZV4A 4GQAA 4AZ3B 3FNRA 4XWYA 1VP9A 4Q6BA 2OB1A 1JIJA 3QNWA 5JDIA 3O2SB 2ACVA 1C30A 3NOOA 5JPIA 2Q6VA 1G18A 1QDEA 3O84A 2BMEA 3LYLA 3VPGA 5KWEA 2DQKA 1TJPB 5FUXA 3ISJA 4TMVA 1NVXQ 1N2BA 4GDFA 4BB9A 2A5GA 2CBGA 2QGFA 2XECA 2G4CA 1EGMB 3DDZX 4BZXA 2D0DA 2OM6A 4L8YA 1JZQA 4D3SA 3L92A 3M4NA 4IWNA 1KVSA 4OOFA 2WM3A 3U39A 1LK0A 2GZ1A 2Q7DA 4A03A 4BP3A 4EY6A 1H0KA 4WOBA 2JARA 3NAQA 1QQBA 1G63A 2FPIA 4F5DA 4GYJA 2V1XA 1XRQA 1E18A 4N3AA 2OV2A 4AJLA 1Y4ZA 2NTVA 3LKDA 3CZRA 2D8AA 1KSFX 4E4RA 1ZUHA 1PJSA 4X1YA 5SICE 4ZHSA 3EGDB 2KJQA 4WOKA 1Y6FA 2XQFA 1WETA 5FPQA 4BC0A 4LNUB 3Q7PA 5FL7A 5EP3A 4MH0R 3UANA 2ZRJA 5E9WA 2IXFA 3TTTA 1BDBA 4RHFA 2WF9A 4XYLA 1UZAA 1ULAA 4G4SO 4IBOA 4MCHA 3SC6A 3FW1A 3OT5A 1VZ2A 4OB8A 3EIEA 1XRLA 5I8WA 2LIPA 4FDVA 5LMZA 1KJQA 1J49A 1HKHA 4HG2A 4BZWA 2ONCA 3DL7A 4WZBA 2ZUSA 3UB2A 4CDNA 5FX2A 1YDEA 4KFCA 3NHUA 1RPAA 2QJFA 1LA2A 3QKUA 2XKBA 3EZXA 3L4KA 2ZIUB 1F38A 3LAWA 1LW6E 1RM0A 1IIRA 4ABTA 4RS3A 1ZH4A 2J31A 5IT9A 2GZSA 3AI7A 2R00A 3T06B 4YBZA 1PYGA 3CLHA 3MM4A 4G4IA 5FADA 3ZWKA 4RJTA 5CLFA 1A69A 3EQ6A 1I3KA 3ZJYA 3AF0A 3WGMA 1ZMOA 3VR0A 3NMUF 1T5TA 3K4HA 1HM5A 4R68A 2GM5A 4P83A 1L4UA 3L82B 4NLLA 3SZUA 2ZULA 3L6UA 5DNCA 2PA0A 3IXMA 4L16A 2EDCA 2FYTA 4C3OB 1JDJA 3CT6A 2YN4A 3PQFA 4JA2A 4NH0A 4CPDA 5AVWA 2HZ7A 2ZFUA 1FJGB 3E2IA 5JH7B 1IPFA 2XA1A 1V45E 2HK9A 4XLTA 2CGEA 2V6JA 4I9NA 4Z51A 2X40A 1DEXA 5CFRA 1HSZA 4NRDA 3BS4A 3KR1A 3UJ8A 4FDTA 1C0PA 3A1EA 3PRKE 4UPDA 1VZ3A 1LGYA 1IQRA 2WBLC 1E2GA 4XIFA 2C88A 1OSNA 3RRZA 1A88A 2XNCA 4PN3A 4EB8A 3GP3A 5K4AA 4EPWA 3O90A 1YIDA 2BEWA 1EB8A 1TZMA 2PKEA 4M8KA 4MYRA 1YXMA 2CVFA 3NEYA 2MMGA 4ALIA 1WSBA 4MVJP 1VBKA 5AW6A 1E0SA 3FZYA 5I45A 2WIKA 1RC1A 1GQSA 1ECBA 2B61A 2A1UB 4PYQA 4J0GA 5JT1A 1KY3A 4NZNA 4M88A 3Q3EA 3SX2A 2FWIA 2HGZA 4XPIB 4BEJA 3V1YA 3C0KA 1MAAA 1ZESA 4X97A 3NHBA 4YUVA 2LPMA 3IQEA 3E48A 1BYUA 2A9RA 1GPNA 2QX4A 3L7MA 4PONA 4X0EA 3V8MA 5A5DA 1FFWA 4U7HA 5BVHB 5IDWA 1RQPA 2AG6A 2ILTA 4WBXC 1RXCA 4KK4A 1DLJA 2ZSBA 1YL5A 3BSYA 2W22A 5ENVA 3P5SA 5HDBB 4MHSA 1HO3A 3BXPA 2BDUA 3D6NB 2O2HA 4ZKEA 2ZI7A 3ZZ0A 1H0SA 4Y2PA 2C7RA 5FWYB 1Z5UA 3EQ8A 5HBGA 4MLZA 4TTAA 3H9CA 1C1DA 4BVEA 3OURA 5ALJA 3ER8A 3TK1A 2VEOA 1L4GA 2VOEA 2ZTUA 4G4JA 3ZTYA 4B44A 3MVEA 2CLIB 2JS7A 1PV2A 1N33B 1P5RA 3QMMA 5EZYB 2DFTA 3VTZA 2QQ0A 4U3JB 5KYNA 4DABA 2AS0A 4Z99A 4B4UA 3MERA 1QHHA 3Q7TA 5IBQA 1SKUA 2AQHA 3U3JA 2W2KB 1QAMA 3BGVA 1QIEA 1G4UR 2BFEA 3NOXA 3S1SA 1E2QA 1R6VA 2CXUA 3ENVA 5HILA 1CP2A 1PZMA 1SIOA 2EFYA 4GPEA 4K86A 3QVGA 1WY5A 2KYRA 3PHIA 4N3GA 4OHCA 5AM4A 1G98A 4EFKA 1INLA 4S0XA 2GLTA 1U6JA 4R9VA 5HXAA 3PQCA 1RLOA 2ONZA 2I1LA 1Z0ZA 3L4SO 1N25A 4UHEA 5DLYA 4ZZ3A 2BLLA 4MUHA 3L07A 3IPXA 4HB3A 1C0LA 1NBHA 3WMGA 5TV2A 1Y9JA 2QYSA 3GDHA 1JL3A 1SBNE 1XZNA 4YJFB 4L7QA 4ZGGA 5DBOA 2BGGA 1JPJA 1DE0A 2A0YA 1QBKC 4ISCA 5EQDA 1MG0A 4A3SA 3T1YB 1NKVA 4FYIA 5LLSA 3M2TA 1R6UA 4I08A 5T3YA 3RAPR 1REQB 1WXEA 4DLLA 5MN5A 3A4TA 1OPRA 4UQOA 3WLEA 2BP7B 4ARBA 2Z6UA 3WGHA 4I55F 3NJRA 1YL6A 2OESA 1AKTA 4INPA 1RPTA 1U5AA 4HNSA 2EBFX 2QZPA 1NM5A 1JI3A 1WKVA 3EAGA 4H7IA 4QVGA 5AVKA 2AFRA 3FSEA 4OQFA 2PQ6A 2HBRA 1NQAO 3QPDA 4R2LA 2O05A 4P3OA 3UJHA 1FDWA 2PU7A 3VNSA 3ONNA 2QRHA 3H7AA 3SYMA 1DHTA 5AOBA 1JJFA 1VHJA 4NPCA 4X95A 2PKQP 3ZLTA 1XTQA 4OREX 1DQYA 5LYJA 1SQGA 3IBFA 1U8TA 2Z57A 3QU5A 3R8FA 