4KLZA

Inhibition of small gtpases by stabilization of the gdp complex, a novel approach applied to rit1, a target for rheumatoid arthritis
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
156
Chain Sequence
b'EYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein Rit1
molecule tags Protein binding
source organism Homo sapiens
publication title Inhibition of Small GTPases by Stabilization of the GDP Complex, a Novel Approach applied to Rit1, a Target for Rheumatoid Arthritis
rcsb
total genus 51
structure length 156
sequence length 165
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4klzA00
1M7BA 2F1IA 3CPHA 4HAZA 4KBFA 1M74A 1P4SA 2ZJZA 5CB8A 4JL8A 4DDUA 2IC5A 4U00A 3KZ1E 5FI1B 5F3WB 2JLQA 1SVWA 3KKOA 4LHVA 721PA 4DB2A 3CNNA 1TADA 1XEWY 4UKDA 3TH5A 3OIVA 3K70C 3N2EA 3CWZA 5LB2A 3DM9B 3KQLA 3OEHA 2ODBA 4JJZA 4LYHA 2YVUA 1KIMA 1CBUA 2QMEA 1NLFA 4D82A 1E2QA 1RRCA 2O8EB 2H17A 3RRMA 2Z0MA 3L2OB 4OHWA 5EE5B 3WXMA 2B92A 3SI7A 1TU3A 1G18A 1E0JA 3NEJA 2ZIAA 4OJKA 1CRPA 5JMTA 1G21E 1XJCA 1DG3A 4UNQA 3VMFA 4Y0VA 3R9IA 3X1YA 2XJ9A 2GJ8A 1K8RA 3ZVNA 3AVWA 3T1OA 3QKSB 1V5WA 1CR0A 1G4AE 2IEZA 2Q3MA 2MSEB 4DBLC 3WRYC 3HU1A 2YWEA 1GKYA 1E2JA 4BRWA 2F43B 4P4UA 2RAPA 3KQNA 2FOLA 4XVUA 1Z08A 5SZHB 2XNDA 4TTRA 1ZW6A 4BECA 4OJQA 1KI8A 2MSCB 3B7GA 3QI2A 1NKTA 1SZPA 3FKSA 1P72A 5DO9A 4IDQA 1E2GA 2ZJYA 5AUPB 4ZI3A 2QP9X 3IHWA 5K8LA 4PSKA 2QMUA 4LJ6A 4JLBA 1QHHA 2ZI6A 4PPFA 5C4MA 2BKUA 3GCGA 3KJHA 4C7OA 3A37A 1IHUA 2J7KA 3I5XA 2LCFA 2V7QD 3TR0A 3QY0A 4ACAA 4QG7A 4IDPA 5AUNB 1NMYA 4ASUD 3Q7QA 1G7SA 1KO8A 2VTKA 3T12A 4OL0A 1XXHB 4ZPXA 1E98A 5J4VA 1Z0AA 3PENA 4FMDF 3P27A 5GADl 1N25A 1ZM2A 1OKKA 3ZYCA 2OG2A 2C95A 4PPQA 5LB4A 2AFHE 1XCGB 4DLUA 1F2TA 3FKSD 4K8OA 1N6PA 1YZUA 1VCMA 1AKYA 1JXMA 3KKNA 