4KLZA

Inhibition of small gtpases by stabilization of the gdp complex, a novel approach applied to rit1, a target for rheumatoid arthritis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
156
Chain Sequence
EYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords GTP-binding protein Rit1
publication title Inhibition of Small GTPases by Stabilization of the GDP Complex, a Novel Approach applied to Rit1, a Target for Rheumatoid Arthritis
rcsb
source organism Homo sapiens
total genus 51
structure length 156
sequence length 165
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4klzA00
1RE0A 1NL3A 3NTUA 3ZYCA 1XCMA 2VSXA 4R2IA 3KKOA 2C9OA 1JI0A 3CF6R 2RHMA 2JLQA 1A1VA 1II8A 2BBSA 3FKSD 2GZDA 4NZYA 5L3QA 1G4UR 4DWJA 4A6XA 3OFND 4C9BA 5G40A 2ZRKA 1BYIA 4KLZA 1N6LA 1EG7A 1P2SA 4B3BA 1CJKC 3SFVA 1V5WA 5F98A 5EXXA 1FPMA 4UQOA 2JJ1D 1XCGB 4NONA 2ZE6A 4QOSA 4NYJR 1KDPA 1YKSA 3OIYA 1N5KA 4HAVA 1ZM4A 4TMTA 1JALA 2JJ8A 2ZR9A 1VYVA 2DHRA 2W6IA 2GAOA 4ZKEA 1S0UA 2YZ2A 3GJ5A 5E7JA 5B2ZA 3W8NA 4A6PA 2HT6A 2W0SA 4XJXA 1VYUA 2O8BB 1R5NA 2BC9A 3Q9LA 2ZROA 2JASA 1TU3A 1VMAA 1XTJA 2QMUA 4CEJB 5EUQB 3AKCA 4Q03A 3AVQA 3KQKA 2YYZA 2ZI9A 4Q9IA 5CYPA 1KHTA 1YZUA 5DN6A 3WP1B 5JCZA 4PO8A 2FX3A 4BECA 3VU9A 4M9SA 1G7CA 4A2PA 4M1SA 1N6NA 2BMDA 2KI5A 2P0EA 4HYYA 1QHNA 1Q57A 5FBLB 3CLVA 3GLHA 2Z83A 2VQSA 2ZRCA 3QVVA 4B47A 2F43B 3CRQA 1P2VA 3GJ4A 2WWHA 2QAGB 1ZUHA 1L7VC 2RGNC 3AGPA 3QPUA 4I1OA 2ONKA 2QORA 3D7MA 3OE7A 1MKYA 5LD2B 3CH5A 3SJZA 2XXAA 2W6ID 5FR2A 1BS1A 1FMLA 2V55B 4A8JB 5AUOB 3A4LA 2JA1A 4RY2A 2KBEA 2IT1A 5J5CA 2OXCA 2G1KA 4YMWA 2HXYA 2ZQ5A 1AZTA 5TY0A 1FW6A 1GAJA 2CE2X 3KB1A 1P62B 4Q5IA 1FUUA 3TSOA 4I1UA 1S96A 1XTQA 2O8FA 2C77A 4C0SA 1E1RA 1SVKA 4F91B 3X1WA 4MRVA 3GPLA 2WJVA 3CZPA 5BN3A 4FMBB 3LAWA 1HV8A 4PHGA 5J4HA 2HF9A 5KOYA 1NNEA 5EP4A 3IQWA 3IHWA 1KZ7B 2ZEJA 4LYJA 2QSYA 4JJZA 4DXAA 3LVRE 2NO9A 1GRQA 1XP8A 4US2R 2ZPTX 3KJGA 3ZS9A 1G3QA 5SZHB 1XBTA 1HQCA 3SI7A 3TH5A 3NC0C 4GP6A 4KSBA 3ZGXA 2Z5FA 5JSZB 4JLKA 2VO1A 4PQFA 2ZE8A 4HUQB 3KQUA 1GSIA 2CCJA 4LV8B 3SC3A 3NBZC 3B2EA 3SR0A 2IYUA 1VG1A 4KU4A 4TTQA 5LDDC 3ADBA 4ZI3A 5DHAA 3GP8A 4RD0A 1G291 2ZAMA 1UKYA 3K70D 1IXZA 2ZRGA 5FPKA 2ZSBA 4QBFA 2WJYA 4IVPA 2EWWA 1NSTA 5BQ5A 4EQ6A 1E1RD 4JMPA 2MSCB 2LWIA 1ZINA 1V43A 5EP1A 1XNJA 4M22A 2XZLA 3QIAA 3AEZA 3QENA 1ZNXA 1OH5A 2FGKA 3SHFA 4OJKA 1U8ZA 2GEVA 5HCNA 2OILA 2NTYC 4MDFA 4QM7A 2J7PA 5E4FA 2GXUA 3OEEA 5A4JA 1ZM9A 2ZREA 1OV4A 3H84A 3K0SA 3R7WB 3AVOA 2E1RA 5FI0B 2VBCA 4C4PA 1KKLA 4BZXA 1W4CA 2W2TA 3LVQE 2F1RA 1F2TB 2IA5A 2B8WA 2JLSA 2Q9AA 3LD9A 4FMDB 2IWRA 1E69A 3SE0A 3ZDQA 4E22A 1UFQA 3QXSA 3SZRA 3NHBA 4LHVA 3LA6A 4A36A 1YJ5A 2JLXA 1XTKA 2CBZA 2NIPA 2W83A 1NSFA 3ONWA 4C0BA 3K0FA 2WJHA 1GUAA 2CLCX 3BH6A 5AJZA 3ZVMA 5KNDA 1HH4A 4TMWA 1OE0A 1ESMA 1ZIOA 4ARZA 4WOPA 1SXJA 3KX2A 1E2DA 3KJEA 3RS5A 2TMKA 3THWB 4MDEA 3M6AA 1QVRA 3WP0A 3I5YA 4Q4AB 1AS3A 2VF8A 4MKHA 1OKKA 2QENA 3W5JA 2X19A 1VG8A 3IIMA 3KFVA 2WKRA 3ICQB 1G7SA 3OEED 2FSHA 1R2QA 2BM1A 2GETA 2PH1A 5TDHA 3TUJC 4IOKA 2ZR0A 1MR3F 2EYQA 1NP6A 1ONBA 2PCLA 4Q4LA 2ASEA 3BERA 2Z0MA 1TEXA 4A0HA 4PZYA 3WNBA 1NN5A 1QHSA 2ZI6A 3EWAA 1W46A 4G01B 4TLEA 3IHLA 4XVQA 3GJ7A 2WWFA 3TKLA 4M1OA 2BKEA 2ZITA 3SS8A 1RRPA 4CRWB 1R8SA 2FFHA 5KNBA 4CEIB 1N5LA 1XXHE 4HB3A 1KIMA 4OHZA 2NGRA 2FDCA 3K0AA 2A3RA 3KKNA 2NO0A 1MRNA 3GMTA 1FQKA 2RAPA 1Z8FA 1SXJD 4O2LA 4URVR 5A5GA 5BYKA 3T1VA 2QRNA 3RWOA 4IRUB 3QG1A 2Q9CA 1OKKD 4EFNA 1RRGA 3QF4B 1P60A 3U7EB 4ZV4A 4BZPA 1N25A 2XNSA 2OBMA 2XNDA 1M34E 1GZSA 3SJAA 1G3IA 2RH5A 1NVWQ 5JRJA 4YLGA 2ERYA 4M2LA 2PZGA 3DEFA 1KGDA 2BKUA 3LY5A 5F9FA 2IYRA 3BH0A 3NBYC 4HAXA 4IKEA 4HUTA 2G77B 4G0NA 1KI6B 3IIKA 3WNDA 1H8HA 3C15C 2GBLA 2ZE7A 4ZDKA 4PSKA 2CCKA 1F3OA 2ZUDA 1XEXB 2WJJA 3G82C 1JBKA 1XJ0A 1AKYA 1SZPA 1XJQA 4B3GA 4ZKDA 1KKMA 2FJUA 4FN5A 3Q72A 4PC1A 3K9GA 5JI2E 2C5LA 4H1UA 5SZKB 3EIQA 3THOA 3TE6A 1XCPA 1KJYA 4DT1A 3BB4A 3L0OA 3RDPA 1P2UA 2OFOA 2WWWA 3RRYA 4JLAA 4G5SA 5FI1B 4B2IA 4P33A 2HCJB 3H4MA 3QKRB 2AX4A 1KJZA 2OEPA 1W0JD 4P4SB 2XNDD 2NPIA 5CB6A 2PZFA 4NCHA 1E2LA 1AN0A 2ZM5A 2C03A 3QE0A 5L3SA 1JR3A 1AKEA 1RKBA 2D4HA 5G3YA 3AH8A 4H1VA 3FGNA 4Q9JA 5CK4A 2JLUA 5J4YA 1DAEA 1E2JA 1BOFA 2RGCA 3QPVA 5CIWA 3UMRA 4I4LA 3VR6A 3WHKA 3QUSA 2QBYB 4C7OA 4EJSC 3QBTA 1Z0DA 2OAQ1 3FHTA 1G8HA 3AVXA 2CVHA 4A9AA 2AK2A 4ITRC 4CF7A 5KHOC 1KMHB 3B60A 2CDNA 2AFHE 4EPWA 1TF5A 2OHFA 2QSZA 5JBQA 4LSGA 2CLDX 1Q1BA 3QEJA 1LV7A 5E3HA 2VP5A 5EE1A 3O47A 2WKPA 1PLKA 5SZIA 4LJ5A 3T34A 2YC2C 4MGZR 3SEAA 1D9ZA 121PA 2ZS7A 2WAXA 2R6GA 2GWHA 2IS2A 1N5IA 4GRAA 5K8TA 4NYIR 2ZJ5A 5AUPB 3U7FB 3EC2A 2ONJA 3NDBB 2PEZA 4TLBA 3F5FA 3V9PA 4MQBA 5K8IA 1NJGA 2MSDB 1KAGA 4PFSA 3WYAA 4TYQA 1KO8A 2PX3A 5CM9C 2QMHA 1WP9A 4Q9HA 2AHOA 5C4GB 5DI9A 3LBHA 4DC9A 3R9IA 4GZMA 4O3MA 1UKEA 1W47A 3P1JA 1X3SA 4DRZA 1X86B 4KV9A 4D4LA 3A1VA 4JBYA 1XF9A 3T1TA 1E99A 3ZZTA 1JJVA 1J8YF 3RABA 2J0QA 4V0LA 1IY2A 1US8A 1XX6A 3KZ1E 4XWOA 1OFHA 2DY1A 3GJXC 4Q9KA 2FE4A 3HWSA 4ERNA 4V03A 1J90A 2G83A 4DDUA 2F9MA 3C4JA 1A5TA 4IOJA 1NKSA 1UF9A 2J3EA 5D3MB 1FQJA 1T3LA 2DR3A 