1XFDA 3DWIA 3TL2A 2OFOA 4IJVA 4O2AF 2CHQA 2X2OA 3LTNC 3RROA 2C4TA 1LX7A 2VQFB 1DDOA 1OWNA 4ZT2A 1HL7A 3TKAA 3T5GA 2JFHA 3PXUA 2QAIA 1FLDA 1WVMA 3GUUA 3QMWA 4LUCA 3KPUA 4IDDA 4TTRA 1VSTA 2MINB 4V0KA 4G5XA 3VO8A 4GKJB 4B32A 1KJ9A 1C2YA 2AJDA 2D8MA 2HSGA 1Q6YA 3V5NA 5JALA 2PKRA 1LI4A 2WTAA 3CR7A 1YRLA 2WYHA 1UOEA 5CHEA 2GD6A 4WLEA 4WQMA 3RUPA 5EJAA 2UVPA 2AR7A 3P7MA 1NVTA 1PNVA 1C30B 2W11A 4D8WA 2CLLB 5K0JA 1Q14A 2OG1A 1JDNA 1DX6A 1XN1A 2YIJA 3P94A 3TJRA 4XASA 2X5XA 4CKCA 3WYGA 3MCTA 5B53A 4CV1A 3BSWA 1C4WA 4R8RA 2DX7A 2O8VA 2VFAA 4XKJA 3DXZA 4KR7A 2P1ZA 2IPMA 3DMTC 3KEOA 3LK6A 5DGIA 1THZA 1ZM3A 2IC5A 4NG5A 4XYGA 2FUEA 4CETA 2Y05A 3N6RA 5LZ2A 4MDEA 4HAVA 1KK1A 3A36A 1KR2A 2MHCA 3CLSC 3H1AA 3KEGA 4X1OA 5AICA 4EECA 1UBFA 4ZZ2A 4YFVA 1WCYA 3HRHA 3I0ZA 1YR2A 2ZQZA 3PNVA 4QAQA 3LYUA 4PQRA 4W7IA 5E1BA 3BTUA 5A7FA 2JLQA 3I37X 1Z88A 3F5DA 4LE2A 5NULA 5IANA 4WK0B 1NXTA 1Y8QA 5BPFA 2VHTA 1RQLA 2VL7A 1ISFA 2XDQA 1UUFA 2FW7A 2GFHA 3EVZA 2JAOA 3II6X 3L0PA 3KZNA 4RV4A 5EIOA 1IUKA 4DLKA 3PJFA 4E46A 1Z6YA 4F5YA 5JJIA 2A84A 4Z4HA 1SZDA 2DBYA 2FMXA 4S12A 2A5FA 2HTFA 1Z63A 2O7RA 1CEQA 1VL2A 3MPOA 3NHJA 3EZ7A 4PS1A 5B7PA 4CKWA 3ICVA 2AX3A 1YC5A 2W6JD 1RRPA 2C8LA 4HWGA 4G24A 1YZUA 4QELA 3WBFA 2WJAA 1PDVA 2Q3MA 2IYZA 1U9IA 2ZJFA 5CT6A 1P4AA 1XGKA 4WZBB 4BDSA 2Y9PB 1ODJA 3G5LA 4QYIA 1A76A 2NU7A 3DMGA 5LNK1 2R6GA 1SXJD 3IP7A 4HH3C 1HYHA 5TEWA 3WWZA 4F5EA 1T6NA 1TGVA 1PZEA 1GFIA 4OMUA 5AR1A 5GINE 4WLNA 1ZD9A 4CMGA 1HYEA 4BKUA 1P1KA 3REQA 1Y6JA 2C94A 4Y30A 1CUAA 1FUYB 2CSXA 1D0SA 1M83A 3KQVA 3NBMA 3MYRA 4IH9A 2B5VA 4PYLA 2QUHA 3KD2A 3NM5A 4UTVA 4DM7A 1UMCA 2Z2KA 4CMEC 1PNTA 1F7UA 4G9BA 4EABA 5LDGA 4YUAA 5FHQA 1RLIA 2H07A 1USUA 2X4GA 1LJUA 2EBUA 1C4KA 1ZBQA 1WZNA 3VHQA 3VR6D 3ZD9A 4N6OA 2IHNA 1EZ1A 3CX7A 5DXFA 2DPGA 1MJGA 1VHQA 3BX1A 3F9RA 3RKSA 1T9CA 1Y3HA 4ZTUB 1C3OA 3UJBA 5JSFA 5DHSA 2JA2A 1GZ5A 4MW5A 1GN9A 2CHGA 1RPNA 1X70A 2VHEA 1L7QA 3CVJA 4M0UA 2HV8A 2WA2A 1G64A 4KRXA 4O8CA 2ECOA 2VDVE 4RVOA 3IDSA 5DYIA 5U1PA 1Z7GA 4XUGB 5HUQA 1AS2A 1CUFA 3MYYA 3G0GA 2DPMA 3OTWA 5JJBA 1VGQA 1E4OA 2WKRA 3EXHC 3NVMB 5HMLA 1NN1A 1RZRD 3UVEA 1G8GA 2H5LA 4AYXA 3FCYA 1ZVJA 5GZ3A 4B3DA 3SOZA 1Z6QA 1QIHA 2MSLA 4NU5A 2OMKA 2P2LA 2ZE8A 1X1SA 1YGYA 1LJ8A 1ECLA 3PJEA 1CRZA 2QTNA 4L9WA 4MB2A 3BH6A 1N6KA 3OFVA 2D1TA 4OHOA 2HU8A 4BRZA 3RADC 2P3LA 2J5KA 3EC2A 4D4IA 1YA8A 3RE1A 3ZVNA 1YAJA 5KNCD 2J6IA 4OFZA 1QQ6A 9MHTA 5IKEA 1AXGA 2C5EA 1QLWA 2G9RA 1AGYA 1NF8A 3FPSA 1QZTA 3TS1A 1UK8A 4QLOA 3SEZA 1RKVA 1Y7LA 4C0AC 5JWHA 1W5AA 3RC3A 5EP4A 4L85A 4GZ3A 1YJXA 3OQ6A 4QSMA 2A67A 2HRQA 3V4FA 2H1CA 3E7FA 4LMPA 1SZCA 1U3VA 1AGNA 2V6IA 1E66A 1TPZA 4QHTA 3UC9A 2ISQA 3PZBA 4QGSA 5JVDF 2NACA 1B23P 2QJOA 5TVGA 2H4YA 1Z18A 3BL6A 3BOSA 3FZEA 4W7SA 1JQAA 1ESCA 1QHHB 2B99A 3ZU6A 4F8YA 1TM1E 1LI7A 4I5IA 4OHBA 3PUXA 4B6EA 2VUUA 3B5JA 1Q83A 2O50A 4TXJA 1ONNA 2XIJA 2I66A 3EIQA 3PGVA 3UUGA 2FR0A 3NKVA 1JDUA 3PUKA 2QPAA 3ELDA 4JEMA 5JLAA 4B2IA 5EHQA 5JCPA 4ON9A 3NVAA 3HDVA 5GY7A 4JI1B 3DZ8A 3I5MA 3AF4A 1V9LA 2B1JA 3UWPA 3UWKA 3QPAA 4JC8A 4A8JC 2NTYC 1SHZA 1J2JA 3I92A 5BQOA 2DQYA 4LJ6A 3AVQA 1GZHB 1DWPA 5ELLA 5I48A 1MNQA 3QLJA 4GPAA 4BCCA 4AUKA 3LT0A 2HKIA 1JHVA 2OM2A 3ZNQA 1YR1A 4PFQA 4BV2A 1CEYA 4LJKA 3G68A 4BJ5A 3TN7A 4IV0A 4NH4A 4A0RA 1KZ1A 2PAAA 1M10A 4BO9A 2QTCA 4BC1A 1KE1A 1P1BA 2XUJA 