4RY2A 3CWQA 1G3IA 1IONA 1FOEB 2UKDA 4LBYA 1ZUNB 2C9YA 4JKYA 2W6JA 3IEUA 2H8KA 2F1HA 4Q9LA 1CJKC 5J5CA 4DCUA 3RS7A 1E69A 3K0AB 1DAEA 2AXPA 2H5EA 2R2AA 2ODEA 1DAIA 2IYUA 1MRSA 2ZJBA 2ZR0A 4A82A 3U3OA 3GJ6A 4Q7MB 1L2TA 2DFKB 2X77A 4US0R 4ILEA 5IK2A 3I62A 1SKQA 2A78A 1VIAA 4NBSA 1IN5A 3DO6A 3EC1A 4TMWA 2ORWA 2G88A 3RC8A 1G64A 5H68A 3KQKA 5DN6A 3QF4B 3WRXC 3B9PA 5JFGA 1UM8A 2RHDA 4HSEA 2J3EA 2G1JA 2A5DA 3KFVA 4DIEA 2H7VA 4PAOA 2A5GA 4H1VA 5DHFA 2IEYA 1J90A 2OT3B 4GOKA 2O8CB 2GCNA 4TTPA 3K53A 3NIBA 2R6CA 1GNPA 2QN6A 3HU3A 4W5WA 5AJVB 4BLQA 4W7SA 4GZLA 4BEBA 2JAQA 3QEJA 2VHUA 4L8GA 2WWHA 1IOZA 1SGWA 4TLBA 2ZPTX 4M9SA 1II9A 2BEKA 1PLKA 1ZD9A 1R8QA 1G5RA 2GEDA 4PZYA 1DVRA 2G0TA 3X1DA 3ZH9B 3THYB 5DN6D 1KI6B 4KCGA 2QQ0A 1G20E 4ZO4A 1JR6A 1TNDA 3MJRA 1HURA 1SULA 4JVSB 1A7JA 1RJ9B 4LY6A 1HQCA 4C0KA 4A0FA 4CEIA 1Z0JA 2H92A 1X3SA 1LNZA 1BS1A 4MYHA 4TMVA 2V6JA 4YMVA 2ZRNA 4QGHA 4XD7D 2REBA 1BO6A 3KKMA 3OE7D 4V02A 3IIMA 3CNLA 3WY9A 1P61B 4IEEA 1XXHA 2E87A 2QTFA 4HLUA 3AF1A 1L8QA 5KO2A 3V4FA 4L9WA 1Z07A 3WNDA 4FINA 5TB5A 2O5VA 3P26A 3SHWA 1G19A 3UK6A 4M1SA 4X8HA 2EFGA 2FFAA 1H8HD 4N0DA 3CONA 2PX3A 4OI0A 1F2TB 3M1IA 3W6PA 5IRCD 2ZI5A 4PPGA 2RGNA 5G3ZA 4B3XA 2MMCA 1Q1ZA 4A6PA 3ZS9A 1ZNYA 1Z3IX 1UDWA 1KKLA 2P67A 3PUYA 4MUAA 3EW9A 2RMKA 5L3SB 4D0NA 2AKAB 2GZHA 4OQLA 1VCNA 3MLEA 5B64A 1AJEA 5DGXA 1CULC 1G8PA 2ZR9A 4JLNA 4NYJR 3PEWA 4G0NA 2C03A 1NMXA 2AHOA 1KDOA 1U0JA 2Q0HA 2VQSA 2X19A 4LZZA 1U2RA 1U8ZA 3QF4A 4Q66C 1S3SA 1FTSA 4PQRA 1CLUA 1GL9B 1NY5A 3WBJA 2OLKA 1DOAA 1CR2A 3B9QA 3VU9B 4US1R 2J41A 5B58C 1II0A 2PMDA 3HR8A 1ZM3A 4DIDA 1T0HB 3VR1A 4OK5A 4Q47A 1P3JA 2B7CA 4NYMR 3SHFA 4M22A 1G291 2CNWD 4B48A 3IBYA 1KSJA 5F98A 2IYTA 5J4HA 2HT1A 1GOTA 4MKHA 3EPKA 1RE0A 4QNMA 4HATA 1S2MA 3UPUA 1H8ED 1QHNA 