1VCHA

Crystal structure of a phosphoribosyltransferase-related protein from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
168
Chain Sequence
ETYPITVGGVTRHVPLIEPLPGRRIPLVEFLGDPEFTRAAAEALRPLVPKEAEILFTTETSPIPLTHVLAEALGLPYVVARRRRRPYMEDPIIQEVQTEVLWLDRRFAEKLLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAVFRQGTPGLAVDTVAELPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoribosyltransferase-related protein
publication title Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 48
structure length 168
sequence length 174
chains with identical sequence B, C, D, E
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vchA00
1XZ8A 3NAGA 1QK3A 1P18A 1G9TA 1PZMA 2VFAA 1TC2A 1DBRA 4P80A 3GGCA 4M0PA 4RABA 1OREA 3ACCA 4MB6A 1L1QA 1NONA 3DEZA 3MJDA 4TWBA 3KB8A 4Z1OA 1Y0BA 2DY0A 3EFHA 1NULA 4P84A 4P82A 1STOA 1QCCA 4QYIA 1AO0A 1TC1A 3GEPA 4RHUA 2E55A 1HMPA 2PRYA 4PAWA 4JLSA 3ACBA 4KN6A 5HIAA 1XTUA 1ECGA 4RAOA 3GGJA 1A3CA 1P17A 2H08A 4X44A 4RV4A 1IBSA 5BQOA 3OHPA 1P19A 2PRZA 4M0KA 3OZFA 4F8EA 3ACDA 1I0LA 3MBIA 4JITA 4RHTA 4RQAA 4FYMA 4QRIA 1J7JA 4RAQA 2AEEA 1LH0A 2JI4A 1DKRA 3N2LA 1A96A 3S5JA 1U9ZA 1DQNA 1D6NA 5HKLA 1A95A 5KAMA 4OHCA 1OROA 4RANA 3LRTA 4LZNA 1JLSA 3M3HA 3O7MA 4LZOA 1FSGA 1UPFA 1U9YA 1XZNA 3LPNA 3QW4B 4P3KA 5IPFA 1QCDA 1ZN9A 2HCRA 1HGXA 1GPH1 1DQPA 4IJQA 1WD5A 2GEBA 2P1ZA 1ZN7A 1A4XA 4LZAA 5ESWA 1UPUA 3OZGA 4M0UA 4S2UA 5JSQA 2IGBA 1BD4A 1G2PA 2FXVA 2H07A 5EUCA 4RHXA 1ECBA 1BZYA 4P81A 4WN3A 1Z7GA 1I0IA 1L1RA 1YFZA 3HVUA 1QK4A 2EHJA 5BRNA 1CJBA 5K51A 2PS1A 3DAHA 4RADA 1XTVA 4LYYA 1V9SA 1QK5A 5BSKA 1OPRA 2H06A 4RACA 2XBUA 1ECJA 5KAPA 2YZKA 1I13A 1DKUA 5ESXA 1JLRA 4LYGA 4X45A 4ZFNA 5JV5A 1R3UA 3G6WA 4QYIB 1MZVA 1ECFA 1I14A 1VDMA 1UFRA 1XTTA 4PFQA 4P83A 4P86A 3H83A 1A98A 1GRVA 1ECCA 1O5OA 2JKZA 1VSTA 5E38A 3DMPA 5BQPA 1G2QA 2C4KA 1QB7A 4WMLA 4RQBA 5IAOA 1VCHA 1O57A 1QB8A 1ZN8A 1G9SA 2JBHA 1BD3A 2WNSA 1A97A 4RHYA 1P4AA 1W30A 1I5EA 2JKYA
chains in the Genus database with same CATH superfamily
1OJ7A 1T0UA 2FPPB 1OBOA 2LRHA 3EQ7A 3EIXA 3M6XA 1TK9A 1TUBB 4I19A 2C1EA 3ZOZA 4GBMA 4BGEA 2PIAA 2VTBB 3I1FA 4NX2A 5IM5A 1M1YA 3M1LA 3CZCA 4ZXFA 3RVMA 3SHTA 2X0JA 2Q21A 2EL7A 3WK4A 4DBVO 4ERNA 1NONA 5IJ0A 1Z7EA 1KZ7B 1NF8A 4BN5A 4JU8A 3GGDA 1N34B 3VH1A 3C3CA 3SDSA 5L3QB 1W88B 3G23A 4PQRA 1G21B 3N3BC 4LF6B 1AJEA 1UZAA 3ZI0A 1WPXA 2HJGA 3AVPA 1X7ZA 2GZDA 3GT4A 3L0PA 5E9QA 3W5JA 2FGKA 3CF4A 4MB0A 3F9IA 5ECWA 1P1JA 2XQGA 3PIDA 3ITEA 4HDQB 3U3ZA 4TZKA 4BJHB 2AW3A 3FI0A 3N76A 1J1UA 4OJNA 2Y27A 4MWBA 5FF9A 2RHBA 2P40A 4PSUA 4F11A 3ZWYA 3ENZA 3O4JA 1XZGA 1Q84A 4H1UA 1RQNA 3UHFA 1AKMA 1DKQA 1I0LA 2JLSA 1GCUA 3Q7QA 3CSSA 1VLVA 5JJIA 2VRCA 5D3MA 2A5GA 3C7AA 4OJQA 2WAAA 3HL0A 3KETA 2I67A 3M7IA 4YJHA 5ERYA 3KTOA 4HOYA 3T9DA 1OH7A 2R7AA 3KE8A 5KTTA 1Q1NA 3EVTA 5KSYA 1JQEA 4ONEA 4BN0A 1Y80A 1IVYA 1DL5A 2QEQA 3HBFA 2XKKA 3ZIUA 3MCUA 1X1AA 4OHKA 1CRQA 1DEXA 1YJXA 1Y5LA 5TEWA 5IPFA 2C3OA 1DRKA 4K3UA 2AUNA 2J41A 5PGMA 1DKLA 1TT5A 1Y5NA 3LRXA 1YRLA 3AI1A 2ZETA 3BS4A 3RTAA 4MLCA 5JDCC 4A82A 4LHYA 5C31A 4C4SA 3R3ZA 3OA2A 2Q27A 5EUCA 1P29A 2B8EA 3ZZ1A 2AHOA 5F23A 2R4QA 4R16A 3D4OA 1EEHA 1K08A 5HA5A 1EM8B 3WQHA 5EHNA 4BLWA 1N1GA 5LD2B 3EPPA 2JIOA 4ZQIA 2OCGA 4FTWA 2Q07A 3BX1A 5JQWA 3U4QB 2DY1A 1NJ6A 3ND6A 4EBBA 1G66A 4ZGGA 1H05A 5J43A 3DR5A 2GYUA 4GL2A 4WKCA 1UDAA 3P9NA 3N5KA 2G25A 1CB7A 5GZ6A 4KPYA 3GXBA 3CW9A 4C29A 2FPGA 1GSAA 2UYCA 4RSHA 1KEPA 2VUIB 3ZD6A 2XUAA 2RBEA 3OA0A 3PQFA 4F1KA 3P0EA 2GN1A 1M9NA 4R3UC 3ONWA 5TQVA 3TLMA 2BZ1A 1YBMA 2ZYSA 4P7BA 5H59A 4MRSA 1G5PA 1RWQA 4WDRA 1YRHA 5B58C 1U2EA 1DV2A 5AK5A 3CLSC 3D3WA 2HDNB 3H5NA 3C16C 2BGMA 1T24A 1MAWA 1P18A 3GLVA 1K7EB 1EFRD 1UBGA 2O57A 3N28A 4LJ8A 1Q0SA 3IMEA 3WKBA 5K0GA 4WNCA 2PRIA 1DV1A 2VPYA 5EIOA 2VDOB 1GOTA 1GZ7A 4PSVA 4RVCA 1LNZA 4RTPA 4W5OA 1UP7A 4HAZA 2IZ7A 3ZHBA 3CLRD 3FDXA 5B53A 3UG7A 1CX9B 4KK3A 5AQ1A 2H8KA 1G3UA 3TZQA 4M86A 3BZUA 2P2NA 3MHTA 3PEUA 4JB0A 5F12A 1EP3B 2VDNB 5B4VA 5IXJA 5TPZA 3G88A 3LC7O 5HMLA 4E08A 1JEDA 4OHUA 4HVCA 2C84A 3WFJA 3PZRA 4Q9JA 5KPDA 1Y7TA 4AKHA 3A2KA 5FPTA 3AZOA 4W5NA 2W6CX 1XTUA 2F8SA 4Q9IA 5A7FA 2P9YA 1UKAA 1E69A 2PFGA 4BY9E 3ILXA 1W1WA 1PW7A 1QV6A 5FBVB 3GNQA 3CLTD 3IBGA 3FUWA 4LNUB 3E22B 3GRUA 4K5QA 4QELA 5LB4A 3WGHA 5DGTA 2AFHB 2AJDA 1D3AA 4DC9A 1OYOA 1R9GA 2G72A 3WGUA 2ACKA 2DWQA 3UJPA 1KDVA 1A8IA 3GL9A 5FI3A 3FF4A 4QTTB 5ITSA 1SUIA 1LQUA 2ZWMA 3G2PA 1HTTA 4HMQA 1GGMA 4FCVA 3FXAA 4KNYA 2B94A 4ZT2A 3NGXA 1KBOA 5CA0B 5F9HA 2Q5QA 1MNAA 3BAFA 1Y9EA 2JBAB 3DL4A 2FEOA 3EXG1 3IOMA 3Q7PA 1N8TA 4P2BA 4ZAVA 1I5OA 3TTXA 3GJSA 3WLQA 2EZ9A 1WQ4A 4KXFB 2BKVA 2H1WA 3ND8A 3RU3A 4E5DA 1BCRB 2P3OA 3PHJA 4JOBA 1PS8A 5IDYA 1CBUA 2XNJA 2WHPB 1ZQ9A 1KI1A 2ZREA 3UC9A 3P0RA 1Q1GA 3LOUA 4HWOA 2AD5A 2QXUA 1LS6A 4K6KA 4WFQA 1N8SA 1A8SA 1RMYA 2G17A 1FJXA 2OFPA 1A9PA 1G8SA 3QQPA 4MS4B 3RREA 1H2XA 4QHYA 4RO0A 5ADUS 4OH1A 1LZLA 1D1TA 1EJBA 3NTXA 4B8ZA 1G5QA 1YKGA 1NRJB 2QU7A 1J70A 3N75A 5CFOA 1YD7A 2X76A 4J6EA 2UAGA 1FLVA 3DBHB 1F48A 3QVTA 5C5DA 4R4JA 5DWDA 1M1YB 2A0UA 3RJZA 3I5XA 1RWWA 1RU3A 4POAA 