3F78A 5CT8A 1G41A 3QEMB 2XY4A 4D9MA 1PDWA 1W44A 1M76A 3PUIA 3K8YA 4RPCA 3KSBC 2H9YA 5A9RA 1PS8A 3VR2A 2BELA 4GP6A 3KP1A 1GZVA 1U6IA 5AJWA 5L3QA 1TLLA 3LCCA 5JDCC 4YAGA 2X14A 2YOHA 4MDYA 4M9XA 1Q0SA 5CEJA 3OPVA 4B34A 3D59A 3C6MA 4IIYA 2QR5A 4YP6A 4ACAA 2FUCA 1NI5A 3O3NB 1X0XA 1IZ9A 2OCDA 4JOBA 4PO9A 3G17A 4AMUA 3P9CA 1UDXA 1HDOA 5H83A 3IL2A 2ID9A 1E2FA 4MPDA 2H57A 3KEMA 4QQFA 5LYJB 2W2MA 4N7RA 3TW6A 3CUUA 4K9NA 1U6KA 3SVTA 3B70A 4UW9A 2EOAA 3WRYC 4D9KA 1PV4A 3LGAA 3GB9A 5KNBD 3U09A 2P0AA 3I6BA 4O4HA 4AUEA 4RQBA 2NQ2C 5A4AA 5CG1A 4ZDJA 4HAUA 1T2AA 4E2YA 3DXXA 2NYUA 1OAAA 3AM4A 3T4PA 2O2ZA 3QXSA 4UPEA 3PHLA 5CB4A 1FRQA 521PA 1SD5A 3JYHA 3D43A 4PNHA 5B2FA 5KQMA 3T0IA 2IPAB 4GX1A 4ML3A 2KB0A 2Q49A 5JXGA 1DG3A 4EPXA 3FB4A 2XTAA 4BO1A 2HL6A 2XT0A 1M1ZA 2BTEA 1FRZA 2HCBA 1PQUA 2I2WA 5LZ7A 1DT3A 3SQLA 4E5NA 1C0EA 1PR2A 2RHWA 4B9AA 1Z5OA 3OM9A 3L7LA 2VQDA 2E4YA 3ZBPA 5B5SA 4H7JA 3KPWA 3IA7A 3IJRA 2R2AA 2ZB2A 1NHGA 4D5GA 2H52A 4CKCB 3ZWVA 3MT7A 4FDLA 5KEIA 2X6RA 5DRYA 4YNBA 1SVSA 1NQ5A 3KVOA 2AI1A 2IK8A 3DXFA 4GD3Q 5CIWA 2AW5A 1MENA 4FOTA 5FLKA 3U0BA 2TMKA 4I2VA 3RIHA 4WNAA 4MDHA 2ZYGA 1XZHA 3TQOA 1C0KA 1U94A 1Q0TA 2HH9A 2FPGB 5D3MB 1SBIA 2IEGA 2QRZA 2ZBPA 3DTTA 1JSCA 4AMYA 2D5IA 1XI2A 2G4VA 4HHEA 3DSRA 5CJJA 3EUAA 1FDRA 4GSKA 3PRJA 3LK7A 1QC5A 4B80A 4DARA 1LPSA 3RO7A 4E1VA 2H1OA 4HVLA 2YVLA 1S3FA 3OLVA 3Q8WA 1Y8QB 1WG8A 1VSBA 2F9FA 2XDQB 1CULC 2ZKIA 4A27A 3B1XA 5KKAA 4PZAA 4WESA 2TMGA 4C87A 1J2RA 3K0KA 1QYRA 3I23A 5LXTB 3Q5GA 4OFXA 4BY9E 1MAUA 5ADVA 4LSMA 1OBHA 3ZD6A 4CKWB 3F3SA 2WJPA 1J5XA 1VSVA 1CIPA 3D0KA 4MP6A 1AE1A 1JKIA 1QR6A 3AJAA 1Z4LA 5IMSA 1CK4A 3LPDA 5I8ZA 1QIJA 2BF7A 2HQ1A 3IP9A 3MZ0A 4ER3A 3PKZA 2MMCA 4CGZA 1MEEA 3UCXA 2OCYC 3B1VA 3CS3A 3L8ZA 2NU7B 3A4IA 3HUUA 1GSIA 4Q4HA 4QYIB 2ONJA 2XE6A 5BV7A 5KQRA 1QR2A 3EJ6A 2B98A 4DEYA 3SPXA 1GAWA 2ZJAA 1D7OA 1YA6A 4BB6A 1QLHA 2FP4B 1DAHA 4JAVC 4Q3LA 1FY2A 3G5UA 1P4HA 3REQB 3WL3A 2Q2OA 3OCJA 5J5VA 3T8YA 1T5DX 3DD1A 3IA2A 4D0GA 1QHGA 3D5EA 4C4ZA 3HU5A 3ADBA 1OLUA 4RIEA 4NYMQ 4BQOA 1HT0A 1RRFA 3D7MA 1M1YA 1U04A 4DIOA 3CM0A 4XIYA 4PC2A 2B36A 3KFVA 3Q9SA 4XZ3A 5C53B 4X6YA 4ZP1A 5LLTA 3UF0A 3A9CA 3W5AA 2HT1A 2AUNA 2WIFA 1VKJA 2ZRLA 3MOGA 4PS0A 3CPEA 4ZI5A 5M5BA 1WU7A 1ZGGA 2ZROA 2JFZA 3AF3A 4S1OA 2CKMA 2ZAIA 1C3OB 2IYLD 4DV0B 4CF4A 1J00A 2IHYA 4NULA 1U31A 2II6A 3LIIA 4TUYA 4U2KA 5FL3A 3VO1A 4CM9D 4OU4A 4WBNA 3WWDA 4BNYA 1BOFA 3Q7QA 3LS2A 4HADA 3WYFA 4RZSA 1O95D 4X1YB 4CG3A 2Q6LA 1X1DA 4P32A 1SHJA 3RS4A 5L53A 1B3BA 1O8BA 1R9MA 4ALKA 3KQLA 5AW3A 3P32A 4KMSA 3IPYA 4COOA 4EGAA 4MRNA 2HRDA 1Z4PX 4RESA 3LSYA 5IJXA 2E87A 4MV8A 4D9NA 4CUJA 3VFDA 3A3YA 1RKBA 4AW9A 2Q9CA 2GZMA 4FOSA 4CKEA 3U37A 4DBLE 3I4CA 2ANCA 1MRZA 2GZAA 5DX1A 1HNWB 4JB2A 3FPAA 4FMBB 1GARA 1FP2A 5JE8A 3NHKA 4BBAA 4LS3A 3MHTA 5F23A 4LAFA 2ACWA 3ZLVA 3JZMA 2PANA 2EXXA 1P39A 4JP8A 4G0NA 1K2VN 1P0PA 1Y6RA 2QMEA 3DT6A 3IV6A 4HDCA 4TGLA 3GARA 5E8JA 3FIJA 4LE0A 3GGJA 2CFTA 1OPXA 2OQ2A 3FDZB 2BFOA 4LDPA 1NV9A 5DASA 2I99A 2I6FA 4PR3A 4FCWA 2I87A 2FPLA 2G9VA 2IJGX 3EK2A 1R00A 3RVLA 3TQFA 1UF9A 3CIOA 3O8OA 4K6KA 2R0QC 3KAPA 3GK3A 1A8IA 1OI3A 3QRWA 3MFYA 4WGFA 4XYBA 2PTHA 2V0CA 5E6SA 1F7VA 3IUSA 1ZJ4A 2QI9C 2HJHA 4K9SA 1E62A 1UWCA 2WIGA 5B1HA 2JH3A 3DB1A 3NATA 2PL1A 2IHUA 3TGLA 1P2DA 4Z6KA 4UDYX 1USVA 1IAQA 1U7PA 1TYZA 