1VCHA

Crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
168
Chain Sequence
b'ETYPITVGGVTRHVPLIEPLPGRRIPLVEFLGDPEFTRAAAEALRPLVPKEAEILFTTETSPIPLTHVLAEALGLPYVVARRRRRPYMEDPIIQEVQTEVLWLDRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVFRQGTPGLAVDTVAELPVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyltransferase-related protein
molecule tags Transferase
source organism Thermus thermophilus
publication title Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
rcsb
total genus 48
structure length 168
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vchA00
1Z7GA 4MB6A 1IBSA 1I0IA 2HCRA 1UPFA 4M0PA 4RABA 1ZN7A 2JKYA 4RQAA 5BQOA 1QCDA 1P19A 2PRYA 5IPFA 1O57A 5HIAA 1A95A 4QRIA 4WN3A 1VSTA 3DMPA 1HMPA 2C4KA 4RHTA 4RHUA 1TC2A 5ESXA 1YFZA 1I13A 1I14A 1GRVA 1TC1A 5KAMA 1V9SA 3NAGA 4OHCA 4JITA 4FYMA 5BRNA 1P17A 2DY0A 2H06A 3GGCA 4LZOA 3LPNA 1ECFA 1NONA 1I0LA 1Y0BA 3OHPA 3QW4B 4TWBA 1A3CA 2PRZA 5EUCA 5KAPA 3HVUA 3N2LA 1D6NA 3OZGA 4P86A 4RQBA 1L1QA 1AO0A 3EFHA 1U9ZA 1XTVA 4RHYA 1JLRA 1QK5A 1HGXA 5JV5A 5ESWA 1LH0A 1O5OA 3MBIA 4F8EA 1A98A 2P1ZA 3LRTA 4RAQA 2JBHA 1DQPA 3S5JA 1NULA 2PS1A 4RADA 2WNSA 3GEPA 4JLSA 3ACBA 3DAHA 3ACDA 1ECJA 1UPUA 3KB8A 1BD4A 1U9YA 5BQPA 5K51A 3M3HA 1P4AA 3GGJA 1G9TA 3O7MA 3G6WA 4KN6A 4X44A 4RACA 1ECBA 2GEBA 4P81A 3ACCA 1ECGA 1STOA 2E55A 1XTTA 5HKLA 1G9SA 1L1RA 1QK4A 1ZN8A 4LYGA 1XZNA 4RV4A 1PZMA 4LZNA 4LZAA 1QK3A 1BZYA 1BD3A 1VCHA 1ZN9A 4P83A 4PAWA 1XZ8A 3MJDA 1OROA 1P18A 2JI4A 1G2PA 4LYYA 1MZVA 1XTUA 1A97A 4ZFNA 4Z1OA 1G2QA 1OREA 2VFAA 5JSQA 4M0KA 2H08A 1QB7A 3DEZA 1A4XA 4IJQA 1FSGA 4RANA 1ECCA 1GPH1 1WD5A 4P80A 1DKRA 2FXVA 2IGBA 2H07A 4M0UA 2EHJA 4P82A 1DKUA 1W30A 3OZFA 2XBUA 5E38A 1A96A 1JLSA 4QYIA 1J7JA 1DBRA 5BSKA 1VDMA 1UFRA 3H83A 2YZKA 4X45A 1QCCA 1R3UA 2AEEA 2JKZA 4P3KA 1OPRA 4RAOA 4WMLA 1DQNA 4P84A 1I5EA 4PFQA 4RHXA 4S2UA 5IAOA 1CJBA 1QB8A 4QYIB
chains in the Genus database with same CATH superfamily
1H2RS 4O4LB 3DYBA 3PGKA 1Y7LA 3B12A 2CHQA 3SFTA 4D79A 2GSWA 1I7QB 1QVRA 5TGZA 4JXXA 3E0QA 2Z4TA 4PGHA 3LX5A 1G8HA 2PRYA 1WZNA 1NV9A 3QIAA 5CGQB 3TNFA 3ZDZB 3G2OA 1O6GA 4TV9F 4CCAA 4R5MA 4MQ5A 1W36B 1YV9A 1P1JA 2HA7A 2LIVA 4FNGA 4JLOA 4PLPA 1VG0B 3A1NA 3NT2A 3QSGA 2AH5A 2F48A 5JH7F 5BWMA 2VK1A 3TPZA 3GDFA 5AK6A 2X14A 3EYWA 3P0RA 4M2LA 4MWEA 2PD6A 1YE5A 4WJZA 4O29A 1L5ZA 3RTEA 1AX9A 2LCIA 2A30A 1GKUB 3U7EB 4R69A 4CM5A 4I9FA 4S1NA 3CVXA 4HWGA 4DLTA 1D2AA 4A8JB 4EY4A 1FVXA 5EZ5A 1P1KA 2F1IA 3GLQA 1Z5NA 4JI8B 1YQTA 2H1IA 4ZPXA 3VPSA 5B55A 3EGDB 1NPTO 2PRZA 3GAFA 3B51X 3ENQA 4UCQA 5EUCA 5KAPA 1ZSYA 3LWBA 3WGOA 4DQ0A 3R1IA 4QUIA 1R0LA 2VK2A 2NZ2A 1DX4A 1MH9A 3L0ZA 3ORHA 4GG1A 2IU6A 4UHDA 4Y2RA 4R1UA 2EYQA 3QEMA 1GTL1 1VBNA 5F73A 4CL0A 4MLCA 5J9FA 1RXEA 5K3OA 3G7NA 3GJ7A 2AA3A 2R6AA 3U13A 3FVTA 1K7YA 4RXTA 5MFZA 3KYDA 4UEKA 3CBQA 4NCIA 5IZ4A 3VJRA 3COSA 4ZVOA 4TTSA 4ZO4A 1B73A 3L8ZA 3URKA 2GJAA 3VYTB 2I6GA 2X4IA 2ZAMA 2NWQA 4RVNA 4CPDA 1UMBB 4DVJA 2QAGB 3D8RA 4OU5A 3PQ4A 5B1DA 3G6KA 1UBSB 3GCWA 1FU7A 5FUVA 4DMMA 1Z8NA 4PHTA 5LZ8A 3S5UA 3W5IA 4C7JA 4YQFA 4NONA 5K09A 1JKJB 3PUVA 4L9AA 1NAHA 1T0BA 4U39A 1GCAA 5IH3A 3OOEA 1KXJA 3V4SA 3ON5A 3TGPA 1SC9A 3W8EA 4RTRA 1IWPB 1QRSA 4PZZA 4XYMA 1EFPB 1ZJ4A 4NK4A 2J9GA 2QV7A 3F97A 5FTWA 2FP4A 4U8GA 2Y68A 3QF7A 5K3DA 1M5TA 4WKBA 3HYRA 3GJ6A 3MUFA 4XWGA 3C1AA 1AXGA 2X8JB 1DXHA 4QFBA 3EEYA 1ZM4A 2OG2A 2IOHA 5E38A 5G1NA 3NH6A 1QYDA 2GNAA 4OKIA 3DLIA 4RKFA 1VDMA 4QPNA 3PL5A 4WOJA 3NHFA 4YI5A 3ZD6A 2F64A 1PU2A 1H2AS 3B52X 3D3WB 3QKRB 3AHEA 3MOIA 5G0WA 4F6LA 1V5IA 4XVHA 5A4MS 4RC9A 1I2DA 1FDVA 4Z3DA 3I01M 4MA4A 3I32A 2VKQA 3V00A 5FBQB 1GNQA 2WAXA 5CCDA 1PJQA 5TV2A 3N8GA 4NCKA 4Z2YA 5LA6F 4N3BA 1O96B 4L22A 4ZZ2A 4CMEC 5HP4A 3WV4A 4A8HA 3C0KA 3MS7A 3AZQA 2Z5GA 1MR3F 2XECA 1I0IA 4LDPA 5U4QA 4U9HS 3TZLA 3RLFA 1B4DA 3RSFA 3DT8A 3IIJA 4CLRA 2AE1A 3DG9A 4GHWA 2QY6A 1Y8QB 4N01A 3N6RA 3HXQA 3VDQA 3H9UA 4TYNA 2FR0A 1JIXA 3OG9A 1CRQA 1G4AE 5GWXA 4R71A 1WU8A 2F55A 5HDQA 3T99A 4Z0TA 4B8WA 1LJUA 3WWDA 1O3YA 1I14A 2X22A 5A3QA 3QSYA 3Q7PA 1VSVA 2WG0A 1V48A 3AY3A 2X0DA 6GPBA 2YC4C 3MMSA 3THYB 3LX4A 1VI6A 3JQ6A 4UNSA 4X8MA 2AE2A 3VKVA 4AKSA 1WKVA 2PUCA 2KHZA 3MW8A 4PIVA 2YJZA 5GGYA 5JE8A 1Q0QA 1VHWA 1EFPA 4D2IA 4NVRA 1T1IA 4HZUA 1CBUA 4IJKA 4CU2A 3GUYA 5KOHA 1JIUA 1L4MA 4JC0A 3K4HA 3NFRA 4E5VA 1EP3B 4MHSA 2WUDA 2CSXA 1PDOA 2JVKA 3RFCA 5BYKA 1R0KA 2IW3A 5EQTA 1CEEA 4HAXA 4EQZA 1Q0PA 2R3SA 1ABFA 3V6MA 2O4UX 3OQVA 4HDNA 2DHRA 5FQOA 1Q6YA 2FAXA 2J7PD 2FQWA 3ETGA 2LZ0A 1Y1QA 4DJEC 3RYCA 1ZLXA 2AD5A 3RAPR 2J9YB 2BFAA 3SHVA 1R74A 2H5JA 1QHHB 4NIMA 1N2ZA 2CNBA 1TF5A 4OXQA 4A23A 1NR5A 1JA1A 2OGSA 3OZWA 4POAA 2F17A 4I1RA 3LUCA 5CRIA 1YFKA 1GN8A 1GPYA 1KFBB 4FMBB 1HFEL 3OAAD 3PB3A 2SKCA 5KSPA 2HRRA 3L7DA 1O96A 2HU8A 2WRZA 4JJGA 4PPQA 5COQA 3RVKA 3VR5D 4CN8A 5ITVA 4ILEA 2GN2A 4BLOA 4I2NA 3ZTWA 2Q2VA 4RTPA 1FTGA 3LDFA 1G5QA 2MYTA 1XNGA 3OJFA 5HE9A 1UK7A 4KRFA 4E94A 5L8VA 1OTHA 5E6RA 3RAEC 5HFJA 3JYHA 4RV5A 4B09A 4BNXA 2V8BA 4FOSA 1KI4A 4QTZA 1PG5A 3WBFA 4Z9XA 3JASA 4RS4A 2YVAA 4MW7A 3DE0X 1Y9DA 2XGJA 3IDZA 