4QDUA 4AK9A 4B34A 4IHQA 2D3TA 1U6KA 3TKYA 2BFWA 5IJ0B 2P2YA 2C2ZA 5KNCD 1U0TA 2GNAA 4XYGA 5DOVA 5JAIA 3R0JA 4GUDA 4KFSA 3P5SA 1RP1A 5K20A 3G13A 1X7ZB 1OWLA 1SUWA 2QQ5A 3SS9X 3CR7A 3Q9SA 2Z08A 3H4MA 1C4OA 1RI3A 3Q12A 3QHQA 3G2HA 5TDHA 4ZDJA 1I4WA 4X41A 1NXXA 3TVYA 1BGWA 5TMPA 1U8XX 3Q41A 5ELXA 2FWNA 3E3OA 3EQZA 4O3MA 4JXJA 2W8ZA 2YWRA 3TM4A 1RKXA 1TZJA 1EU1A 5HGJA 1KFKB 2FJ0A 2FG7C 1Y8ZA 5LQUA 4BWGA 3TVDA 4RHYA 4KU4A 2C0QA 5HZHA 1XZ8A 1X1RA 1ZRMA 4E6PA 1SUEA 1TUEA 4DVJA 1IXRC 4RM2A 1QP4A 3ZOKA 3MCAA 1TCBA 3HNOA 1CUVA 2GZAA 1CKEA 2GJKA 3GMDA 4OD0A 4F97A 2PUCA 4OHWA 1OYVA 3ZGVA 3BRSA 2AQ8A 2OCKA 2CFOA 2R86A 2XI4A 2QM0A 3EBPA 3EBLA 1JTEA 2COKA 2CMDA 1WXEA 4N4AA 3U56A 1PGOA 4PLFA 1LQTA 4EY8A 1NW9B 1FFXA 2O8VA 4E32A 4XPZA 4M1TA 3WLHA 3E0XA 1M5UA 2OVFA 4U5QA 3CNBA 5G0VA 2DHQA 4CDNA 3DA8A 1TT5B 2NLOA 2TECE 1ADFA 2YY6A 2IU4A 1B1AA 4YJDA 3TUZC 4FIZA 2O5RA 2WIDA 2SHKA 2Y1OA 4EG6A 4DBLE 2YW9A 5LQNA 4RTMA 2WM8A 1THMA 3DYBA 2WV7A 2V4MA 3JZIA 5HBRA 4ZMBA 2RE8A 4FWIB 3ZQ6A 4P7JA 2C3MA 3ZJVA 4FYVA 2Z2XA 1J2EA 4H7DA 1FRFS 3GUCA 3T3MB 3TLXA 5A02A 3T3NA 3C5WP 1ESMA 3P0HA 3BD8A 2HSJA 3MBIA 3ME5A 5ALHA 3BWVA 1NR7A 1WEKA 3LPAA 2I8CA 2RGAA 1SQFA 4RAQA 4FJ1A 1LH0A 1OC2A 5GONF 4DREA 2O0JA 4ZODA 2I3AA 1E9EA 1HA3A 2JCGA 4NQRA 1CHDA 2R1VB 2ZVJA 3O9ZA 4B9AA 4EHAA 2FPWA 4X90A 3K9FC 1Z73A 2VC2B 5CDFA 4BEBA 2LCQA 1KPIA 3HJUA 2FPGB 4V39A 3K1AB 2Q3JA 2QLNA 4N40A 3UAWA 1FSGA 1GTL1 3PRKE 3W06A 3VHXB 1GNPA 3KR1A 1BXGA 3J7TA 3LPNA 4XIIA 1AHNA 2HJ9A 4KN9S 3WRVA 4DA9A 1PNOA 1U90A 1O0BA 1SRRA 3NAMA 5JDIA 3BEDA 1GYQA 5TJHA 2EOAA 2XE8A 4RPCA 1JA1A 1JILA 4B82A 3HN6A 3O93A 2V5AA 3DONA 4LX8A 5BSTA 1D9ZA 3ELWA 1WP4A 2P69A 1N8NA 3G9UA 5IN5A 1ZD2P 2Y1FA 1MAVA 1S02A 1ZI6A 4FGWA 3FGOA 2PT7A 4I08A 3TX6A 2VQEB 4YAJA 5AKLA 3V3TA 4TMTA 2CYAA 2V96A 3TVTA 5AKJA 3UOGA 4BVBA 1VE3A 2GTIA 3P19A 3S8EA 1MBZA 2PXAA 4A0FA 5CURA 3USZA 3L8HA 3MWLA 1YQXA 3IHWA 3ZHQA 5DEIA 3X0DA 4P32A 5IKEA 2C57A 3FTQA 5KZMB 4U00A 4E4TA 1TF7A 2H4FA 4ACAA 4HWPA 2CYCA 4BV8A 1KMNA 4C5CA 5LP1A 1KQFA 2WWHA 3HVIA 5FUBA 5CNMA 3K4PA 4AZTA 2LR0A 2AUTA 1GQFA 4JFAA 4BRSA 2BEJA 1PVOA 1FY2A 3KU4A 3LVQE 4FM9A 5U9CA 5AI6A 1N5JA 3DV0A 1FPQA 3AUKA 1Z06A 2LDBA 1LLUA 2BLLA 4JAVC 4MULA 5D7NA 3S0JA 4MYRA 2IV2X 1ORHA 4GSYA 1CUYA 1OFGA 4PG7A 5EXPA 2KM1A 3TLEA 3UFXA 1GZ4A 4K88A 5F33A 3FWKA 1AS0A 4X60A 3PXGA 3R8CA 3SM3A 1OASA 1ESCA 3NHMA 5IN4A 2PZ8A 3V4SA 3VNSA 3M6AA 3EG9B 1E5TA 1PNVA 4FT4A 4G0MA 4QLOA 8GPBA 1ECLA 1TXGA 1Q7CA 1VHQA 2RMKA 1TZ2A 2XTZA 3OO0A 4HEQA 4RFVA 2CC2A 3WYFA 1EP9A 1DFGA 1A9RA 4UM8B 1U7ZA 3OECA 5K2OA 2ZXEA 3IDZA 1LBTA 2XYQA 1E3SA 5D8DA 3MGCA 3ND7A 4JVMA 3QMPA 3EGDA 3PYXA 4H6WA 2NYRA 1TYZA 2V0CA 1XYGA 3BWEA 4DR6B 3G9ZA 2ZYRA 4I99A 3PX2A 2NZ2A 3MCZA 2V1UA 2Q3CA 2RGXA 4TWRA 1UJ5A 4O4IF 1E1KA 1IAQA 1LK7A 3E53A 5EQTA 1KIMA 3PD7A 4GM1A 3ODGA 5DLYA 2EAUA 2F1KA 5JI2E 2DFKB 1J2UA 3J7AC 4QD3A 2V03A 2J0UA 2Z09A 3HJAA 2VF7A 2FW0A 1A77A 3L7CA 4PPGA 5CFPA 1G18A 1EXVA 3H86A 1UXGA 1MOZA 3CWCA 3QE3A 2A67A 3AEZA 4XGIA 1NVUQ 2RAVA 3F3YA 4BVEA 1UPCA 3I32A 3K70C 4F84A 1KOFA 2OECA 4IVRA 5CM9C 1XXHA 2B0JA 4N3GA 3UJ8A 5CDUA 3BWMA 3MWEB 2UUCB 2ZJBA 2ZIUB 1KKUA 3O7MA 2B82A 1E9SA 2OOSA 4BBZA 1AK1A 1CUXA 2BF7A 4P0TA 1OZHA 5E4TA 4CFSA 3T3HA 3GCZA 2WAMA 3MWYW 2UZAA 3BWBA 4J43A 3CU5A 3BRWA 4R5MA 3ILVA 1KH2A 4W9NC 3SF0A 1M83A 4D3XA 4ZICA 1SBQA 1NI3A 3PUIA 2QP9X 4QBKA 3IEMA 1O95A 1XE3A 4L02A 1I6LA 3C3YA 5BRNA 1XZPA 4M88A 1IPEA 2EC5A 2OGUA 4QXOA 4BLVA 4F6RB 1NG9A 2UZIR 4BLTA 1NBWB 2WKWA 3BFVA 2QWXA 1ZVMA 3C3MA 1L2TA 2AK3A 2XOEA 2QE6A 3AC0A 3PBKA 2DPGA 4HGNA 1HURA 4TMXA 4Z9BA 3O8NA 4HB0A 4QEDA 2O7RA 2V0NA 2PUEA 1BXZA 1D4OA 1WXQA 2RGCA 1LRJA 1FFXB 1IN5A 3ICPA 1F14A 1RLJA 3C8ZA 4M7PA 3V4OA 1PV1A 4AWAA 1TYBE 4ND8A 4B3MB 2IYYA 4Q1FA 1Z63A 5FLXA 3CE9A 2R0QC 3COVA 3WB0A 3BHJA 1OXSC 4P08A 1TKCA 2I7TA 4LXHA 1ZUD1 2BFAA 2JFWA 1W46A 2PAFA 5BURA 4QQRA 2VUSA 5JDCA 2GPTA 3WLPA 2VBFA 2QL6A 3REOA 1KDOA 2J46A 4NJMA 3RIYA 1NVVQ 1LBIA 1ZSVA 3FPHA 5J1SB 4KI7A 1ZUHA 3TUJC 1U8FO 1G63A 2X1MA 3RS9A 2QVXX 1Q12A 5FPKA 2VF8A 4CMKA 1N1DA 4ZMRA 2GARA 1KOLA 2Y76A 1J49A 3U4IA 1MVOA 1TEXA 1KJYA 5IRCD 3DEAA 4W1RA 1SKUA 2HSWA 2Z1DA 3B6KA 1HBJA 3I83A 3OLQA 4BPRA 1U8EA 3WFIA 4CCSA 5LBUA 1OI2A 2HQRA 2VUTA 4BJ1A 3TQRA 1CVIA 2IBTA 2I4IA 5DNAA 2CHVA 2IDJA 3DVRX 3V6MA 4ENUA 5JFTA 1D2NA 1LPPA 3O4FA 1XTQA 1U9CA 1I3MA 3GVHA 4PAWA 1QQ7A 1CF4A 1N6NA 1QVZA 1YR1A 1J99A 4KBGA 3SLKA 5HJ5A 3KJXA 4O4JA 5KX5F 3GFPA 4R8LA 4CETA 1Y1TA 1QDLB 2Q3BA 3A3NA 4RGYA 2FUG6 5DPMA 4B76A 3KKOA 4PTZA 4EB3A 5K8JB 4CDGA 4GVLA 2EVWX 2J6IA 3FDFA 1FBNA 2FQQA 2ATIA 2CVFA 4B09A 4WCFA 2CUZA 2PBFA 1YTLA 5DYWA 2DU8A 2HCTA 4YPFA 4DWVA 1LWOA 1BIFA 2ZXFA 1M2OB 1G2OA 2Q4BA 3H0EA 3U3KA 1SC1A 5LLTA 3R7DA 1UC8A 3W3AH 2HFKA 1NVBA 3S8YA 5CGZA 2NUBA 1D1QA 1FDIA 3PVSA 5EXEA 5BNWA 2VJQA 1A8QA 1O6ZA 3BF8A 4X65B 3V00A 3PLNA 1ZJJA 3IDSA 4AX8A 1NSFA 3PF9A 1F2VA 1P6UA 2GJ9A 4IIJA 1OSNA 2BEVA 4WVLA 2FI1A 3E3AA 1P3DA 2PWAA 3FYHA 3GO4A 4I1VA 4FQ5A 1J22A 4M6WB 3QKIA 4ZJUA 4HQOA 5CD9A 1RZRA 1KO1A 4LBVA 2V5VA 1IEQA 1JIJA 2W5UA 3NBAA 4WDQA 1A04A 1JXQA 1N4DA 1VQ1A 