1OHHD 2ZJ8A 1RC8A 3BWDD 1ZNZA 1NBMD 3PUYA 1XEWX 2OFXA 4LRWA 3K70C 4AC9A 2FV8A 4DLWA 5FTJA 2BIFA 3FMIA 2RGNA 3WXMA 1I4DD 2CJWB 1E9FA 3TUIC 4AK9A 4QM6A 4NCKA 4J0QA 4DEYA 3QKSB 5CITA 3O8DA 4DEXA 4X8LA 4KJZA 3PIRA 3IDQA 1XD9A 4Z8YA 3W5IA 1TEVA 3PXGA 2BDTA 5BN4A 3FMOB 1N6HA 1T5IA 3DKVA 3KJIA 3KKPA 2I4IA 3ADKA 5LBIA 1UJ2A 1YZGA 3U4QA 4JLOA 3ZVNA 1FOEB 1AQUA 1EK0A 1Z6XA 2HCBA 1RIFA 2OLKA 2ECKA 2JLRA 3DM9B 2K5UA 1NLZA 4A2WA 1M8PA 2XTZA 1E9RA 2YINC 4MRRA 5DI3B 2WKQA 4DLZA 3PVSA 3ND8A 2QP3A 4HDCA 2OM2A 2A9KA 3ND9A 4XVRA 4Q7JB 1XTIA 1P5ZB 1T4GA 5JLJA 3AM1A 2ZU6A 4B3FX 3GLIB 4A4DA 2XITA 5CJ2A 3TMKA 1RPZA 4RD3A 4GMDA 2GCOA 3GEIA 4OL0A 3B78A 1QVAA 3VR4A 2H92A 3EIHA 1XPUA 4B43A 2JATA 3IO3A 4YC7A 3MG9A 4MKIA 4WZ6A 421PA 2ZXUA 1CIPA 2ZRIA 3W6OA 1G5PA 4JBXA 1IY0A 1YZLA 2D7DA 3A1UA 2FG5A 2A2ZA 3U5ZB 2ZRAA 1IXSB 1KO7A 4ACAA 4FWTA 3VX3A 3TNFA 4GL2A 2WICA 2A78A 1YR9A 4Q47A 4QBGB 4BFSA 1W48A 4N0EA 4LBWA 1DEKA 3CNOA 3HU3A 4S2EA 1T3SA 2ATXA 3PEYA 4R9UC 4G1UC 3AVWA 1NBME 1E4YA 3K0EA 5SZJA 3LV8A 4MA4A 3W9YA 5IF9A 2JCSA 4EFLA 3CRMA 4Q66C 1G5TA 1RRFA 2DFLA 1YHNA 4NH0A 4OI4A 4A0RA 3R9WA 4OHYA 3DMNA 1KZGB 3QKUA 4RVCA 1J2JA 4UNPA 1SKQA 1XTRA 3VR1A 4IOMA 221PA 4KLNA 1ODFA 5DNYB 2IXEA 4LJAA 1PJRA 4QXAA 1Z2AA 4LHWA 1KY3A 1SXJC 3T61A 4BFZA 2GILA 4YXWA 2UZ3A 4C0AC 1MO4A 1AIPA 4MKFA 3L8ZA 5J47A 3O8CA 1WB9A 2FN4A 1KTVA 4UXHA 1C4OA 4PPQA 3RWMB 4I81A 3UKDA 2ZAOA 4ACBA 4JZKA 4A0FA 1G7RA 4UNSA 1XMSA 1HYQA 1S9DA 3BD9A 4MH0R 4DSTA 3VKGA 1UBEA 3GLGB 1H65A 3GLIE 1KNXA 4B3CA 5IDVA 1FTNA 4A1FA 4TYPA 1OW3B 4EPTA 1YR7A 3VR2A 3A8TA 3LFUA 1JEEA 1NMYA 4AYWA 2BCJQ 2QP4A 3C5CA 3L43A 3U6KA 2B92A 1ZCAA 3MUFA 1GNQA 2IXGA 5J4LA 1N3BA 3P20A 4RFSA 2J0UA 2ZSAA 3WMEA 4YDSA 2A5FA 3I72A 3ASYA 3CNNA 4EIWA 1K8RA 4GOJA 2PL3A 4HAZA 4O25A 4F38A 4YXWD 3B9PA 2H16A 2GCPA 3R8CA 3SYNA 2R6CA 2UZIR 5TV2A 5M04A 2IS4A 1Y63A 3AVVA 5JS8A 3AP3A 1XEFA 1A82A 1T8UA 1DARA 2VL7A 2YWGA 4ABYA 2LCFA 4B75A 4LJ9A 1II9A 1WBDA 1PVOA 1C1YA 3NKVA 2GF0A 5KDDA 3KQNA 3RHFA 5EE3A 2GNOA 2VSOA 2OZEA 4CEHB 1OSNA 2GBLC 4Y0AA 1LNZA 2WJGA 4DLSA 3U2QA 4D0NA 5FTLA 3GCGA 5KDLA 5JJKA 2HLDD 2OBLA 4GPTA 4LWZA 1ZW6A 2D62A 5FBWB 1GG2A 2HJVA 1T8TA 2WWIA 3NH9A 1U99A 3VNUA 4C0JA 2WBLC 3FB4A 4M9ZA 4W9MC 4A15A 3P4YA 5FOVA 2A5GA 4LUCA 4RZXA 4PC3A 1UEJA 1M1YE 1KI1A 2R44A 3GQBA 3GLGE 4PANA 4NYJQ 1XPOA 1P9NA 1T9HA 3EPHA 1EFTA 4IDNA 1G5RA 3UATA 1CTQA 3C41J 4RD2A 3T1OA 1WQ1R 4TT3D 3F3YA 1G8GA 5JWHA 5IK2D 4BLRA 4RD4A 1HTWA 4EDHA 4ZCIA 2OT3B 2YOHA 1G20E 3UIEA 4RFVA 3BRWD 2RGBA 1ZD1A 1ZCBA 5KSPA 1Z3IX 3C7KA 1KI7A 1B0UA 5UKDA 2IC5A 2HUPA 1ZC4A 3QPWA 3IEUA 1LY1A 1HEIA 2QROA 3OFNA 3A6PC 5BW8A 3MJHA 1UKVY 2RGXA 3R9XA 3KKMA 5KSOA 1YU9A 1VCNA 2IS6A 4EPVA 4HLCA 1UAAA 2J87A 4UJ3A 5C2JB 1SHKA 3U3RA 1C9KA 3FMFA 5GVRA 2OO7A 4ZCMA 4Q4JA 2ERXA 4LV5B 5DE3A 1G17A 3K8YA 2VRWA 2IYSA 3S1AB 1CP2A 4AWXA 2O8BA 2DFKB 1W44A 5FOSA 4GOKA 2ZS9A 4K46A 4CEJA 1YZNA 1ZYUA 2QEQA 1B23P 3SQXA 1R5OA 1P73A 2ZYUX 5EXTA 3QQ5A 3IIJA 2BEJA 1WRBA 1LVGA 4K81B 4XH9B 1AQYA 1P3JA 4EJSA 2GXSA 4KBGA 4QG7A 3M1IA 3VR5A 1SHZA 1N5JA 4LHZA 3N5CA 3NBFA 5GADl 2CCGA 2BMEA 3BC1A 2OLJA 3MWJA 4BPBA 1K6MA 4OI1A 3C14C 3ZS8A 1J70A 1EX6A 2ZRDA 4XD7D 4DCUA 5AWFC 2F43A 2OXRA 3A4MA 3CF0A 2QAGA 3I32A 5AK0A 2IUUA 4UNRA 3I4LA 4XWKA 2GRJA 2QI9C 4DB4A 1WBBA 1FX0B 1KAOA 3AF0A 4Q02A 1MT0A 1SVIA 4LGMA 4A8JA 2G6BA 3A36A 4PHHA 3A1WA 1Q3TA 3IKJA 2BBOA 4BFVA 4ESHA 2A5JA 3JZAA 1KO5A 3J81k 2RGAA 3SYLA 2AKAB 2N1BA 3EG5A 2ZJAA 4HI0E 3IBYA 3CPJB 4KODA 1E1QD 1F2UB 3MCAA 2ZRFA 5CDFE 5EE9A 4HZUB 4Q21A 1OIVA 4UNNA 3DKPA 1NN3A 4PPGA 3ZJYA 5FBVB 3A37A 4FWIB 2IYWA 3GJ3A 1D6JA 4DLUA 1AK2A 5FUXA 1DAKA 4LJYA 1U9IC 2P2LA 2VEDA 5FFMA 1OXSC 4W7SA 1Z28A 3OHMA 5JSZA 4KFTA 3TAUA 1CRQA 4KAXA 2YJTD 4OK6A 4Q7MB 4R2HA 5FOWA 2REBA 4TLDA 5HPYB 2FFAA 4C2UA 4WZAE 3NG1A 2EW1A 5FPSA 3ZVRA 2ODEA 1E4VA 2XSZA 4IOLA 5HE9A 3RRNA 3ADDA 1RYHA 2VIIA 1MH1A 1MO5A 2W58A 4BEBA 3L0PA 1E2NA 1WMSA 2J9RA 2I1VB 5DLQC 3Q7PA 3CF2A 2C95A 1QF9A 2IYLD 2WOJA 3LBNA 3EXAA 3ADCA 1WDTA 4DJTA 2DPXA 2XB4A 4P31A 3BIFA 2GK6A 1II8B 2WWXA 2GTPA 4IDOA 1I2MA 1S2MA 2PEYA 4HDOB 4IEEA 3MD0A 4JL5A 3T12A 1XXHA 3GFTA 4FMCB 3AVTA 1ZU5A 2NO7A 4Q4HB 1P7CA 4IEIA 3KUCA 3TR5A 2QUZA 3HPQA 4Q1FA 1TQ2A 4BRWA 1Z63A 4DUGA 3NEYA 4XSGA 4KCGA 5DHFA 5JCPA 3TUZC 1UDWA 1F2TA 2C96A 4BLOA 3PR1A 2GVDC 4RD6A 3UG7A 1RJ9B 2XSZD 1S1CA 3VHXA 2ZU0C 3OIWA 5DIFA 4LJ8A 2C8VA 1DOAA 2IK8A 3EA5A 3UANA 1PZNA 3LW8A 1AZSC 2WSSD 4NCJA 4E09A 2EVWX 4Q18A 4FCTA 2N46A 3SJBA 3DO6A 1OB2A 1P9RA 2ORVA 1E79D 1CLUA 3BXZA 4BFWA 2JLWA 3PJRA 2DWQA 4MYUA 4XWAA 2WPDA 3ZD7A 3E70C 2IYQA 3THWA 3T35A 2BJWA 5F9HA 2ANBA 4PAOA 1NF3A 2NO6A 4Q4AA 4TL9A 3CM0A 2J0VA 1GITA 1NN1A 3F0TA 3V4RA 2R8RA 2BVNA 2IUTA 4WAUA 3GLHB 1QG2A 3MMPA 4JKIA 4LPKA 3RAPR 3RRMA 3VKWA 1U8YA 3K53A 3OEHD 4NL4H 4LJ4A 3DM5A 3BBPA 2ZJYA 5IT5A 2QN6A 2ZANA 4URYR 3CRRA 5IRCD 4DUGD 4CGZA 5GJCA 1E9SA 2CK3A 4A2QA 2G0NA 1J7KA 1NN0A 1RVDA 2R9VA 1HE1C 1DELA 5FTKA 4CEIA 3KTAB 2BMJA 2LKDA 5A0FA 2P67A 2EWVA 4NCNA 2RB4A 2G9NA 3IUYA 4OI2A 2IF2A 1W0KD 3EASA 3F8TA 3ZIAA 1QZXA 2WPDD 2YOGA 1ZRHA 4QGFA 4ZDWA 3KXLA 2IYVA 