1OXUA 1X8JA 3WYGA 1DE0A 2WAYA 3K0FA 2F6RA 5TMPA 2O52A 4H1UA 3IGFA 1IN4A 2REOA 3BRWD 3RSLA 4A8JA 2LKDA 1WQ1R 3OZXA 3MRSA 2OO7A 1UBCA 5KDDA 3KJGA 3DVLA 1OXVA 5JS8A 4RVCA 2JCSA 2BM1A 5FR2A 3NG1A 2Z4RA 3EASA 5CITA 3RANA 1BOFA 5L3QB 5EZ5A 3CR7A 3B85A 3NBZC 2CJWA 3ZVRA 4YC7A 3Q5EA 2JDID 4XTRA 4LJYA 4MRRA 3R8CA 5EXTA 2RGEA 1OHHD 4I81A 1Q20A 5SZIA 1S3GA 2GWHA 2W6ID 3CZPA 3QXJA 4BZXA 1N6OA 2YOHA 3LVRE 3WBKA 2FN4A 2GZDA 2ODNA 5FOVA 3BAFA 3PJRA 1SVIA 2Z5FA 2ZSDA 3MWKA 1C4OA 4A6XA 4UXJA 1XFAA 2QPOA 4C0HA 3K0EA 3LLMA 2ZRBA 3B1VA 2YOGA 4A1FA 2JJ1D 4HB0A 4V0OA 1XPRA 2GESA 2HEIA 1X8KA 3B2EA 4IRUB 2PT7A 4AWXA 1OYWA 5FPKA 1LS1A 2XOKD 1HEIA 3LW7A 4KFSA 1R6BX 4TLEA 1Q21A 3RSOA 1G6OA 4RD1A 4TQAA 3QPWA 3RS3A 1BH2A 4BLRA 1M34E 4NMMA 5B57C 1PLLA 2QE7D 4LYJA 5EP1A 5JEDA 4DT1A 1E2FA 2RGCA 3FFAA 2IWRA 2WWWA 4C2TA 3TNFA 2WVJA 3HDTA 3U3MA 3NBXX 1KDPA 3AVVA 4HAYA 2B21A 4NL4H 2VHCA 3BXZA 3IIJA 3CPJB 2NO7A 2PZGA 3GJ5A 3TW8B 2R6GA 3BWDD 4MRNA 4B3BA 1I4LD 4KI0A 2SHKA 3U4QA 2JJ1A 3LX5A 4LYFA 2JJ8A 3WMEA 3SC3A 1SVSA 1P6XA 1YVDA 2Y8EA 4Q4AB 3U4QB 1KI7A 4CGZA 3GLGE 3UANA 2QMOA 4HB2A 2N1BA 1KSHA 1MO6A 2GAAA 3EIQA 3CF6R 5FPSA 2UVQA 2VYFA 2IS4A 4TMZA 3CLVA 1AN0A 1ZRHA 4GRAA 4Q1AA 4AC9A 4B44A 4IXMA 4RD4A 2UZ3A 2IHYA 4Q00A 3GQBA 1ZC3A 2CK3A 1NY6A 3RHFA 2RGGA 1I2DA 3ZQJA 3IKJA 4B43A 1FNNA 1KKMA 3ADCA 2C9CA 2AKYA 1QG4A 3NC1C 4GI7A 1XJQA 1IY0A 3CF2A 1QHSA 4HLUC 3KUDA 3AF2A 3C15C 1MO4A 3L0IB 4NYMQ 3SBEA 5KSOA 3LW8A 4B2IA 4DLXA 5DSZA 4D0GA 3AVTA 4Q02A 1W4BA 3HYTA 2J0SA 1RKBA 2YWHA 3BOSA 1XBTA 3TVTA 1AZTA 4I1SA 1MH1A 3VHLB 5CK5A 4F91B 3DDCA 3TUJC 1FMJA 3M6AA 2CLDX 4LK2A 4PQYA 2QRZA 4YMSA 1N5IA 3T34A 3KJIA 4A8JC 3ND8A 4LX0A 2CHQA 4IOJA 1G17A 1QHYA 4B3FX 2VH5R 5BXQC 1D2EA 2ZRGA 3GJ3A 2G6BA 2CK3D 2X2EA 4XTCS 4YXWD 3WYFA 1E9DA 1O87A 