4G1BA 2XT9A 1WPRA 1EJ6A 3CY6A 3TIXB 3KZVA 3F8TA 1T0PA 3JD1A 5KHOC 4TXLA 2WU0A 3CCCA 4P82A 5HDBB 5BN3A 3GJ8A 4MIOA 4KCGA 4PR0A 4BNNA 1GGVA 1SQSA 3NFYA 3L0DA 1A4IA 2YY5A 1DXOA 1XVIA 2PR7A 1SB9A 1Z82A 4ED9A 3HJRA 3R5KA 4MV7A 2CDNA 3JY6A 4TM8A 4IMIB 5SICE 3W04A 4KO2S 1YO6A 2JGIA 1Y1RA 2B34A 2YWHA 4Z53A 1HF3A 5AXBA 4B84A 1ZGZA 1DXYA 1HYGA 2HI0A 4O2BF 2VK8A 4PAQA 4D98A 1BHQ1 1K97A 2Z0MA 4FDAA 3P4YA 1NVUQ 3UXYA 1O4VA 3YASA 2O19A 3TCXB 2NACA 1LPSA 1A8QA 1U9JA 1RCFA 3CISA 2Y1XA 3I30X 5IVHA 3RFXA 2OQ2A 4KAAA 5KDDA 4M89A 3HV2A 4WZAE 3BWMA 4BQSA 3GFGA 3ZU2A 4MVJM 2H57A 1JQEA 3JR7A 4TTPA 1HDGO 2NZXA 3CH6A 3I9FA 4CN9A 1JXAA 3FETA 4HVAA 2ZDQA 1GPBA 1Y63A 4KQJA 2FPUA 5BW6B 2XKKA 1E1CB 4AJ2A 4D9CA 4CF7A 4A1OA 5DT9A 3K92A 5AW0A 1KJZA 5CIWA 2JD1A 1M0EA 3HKCA 3HKEB 4D9MA 4XVUA 3FSGA 1X7ZA 3TOSA 2FSVC 1MX3A 1DFGA 3ENNA 3WG9A 5L40A 2J5RA 4G97A 4PYOA 3M9WA 3E9ZA 1XMOB 4GGMX 1ILWA 1V3UA 3R40A 5HK8A 4E22A 2QJFA 3LHDA 1YH3A 4B40A 3DE5X 3VR4H 3C98A 4B35A 2HRBA 2WLTA 3MHPA 1IDOA 2FRDC 4UCXA 3Q4GA 4NZMA 3BMXA 4DXHA 4IVNA 1D6NA 1A4UA 4H3SA 4RQBA 2W6JA 3V48A 1P0PA 1RWQA 1NE7A 3PKJA 4YPFA 3GJ4A 3RVLA 5EG5A 1IVSA 1TJ3A 3Q3EA 4G81A 1EMDA 4BJHB 1XHEA 2PWZA 3EOAI 1IHUA 2J0VA 1K5DA 3GZNB 3JZAA 4ERXA 2ZPAA 1E1NA 3GF4A 3EGWA 4IM7A 4LK2A 5FWYB 1UC4B 1KYQA 4EMTA 1P1FA 5TVGA 2DP4E 4Q3CA 2FZVA 3ZLVA 1RLJA 3NDBB 4L85A 4FONA 3PQDA 5ERGB 1EU1A 5ALIA 3WLQA 3KJHA 4A0GA 4WZZA 2BFFB 1EFRA 5JYBA 3V1YA 5KEIA 1VSBA 2J3DA 1F8UA 1TZCA 3OPYB 2ZULA 4FGUA 3BD6A 4XVCA 2QTAA 1OBHA 1RTTA 3FFXA 3ND5A 4AMZA 4KO3S 1Z4IA 2A1TS 5THQA 5DNEA 2F3PA 3ABOB 3NYQA 4CCSA 1IWBB 2H4WA 3EQZA 1YZTA 5LLDA 3D8SA 2CJWB 2AT1A 1C9YA 3NOXA 4HXEB 4CMGA 4V1CA 4ZYTA 4HRYA 5B1YA 1F7UA 4JI2B 1G64A 1QIMA 2H16A 3EF0A 3RS8A 3EUEA 4Q16A 2ZJ0A 8GPBA 2I55A 1E0JA 4KO8A 3HM2A 5M3BA 1XSEA 2HGSA 2MYPA 1M6NA 4ARUA 1OVMA 1IYZA 1ISHA 4W5TA 1ZUIA 3U60B 4IDCA 1LBHA 3DBHB 3WIBA 4P4TA 2YNMD 3AR3A 4L5AA 1X7ZB 2Z09A 1TA0A 2HZBA 3EIFA 3O21A 3GMTA 1GFIA 5BSFA 3W6PA 4HX2A 4AJNA 2R6GA 4TMFA 1S8OA 1XAIA 5D2CA 3WAJA 2IS2A 4I6EA 2FPWA 3ZY4A 2ZRIA 4BO2A 1I1NA 3PLNA 3E3NA 4MYRA 1Z5WA 3ZDQA 4LBYA 4TVSA 1IK6A 2VPQA 5CITA 2QG4A 1TD1A 2AEEA 1CJVC 2XV1A 3LIPA 4JX9A 4DCNA 1MJGM 4F85A 1HEUA 1R8YA 2GZAA 4KVGA 3BB1A 3RYHA 3X1KA 3F6CA 2YYYA 5K8TA 1YA6A 2P77A 4ZO9A 5LR6A 3ABIA 2WD9A 5EIWA 1K4YA 2R00A 4D99A 4J1QA 3HFSA 1GUFA 1YR8A 2B7CA 3IP7A 3MTAA 4MYSA 2V1XA 1FUEA 3G5TA 4RLSA 4NJMA 5LMCA 4U7HA 3ZG6A 4CKBA 4N18A 2ONCA 5EZQA 3IQZA 2R6R1 1ZNWA 3IVXA 1EI9A 2CDAA 4K5QA 2BFFA 1OXVA 2H4FA 6ABPA 2CCJA 1OTYA 2CUTA 2H8GA 3KB6A 3P94A 4K3VA 1PS9A 1FS4A 3JAKA 2HO5A 4C6HA 1RWWA 2HY7A 3M82A 2J8ZA 3D6UA 1N33B 4XTCS 5H4HA 2IPNA 4UHKA 3LT5A 4Y2PA 1PJBA 1V41E 3ZVLA 5BSGA 1WY7A 5LZ9A 2AXEA 3TLEA 3TL2A 1P75A 1V1RB 1HOTA 3D7NA 2IV2X 1YZVA 2C4WA 3EXHB 1QWOA 4AP5A 3DHNA 3KDAA 1TW2A 3OOWA 4CT4B 1T0JB 1WMDA 3R0VA 5GONF 3KQHA 5AVUA 2I8LA 3ICPA 5JBIA 4A91A 3FSRA 4IINA 3TX2A 1TLFA 3ZHRA 4LMRA 1YSCA 1TQ6A 1KSJA 3R3WA 4N5MA 3TMAA 3BUSA 1S89A 1QH1B 1U0JA 5B2FA 4GVLA 4KEAA 5AW9A 1IN5A 4BVGA 4DLYA 1BVHA 3P9QA 2BFBB 3T52A 1RZ3A 3QPVA 3EAQA 1ABEA 3ZYZA 1TK2A 4ARVA 4HD8A 4J6EA 4DLKA 4HB4A 3IH5A 1GGHA 2RE8A 5KOJA 1ES9A 1Z8DA 2NAPA 4NCXA 2IYXA 2Y76A 5FIUA 1HK7A 2G70A 2ZYAA 1TUBA 3GFBA 1ZWKA 1SUFA 5TQJA 3ZBPA 2P8SA 3H75A 1LV7A 2GUWA 1NBHA 1FVOA 1P4AA 1JPVA 3PEFA 1DDGA 3K2BA 2E1RA 4X85A 3G0HA 1PZHA 1DJOA 3KUUA 3H6KA 2F3RA 4RMNA 1ML4A 3KQLA 5DCUA 1MNQA 1L8AA 1LXCA 1QGED 4ND4A 5EXPA 2FVXA 1QZXA 5TVKA 3TM4A 3ESBA 4DC0A 2JZNA 1Q0UA 4TMVA 2IUTA 1DHTA 1SBZA 2W6NA 2H11A 4Q3EA 4ZKDA 3O03A 4K1LA 1WZ2A 1G41A 2W2LA 2Z04A 3NHUA 5REQA 3GAMA 3JAKB 2HA6A 3KVNA 3AR2A 4IMJB 5K0EA 5B4UA 2H59A 3AB7A 5E9QA 1O08A 4RETA 3V2IA 3WNDA 4F9TA 2W37A 1Y33E 4TL8A 1PT5A 2PZGA 2QTRA 4J49A 2AYYA 3LC0A 2Q07A 3UB2A 2DUUA 1NW4A 4Q9AA 3T5TA 1QZ3A 4WNAB 2Y6UA 3AHDA 3FNEA 4UMEA 1RHUA 4MVXA 4QYIA 2YWXA 3NASA 1GZ7A 4TSKA 4ZO8A 5B7QA 2G09A 3TOVA 1YOVA 4D74A 4DEXA 2CHEA 3B9PA 3H83A 2DBRA 1RACA 1GZHB 2W4MA 4X94A 1JILA 3ROMA 3TG2A 1KRXA 1PN3A 3GUCA 3EMDA 3ETHA 2VUSA 4PXSA 4DQDA 3F49S 4NJOA 4MDHA 4CKWA 1MDBA 6CHYA 5L95A 1L3CA 2CMKA 3TXAA 1TCCA 2C99A 4R51A 4WOKA 1CJBA 5ILQA 3T9FA 1QVWA 3D8HA 4QUBA 3CXUA 5JADA 3RVOA 2HT1A 2PGLA 1J21A 1I0ZA 4G84A 1W52X 4FUQA 3LI2A 4UBKA 1PDVA 3ZIUA 1NVEA 3WRYA 2A57A 3O3CA 1WA5A 5JAQA 4EB0A 4RM2A 1V8PA 2JCBA 2ZI6A 3LD9A 2Z43A 4LSMA 1D2RA 5HIAA 3G1WA 3CA8A 1TPZA 2WNHA 3W9BA 5BV1A 1ODLA 5BV8A 4Z4EA 3SP1A 3ZOKA 2JIQA 2BEKA 2P65A 1GTRA 3IT1A 3TNDA 4WUTA 1KAHA 2ZETA 1SULA 1KMQA 5CDFA 2PXHA 1MCZA 3PUKA 4ME6A 1W5SA 1P17A 2A0XA 3FHLA 4LY6A 3CV3A 3AVYA 1VYVA 2WK1A 3NDJA 3O8QA 3T4EA 4FB4A 3E5MA 1F17A 4QJ5A 1EDEA 1I4LD 3CW8X 1LDYA 4TZKA 1EH5A 2H0RA 3KEGA 3N2LA 4M8NE 2D1SA 5B7GA 5JAOA 3UAYA 2W2TA 1LSJA 4OQNA 3ZHVA 1GZUA 4H7IA 3EFHA 5IBRA 3BK7A 3DAGA 5C81A 1QH0A 4R1TA 1D1SA 3B89A 2WTXA 1JQBA 2X0KA 4N3NA 1QIDA 3ONVA 4NR0A 5LJLA 2QJWA 4NY1A 1A98A 4CIVA 3PFGA 3RR2A 2IVFA 5JCJD 3DVAA 5CBKA 1U90A 3OPQA 4MUAA 3B6KA 4E2XA 4GM4A 3GEPA 1F6BA 4AWAA 3TD6A 1KI6A 4AVYA 1W73A 3IP8A 4BX2A 1IM5A 4J2HA 3WLHA 1AUOA 2ZWPA 1M10A 3HGTA 1KKLA 1SBNE 