4TRRA 5E7QA 2D6FA 2AGVA 4R8MA 5ILOA 5A3QA 1ANKA 1JWBB 3AHEA 5HGJA 3ICWA 4O4IA 1UL1X 4IL5A 4WKNA 1EVKA 5E1DA 2OGZA 5BPHA 2XE7A 1LBIA 1MZPA 1T13A 4LI3X 4UKDA 4F5WA 2QMZA 4ZVRA 4KQ1A 4JDUA 1K5DA 4WZAE 4YBRA 1VJ0A 1RI3A 3L8EA 3W8FA 1UBEA 1QIKA 1HDEA 2OQIA 5AQ1A 3AT1A 5ENZA 4Y98A 3ZHYA 2VDJA 2ZBDA 1Y1SA 2JI8A 2DSNA 2GYWA 4ZGBA 2GHTA 4D8UA 5BRJA 3QPUA 3WK9A 4EZIA 3DAFA 4LX0A 4AP9A 5KMGB 3VO2A 3TGPA 1BE0A 1O0CA 1WW2A 2BFCA 3LY8A 1D03A 3B2QA 4MLDA 1V48A 2V6BA 2P75A 5IAKA 3NWBA 1SXJA 2GM3A 1HZZA 3KKLA 3WR5A 2PMKA 2JJ2D 3AY3A 3I6YA 5C4GB 1V7ZA 2P8SA 2JD2A 2FPMA 3RV4A 4OH1A 1OWMA 1V8BA 2C9YA 1RYFA 1IZ8A 2EKZA 2JJMA 1K7CA 1Y4SA 4DDHA 2PZJA 4FFMA 4OK5A 9ABPA 5L3QB 5AI5A 3MQ2A 1V47A 4H18A 3R76A 4GICA 2AJBA 3FH0A 5IASA 4LF9B 1I7QB 2Z4TA 4ISBA 2C2HA 1DKRA 4KOAA 4P7FA 1JPUA 2Y2UA 3TZ6A 5LJLA 4TX1A 1AV6A 2BR5A 3V1LA 3DZKA 3EGCA 4E08A 4DIMA 2F7SA 1MOQA 2YWCA 3VR6A 1RR6A 3G7UA 4QDXA 5NLLA 1MC5A 2FOIA 2F43A 1JXMA 2IGTA 1KTVA 1AB6A 3EIOA 3HP7A 3HWWA 2WKWA 2QAGB 1MH1A 4M0FA 4O4HB 5JS8A 1F3LA 3U17A 2BVNA 3WHKA 3L41A 1WD7A 3AR2A 2EX1A 2AEFA 1KFKB 1T0IA 1D0VA 1UWLA 2PBRA 2QE6A 4MV1A 4L28A 5CB4B 1O0SA 4BQFA 1WMDA 3EGEA 2OHVA 1Z0KA 3WQSB 3WZLA 3JSAA 2IXAA 1T8UA 1XKXA 3E1SA 1P9RA 2EP7A 1RZRA 2N3ZA 3JQFA 3A6KA 5JSZB 3PFWO 3RRYA 2O3SA 1ISHA 3QKWA 2P1RA 5I7HA 1FX0A 4DB2A 5KB3A 4D98A 3UN1A 2ZJ6A 2OHXA 5I51A 4XQ9A 2AFHE 4OHKA 4E5UA 3DNMA 3TLYA 4UVDA 3KKPA 1YZVA 4QSHA 5FI1B 3GLFE 3IDQA 4MUYA 5AMXA 2OFWA 3M6FA 2ZDQA 4R6WA 4UM8B 1Q11A 5KNCA 1H9BA 3DHYA 4WNAB 5E38A 3PPXA 3BWDD 5DKFA 3T5CA 2OL4A 3R09A 1PDOA 1CP3A 2J3KA 4MUFA 2IYPA 4DCMA 2YZ7A 4RPLA 4RKRA 5TEVA 4Q12A 1QC5B 4AC9A 2I9PA 3EASA 3CEJA 4HF7A 5E1MA 3CTMA 1GL6A 3VX4A 5L3RA 2PVSA 4CMHA 3T1OA 1OXTA 3A06A 5IT5A 1QG6A 4GNKA 4WESB 1GTG1 1LSOA 3TLJA 5JSYA 2XRZA 1SOUA 4JIMA 2IUTA 2BSXA 1DKMA 2B7BA 1XOIA 3JD2A 3H5RA 1CR4A 2I29A 4L4ZA 3R7NA 1QH1B 3NANA 2VPYA 4UE2A 1JS1X 1ATZA 5ALOA 4M46A 4X6XA 1PE0A 2R1UA 1P2SA 1NMXA 3KSRA 4DNFA 3SVLA 1UXKA 4ONEA 2GFIA 8ABPA 3WK5A 4WJLA 4LVOA 2C2KA 1YACA 5DHUA 4RSRA 3GVIA 1QCCA 1M8PA 2J6CA 3SYLA 4UOQA 5HEKA 5KQLA 2BGJA 2B6NA 1CF2O 1NUHA 3GRZA 3RJMA 2DWCA 4HCJA 2V4MA 1JMKC 2WOJA 4KX5A 5GVRA 2GBLA 4ZYWA 3ENZA 5CX1B 3I9MA 1E79D 1YB6A 4DCVA 3KOOA 5BWLA 1XD9A 2VWGA 3D7KA 3BULA 3OOHA 1OLUB 3IDAA 5BN3A 1YDGA 4FM9A 4D26A 1M1YB 1UJ2A 4AY4A 3HKEA 2QU8A 1O2DA 2OO7A 2W8ZA 4TTSA 2GEFA 3CNLA 4P0QB 2ODAA 1ZICA 1RI4A 3UY4A 3ZDFA 1XDGA 2CV1A 1YMVA 3TQTA 2LCIA 1TMYA 2VG8A 2D59A 3ETDA 1AGPA 1UBMS 4BATA 3LP8A 4XIIA 4L51A 4MTCA 4IEIA 1SOWA 3VTAA 2ZEJA 1E9FA 1C0IA 1RQXA 2PEZA 4H6WA 4QUBA 4TUYB 4Z49A 4WBNB 5IX8A 1T1GA 2JVKA 4TLCA 2C59A 2FVXA 3NGMA 4HVAA 2C3YA 4JSTA 5J2TF 1CRLA 2WSSD 4B3BA 1R9NA 4WNCA 4DR3B 3G79A 1J2TA 1MXHA 3HZHA 5FBKA 4AJ1A 2BMFA 5K3BA 4J2OA 1ZQ1A 2FN4A 3Q1LA 2ATVA 2GAFA 3R6WA 4AJ9A 3IEUA 3ESBA 1R7RA 2ZIVB 1IOLA 5KNBA 4AAYA 3ZVLA 3V3KA 1FPQA 1TC1A 2WRZA 4TS4A 4OGLA 4BLVA 1YMQA 2ALJA 3PUHA 4MUMA 2R7LA 3VU8A 2HWXA 1JKFA 3WSVA 5L51A 3LBIA 1TM4E 3NTLA 4BYMA 1UIRA 3JQ7A 5IUJC 1GPMA 3FETA 4KQIA 4C3UA 2FFHA 1L5KA 2JK1A 3PE3A 4ILKA 3F6YA 4D7AA 3QPVA 4BUCA 2XBUA 4JK3A 1WXDA 2ZI4A 3G8BA 1GQFA 5LP6A 5KSOA 1F2TA 3EYWA 1X38A 4JSYA 5DNVA 3DPIA 2WPNA 1Q15A 1YI8A 2WTXA 4GWKA 5FTMA 1CJUC 2BBTA 4CFZA 1XQ1A 1NTOA 1ZONA 1CTQA 1MHTA 1AKYA 4V2IA 3O8OB 1SOAA 3VDMA 5HJ2A 5K6TA 5G1OA 2NP7A 