5C18A 5J4KA 3UG6A 5KOYA 1BKDR 5FI0B 4JMPA 4Z1MA 2WJYA 4KODA 3LV8A 2WICA 3AF4A 2GJ9A 4V0KA 2ZRDA 5GJVC 1KAGA 2VP6A 1UBGA 1PUIA 3QENA 3RYTC 1YZQA 2NO6A 1I2MA 1UEIA 4GBMA 4X8LA 1AM4D 2VHJA 2FSHA 2IF2A 2PEYA 4WXPA 3KKPA 3CIOA 2QT0A 3RS0A 4ACBA 4ZCIA 2BBSA 4AURA 2ODWA 3X1XA 4DKXA 2A5JA 2VF8A 4OHYA 2FE4A 4W5JA 4R71A 4LV5B 4DDVA 3L8ZA 4OI1A 2RGBA 1XB2A 4LJ7A 4IVPA 2OFOA 5E4FA 4DSNA 2W6IA 1SXJD 2WKQA 3CRVA 2VRWA 4B34A 2PZEA 3B13B 5KNDA 3UXMA 1Z0FA 4UJ5A 421PA 3BE4A 1GILA 2ZJAA 4O25A 4BFWA 1G4UR 4P4TA 1YU9A 1HA3A 4IOLA 2I1QA 4MYCA 4AIIA 2OXRA 3PVSA 1DAKA 3AKDA 1NVWQ 4BFZA 3BBPA 5F9HA 1AKEA 1E0SA 2QAJA 1ZU5A 2VPPA 2NO0A 5KU1A 3P4XA 3U6KA 3VU9A 4Y0AA 1Z6GA 2OHFA 3NWJA 3KDSE 1VYVA 2ZREA 3EZ7A 1F2UB 3IILA 5JHHB 4A4DA 2FPLA 2OV2A 4HZUA 2PZFA 1XD8A 1QVAA 3DL0A 3TQFA 2QP4A 4MGZR 4OQMA 2ZRIA 1XTQA 3FVQA 4QNRA 3KQUA 4JT2A 5JSZB 4ZCMA 2PJRA 1KO4A 4ARZA 4ZDIA 4BRUA 4PHTA 4EQ6B 1AS0A 1XF9A 2OBMA 3QPVA 4R98A 3SFZA 1OFTA 1X6VA 1XMJA 2OLJA 1XEFA 4GT1A 4JLVA 2IYLD 3GJ4A 3RRNA 1QBKC 2BDTA 3ZDQA 1D2NA 3ZZ0A 4LV6A 4HUQB 2QPAA 1IN6A 3GEIA 1TF7A 5BN5A 1XTRA 1WF3A 2V9PA 1D2MA 3DKVA 3EA0A 5EP4A 3W8NA 1UKZA 2V6IA 1GITA 2VLIA 2OCAA 2PBRA 4HYYA 2VP0A 4II7A 4Q18A 2VBCA 2XX3A 3AKCA 1N5KA 1Z6TA 2BJVA 2O8BA 1FFHA 1ANKA 1YZNA 1DELA 3IIKA 3E1SA 2VP4A 1IAQA 4MRVA 1NIPA 2ASEA 2FNAA 3ICQB 2QAGC 1DS6A 3BFXA 2L0XA 3LH5A 3G5UA 3W5IA 1E2HA 1MR3F 4QXAA 5BN3A 1WBBA 4LSGA 1NKSA 3Q9LA 1GIAA 2ZYWX 4AKHA 1UJ2A 2W6JD 2DY1A 4C0JA 3B78A 1P75A 1XDBA 4B6EA 4F93B 2ZJ5A 2CHVA 4FCTA 3FOZA 3B82A 1XPOA 2KBEA 3A4LA 1OXSC 1JALA 1T3SA 1XCPA 2W2TA 3ECCA 1RW4A 4FMBB 3SFVA 3AKYA 4EPYA 1KO5A 3E5HA 3L8YA 3DOFA 3QXSA 1HE8B 2FZLA 2FSIA 3QEOA 1OIXA 4QGFA 2FGKA 4Z8YA 4A0HA 4F92B 4M53A 1VYUA 5HZKA 1N6IA 4PC7A 4ZDKA 4IDHA 4C4PA 4G5OA 2CVFA 1MKYA 1SXJB 