3I4FA 3OSUA 3PL1A 2BGTA 4WXMA 1L5GB 3TR5A 4D4GA 1C4WA 3AR4A 1NASA 3WLPA 4EZEA 2P9YA 2OZVA 2YMQA 4WJKB 1PFVA 3WIUA 3NWOA 4AK9A 5HZMA 3AUJB 1L5QA 1RAGA 2CMGA 1NHWA 4BQPA 3I83A 4HY3A 5M7EA 4REMA 3UJPA 1TGVA 4M86A 3H1FA 1LW6E 4FMCB 4MP8A 1RYNA 2AQ8A 4AECA 3QPWA 1QHIA 3UMBA 5IFKA 3KK0A 2LW7A 1A4XA 2B7BA 2ID9A 5K3CA 2F43A 3A04A 2PMDA 1JWLA 4K26A 1V8ZA 4QARA 4XR9A 4EDFA 2RHMA 2SHKA 2AK3A 1DC3A 3S68A 5ALTA 1I2BA 3WTCA 4YAOA 5IRCD 2YHSA 3QHAA 4FFRA 1W30A 2BLLA 1MOPA 3KXDA 1XZKA 3ECCA 4JLPA 3HWWA 2DPHA 2B2NA 3RS0A 1F06A 4MO9A 1H0KA 2DUJA 2JKZA 4NNJA 2ZT5A 3DTVA 1YRHA 3ASVA 1GTG1 2F00A 2HOQA 3H6GA 4IXMA 3KT3A 2EDCA 2FN7A 4A6EA 3EVGA 3CRNA 1M2OA 2XIJA 4Q82A 4LYAA 4B87A 3C74A 3H9GA 4UEWA 1E66A 5LUAA 3ZZTA 4RPCA 3PX7A 4UNRA 3QEOA 1F51E 1L7EA 1C41A 4RHCA 1R4AA 4PU0A 1I2CA 3KL4A 1ZBQA 5JCXA 1PKEA 1U3FA 4WOCA 1G8FA 3OY7A 4OJMX 5LA6A 5DGDA 5DHFA 4OF4A 3CLUC 5I6DA 1R10A 2SECE 2YRXA 3C3MA 4HAZA 3IT3A 3L46A 3PDWA 1H2WA 1YS7A 1FL9A 2PQ6A 2XB8A 3F4KA 4F46A 1GSAA 1N1DA 3NAQA 3RRBA 4I55F 2VP9A 3IV6A 4KGXA 1QRUA 3WXBA 1YR1A 1KJ9A 3SQWA 5H5JA 1FZTA 1G3UA 5CCEA 2QUIA 4YJGA 4KI7A 2BFDA 3IB3A 4HEHA 4Q21A 4UTPA 4MO2A 4EY7A 2PUHA 5MGNA 3F6RA 4EY8A 4R8LA 3K6SA 2PSHA 5L6LB 2OBXA 2QD5A 1FDTA 4CI0B 5BRNA 1CUJA 4K9LA 3HZOA 3SDSA 3EXEB 4MNTA 1Q77A 1QG2A 4ZAXA 3DA8A 3IEKA 3RFFA 1FOEB 4KH1A 1M0TA 4NU5A 1OX4A 2GA9A 3OHPA 1NJ6A 2BUBA 4KLZA 1YI8A 2XDYA 4UU8A 4CM3A 5HZGA 4UW9A 2NUPB 2WJ3A 4L0MA 3RSCA 1D4ZA 1V6SA 4RVDA 4ARAA 1PZGA 5CB4F 1Z2EA 3U5ZB 4YP9A 1Y3HA 2XUPA 4G0UA 4JBXA 4WCDA 1JSRA 1JSXA 4MH0R 4BYMA 1CHNA 3PQFA 1JLRA 3CKYA 3FSGD 3NHWA 3LO8A 5CNMA 2GX6A 2OFOA 1RT9A 2IPOA 4EPRA 4EA7A 1XQ1A 3OLZA 1G3RA 4FEGA 4MQLA 5E6RB 2J30A 3DMGA 5AW6A 2CK3D 4V0SA 3MT8A 1XTPA 4EW6A 4H1HA 4N7RA 5INTA 3EGVA 1H6CA 2QORA 1O9HA 1Q0HA 3FROA 3G0DA 3UB4A 2VXBA 5KTRA 2IPMA 4YYZA 2VAVA 1OX5A 1Y6RA 5HE8A 3STUA 2P30A 1QFZA 4QL3A 3T06B 4B32A 3KHUA 3ROPA 3EA0A 4C3OB 1X8LA 4F1KA 1CD5A 1ZCAA 2H1WA 1DAKA 1KU0A 2CNOA 2PHZA 3EZXA 4FT4A 1N6LA 3KUKA 4OLHA 4CG0A 3DAFA 2R6FA 1P7CA 2FSIA 2YVKA 3I2IA 3MJDA 4LGVA 4A0HA 3HUEA 4I1PA 3FW1A 3SGLA 3NHZA 4M0KA 4U5XA 4Y9TA 4PV7A 4F86A 2MSLA 2ZW9A 4ZT3A 3DEYX 1Q19A 1CZOA 5C5CA 2Q1YA 2LTAA 2Q9UA 3GR6A 1JQ5A 4YWJA 2VIIA 4IOJA 1B74A 4MPDA 2AKAB 3OMLA 3FI9A 4RF3A 1R9MA 1V4BA 1UAGA 4EW1A 3T1HB 3MERA 2XZPA 2CLHB 2VF7A 1RFLA 4ICIA 2FYTA 4JY7A 3VO2A 3NHMA 1IXYA 2P0EA 1M73E 1DIOB 2BLNA 3ZZMA 5CAEB 2DWCA 5JH7A 3WO1A 4Z4GA 4LE0A 2Y9PB 4E32A 3DBVO 1G5IA 1WE2A 1CJUC 3EDQA 1G5TA 5TT1A 3RPEA 5CYPA 2DECA 5FLXA 1JHXA 4CGZA 2EQ5A 4DRZA 5F7OA 3M0EA 3MD0A 2YNMA 1VLLA 3O4GA 3LY7A 3OX4A 5TJHA 1XTBA 4CVNA 2V3VA 4UQLA 3FUVA 4JVLA 2O8NA 4FQ7A 3IIKA 5A2QA 1O6FA 1QVZA 2GPYA 2XJ9A 3O4FA 3ZNOA 4F96A 1CNMA 3C5HA 2ZKLA 3AINA 1H94A 2XMRA 5BQOA 1WAMA 3WDSA 2P9CA 3ZXUB 1GNPA 3CNNA 4B3GA 2IEYA 1O57A 1E2HA 2MSCB 3D3JA 4LKOA 5IULC 1CR0A 1QLWA 2P4UA 3PPVA 5JCPA 3F46A 2ZAYA 1MQAA 2UDPA 3GLGE 3OIYA 4LY0A 1GPMA 1OFGA 5JMPA 1TC2A 1RWXA 2BMJA 2FP4B 5IM4A 3LC7O 3GG2A 2CY0A 4DL9A 1KXZA 3DFMA 1AKVA 2JRCA 3T9AA 5KWEA 1OA0A 3REGA 3SR3A 2Q21A 3BGVA 1ESZA 1PE0A 3KKLA 3LA8A 3OKCA 1FP4A 3LO5A 3JATB 4HS9A 4NE9A 5FL7A 1F7VA 3FHJA 1QGZA 1IM8A 2C4TA 2JAUA 2XWJI 1OZAA 1YA4A 5HR5A 4EBBA 1KU6A 5A4JA 4FQ8A 2IHBA 3WDMA 2G6TA 2QVYX 1VZ2A 3VZSA 3OJWA 4DZRA 3AHFA 1TKRA 3GLRA 4GNRA 1Y8RA 4Y6LA 3OTWA 1BS9A 1ST3A 1QMGA 4MW0A 4LRTB 1OC2A 5EUMA 4BTEA 1BS1A 5AXCA 2VYND 3D54D 3NGLA 4P33A 5H82A 3V8RA 3WYNA 1F6DA 3WYAA 4EELA 3HB9A 4EYGA 5T3YA 1UPXA 3VKHA 1PR9A 3EEBA 5DXFA 3AYXB 1J09A 2REQB 3E22A 3OJEA 5SY4A 5IXYA 4HAOA 3L92A 1L5FA 4RADA 4XEUA 1M2HA 1UKCA 3DB2A 5K05A 1IHOA 1LFAA 3NXKA 4FLFA 3BMQB 4UTNA 1DTSA 1SVNA 3IX7A 2PRJA 3HCNA 4G5YA 2XMZA 1AGNA 3EEFA 3HABA 1KNQA 1TVMA 4RKYA 3F5FA 4UU7A 3OT1B 3TAHA 4DLVA 1L7RA 2YFHA 3GJQA 4UMDA 1TOAA 1FA9A 1K08A 1KYIA 1TRKA 1S1MA 1XZNA 4XAQA 4A16A 3ZZ0A 3U44B 1I9CA 1CY7A 4IGIA 2QAJA 1LKZA 1NRIA 3R7NA 1PL8A 2ECKA 1NQUA 2P90A 2Q6LA 2B2XA 3G82C 3ROKA 4DR5B 1W9HA 3RHZA 3RKRA 1G2QA 1HFWA 3HR8A 4ADSG 2FSGA 2W6MA 2ZRKA 4IKOA 3SZGA 3UGQA 5BMVF 1UIRA 4PLTA 2J3LA 5T4BA 3PC2A 1QG0A 3NUGA 4XM0A 4ACBA 3EA4A 5FDFA 4JAVC 4BY9E 5BVHA 1UDWA 4XDHA 3RDPA 4C03A 2XRYA 1II8B 3I9MA 3KKQA 3LY5A 4BNFA 1INLA 1P91A 3WKBA 2ATIA 1FBNA 3DFUA 4ARCA 3EVCA 5AVQA 2OBFA 2DKFA 3OIVA 2XUGA 4MS3B 4JJ4A 4IMRA 1GNLA 4I46A 3FLEA 3IPXA 2V7BA 1HZJA 3ZH9B 4F2HA 1LD3A 2XT6A 4MIKA 3ICEA 5TJ9A 5I8PA 2IYNA 5IWAB 1A1SA 2IHKA 1QLJA 3ELBA 2C7BA 2VUTA 4XPIB 4IUCS 4B4OA 5EWJA 2B8JA 5TSDA 1M72A 2I1WA 2OOKA 3RSGA 3QFRA 3BJMA 4GOJA 4QUEA 2CD7A 5K3SA 1N78A 1HNWB 5FEMA 4FGKA 2O8EA 1JMKC 4MUJA 1OHHA 1QKJA 2P79A 1B15A 3FPJA 4P32A 2ZVQX 1CUDA 2ATXA 1O5IA 2BBSA 3RSSA 1GTSA 5FUQA 4YAFA 3UCEA 1DC5A 1H6DA 1XZLA 2OBBA 3FZYA 3MBOA 4MKGA 1L1EA 5FWXA 1B23P 1RQ7A 2IK8A 5JD5A 2D5AA 1E2JA 1D3AA 4UVDA 3QX8A 3VJMA 3AFNA 4D56A 4K05A 4QHYA 4CHTA 4HUJA 4GOND 1F3LA 1LBQA 3LC2O 3E0XA 1JEQB 1KVSA 1ZJYA 2IA5A 2P2GA 3L43A 3C7AA 4PIPA 1V25A 5G0TA 3VH1A 3KQYA 5ADVA 3MJVA 5DGIA 2E5LB 2FZLA 1X7GA 2YV4A 5G2OA 1NBOA 3KJIA 2QY9A 3SF8B 1OI2A 4W82A 1FX1A 2FHPA 1DAOA 2C3PA 2N0SA 4I4TB 5SYMA 2NNWB 