1I2ZA 4B6JA 5LMUB 4LYEA 4RY2A 5E6SB 4Y0NA 1R16A 4HDSA 4C0SA 4O25A 1W59A 5AHRA 4DRYA 5BW5A 3OBBA 4LJLA 4PGMA 5DYGA 1Z45A 1EH5A 4O0LA 4CL2A 3O82A 4AZVA 1KC1A 1TJ3A 2QENA 3RAJA 3STHA 2WMOB 3P9ZA 3TLBA 3GFVA 2B9VA 3DEIA 2ZU6A 1WXGA 1WL8A 4KQCA 4MGYR 3SF8A 1HZJA 2XDYA 2C4MA 3HACA 5ESDA 2JAHA 4QNNA 2ZRBA 3OQBA 4G1VA 4TLLB 1MJFA 5JJ5A 3N2IA 3RWBA 3UMYA 4MEJA 4U2EA 5IJAA 3ZYZA 1NBWB 2HUPA 3DFZA 2WD8A 3KYIB 4QVKA 1FE8A 5CTAA 3LXUX 2D5BA 3OLXA 3VMMA 3O4IA 3QUQA 4B7CA 1T4GA 3GXOA 2IU3A 1E98A 2J1LA 4FKMA 3NETA 5IYZF 3U1BA 1ZOPA 4ZVLA 5EMKA 4KHPB 2VHVA 3CNEA 1B3RA 5EE0A 3IBSA 3EDMA 4WN9A 3TI9A 4K88A 1FNBA 2I3DA 1XPJA 3CKKA 4JQSA 1EFRA 5CB0A 5L7TA 2CVQA 2WJYA 1SXJB 2YNMC 3B9QA 4CEJA 3NH9A 4FFNA 4OQDA 1EGAA 1BVRA 2HF7A 4UHCA 2FSVC 1TE2A 3GJXC 4BKRA 3HGMA 4B8ZA 1OZHA 4BKMA 1UBHS 2C3MA 5CVJA 1CS0A 5GZ1A 1KVQA 1NE7A 1P5HA 4N82A 3LLUA 4YJHA 3DHVA 2GSWA 1TTHA 4IXWA 2ODNA 2FFQA 1H3EA 4EA8A 4CQMD 3ZQ6A 4C76A 1I33A 2OK8A 1L7DA 3SSAA 3WQBA 1CDZA 2GHIA 3QBTA 1U3WA 3OQVA 4X93A 2B21A 1WJGA 5D3ZA 4Y9RA 1DBWA 2JGNA 2JLSA 2IPOA 3KVRA 1BN6A 3OCWA 5JDIC 1T5HX 3LXXA 3QLEA 2F43B 1DP4A 4YS6A 1I7NA 4P08A 5IDXA 2C31A 3PGLA 1QHFA 4MQMA 3AIMA 4RM3A 3HI4A 3KYDA 2H4HA 3FTQA 3HCWA 3CPHA 4CCWA 2IZ6A 4CM9A 5HIAA 1E2PA 5EL0A 4B35A 1H66A 1G8YA 1G1AA 5WRFA 1Q7TA 1SPBS 5JD4A 5K01A 2YY7A 1O95A 3GLIB 2P2CA 4RD2A 1KF0A 5JD5A 3I9JA 1FJHA 3G2IA 1X92A 3DUFA 3KLMX 3S0JA 4PYRA 3ZHOA 1LTHR 4R0NA 3PPWA 1ZCAA 3KWFA 4I9GA 3WXMA 1R8QA 1L9KA 1HDGO 2GHRA 2Z5GA 3FHCB 2H2FA 3HR4A 1DAKA 1U0EA 3K4PA 1FX0B 1H6BA 2ZR0A 3OQIA 3D4LA 4ND6A 3NTXA 4IZHA 5G0UA 2E7ZA 4LDQA 2IEIA 4HZGA 3R8CA 5K3FA 3RFVA 3I0NA 3DLAA 3OCYA 4CIYA 2PWBA 3GN1A 3MLAA 1I5RA 2OAP1 4A92A 3IEMA 4EM6A 3MMZA 3HJHA 4ZMSA 2GKGA 2NUAA 3FOBA 1XSEA 1TQDA 2BN4A 3ICCA 3QVLA 4QDTA 3KSMA 4RLFA 2WTNA 5A02A 3QV2A 1CUBA 1ZL2A 1IDN1 3P5BA 5AI0A 4UVEA 1VPWA 3WL8A 4A8HA 2YRWA 4GL2A 1ZD4A 1AJEA 2OYRA 3E9MA 3PFKA 4TWJA 4G36A 5DP1A 2XQKA 4IXTA 2I7CA 3WTBA 1S5PA 2GN4A 2UXCB 1XDSA 4MYTA 3LF2A 1Q44A 4P82A 1X6VA 2I03A 3MS2A 4FT2A 2R00C 3ROZA 1DDIA 4KYUA 2CL7X 2A4MA 3TINA 4CM6A 4DMMA 2K7FA 1U0LA 1DMRA 1N2GA 4LTMA 1X39A 3MJRA 1ZCBA 2R6HA 4NESA 1P2GA 2CD9A 2GB4A 4N03A 2PBFA 5C31A 4EUFA 5AQEA 3D2LA 1MP0A 3MSXA 4LI0A 3CNOA 3Q41A 1GG2A 1RWBA 4TMYA 4TV9A 3ZDYB 4JJ8A 4DM3A 2RI6A 5LKRA 3W77A 1TT5A 4HDMA 1WM1A 1CDOA 5JAUA 2IODA 1T2EA 2BUAA 1NRWA 4PTYA 4CNBA 4A6PA 2CNKA 2IPLA 4F97A 4OLBA 1D1QA 3M6LA 5THKA 3GLSA 1AH2A 1YI0A 1MW8X 3C6XA 2XCOA 4NBUA 4X7RA 4QPZA 4IINA 4M1ZA 5JRJA 1VM6A 4M9ZA 4B33A 3QVUA 2XQJA 1APBA 4O2AA 1WQ3A 1K3TA 4K5QA 3HJAA 3BL8A 5LDHA 4DLNA 5DCWA 1O5TA 2GS9A 2ZJ4A 2A7QA 2IU6A 3GRUA 3GU3A 4X45A 1M0EA 3AGQA 4N6GA 4ALMA 3LWDA 1I30A 1ZGHA 4DXHA 1D07A 2R2GA 4PBRA 5BN3B 2O59A 3GFPA 1RWXA 2HJ9A 2KBFA 1YVRA 1JH8A 2HNBA 3HKEB 1W96A 5DIZA 1R4ZA 1UJMA 5DU2A 3IMFA 4WVFA 1PWYE 2COKA 4I9HA 2OGUA 4KMOA 1M8FA 4NS1A 4PSAA 3VVLA 4BQEA 4P0TA 1AF4A 1IEQA 1M8JA 1MB0A 3GFFA 4YQZA 2IWRA 1BX3A 1WW8A 1XFAA 4ZO8A 5K3CA 2O14A 1JJ7A 3DD5A 1EVZA 4GW3A 4OD0A 3GFRA 1X9GA 2NQTA 3QUAA 4CCSA 2Q0HA 2PRIA 3WGZA 2OYSA 2GT1A 1J20A 4NIMA 5HIJA 4ZMRA 1YVPA 5BORA 4WXPA 2ZIGA 3NCHA 1NLUA 4E5PA 3BXGA 4D46A 2IIPA 1OVMA 4HEJA 2ZS7A 1T5OA 3GOHA 4Q3NA 1JLHA 1RWKA 2MSKA 3KL2A 4B6GA 2G1JA 1EXVA 3Q2IA 4EG6A 3U6KA 1K66A 5E95A 1PJ4A 2C03A 4AQ7A 4IGIA 1M73E 2G63A 1ISMA 2B3DA 2G8LA 