1A82A 1K6MA 1NJFA 3F3YA 3QIAA 4DWJA 3PXGA 3MWJA 1P2SA 2YOFA 4Q1FA 2ZAOA 3H2YA 1T4GA 2CVHA 3QPUA 3CRQA 2ZRCA 4DCTA 3GLFE 3PUXA 4AK9A 5FUWA 5KNBA 2JLXA 3AH8A 4QJ5A 4TZ6A 1KJWA 2AR7A 3WP1B 5FTNA 3W3ZB 4D4MA 6Q21A 4JLPA 4ON9A 4YMUA 4IKEA 5DISB 3ASZA 1JQLB 1HQYE 1J70A 4B75A 2EVWX 3I73A 4TMKA 4CEHA 4I4LA 4WOPA 4BPBA 5CYPA 2IYSA 3ZVLA 4RJLA 2OESA 4LC1A 3H0KA 3NEYA 4PAQA 1WMSA 2F3TA 4FWTA 1US8A 5BYKA 3TUZC 1S4QA 2F1RA 2DFLA 1HH4A 2O0KA 4XD7A 5TXGA 3W34A 3IO5A 4G5SA 4Q5IA 4F4JA 4W9MC 2FPMA 4P0TA 2GZAA 4JIMA 1ZAKA 4TL9A 1Q1QA 1X1RA 4YDHB 4LI0A 1UKEA 2ECKA 1EXMA 1MABA 4URVR 2QT1A 2VO1A 4LBZA 3U5ZB 1XPUA 4WA7A 1LY1A 3SJBA 5BWMA 4UQOA 1MT0A 1WXQA 2BHRA 3OAAD 5JLJA 3O8CA 2J7PD 1QHHB 1L4UA 5KUTA 4TYWA 2O8EA 1G8FA 2VHTA 2ZSAA 1EFTA 2JLSA 1W7AA 1E0KA 2P6UA 1E6CA 2BBOA 2BBWA 4KFTA 3GEEA 4Q19A 1J2JA 4PZZA 4QL3A 4L16A 3O8RA 4YONB 4NTZA 2JLRA 2MSDB 1ZM4A 3SU8A 3U7FB 1XMVA 5FOTA 5J4YA 1T91A 1F3OA 4GFDA 2YV5A 3SQXA 3VKWA 2JLUA 1ZUHA 4JS0A 1NN1A 1I4TD 2ZRLA 3K0SA 2ZE5A 3OAAA 5HKKA 1SVMA 2QNRA 1OB5A 2XNDD 1FX0A 4HZIA 4HEJA 1R0XA 1W49A 1R0WA 2ZRHA 3KTAB 4ZCLA 2XSZD 2CHGA 3HWSA 1KI2A 4B76A 5GJWC 2JLVA 3AQ4A 3K0AA 3KKQA 4KFUA 3KTAA 5EP2A 3EPLA 1XMIA 2GTPA 3QE0A 2IK8A 1OF1A 5KSPA 1H8EA 3QG1A 3NXSA 2ZEJA 4W5HA 3RABA 1E4VA 2CDNA 2G3YA 3NC0C 5DI9A 4QOSA 4RD2A 4DLVA 2EW1A 4HZUB 4BQSA 2IUUA 4EUNA 5J47A 1ZJ6A 1OT3A 4L15A 3WYAA 1NVVQ 2RKOA 3MFYA 1JNYA 1OB2A 2PT5A 3E2IA 5D3MB 3L0OA 5JCPA 1TQDA 1KI3A 2J0VA 1US8B 3HPRA 1RZ3A 2GJAA 2XSZA 4M9QA 1MV5A 1G6HA 2YNMA 3DZ8A 3N2IA 1BMFA 5B30A 1ZU4A 3W5JA 4NYIQ 2YYZA 3ZZTA 2J46A 3EZ2A 3QG5A 2K5UA 5GJBA 4YQFA 3QVUA 4C0QC 2QGNA 1J8YF 1VECA 3VR2A 4CRWB 3A1SA 3AVUA 1LVGA 3ZGXA 3OIWA 1C9KA 1W44A 5AUOB 3KX2A 1DO0A 1IXRC 5JRJA 2O8FB 1SHKA 4HUQA 3TBKA 2IL1A 4OK3A 5JJKA 1DARA 1M2OB 2VL7A 