2POQX 3RSGA 4D9FA 4DCMA 4DTIA 4DQKA 5B30A 1BA2A 3DCJA 2A4MA 3K16A 5M29A 3WRYC 1EFVA 2GHRA 2HR1A 3HKDA 3BGWA 1E60A 2J33A 1UQTA 1JS1X 4OXNA 3IT1A 1C3OA 1BXKA 1FCJA 1T2FA 2BELA 2YV5A 3CEMA 3LGSA 3MWDB 2F9MA 3COYA 4ZQEA 3C8MA 1SUSA 5CVJA 3PD1A 2OHXA 3DAOA 1WZNA 3UFXB 4ZI2A 3BDIA 4MKHA 2KJQA 4EGCB 3DT6A 3CNEA 1QWSA 5FTKA 5FWDA 1VKOA 2X7JA 3A2LA 2WM9B 3GFGA 3QEMA 1Y4SA 4JBIA 3ZWVA 1L5RA 2WU4A 1M6NA 2ZJ5A 3B9BA 4KQIA 1TYEB 4QO8A 3PQ7A 5JSHA 4DLSA 2MSWA 1OR8A 4QPDA 4MTCA 2PTGA 4HNRA 4FGLA 3MQ2A 3VOAA 1T2DA 1VKZA 4KGDA 1A2QA 1R3UA 3CHYA 2G67A 2PA3A 3K9CA 1ZHOA 3WQQA 1CUWA 4G1VA 4HEHA 3EXEB 4IDNA 4PO1A 3EGDB 3V5NA 5SZHB 2DFPA 4C03A 4LVCA 2V55B 2B7BA 3L8FA 1DU4A 2EATA 3CPEA 3HZRA 3WSTA 1XF9A 5AJTA 1IPHA 2C59A 3DOJA 3AB7A 1YACA 4BV3A 1YSCA 2FDXA 5CNIA 4GMHA 3IILA 3WWZA 2EBUA 3ZNOA 4QXMA 1LI5A 1ZCFA 1W5AA 1W29A 1H2BA 1XO1A 5FTWA 3CVWA 3C7KA 4DHWA 3DD5A 1I1OA 2FFBA 3PEFA 1QRDA 4XW2A 5L4SA 2SKCA 2UUAB 4AKTA 5H5JA 1OLUA 3Q0IA 2IE0A 3MC1A 1D04A 2DHRA 1XQWA 1XTZA 2ORWA 1ZD8A 4PFJA 4E12A 1IUPA 5L6MB 5K0JA 4FT2A 4MB6A 4YRGA 1PJCA 1TEZA 4K9DA 4TN1A 3ZNPA 2WJJA 1Y3DE 2PGDA 4QDOA 1ZS9A 1W4ZA 4YJFB 2CDRA 3R0IA 2F3UA 2PAAA 2XHEA 5AHOA 5HTKA 2WQ6A 1WUKS 4LYDA 1UMKA 1WF6A 2BISA 3VO2A 1KSFX 2VP9A 4NZYA 1Q0LA 1NT2A 1XHFA 1RNLA 2AXQA 1UR5A 2ZRHA 5EWMA 2A9OA 4UULA 5ER9A 1VMIA 1V9CA 5GIPE 2PLNA 1EK2A 1ZOPA 1TZMA 1XJ5A 1THTA 1ZSNA 3IIJA 4P33A 2WWTA 2KSQA 3BBLA 1L0BA 3ASYA 3MFYA 4QGSA 3UBTA 3H1GA 1I10A 2JC3A 1L7QA 2H1VA 3A9UA 4GPEA 3BREA 3OFJA 1DO0A 1EH5A 2C8KA 4US2R 1OH8A 2OOKA 3B60A 1ZIXA 3WBJA 3QJ5A 2YHAA 1BWPA 2NXNA 1U2RA 3CW8X 2BHLA 3TSCA 4H7JA 3TI7A 5LOVA 2EW8A 4S05A 1RYEA 3RYFA 1XB2A 4BQFA 2IXEA 4M4SA 2ZRCA 2CUKA 4U8GA 2J7PA 1OKKD 1T1IA 8ATCA 4IJMA 2WUFA 3H13A 1NMYA 4J0EA 1GQOA 4B85A 3IDOA 4PSDA 1R9JA 3AI7A 4A03A 4J2HA 1S4QA 3UJNA 4I46A 4YV7A 4GM0A 4KB5A 4EKNB 5FTLA 1NR5A 2ZRPA 4YJ3F 2VF2A 1FRZA 5ES3A 3B85A 3FMGA 3P20A 4PZYA 4CLXA 2NXWA 3ORSA 4IOMA 4C7JA 2XADA 4IOLA 4QUHA 3IHKA 4NJMB 2H8GA 1EG7A 1SWWA 5CR9A 3W3AD 1VP3A 4D9GA 4L27A 2W42A 4GIBA 2WT4A 3RVLA 1QR2A 4BAZA 4IWXA 1DJNA 2I2FA 1DKPA 1E89A 1GUZA 4YIHA 2AL7A 3LRPA 3GNTA 2XHZA 2E5FA 1H9BA 3SYRA 1L3BA 3NVAA 2DAPA 4FFDA 3CLUC 2QGFA 5B3JA 4BFYA 2NVWA 3OQOA 2OHGA 1NXWA 5JSYA 3SDZA 4NFLA 1KU0A 4B80A 2J30A 2BJVA 2O06A 4H0NA 2B4RO 2VLBA 3T3IA 4CCAA 1J56A 3I64A 3TMYA 1EDOA 2JJ2A 2OZVA 2JGAA 2WIAA 3DS8A 2H29A 2QPTA 4JVLA 1KWKA 5IAAA 3TJMA 1KVQA 1R4AA 2A86A 2FW9A 4DSUA 1HWYA 3RRMA 1X1DA 3L6BA 2FFAA 2EJBA 5EHIA 2ZUUA 1LDGA 3RUIA 1L9XA 4WAUA 3RVRA 1HUQA 4GOLD 2DQKA 3S5UA 1CY8A 1QVWA 1X1EA 1ZGZA 2C61A 2PUHA 4O4JB 4XEHA 3ZDFA 4URXR 3RV3A 4MV5A 2YX1A 4J49A 1XALA 2HIHA 4X7RA 1CT9A 4RVSA 4ZCQA 1CP2A 1S3FA 3MBOA 5SICE 1O57A 1EXNA 4CIVA 2GNPA 4JI8B 4WCFB 2X7HA 4WE3A 5IKXA 3C8HA 4H4DA 2FWRA 2NO6A 2BVNA 1U63A 4QOIA 2DVMA 1WP9A 1OAOC 3UMJA 2XJ9A 2WM3A 4IYJA 4EZIA 5E3HA 3KYIB 1CR2A 2HK7A 4TRJA 3SLRA 4B3XA 5IJ9A 3P2JA 1E7QA 2VK4A 3EX7C 1MT0A 1NURA 2OYSA 1E2FA 4GG1A 2HHCA 1ODKA 4D9EA 1WETA 1C0KA 1E1LA 1XA3A 2QN6A 3BD6A 4K9MA 1WY7A 2JIPA 4IIJB 1E99A 3BMQA 5TGDA 2GX6A 3G9XA 2OWEA 2G5GX 1Y1LA 2B0CA 2QPAA 9ABPA 1NMZA 4N01A 3I2JA 4HNHA 4JJAA 5A04A 3MF4A 3O26A 1C50A 3ITDA 3CEHA 1PEKE 4CQMA 2YWDA 1KIAA 2J4DA 3JX9A 5HNKA 5EESA 1YNOA 3FOWA 2JHCA 5CFLA 3ELUA 2YW2A 3HKDB 1BYUA 4V02A 2F67A 4M46A 3EXHA 4WXYB 4B6OA 1C3OB 2WD9A 1N5KA 2FR0A 4EW1A 1HE5A 4G5OA 4I2VA 1M1YE 1XZAA 2W4MA 3OLYA 3ONDA 1VI2A 2HRQA 2PKCA 2W58A 3SC6A 3TM5A 3VSAA 4B83A 3H0KA 2JRLA 2I78A 3EW7A 4TKUA 3FDZB 1B73A 5JHGB 3CB4A 2YS7A 2CLSA 5H0IA 3UJAA 3QEMB 3ADKA 1UJBA 3FNGA 1NTRA 4DCGA 1JAXA 4DLKA 3W2GA 3GI1A 3NANA 4TLMB 2IYEA 2Z8ZA 3AWDA 3T5TA 4RTQA 2JLUA 1I01A 3LC2O 4GP7A 4EHLA 2IXGA 2AKEA 1ODJA 2FOXA 1JHQA 3V1MA 1AV6A 4OO3A 3SWWA 2P35A 4AQYB 2IP1A 1PDOA 2O2IA 4LZOA 3JVDA 4DGQA 2BE9A 1ELOA 2CJWB 2QLMA 3A1FA 2NNLD 2CL7X 4ZK2A 5IU6A 1AQNA 3I3OA 1KFEB 2WYWA 4NBVA 1JDSA 4ZYTA 1DXOA 1OZFA 2QI9F 1K92A 3VPCA 2Q3DA 3EA4A 1DDOA 1WOMA 3PFIA 4C3OB 1Y3IA 2C4WA 5K03A 1KORA 4P0PB 4OOEA 5AM3A 3PC4A 4EF5A 3D2AA 3T61A 3T7RA 2JEZA 1XRRA 3ZZ0A 1HQYE 3COJA 3AWIA 4XIGS 4ZQHA 3ZE8A 3R7LA 2P2LA 3PC2A 1DZIA 3BRCA 2VA9A 1NXTA 3K53A 3NQ41 5BVHA 2IHBA 2O2ZA 5A6SA 1LDEA 1WMDA 1ACMA 1BKSB 2DEUA 2PEYA 3LYLA 4G65A 1P6XA 3T7AA 5I5GA 1RAAA 2PEZA 5KTMA 1IN1A 4BU0A 3DEIA 3T06B 3NTQA 3K35A 5IW8A 2FU5C 4NU5A 1GQ2A 1GYRA 3JS5A 4FFRA 4I1SA 3ZEAA 1E6CA 2DHEA 2OBLA 5EWMB 4URFA 3L4JA 2X7XA 3LGAA 1UBTS 3O8QA 2XRZA 2PUFA 2QRGA 1AURA 3H2BA 3DMPA 2H5LA 4G63A 4KC0A 1S3GA 4HG2A 3SC4A 4PLWA 4D4IA 2WB4A 1NIJA 1LNSA 2YVUA 3DWFA 3EN0A 4YONB 2QP4A 3CC8A 4E11A 1ODSA 1JB9A 3LNCA 1H69A 2QPOA 1GFIA 1XMXA 2VAPA 3ABIA 1KH1A 2BMDA 4AMYA 5LOVB 5THKA 5L3VA 4IDBA 3RYFB 5IKMA 3PJEA 3IP1A 3B3JA 2C83A 1MOPA 2OSVA 2YASA 2GCOB 3DT9A 5ENZA 1MV8A 4N0PA 4UTRA 4BP3A 3L6OO 3O8DA 1Q5PA 2VDQB 2H1OA 1USWA 4KRGA 4CDMA 1BXRB 1JFVA 2AFVA 2F1HA 2VXYA 5AICA 5FUWA 4AXXA 2ZBVA 4DBZA 2E7ZA 2XMRA 3DOIA 4G26A 2GK4A 2HHAA 3LP5A 4PU0A 5EJ2A 3RAGA 4DWWA 4DCVA 4D57A 1TFUA 3L7NA 1JHMA 4C4OA 1DLJA 5ALTA 1PE0A 2VAVA 3AR4A 4HI0E 4YAWA 3ZR4B 2E4AA 1FS4A 1F8XA 2ORVA 1J2JA 2XUOA 