4OSEA 1Z7EA 1M7BA 5EKXA 1VMIA 5AYVA 4WTOA 1KFEB 1OAAA 3A4NA 2JFQA 3NIGB 3R3YA 5FWNA 1TQ8A 2QENA 4AO6A 1C4KA 2E6UX 2Y1CA 4ZQCB 3WLLA 3T7EA 4G9GA 1JR3E 4MCHA 5CYFA 1ADCA 4Y8VA 2A0FA 2GEJA 4HCJA 3ZDRA 1ZOOA 3ZK7A 4YFYA 2O50A 3S2FA 3GI1A 3SF0A 3KUDA 3DT9A 4FC7A 3V2GA 3JWJA 2EP5A 2PG3A 1G6KA 1A5SB 2A7QA 3L7BA 4GECA 3SR0A 4CLXA 3ZU4A 2BFOA 3MQFA 3CLRD 3QE3A 1E94E 4FE4A 4MWDA 4X1YA 3VU8A 5I51A 3HDJA 1XAHA 1U2RA 5GP1A 1PHPA 3TTUA 1N9GA 1XEWX 2BAGA 2HTEA 3KHSA 4M0DA 1AK9A 4LBZA 5CFOA 1ZPDA 4L8FA 1KFJB 3ZU3A 3KYJB 1P29A 1N7JA 1ECJA 1F5NA 4KRGA 3SXJA 3SJAA 4G41A 3UWSA 3OQ6A 1JHDA 4CDNA 2JI7A 4HXGA 3HI6A 1DI0A 1XC7A 3TDMA 5IKPA 2NQ8A 2VDLB 2VHQA 1LRKA 1M83A 3P1JA 2NAFA 4HQRA 4TSFA 4JWKA 4YBRA 4AS3A 3OOSA 4JQYA 2PZKA 5B2ZA 1EIZA 1XZBA 1YRAA 1M1NA 4BXOA 3FJ1A 3RH0A 1M6YA 1PZMA 1E6WA 2V7QD 4H4DA 4WNAA 1Y3CE 1L5KA 2FEPA 4E2YA 2QXUA 4TWAA 5DK4A 1U1CA 5K3BA 1U63A 3LHKA 2J3KA 2W6QA 2GEVA 1DEHA 2QPLA 4OHRA 3RT9A 1ZIOA 1CF9A 1R37A 2JHAA 4PTYA 1ZC4A 1URPA 2IS4A 3ZQUA 3DB1A 8ABPA 4FWTA 3KQSA 1NVGA 4B76A 3NYRA 1P6XA 1NVMB 4RWEA 3RANA 4ER5A 1G20A 2A9VA 4N76A 1DE0A 2AFHB 3GUHA 1L5HA 3A1DA 3DZJA 1JIIA 1N8KA 5J2UF 2J0SA 1Q91A 4E11A 1JLKA 1IY2A 3RNOA 2C42A 2ZU6A 3R7SA 1E61A 3H5LA 3O3NB 2PGDA 3OPYI 4R9NA 3AVOA 3U3JA 1K06A 2ZAOA 1LWNA 2WOOA 3GU3A 4YRFA 3QLUA 1UPBA 5AW8A 3DD5A 3OLVA 1FFXB 4D92A 1UFRA 2I4OA 5PNTA 4H0FA 5HMLA 1E9AA 3LGXA 3QNWA 1XCGB 5KVCA 1A7UA 1AZWA 3F4LA 1C0EA 3HTXA 1IQ0A 2WMNB 4KQXA 1XI2A 2FKNA 4IVRA 4EG3A 1Q3HA 3B3QA 2XYHA 4MUKA 4NNPA 4DWOA 3T0GA 3V4ZA 4U2KA 3P7MA 3V3TA 3Q8LA 1EUQA 1KZ4A 1CY1A 1FPQA 1J2JA 1J8YF 3QLVC 4GICA 3S2ZA 4CEJA 4MI9A 2J41A 2WF5A 4ZCLA 4BB9A 4FGLA 4JC8A 3HCEA 1PLKA 4YUVA 1MIOA 1DEOA 1DSSG 2QN1A 4EZBA 5JUWA 2JKYA 2GESA 3I61A 4P5PA 3EMBA 3O8QB 1IMOA 4OQEA 4QUAA 3L7JA 4CV1A 4YRJA 4LECA 3NC0C 3RS9A 1UC8A 4OD0A 4RZQA 4FFBA 3NDRA 2C0CA 5CVJA 2RIPA 2R4UA 2DC1A 3R3XA 4W5WA 4X3PA 3VHXA 2UUPA 3IHWA 3CPEA 1I2MA 1N7GA 4NYJQ 2CHGA 4WD3A 1TC1A 5CK5A 4E1AA 1X8JA 2VP3A 3IQDB 4FC6A 4I19A 5JBNA 1V0JA 3LUBA 5JSKA 2YINC 4HL6A 3KHTA 4HDMA 2YHBA 2FZKA 3H11B 1GPDG 2XCUA 5KTSA 1GQOA 1A9QA 4Q39A 3STHA 1SBTA 3T95A 5EJ7A 4WCFB 3UYKA 4XGKA 3IIIA 4CIYA 3IAFA 1Q83A 4G0ZA 3WADA 2A9QA 1DG3A 3HGQA 1ND6A 3B2EA 1KVUA 4PCVA 2ID7A 4QU9A 5IAGA 2YWRA 1DKPA 2B5OA 1T13A 2FPGB 2YHUA 3ZBTA 5IBQA 3W5SA 1NY6A 4DRXA 1E63A 4XYGA 1IULA 2X0FA 1DLJA 4BUZA 3D8BA 3A4YA 3RD5A 1BG6A 4CFYA 2HQRA 5EHGA 4AYTA 2MR6A 4F3KA 4NJMB 5IZCC 4TL6A 3V9PA 5FHQA 3TVYA 2ODEA 3NIDB 3VKWA 5FF9A 2ZYDA 4BCDA 2GEKA 2HMWA 4N5DA 4YRDA 1UH5A 4F45A 3QI7A 5EGSA 13PKA 3BL6A 3DEAA 1JR6A 2GKOA 2JB9A 2VTEA 1QAOA 5D5QA 5J40A 1NX6A 3UIEA 1STOA 4B3DA 4MGIR 2VPYA 4R1OA 4KJXA 3VDRA 1UMDA 1FZQA 2QRZA 3P0JA 1H1LB 1RVV1 2XE4A 4PZLA 3D6MA 2IVZA 2HB6A 2P40A 4RMJA 1IN6A 3D1JA 4UUBA 4QEDA 2AJCA 2ACEA 5JNRA 1G2PA 4CV3A 2AV6A 1BXZA 1QJ4A 1Q1QA 3K2EA 2I2BA 4I9UA 3RHSA 5JRZA 1DJMA 4YFVA 1HQYE 3DEZA 2CK3A 3NOQA 1H4TA 1O0SA 3B13B 3NBZC 4ARZB 4RFSA 2B98A 2X9NA 1XD2A 3QYJA 3WWPA 3HBLA 1E32A 1QHSA 2WWFA 3CU5A 3IAEA 3QZUA 4BNYA 4NCAA 2CFOA 5EQJB 3B3AA 2OTCA 2NUBA 3FDIA 1NW3A 1MGPA 4H0NA 4GL2A 3TTYA 4MVCA 2WUVA 3V7FA 2A0WA 5F77A 3UKDA 4CE6A 1D6SA 2WKQA 4MVJA 5LA6B 5BSKA 5M04A 2CNWA 4ZOBA 1A27A 4L5YA 5CT5A 3TECE 1PLLA 1LNSA 1NLMA 3QWFA 4HLCA 4GPBA 1IZZA 2OSBA 1OH8A 5ED0A 5J5AA 5EA2A 5BYJA 4OLJA 3V80A 2VDUE 4UDOA 1UJMA 5THXA 1AKEA 3U3ZA 4OHYA 1OSNA 4G1MB 5LXTF 4DTIA 4M8SA 2C2KA 2QE7A 4G65A 2V5AA 4GLBA 3W34A 1UBGA 2G06A 3IP9A 4XJVA 4LWOA 1KP3A 4BEVA 1DBSA 3DJFA 1PJ4A 1ZZGA 3CPSA 1HX7A 3GNLA 2WD7B 4QUJA 4W5OA 3T7CA 1IBSA 2Q6TA 5JJ5A 2FEWB 3QU7A 4B2PA 3AP2A 2VBFA 5C8VA 3I05A 1J24A 3FAZA 3ZCUA 3RVQA 3H8VA 3CZRA 1LDNA 2FQYA 1YB7A 5CX1A 4B3SB 1Y5MA 3UTDA 1A95A 1SZCA 1UZLA 5CB4B 1WMBA 3FMOB 4FCTA 1XV5A 3ZJ4A 2DEUA 5BNFA 2BD0A 4BWGA 3CNBA 3OZSA 3U7IA 4AF7A 5IU6A 4OVKA 5JNLA 3I2JA 1QGYA 4L0DA 1NFQA 4GQIA 4MI3A 4K87A 2ZJBA 1DC4A 3KJFA 2VF5X 4WIAA 2HLPA 2JA2A 4QXRA 5F4ZA 1YL6A 3EVAA 4QVIA 3SZUA 3TUZC 4FDLA 3E7FA 3ZQJA 4GI3A 2YXDA 3DUFA 4J9UE 1R6TA 1JE1A 2QI9F 4JYPA 4R3NA 3SBEA 5A5VA 1LDEA 1SM4A 1FFGA 3E7DA 1OFIA 1Z4MA 4NV0A 3AEKB 3B1XA 4F72A 2WG1A 1LSSA 2AW3A 1T3TA 1J7KA 2GRAA 3E1SA 4OQQA 3QVUA 3PFKA 4B3MB 2B4QA 1FF9A 1V43A 2ILTA 2DVMA 1XQXA 4IH4A 4GYYA 2NGRA 5CLLA 4YJDA 1YJXA 2ZIXA 4MQEB 4OBWA 4M8LA 1GG8A 3Q5DA 4NQRA 3BDAA 4AWXA 2Q3HA 2UVPB 2AI1A 3FN4A 4Y6RA 5C31A 2ISCA 3AETA 4BO8A 3BIJA 4QPJC 4AS1A 3ZI7A 2ZYHA 1ATIA 4RTQA 4X66B 4CKEA 5AM0A 5JU6A 4BZZA 4B3IA 4MMXB 1ULSA 3KUXA 3MBKA 2BEVB 3VPFA 5EESA 4FI3F 4DC9A 5BYAA 1AA6A 1RLMA 4G5GA 5CX4A 1W4AA 3SQDA 3CURA 3ZWYA 2GXUA 4CU5A 2OZEA 3IPCA 4MRPA 4GWLA 1BFKA 3DP7A 1D07A 1ZD4A 3CO5A 3MCZA 2RIRA 1E6EA 1FLDA 4GRDA 2ZUTA 5JZOA 1XKXA 4OHUA 2HLHA 1J8DA 2YVQA 4A27A 1Z18A 2IH4A 2GBLA 2C7GA 1A7KA 4PCLA 5CAEA 1GAWA 3BRCA 1I3CA 3QXSA 3ZHSA 2Q5EA 5JH7B 3PJRA 1I6MA 2W2LD 2IZ1A 3CLSC 2PT7A 2BKVA 4G4GA 5LBIA 4BE9A 2PH5A 4DLZA 3E4DA 5E1MA 4D8VA 1NW7A 1QIIA 5T6BA 4D3XA 1SOUA 1Y9ZA 1NATA 1THZA 2RAPA 3HACA 4Y0VA 4GEGA 4FGSA 1GCGA 5IUNC 3WICA 1LPOA 3DOOA 1U0BB 3MTQA 1EWVA 4J0QA 1OLSB 3P26A 2G8LA 1D0IA 4O4LA 