3SZRA 2QL6A 3GLHB 3ZZUA 1DADA 4PC2A 2RHMA 2AD1A 3SBDA 2IWHA 5P21A 1UPTA 4JJKA 3FDIA 2J45A 3LLUA 4LGMA 4PC1A 1ONBA 2FFHA 3P20A 1II8B 1W47A 2PCLA 3QBTA 4FCVA 3RRZA 3KQHA 2IYRA 1ZIOA 2ZSEA 3THXB 1WCV1 3QNUA 2ZANA 4PC3A 3CO5A 3TAHA 5F9FA 1M1YE 3THXA 3UWKA 1NF3A 3F5FA 4GOJA 4JVMA 2CJWB 1JEDA 4JLOA 5DIFA 1PVOA 2IYVA 1YR7A 1DBSA 4AYWA 3NHBA 4DLZA 2YC2C 1OIVA 4I1OA 2QORA 3LVQE 2W83A 4F38A 5JWRA 1Z6YA 2BMDA 5L8VA 2YKGA 3TRFA 3CKLA 2J7PA 4CEJA 2IYQA 2P65A 3TK1A 1RJ9A 4CEIB 3CW2A 1S8FA 2DFTA 2REXB 3JVUA 5M04A 1ESMA 4MKFA 5TV2A 4IHQA 4WIAA 5KTYA 3RS4A 1DO2A 1E9BA 4ZI2A 2C8VA 1E32A 2CCKA 1ZNWA 2LKCA 2QROA 2WOOA 4URXR 4JZKA 4DUGD 1X8LA 3OE7A 3T5GA 2NPFA 2WJVA 2GDJA 1GM5A 3RS2A 3GLHE 4TLAA 5IT5A 1CRQA 3QQ5A 2ZRPA 3QKUA 3AP1A 4BUJA 1ZM9A 1XTKA 3PCRB 4A15A 4JLDA 4EFLA 1CR1A 3TSWA 1T8TA 1OH7A 1XTIA 2ZS9A 2CL0X 5AJYA 3RVBA 3SEAA 3CRMA 4DT1B 3TW4A 4HUTA 4XWOA 4JBWA 1WDTA 2DWQA 1VG8A 4NDZA 1CS4C 1LF0A 1NBME 5CB6A 4Q7KA 5FOUA 5HKKD 3R9XA 4D81A 4HDQB 5FPHA 4EPTA 2J87A 1EX6A 2J59A 4URYR 1N5JA 4D80A 2OM2A 4NHOA 1NVVR 2NQ2C 5BQ5A 1JB1A 5EE3A 5LD2B 2ZRFA 3QOFA 2XTZA 3WHKA 1DG1G 4BGDA 1F5NA 1RPZA 3GLGA 4MDFA 2O8FA 2QM7A 2GBLC 5A5GA 3AVXA 4Q1BA 4ITRC 2ZSFA 1G8HA 3GLFA 1YHNA 1OYYA 3TSOA 2R62A 1W2GA 3AP2A 5JBQA 4DDWA 3EG5A 4PO9A 4HB4A 621PA 2KWIA 4PO8A 4B71A 1PLJA 3HPQA 3BH0A 1CU1A 2D06A 3GLFB 3SE0A 4IVQA 1P62B 4ESHA 3KJEA 1OH8A 4UNPA 3ZVMA 1E2NA 4QKQA 1VDZA 1MABB 4RZUA 5JS7A 4CVNA 2I1VB 4EFNA 2WSSA 1S9HA 2D74A 2CNWA 4OBEA 5FPYA 2CEAA 4B74A 2ZR7A 1HY3A 2ORIA 1RFLA 3DMNA 3LNCA 3PIRA 2D7DA 1G8YA 3B1YA 2OE2A 4ERNA 5DI3A 2WKPA 3PQCA 2JLWA 5JJLA 4IXNA 2EFDB 3AF3A 4WZ6A 3I32A 3LO5A 5TDHA 1UADA 2GBLA 4HAWA 3L0SA 1U0HC 3NH9A 2FWRA 3O8BA 4C0LA 4ZIRB 3IUYA 3QXCA 1E94E 2AD5A 3FHOA 1P2UA 2FPKA 4E22A 2ZJOA 3ZIAA 5TY0A 2BEJA 