3GGJA 4MUNA 1N3BA 1ZO8A 2PZJA 3MRVA 3MCVA 1GAXA 1JI3A 4UQOA 3GCGA 3AJ9A 4QG3A 1TRKA 3DAGA 2XCIA 3OKFA 3RYTC 1R0XA 1FSFA 2JIBA 1CIPA 3FG9A 4KAXA 4U5XA 4UXJA 1PUIA 2TRSB 3UHJA 3VHRA 4P92A 4JQCA 3WISA 4OLBA 2NYUA 4MUJA 5EE5B 1AKWA 1R0CA 3WBFA 3CWQA 1OU0A 4JGIA 1TD9A 1Z0SA 4LQLA 3S5JA 4U9HS 2XCUA 4IOKA 4G4SO 5TQJA 3TSAA 5CITA 4DKJA 1VPDA 4BMOB 3QELA 1YOVA 2NTJA 2DBYA 2NNWB 4HWGA 1NVXQ 1D4FA 1WWKA 1Q2XA 3BL8A 2ZR9A 3WLRA 4EO7A 4XGRA 4RD6A 4D9BA 2P30A 4QUEA 2J3KA 2RBGA 2V9ZA 1B0UA 4BQIA 3E8MA 3QEJA 3PQ3A 3HKCB 1U6IA 3L2OB 5JFGA 2Z57A 1CJVC 3D8NA 3JSAA 4K81B 3EZ6A 5IJ9B 1E3MA 4Q3AA 2GT1A 4OI4A 5AM4A 1UIRA 1ZGGA 1NRXA 1IULA 3BL6A 4D3DA 4YX9A 3E9NA 4LS3A 5ALIA 1OPRA 3MVEA 5DXFA 5EUQB 4YCDA 1HDOA 4AN1A 4F45A 4Z54A 4R1UA 3BMQB 3QTTA 4E70A 4ZZ1A 1P4SA 1E3EA 1Y48E 3TOSA 1M10A 2ZYHA 1L4FA 4LY9A 2F3RA 4Z0NA 3IHLA 4E30A 3SGLA 1MX3A 1QGUA 1SC4A 1HFJA 1LGYA 1VDMA 2MHCA 5CT8A 2J4CA 5D01A 2C98A 4KAFA 1Z2EA 4EPTA 5AVWA 3C5CA 4CQMB 1WZUA 5B58T 1KI2A 2L42A 3WLTA 5F4BA 2WWIA 5FOXA 1MJ5A 1P1BA 3EXHB 1DKMA 4WNYA 5KSPA 3X1KA 4QAJA 1T9DA 4HZIA 5DBEX 3ZZTA 4F06A 1ZR4A 1SXJC 3EF3A 4LWQA 2VSNA 2VYVA 3RSQA 1T8YA 3I2GA 1E92A 1I4LD 3HR8A 5HPYB 1PHRA 4YP1A 5E2BA 1LU9A 2QTMA 5F7OA 4TKUB 5DU2A 3ECCA 2LNDA 5JISA 4DUYB 2AR0A 2XRFA 4XIFA 1I5EA 3I9OA 3DEFA 2W98A 3RKSA 2H18A 3EOBI 5KYWA 4XAQA 2O0MA 1YGPA 2P7HA 4EA9A 5MF6A 5T4HA 1K4KA 1DBRA 3H5LA 1CRWG 2Z2IA 3W2TA 3DFUA 1N25A 5DP1A 3LJKA 1HI9A 2ADFA 4MI1A 2JH3A 4YB8A 1UPAA 2MOKA 3WIDA 2NZUG 2W00A 1QIGA 4Q1EA 4Z5XA 1BE1A 5B1YA 3A6PC 1R1DA 2I7DA 4CM9A 3E27A 1Z0UA 1J5XA 3HXTA 4B35A 1Q95A 2X0NA 3MM4A 3D8UA 3OT1A 4G1MB 5GOZA 1I7SB 4NS1A 2F3PA 2RKBA 4GQBA 5CEJA 1EFKA 2WDPA 3HGQA 3PTAA 3HE3A 3WLSA 4IIEA 3L7KA 2QENA 3LBIA 1C29B 5KNBA 1FVHA 4TS1A 1SZCA 4CKCA 3UZUA 1FFGA 2GZMA 2XCTB 2ST1A 1E1YA 3Q7RA 4O02B 1VB5A 4AZSA 1GLNA 2JG3A 1LDMA 4M1YA 2HF2A 3R6DA 1ODFA 3G9QA 5JZ9A 1YR2A 3HI6A 2FSFA 3VC1A 1FVXA 2WINI 3WP0A 4G9BA 2G06A 3KX2A 3FNRA 3HO8A 2W83A 3I76A 4Q66C 3F6SA 4P38A 4YJKA 4EW2A 4ZYLA 3FKQA 4TLDA 2CT8A 1E3WA 3SZUA 5CFQA 1OE0A 2UYOA 3U6BA 5A6SB 1S0UA 3QU4A 1BX1A 3O8OA 1YVEI 3IBTA 2QN8A 5FUXA 3ZKWA 3T1VA 3JQAA 1CUCA 4MYHA 1CJTC 1KPGA 3AY3A 2ZEJA 3AR9A 2C7QA 4M0FA 2X2FA 1EIZA 3DM9B 2ZIGA 4WCDA 1EFAA 1QTNA 3LLVA 3OX1A 1E2NA 1O97C 2WUDA 2Y0EA 2V7QD 4IGFA 4DJAA 4EY4A 4FBLA 3AQ4A 4QOSA 2XNCA 3O8QB 3OE4A 5E6RA 5GGYA 3VZBA 5HKOA 1N3IA 3LSTA 2HMAA 2BFFA 3FYUC 3UUFA 3Q7TA 2H4ZA 4F56A 4YAOA 3EB9A 3TIFA 4EGAA 2I91A 4KO3S 1O08A 1XFAA 1T36A 4KXUA 3CVUA 1M3SA 4S2UA 4TL6A 1P9LA 1O03A 1UM9A 2Q6LA 2ZAIA 1IHXA 1SUPA 1P7WA 1SA0B 5BQ3A 4HLDA 1PCXA 3B51X 2QRQA 3CXRA 3P9RA 4GZ5A 1RYBA 4LHEA 1RHUA 4AUNA 1MIHA 4X24A 3DDWA 5CDFE 4QECA 4OVKA 3R24A 4YRDA 4Q4DA 4BLUA 2HD4A 4QO7A 2Q5EA 4ICIA 5TMDA 4PICA 1GFSA 5SYNA 1G8YA 2I65A 4OMUA 1DBSA 2WJ3A 5COBA 1B2RA 3NBFA 1IC6A 2JVJA 3S2GA 3DKVA 4XCQA 3U4HA 1N2BA 4AYXA 2ENUA 1GFWA 6GPBA 3QEBZ 3K73O 4G0PA 4ZEMA 2QUKA 4HXEB 5CDSA 4WLEA 3C5EA 4LYEA 5FCDA 1P77A 4I4TB 4ZU6X 2Z3VA 3ZIAA 1QYDA 4TL7A 2ZI9A 4Y9UA 4DDHA 3HA5A 2FN9A 5REQA 4EF6A 5AI4A 4QFDA 1JKXA 1SHUX 4DUGA 2ECPA 1THGA 3VOTA 1KOGA 3ZE2B 3L8DA 2NN3C 4RQBA 5IAOA 1NVTA 4IUCS 4MWSA 1DB3A 4NATA 2RHGB 3IKVA 1GU7A 5AKEA 4EUSA 4PX5A 3HWSA 1HLPA 4PGAA 4RGQA 3OCJA 1SIUA 3JQEA 2QY6A 3SEQA 2A9QA 1G9TA 2I4RA 3DD1A 5DHTA 1MOQA 2E4WA 3AM4A 4JI7B 1GNRA 3GGOA 3SI7A 1E3JA 3EFEA 2X0KA 3OBIA 2IY9A 4CKWA 4FIDA 1EXWA 1VLJA 4R8VA 1UC4B 1L8OA 5H83A 3RKRA 4CLHA 1E6LA 5DN6A 3L8ZA 3QELB 4JKYA 3FPSA 2WD8A 3V8PA 3ZD7A 2KX7A 3ANMA 3HQ4O 1E5XA 4OFBA 1ACLA 1Q6ZA 4HJRA 1K8YB 4OUKX 3Q3CA 5B64A 1BEUB 1PD1A 1E6KA 2GD1O 4FP9A 3QPWA 3EAFA 4IKPA 1TA9A 4HXFB 2NVOA 4L16A 9LDBA 1SQ6A 3BJRA 4AXBA 1N2CB 1U7PA 2G08A 3ROEA 5C8DA 2B69A 1H0HA 4DRYA 3AKDA 3DB2A 3QIAA 4EKIA 1IDOA 4PFSA 4F7WA 1OAOA 2R6DA 2XA2A 2YRWA 3P9YA 1JE0A 3JQ7A 1T2NA 1DINA 4J0HA 3WRXC 4LV6A 3KB6A 5DJ5A 3SX4A 4EHKA 1OVMA 2OFXA 1U3DA 3AERA 2XUFA 1ZGAA 1TPZA 2X22A 3GLFB 2WHQA 1OBVA 5C34B 4V2IA 3W05A 3QKTA 3DKIA 4WNIA 1J6UA 2HB6A 3WSVA 2HZBA 2P0AA 1PEDA 2GXSA 3BT7A 1CJSA 1QGUB 3CYFA 3KQMA 4AP6A 2QPLA 1HYEA 2J32A 5CA1A 4E2FA 4BNGA 5GJVC 4PIVA 3VC2A 3DCNA 1UPFA 1TYAE 1W9HA 3IR6A 4JX9A 4O4LF 4GPTA 3TSOA 3QVGA 1L5ZA 3WNCA 3ZHCA 2WYHA 4Z3OA 3SFVA 4NMLA 2IFTA 1LSUA 2VK8A 1NYQA 2BL4A 2WMNB 3CWZA 1JEEA 1FLDA 3NAZA 4QYTA 3RSHA 4EEKA 4ZIRA 4RS4A 3L7BA 3L6UA 5HOEA 4I9NA 1QDEA 5CGQB 2B4KA 3TD6A 3AUJB 3EEOA 1WVIA 4EY7A 1H2AS 1YQQA 1P1RA 2I9PA 5KYWB 1U2PA 6AT1A 5IJWA 5DW3A 3BFXA 1XXHE 4CI0B 4YAUA 5EWJA 3HYRA 4HVTA 1CQIB 1DXHA 1FNMA 2SECE 2CL0X 3DLAA 3E8SA 4NZZA 2K2WA 3G1UA 2H06A 4D9NA 1QDUA 4DMHA 4RVOA 3CF4G 4GOOD 4RELA 3RJMA 1EIWA 4R54A 3CEAA 3BSFA 1E4EA 3AT1A 4YRQA 4JQSA 1XMQB 3OT1B 4XDGA 2XXAA 2BSQA 1ZRSA 4O4LA 5AUNB 3I04M 5KPJA 4IUBS 4MMYB 2BM0A 1W0JA 2VBCA 3H83A 4CMHA 3RIHA 4XWTA 2EBHX 2VSQA 1NLMA 4WBNF 3URKA 2CHQA 2WTEA 2D2XA 3W77A 3LH5A 4HDKA 5C35A 3DDUA 3U1BA 2CD7A 1RJGA 1PTKA 4Q24A 4Y98A 2QVCA 1UPXA 3C24A 3W6OA 4AC9A 4G0UA 4DVGA 1L5OA 1GP2A 3CZ4A 1ZUWA 1CLEA 3NOQA 4LE1A 2GFIA 3U19A 2CZCA 1QTQA 4AIRA 5I6DA 1QH8A 2GA8A 1E5VA 1PFWA 2QB5A 1E3WB 5LP6C 2XF8A 3CUYA 