3DUWA 4J1NA 1E6LA 1IRXA 1IG0A 3BMCA 2MJLA 3D7LA 4BLWA 5C80A 3NTUA 1SG6A 2OXEA 4X3CA 3QU2A 2XT6A 5LP6B 3QE0A 5CM8B 3BHNA 3BA6A 1QGUA 3KQYA 4BVBA 4IIFA 5D6OA 1Q22A 3F6EX 4KSCA 2GPAA 3H83A 5IVDA 5LQNA 1SGWA 4PLCA 5AVZA 1DJLA 4BMZA 3W1WA 3AJRA 4F8JA 3F8SA 2YYYA 2IBSA 1T91A 4D57A 4GBJA 3IE0A 3KDPA 1RZVA 4JKYA 1HL3A 1OV4A 2E4ZA 4M1MA 1PZHA 3R0VA 3X1MA 4HDSB 4D9FA 4EI7A 4DGQA 1JDSA 1QBGA 5C52B 3GQVA 3ADOA 1R8XA 3MBIA 1ZQ9A 3VYTB 5AXBA 4CMKA 4MVJH 4RY8A 1K8XB 4KX3A 2BGTA 3PUJA 1H5UA 4YR9A 1BS2A 1GITA 2I6QA 3FTDA 3SF8B 4JQOA 2IV7A 2IY8A 3IR5A 2IYRA 2VUTA 5ABPA 1ZCZA 2JLRA 4N5IX 5ANRB 1BYIA 2BGKA 4KH0A 5IH3A 4RTOA 3GDFA 4FMCF 4B75A 1VA4A 1DKPA 1NM5C 1QJCA 3CCCA 4TVOA 5C3UA 2VT7A 3AR8A 3HA5A 5DTIA 1MEOA 1TUBB 4CI0B 1GKYA 3FMIA 3KNZA 3LFTA 2ZUFA 2RG1A 4BNJA 1JFTA 4BL5A 4C6HA 5TT1A 3ZI4A 1K6XA 2R8BA 4FMDF 3WLKX 1LY1A 2IHTA 3AW8A 1K86A 3TLZA 3ZHRA 2QUBA 4X8LA 4WN9B 4PC3A 5J43A 4TLMB 4YCDA 5GV8A 4FHFA 1VJ5A 1BMTA 4YFYA 3INNA 5FOSA 3WKBA 5BSGA 4CEJB 4CT4B 3HNPA 2H4ZA 3GG2A 3IIKA 1GRQA 5SZHB 3ZQ4A 3A2KA 4WZZA 5DHRA 4FKZA 3EHEA 2VNJA 4OMCA 5IJZA 4CLDA 1KWGA 4L4RA 3TF5A 1E79A 4FIZA 5EJFA 5JAZA 5K99A 3FWPA 1WP4A 1CS0B 1GSHA 2FSIA 2J46A 4WECA 4YJHB 2O1WA 4IH4A 5KCZA 2HC9A 3IELA 3BAZA 4NFYA 4BMCA 1RI2A 1YIOA 1O03A 2ZVPX 4JUCA 3RH0A 3H8VA 2H0RA 3HLTA 1MN6A 4PQEA 3W3ZB 2K5UA 2Q5OA 3D6AA 1WX1A 4BBJA 4JP1A 4ENSA 1JVNA 4LC9A 4JL5A 3OZUA 4XVRA 1PLLA 5BYBA 4DR1B 4TYQA 1MX9A 1PD1A 3K1ZA 4L8GA 1AA9A 3I42A 1PIWA 2XWJI 4P80A 4FB4A 1B14A 3NP9A 3UB4A 1KEPA 5IBCA 1U8EA 5KTMA 1NOKA 1GADO 3GJTA 3HZOA 2JEZA 2VO1A 1JR3E 5AWFC 3R77A 2FZ4A 4ITUA 3X44A 4DGSA 3F3YA 3IQDB 3TKYA 1FQOA 3JCZA 3DT8A 5KTTA 4F3RA 4Q9KA 2Z09A 3ZOZA 1M1UA 3ORHA 3OECA 1YUNA 2XTZA 3G13A 3QK7A 2GK4A 3K09A 3EJWA 1FU8A 2WSSA 4KWHA 2V55B 4PHFA 5JVDA 4BVAA 2OZKA 2UUBB 1XD2A 3DUFB 3BTVA 4LXUA 1BA2A 2AT1A 1P2VA 2FUG1 1WRBA 2V0GA 2P11A 3H19A 5AKLA 3MTGA 4QM6A 1A9QA 1KI1A 2FW9A 2ZDGA 4MITA 4V1CI 2FU5C 5IKOA 3U7GA 1YFZA 4JA0A 4C14A 4DDKA 3VR5A 4NJEB 3EUFA 4E4TA 4F7DA 1T2VA 3H97A 3CLKA 5FBWB 3H5OA 3ONVA 1MAWA 5K3FB 3ANNA 4ZV4A 4HFJA 4TKVB 3V6LA 1RLMA 5EHXA 4LDNA 5JBNA 4X60A 4ESHA 2NUAB 3R6DA 2YASA 3VC2A 1J9GA 2XX3A 4NECA 5KJ1A 2HA6A 2YJNA 1PJAA 2WVHA 1C9JA 1XWFA 3AEKA 3NBXX 4QUDA 2BUBA 2H0AA 2PWPA 1ISGA 4WKPA 4BX2A 1U9IC 4NBSA 1CJVC 4UBKA 4DCGA 3GZNA 3B85A 2BJVA 3EF3A 4QGBA 2YJTD 5ETJA 3C48A 2C99A 3K0BA 1Q1GA 3EPJA 4DCSA 1TLFA 3HXTA 4C04A 1BWQA 3OPQA 4IEEA 3QPWA 4OQZA 5F73A 4G8BA 5FTWA 1GT91 1HEUA 4X1KA 3T0GA 3I4FA 4I7EA 2YTZA 1N1GA 4JJ6A 2GYYA 3IUNA 4J9UE 5I01A 3JRXA 2WIAA 3DG9A 5ULLA 1A8HA 1YDHA 2FQWA 4LPSA 1L4FA 2EZTA 3ORFA 4KAFA 3WMEA 3CVYA 3IT0A 2YJ6A 1E7QA 3NP7A 3FROA 4BNHA 1N7GA 1ZN2A 1AQJA 3UK2A 4CKYA 4D3DA 2F8MA 3PRYA 4M0EA 4TV9B 3NC1C 3PEUA 4DV3B 1OX5A 3KZKA 5TJ9A 3G6KA 3GRKA 4HDMB 2YN0A 2J6BA 2DWPA 4LXTA 3O75A 3KLBA 2I55A 3AI2A 5I7OA 4YJ2A 2QW0X 2XRMA 4P53A 1GYPA 3DDCA 4KTVE 5JY1A 3MWDA 2PMFA 4X7MA 5D8DA 2O0LA 4D9CA 5EVCA 3LPCA 4Y18A 4KR3A 2YQ5A 1SO8A 2IPNA 5ICMA 3J7AC 2WMYA 3CX6A 5BURA 4MRVA 4TT3D 5DRTA 3GX1A 5K0ZA 1R0XA 2O2DA 3DLPX 4DWVA 5CD1A 2P9YA 2DFVA 2VYCA 4ZVKA 2P4UA 4UAUA 4E2FA 1DU4A 2O4CA 4L1KA 4DKJA 2QN3A 2SKDA 3Q3HA 3HR7A 3PC2A 1U81A 2VK1A 2GN1A 2CWWA 3JASA 5FYDA 3UIEA 2ORIA 3W1EA 2EWWA 3QEAZ 2Y8EA 4OX9B 1J8YF 1JA0A 1ENZA 2ZE5A 1ECFA 3FOAA 1JEAA 3KHTA 4GO1A 4JBGA 