4D4KA 1NL3A 4FXPA 2ZJ8A 2D2EA 5L3QA 2W0SA 1U9IC 3FHCB 3RAPR 4TMXA 2A3RA 3U3JA 4R2HA 3T1TA 1B0UA 4KO8A 3K0CC 1ODFA 2F1JA 4D4LA 5JI2E 3LD9A 2DCUA 4JL5A 4LBVA 4B33A 3MAAC 4DLWA 1R5BA 2HYIC 2RGDA 1NN0A 2V1UA 2G77B 4XWAA 2D2FA 1G3UA 2RH5A 3K9HA 1OHHA 3TKLA 1UKVY 2ZYVX 2NTYC 4QC2A 4LYAA 5L3SA 3GFPA 3C8UA 4PHFA 2D62A 2IYYA 3C5HA 1KY3A 1N0WA 1OW3B 3BFKA 2AX4A 3C5CA 2R6AA 2BOVA 4PO1A 3KL4A 2WBLC 4DSUA 1WBDA 2OAP1 2YHSA 3QXHA 5D3QA 1KSGA 1IXSB 4QHYA 4LCBA 3TR5A 5KNCA 4N1AA 1RRFA 2XOKA 3PEVA 2OFWA 4MH0R 4F4IA 2XZOA 2J0UB 2XAUA 2B8TA 1FP6A 1ZCBA 4BE7B 1EWQA 2V54A 2HT6A 3KUCA 1LW7A 3D7MA 2ZQ5A 2GXUA 3DOEA 2W0MA 4TYYA 1GDDA 2BKEA 4MGIR 1W0JD 1Z6XA 4CIDA 2QE7A 4U7DA 2ZE6A 4ZV4A 4WVFA 3HU2A 3CBQA 4IOKA 1P2TA 4M1YA 4O0MA 4EAQA 2IXGA 3O47A 2ZS7A 2GVZC 5J40A 5JWHA 2DWOA 3THOA 4LHYA 4TMTA 3KFXA 1GWNA 2Q21A 5H1YA 1ZP6A 4OHXA 4KYUA 4Q4AA 5GJCA 1GG2A 1XEWX 3BFVA 2A2ZA 4E07A 3QKTA 4X8OA 4C0SA 1P9RA 3F0TA 1G5TA 1XEXB 1FZQA 3ETLA 3IEVA 1KI6A 2AXNA 3I1FA 1W0JA 4ABYA 4IJMA 2R6FA 5FH9A 4QFMA 3TMKA 1N6HA 5EE9A 5EUMA 3LY5A 4QBIA 5JRZA 2EFEB 3GLIE 3MWLA 3N70A 1AGPA 2GCOB 4LRWA 5DYGA 4EJSC 1S0UA 1EFUA 2W58A 5IF9A 2ZTSA 1EFRD 4NPHA 3B1WA 2P6RA 3QJYA 4LJ8A 2DHRA 2ZU0C 4XSHA 1UBFA 2QSYA 2WJJA 3W3AA 3UATA 2BBTA 1CEEA 3P32A 4RKEA 4B73A 1U0LA 1R10A 3ONWA 3CZQA 1Q12A 3FB4A 4RCZA 4BLOA 4LHXA 1JXOA 2OBNA 2GK6A 1YR8A 1Z5ZA 2FFBA 2FJUA 3GFTA 5G3YA 1XRJA 2W00A 3X2SA 5JJIA 5KPDA 3BERA 4C0AC 3D8BA 3BB1A 5L3RA 1WRBA 4Z1MD 3EZ9A 3VR3A 2FV8A 4K46A 1CTQA 4PXAA 2QPTA 1W1WA 3P1JA 5LBIA 4WZAE 2IUSA 3T35A 1W36D 4OI4A 3QKRA 3SYKA 4EDHA 2FSFA 2QBYB 1S1CA 3Q72A 4QM7A 3T1QA 4XVQA 2GRJA 2XJ4A 4RD6A 4LHWA 5AJXA 4OI2A 4PHHA 2JJ2D 3LAWA 3E70C 2BIFA 2KI5A 1Z63A 4NP6A 3GJXC 3EX7C 3ZD6A 4KSBA 2Z6VA 1P2VA 1UFQA 4TQUS 2A9KA 1VHLA 5FPTA 1CJTC 