1PFQA 3FCOA 3UPUA 2W6PA 2Y77A 3A3OA 4YMGA 3AG5A 1KZGB 3O8OB 4S12A 4BQNA 2Z04A 4ZO9A 3ZKWB 1GY8A 1OREA 2XB6A 1VXOA 1AZTA 2Z8YM 3JQAB 1E9AA 1PX0A 3K05A 1M1UA 1DDIA 4K40A 1RPTA 4KOAA 4MA5A 4HUQA 1Z5NA 3HU2A 3BMNB 1N1MA 2VDWA 4ZJZA 3IQEA 3KK0A 5FBQB 3QYFA 2UVDA 5AUQA 4RM3A 3FZQA 5E6RB 3RYHA 1JLMA 4P5EA 5E9WA 4CM6A 3U40A 4TS9A 5LJIA 1HRKA 3DZBA 2BFFB 1KAQA 1M2GA 3HCWA 3NW9A 5BNFA 1PL8A 4XKJA 5ALYA 2ZQYA 1UT6A 3AJRA 1JR2A 2LVBA 1Z2DA 3ESXA 4PPYA 1C1YA 5JR3A 2C9MA 1T36B 3G8AA 4EELA 2P7IA 1RAEA 3KT8A 3KOYA 1Q0HA 1WB4A 5D86A 1UM9B 1NYLA 1KA9H 4XH9B 5KS2A 4NCIA 3W7VA 1IEVA 1HDIA 1ORWA 5D51S 2UU9B 5CRIA 5EP1A 2Y1KA 2PVPA 4KX5A 2A3NA 4M99A 4DNFA 9MHTA 2Q6IA 3INTA 4BKQA 4CKCB 1LA2A 2R6GA 2GPSA 3WLFA 3IUNA 4Y30A 3UGQA 1CS0A 1U0GA 2ZE7A 3JYHA 3GFFA 2YS6A 4ZVPA 3RUEA 5A9RA 1NKVA 3IKMB 2X41A 3OG9A 1M8FA 4PCLA 3EIFA 4H6PA 5DK6A 4E5UA 1CK4A 3GRAA 3AP2A 2AXNA 4OLHA 1IK4A 4QICA 4R5HA 1J7KA 1HSOA 1JP7A 3AY0A 3IA2A 3EZGA 2NAFA 5IAGA 1J8VA 5KTOA 4DV4B 2V7PA 2ZTUA 1CY2A 1K7SN 4H1HA 3ULKA 5BRJA 3M3HA 5I01A 1ZVJA 5REQB 5JBNA 2FW8A 5BRAA 2Z1NA 2AFIA 4PBSA 2GPNA 2YXBA 3LY8A 4U0KA 1S2NA 4GKAA 4FLEA 5JNUA 3BA1A 3BSYA 3IPXA 2O7VA 4BLSA 1JQKA 1PIWA 1CNEA 2QORA 2W6OA 4ZT7A 1O6GA 1WS6A 3I4FA 4DXHA 1C2TA 1V8OA 1VI6A 1P0CA 2GVDC 4FGJA 4Z4CA 1QRSA 1I7PA 1X38A 2JVKA 1DAHA 4HNVA 5EKDA 3R44A 4OJYA 1QIHA 2IPLA 2P11A 1SBYA 1ZX1A 2Q4OA 3CLTC 4WN3A 3N0TA 1DARA 1PU2A 1X8LA 2R9VA 3BSSA 1II9A 2R62A 2XMBA 4IW3B 4PHCA 3EIEA 4YAEA 1SB8A 1BMDA 3O4HA 1K0UA 3N87A 4J9VA 5MFZA 4KCGA 3WGKA 2ZRFA 1N75A 2DUNA 2D7CA 3KOUA 1DUSA 3Q9UA 4GOND 4HQ0A 2CWDA 1E2IA 4LOLA 1FYDA 3T54A 1PZNA 3IQZA 1GDDA 4BNKA 2HK6A 4C2BA 1A4IA 1J8YF 4DMKA 3NBQA 5KMGA 2CLIB 2GUWA 3C7CB 2C2HA 3FMFA 3KQVA 2YXEA 3QPAA 3FPAA 1LB1B 3N07A 4LF5B 1BHJA 4BO1A 2HSGA 2B8TA 2E18A 4M49A 4MKIA 2XIQA 4H08A 5DTIA 1KK0A 4ZXPA 2TYSB 5B1HA 5ILGA 4A8JA 3W2IA 3E2PA 1C9DB 1NRIA 1G2QA 1PK8A 2E5WA 1BHSA 1NY5A 2NPIA 3JASA 3JPWA 4KMOA 2GDJA 5KVQA 4ZI7B 2C2YA 4KJXA 3GLFA 3O73A 3W04A 1VLZA 1JV2B 1X70A 1F51E 2FZEA 2P9ZA 2YOFA 4R1PA 4RY2A 5E4JA 1CETA 1X2EA 1EK0A 3GN2A 4LYFA 3LK7A 1M6EX 1Z82A 2BT4A 3PL1A 4MS1B 3JZMA 4B6SA 3FBGA 4P3OA 2PRKA 2NGRA 2DH6A 4EJ6A 1RRCA 2J5BA 3DH0A 5ICEA 2YY5A 2CNWA 1NMEA 2IDZA 1J8QA 4JCOA 4L5BA 1R0RE 1TNDA 1U2GC 1SNYA 3NBZC 2H0QA 1UINA 2CMFA 2PH1A 3JALA 4Y2YA 2P2GA 4NAVA 5CA1B 1J21A 4EX7A 5FH9A 2AOWA 2JDIA 4RF5A 4JLKA 4MO9A 4BOYA 3DEKA 3QVGB 4JI4B 3MW8A 5JZBA 4EFNA 1B26A 3H6KA 1PR3A 4INAA 1X13A 1C0IA 4F92B 2CVQA 3A27A 1ORDA 3AUAA 1CY1A 1PHPA 1Q20A 3ORQA 3QPBA 4ZIRB 1PJLA 1SXJA 3NMUF 1PJQA 4PS0A 4BO8A 4D9HA 5AVQA 3PXBA 2I7VA 1U5AA 3MJEA 3ZWMA 2YV4A 4RIIA 2FSGA 4YUAA 4IMPA 2W6JD 4BLRA 4ARSA 1ZA2A 3SDBA 2O54A 4LY6A 1P5RA 2VATA 4L08A 5EWJB 2ZBUA 1ULHA 1AZSC 2V7VA 3KWFA 1Y6JA 4I1IA 5A0VA 4ZOEA 2CMKA 2JEYA 1GVHA 2C78A 4MEJA 2GPJA 2PYIA 4IVNA 4ER7A 3K15A 4RJLA 1QQAA 1E4EB 4YPVA 2Z56A 3PT9A 4AS3A 4N41A 1IIBA 2WP8J 3ZZUA 4OHCA 5I3CA 2XXAB 4Q15A 4URVR 2IIVA 2QZSA 1JLSA 1II0A 2ANBA 3PNOA 4WCVA 3IBSA 2JGDA 4O4HF 2IOFK 1MABA 1TCUA 2NO0A 5LC1A 4HDKB 3RTBA 1XD2A 2YV1A 1MRNA 7ABPA 1VL0A 3E58A 3WAJA 1SCKA 1KVRA 2QRVA 4KYTA 3WKAA 3ECSA 3T4UA 2W11A 3N2EA 4N9WA 5FB3A 3VVBA 2J9ZB 3JWPA 3PC7A 4FDUA 5D5PA 1QH8B 3BTUA 5DTRA 4UOEA 5A2GA 5I7RA 1Z6QA 5GPBA 3L1HA 5BYBA 3ZVNA 4KXQA 1I9CA 3GFSA 3OE7A 4OXQA 1A9SA 1DEAA 2L2QA 1JTVA 1YONA 1I2ZA 5JS2A 3RGWS 5TEVA 5CCBA 2QGZA 3WIBA 1TCCA 4NZPA 1S3IA 3OBBA 5FXMA 4FFBB 1ZL0A 3E3NA 1J8DA 4HUQB 5ULLA 3VM6A 3B6MA 4NABA 1IVNA 1P2VA 1GYPA 4OAQA 2VDWB 3CRRA 3HEAA 4HGZA 2WKSA 4I8XA 3OIGA 5K5EA 1NXPA 4MA4A 1R74A 4OF4A 3RYHB 2A0KA 3D7KA 4ZRDA 4LE2A 5FBKA 1H0KA 4YQEA 5C4IA 4PFQA 3B1YA 2ZYDA 3HABA 2G3YA 4DJEC 4PCUA 4EDHA 1MIOA 2DSTA 3LIIA 1PFUA 2OZPA 2WJAA 1R18A 4LRYA 3VMMA 2DPMA 1V4BA 1ZNWA 3BWDD 4O6VA 5BWNA 3OJLA 1VJ5A 4C6SA 1DAFA 3DLTA 4WECA 2WA2A 1E18A 3KJNA 2OHHA 2Q9AA 2JIZA 2PZBA 3H6GA 3RVJA 5HJEA 4JJ6A 3HKBA 2JKYA 4EHNA 1CS0B 3OCXA 2C95A 4L5IA 4MDEA 2IXDA 3ZWNA 1DXQA 1GTZA 2GS9A 5EMHA 3W5HA 4DARA 3U09A 5EHXA 1LTKA 3K1TA 1RLOA 1Y3HA 2AWNA 4Y6RA 4Y6SA 3UA4A 5A1TA 2B35A 4C2UA 1X7HA 4EO4A 3FB4A 2BEUA 3I01A 1L5MA 2PGJA 2R3SA 4BNUA 2O2SA 4MV7A 2V5UA 2I4TA 2ZRDA 4PG4A 3WBBA 3T5AA 4DT1A 2ZIZA 4M3NA 3SJUA 4CKBA 1S4MA 2AFIB 1WPGA 5ALNA 4TV8F 3PT5A 4BKPA 3LZDA 5K6RA 5TLSA 2QZZA 4N82A 4URHA 3RVDA 1OW3B 2YFQA 5LZ4A 1KYYA 2WJVA 1ULAA 1P1FA 3P9QA 2XEXA 5ERGB 5KSWB 5K0NA 2P4HX 4P34A 3L7MA 1YDWA 2FETA 5E4FA 2EG5A 2HCJB 4KPUA 3HDVA 1JSCA 2AMYA 2EXXA 2C5EA 2EKLA 2GAJA 2QJWA 4WXPA 3HBNA 5FORA 3PTLA 3DXYA 1SQ5A 4UJ5A 4IYRA 5J1TB 2OCYC 1E1DA 1NVEA 2H1IA 3CX3A 2FVYA 2ZIWB 2E0IA 4JL8A 5BW6B 1G3RA 3CNLA 1CE8A 2QM3A 3S28A 3TLKA 2PRSA 3UAOA 1SCDA 3PDHA 4PV7A 4LF7B 2AZXA 4ALIA 5KMGB 2A9KA 4TXMA 3BHIA 4HDOB 4G0WA 4LK2A 5CB0A 1Z0AA 5ALUA 1T5TA 4TV8A 1YR9A 1R4ZA 5JS6A 1EXDA 3JAWA 2R8RA 3A1UA 3DL0A 4ITVA 4A8JB 3KYBA 1RD4A 1J2RA 3DZ8A 3N05A 4FKBA 4FN4A 4B40A 1QLHA 4RK0A 1XNHA 5AQEA 4B84A 4GX1A 4UVGA 4DLRA 3UFBA 3AV0B 1TA4A 4IG9A 1H5NA 3NJ8A 3PNSA 2XGMA 3S7ZA 4ZVSA 1TLLA 1PL0A 2YMPA 3DTVD 3E9MA 3IALA 2I3GA 1IWBB 3G3EA 4QYMA 4YRSA 2P65A 1BOFA 3O31A 4HUTA 