3MCAA 4D0GA 4DG5A 1G8AA 4GDFA 3M6XA 4N0PA 1U7UA 4JU8A 4RZXA 5ERXA 3U4CA 5BWCA 4EK9A 1CEQA 3PWZA 1PVVA 4N12A 4ZI7B 3ERCA 2VDJA 2AX4A 3INGA 4Y2HA 3UFBA 1DKNA 2Q9AA 5DE3A 4N5IX 2BCEA 1KHTA 1UQRA 3O94A 3W8NA 4QJBA 3WLJA 4B6EA 2VWHA 4CM4A 3PX3A 4JA0A 1NYRA 3RCBA 1E3WA 4YUWA 4B7CA 4W1RA 2QT1A 1M6HA 1T25A 4INAA 4MOWA 3VDNB 1CQIB 4V0RA 1QQ5A 1ISJA 3VYUB 3EIXA 4C78A 1RFGE 2GZ3A 4AZ3B 2OYCA 2JBAB 3ZY3A 5C53B 3RTGA 1T8SA 4FTWA 3QTTA 3G2HA 1Z7YA 2OM6A 5K45A 3ENZA 4HGRA 2WJIA 5GVSA 1JAHA 1AZSC 2NIPA 1Q7EA 4HN2A 4LQLA 3QVWA 1Y82A 4YDHB 4QBGB 2JIZD 3FNFA 5JMOA 3MLAA 3FZNA 3WGLA 2VWQA 4GW3A 2ZTVA 2FZGA 1FDWA 4M3NA 3JQGA 4N49A 4O6VA 4QQRA 4N48A 3S6JA 4QXMA 4U0JA 1S7GA 2IYZA 3FM9A 2XMQA 5J2TA 4GBJA 3AKCA 4NMLA 1DBQA 4RY8A 2EZ8A 1DCMA 2PXXA 4Y98A 1QOPB 3SZMA 1N5DA 3X1JA 4RTLA 2F6RA 4Q01A 5L3QB 4Q48A 1WZCA 2EGHA 3WA7A 3BGSA 5D3MB 2W48A 3FPBA 2VHUA 2XDAA 3IR5A 4JP5A 1GLVA 2ZRPA 1GO2A 2CNLA 3DF7A 3M3PA 4BS9A 1CQPA 1VXOA 2R6ZA 4OQFA 3D1LA 3REFA 5EKUA 1QFYA 2EGGA 5CH5A 1VFPA 4UC0A 1U9ZA 4ARBA 1YVRA 1X7WB 4HZGA 2MU1A 2IYEA 4HB3A 3NCTA 4EI9A 1ORDA 3DE2X 4BBZA 4AJKA 4NARA 2NO6A 2Y4NA 3BMOA 1SUBA 2G67A 3IURA 3PHHA 1XELA 2PAAA 1Z29A 5BV0A 2C95A 1K88A 2RHTA 1LBEA 1HDOA 2WU4A 1E5QA 3PE3A 2IYPA 4KV7A 4RO0A 5IM5A 3ACDA 1X1TA 3ZKWA 1UK9A 5CLFA 3E3AA 2M6LA 1HXHA 3WFZA 2NW6A 3A4IA 1IUPA 1S2IA 2AOTA 2C4NA 2CYCA 2ZRNA 3R5JA 5B37A 4AJ9A 4UVHA 2A5FA 3FFTA 4RVFA 4Y2TA 1H65A 3VA7A 5DYWA 1U1EA 4J2OA 2WYOA 3FCSB 4OB6A 1U3TA 3OA2A 2H52A 4H77A 1SKUA 4I50B 1XAJA 2SICE 1PEKE 4S1TA 2HKIA 3ICOA 5FPYA 1RU3A 3FUXA 1LNZA 4L07A 1GPLA 3RJ9A 5F23A 1IONA 4QTXA 4V2UA 1UK8A 1XVLA 3A28A 1JU9A 1KI3A 3TLJA 3WOHA 3ZHOA 2W6CX 4LVUA 2V4UA 4HUQA 1G8GA 2B1QA 1IB6A 3VH2A 2QN6A 3HEBA 3G2LA 1SK9A 4D6PA 1NZDA 1LCIA 1BFDA 1WRBA 2M98A 3U4AA 2VA9A 2XBMA 1BCRA 1WDWB 1ZCBA 5BWOA 3KSAC 2XUAA 1QUEA 2QLFA 1CZUA 3AXSA 5CVVA 4D46A 3U7FB 3B1WA 4BX0A 2VNIA 3OUUA 1Q17A 4EAQA 4IJ5A 1LSUA 3IFSA 4IICA 2YUIA 4MI1A 1OB2A 4BFXA 4KJZA 3OMWA 5FFNA 2HQOA 3MGGA 4XIIA 2NSJA 4G5XA 2WSSA 3TQQA 4Y6QA 2WKSA 2NZYA 2PZJA 1JALA 1KH1A 1ZGAA 2AHOA 2BP7B 3DMYA 3EXIB 5JDCA 2C29D 4M37A 3PC7A 1TYBE 1PQ4A 1U94A 3QJ5A 3VPBA 4P3YA 2EC5A 1XZPA 1LPMA 4FN5A 4CIDA 1EK5A 4DBZA 3T3OA 2AZ4A 3Q5GA 2JLXA 3KLPX 2C5SA 4FYVA 2R7MA 2GCGA 2JFNA 1LV8A 3A32A 2X0RA 3FBWA 1ZX1A 2WUGA 3OFSA 4WVLA 2AKYA 5EIOA 1NDUA 4F4CA 3L04A 1CSEE 4JBNA 3SC6A 2IXAA 1P2SA 1OPXA 1XLTA 3C43A 3FPGA 1LX6A 3OZDA 4EF5A 1MB9A 1E2QA 1SVWA 4YRAA 3QX3A 1JEEA 1HG0A 4YJHA 4UM5A 1XZQA 4TKMA 4YT2A 1BHSA 2PGAA 1I7NA 2ECPA 3O4RA 2XNKA 4ZVPA 3HGMA 5LQAA 1AQNA 4RA6A 3L1VA 4RK7A 4BMDA 3QKSA 1YQXA 2IY8A 4IIJB 4HFMA 1JR2A 2XB6A 4KHZA 2VOEA 3NBQA 3RQSA 3VTFA 1TO2E 3CLVA 5I9MA 1FDUA 4KR2A 2XVYA 3BERA 1OXBB 5HGXA 2NO1A 1SEPA 1Z2DA 1V96A 2P2DA 2PUAA 2WV9A 5MN5A 1JHUA 3IKJA 1U3UA 4DMHA 3PXXA 1KJWA 3N8DA 4IHJB 3GJ5A 5EWLA 3T1VA 3AL0C 3GUVA 1T5SA 2X86A 3DMNA 1U1FA 2C9OA 4ID9A 4RIHA 5HQ3B 4KRXA 3MWDA 2FV8A 3Q15C 1ZDMA 4FOLA 3AVPA 5SV2A 4QYMA 1VHDA 2CLOB 4YAUA 2C5AA 1WDLA 1XRNA 2VP2A 3JQDA 3JZDA 3Q98A 1SY7A 2DTXA 4KFUA 3ADOA 3F96A 1ENZA 3FVVA 2QWXA 5DIFA 3TSZA 4KQMA 5DM1A 2YTZA 3HBJA 3IAUA 1GGFA 2GFIA 2AVNA 4BDTA 2GB4A 5FL3A 1U80A 3UMGA 4L4UA 1HZZA 2HDNB 2GEDA 3N8IA 3GPCA 4W9NA 5HJ2A 3AF1A 3R7WA 2PL3A 4CM9A 4E5SA 5DO9A 1J25A 1X1DA 4EGQA 1OBVA 3AG6A 4U63A 1AKUA 4G0PA 1W29A 2FWIA 2PSJA 1Q95A 4QU0A 4OYYA 5IKEA 3B1VA 3UMFA 2BF7A 1QO9A 1W44A 3CB2A 4C4TA 3UN1A 4LS3A 2QTVA 4CRWB 3FTEA 1TYDE 3GEEA 2CL7X 1TJ4A 4WCVA 5B1SA 1ZK4A 4PFKA 4JELA 3HXLA 3VYSB 3DGEC 4Q1EA 4YMUA 3ZGNA 4OHXA 5F1OA 2VCEA 5L9AA 4PSVA 5C1DA 4W1QA 4O8ZA 5HUHA 1QGUA 1J8VA 1KDOA 2N1MA 2F9FA 2ZBQA 1O89A 1RAEA 5DP2A 4NEGA 2X6QA 5IUJC 4RPJA 4AJPA 2A0UA 3MN1A 7REQA 1Q0TA 1N32B 5KIAA 2J08A 4K7JA 2P7IA 4CKCB 2RHRA 1ZRHA 2CVZA 2OZKA 5TRTA 5ITSA 4M98A 5CH3A 3QG5A 4MPTA 2Z3VA 4UHCA 1QQAA 1C0KA 2YRWA 5LBTA 4BECA 1SO8A 1PJ8A 4HFJA 1Z22A 3RK0A 5JTUA 3U1BA 2V58A 4UMFA 2E2WA 3KV1A 3P0HA 1VL1A 2O3TA 2PZLA 4JEUA 3W2IA 5A5FA 1B8OA 2RC6A 3DUWA 3E3OA 4B33A 4BFZA 3WAGA 2RGYA 3OZRA 1EP2B 1BMTA 2GYYA 5KVAA 2YHIB 1RDFA 4H35A 4WESB 1DWOA 4OA5A 5DOVA 3RQIA 3DTNA 4HLUA 4W99A 3ZXYA 1E5VA 3C5EA 1UKZA 2R8EA 2QSYA 2ZIVB 2G36A 1CIPA 4DQUA 4DV2B 3EGIA 4FZVA 4UUAA 1PS0A 3VO1A 2DB3A 4DC1A 1NJ5A 4BQOA 3KALA 4M99A 3DMPA 4NBWA 1M74A 5AM1A 4MS4B 3VSEA 4EATA 3ADPA 3MRSA 3TSAA 1E9VA 1QLHA 1TU4A 2QE7D 3PR1A 5F9MA 3FOBA 4LF5B 1NF8A 4JLJA 3V1KA 1IXZA 1EVLA 2QI9C 3G8DA 3ITDA 4LDZA 3NU1A 4WK4B 2G9NA 5AESA 1V3VA 2EARA 2QYHA 4F6RA 3KOZA 4WZBB 1P4SA 3RWBA 3CSSA 2D2FA 3M81A 2WVJA 4RWZA 3ZGXA 5LDHA 3L07A 2COUA 2XQFA 2R97A 3DBOB 1Z74A 1Q14A 1ZVVA 3LSYA 1FLVA 2PYZA 2WTBA 5B3JC 4NENB 1LJLA 4O4HB 2Y0EA 2P41A 4AQDA 1P7YA 1R4ZA 2NLOA 5F52A 3HCAA 5JNVA 3CMCO 3K0KA 4URYR 3D1VA 621PA 4G67A 3BA1A 4L2IA 1H1LA 1T1GA 2IPXA 5LP1A 2A5JA 3LYLA 2QN7A 5KOIA 3WLFA 1V5FA 5FWXB 4P0PB 3RS7A 5D86A 2YWBA 1J56A 1SU8A 3HB1A 4BP8A 4ZU3A 4JB2A 2XODA 1YACA 1NVXQ 2WJAA 2ZU0C 4W5QA 4HNQA 3PQ2A 2QVBA 4MR7B 3RYIB 1AS2A 3HYCA 1YR3A 5B57C 1SIUA 3SYNA 4QQFA 5GZ3A 2G5CA 3GY0A 5P21A 4P98A 4XM1A 2K2WA 5LMNB 4JCCA 1ECBA 4DDWA 4KHPB 3BVPA 