3KXIA 2PJZA 1XMVA 2R65A 1LTQA 1RFLA 3QXHA 4Z1MA 2NMVA 1Z6GA 1R4AA 4P4TA 3WMGA 1W36D 4GNKA 2D2EA 1JB1A 3QF4A 4Q1BA 5JJIA 2ZI4A 2CMKA 4GBMA 3BFXA 2H5EA 4AYTA 1TF2A 4V0ME 2IX3A 1CR4A 4RZ3A 3U6BA 1W36B 2YWHA 2XZPA 3HR7A 3U61B 4Q19A 3K0CA 3W8RA 1E2IA 4MYTA 2KSQA 3N2IA 3SOPA 2IF0A 4BEJA 3UMFA 3AF1A 2CK3D 3C8UA 3D8BA 1JECA 1XEXA 1I4TD 4MRPA 3UWOA 5KNCA 3AF4A 2DFNA 2XTNA 4QFMA 3T5GA 1UKZA 1U8AA 2UKDA 4AKHA 2O52A 1MOZA 1ZC3A 3A1TA 3REGA 2PT7A 4HLUC 3ZIAD 3R8FA 5ELXA 3U3OA 2P6RA 3L82B 2YHSA 2EYUA 4ZIRA 3B5JA 5EQTA 2ZYWX 4Z1MD 1YE8A 3LH5A 1E98A 4Q01A 2QZ4A 4PSAA 3TIFA 1F60A 1NI3A 4HDQB 1Q22A 3QKRA 4YMTA 3N70A 4TWZA 1VCOA 4TSFA 1G16A 4P4SA 4RD1A 5FOXA 3HDTA 3ZZUA 4BLSA 4CT4B 1VHTA 4G5OA 2A5YB 3QXCA 1S1MA 3AKYA 1XZQA 3KQHA 4OQFA 1G6OA 1D5CA 2B6HA 2SHKA 3BGWA 1OYYA 2CHVA 2FOLA 2QBYA 1IN5A 1LFDB 2HJGA 1GL7A 1KDTA 1W0JA 3B7GA 4Q1DA 2F1JA 1SVSA 1CR0A 1LW7A 3LNCA 4F4IA 4C0LA 4M1YA 1G18A 4X8OA 3EC1A 2FU5C 1DBSA 4LY6A 4TZ0A 2P6NA 4NYIQ 1KMHA 2EFEB 1HQYE 4I1SA 2V1UA 4TN1A 3K0FB 3EW9A 5K8LA 2REXB 4B34A 2PZEA 1XEWY 1N6KA 4JT4A 2Q3HA 3QY0A 2P5SA 4HSEA 2O8DB 1SVOA 5H70A 1MABB 1P72A 1AS0A 1CS4C 2FFQA 3WHLA 4CZ2A 1ZJ6A 4V0NA 2GHIA 2WIBA 3E1SA 4TSFD 4IXNA 2CHQA 4M9XA 4B71A 2ZETA 1E0AA 3DDCA 4M0LA 2G1JA 4ZO4A 1OYWA 2GZAA 1S3GA 4EFMA 1KK2A 2J5XA 1U90A 1ZUIA 1L4YA 2PLFA 1XU4A 3L2OB 1N0VC 3OZXA 5H68A 2H8KA 2KJQA 3E2IA 3W6PA 4URXR 1G8PA 1EXMA 2R2AA 4HB2A 4AD8A 1OH8A 1DG3A 4NU0A 4PXAA 1HE8B 4BFYA 2KWIA 4PAMA 3DZ8A 4WVFA 2D06A 4OQXA 2GCNA 1ZMXA 3K0AB 5J4KA 3IPXA 2RGGA 2A5DA 3I73A 2AK3A 4FINA 1JAIA 1E2GA 1EGAA 1UBCA 2QAGC 1OH6A 1BMFD 1KMQA 2KE5A 3G5UA 1E9DA 4F93B 1CJVC 5EXSA 2NOAA 3Q3JB 5HTKA 4MRNA 1KO1A 3EZFA 4M1WA 1SVMA 3CRW1 4JYBA 5LD2C 2WVJA 5D3MA 1Q1QA 4P0TA 4A8JC 3FYHA 4Q1EA 4V0KA 1UDXA 2AWNA 3X1DA 2OESA 4AYXA 2GJAA 2AD1A 1OIXA 3BE4A 4I1VA 4R71A 1E2HA 1OHHA 1IN4A 1TPZA 2FWRA 3JVVA 4KFUA 1COWD 2CJWA 1UPTA 4RZ2A 1NBMA 4FMDF 1AGPA 2AD5A 2JAQA 2J59A 3UMSA 3QKSA 1U0HC 1IY1A 1UADA 2IWHA 4I99A 1OXUA 2JDIA 3HYTA 3Q5EA 1J99A 1QHGA 1J8MF 3QOFA 4C0HA 1JNYA 3GLFB 2W2VA 5CJPA 2GJKA 4TMKA 1KK3A 1W4BA 1TF7A 2CL7X 1TL7C 2FEOA 3GJ0A 2J46A 4NPHA 2ZUBA 1ZIPA 2F9LA 2PLRA 2QQ0A 5DI3A 1KO4A 3EPKA 2QMEA 4IDHA 4EPXA 2NPFA 1LF5A 2RCNA 2QTFA 5KDOA 4TYWA 4YMUA 2G3YA 2GAAA 3OAAA 4DLYA 3GLIA 1U9IA 4DKXA 1GRRA 1X1SA 2ZS8A 5E7IA 5KSZA 3RANA 4QJ3A 1XRJA 4OK3A 2ZIAA 4DDTA 2NZ8A 2HXSA 5DH9A 4LK2A 721PA 4NYMR 1YZQA 5G41A 1IN7A 4QC2A 2JDID 1LB1B 2QT1A 1ZAKA 1DO2A 3IBGA 4TL6A 3T06B 3UG6A 3DPUA 1JPNA 2OE2A 2ORIA 3MAAC 4G5GA 4ZPXA 2QTHA 4BUJA 3PV0A 1VPLA 1X1RA 4R98A 4CT5A 3BB3A 4ZDIA 5H8WA 2O0KA 1OIWA 1I4LD 3T15A 1OF1A 1P4SA 3VTKA 2VF7A 5EUMA 4KFRA 4CIDA 1Z2CA 3AVYA 4AKIA 2GVZC 2ZJZA 3ZQ6A 1TNDA 1BO6A 1S8FA 3X1ZA 1KI9A 1DTSA 4JLJA 2QA5A 2JGNA 3OAAD 3X1YA 3I8XA 1U2RA 3R20A 4Y0VA 3GLFE 4BE7B 4HZIA 2X2FA 2R6AA 3QEOA 1GKYA 4Q00A 5J40A 4IVQA 4JVMA 3BB1A 4L5BA 4RCYA 5GJWC 1WE2A 2FNAA 3GJ6A 1GOTA 4DLXA 2XOKA 1YR6A 4QJ5A 1OFUX 1X8KA 2FMXA 4B3XA 2Z43A 3OIVA 2VH5R 1W36C 4MGYR 4U00A 3I92A 3DOEA 4QBHA 1NJFA 1R0YA 4L8GA 4PQRA 4PPNA 2GK7A 4DSOA 2B7BA 4IFEA 4HAYA 3GLGA 1VECA 1RYFA 1ZU4A 3W3AA 4PSVA 1SVWA 4JSTA 4G5RA 4DDWA 4GMXA 4HATA 3RSLA 3SBEA 1DE0A 2DCUA 4NBSA 5HE8A 3CNLA 4QGHA 4FD2A 4F4CA 4LOAA 3A58B 4NE2A 3ZLJA 3W6NA 2J1LA 4M1TA 4P3YA 3QBVA 1M7BA 4ZDJA 2IYXA 3AF3A 2ANCA 1XZPA 2QE7D 3HU2A 2V3CC 4DBLC 4KFSA 2EU8A 2HF8A 1W4RA 4F7WA 5L3RA 2GZHA 3PQCA 2OG2A 3AV0B 2XZOA 1KK0A 1PLLA 2XOKD 1KNQA 3KB2A 2X1VA 1CBUA 4LCBA 3MWYW 5FTNA 2XJ4A 2AR7A 3FFAA 1Z6YA 3TQCA 3AGQA 1NVVR 2AL7A 4JS0A 4IHQA 4LJ6A 5F2EA 4JSYA 3B1VA 4LDJA 5FOUA 2JJ2A 4MGIR 1Z07A 5B58C 2B8TA 2JLVA 5E7MA 2V7QA 1Q21A 2W2XA 3NBXX 1Z0FA 4B74A 4DLTA 6Q21A 2Z4SA 5B64A 4B76A 3CKLA 3K0CC 1M2OB 4LYAA 1N2CE 3RVBA 2QM8A 2VTKA 4CEHA 5K8UA 1Q1EA 2F55A 1U98A 2DB3A 2C98A 2IEYA 4O2RA 1X8JA 1VYTA 4OHVA 1TQ6A 4NP6A 1Z83A 4PAQA 1NRJB 1IM2A 5KO2A 4OQMA 4IDPA 4BFUA 2JLZA 2HLDA 2QPAA 3MLEA 3PCRB 4IXMA 1IHUA 3P27A 4JYCA 2G0TA 4MUAA 1CRPA 4JVLA 5KYKA 1NY6A 3IILA 1OXVA 2PMDA 3TRFA 2I3BA 3D31A 1JJ7A 1JPJA 1KSHA 3EIEA 4QHYA 4OJQA 3QJYA 4IDQA 1QHHB 1HY3A 3IO5A 5CLLA 4OHXA 4KSCA 2JJ2D 2RGDA 2AWOA 2XTMA 1TTTA 5EZ6B 2V7QD 4TT3A 2H18A 5IK2A 2WOOA 1VG0B 2MSEB 4HLUA 1II0A 3CR7A 3VHLB 1Z0JA 2FSFA 5CDFA 4TMZA 4AKGA 3P32A 3HYRA 1T0HB 2YWEA 3FHCB 1T3HA 2WV9A 2CLSA 5JMTA 2F1HA 2FFBA 5HKKA 3EPLA 1CJUC 4TQ9A 3OESA 2H17A 1YRAA 1YRBA 3M4YA 5JS7A 3S1AA 5TARA 3PEUA 5DYIA 4BGDA 2XEXA 1QBKC 2YVUA 4WIAA 4US1R 1OFIA 4RCZA 1NVXQ 4URUR 4PO9A 2ZVPX 3JZMA 4E03A 4BQSA 4TLCA 2ZRJA 2O8CB 2BHRA 1XD8A 4M1MA 4FXPA 1JAHA 2WWYA 1NVUQ 4DCSA 3EZ6A 3AF2A 3REFA 2J0SA 1NIJA 1A2KC 2AKYA 4GI7A 3TAHA 4F92B 1G21E 5J4VA 3C16C 3VR3A 3WY9A 3GFPA 4GFDA 2C9YA 3P4XA 3ASZA 4MRSA 3O8RA 1TUIA 4LZZA 3HU1A 2A7QA 1EFRD 1KI4A 4XD7A 4QJ4A 1FX0A 1TAGA 4TL8A 5GVSA 3RSOA 4DSNA 5HKKD 4IVRA 5FBQB 2D3WA 3TW4A 2C04A 1JQJC 2Q3MA 4TQAA 3BOSA 4TMVA 4RZUA 4OI0A 2GF9A 4DDVA 1MO3A 1R5BA 5EJEA 2F3RA 2H1LA 2BBTA 4TL7A 5JHHB 3EWSA 4D0LB 2ZVQX 1KDOA 4KVGA 1F2UA 4S35A 2ZE5A 4AY2A 1ZNWA 2VPPA 4HZUA 4AURA 3AP1A 2VHJA 1G41A 2ZSFA 2VHUA 3SHWA 1S4QA 2CXXA 1SVLA 