4CLRA 1HSZA 4Z0TA 4I6EA 4C04A 5MHTA 2PS1A 3ZY6A 4ERXA 3H7AA 2TMYA 4HAWA 1ZW1A 2FSVA 4PYLA 1UWVA 4GOMD 2VKTA 2AN1A 2CXSA 2OQIA 2P4EA 2VTDA 1UJCA 2I1VB 1WHTA 3BAZA 4PLYA 3FJ1A 4D99A 1DQSA 4NV0A 3QKSA 1S2GA 4ZHQB 1FK8A 1HF3A 5F35A 2QTNA 1U98A 4TVSA 2XGGA 3DE6X 3H8VA 5DSZA 4CM4A 3PVCA 5IBCA 3C6KA 3JD4A 2AN4A 1SXJB 2HMSA 3O4RA 4I1YA 2ILTA 2ECOA 3LQFA 1TCVA 4P4SA 3S3TA 5KTPA 1JU4A 3SMVA 1WCWA 2WSIA 4YASA 3C6MA 2QQFA 4G0NA 4Q9KA 3H16A 5LLDA 4NBLA 3SS7X 4WEOA 4U7HA 1GA4A 3STYA 3TTWA 1ODLA 4H1TA 4K28A 4FN5A 3KUXA 1BU5A 5HP4A 4JJGA 2RC6A 5LP6F 1YS6A 3PF8A 3ERCA 2FQXA 3IEUA 2YQ4A 1JNXX 3EBOA 4D0NA 4EPWA 1GQQA 2E82A 2VPXA 3E4CA 4ENTA 3KFXA 4G4JA 5AESA 3PCRB 3F2IA 4UD6A 5IARA 4NPHA 2X3YA 1IL0A 1V5GA 6REQA 4E5PA 2ZI3A 1Z5OA 3L41A 2Z8XA 4C0WA 3OC6A 5IK2D 1VL5A 5KYKA 3K3PA 5KINB 1WG8A 1FL9A 3CGWA 3HB4X 5FUVA 3ZHYA 4D45A 2ZYVX 4LHSA 1NI5A 1Z2PX 3ICQB 5JJKA 4WKNA 1ZD4A 2C92A 1Z15A 3PXAA 1STOA 3G7UA 3LD9A 3U7QA 1MABB 1QXSA 3VPHA 4C6TA 4GLLA 1UBMS 2A9RA 4WHMA 2GETA 5ESRA 3SS8A 2Q5LA 1XD2B 4CUJA 5HZMA 1MW8X 3QEAZ 5EMMA 5CJPA 1EESA 2QRVB 1DAOA 3VKHA 1U1GA 4V0KA 1RBQA 3PYMA 3ZJUA 1Z9BA 3HUDA 4RYDA 1K5PA 4EG3A 4F04A 1Q7GA 3MBKA 1WDTA 1X42A 3CNNA 3EVFA 3SIWA 3UC5A 2QNBA 3L93A 4CG3A 2ZS8A 4RSRA 1DCKA 3MT7A 3AHDA 2JI7A 4WVFA 1OY1A 3EQ8A 1YR6A 1DUIA 4O8CA 5G1OA 5L4LA 4HDMB 4Q1AA 1HG1A 1M0SA 2E87A 5A5GA 2GEVA 4WXHA 1T25A 4QOFA 2QYOA 2OGTA 3NOXA 1IZZA 1WCIA 4C78A 5JAOA 4E03A 2WV9A 3RRYA 3F4KA 4H7KA 2ONJA 2W2KA 3GHHA 3SQNA 3PSAA 1SPBS 4J0JA 4L0QA 5F9MA 2I66A 5IH7A 5BMVF 5A6VA 5C8XA 1R8YA 1ONNA 3I72A 4LXQA 5ICFA 2AF4C 5ALWA 5AJYA 6NULA 3AEQA 4WFIA 2DWUA 3DOOA 3QFFA 3H04A 5C1DA 5CG2A 1N6HA 5G40A 3CF2A 1KO8A 3D64A 3C0KA 2WJPA 4ATNA 2JCVA 2HJWA 1X9IA 1C9JA 3E03A 3G0BA 4IO0A 5T6BA 2YDYA 2HTFA 2YJGA 4KFUA 3FSRA 2HWUA 4M7OA 4D0LB 4BB9A 1DKNA 1FJ2A 3T1HB 3I62A 4CMJA 1K6MA 3L6EA 2XSZA 5L9AA 2ANCA 4KR6A 1H6CA 4FUQA 3HKBB 4HVAA 4JC4A 3CA8A 3EXAA 2IH5A 3WGMA 3AKZA 2AUMA 4D1YA 3L84A 2EDAA 1EFRA 5JAZA 1GTJ1 3B6EA 3HYTA 2P2ZA 3MS7A 1E2HA 2JFOA 2XT0A 5IABA 1A8PA 4GECA 4YH1A 2WWYA 3PKIA 2M1XA 4DIBA 1CQWA 1INLA 3C3JA 3HJGA 1KPHA 3Q9LA 4ETIA 1V6SA 3QSGA 2BR3A 3BE8A 3PUYA 1G8JA 4MCIA 5JCJA 3OEYA 4DY4A 2INGX 1IWPB 3L05A 3T9BA 3VBCA 1G1AA 1V95A 4X97A 3GPBA 1CZNA 1PDVA 2CLOB 1BN6A 1J9ZA 4A1OA 5IKOA 2HN9A 2JJ1D 3LGXA 3SZ3A 3LPMA 3OOHA 3EJ6A 4MZXA 2DJIA 2J07A 3KQWA 2ZS9A 3LO8A 3MILA 1SM4A 1RQGA 4LJLA 1SXQA 3ESRA 4LOIA 3ZCQA 3DAFA 1W73A 4RHEA 4RA9A 5HZKA 1A5AB 4I9HA 4DY6A 4MWOA 3O94A 4RPLA 3D2CA 2H48A 1BE8A 4X0EA 3MMPA 5K3CA 3GLFE 1L8AA 2XD4A 2OILA 1F1BA 1Z35A 4FFWA 5M5BA 2DERA 1NBHA 1WZ2A 2OP0A 4HH0A 3UUWA 1Q0QA 5EIAA 2FMFA 4DYDA 1Q1QA 1JF8A 1F20A 3BIFA 1CE8B 3O84A 2QQ0A 4TXLA 1G6HA 2QD4A 1X9GA 3MTIA 4R8KA 2DUMA 3RASA 3VUFA 3ZWKA 3FOZA 1W5FA 1ZLYA 3CGGA 1L1QA 6YASA 1M74A 3NEPX 2A0FA 3ZJTA 3RARA 4D5EA 3WKEA 4MYUA 2EIXA 3IOEA 2QJRA 2FEMA 3SYMA 1T2EA 2C9BA 5KCMA 2GO7A 3JAWB 1APBA 4O1MA 1FFHA 3KXIA 3OQMA 4HLQB 1Y7LA 4KXLA 3IXMA 1OFUX 1LPOA 1RYMA 1UBKS 3OZUA 3PVZA 1Y8QA 1QKIA 2XY4A 1M1ZA 4Y9DA 1SBTA 3ASZA 1N2OA 2P62A 2BKAA 4QU5A 4ANFA 3WIEA 2JL1A 3DF9A 3B6JA 1ZJ4A 3O1LA 2JASA 4KKVA 3J80A 1V6CA 3S2ZA 4PR0A 3ROGA 1QAOA 2V3CC 1CJMA 2OM6A 3OHPA 4CLRB 2IYQA 3AYXB 3FFAA 1Z2OX 5EPEA 1SVNA 2PWBA 3Q5DA 4RL6A 4TXHA 5AW3A 4JITA 5KWJA 3OEHD 5AVYA 3K6SA 3R09A 2AR7A 3FGPA 2EP7A 1ECPA 1U2GA 3ASUA 3SXPA 3F4LA 4BO2A 1H85A 1PL6A 2QTWB 5T4FA 3UN1A 1G8HA 2Y6UA 2R2AA 1WQ1R 3VPDA 3QKSB 5JWRA 5KNCA 3BIWA 2X42A 2A7QA 4WY2A 5K0FA 5K4AA 3I1IA 1RVV1 3KSUA 2J5XA 1XDWA 5B1DA 4CM4B 1NTOA 3UWPA 5ELMA 2BZSA 3MJRA 3OWHA 1AY0A 3ADDA 3KD2A 3AL3A 1M7GA 1F4PA 1YI1A 3M89A 2P3LA 3ONVA 3U4DA 3H2JA 3FVRA 4I1PA 3W5CA 1GA6A 4FOLA 1I9GA 1PYGA 2PD4A 1SIOA 2X4DA 5E6SA 2IPXA 5IAKA 4G5RA 5EJFA 2OSBA 2PK3A 2JPDA 1KEUA 4ZC1A 4BAUA 2ZJ4A 3IRUA 4TKZA 2QJOA 1OWMA 1PD0A 4ZVUA 4JBHA 3O91A 1PLLA 5MGBA 3E23A 1QIFA 3OPQA 2XZDA 2BHNA 5EYPA 2WUVA 4JCCA 2VH2A 2W37A 4BMNA 6REQB 4W9MC 3H7IA 3QPDA 3GD5A 2PMDA 1EZ1A 3RK1A 5IT9A 1CW2B 4LTDA 3PC8A 4PPQA 1OXMA 2QV7A 1RJFA 2C5AA 2ID7A 1L7DA 3DFIA 4IS2A 1R4MB 4M9SA 4Q19A 3RS5A 1FF9A 5AW5A 4LZJA 3HB9A 3UKJA 3W34A 2DFVA 5KQRA 3VYTB 4WXRA 3OIDA 5C8VA 1WBDA 3R5SA 1JSRA 1F8GA 2QK4A 4C6TB 1SEVA 1W76A 4IIHA 4CZ2A 3VJLA 5J40A 2FUCA 2GD2A 2N0SA 5IFKA 4LFBB 3W8NA 4ADSG 4NU8X 5LXTF 3FIUA 5IM4F 2Z9CA 4GRIA 3V34A 3X1XA 3O8RA 3QXHA 4JYAB 1T10A 3GLHB 3SNKA 1GCAA 1S2OA 2I6XA 1MB9A 3HHEA 2QMZA 3IXQA 4I5DA 1RM3A 2IUUA 2V8BA 1TVCA 3H1FA 3OZRA 4Q3DA 2PLFA 3OURA 1ZGHA 4QDJA 4C0HA 4IG4A 1UBFA 2UZ1A 5BSUA 5EIBC 3WJ2A 4HS9A 3RS0A 4F2PA 3NNSA 4HAOA 5HIMA 4Z7NB 4MDFA 1KR2A 2CMHA 1WM1A 3QFRA 3UYKA 2W2KB 1QBKC 2Z4TA 4J94A 4QNMA 2V58A 3I0ZA 1GUDA 2NU6A 2WG2A 2CXRA 1FMJA 1NQVA 4KTVE 3TQSA 3E1GA 4EW6A 3FNIA 3SQDA 4ZTBA 1JHXA 4BO6A 3RDPA 1E1RD 3EXG2 3AEQB 3H2SA 3IVAA 2DY0A 3NWJA 3MWFA 3WKCA 4A23A 3P52A 4ZTUB 2MR6A 3EIWA 1Z2NX 3BWYA 4E22A 3HVJA 4BTLA 2OUKA 3EOAI 4RPGA 3SQLA 2J6CA 1CQZA 2C8LA 2YWJA 2E49A 4MR9A 4WUVA 5BYKA 3ACBA 3KZNA 1MT3A 3H05A 4RXTA 5HRCA 3QPCA 1MJHA 2C29D 3BGIA 4EFKA 3ROMA 2ONKA 4DIUA 1KGSA 1O5IA 1U2SA 5IVKA 1WAMA 2GYYA 4GE0A 1U1FA 4R8MA 