1I5OA 1X2BA 3GWGA 4ZVKA 1XD8A 3FVQA 1FIUA 1Z2PX 4TUYB 2GK7A 2VTDA 2RHCA 2ZAGA 4YDSA 3K2IA 1R5JA 4P4SB 3GCZA 1SD5A 5KYKA 1DB3A 3VGJA 2HJWA 1N5OX 1ZZEA 4W9RA 5H3HA 3JQAB 4JYMA 3EPHA 2RAVA 3ABQB 1EM8B 3GZJA 3SYRA 3GLGA 2VFAA 1ENOA 3A9TA 4BO7A 2J7PA 3F8WA 4RKQA 4YIKA 1S8FA 5EEHA 4RMHA 3TJRA 1QNFA 5F5LA 1UKEA 4HYQA 4YAGA 3KWJA 1GJRA 2QUAA 2CUZA 1PFUA 1ODCA 1H0HA 3AV0B 3LVBA 1N3YA 2P62A 1P0IA 4XUDA 2ARKA 2I67A 2YVLA 4PC1A 1IHPA 2AEFA 5DMHA 1IQUA 1TIBA 3BPSA 4FWBA 4Q37A 3I8SA 2M6KA 1GUAA 1AGPA 3RIMA 5JD4A 1W581 2HFJA 3I6YA 3TI7A 3ADDA 9LDTA 3L02A 4R5HA 1UKYA 5BV2P 1GT6A 2GILA 2WIKA 1N9GB 1N5RA 2H1FA 1HDXA 3AI1A 5TE9A 1J00A 1TM2A 2B6NA 3NHJA 2V9PA 1A77A 2EU8A 3DHEA 3WGQA 4Q9LA 3REQB 4LVOA 1T9KA 2I71A 1X9HA 1SRQA 2PBZA 1YR2A 2VLBA 1BQEA 2YWGA 4M8KA 4KOEC 3U6KA 1SURA 1S6YA 2REXB 3FD8A 2PMWB 2ZRCA 1UBLS 4R16A 1K9SA 1F9AA 4RK1A 3V4PB 5IKXA 1NBWB 3PJGA 3ISJA 3PICA 5HKKA 3E9MA 1YCGA 1FB5A 5BT8A 5KNBA 2ZANA 1VXRA 3EF1A 3FMGA 3LLUA 3QXHA 5K5EA 4ARSA 1CXZA 2FLWA 2J9FB 2YUTA 3PQ6A 4A73A 3JQ8A 2PPLA 4ZODA 2GPJA 2WJVA 3EARA 1B3RA 4A9AA 4RPHA 5K0GA 3HP7A 2A8YA 4RJIA 4YHBA 4YLEA 1X7XA 3AR5A 4BRSA 4P6VF 3JQ9C 5FPSA 3OCUA 4PQRA 3AM3A 3O3OB 1FLNA 3GT3A 3S2UA 4EKIA 4Z7QB 4MKRA 5AMXA 1ADJA 1F2UB 3L1IA 5F2EA 3CC8A 1EVEA 3IAS6 5LWQA 1CR6A 5CTAA 5ELXA 2BMAA 1YS6A 1G16A 1MX1A 2HRZA 1CB0A 2OHJA 1D7OA 1MC5A 3SXPA 3GH3A 1NVAA 1XRSB 1WB5A 3GJRA 5JEDA 3H9QA 1U2EA 1EFCA 1HI9A 3GD7A 5TF4A 3SNKA 3WDKA 1B0AA 1LW7A 2AQHA 1ZICA 2O06A 4PXAA 4M1KA 3ZDXB 4EHAA 1NKSA 3EFOA 2V98A 1VKZA 1W35A 2EZTA 3R3UA 2QZ4A 5B58T 3EZYA 4ZYUA 2R00C 1MN6A 4DR3B 4QQ8A 2V6FA 3H5TA 4GZMA 1I5RA 3EIOA 1JMVA 1XZAA 5K0SA 4IJMA 4J7AA 3LLSA 1KEUA 1FTYA 4U2CA 1X9IA 3I52A 2WZBA 4MULA 4DA8A 2DUNA 2HX1A 1PWXA 1N6PA 4J6FA 2PRIA 1ISIA 3ORSA 4WGGA 3CINA 3K0AB 3MJFA 4B47A 2VXYA 1ZL0A 1CJSA 4L95C 3PPWA 1DQPA 4C29A 4RBNA 2DFLA 3RB8A 1L7QA 1SUSA 4QPPA 2I2CA 2XE8A 4N4AA 4C7BA 5I7UA 5C5EA 1SBYA 3WB9A 4W5RA 3NH9A 4QBHA 2WPNA 2OGUA 4KN6A 5MGBA 3SPXA 2HRCA 3OTHA 5DVZA 3IV7A 3VZRA 1XNRB 4B3XA 2JASA 4E2FA 2QNRA 2DLCX 1ZRMA 4I6GA 1QTIA 5CUQA 1MT0A 2VPXA 2WMOB 3OT4A 4HQNA 4G1VA 3IR6A 1LTHR 1NUSA 2RG1A 3IDQA 2P5UA 3Q9NA 4NP6A 4R01A 1NUAA 2XDQA 2CXOA 2J07A 3AR9A 3VU0A 5LBUA 2PD3A 2AFHE 1RWVA 1SNYA 5BW4A 1NF9A 3E81A 2YJNA 1ZY2A 1JKIA 2ZLBA 3BFPA 5DNDA 4QT4A 2AQKA 3MOGA 2IYSA 2Q29A 3M1AA 4TYYA 3LFHA 3BXOA 3QKWA 5J47A 1ECCA 3DF9A 1NQAO 4NHOA 2QDXA 2CNKA 4II7A 4P92A 1LY1A 3RT1A 4EMUA 1PWZA 1A2KC 1PSZA 1N92A 1TT7A 1W2GA 2UZ3A 3WIOA 1FUYB 3NKLA 4K6MA 2B35A 4RV9A 4B82A 4V3BA 2OK7A 1U7WA 4TS4A 1RJDA 1YBMA 1FRQA 2H1SA 4OKNA 1DAHA 3AEYA 4HADA 5G4KB 2OSVA 3DMTC 3HXOA 3TMYA 1DJPA 3FOCA 3WHLA 2HCFA 3BXXA 3M34A 4JJAA 2ZREA 3CZ9A 5EZYA 3PR2B 2QMYA 1X1QA 1DZIA 4HO1X 3EXFA 4RY2A 5ELLA 1UBFA 2OXRA 4IXTA 4DCJA 1I5EA 1Q50A 2AC2A 1L4HA 3WK6A 2EBWA 3UT0A 3ZK9A 4IDPA 4NE2A 1C1HA 1R8QA 3Q9UA 2PS0A 5ALUA 1J20A 4MB6A 3EOBI 2J9ZB 2AFIB 2PTHA 3O2JA 4M0PA 4NZZA 3K3PA 4E21A 2GM5A 3AHIA 4ILKA 4L02A 1RI2A 3PK0A 2D0OB 3IKMB 3ZWMA 3LGSA 1GWNA 3ZHUA 4DHWA 4FP9A 2L42A 1Y1TA 4F4UA 1OXKB 3FPLA 1QP4A 3MSXA 3U3MA 1ZEMA 3MCUA 1W2HA 2GS9A 3KYCB 3MILA 4LZZA 4MJ3A 4NBUA 3X1YA 2XEDA 3ZTYA 5FYDA 2FQXA 2G7MC 5F9FA 2PY6A 3M4YA 2Y1LA 3D7MA 4BVFA 1FYXA 3ILYA 5L3VA 3PXEA 1L4BA 3IOYA 1XQVA 2DH6A 1GQYA 4OH7A 4KNVA 2MHCA 2HWKA 2Q0SA 5C52B 1H5UA 1JQDA 5CK4A 2CUNA 4TN1A 3VU9B 1E1DA 1Z3IX 5B3AA 4UHJA 1ZUNB 1HYEA 1DIAA 2BDTA 3VMFA 4EFNA 2DAPA 5A9TA 3VO8A 3JQ9A 3J80A 5CA0F 3U4MA 4RIFA 4AQ7A 2AC4A 3BKXA 3ED5A 5E7MA 4GSLA 1WM1A 3W6ZA 4B2YA 3NTUA 1RC1A 2ASVA 2FG5A 4JQZA 2GETA 1KI6B 2W11A 4N47A 1GNTA 4MYDA 4PINA 4LTDA 3D4BA 1PL7A 4GNKA 3EQ9A 3NX4A 5FNVA 5T41A 3GCGA 2QTTA 1T5IA 3EWAA 4DG8A 3NQ41 3AI7A 4YMVA 1T4GA 1FXWF 5AVSA 1DX9A 5IMBA 4BVHA 3LHFA 4P31A 2P9HA 2WD7A 3VZCA 4RX1A 2ZT7A 1U3CA 1F6WA 1KJQA 3GARA 3L77A 2BSXA 1EQUA 2PS1A 3OP4A 1D2NA 5LZ2A 1XUOA 4CCYA 1Y89A 1ZWLA 1SK8A 3NUQA 4JNKA 5IK2A 1GTMA 4A2CA 4AY3A 4ZVUA 4DLAA 4HBZA 3COJA 2R5NA 5EIHA 4CR6A 1Z75A 2IXEA 1LTQA 2ZPUA 4DANA 3V4LA 2F9MA 2I2DA 4IYRA 3ZD7A 1KZ7B 4YRLA 4CEIA 2Y0BA 3ACCA 4JP3A 2IQIA 2ORVA 2BUCA 2ENUA 1VHJA 3L6BA 3BWVA 4NFYA 4UJ3A 4WA8A 4P34A 5AKIA 1T3SA 4GMFA 1S2NA 1XZFA 4OQLA 2V1UA 1YR9A 1R88A 4GX2A 5IASA 1UOEA 4MTCA 2UUBB 1J2RA 1BH6A 1KPGA 1OREA 2BFCA 3WQSB 2PKYX 4FNOA 2NV2B 4DLSA 3QG1A 1FLAA 2ZSEA 4GO1A 1KKUA 2XE6A 4X7RA 1YC5A 3FCOA 3O26A 3AR7A 4ZJPA 3LUAA 3IPYA 4PG4A 3W1VA 4JUAA 4CR7A 1Z34A 4ZMBA 2OHGA 5DWDA 2Y0DA 3T3PB 2PBLA 2W5UA 2ZWMA 3KTOA 2FUNB 3WKCA 4DJDC 1E4VA 3TLGB 2P91A 4KQHA 2FOXA 4DUPA 3HSKA 4EVRA 1O97D 1TTQB 1JKJA 3DKKA 3BHMA 4IG9A 2YWFA 4GMDA 3UWMA 1PJTA 1NHGA 2EWWA 2W2QA 3O8BA 2Z5LA 3F78A 1J39A 3IHTA 4ITVA 3OA0A 2VZEA 1FNBA 2UVPA 1CJTC 1M2WA 1VJDA 3EPRA 2PZ8A 2QYSA 1X92A 1YCHA 2OFPA 3OE1A 4RNCA 3KHKA 3CF0A 2RGUA 5JS2A 4BQQA 2PO5A 5J5CA 5KTTA 3HKDA 3UY4A 4R98A 4DV1B 3F8SA 1E2EA 3H42B 2ZRMA 3PC4A 3QVMA 4ZPJA 4EA6A 4A82A 4TTQA 5SZHB 3GMDA 2WF7A 2VRWA 3ANMA 3VR6A 3W5UA 4DHEA 2WWWA 2A67A 3OCWA 5DGXA 3BCSA 4BV2A 2G1JA 3PV0A 1SZJG 1E9BA 3G5UA 4L72A 5KKCA 4P36A 4BLQA 4EYOA 1WKCA 5IPFA 3H5WA 2G04A 4FILA 4HLNA 