4LX0A 4FI3C 2RMKA 3CBQA 4KYUA 1E1QA 3I5XA 1CKEA 4B32A 1IONA 2OUKA 4HLQB 2C9CA 4KYIB 4W5WA 2ZJ2A 3HR8A 4P4UA 2J41A 2IL1A 3H2YA 1UEIA 3UWKA 2B7CA 4M21A 3OF5A 4LHXA 3TVDA 2HT1A 2Q6TA 3B13B 4TYNA 3LBIA 2WAYA 2WTUA 5TB5A 2QPOA 3PUZA 4RKEA 1ZD8A 1GTVA 3PITA 4OBEA 1DAIA 1GM5A 2V6JA 3U60B 1N0WA 3K9LA 1KOFA 4EUNA 1VCMA 5FR1A 3BFVA 2QL6A 1XFAA 4RKFA 4BASA 2BWJA 1G4AE 3KFXA 2ZI3A 2FPLA 1N6OA 1QG4A 3PUWA 1T6NA 1T91A 2V1XA 4XOIA 1SULA 4OKSA 3THYB 2ZRMA 4B44A 1HURA 4Q4HA 4DVGA 1DADA 1EFHA 2KBFA 1KSGA 3UPUA 4EPRA 821PA 1E0KA 3TK1A 2Z4RA 3SYKA 3IPYA 1I2DA 3B1YA 4TQUS 3B1XA 4Q7KA 2VP4A 3FWYA 1UBGA 3CX7A 3BJIC 1Z47A 2H7VA 2BEKA 1D8TA 3TQFA 1OXTA 4CVNA 2HEIA 2Z6VA 4A92A 2OAP1 2VP2A 4OQLA 1RJ9A 3RNLA 1GP2A 2EFCB 2FPKA 4B73A 2O8EB 1JXMA 2FSIA 1ZM7A 1G3UA 4V0MA 4HUQA 4Q4JB 3FMPB 4JVSB 4JBWA 3TW8B 1G9XA 1Q12A 3K9NA 5CK5A 3THXB 1W49A 2H57A 2AXPA 1VTKA 3SFZA 2OCAA 3CWQA 2ZR7A 5AJXA 3BFKA 3BORA 2O0JA 2FPMA 2WSSA 3NDPA 1EESA 4EJSB 2QNRA 1XD2B 2DFTA 4C0QC 4XTRA 2X8AA 1GNPA 1X8LA 2A30A 3K09A 1E79A 4B33A 4L9WA 4C3ZA 2ZSDA 1E9EA 2UVQA 4JKYA 3A1SA 2QP9X 3AVPA 4AKEA 1YZKA 2R62A 1F48A 5FTMA 4M4SA 4WXRA 5L3QB 1KY2A 1E0JA 1ZD9A 4PC2A 1AJEA 3PENA 4BZQA 3WYGA 4TZ6A 1IXRC 2FGJA 4MITA 2YNMA 3Q7QA 4Z8XA 1O87A 4MUBA 1XPRA 3R7WA 3OEHA 521PA 1BH2A 1JXOA 3LX8A 4N3NA 2IUSA 1GKUB 3B6EA 3KTAA 5GJVC 2G88A 3QXJA 4LBYA 1H8EA 4OHWA 1R0XA 4YDHB 1R0WA 2FF7A 2WM9B 2O0HA 3CX8A 2XGJA 2D7CA 1Q1ZA 1E6CA 1HT1E 1F6BA 2P65A 3CW2A 1DAGA 1Z29A 5ANRB 1P75A 4Q1CA 4E07A 5DN6D 4TTRA 4HAUA 1UBFA 3K9HA 3DOFA 1CXZA 3EAQA 4PHTA 1W0KA 1U94A 4IJMA 2EFHB 2F1IA 4TMXA 3RS2A 1N0UA 5EXPA 4B48A 2CL6X 4L4UA 5TXGA 3WNCA 3I62A 5BYJA 3VU9B 4BLTA 1Z5ZA 1CF4A 5JWRA 1G3RA 1M74A 2YWFA 4PZLA 2FEMA 5KPDA 3PEVA 3L0SA 3MWLA 2VHCA 3AUYA 2AFIE 5LB2A 2GEUA 4LBVA 1OH7A 3LO5A 3DMDA 4D81A 1VIYA 3OE7D 1OT3A 5BN5A 3RC8A 1YR8A 1HT2E 1JQLB 4WA7A 3NIBA 2ODNA 4ASUA 1JEDA 3TGPA 4LBZA 3CR8A 1ANKA 4AI6A 4QBIA 1H8ED 1Q0UA 4D26A 4LYHA 2XXAB 4G3XA 4U7DA 1D9XA 2GKSA 3ICEA 4O0MA 5AUNB 2QT0A 3CPEA 1Q20A 1TQ4A 1RZ3A 3K70B 5EZ5A 1G19A 4B2PA 3NVAA 1P9WA 4OK5A 3H0KA 1SGWA 2GESA 5KPJA 4N0DA 2QG6A 2VYFA 5H1YA 2WHXA 1DPFA 2O8FB 1UM8A 2IHYA 1XXHB 2J45A 2P5TB 2PCJA 3TVTA 4B35A 3RRZA 1D2NA 3RC3A 2NZJA 4HAWA 4AIIA 1BIFA 2B21A 2P3SA 1ZM2A 4BRUA 1K5DA 2V4ZA 3BAFA 1KDRA 1GILA 2CNWA 3W3ZB 4D80A 3PEWA 3GEEA 4UNQA 5DO9A 3U3MA 4BFXA 3B1WA 1S3SA 4ASUD 4NMMA 5F3WB 4JJKA 1FUKA 1KI6A 2ODWA 4QHTA 5FPHA 4PPFA 5AR1A 3HP1A 5KUTA 4C0KA 3IQXA 3HPRA 5JHGB 4V02A 1FNMA 5DISB 3WRXC 4QL3A 2O8DA 3KDSE 3RS0A 3U7HB 1MABA 1T5LA 1NIPA 1E2MA 4PX9A 3GLHE 2EFDB 1QHYA 3UXMA 1A7JA 1GIAA 4H9GA 1E2PA 2F3TA 5C18A 4B6EA 1D2MA 1CU1A 1TUEA 3LXXA 4EQ6B 2WWGA 4XIGS 2IW3A 4GOXA 1K5GA 2DWPA 2J7PD 4LPSA 3EX7C 5TVKA 1U0JA 5B30A 1YQTA 2HYIC 3QG5A 5JJLA 2GJ8A 3AKEA 1TMKA 4M9QA 4YONB 1PV4A 3AVUA 2CNWD 3NXSA 4GP7A 2BJVA 3GJ8A 3AP2A 1Z22A 3FVQA 3U44A 2D74A 3L8YA 4EPYA 2BV3A 5KTYA 1AA9A 1DAHA 3KUDA 2IS1A 4QHSA 4HEJA 3QF7A 4NHOA 2FH5B 2FZLA 4ILEA 2PBRA 5CIQA 3KQLA 1EWQA 1W5SA 1FL9A 3U44B 1CJMA 2IYTA 1N6PA 4OQNA 4Q1AA 2F7SA 2QMOA 3ZD6A 3V4FA 4D6PA 3MRSA 1XWIA 3KXKA 2OV2A 2RGEA 4JT2A 3FTQA 5FBRB 2JLYA 4PQYA 1E9BA 3LLUA 3H86A 3MSXA 4ARZB 1KI3A 2J7KA 1DVRA 1M6NA 2GJ9A 2C99A 1SXJB 1Z0AA 4CYMA 1GL9B 4PTLA 1E9CA 4UJ5A 1BMFA 1E0SA 4FMCF 4DIEA 4EKDA 3ZH9B 5JRZA 1Y3AA 1ZVQA 4MYHA 1JR6A 3LW7A 1VDZA 2R6FA 2YC4C 2ZRHA 4PC7A 4W5HA 2QPTA 2XB2A 3MWKA 2Q9BA 2QQEA 2VP6A 2PX0A 4QRHA 1IAQA 3TBKA 2VP9A 3VKHA 2ODBA 4X8HA 4WXPA 3KL4A 4L15A 5HZHA 2Y8EA 1VKJA 3OIUA 1L4UA 1ZUNB 2NG1A 4FIDA 2CE7A 5AJYA 3LLMA 5KSYA 3I61A 1COWA 2GJSA 3GLFA 1A4RA 2MMCA 4GSYA 1BYUA 1KSJA 2ZTSA 1G7TA 2NO1A 4ZIRB 4G5QA 3C5HA 4RJLA 1EFUA 4LI0A 4DZZA 2ZYTX 1GKIA 3M0EA 3VX4A 4NYMQ 1OJLA 2RKOA 3QVUA 1QHXA 2W6JA 3P26A 4D0GA 2WIAA 1NG9A 2BMFA 2IYYA 3FKQA 3QNUA 4FW9A 4ON9A 2V6IA 1G64A 1GNRA 1YZTA 4AG6A 1Q44A 1Z0IA 3EZ2A 4QGGA 5FPTA 5JI3E 1FFHA 3RS3A 4E5UA 4UXJA 3EA0A 1H8HD 1KYIA 1M7HA 3CO5A 1NLYA 1R8QA 1XTSA 4PC6A 5D3QA 3TR0A 5IHPA 5AJWA 4GDFA 1OB5A 4TTPA 1GVNB 1P2TA 5EE0A 1RW4A 4MKGA 1EFCA 4ESVA 1FZQA 3BK7A 1SXJE 2HYDA 4WW0A 1DG1G 4Z51A 1GL6A 2HV8A 2JIZA 4C30A 1IN6A 3H1TA 3ZVLA 4IW3B 3B1ZA 2DWOA 2YOFA 1P61B 2OFWA 2QM7A 4W5JA 1G1MA 3Q5DA 1XDBA 5CB8A 5CLQA 1MV5A 5FL7A 2CL0X 2OCPA 5LB4A 2V9PA 1PUJA 4MGKR 4GT1A 3CUEF 3N2EA 5GJBA 2W6JD 2X2EA 1OXXK 4DT1B 4M1KA 4ZCLA 1TQDA 2C2HA 1JR3D 4NCIA 4A0GA 2MMGA 4L9SA 2WMNB 5FH9A 8OHMA 1OFTA 5C46F 5L3SB 2VP0A 4JLNA 3DL0A 2E9SA 4C7OB 3NWJA 1TADA 1FTSA 2EFGA 3GD7A 4LJ7A 4D4KA 3VFDA 3U7GA 5L8VA 1U81A 1AS2A 3K09C 1E94E 1E2KA 3FOZA 1Z0KA 2JIZD 1XMJA 2JEOA 2REOA 1XMIA 1LS1A 1R10A 1CR2A 1S9HA 4KXFB 5FUYA 4B3DA 4CDGA 3BS4A 4LC0A 3X1XA 5DSZA 5FL7D 4TYYA 5EE5B 4U02A 2ZYVX 3O8BA 4A82A 4KI0A 1FMJA 2PMKA 4Z54A 5FUVA 3NC1C 2CHGA 4DB2A 2IEZA 3ZQJA 1XB2A 1SQ5A 3RS4A 1AGRA 3DVLA 1NVVQ 3AQ4A 5EP3A 4ZI2A 3HJNA 4YMVA 1M7GA 4K8OA 2OCBA 2BM0A 3Q8XB 3RYTC 1KSFX 4M53A 4FCWA 5FPYA 5AUQA 1E96A 2E87A 1W4AA 4PR0A 3G0HA 3QKTA 4BFTA 1EWRA 4DSUA 1PUIA 3FHOA 4WZBE 2OCYC 2QE7A 4POAA 4JL8A 5CM8B 2BBWA 3JVUA 3WYFA 2N42A 1X6VA 3A4NA 2YKGA 1FNNA 1F5NA 3U3KA 3IGFA 3CWZA 