4EG5A 3K5IA 4DADA 2A4KA 4H3KB 1QYIA 2R6ZA 3NOOA 2WG0A 3AU8A 1PJSA 4YRIA 3UUGA 1IYZA 1XBTA 3I9KA 3V7NA 1P3JA 2XZPA 4EPYA 1I3KA 2B61A 2MINA 1H4VB 1TIPA 1JFFA 2W4QA 4D3ZA 4B81A 1O0SA 2ZI5A 6ADHA 2ECFA 1V4NA 3UGKA 1TQHA 4YDHB 5ARCA 3E9QA 1X6VA 4UNSA 4C4XA 1ZGBA 3K6JA 3TL2A 3IUPA 5DRYA 2B1GA 3UJ6A 5EI5A 4X62B 4D4GA 1J0BA 1DAKA 2FMUA 2VNSA 3D1VA 2Z5VA 4TM7A 3QLEA 5UKDA 1THZA 1V1MA 3KLPX 1SWVA 4CM7A 1BSVA 2AI2A 1JHPA 1N2GA 1DNPA 1RHJA 4AJNA 1U0RA 4EY6A 3K8YA 1CF2O 2BBTA 1K88A 1JR3E 3N8DA 5JD6A 5TC4A 1YF3A 1Z47A 1TJ4A 3VR5H 1WSAA 3GZJA 1NN0A 2D1QA 3V7YA 4NCAA 1VGVA 4N5DA 1JPNA 4MRVA 1SQSA 1OI7A 1NVDA 3EY9A 2G9ZA 4RD3A 2EKDA 4GPIB 5G02A 4AS2A 2J0VA 3PFKA 1JEYA 3GAZA 5CFZA 3EC1A 3NTRA 3RWOA 1TTTA 2W6ID 2JHFA 5EZYF 4DLZA 1J20A 4N7JA 1MCZA 3SEFA 2ACWA 4HWKA 1GAWA 2V6JA 4R9NA 4CHGA 4QDXA 4OI1A 2GBPA 3SD7A 4D6XA 3SYLA 1AQIA 2FFJA 3AFMA 1GKLA 2XLCA 4L4SA 1EFDN 3M2PA 1TLTA 3K9LA 2R48A 2X0DA 4CV2A 3BK2A 3I05A 3IAS1 1C7FA 4EWLA 4WPGA 4DJDC 1Z68A 2C4KA 1PP4A 2NSJA 2R8XA 2V3WA 2VNHA 4ZEVA 2C5FA 3B3QA 1VRWA 2JJYA 1QNLA 3NBXX 4KW7A 3FR7A 4OB7A 1UPTA 3QBVA 4OX9B 5JJBA 3PDWA 1WUJS 4XLZA 1K2VN 2O2EA 3O3MB 2EERA 1QHHA 2ZSBA 2C00A 2I3ZA 1BEEA 2BM1A 3HO6A 3K6SB 2OTCA 3Q88A 2DFLA 1SU7A 2O1EA 4JC0A 4MR7A 2QX8A 1N0IA 1YJ8A 3GY0A 2HIAA 1HTWA 1K6IA 4ZVLA 1FNSA 1NUSA 1P61B 5DK4A 2J3MA 4TZTA 1W19A 3OZAA 1S9HA 4FFMA 1SKYB 4D8YA 4WKBA 2CZGA 5GY7A 4PGHA 5EHZA 4YXWD 1M6VA 2JS7A 3FZGA 4ILKA 1TF5A 4QXQA 5DMXA 4Y7CA 4DS3A 2G6BA 3HEMA 4PYOA 1GQYA 5MDHA 1GT6A 5DRTA 2GAAA 2O20A 3VRHA 5E6SB 4AU1A 4HN4B 3I0MA 1GQRA 4TTAA 3HCDA 3U1TA 1P17A 1QMGA 3IULA 3HA3A 3VSEA 4UOZA 2WOOA 2RD2A 3BTOA 1QORA 2H51A 2RKWA 3L49A 3WJ7A 1G7SA 1MX5A 1FNDA 2XOKA 3LUPA 2B37A 2YVAA 2VVTA 5CLHA 3D8HA 3N0VA 3VX3A 4B5LA 5ITZA 3E15A 3ETNA 2H6EA 3DL2A 1OXBB 1W1IA 2HHLA 4B44A 3FOCA 1G2IA 2XGOA 4O2RA 2VK2A 4EMUA 2Y68A 3UICA 2XDYA 1VFPA 3DV2A 4Q9AA 3ZX4A 1XZBA 4IR7A 3MT0A 3DO6A 3LBHA 1UXIA 2GEJA 4MUBA 2P4UA 5KAMA 5JAMA 1Y6QA 1RFGE 5BSWA 2WUWE 3UGJA 2CEKA 3EZ9A 3BKXA 2BMAA 4NAHA 4MWEA 3RSZA 4CN9A 3E9EA 3AHGA 1HE3A 4GXRA 3GD7A 3MK31 2GI4A 2R7LA 4GU5A 4IFIA 2IYPA 4PRZA 1Z39A 3U31A 2LIVA 5C8YA 3GDOA 1JEOA 5FWXA 4C0QC 1XCBA 1WHSA 5J5AA 2GLUA 4LDNA 1EX6A 1QO9A 1U2TA 4QJIA 4FZ3A 1KC3A 2MJLA 3DFZA 4IGKA 4DR3B 1Q83A 2UZ1B 4MW6A 1COZA 4KVAA 4KYUA 5KYGA 1H9AA 4YT4A 2D5CA 4MQBA 1IQPA 3W5DA 2GSWA 2ZBEA 1DJOA 3BK7A 4M0LA 2Z58A 4MVJM 1Z08A 3V4RA 1E7SA 2GN9A 2NU6B 3IUJA 1QK5A 1VZ2A 2O14A 1FQWA 2A9VA 4FOSA 3UCEA 1SCAA 4UEJA 1HQDA 3B9QA 2B7CA 5FPQA 2JAPA 2VDPB 2WILA 3NFYA 3HWWA 2H1RA 2WFAA 1JLRA 5GM1A 3U7JA 5KHAA 1E6MA 1A9ZA 4L9AA 1XKLA 4JLUA 5TE9A 4NE9A 4DM4A 2YC2C 4M1MA 3VR5D 2QE7D 5KOJA 1CSEE 3LECA 3OE5A 4MR9B 4MV4A 3STTA 2B2XA 2E9SA 4N54A 4U8HA 4BX0A 1SXGA 3ETEA 1P2DA 2BEKA 5LYJB 3W2EA 2FP3A 1C4XA 4FDTA 3OPVA 1R88A 4XRGA 4DA4A 1ZI9A 3IKJA 3IUBA 5C46F 1SCIA 2OD2A 1Y5MA 1SOWA 3ABRB 1QP0A 4JJ7A 4RDXA 4PYMA 4XQEA 4YV2A 1C80A 4CMIA 4BWYA 1E1NA 3CRMA 5HKKD 4NOJA 1B15A 5SZKB 1FRQA 3CH7A 3P2OA 1AVTA 4O2BF 2MINB 3C1OA 1I30A 1JFFB 1Z6YA 4M0PA 3MGBA 3QXCA 4C76A 4EUKA 4YRKA 4HEA6 4YP6A 3ICVA 4D8WA 4E3ZA 5F5NA 1L5GB 1BFKA 1MTZA 4RBNA 1IY2A 3KLNA 4IDFA 4RKWA 2QUJA 5DI3A 2GRUA 3QPUA 1SC6A 5K3FB 1JU9A 2OA0A 1V1MB 1NU8A 2PS3A 4UHHA 2PNFA 3LLMA 1UOPA 2LW7A 2PRYA 3OY2A 5G41A 1SBNE 5HK8A 5TS2A 3INGA 4RESA 4RCZA 4AUEA 3IMFA 3TDNA 4UU1A 5L95A 4GWKA 2ONYA 4N65A 5A05A 4N5NA 1M8KA 4YMSA 5HUQA 2E21A 3A4MA 2O52A 1XQ6A 2ZU6A 3D3NA 4LDJA 5DASA 3GMIA 5DKFA 4JL6A 3WA7A 4RTNA 3FVVA 4O2BA 2P2SA 4C5BA 2YY7A 4K9KA 3HUUA 5JS7A 5KTSA 4L75A 1XZHA 1JEYB 3WL8A 1KK3A 2I5PO 1EWYA 4LXIA 4EGJA 1FNCA 1H2EA 1Z8FA 1R5BA 2FZ5A 3NHLA 1H4SA 5KREA 1G59A 4EJMA 4M53A 1FSZA 6CHYA 4RKEA 2H4JA 2I62A 4OFXA 2EFYA 1SXJE 4PG5A 3LX4A 4OREX 3RU2A 2HZ7A 3S40A 1PQYA 4L8WB 2AC7A 2JAHA 4WD3A 2JFPA 3TSZA 4D80A 1NP7A 1XWIA 4AAYA 1CY0A 2J1LA 2VHYA 1R5JA 1MEOA 1VE7A 1XZQA 3K2EA 1HEIA 3ZKAA 5BUZA 1W96A 1XZJA 3H8JA 4DB4A 2F8LA 4Z4HA 2BFMA 2FE4A 4MUAA 4UMVA 3CUVA 5DT2A 4TQGA 2N42A 1I2BA 4NCJA 2NYAA 1WPQA 3P94A 1K6XA 2AF3C 3KKMA 4HWSA 3Q7EA 5EMJA 4X71A 1OT3A 4I0WB 3BB3A 5EPUA 1QHHB 2GMWA 2JLXA 3ZVKA 2QM8A 3LK6A 2PQ0A 2XDWA 1DTEA 3A4VA 3O2NA 2GOYA 3ZU2A 3NWBA 4N3CA 4MR7B 3EODA 2EWVA 2VTVA 3D7LA 4DLUA 5EXTA 1O95D 4JZKA 3SZLA 4EBFA 3QE4A 1KAEA 3F5QA 4JLNA 2OXCA 3S6JA 3F6CA 2YXPX 1W1UA 4MMXB 3T15A 4A26A 3UANA 3L7YA 1IWOA 3AFGA 2WEKA 4BQQA 1TADA 4ZT5A 3GEEA 3MLEA 3P0IA 4TYNA 2A57A 4LMPA 3V7WA 1KEWA 1DIGA 1OPXA 2Z9DA 4K6FA 4D44A 4XXHA 3ZWPA 4A5OA 3ELBA 1RE1A 1XRMA 4UAUA 2GB4A 2HIGA 1J97A 2JKZA 3TRJA 4A6DA 1MB2A 4F4FA 2KPOA 4OU4A 4XOIA 1GSOA 2HLNA 4IDOA 4ND1A 1JHUA 4F21A 4EL0A 3MCTA 2EU8A 4ND4A 1R0LA 4BMCA 4BS9A 2E48A 2FWPA 2BW0A 2GFHA 3QFSA 4DWJA 1NI4A 4QUGA 3WHLA 2OAGA 4LHXA 1IBCA 1PR9A 1ZK3A 2XNHA 5C4GB 5B7PA 1XIVA 1DIBA 5JYDA 1OKKA 1ZM3A 3JU3A 4V0NA 2NU8B 3T3DA 3EDRA 5C7YA 1SFRA 2VDVE 3BIOA 1QVAA 2ZE6A 2I4NA 1PDWA 3FF1A 3OPXA 4EUEA 3H5TA 4UE3S 5JH7F 1PZXA 1PJ2A 3IAFA 4IF6A 4EB8A 5BSRA 1DBVO 4NNPA 2FHSA 1NVWQ 3F5FA 1Q1EA 3FNBA 3UXMA 1L7PA 1BHO1 4G85A 1OAAA 4X6LA 1Q2UA 2WMOB 2WSSD 3H4TA 3I01M 5G0SA 4EHBA 4UFPA 