4OBEA 4XFKA 3TLAA 1VE9A 4GMFA 5IAGA 5ITZA 4ZREA 3EAQA 1KMMA 1ZGBA 2HIAA 5J1SB 4GM4A 1L7XA 3RF6A 2B25A 2CJYA 2YIMA 4ZWNA 3PFNA 1XWIA 2HLHA 2JB9A 3W8DA 4CQMA 1ZJWA 1SVMA 2BCGY 4F72A 4XWAA 3VR6H 4OXYA 3CW8X 5E2BA 5A1JA 3DTNA 1G5QA 2C7BA 5ELMA 1SVIA 1X1RA 2IUSA 1JDPA 2WT9A 3EXG1 2AIRA 4TPKA 5BRAA 1DC5A 4K3VA 5BSRA 1Y9AA 3VRHA 3NEAA 4YAUA 2I4NA 3ZI0A 4GLBA 3G5AA 1YZYA 4O4LA 2JHAA 3AEXA 1WZEA 3SAJA 3ZE9A 4GRAA 4AF6A 2J09A 1UBUS 2A9KA 5DNUA 2RHBA 1XYYA 4L4SA 1OX6A 4NBNA 4UM9D 4KBFA 4E0BA 4X71A 1IIBA 3KTAA 3EVFA 5ALZA 3G9QA 2O54A 2BT4A 3LHKA 5JJCA 5DWDA 3BMCB 4YRZA 1NAHA 2UZ1A 4C06A 3TCNA 4GL4A 1WNFA 3WTCA 4GXRA 4RTPA 4YWJA 4F7WA 2GSDA 4MI9A 1QGUB 3HZRA 2P9QA 3PUYA 2BRUA 1CUZA 4UREA 1L7AA 4OO3A 1UPTA 1SNYA 5SZIA 2YV5A 2H4FA 3N6XA 5D3KA 2Q8QA 1C2TA 1CQWA 1GRRA 1NRJB 1X77A 2NNWB 3PWZA 4J0HA 2ZT5A 4E2ZA 1KOGA 4FJ2A 4R7ZA 5CEFA 1K4KA 1QV9A 2H3HA 4RJIA 1SXPA 4JI0B 1EWVA 4KP7A 5ALUA 4EUEA 4ZTBA 2RC5A 3D2AA 4MWTA 4A9AA 3DE1X 3KZ1E 4O0MA 4LRUA 1T43A 3OOSA 4WIAA 1BH2A 3IEKA 1E59A 3PCXA 4LISA 4I81A 3IHLA 1VMEA 1ESZA 1OE0A 1NFFA 5IKMA 1CUYA 1QDUA 3ASUA 1PJTA 3Q3JB 1PR4A 4FHCA 3LA6A 4K9OA 5ERXA 5J9FA 1WBBA 4J0JA 3BCRA 4OP2A 3WP0A 1K06A 1B0AA 2YIDA 1JDZA 3E7XA 4FZVA 3WVNA 4P3XA 4BNZA 3NYWA 2O8CA 1N92A 2OKCA 1N2ZA 3HV2A 4NBLA 1LPMA 1Y3CE 3KJGA 3U4IA 1XZIA 1WPGA 1KMCA 4BIIA 4D43A 5JAMA 2CLOB 4R8LA 4BNDA 3MPUA 2QTWB 2QRQA 4LNHA 5ARBA 3S1LA 1QIMA 4O1MA 4BN4A 1F48A 2PH3A 4UHJA 3FZNA 3NTRA 5T41A 5KIAA 4RH3A 2V8OA 5LWHA 9GPBA 5IT4A 4MW0A 1AU9A 2MR5A 1Q0RA 4IGFA 5IG2A 1MKYA 1WB5A 1SQ5A 1XK7A 4OYHA 5FFNA 2YKGA 4KN8A 3FOWA 3STYA 3VMFA 4EKDA 1T2CA 3SX0A 1NUSA 2BTQA 2DG2A 2HQSA 3O9VA 2ZIFA 3PU6A 4G0QA 5F9MA 5FUQA 2C9CA 3JVVA 5FBQB 1JEJA 3EW7A 2C3OA 4MUXA 4B6FA 3PVCA 3RHFA 1TIPA 3ENQA 3ZX5A 3B2EA 3SYRA 3BE6A 2WM9B 1NVAA 1PEDA 2XDWA 3PEFA 4QXOA 5JFTA 1URPA 3VX3A 2WPDD 3H5TA 3G2PA 2FN7A 4YRRA 2O19A 2IIQA 3TD9A 3ANLA 2IRWA 4D92A 2ZTMA 4OLFA 4PX2A 821PA 1HE5A 2P2GA 4ZQIA 4V3CA 2DYKA 2BISA 1UPAA 3WIVA 2AJCA 5KNLA 4FP9A 1QZUA 4O2BF 3TSOA 5KYWA 1FQWA 3E9EA 4I14A 5ECGC 1Q20A 2ZSHA 4FUQA 4AYWA 1QGYA 3WKAA 3OX4A 1YDWA 1C1HA 1WDKA 2RBEA 4I50F 2P9JA 3E35A 3JVDA 4UU1A 4GQIA 4JLKA 3RC9A 1JLMA 2H2DA 3EPLA 2J0QA 1WP9A 4ZK2A 1GZ6A 3LYHA 2HMUA 4WBSA 5B2ZA 1X3LA 1NVBA 1WOMA 3SZMA 4BGUA 4F45A 3PX7A 4DADA 5KNBH 1W581 1XD2B 3E27A 2QPTA 3L1IA 1LPBB 3NC0C 4KIUA 4A6DA 3ADDA 4AO6A 3MGKA 4M49A 5ER6A 1QKIA 2Q3JA 4G0MA 4X8MA 5LQMA 4PLVA 3V32A 5DXAA 1FDVA 4CODB 5BWNA 1CRWG 4YK7A 2G5PA 2LDXA 2FOLA 2ZRGA 2W5UA 3CJQA 4IKEA 3WMFA 3V48A 2EZ9A 3DEZA 1Q0PA 3IVGA 5F3RA 2Z3WA 1E32A 3RK0A 3G89A 3AY6A 5EJ4A 3KETA 1RRCA 1GLGA 3RVSA 4ZYVA 4DS3A 2AI3A 1EJBA 5DDIP 1RYNA 3S29A 3ZDCA 2VWQA 1XE3A 3AZPA 1Q1QA 2OCBA 1NBAA 2ZGVA 3DOCA 1MQ9A 4ZPXA 3IHWA 3AEKB 5CA0A 1ISPA 1X2EA 1M33A 2WYIA 3DOJA 4G89A 4H0CA 2JF0A 3FPHA 4RVHA 4QM7A 1WW3A 2IEZA 3GZNB 4U2BA 4TMZA 5F5NA 1N2CE 2CK3A 2ZT6A 3GEIA 3N8GA 3QE3A 4HEQA 4KVGA 4QATA 5BQPA 3TMAA 1F4LA 1QRTA 3TTWA 1USKA 1OA1A 1F8YA 4MKFA 4XXHA 1ZHHA 4X1KB 1PSWA 1EX9A 3FUTA 3ZDBA 4OUKX 4G84A 2R1TA 2ZUCA 3T7DA 1UT6A 1FVHA 1S6YA 5EIBD 2YZKA 1N5IA 5D00A 3UWDA 5T67A 4DYVA 3ZD7A 3FNBA 5E4YA 4A2QA 2ZW9A 1RWWA 2F3SA 2Q1SA 2LKDA 2YFKA 4DG9A 4L5AA 1IWBB 3EZLA 3OQNA 4KB5A 3O5AA 3REGA 3GZJA 1KBOA 1AY0A 4JXZA 4XJTA 3DPSA 3PLRA 4QA9A 3OMLA 2NO7A 2X19A 4YJ2B 3U3KA 1MW9X 