4B6FA 2GXQA 5JZVA 3B85A 5HR5A 1R0ZA 2ZSEA 2O5VA 3LX5A 1VCIA 2XX3A 2YV5A 3MGCA 3CONA 4JLDA 4PO1A 3WBJA 4D82A 1FP7A 1BKDR 1JR3E 1W2HA 3CZQA 3ZZ0A 3PG5A 3NH6A 2FZ4A 1E9AA 4F4JA 1SKYB 3EPJA 1IJFA 3MJRA 2DBYA 1DS6A 1R7RA 3GEHA 5FUWA 1US8B 1IQPA 2C78A 1QRAA 1U0LA 3Q85A 3SU8A 4D2IA 2QGZA 4UKDA 3TJZA 1T0JB 4GZLA 5JECA 2L0XA 4JLBA 1D2EA 1CR1A 2ZI7A 3MFYA 621PA 2VSFA 1LF0A 3CX6A 3PUXA 4LV6A 4D4JA 2ZJBA 4U5XA 4RSGA 3IEVA 5L3VA 4JLMA 2DYKA 3D6TB 2ZI5A 3FPAA 2IXFA 4NTZA 1IJEA 4Q48A 2ZRLA 1NKTA 4KVAA 5JWOA 2ORWA 4LYFA 1VIAA 2V8OA 3NEJA 4QNRA 3QI2A 3QSYA 1QHHA 2W00A 3NHAA 2IHBA 3FDIA 2BCGY 1ZP6A 2ZJOA 2ZRBA 4URZR 4X8MA 4DLRA 3LWNA 1CULC 2WSMA 3PUVA 2EQBA 2ATVA 2VLIA 2KB0A 2WMOB 5KU1A 1CEEA 1FP6A 2WZQA 3LQRA 2VA8A 1ZNYA 3ECCA 1DO0A 4YMSA 3W90A 4HB4A 4DCTA 2I1QA 3EZ9A 3T1QA 5HCIA 1VHLA 3AKDA 1L2TA 3U4QB 4JVNA 4YQFA 1P6XA 1WA5A 4KO8A 3E5HA 3VQTA 4KBFA 1W2GA 1NLFA 1G8YA 5JFGA 3W34A 5C1BA 4NDZA 2O8CA 2R6DA 4LC1A 4QNMA 2GEDA 4US0R 1SKYE 4PHFA 3WRYC 2GCOB 1Z6AA 4UXIA 4WBSA 3B82A 5CYOA 5DGXA 3AUXA 1W1WA 3U3JA 3BH7A 1W5TA 2D2FA 2V54A 3L0IB 3TLXA 1HA3A 2QY9A 3WBKA 4B2LA 3WMFA 1A2BA 1E32A 1KK1A 5G3ZA 1E2EA 4MYCA 1MRSA 1N6RA 1G6HA 2BOVA 1CJTC 5LPNA 1ZBDA 1G8FA 1PLJA 4P32A 1ZM3A 3SDZA 1NMZA 3UK6A 1N6IA 3TSZA 3EARA 1YVDA 2CEAA 4FCVA 5P21A 5G53C 3SN6A 3DHWC 4R7ZA 3PFIA 4Q9LA 5C4MA 2RHDA 1EFRA 4C2TA 4JIMA 4HB0A 1Z06A 2X77A 4LHYA 1IN8A 2XAUA 1E2FA 3FFBA 4Q7LA 2AXNA 3SQWA 3CPHA 4DLVA 1TU4A 1QDEA 2PT5A 3T5DA 1RRCA 2CVFA 5FOTA 2AN9A 4KHZA 1Z08A 3EZ7A 4HLDA 4JLPA 1G3MA 2ZRPA 1WF3A 2QTVB 4QKQA 4DCVA 4D4MA 2HDNB 5BWMA 1O3YA 4V0OA 3B9QA 1L8QA 1IOZA 1IBRA 2Q3FA 5HZKA 4NKRA 4L16A 5DYGA 1TX4B 4TLAA 4IFBA 4II7A 1NMXA 3I1FA 4URWR 1ESNA 3AB3A 4CW7A 2P6UA 1KI8A 3VAAA 3CB4A 5FL3A 4BLQA 2QRZA 4BLPA 1HUQA 2NQ2C 5JEEA 3GFOA 3RLFA 5TMPA 1OPXA 3CH4B 1NY5A 1ELOA 3ETLA 3I8SA 3KJHA 5AJVB 2F6RA 4XVUA 2XJ9A 1GFIA 2GA8A 1MO6A 1GRNA 4DCNA 4EAQA 3SNHA 1W7AA 2GXAA 5JEDA 1DAMA 4DHEA 2OSBA 2ZRNA 3LDAA 5E95A 1Z6TA 2IYZA 2VHQA 3X2SA 2FA9A 1NG1A 3QXXA 4RFSB 2J0UB 3LRPA 3VNVA 4JL6A 2QU8A 3CIOA 2PJRA 3I3SR 3FE2A 3K1JA 4XTCS 5EP2A 3LQQA 4OYHA 3THYA 1EX7A 4AG5A 4N1AA 3SBDA 1VG9B 1WXQA 3FKSA 1ETUA 2LKCA 4DIDA 1R6BX 1E2QA 1LS6A 1WCV1 2QAJA 2W0MA 1GWNA 1KI2A 4BWYA 1Q3HA 3SJCA 1KJWA 1QHIA 2FSGA 2WJIA 1AM4D 1OLOA 3KKQA 4JLVA 3B8HA 2Q21A 3DZDA 3VMFA 4XSHA 1E3MA 5B57C 2Q0HA 2O8EA 2GDJA 2VHTA 2JJ1A 4PZZA 2OBNA 4M8NE 3LXRA 3TSWA 3RS7A 4KITB 1GDDA 3THXA 3V00A 4QGAA 2ZUCA 2QGNA 5BXQC 3CRVA 1XD2A 2IBMA 3D3QA 1DAFA 1XJCA 4D25A
chains in the Genus database with same CATH superfamily
3U26A 2Y68A 1CUXA 4WEOA 3NBUA 2C9OA 1JI0A 4TOIA 5CNIA 3ROTA 2ACVA 4ZVSA 4UBLA 1EGMB 4L4YA 1II8A 2BBSA 3FKSD 1YBFA 3T3HA 1KZ9A 3N0VA 2GZDA 2WSBA 4NZYA 1DBVO 1DKLA 4U7TB 2WHQA 3E03A 1IRXA 1H6AA 1Y34E 4DWJA 4C0WA 1HNZB 3L77A 4BMPB 4HAOA 2DBQA 7YASA 5KWSA 4UZEA 6CHYA 1WW3A 1C9DB 3BK1A 1R6AA 3HXPA 1CQJB 3HLKA 3MTGA 1N75A 3D5TA 3OMLA 3RCBA 2C97A 5LU8A 5EXXA 4UQOA 4UU7A 3HP4A 2MTBA 2JJ1D 1HKHA 1XCLA 1EHIA 3LECA 4QOSA 1GY8A 3LYLA 1EK1A 1Q0LA 1KDPA 3MPOA 3EEQA 3R75A 5K9ZA 1P45A 1DBIA 3MCVA 2DHRA 2APJA 2W6IA 4S04A 2YZ2A 3GJ5A 1CF2O 4YO8A 3TRDA 1DIGA 2GWRA 4X93A 3PYLA 4JDUA 5BPHA 2W0SA 4WLFA 2VJMB 2GLTA 2X1MA 3SQLA 1VYUA 2BGNA 3BICA 3Q9LA 3NAMA 2ZROA 3Q9NA 2AW3A 3D6JA 5LA6B 1Z6QA 2H9AA 3AKCA 3RKSA 9MHTA 2R00C 4JA0A 1I7QB 3H7AA 3T6KA 3ADOA 2HN9A 2FW1A 1Y3HA 1YZUA 2HUNA 1ISSA 5AHWA 3RO7A 4PO8A 4YJKA 2FX3A 3T38A 4Z6KA 1OQAA 4ZZ1A 5AD1A 5JAHA 4BNIA 4BECA 4M9SA 3N28A 3UXHA 4A2PA 5AW9A 4TXLA 4UHKA 3RUAA 5LIRA 1Y4ZA 2QJRA 2XCIA 4KXYA 4WESB 3TX6A 4HYYA 5CT5A 1JHMA 3N39C 4YN3A 3GLHA 2Z83A 3X43A 2QD2A 2X5XA 4OHPA 2VQSA 3GAFA 4UPVA 2B6NA 4UE2A 5EWJA 1V1RA 1IZZA 4CM3A 4EECA 3HUEA 2VP3A 4J16C 1K7CA 4R1PA 3QPUA 3UWSA 1JHZA 2HRRA 3TKAA 4LRYA 1U31A 3D7MA 5EXDA 5LQKA 2YRFA 1MKYA 4HNSA 4IQ0A 4ZAGA 1PV2A 5ESRA 2XXAA 4ZQFA 3PC8A 3VGPA 3LDFA 1FDRA 1GEGA 3A4LA 4OSPA 4RY2A 5J5CA 1JMVA 1ADJA 3DXFA 4PRKA 3FI9A 2HXYA 2OV1A 1AZTA 1GAJA 2CE2X 3FFTA 4F8EA 4ZU1X 3TSOA 5AW4A 4L9RA 2Z9CA 2LV8A 3BSWA 1C81A 5A9SB 1A88A 4RU1A 3X1WA 4L5JA 1YVPA 2Z2ZA 1Z13A 3GPLA 2WJVA 1QQBA 4FOTA 2R8OA 3LAWA 4FMBB 4RPIA 3V8VA 1T5SA 1YS6A 4ZV7A 1KZ6A 2C5HA 4AJ2A 1A8HA 4BP1A 2ZEJA 5KOYA 3W5BA 2QSYA 2C2YA 1RKQA 1CSEE 8ATCA 4US2R 2IPXA 2WMDA 5B6JA 3QFHA 1DUSA 4UVDA 4HUJA 3AB8A 1G3QA 4ZQIA 1C7ZA 2X3YA 4D0RA 1V16A 2OR3A 1GPLA 3V7WA 3ZGXA 4BX8A 1X87A 4HNQA 4DLKA 2DLCX 4PBTA 2V65A 1G63A 1NUAA 2WVHA 3L7YA 1ZH6A 1DOHA 5GZ6A 1XFDA 4I08A 3KQUA 1PJLA 3EFHA 4XR4A 3W2EA 4UE3S 2IH4A 2VTVA 2H4XA 4C89A 3FWZA 3SR0A 1ISIA 1Z9BA 3GNTA 3NASA 3PQ8A 2IXBA 3KYCB 1JBEA 1F0YA 2LVBA 3ADBA 5ARBA 3S1SA 4MTCA 5E6SB 4DFDA 2Z57A 3K70D 3LT2A 2M1ZA 1IXZA 5FPKA 2WAOA 5BMVB 3GZNA 1JG4A 4CIAA 3MWEB 1IATA 1U0EA 2FW9A 5BQ5A 4QDTA 4BY9E 1GAEO 3GLSA 5DLEA 1E1RD 2F3UA 1YJXA 3CEMA 2TRSB 1L1FA 2H59A 4E1BA 2C2XA 4CMJA 2XYQA 1YXMA 3EDMA 3WNZA 4EX7A 1ZR4A 4DLNA 1OH5A 2FGKA 3NXKA 4OJKA 3SHFA 1R37A 2GEVA 1LD3A 3WLKX 1P74A 5HIAA 3ABIA 1Z5GA 4QPDA 5D84A 5BPFA 4MDFA 1VIDA 3AM3A 5C80A 4FEGA 3T9AA 1V4BA 2K7FA 3OEEA 1ZM9A 2VEOA 2W48A 5A6SB 3UMMA 1RHJA 3H84A 4JYAB 