3AVVA 5FWXB 1NX6A 1VJRA 1L7BA 2X4IA 5JMOA 1WHSB 1II8A 4BKUA 4ES6A 3N70A 3W3AA 1KJIA 2AX3A 4IJWA 4NH4A 2X9NA 1SY7A 2FWAA 3PNKA 4HH1A 2G63A 4DEYA 2DPYA 1A76A 2K4MA 3CX8A 4B6QA 2AMLA 1BNCA 3K4HA 2PMKA 3MN1A 3DLBA 1FTSA 3ELDA 1GG9A 3G2QA 4B5KA 1P74A 4Q7EA 2X8WA 1NLZA 3I09A 1GUFA 1E4YA 4G56A 3H8SA 5G4LA 1I94B 3G5LA 3RLFA 1QYWA 4FQ7A 4EARA 2NP6A 1VG0B 2ESRA 4UU0A 1YDEA 4BRUA 4D4LA 1U3WA 4JUDX 2BPOA 2QMHA 3ROPA 3GNLA 2QTCA 4ECEA 4JUCA 2PFKA 2AB0A 3ZD8A 4ZOCA 3EIUA 3F7TA 4Z9FA 4Q3OA 3JQBA 5EP2A 4YNBA 4IEEA 4MVWA 5KQSA 4NARA 3QSYA 5KOJB 3Q8KA 3UMFA 4GMFA 4PG6A 3DULA 3R3HA 1LRLA 2ZJ3A 3WLAA 1ZIDA 4H27A 4LSZA 4XFJA 4YCNA 2ZB4A 1P8AA 3FPLA 3UG6A 3ZK8A 1IQRA 1YU6A 2ZSFA 3FCUB 1H6AA 4KBYA 5FYQA 3NFRA 5T4BA 1BVYF 1IHYA 2ZRGA 4KKXB 4IDCA 1RWNA 5AW1A 3AOEC 1XQ9A 2VHJA 2GFQA 4I55A 1KMMA 2NQTA 2HBQA 4LSMA 4RLSA 3ZYCA 3GLKA 1FUIA 2QJFA 2WABA 3GEMA 5FR1A 5JPIA 3UJ7A 4CMIB 4EEZA 5AW2A 2RJ3A 1XZIA 1FP4A 4DMGA 3BN3A 4IXTA 1VJ0A 2FEWB 3M6MD 4RH1A 5ETJA 4G8BA 1EVYA 1QRTA 2BSAA 4HNSA 3L77A 1HLGA 1SBIA 4H18A 2RK6A 1A5BB 1CUHA 1VSBA 3KHTA 1AC5A 4YQFA 3OX2A 4R3WA 1M5RA 2AJBA 1NMXA 3GBSA 4OKIA 5ECDA 3AILA 3RFTA 3OQJA 1IBMB 4QWMA 1IHUA 1GR1A 4K9LA 1JDNA 3OZDA 3EIQA 5BN1A 5FA8A 1N0UA 4TUYA 4MRAA 5HMMA 2WF8A 4BPBA 1XLWA 4KSCA 4KGXA 1P75A 4Y7DA 2WTBA 3HDGA 1QLWA 3KHKA 1RSZA 3DR3A 1D8TA 4UAJA 1PAUA 3TWOA 2BZGA 4CKEB 1U3GA 3MQFA 2FMXA 1NNLA 1A69A 1EEXB 3JATA 1WEHA 3F8WA 3THOA 3OZSA 3OIWA 3AU9A 2IVZA 1G9SA 2QX9A 4RD1A 4PZPA 1U8AA 5AKYA 5IAJA 1KEKA 1UK6A 1X1QA 3AG6A 3ETLA 4KDCA 5EZSA 1ORTA 1EX9A 1Z74A 4M1WA 4CR6A 5DULA 4CCYB 3DNPA 1K97A 4A6XA 4LA4A 1SC3A 4OHRA 3AONB 3ADOA 5DW0A 1A9YA 1FXUA 1XCOA 2VT2A 1OU4A 3QVMA 4N7BA 5TVKA 3B3GA 4LXGA 4LFCB 3RU9A 4TKVA 1VJGA 5IF3A 4D0GA 1BH2A 3K0HA 3RVPA 3TR6A 1ULSA 1OC4A 4OHPA 2AG5A 3QWFA 3LCJA 3QGMA 1QHGA 4AJ1A 3G2LA 3TW6A 3T7DA 3F96A 1XCGB 2BMJA 3BE6A 3BMOA 2ODAA 5CIYA 3DC2A 2ZWIA 5FOTA 2FP4A 3JAKA 4ALLA 3K5WA 2PYZA 1OD6A 4P31A 3WB1A 1KKMA 4G25A 1SO8A 4QYWA 2XF2A 3BE4A 1QJCA 3FTPA 4KUEA 1MQSA 1BDBA 3QU7A 4CF3A 1FW6A 4FW9A 1ZXXA 5K05A 2IKQA 3ZWCA 1SVMA 4M0KA 3AMVA 3ZUPA 1NOJA 2QVYX 1ABBA 2VCYA 4AMUA 3MIZA 1FSPA 3JR7A 1KDTA 1ND5A 2O2GA 4FD2A 4HDNB 4HMOA 4HATA 5MN4A 1AQUA 4Z7OB 4MP6A 2AX4A 3MMXA 4NVRA 1C9EA 2VRWA 2EWWA 2L19A 2ODPA 4ZV7A 5A5DA 3I8OA 5HZGA 4WXEA 1RLIA 3C1TA 3W1EA 1A95A 1I51A 3C4JA 1T9GR 1JQAA 4HNQA 2W71A 1XCPA 3IS3A 3T6KA 5AXBA 5IT4A 1R16A 4I9FA 3HTXA 1XV5A 1FRVA 3DXXA 1KEZA 3IHTA 4R98A 4PG8A 1WBJB 3NVKI 1JJAA 3I5AA 4QG7A 4R84A 3OMLA 1CEXA 2VHCA 4JUIA 1Z0ZA 3L02A 4TSRA 1AXEA 5I9NA 2BFCA 5LA6F 2BTEA 1JZTA 2H07A 1NFRA 2C82A 2IUYA 3GFBA 1KP9A 2ZPUA 2HF7A 4IKOA 4EPVA 5KJ1A 2GN0A 4HEA1 4IWYA 3SKVA 3TIXB 3L4BA 1NI4B 2YYZA 1EGHA 1NW3A 4DAEA 4D9IA 4BZQA 1MO4A 2YCBA 1USUA 2HM7A 3MAGA 3OFNA 3VKGA 1XTRA 3IXLA 4KN8A 4U2CA 4EKYA 1X7XA 3FFWA 3JWJA 5KOYA 3QX7A 4TS3A 5FKJA 4DUZB 1MZPA 2XBUA 2DG2A 2V74B 2D8AA 3HFRA 1AN0A 2PJRA 4EQ6A 1SU8A 1VBMA 2Q5OA 3R2JA 5B12A 2XGJA 3K8QA 1YS1X 2I4MA 4Y2UA 2RJOA 4ZVNA 2PZEA 1GUBA 4DIOA 2O4CA 5B7QA 4DLPA 4O2AF 5LR6A 4NBTA 1QHSA 1KYWA 4JLDA 4HWRA 5B2EA 1H3EA 4KEAA 1LJLA 3A25A 1RYFA 3AR7A 4MDYA 4P83A 4R6XA 2GDZA 5FEUA 4II7A 3B7PA 4HH4A 3V1TC 1RKVA 3PFWO 4N0DA 3PR3A 2FCAA 2CW5A 4WESA 2MT9A 2Z3WA 2D5IA 1DOHA 3AR2A 3ZQUA 4CGZA 1UODA 1HR0B 1OV4A 1P2GA 1Y1PA 5FLEX 4ALMA 3V32A 4QFMA 1M2VB 3I92A 1O94D 2WFZA 4KZKA 1H2FA 3SYTA 4DCNA 5CB4F 4BZWA 4LYJA 1RXVA 1EGVB 2AYZA 4Q47A 5LMZA 1ZONA 2CVZA 1MDFA 2RI1A 2Q50A 1GEEA 2ODEA 2ZRKA 2JIDA 3GPDG 3K0FB 1EZ4A 3RAEC 4PYKA 1SHLA 3PWSA 2CCJA 1XJQA 4I81A 5ALDA 3TMKA 3MZ0A 5HFJA 1E2DA 3WK7A 5K8CA 1T3LA 2IF2A 4F2DA 2CDNA 3C6ZA 4BLPA 3ESCA 4MVJG 4XWAA 2DX7A 2A9PA 2A78A 3DEHA 5DISB 4UM7A 2A5LA 2ZSKA 2VSFA 2C7GA 2V7UA 3RIGA 2VZEA 3UK1A 3AM1A 1Q14A 1XU9A 4PZAA 4E51A 4XDHA 1OB2A 2LCIA 2OAP1 2CXHA 2XDQA 1PX2A 4BWFB 3C4QA 1WR8A 3IIMA 2DXIA 1ZESA 3OZWA 3NNNA 2XPCA 4I4LA 1IQ0A 1M34A 4QQFA 4FXOA 3G49A 4UEWA 3H17A 5YASA 2FMIA 5EJAA 2DHCA 4CQMD 5F9FA 4TV9F 1T9HA 4EB0A 5KQLA 4IXWA 2R84A 1FP4B 3HCPA 2N46A 1OLOA 2QMYA 1GNTA 5F73A 4P4GA 4OHZA 4LSGA 5TT1A 2WIGA 1VP9A 2CFCA 3VMFA 4Y1FA 4OL9A 3CRQA 1B0ZA 4IWNA 2AJCA 5EWLA 3W5IA 4BATA 4W1QA 3SEAA 3TNYA 5C3UA 5JCOC 2OD9A 3A14A 2QTHA 1E9RA 1QX3A 1ZVQA 2QT1A 1JAIA 4MS3B 1K68A 1L7EA 2IEZA 1Q0ZA 3D6FA 5DNWA 1DLIA 1UANA 4TUYB 5AXCA 3WICA 3K96A 1JQBA 1TLFA 4FMBB 1C0PA 1G8AA 3HA7A 4TTJA 4PF1A 4TMYA 3FHCB 4U4AA 5IASA 1U0JA 3PENA 3VKFA 3VZQA 4JL5A 1XUOA 1MQ8B 3QW4B 2DBQA 1RJ9A 3DEYX 1ZN9A 2Y93A 3D9QX 5FFMA 3AW9A 3OVMA 4BNHA 4ZO6A 1CV2A 4ZRNA 5IJZA 2P0EA 4DPLA 2CKDA 4NKRA 4TV9A 2FOIA 2GTHA 3I73A 2A5FA 5HR5A 4EGFA 4GVXA 1TMYA 2AZMA 2GCIA 5KI6A 4EL5A 5B5SA 4P81A 4YP5A 1DADA 1T2AA 1D2AA 1RKUA 1OIXA 2C8VA 4IH1A 1BMTA 4GQAA 3SYNA 1L5HA 3WV5A 4YCLA 2HSDA 4TL9A 4O25A 5B36A 3GUUA 1UZLA 3BJZA 2TS1A 4L3WA 4YHHB 5LIPA 4BX9A 3EH2A 2VSYA 1PF7E 1LPBB 3PGLA 4S3MA 2P90A 4R1OA 3RKUA 4EGSA 2YBDA 4FINA 4NBSA 3ZLVA 4Z1MD 1IMJA 3NHWA 4QULA 1Q22A 1RXYA 5FV7A 4GRAA 3T4PA 1K7FB 3BMOB 4ALNA 2ZTMA 1KTVA 3A11A 3IUQA 3IOYA 1RI2A 4X66B 2PZLA 4P86A 3AESA 5K0LA 1JDJA 2FP4B 3JAKB 3JYOA 3KUKA 2VQD