4IPTA 3HMQA 1R4NA 2JIBA 3MWDB 3W9UA 2QX7A 1CZLA 5IN4A 3WYNA 4JYCA 4DA9A 4BCDA 4KHZA 1Q1ZA 3EHDA 4KLRA 1KDVA 5IKXA 2ZRIA 3TEMA 3CZ9A 2BCJQ 4GVPA 1Z33A 2PSSA 2XMSA 2RH5A 2ROQA 2HRZA 3Q3IA 4JLBA 3BB4A 3D4PA 1TO6A 4KVFA 4YUYA 1KI2A 3GRFA 3K72B 1G5HA 3RD5A 4HMPA 4YRTA 4CJXA 1F9EA 3JASB 1P3JA 2IE0A 3I76A 2HA5A 1EGVB 4AN0A 5F7XA 4RS4A 3CLUC 2VC2B 3AEQA 1H9CA 4CM1A 3T61A 3AIIA 3JD1A 4YLYA 1W48A 1CUXA 1YU9A 2C54A 2X23A 5CFMA 3JAKB 4BS9A 5CDTA 4FIDA 1A9PA 2C8KA 4A26A 2E18A 3F2IA 3I3SR 4HH1A 2XRYA 4KDCA 3JQGA 1FB5A 1RSZA 2J0VA 1F17A 4HJXA 4CQMB 3E3AA 1J7KA 3V1TC 3LQ2A 2D06A 3R3SA 2Q1TA 1T9DA 1V41E 2D0IA 3OM8A 2VKTA 3RHTA 5ALWA 1RBYA 4B3HA 1COWD 2EYUA 3TTVA 3U9SA 3JWHA 4AY2A 2W2QA 3V55A 1SCKA 2IUYA 4FFDA 4FEGA 4FFOA 4O4LB 3W6OA 4DCJA 3JD3A 1NV8A 4GI3A 2AZMA 1NMQA 1CW2B 2ZK7A 1IWOA 2CN1A 3B9PA 3IFSA 4PAWA 1MIHA 3AYXB 2Q6TA 2IYEA 3RSHA 2RHMA 4OXIA 4R2WA 2ZR9A 4I0WB 1EUCA 4OMDA 3WLOA 4G0OA 2BL4A 1TF7A 2NYVA 4FHDA 1N8SA 1ZH6A 2G0TA 1W94A 3KTAB 3N8NA 1RVV1 1DC4A 1J0XO 2IF2A 4MX8A 1DRVA 4QAJA 4WINA 3S7ZA 2NVUA 4OY3A 4DAOA 1B74A 1CJBA 1ID1A 2PQMA 3B1ZA 3OOJA 4H59A 4HUJA 4JLVA 2UZ1B 2JDID 4O59O 3FVWA 4PZUA 4RXTA 1ZK2A 3BFKA 1NBMD 5IARA 4KC0A 4PLYA 1GDTA 1IRIA 1SCJA 3CVOA 1PT6A 5ECWA 5K4HA 5LIRA 1ZOSA 3LBNA 3P9PA 4INOA 1HETA 5A6SB 4YIHA 2BHNA 3K4QA 2OBMA 2YN2A 1ZL0A 1TZKA 3DWFA 5KYKA 4II2A 1OQAA 2I3GA 3M5PA 4QFDA 3CSDA 4J6EA 3C8ZA 4YDSA 3SR0A 4DLVA 5IFKA 2Y99A 4JZYA 3WAKA 1X7DA 2C29D 2MSWA 4ND2A 3TR5A 1Q16A 1U0SY 2QB5A 3S2FA 3C3BA 1IEVA 3HRKA 1QGZA 3T1TA 3EFEA 3TZBA 4BTLA 2BMAA 2CLCX 2ZXEA 2JRLA 3ROMA 5AXCA 3VC7A 1P4SA 1PL6A 2CDBA 2GN8A 4L95C 5LBIA 2I71A 4H17A 5BV8A 3UMSA 5SYMA 1WVIA 2LP4Y 1SXJC 2QSZA 2V74B 4KXWA 1QHNA 1HZZC 1LNZA 4J76A 4LYDA 2CYAA 4UEWA 1WPRA 3T15A 1E1YA 1VJCA 2Q5EA 1M1NB 3L7NA 4K6CA 5AVXA 4KQEA 3O21A 1IM8A 3HVRA 1UEXC 5BSEA 1GUDA 5DTQA 2BPOA 4Q3DA 2ONKA 3CQ9A 5FNVA 3ZWPA 5TC4A 3WQHA 2I1QA 3IDZA 3NIDB 3TTUA 1OGIA 4F06A 1FSZA 5C35A 1V5WA 2V58A 3G2MA 4K7JA 3RREA 3CRZA 1UBNA 2BV3A 2CJPA 3H1GA 4BNDB 3KJXA 3LOPA 4MO9A 1NKTA 5KKCA 1UXIA 4LHVA 3HHPA 1XX6A 2HJSA 3GGOA 3C1TA 1IY8A 1I1OA 4NI5A 4PM4A 3I72A 5CNMA 3T3MB 1J0DA 2UYQA 4F46A 1BFDA 1NUTA 1ZI8A 5AKGA 4IDGA 2GTHA 1NXWA 3QUCA 3F4KA 4HWTA 3YASA 3ZUGA 3UJ7A 3RS2A 3ZLJA 2INGX 4ZCLA 4NBTA 3VR1A 2IY9A 4GUDA 3ZH9B 2ZRDA 2KW5A 3HDHA 2XE8A 2CYBA 4URVR 1NXPA 4BFLA 4JQCA 2EKLA 4QZVA 4B71A 4EKYA 4MVWA 1DX4A 4TT3A 4WCDA 2XE4A 3G9TA 4WLUA 4JGBA 4Q03A 3L7YA 1XXHA 3K16A 4LRQA 5BVGA 4NF2A 2ZAOA 1PG5A 2JVJA 5KWJA 3AU9A 1UBRS 3C7AA 4FCVA 4HH0A 1ZZGA 4Q19A 3RIXA 3ZGXA 4A0QA 2A9VA 3IVMA 3KQHA 4AS2A 4IG9A 3JQFC 2HO4A 2R5FA 4WADA 3FCOA 1E61A 5AK0A 1EP3B 1PG0A 2VJCA 3P9NA 3C8DA 4TSRA 1RHRA 1Z4MA 3S7TA 1YHYA 3R3ZA 1J9ZA 1EBBA 2RKWA 2SBTA 2GXQA 3DV2A 4Z0TA 4QU8A 1YAHA 3S2UA 3ITKA 4I1VA 1PFQA 1UPFA 1A9SA 2BGMA 2WVAA 2PUFA 3P2EA 3VJKA 2WTUA 4ENPA 3E9CA 3O83A 1ESNA 4FS8A 4KU4A 1EINA 4U2CA 3PDJA 5A03A 4WN3A 1AMUA 3EG5A 4KUEA 3SE0A 3ZWOA 4WEOA 1T3LA 3G5MA 5JY6A 2WVJA 1WD5A 1LK7A 4UBMA 1KIMA 3BHMA 3M4XA 4N0QA 1ZIXA 3HCRA 2PLFA 5F7OA 3VYWA 5J2UB 1QM5A 4EHAA 2C5LA 4ZODA 1JYEA 1ZA2A 2VNIA 3E8SA 3M9WA 4TWIA 4YT5A 1FP1D 3RKUA 1JV2B 1TGYA 2X8JB 3IP1A 2QX6A 1KQNA 2NU8B 1KFJB 1UOQA 3BXEA 1CJTC 4RZXA 3Q5EA 1GA4A 3MWEA 4JHLA 3SBEA 2AOVA 4Q4JA 1S96A 2X2EA 4P3NA 1YU6A 5LA6A 3V00A 1GN8A 2G77B 1E1LA 2W2XA 3DYVA