3UAZA 4LVNA 9ABPA 2BGJA 4MHTA 1Y3FE 2HA5A 3HBMA 1DKRA 5ALRA 1NE7A 3O75A 3WLTA 2AF3C 3LVQE 2CB0A 4LFCB 4KQHA 4JGBA 2PL1A 2IA5A 2PLWA 3LD9A 4TROA 4E22A 2VTBB 2IWRA 1E69A 1NFRA 5DOVA 2FUG1 2JGMA 3SC2A 4IUYA 1DCMA 1P0PA 3NHJA 4NU8X 5B53A 3ZKWA 4EL5A 2JLXA 1XTKA 4GSLA 2W83A 4E15A 1NSFA 1U2SA 2P6OA 3K0FA 4QPCA 3U4CA 3GAAA 1GUAA 4IIYA 2XWSA 3GAMA 4MR9A 1VRCA 6REQA 1ADYA 4JB8A 4ZZ2A 4E2ZA 1NXXA 1YI8A 1SQ6A 2P9TA 1UIRA 1ESMA 3DE7X 4UARA 4ARZA 1X7GA 1RQ2A 4HAIA 5BSUA 3MS2A 4EA6A 1IUKA 4JFRA 4G25A 3KJEA 2QR5A 2E4UA 2GO7A 1QH8B 3VAYA 3IPAA 3B12A 3LOUA 1QVRA 2C0QA 3KNZA 4TLMB 4OFXA 1AS3A 1FDWA 2FE1A 4KYTA 5CXSA 1QUFA 3PFCA 3BN3A 3WLNA 5BN1A 3NKFA 3EW7A 3D8HA 4C2AA 1G7SA 1DCKA 2XGSA 1WDWB 2P1ZA 3FSGD 4BTLA 1U5BA 2OCDA 1N8TA 2PH1A 3N2LA 3SICE 3TUJC 3JAWA 4ABTA 2ZR0A 2EYQA 2YFKA 1ONBA 4GLJA 3P9NA 4WFIA 3HRKA 4P35A 4DABA 3K4QA 4NCBA 2J48A 4A0HA 3O4JA 4PZYA 3OJOA 3EWAA 1C50A 1AKQA 3DE4X 3G2MA 1ZUNA 3J80A 1M5TA 1Z2NX 1NLUA 1CVLA 3FXAA 2BEWA 1B6SA 4CCYA 3SS8A 5K03A 4CEIB 1AXGA 1CUJA 4BQPA 3VU1A 4M0CA 1XXHE 4OHZA 4YDRA 3TFWA 3V33A 1JKJA 5CBPB 4B85A 1PJTA 2B5WA 2A3RA 3K0AA 3Q3EA 5CMLA 3I6QA 4KNVA 5DYNA 3W2FA 4AICA 4EG1A 2VZ8A 1Z8FA 4MCJA 3QVJA 5DYYA 4URVR 2RHHA 5A5GA 2PUJA 2HU5A 2G9UA 1GA4A 2QRNA 5EJ8A 1T36B 4HWOA 1YJ8A 1L4FA 4C4RA 2ZYDA 2PU7A 2JGRA 4BZPA 1RP7A 2OBMA 2O2DA 2PKWA 1UC9A 1CE8B 4WK0B 3SJAA 3TZQA 2RH5A 3OQJA 1NVWQ 1O9BA 4CV1A 5ADHA 3CW9A 4K6CA 1Z25A 3HB0A 4IJUA 4U2KA 5AKIA 4F9TA 4JI4B 4D6XA 3FF1A 4Q3OA 5F9FA 3L7BA 4C7MA 5LP6C 3DE2X 1KI6B 3D4PA 1Z73A 4GMFA 4IZHA 3V80A 3WL8A 3C15C 4X6UA 4M76B 2Y9PB 3FCYA 3JYPA 2VJQA 1F3OA 4R2JA 4NCAA 1M0EA 4G0VA 3JU3A 1XEXB 4MWSA 4RL4A 2B30A 5ALUA 1HZZA 3LWDA 3LQ4A 3GT7A 5DCUA 4Z3KA 1XJ0A 4MYDA 4TKMA 4KOAA 1SZPA 5LZ5A 2QS9A 5KQPA 4MUKA 3OZFA 4UUAA 3Q72A 4OHMA 2QVZX 1A9ZA 1NMSA 3M1LA 1PZGA 4GQIA 1LWNA 3THOA 5H3LA 5LSAA 3PDUA 4HN9A 1IG3A 3JVIA 3GN2A 4L6CA 4RL6A 4DT1A 4ER3A 5CUQA 1GPJA 1ECJA 1QO7A 3D1LA 3FYUB 1PR3A 3IJ5A 4PSDA 1CYDA 5BO5A 2ZR8A 3RUIA 4G5SA 3OJFA 4LZLA 2EGHA 4DM3A 3QLJA 4BV2A 4C1BA 4YRBA 1BDHA 3ELBA 3RU3A 5TPWB 2VJOA 4O4JB 1BVHA 2OGUA 4QX6A 2J3DA 1AN0A 5TQJA 4GXNA 3C3CA 3K8ZA 4JGIA 5G3YA 5AKLA 1DWQA 4INOA 5CK4A 4R2WA 1Q11A 4F2DA 1DAEA 1HC7A 1BOFA 1QKJA 3QPVA 1B8PA 3CTMA 5FWDA 2R79A 3GP5A 4P7GA 2OAQ1 3H8JA 3E8MA 5K0JA 3DEKA 4TT8A 4QG3A 4FUQA 5HKBA 3A3PA 4BJ1A 2C2ZA 5JAMA 3RIYA 3GOQA 4YV7A 2VAMA 1NUHA 2ZW9A 3IUSA 3GARA 3B7WA 3B60A 1H9AA 2HLNA 2CDNA 5AXCA 5KI6A 3ZWNA 2Y77A 4EPWA 2JAOA 1Z88A 1CQWA 4Q3KA 1AKUA 2B35A 2XADA 5JASA 1UP7A 3C3PA 1Q1BA 4D46A 1EE9A 3EBOA 5E3HA 5HP4A 1D4AA 3PXCX 4YR9A 5LLDA 1E2BA 1PLKA 2Z1MA 2CY0A 3U37A 2ODPA 4KBYA 1D0IA 1YI0A 2X6TA 3SEAA 4X1YB 121PA 3IRVA 5IC4A 3N0RA 4AO7A 4I66A 2AEEA 4IQ4A 1Z4LA 3FG9A 4NCXA 2NZ2A 1N5IA 1UMDA 2QVBA 4Z4IA 3H3XA 2CJXA 4HFJA 3Q40A 3IAS1 3PXDA 1P81A 3C97A 2ONJA 2BUBA 5JG7A 1A7KA 1EJ0A 4ZRDA 2XAAA 3H5AA 4MQBA 5K8IA 1FUYB 5L53A 3R9KA 4WKCA 2EL7A 3U60B 1KAGA 2EQ5A 2ECOA 2GZMA 5E3IA 1ST2A 1ENOA 4CF7A 1XC7A 3UUFA 4OQZA 2OXEA 1LH0A 1IEWA 3FM9A 1GYQA 4EOGA 5BQPA 4QUJA 3T94A 1T1GA 4Y2HA 5HJ7A 1UQRA 3F4LA 4FZVA 4IJVA 4EB3A 5LWQA 2EJBA 3LBHA 5B3JC 5FV4A 1ULSA 2Q4EA 3AR5A 4DRZA 1TLTA 4KV9A 2PO5A 3R7NA 4JBYA 1XF9A 2BZ0A 2J3IA 2YYSA 3AZOA 3T1TA 4W4TA 2A1IA 3UFXB 2HCFA 3CNBA 5LBTA 2W70A 3ZZTA 1OWOA 5M7EA 3NUQA 1JJVA 2QGFA 1J8YF 2FFRA 3RAJA 4BNFA 2W4MA 3H0CA 2GPBA 5C7LO 2GN4A 3DP7A 1QYXA 4KTVE 2QMQA 3M3HA 1XX6A 4MHSA 3WGJA 3GYBA 1OFHA 2OV4A 1V71A 4IS2A 4DDUA 4I8IA 2G83A 1SWVA 3KAKA 5CAEA 3IV9A 2PUAA 3NC4A 1ULHA 4ZPJA 1NQAO 2GD2A 2J3EA 4B3SB 1T3LA 3PVZA 1SXHA 3Q3GE 5E4YA 4ZD6A 3GRRA 2JFYA 3B53X 2HPZA 3TYXA 1NJ2A 1L9KA 5DXFA 2JGIA 3PUYA 1NBMD 1NQ5A 3PL5A 2YV4A 3QVLA 3PUJA 4LRWA 1HYBA 2EOAA 2GTIA 1A9XB 5GWXA 2FV8A 2Q7XA 1VLMA 5DM60 4ITUA 2OYCA 3UMBA 2H4FA 5FTJA 3BL5A 4CQLB 1C30A 3TUIC 1T3TA 4MULA 5DF1A 4G1BA 1Y48E 3QKSB 1J20A 5CITA 4X8LA 4QO8A 1GCGA 2GHRA 1K66A 3H19A 4DHWA 3F46A 2BDTA 2R8PA 4DTIA 2O7VA 4E7OA 2ENWA 3FMOB 1N6HA 1P5JA 2C61A 4EKEA 4N6GA 3DKVA 5MN6A 3LK6A 1VM6A 4L8YA 3UEOA 3TIIA 2GPJA 4RF2A 2VDWB 3AWDA 4JLOA 1TLFA 1U2DA 2FWIA 3A04A 1O5OA 4Q9DA 3WKCA 4YUVA 5LMZA 4XB1A 4BJ5A 1RIFA 3QU4A 4BNZA 2IBTA 1P4GA 1MA3A 5D7BA 2N1MA 3U7JA 1JTVA 4HH4A 1Y3CE 3GDOA 1E9RA 5DI3B 3TRHA 5JBNA 1BDIA 4ARBA 2WKQA 1RRMA 4DLZA 5JQGA 4HDCA 2O2HA 2YR0A 5DPMA 1PT5A 1RI3A 1BVRA 3CG0A 1NBWB 2OM2A 4XVRA 1Z15A 4Q7JB 4QGBA 1XTIA 1BVUA 1WEKA 2WB2A 5JLJA 5DWVA 1RAGA 4B3FX 2C94A 2OB2A 1KYYA 2Q8PA 2YFQA 3AEQA 3RYFB 5F2NA 2QQGA 1RPZA 4INPA 4R9NA 4GMDA 2CVOA 5DW0A 1CUHA 4PN7A 3GEIA 4MW2A 3PDHA 4OL0A 5A1JA 2OMEA 2C54A 2HSWA 3PGVA 3DTVA 3RB8A 5CA0A 2JATA 3EHDA 3M34A 2X3FA 4MUGA 3IO3A 3PGMA 5DNVA 2CWWA 3O1LA 3KLNA 4EW2A 4UCXA 2BI8A 2ZXUA 1CIPA 4X44A 3W6OA 2QTAA 3MXTA 5IJWA 1G5PA 2JKZA 2C5AA 1IY0A 1FDTA 2YICA 2BP7A 3A1UA 2FG5A 2A2ZA 2A0UA 1QV9A 2ZRAA 4ACAA 5AM0A 3DYBA 5AHKA 5AXBA 4NI5A 4YY3B 3HCEA 4ED9A 3K5PA 4Q47A 1REQA 1W48A 3ND5A 3VDXA 1I3KA 1DEKA 1EDOA 1ODSA 3A1CA 3AW8A 1O94D 2RHRA 4Y1EA 3GLKA 3O4HA 3SXUB 4C3OB 3LTNC 4G1UC 3GNQA 3AVWA 2WC1A 2G25A 5LQJA 5SZJA 3JQ8A 4XWWA 3HBLA 5I9IA 2ZUVA 3K1AA 