2ZBFA 3AX6A 2B4YA 1VLHA 3BORA 4L4RA 1HY3A 5DRYA 1RJWA 2TMYA 2XXJA 1DARA 2AOUA 2X77A 3LPMA 3P0FA 5MN4A 4RULA 3TX6A 1C9EA 2O7SA 4EZIA 3DO8A 3HA5A 3VVBA 3ANLA 4F1WA 4PFJA 3S8EA 4EYQA 4XD7D 1OIVA 2R2AA 4ZEOA 4F97A 2G9QA 5F2OA 1MTZA 4GBMA 1XO1A 3R6WA 5EIBD 3SLGA 4C9BA 2E5FA 2NSDA 3RFUA 3AO0B 1PT7A 2NU6B 4QSMA 4NFLA 3RKUA 2OO7A 2GAOA 2Z4SA 3FYUA 1D4AA 2JK0A 2GYVA 4WLNA 4CLRB 4AY5A 2LDBA 4HV4A 1WMSA 4IGFA 4FOTA 1YFJA 2ZITA 3BWXA 1JBKA 1J2TA 4ANFA 5ILOA 3DZDA 3H1AA 2RBEA 3HHEA 4H7KA 4R2HA 3AILA 3B3JA 4R0NA 1AO0A 1QOZA 1OV4A 1GRQA 3HDVA 5BQFA 4G23A 3U40A 2RBKA 4MV1A 4F11A 5JXWA 2JDIA 2X9VA 5A1JA 4HNVA 3Q0TA 4BTVA 4YJ2B 5ESWA 1E60A 4MGKR 3RF7A 1DFHA 1TIKA 2Q1WA 2GRJA 4OH1A 5HILA 2BDUA 1X3SA 2OBLA 4AP9A 1WB4A 4XQ0A 1T8RA 3MT9A 2PS3A 1WHSA 3CFYA 3LCCA 3JD3A 1UJNA 3NP7A 4M53A 2PEZA 1NPDA 2BZSA 3OLXA 3AEQB 4EHIA 1RNLA 1BJTA 2GPAA 4IH9A 4QGGA 4OP2A 4JVOA 4Q7KA 1E9CA 3JVEA 4KX3A 2ZJ4A 5K0FA 3B7WA 5F1PA 4CLHA 3BBPA 4H6WA 4R8RA 2PVCA 1PGOA 4HQ6A 5TGDA 3PS9A 4ZVMA 3RTBA 4R6WA 3HS3A 2Z5FA 3V8VA 1QTRA 3IKVA 1NVTA 1CU1A 4JLBA 3LPCA 2HXYA 4GM1A 5CYOA 2OFFA 4IRMA 2OCPA 2Q5HA 1U0OC 1VPDA 2FZCA 3NHAA 4M55A 2OLKA 4HQKA 3ZJYA 4BUJA 1P4RA 5LJIA 1CP2A 2J3EA 5EUBA 2F1RA 4URUR 1TVKB 5AKZA 2KPOA 3ND8A 2JFZA 2QRJA 3FNGA 3AHGA 3UMRA 3LU1A 3IDFA 4HMOA 1GPUA 2VSQA 2YMLA 5JYDA 2D3TA 1RZVA 3F6EX 3IYLW 2IV7A 3J81k 1H3FA 3TRKA 2IZ5A 4L27A 2PGNA 3OZFA 1S2DA 2J3IA 4BMSA 4DABA 3EPLA 1DKQA 2O7RA 1E5DA 2O6LA 4G5RA 2N3ZA 3V8PA 4UM8B 5FTLA 1W6UA 3I0MA 5TLSA 2ETXA 1H9BA 3C16C 1OKKD 4R8KA 3HB4X 3Q7SA 4QX6A 3UJ7A 1AS3A 4HFNA 4PC2A 4TLAA 1E9SA 3W3ZB 4NESA 1W49A 2X9QA 3QVGA 2GZ1A 2P9FA 1Q7GA 3BL5A 5AK3A 3V7UA 4LF8B 3N2KA 5JBQA 4ZOCA 2H2GA 2VHCA 1PTJC 3ESAA 3OT5A 1A9TA 4FZ5A 2PS9A 1IY9A 1DKMA 4RSHA 2AJTA 4NAVA 1P7PA 1OBCA 4O4JA 1IH8A 4HPJB 5LUBA 2AL7A 2AK2A 4J3NA 4EHNA 3SIXA 5FH9A 5I9IA 2Y1FA 4MKXA 5C4IA 4H9GA 3NGXA 1A2OA 2DBZA 4JYZA 1PLJA 1BW9B 1FTNA 3HNPA 3QUQA 2ZJ6A 4WNYA 5EFOA 1ADGA 2QJRA 3LXUX 3STVA 2K2QB 3MJHA 4TYPA 5LQKA 1ULZA 3RYTC 3HUDA 1KZ1A 4Z0HO 3ZHZA 4UBJA 1TUGA 2JCXA 2WTEA 4IUYA 3NPMA 1P60A 4PICA 3RADC 2W22A 5KKAA 2HUNA 2XXBA 1MG5A 3RK1A 4GBED 2FWAA 3A1EA 3G1TA 2II6A 2F4VB 1HORA 3CJTA 2WT4A 2I6UA 5A6SB 4Y9DA 4KXYA 3O8RA 2F1JA 3ONWA 1UP4A 2WIBA 3NC1C 2IS6A 1YRYE 3T7AA 3ZOZA 3KQNA 4RCZA 3TBHA 4ZMRA 3A7DA 1PJ2A 2X2PA 4MWGA 1R0WA 1XRJA 1MU0A 5HS6A 2ECOA 3UCFA 3WLEA 1B2RA 1YRBA 2V45A 3A1VA 1T0HB 3OETA 2M9MA 5FI0B 3SX2A 5C8XA 5DLQC 1E18A 1SELA 3RHTA 2QU8A 3MMPA 3CE9A 1UAYA 2I4NA 4OFWA 5CA1A 1ZUD1 5G1OA 4KIWA 1JRLA 1BE0A 2HT6A 3HLKA 5DKFA 5TC4A 1TEHA 1XQWA 1DPGA 1W4LA 2XE7A 3DOHA 4P4SA 1V2HE 5CM8B 4CF3A 3RVPA 3U6BA 2DHDA 3KOXA 5JSUA 3T1YB 2IHTA 2PH1A 4TRMA 4UHHA 4D80A 4QFMA 1AG9A 3R8CA 1UDAA 1LPBB 3HEAA 4JWTA 5JWOA 1SG9A 1ZC3A 4EUHA 2ZJ5A 5HIIA 1P73A 1RYHA 1AIPA 3KR2A 2V97A 4PO8A 4YROA 5E1BA 3GEBA 4WBNA 2GCOA 4E31A 4L75A 3PX2A 2BH9A 4C4AA 1S4MA 1KOJA 4IIJF 1WR8A 3C3WA 4YCSA 3PKIA 4M7PA 2OCAA 4UEQA 1TO6A 1SQ6A 3I5YA 2V74B 4Q9IA 1E2BA 3P9KA 5GV8A 1RYBA 5TS2A 1H2FA 4WL0A 2XZTA 3SBDA 4JV5B 2OE2A 4DZTA 4ZN6A 4EYSA 2H08A 2RHBA 1N3IA 4FFNA 4A6XA 5IMSA 2VAPA 4A0RA 3LLCA 3UWOA 3H2GA 3GGDA 1RKQA 4H7HA 4IEIA 1O8BA 4RD2A 4AZWA 5FV4A 4IJUA 2P35A 4KH0A 1S01A 1WXDA 1X1CA 2FSFA 4QGHA 1NWHA 5KQLA 2BHLA 2RGCA 5IAEA 4LJ8A 3BRSA 5AIBA 1DO2A 3AM5A 3MUEA 3THXB 2EATA 5L4LA 3WIEA 1RXYA 4EGCB 2M2IA 2B1RA 3KVOA 2C9YA 2I4TA 4BO0A 5DNWA 5B4VA 3RVSA 2O0LA 2QK4A 3HH8A 3F47A 2J9FA 4RZHA 2ISQA 3CMMA 1XF9A 4UVIA 2VJCA 5EE3A 1Z38A 3UOAB 1WSWA 3WLNA 4BGDA 2A88A 2R9VA 1E4EA 3FYUC 4I9GA 1WSAA 1SVMA 4PIMA 2BHTA 3GAAA 2O8DA 3QPAA 1GV1A 1NQTA 3FPFA 4WFKA 4B83A 4FFLA 4EEXA 4H1UA 3ST7A 1SCUB 4C0KA 2BZ1A 2V7GA 1UWKA 2AG1A 3WQQA 3MWYW 3CZAA 1RI4A 3OJOA 5EHXA 3PYLA 3WXMA 3ZDAA 4NC9A 2UZ0A 2RHLA 4GYKA 5C7IO 3WGVA 1T9ZA 4KPUA 3GB9A 1T35A 2PT5A 1IOZA 5KJCA 1AQYA 4JB3A 4DEVA 1QF6A 2IDKA 3LXRA 1IXSB 1QE0A 2TS1A 3A8TA 3IRVA 3PFIA 3V2UA 4BBJA 1D4OA 1Y1LA 1EVZA 1JSCA 1WUKS 2D0DA 4TXMA 5A0FA 5AUPB 4FDTA 2XA1A 4ROTA 3CKKA 1JEAA 1Y6ZA 2WU8A 3F5MA 2EKZA 5IJ0B 1NI4B 4L16A 3E4CA 2YH2A 5GPBA 1N9ZA 1U7XA 2XNSA 4Q02A 3W90A 3NHYA 5C18A 3FWZA 3FOEC 4AQYB 4YASA 3ML1A 2Q4EA 3A4TA 1X86B 4IF4A 1J5PA 5CTJA 4AG6A 4M1TA 4KGZA 1N3LA 5FTJA 2XMBA 1VHLA 3G3EA 4KXMA 4UFPA 2MSNA 3BMCA 3OIWA 1R0XA 1XLTC 4YY3B 3LNTA 4WY2A 1PRYA 5F64A 4F3NA 4K9RA 1YWGO 2VJDA 3EHEA 2C5FA 4UD2A 5KREA 5T7BA 1SOMA 4ZV7A 2Q1XA 1YDGA 1IY1A 5IT5A 4EG4A 2NVOA 4KMMA 3C85A 3AEUA 3ZLUA 4XGNA 2Y6VA 2P1ZA 1JH8A 4QE3A 5FOTA 3H0EA 2JBHA 1TPYA 3E9CA 3A1CA 1DGQA 5KU7A 4LHZA 2AZMA 2R8YA 3C6QA 1KAMA 3OPYA 2G9VA 2WMDA 3LLVA 5ALNA 1MRSA 2YMPA 1B8NA 1QX4A 1BSVA 2ZVPX 3ANSA 3CLRC 5FL7D 4RL6A 4OOEA 2QMUA 2EL7A 1EDOA 4PC3A 5L51A 5DK6A 1Q1GA 3KFVA 2X2FA 5C80A 2VRCD 4R41A 1BGXT 2QPOA 4QBTA 1S2MA 3W06A 1BE1A 5MHTA 5HMMA 3QPDA 1KQFA 1ZJ6A 1OXMA 3QYAA 2UUAB 1SCNE 3EXG2 1JQLB 3FMFA 1V8OA 2YFKA 3I6MA 3KKKA 2RK6A 1H4SA 1E69A 3OTIA 3RUIA 3VHRA 4F38A 3CF6R 3H7AA 4OP1A 4EENA 4KYIB 3Q1LA 3U4QB 1ZMBA 4B71A 1EUDB 4WV3A 3R4CA 3D4LA 4FQ5A 3WRVA 4FB5A 4AJEA 4C05A 2CJYA 1PEDA 1PNOA 2D2XA 1G60A 2AOXA 2PUJA 3JALB 3MGKA 