3NEPX 1WQ4A 4QASA 1ZQ1A 4FSDA 2X0JA 2QT9A 1RRFA 5GMOA 2J5BA 1RMTA 4OHYA 1OAAA 2KLHA 3CQ9A 3QKUA 1DJOA 3Q3VA 4UNPA 1C3JA 4E7PA 3UJHA 5HF5A 3ZBUA 1O9GA 3ZJTA 1EJ2A 3PE4A 1ODFA 4AMYA 2IXEA 4LJAA 5DNYB 2G7MC 4EG3A 4ZEXA 3G1TA 3JW8A 1LVHA 4O4LA 3T61A 2GYWA 4Q15A 4S24A 3WGTA 5KSWB 1AUPA 4C0AC 5B4VA 1ETHA 1DV1A 3L8ZA 5THKA 4JQOA 4F6RA 4ZEVA 3HA5A 2VF4X 4R4JA 5ECGC 1AO3A 5FBZA 4XB2A 4I5EA 4BMVA 5AVTA 2NVBA 4NENA 5NULA 3UKDA 2O2ZA 2XT9A 5J47A 2YV2A 2AUTA 2H1HA 1L5MA 2I3GA 1XMSA 1HL7A 4E30A 1S9DA 3BD9A 3CGWA 5EIAA 5ALJA 4FLMA 4E5MA 1UBEA 3HGMA 3GLIE 1GT6A 2JH8A 3CMMA 3JRNA 1FTNA 4A1FA 5IM4F 3B1KA 4RMIA 1YR7A 4LE2A 4ITVA 5JDIC 2ZBRA 1RAAA 1O95D 1NMYA 5FLEX 5EZSA 3UC9A 3I9V1 1G2QA 1NDHA 2B92A 3O84A 1G20B 1THZA 3BHMA 4CM8B 3U6KA 5C51B 1Q6YA 3GGGA 3EFOB 1ZIDA 1SC1A 4MWTA 4BGUA 4RFSA 3ENNA 2J0UA 3EGXB 3GDWA 1ULTA 1XDGA 3C6ZA 4CIWA 1ZGGA 3A1EA 3ED1A 2A5FA 5BRJA 2DSTA 4IXTA 4TWAA 4GOJA 4CNBA 2Q50A 4O25A 4CG1A 4DMUB 2GCPA 1EUQA 1TCVA 3ESCA 3R8CA 5SYMA 1QOPB 1SOMA 2IS4A 1Y63A 3B20A 1KETA 4W7IA 3GOHA 1NJ5A 2JBWA 4Y7DA 5JS8A 1CLEA 3AVVA 1YS9A 3VV3A 3HUFA 4GH5A 4REQB 3LUJA 3N59A 3VO8A 4F72A 3HGTA 1A1SA 1W88A 2YWGA 3MYYA 1HDXA 3VPXA 3DVAB 3MB8A 3MK31 4MVJH 1RFGE 3AM5A 3OCUA 1II9A 4LJ9A 4PIPA 3UJ3X 3CLTD 3AF6A 3SJUA 3MOSA 3HO1A 1KZ1A 2GNOA 2VSOA 2ZLBA 3CEJA 5DSXA 2OZEA 5LYJB 1EE2A 1OSNA 1S2LA 2C9BA 1O4VA 2GBLC 3CZRA 5GV7A 4Y0AA 5ES3A 1N2IA 1V0JA 2OBLA 3FLBA 3HACA 4GPTA 4ETMA 3CLUC 5IAOA 5TF4A 5ERGB 1FUIA 1MXHA 5KNDH 1GG2A 1T8TA 2WWIA 2O3RA 1IUNA 1QQAA 2WBLC 1G8AA 3VSBA 4W9MC 1GVHA 3P4YA 1EDEA 1SURA 2G36A 2UZ0A 5TVGA 4D92A 3WLMA 4C5BA 1UEJA 5HSGA 3DLBA 2QI9F 4LZAA 4NYJQ 1XPOA 5B7QA 1CPYA 3C7CB 2YHAA 3UAGA 2IOYA 3ZE9A 3ORQA 2W2LD 2ON6A 4RD2A 1PJ2A 1I5RA 4IFIA 1WQ1R 4MWDA 3PDWA 1G8GA 1NC3A 5JWHA 5JZOA 4RD4A 2INGX 3AUJB 3UUEA 1PHPA 3LRTA 3ER6A 2YOHA 4EDHA 4ZEMA 4C4OA 4ZCIA 5JDCA 3REOA 1S2OA 2BRUA 5AYVA 1YTUA 3O3OB 3BZWA 1ZC4A 3OTHA 4PLZA 5F4BA 5M2QA 3OFNA 2XF8A 1XAHA 3ZJ5A 2EARA 4Z99A 4Z9YA 2ODQA 4TTTS 1ZAYA 3MJHA 2JD2A 3R9XA 5KSOA 1FRQA 3P9XA 1XI2A 5KQGA 2OO5A 2OPBA 2J87A 3LF1A 3PFGA 4UJ3A 5C2JB 2XPCA 2PRSA 1U0BB 1V6CA 1W73A 2WYVA 5JFTA 2ETVA 1VRWA 2ERXA 5DE3A 3O4RA 1VJRA 5D5PA 2XXJA 2VRWA 3MN1A 1Z7WA 4FS3A 3ZOZA 4U6SA 2PXAA 1PGQA 2YUTA 2ZS9A 4J9VA 4K46A 4CEJA 3IIEA 3T3EA 4QUHA 4C2BA 2W22A 1ZSVA 3SQXA 3WHIA 4X71A 2QB5A 1DCTA 3IIJA 2BEJA 4WTOA 1C1DB 1LVGA 2GCEA 2REQA 4XH9B 1BU5A 1HEUA 3PE6A 4TS3A 2F4VB 1MRZA 4LHZA 3AZPA 3V6MA 4MRMB 5GADl 5EJAA 2DU8A 1JHDA 1G6KA 2ZBVA 3ITKA 4BN0A 3O26A 4OI1A 4XE5A 2IYPA 3IDSA 5AWFC 5I4CA 3IB6A 1QGZA 3MXOA 1DBPA 2AJ8A 2HPAA 1BJRE 2IE0A 2OXRA 3H5LA 4HX2A 4J6FA 4JFAA 2XGGA 4MMYB 4YJ3B 5AK0A 1KE2A 5KMGB 4ZVPA 2C4KA 1TECE 3N2GB 4XDYA 4N9QA 4PWYA 1L0BA 5CFQA 3NI2A 2GRJA 1PBNA 2WDZA 1JDTA 4IMPA 4D3DA 1KAOA 1K97A 4JZYA 1HPLA 4R8KA 1Y1RA 2RGWA 3WZMA 5KVSA 1ESEA 1M1ZA 2PGJA 3A36A 4PHHA 2G4CA 2QIPA 4REOA 5EKXA 3G2PA 5JADA 4DQ0A 4D8YA 2BBOA 3CB2A 1L3BA 4YBZA 4YV2A 1JWLA 1UPXA 5JQGF 1MTOA 2A5LA 1CC1S 4CXMA 3G5MA 2FVXA 4Z0NA 4KNYA 3A6HA 1YOVB 1VXRA 3UV6A 3VZPA 3WYCA 3KYDA 4ZYZA 2XA2A 2H3EA 3EG5A 1OTHA 2O1WA 3LKDA 3M6UA 4HI0E 5K99A 5AHRA 4Z9BA 4YWJA 4I9UA 4BRZA 1J09A 2I4MA 1F2UB 3VR5D 4JOQA 3AJEA 5EE9A 4PYKA 1VBKA 1W2WB 4Q05A 5CA0F 1YQ9A 1YRQA 2ID8A 2C3OA 3NHUA 9GPBA 4NZPA 3A37A 3TOSA 2IYWA 2OSVA 3GJ3A 4BLVA 4D3FA 2R7LA 4DLUA 1RI1A 1QIFA 1QNLA 3AUFA 3ML1A 1OXSC 1TC2A 4G1VA 4UATA 1VSQA 4EEKA 5JSQA 4BX0A 3QVTA 5EHQA 3NMUF 4N5MA 3I1YA 4PBSA 4ER5A 4MDHA 3CKMA 3JQ9C 4MV8A 3M7IA 5FOWA 4TLDA 1XDZA 1X92A 3ZDYB 5BORA 7MDHA 4AO6A 5H9VA 1R16A 3ZVRA 4DM7A 5LQNA 2XSZA 4QFCA 3ESZA 4QATA 1NVFA 2ZSIA 3DV2A 2B4YA 4OJNA 3A7DA 3RRNA 4DR7B 4C7BA 1MO5A 2W58A 1OYVA 2IGTA 5TQ0B 4BEBA 1QYIA 1WMSA 1MAHA 4NR0A 1V1MB 2ZDGA 3O9VA 3HMQA 4X1IA 1U3WA 1AUQA 4I4NA 3Q7PA 4EYEA 3CF2A 3HJUA 1EIZA 3AW9A 4QUGA 2WOJA 2IYLD 4IQGA 4B3RB 3OVMA 3HVJA 3G85A 3RGWS 1WF6A 4JIGA 2XB4A 1IMJA 1AKNA 5EWLA 5KZMB 1FS4A 1II8B 2P3LA 4O4LF 1SHUX 2B8NA 3KT6A 4W6QA 3VYVA 4ZTUB 1T1JA 2Q6KA 3EWIA 2Y1GA 3CLKA 2V0CA 4LZOA 1DTEA 1ICIA 1XXHA 1GXSB 2AG6A 2BFFA 3GFTA 3T12A 3FOEC 2PUCA 2FPGA 4OXQA 4YMIA 1XTUA 4TM8A 1KEPA 1WPQA 1P7CA 1CUZA 2CDCA 3AILA 3TR5A 3GH3A 1WMAA 3C3YA 1QFJA 5HFNA 2VKTA 1TQ2A 1F6DA 3WK4A 2CLLB 4PCUA 3FTFA 2J9GA 2O6LA 3A27A 3RIHA 1Z63A 3E81A 1ESDA 1PS9A 2EERA 5DHFA 3TUZC 4NMWA 3GH1A 4YGYA 3M6VA 1OWPA 5H0IA 3PR1A 4F2WA 1WB4A 1FSPA 1IBSA 4NJEB 1QU3A 1CZRA 1RJ9B 3KWMA 3OIWA 3CCCA 2E37A 1GDHA 1DOAA 4LJ8A 2BFBB 3UANA 3RG8A 1PZNA 3LW8A 1A77A 1AZSC 1BWPA 2WSSD 2QVYX 1ADCA 1MC8A 3EIUA 4NCJA 4D43A 2D5IA 2QRPA 2N46A 4N3CA 1UMBA 1OB2A 3R0XA 1JFSA 2ORVA 5BXYA 1A1VA 3UGKA 1CLUA 1UL1X 3TTWA 3PJRA 3PC6A 2UUPA 4UDNA 2WPDA 4QRIA 3ZD7A 2IYQA 3GHYA 3NO4A 2BJWA 2R8EA 4M99A 1IEVA 4PAOA 1NF3A 1UFVA 1XWWA 3C87A 4QLAA 4Q4AA 4TL9A 1TQ8A 5KINB 5KHAA 2H2GA 1C8KA 1GITA 1OY1A 3F0TA 5FWYB 5B6PA 2BVNA 4K9PA 1DLJA 1SH7A 3TZCA 4P5PA 5AW1A 3GLHB 1X8XA 3MMPA 1RMYA 1ODTC 4JKIA 5B1HA 4KIUA 4QXPA 5FF9A 1JDPA 4MPPA 2R25B 3GFFA 3PR2B 3IPRA 3OLXA 3D3EA 2ZANA 4F84A 5IT5A 4MS4A 1KBZA 2LD4A 2Q1SA 4CGZA 5GJCA 1P7ZA 1ZN8A 3GYGA 3MYRA 3ZV5A 