3NWBA 1HTBA 4XOIA 1RXVA 4AKGA 2IP4A 3R3HA 5A3RA 4I36A 7GPBA 3SLKA 2FSPA 2WFLA 4CQLA 4PZCA 5KNBH 1FQKA 3BSFA 2OD7A 1U5BA 1HFJA 5HNKA 2W58A 3M2PA 1IQRA 3H13A 3B1KA 3OEWA 1A9XA 4L3WA 5KHLB 4KB5A 3EQ6A 1F4LA 3HKCB 1CVIA 2IU0A 4UDXX 4JR1A 2VJMA 2Z3WA 3UXMA 1KTVA 2CNDA 3QM1A 3WNZA 2Z6VA 3U56A 4KDRA 5B64A 1JR3A 2OVFA 4B7AA 1Y7TA 3KS9A 3PWSA 5EERA 3VRHA 5BY2A 2ZRFA 3HUUA 1V5EA 1EM8A 1GSHA 1OGYA 4MMZB 4V0QA 4EFKA 2QQ5A 1GSOA 4RTMA 1EXDA 1OYOA 4B6QA 121PA 4PCUA 2YN2A 3RAFC 1JBEA 1V35A 2E4VA 2QTWB 1E2DA 3L7LA 3MMZA 2DPGA 4K6HA 2R1ZA 4K6OA 4MKZA 4RHUA 5TGTA 4EH1A 2HHHB 4L7QA 4R7ZA 2RMKA 3R7BA 1YQWA 2J3MA 2XOXA 3FTQA 1JAIA 1E9DA 3QBVA 4IOLA 1OIWA 1XTZA 2GPBA 2XUOA 4KN8A 3U49A 3SZLA 2WM8A 1H9AA 1EFVB 2GM9A 2JPDA 2XLBA 1V11B 3HP1A 4EDHA 4CMIB 3ZW8A 1I6KA 4ZTZB 1XDDA 4FKMA 1XFAA 3QW4B 4U7JA 2OXFA 4PFSA 5BYBA 4B5KA 4EG6A 1FDIA 4ZVSA 3X2SA 3L0IB 2JFGA 3AOEA 3S28A 3IJ5A 4DCGA 2C2HA 2ZUSA 3OZGA 2Q4RA 3KD2A 1J9ZA 4ZAGA 4EPXA 1XNHA 2FWMX 1ISPA 2O2EA 5DHUA 2XTMA 2AMYA 2X9GA 2VHVA 1QR2A 3LYAA 1K6XA 2VRBA 3SOPA 1XTSA 5EZ6B 1OZGA 2I4LA 3HN6A 4JOBA 1V26A 3RBZA 1PGJA 5IVKA 4UASA 1HSZA 1NE2A 1TM4E 2ZQYA 3LWZA 3ONNA 3AUYA 1IOLA 2IPLA 3AV3A 3OF3A 4YCMA 4Y1FA 2IEDA 3H1GA 3A14A 1V3TA 1OTXA 1KGDA 2PIAA 2V9ZA 3AUAA 4JLSA 4WZ6A 2E9SA 2QN2A 3ACBA 1PFQA 3BTSA 3E5NA 1U3VA 2ON6A 1Z0JA 5T8KA 3RU9A 1SC1A 2IBSA 1NN1A 2CF5A 2W43A 1NTRA 3NHPA 5TY0A 1W1UA 2UZIR 5D5HA 5KYXA 5EXSA 4W63A 4G2NA 4F06A 3NJ4A 1RYYA 5CLIA 3IULA 2JGJA 2C1XA 5A02A 5FAKA 5JZSA 1YR7A 2O14A 3JYQA 5EJMA 4W7SA 2QSUA 2ANBA 1HT1E 3HJHA 3N2NA 2Q8PA 4UHEA 5ABPA 2BEUB 1L6IA 4JBWA 5JSQA 3GH1A 4Z7JA 1QB7A 2C7PA 1NLUA 4UBLA 4YB8A 4ABYA 3R9KA 1Y3AA 5M5BA 1TIPA 2BI8A 2RHDA 2HJ9A 1JHOA 2DSNA 3SC3A 5EHNA 4LOJA 5EJAA 4BB6A 4EBFA 1Z62A 4DPMA 2JH9A 3MSCA 2ZI3A 1KDRA 3L1HA 1LQTA 4F5YA 5EJ4A 1PZNA 2QT9A 3Q7TA 3O4VA 3BXGA 2O5VA 3P2MA 4WBNF 4E1VA 2CYBA 1CWUA 5FUWA 1P1CA 3W2FA 4MA0A 4F8JA 2D0IA 2CVQA 1KJYA 4YJ3B 1E6UA 5HVNA 2GK6A 2GTHA 3W5JA 4FLEA 3F2VA 4EFLA 3EIEA 2VZLA 4CKBB 1P8JA 2JI6A 2PFGA 2V65A 4UPVA 2J31A 2OLJA 3JAMA 2KW5A 3PNPA 2QM3A 1DQNA 4GWGA 1R5BA 2PXCA 4NEQA 2QXYA 2HWXA 4F4HA 2BKAA 2Q6IA 2WICA 2A3RA 2QW8A 3QY9A 2WDPA 4U2FA 1ZGCA 3T9EA 3DL4A 3OFNA 3WL8A 4S24A 1YE8A 2E21A 4TMWA 3SCZA 2FI1A 1SHLA 5AHXA 1CF2O 4JI4B 1ZXLA 3QKIA 5AKKA 2DWOA 4H3KB 2BGMA 2PLAA 3RS3A 3WLRA 4JVSB 5LOVA 2LD4A 1ZVMA 3F5DA 3CPHA 3DUFB 2YIMA 2QNIA 5KYTA 3TGLA 4I6JA 3ESDA 1SPBS 1XEFA 2YIVX 3JYNA 4MR9A 4M0EA 4D9NA 5IDYA 2FLKA 4G0QA 5EIAA 1WUIS 5ESXA 4AKIA 3F9CA 4GLFA 5KYUA 3T6KA 4I8XA 3SHQA 5A7HA 2NO5A 5L3ZA 3IMKA 2V8OA 2QW0X 4YO7A 1PZXA 3BAZA 3OO1A 1ODIA 3ORFA 2VHZA 5E2BA 2H18A 1G20E 3QU2A 3NIWA 3SYTA 3N74A 4KFRA 3IIMA 4RJTA 2ZUDA 1W7AA 1H3NA 3MTBA 4NDZA 4RVCA 2FTKE 4TLBA 4U02A 3U61B 3K8OE 3DS8A 1BXKA 5BSWA 3HWRA 2N46A 3GUZA 1CZKA 3G02A 2VXCA 3P9RA 2KX7A 3MZ0A 2YFQA 3QVVA 2XTNA 4GC5A 4XRGA 3BA6A 4C2UA 2A92A 3S2IA 4O4JF 2H4HA 2D2EA 2JAWA 3ICVA 3W4JA 4PHCA 3W79A 3WK7A 4LW8A 4OQ4A 2RKOA 4D9FA 2TYSB 3L18A 4RSGA 4G0XA 2CSUA 5AJZA 1C81A 1JFVA 5IYZF 3GVPA 1DQSA 2GN1A 3E5HA 2GJ8A 3GLIE 2F8SA 4LYHA 3L7YA 2N47A 2EJTA 3DHVA 4WLOA 3DAPA 1XF1A 2E37A 5LZ5A 5IYZB 2X6RA 4HGOA 5F51A 3C5CA 1HBJA 5ULLA 4F21A 3RYFB 5L4SA 2WJYA 2NU8A 3GFQA 4DREA 1QHFA 3FF4A 4RNDB 1LF5A 3X44A 4Z4IA 5C7YA 4AX4A 1HKUA 2PSDA 4E5PA 3AI2A 1R6AA 1RPAA 2CWWA 4DMGA 4DF3A 1BFUA 5K0TA 2X13A 4EHKA 4BC0A 2QTLA 5EINA 5JD3A 3TZHA 2VSOA 1HKHA 5FKJA 3IXMA 1VE3A 5JFTA 2EJBA 1K8YB 1WW2A 1YOVB 5AI8A 2GAAA 1ZH4A 4BZWA 1ZUNA 1Z0KA 4QXPA 3GDHA 2AS0A 1IPHA 2VC2B 4OTZA 2ZSDA 3ITKA 4TS3A 1GEEA 3U31A 1ZVJA 4OJQA 4ND8B 3RC9A 5MFPA 3N2EA 3HL0A 2WW8A 1PS8A 2PX6A 4O59O 1T8UA 4PQFA 3N86A 4V03A 3LK6A 1IG3A 1DAGA 1BRMA 4MUEA 4D9EA 2O8CB 4OGGA 2W83A 4RVUA 1ORTA 2A86A 2J45A 4PO9A 3IOBA 5LCXA 1CCWA 1RWNA 3BX1A 3FCCA 4ZAFA 1PG0A 1DBRA 1NMEA 2YYZA 4QC2A 5DI3B 1ZH8A 3R24A 4NBNA 5E4JA 2I5PO 1VIYA 2H92A 3GELA 4M9QA 4D8WA 2YZMA 3K16A 2BM1A 1XFDA 1XKTA 1FUKA 4L6AA 5KPJA 1CR1A 1S3GA 3GP3A 1AHIA 1DRJA 3AY7A 2EZ9A 3I6IA 3R0JA 4NECA 1YKFA 4PQGA 4GPD1 1A7JA 2EZ4A 3VR6H 1QMPA 1W94A 2VUIB 4ETMA 1EWYA 5L7TA 2R25B 3Q8MA 1QVAA 4CEIB 4PM4A 1GYPA 5BWNA 5CDTA 3IEXA 1IVYA 2VF8A 1Y6GA 1NU6A 2XNDA 5K0LA 1ZGGA 4DLBA 5FI1B 1PV2A 5J2TB 1EZZA 3VV2A 1G5RA 1XVVA 4WECA 3H17A 1ZGHA 2WB4A 1JQ3A 1SCJA 4G4IA 4NOMA 1JTFA 3KQUA 2RJNA 3GAZA 1RQGA 1FDSA 3Q7RA 4WN3A 2O5RA 3S55A 4F2DA 2O1WA 4IQ8A 3A4LA 1FNDA 3L0SA 2A9PA 5BSTA 5LP6F 1YRQA 1HQDA 2QVLA 3QUSA 5GIPE 3WWYA 2F9LA 1C4OA 2OESA 3KU4A 5I7SA 1XTJA 2RB5A 4AY4A 4PG8A 2W42A 5TXGA 3E6AA 2C2WA 4X3OA 3A27A 1P39A 1RKVA 1TJPB 2PX2A 2FSUA 2VP0A 5LQUA 2QD3A 5BMVB 2CXNA 4JSRA 4D6XA 2XTAA 3ZC3A 2OQIA 5BSUA 3IVRA 1L8LA 2ACWA 4UM9D 5BNZA 2FPXA 5JI2E 2DRIA 2R86A 4YO8A 1UDBA 5DOZA 2Z57A 3URMA 3EULA 3M5WA 1VPEA 3LQ1A 1NJSA 4HZUB 2OT3B 4HVTA 1M7GA 4EVIA 2QD2A 3MG9A 3FKSD 3H7IA 2ZUWA 4GE3A 1K5GA 1UXJA 3Q11A 4IVQA 1ONNA 1GDDA 4IV8A 3N6XA 3WK8A 1NKVA 5JANA 4JFRA 1CS0A 3O0TA 2M6RA 2P4SA 5JISA 3HJGA 4A8JA 2FFJA 3BSWA 1DC7A 3PNOA 4LPKA 3O2NA 5KVVA 1BMFA 4KQGA 2IX3A 3SEFA 1WTAA 3C7CB 1YNSA 4XFKA 1ND5A 2K5UA 3L0PA 4MGYR 5K51A 3SK0A