4B7UA 3EXEA 4LSZA 3OMWA 1A50B 2Q2QA 3EXG2 4OMCA 4YAWA 3U39A 3K1YA 1IPEA 1HE1C 1GHTA 2CLOB 3Q2IA 3UY4A 1DELA 2XODA 1C80A 2YH2A 4FJ2A 3IR6A 5FTKA 4YREA 3UJBA 4B3IA 3E2MA 4LKOA 1YA4A 3DJYA 2RB4A 1CUYA 1O97C 2H2IA 1SU6A 3E15A 1KYZA 4PLPA 2NV0A 5AM3A 2IF2A 3BKXA 1M2FA 4WL0A 5F3RA 5JD4A 1JHRA 1FBTA 1IL0A 1QX4A 3EASA 2PSJA 5EJFA 5BSHA 1OU0A 2DJIA 3IKVA 4D0SA 3UK0A 1GQRA 4GYYA 1SG0A 4B6PA 2FZKA 4EY6A 3HVRA 1DRVA 4N5LA 4Z1MA 3T1NA 5DM1A 1G59A 1W36D 2GYYA 3WWPA 2BEUA 3QF4A 2PAFA 2ZI4A 1IEQA 1QOZA 4G0UA 2HK6A 2YHIA 4WN9B 4V0ME 4G4GA 4HMOA 1CR4A 1YR1A 2BGLA 3W8EA 1F0NA 5IMSA 1W36B 3GRVA 2XZPA 2BISA 1R64A 2OCIA 1MC5A 3K0CA 4MS1A 3D7KA 4XDHA 3A9CA 5J5AA 1KDYA 4RMGA 5B7NA 2KSQA 2WUEA 1LXCA 2LCIA 3C8UA 2BUAA 3IT3A 2R2GA 4MRPA 4IUBS 4GX1A 2BZGA 2DFNA 2BR3A 3MQFA 1OLXA 4LQDA 4RGVA 4B3MB 1IBMB 2UKDA 4F4HA 4M7RA 3UJCA 4OXIA 1XYGA 3NR2A 3V46A 4PHCA 4PAWA 1XVVA 2GRUA 1S02A 4BNMA 2I4TA 3WLFA 4R8RA 1WXXA 2ID9A 1SIOA 5TGDA 5AFSA 2HM7A 3L82B 3RRJA 4R8SA 2EYUA 3TRJA 3B5JA 4FGSA 1L5QA 4ZIRA 4ZK2A 5AKHA 1RXUA 4PSAA 3OSZA 5AICA 2QD4A 1CG6A 1NM5C 4YMTA 4TWZA 2DY0A 4TSFA 5EERA 3OQMA 4RD1A 4OMFG 4YV0A 3EVGA 3S99A 3ZZUA 3HP7A 4CHGA 1VHTA 1ZWKA 3UTDA 2EZ4A 2JS7A 3AKYA 2WP8J 1AGYA 1EK2A 2PKXA 1V26A 1G6OA 1MQ8B 3C1UA 3UQZA 2FOLA 3C7DB 4RPJA 3TIVA 3ERCA 3MT9A 1IN5A 1LFDB 2HJGA 3B7GA 3L8HA 1X7ZA 1N9ZA 1W85B 1TK3A 1A9QA 1IQRA 1BXZA 1CR0A 1SVSA 1U1CA 2CUKA 2POCA 3DFUA 4W9RA 3RQIA 4C0LA 2DUWA 2PZLA 1G18A 2HD4A 3QFTA 1HE5A 3KVNA 4M1YA 4YRKA 1ZK3A 5KOHB 1WCIA 3F6SA 4GHWA 1OGYA 2Q3EA 3R24A 4JBNA 1HOXA 2C4HA 1EQUA 1NUTA 1S89A 3K0FB 1L4EA 2QTRA 2PZEA 2VJPA 3N7AA 4JY7A 5F78A 2FWJA 3ANTA 2XHZA 2Q3HA 3QY0A 2BELA 2F9FA 3PUKA 1G8JA 1XVAA 1XZFA 3C85A 3BIWA 4GQAA 5EIBC 5AT1A 5H70A 5C31A 4CN8A 2XMDA 4Y2VA 2FFQA 5LOVB 4CZ2A 2H54A 2VHEA 2V45A 1ZMBA 5ALSA 3EMBA 1E1MA 2XUQA 2FJ0A 2V5AA 1UFOA 1EVZA 4I5FA 1KR2A 3CH6A 2C5SA 1GU1A 4EG0A 4B71A 2ZETA 4Y9RA 2Y05A 4II3A 4ZO4A 1PJ4A 3AHFA 3VXKA 2BF4A 2D59A 3RBVA 3C8DA 1XRMA 2H9IA 3HCBA 5IYZA 1ZUIA 1L4YA 4L02A 4IKOA 1ULBA 3TGWA 3OZXA 1VSVA 5ALVA 5AOAA 4C4AA 3AFHA 2H8KA 3MVEA 3TQQA 2R1TB 4ZTBA 4X91A 2IIVA 5KQSA 1OH8A 2QLFA 4NU0A 3U81A 1XGKA 3FFXA 1UPFA 4RHEA 1XVLA 4P93A 5EMNA 5BVGA 5AVZA 1HE8B 1JHXA 1SIUA 1I14A 1UM9A 2KWIA 4HNTA 5F5LA 4WVFA 1JKJB 4YUWA 3R5SA 3EBPA 3K0AB 5F52A 3I73A 1S8OA 2CFCA 1JWBB 2I7XA 3OX2A 1VZ2A 1E2GA 4LY0A 4B9EA 3EFBA 5HJ2A 2FPXA 3HM9A 2WV7A 2LNDA 2OL4A 4NC9A 3B52X 5KVAA 2P78A 3ZWAA 3G5UA 1E9DA 1JQEA 5LNK1 1RHMA 1D1TA 1SQ0A 4MUFA 4QECA 4N01A 4MRNA 5DNAA 1KO1A 4EGAA 4CLOA 4ARCA 1LDNA 5JANA 2WVJA 3L46A 4N7BA 4F5DA 3FYSA 5C5CA 4BKQA 4P0TA 3BGVA 3BMXA 1CEYA 4V0KA 3SQOA 4DE5A 1UDXA 2X0DA 1HE2A 3K20A 4AYXA 2R7AA 3QWHA 3R6LA 4HTAA 3R0ZA 2Q0QA 1KOLA 1A9OA 3ZEIA 1RU3A 4CI0B 2O2EA 4P4GA 1P1HA 4QIHA 1TPZA 2FWRA 3FGOA 3JVVA 3ONDA 3UF0A 1COWD 3UKOA 1DUVG 1UPTA 4F5YA 3OY7A 3HB7A 3PLRA 4GS5A 2JAQA 4XQEA 2J59A 3UMSA 1YDWA 2ZIEA 1UADA 2H1FA 5AOCA 2RFLA 3LVBA 3Q5EA 3HYTA 4HFMA 3JD2A 4B6SA 1BS2A 3NHSA 1A7UA 3JQFC 1G38A 4TMKA 2V7GA 1KK3A 3FMVA 1OFUA 4Z3OA 1TTHA 1W4BA 1XP5A 4TRJA 1VKZA 1FRNA 4KQMA 2FEOA 2J46A 2GZ1A 4K05A 1N1MA 1RWBA 2LRHA 3DEAA 2F9LA 3PFWO 4N8EA 3KB6A 2QRLA 1ADFA 3U49A 5KS2A 3PQFA 3DW3X 1KO4A 1P7PA 1XCOA 2GPSA 2KM1A 5AK3A 3STVA 4N48A 2QMEA 3JALB 2WPNA 2NPFA 2RCNA 2I54A 1ORDA 3UK2A 1H6DA 4G1EB 3OAAA 3GLIA 2GTHA 2O0MA 1PJBA 2PH7A 4JC5A 1GRRA 1X1SA 3VU3A 1W5EA 2ZM6B 3CVUA 1XRJA 1AVTA 3EUWA 1G0OA 3ZHBA 3DDUA 3N86A 4BU0A 1RPNA 1NXQA 1C7QA 2DBZA 2WD7B 4IX9A 3JQAA 3ZBPA 2QT1A 1OI7A 1DO2A 1R8YA 1ZAKA 3CN9A 3IBGA 3SGLA 4G84A 1C7FA 3EIWA 3MAAC 4WASA 1GDTA 1MP0A 2C88A 2QTHA 4DNOA 3PZBA 3ZHYA 1X1RA 3LHSA 4CT5A 3BB3A 4TV8A 1P19A 3H5OA 4HDMB 5AVYA 1OIWA 1ZMOA 1I4LD 2YQZA 2O5CA 1TTQB 4MB0A 1RRKA 2VF7A 4KFRA 1UR5A 2YXLA 4I50B 4E31A 2ZJ3A 1TM7E 1MJGM 1YQGA 5CRIA 2HK9A 2GVZC 4NU5A 2B34A 2Y2UA 3UAWA 2ZJZA 4EJMA 2PKCA 2J5KA 4KH1A 2DQKA 3TPFA 1M2KA 1BO6A 1SVNA 2QXTA 4Y1FA 2HY7A 2OFPA 1KI9A 4P3OA 1QE3A 3RE1A 3S28A 4F46A 4ZI7F 4J0FA 4TKUB 4OPMA 3EXHC 5ER9A 2QA5A 2JGNA 3CF4A 3QUTA 5I3ZA 1E3WA 3I8XA 3R20A 3GLFE 1P2DA 2ZXEA 3IH5A 3VRHA 5K0FA 4RIEA 3PGLA 4BMYA 2X2FA 3RIEA 4TVOA 4NBUA 2VDKB 2AE1A 1GRVA 3UA4A 5LZ2A 4U9UA 5GJWC 2HDWA 1IZ7A 2NZXA 2OD9A 3T9BA 1IE3A 1GOTA 3ZJVA 2XBLA 3KUKA 1YR6A 1CETA 4B3XA 3OIVA 2CHUA 5U4XA 2WZCA 3V1LA 1GD1O 1K08A 1F0KA 1A9RA 2HNKA 2XVYA 1W9HA 2FWAA 1JP7A 2ZYRA 2I0FA 4J2TA 1D0VA 4DSOA 2GZRA 3OJLA 4IFEA 4QTXA 2WIGA 1VECA 1Z5NA 1CB0A 3W3AA 4AO8A 1ZCJA 4UBMA 1AXEA 3N53A 3ZCRA 4UEWA 5H3HA 3NHFA 2I66A 4PZDA 4KZPA 4BO5A 3N8DA 1VB3A 4H59A 4QPPA 4ZQEA 2Z09A 5FTWA 3SP1A 2GPAA 1XVTA 3VZSA 4I0WB 4QGHA 2YJ3A 2VH1A 4FD2A 3C8MA 4AMUA 1W19A 2LPMA 1V8ZA 4R84A 3W6NA 2MIIA 2VXOA 3IBTA 1VB5A 4M1TA 2UXBB 3DFZA 2IYXA 1KH1A 3AF3A 3F7TA 2ANCA 1XZPA 2GFQA 4G8CA 3OC6A 1A4UA 4GZ6A 4KFSA 4YP9A 3TECE 1DFHA 1SQSA 3WGKA 5L3RA 5AKJA 3H6KA 4EKIA 4NZMA 1O7JA 2GF2A 3B6JA 2GCGA 1K92A 4PX2A 3PQCA 4BO0A 4RHFA 1KEVA 2W6ZA 3AV0B 1LVUA 3DD5A 3O8OA 4XKJA 4ZARA 3WJAA 4C0XA 2XZOA 5LKAA 1UUFA 1UKAA 2Q6IA 2ST1A 4XARA 5EUBA 5FKJA 1B43A 2HWKA 1IY8A 1CBUA 2X1VA 4R1LA 3UC5A 2AR7A 4UUNA