3VR6A 1FL9A 1LF5A 1JR3D 4JYCA 5TVKA 2P0EA 2AL7A 2R8RA 2X1VA 4MUBA 5IDVA 2CMKA 4CT4B 4EPRA 2BJWA 1IY1A 4G3XA 1S1MA 4XOIA 3OFND 3U7EB 3LXXA 2BCGY 3ZLJA 3SYLA 1ZNZA 4D26A 4JVLA 1MO5A 2GF9A 4B2PA 1ZVQA 3RNLA 3WMFA 1DEKA 1NN5A 4L4UA 4UJ3A 5JEEA 4HI0E 1KGDA 1KZGB 1G3QA 2ZYUX 4M1WA 2JJ2A 2D3WA 2GNOA 3C7KA 3CR8A 1AGRA 4URUR 1G16A 1KAOA 3QUSA 2XB4A 2OBLA 3LBIA 3WMGA 4IFEA 4RFVA 5J4LA 4I1UA 5LDDC 1W5TA 2IW3A 2VHQA 1UKYA 5KDLA 1SXJC 4QRHA 4A0RA 2WOJA 4AG5A 5DI3B 5AWFC 3OFNA 1G7CA 3EIHA 5JCZA 1VCOA 1Y63A 3LQQA 4F4CA 5FUXA 3LFUA 2RGAA 3VKHA 5CDFA 5EXPA 4OQNA 2ATXA 3SJCA 3KXLA 2IS1A 3MSXA 2BMEA 3C41J 3OHMA 2X8AA 1LTQA 4MYUA 1DAHA 4B2LA 3QXXA 1EESA 1A2BA 1QHIA 1DAFA 1JECA 4XVRA 2BWJA 4LUCA 5KSZA 1OFUX 4D0LB 4Q03A 3H86A 1ZC4A 1VYTA 5CLQA 3BH6A 5E3HA 4WXRA 2KSQA 4KFRA 4MITA 3ZQ6A 3BGWA 1AS3A 2OCYC 3ADKA 4ZDJA 1R0YA 4KVGA 1A5TA 4M0LA 4IEIA 3A36A 3OF5A 4Z51A 3LQRA 4QBFA 3K09C 5HCNA 1XX6A 4XSGA 3Q8XB 5A4JA 2ATVA 3WNBA 2QQEA 3H84A 4C7OB 3M0EA 1E2IA 1FX0B 2BM0A 4BFVA 3CX8A 1Q57A 4Q48A 2QTHA 4NE2A 3CX6A 2RGXA 3MG9A 1U99A 1W36B 2FSGA 5SZKB 1F6BA 2C78A 2O8DA 2ZE7A 2HLDD 2QSZA 4P32A 1Z2CA 4B32A 4KITB 3GP8A 2QEQA 1HUQA 1NIJA 2C9OA 1NI3A 3J81k 4LJ9A 2WIBA 2GXAA 3WP0A 2J5XA 3R9WA 1HV8A 3ZJYA 5FL7D 3AVYA 2IBMA 1S9DA 1T0JB 1TQ2A 1XZPA 1Z2AA 2H57A 4TL7A 5EXXA 1XWIA 2BVNA 3CM0A 1G8GA 2CE7A 3GLIA 4O3MA 1RVDA 1YZKA 3K9NA 3U3KA 3ASYA 1FPMA 2F55A 3GMTA 3BD9A 2WKRA 5HZHA 1PJRA 1E96A 2GXSA 1Z0IA 4BFSA 1YZLA 3GPLA 1HTWA 2X2FA 5LPNA 3EPHA 1OSNA 1Q44A 3TSZA 2PLRA 1BYIA 4WW0A 5CDFE 3HP1A 2Q6TA 2GEUA 3PG5A 3CUEF 1JAHA 4PAMA 3AV0B 3U60B 1HYQA 5KSYA 1NVXQ 3W9YA 4Q9HA 2XNSA 1VG9B 1D5CA 1KMHA 1YRAA 5C46F 4B3GA 1KOFA 1C1YA 1BIFA 2V8OA 4BWYA 2QA5A 3GD7A 2C77A 4PTLA 1VG1A 1XD2B 2WPDA 4LOAA 4DJTA 2ZRAA 221PA 3DZDA 2EU8A 4DUGA 2GILA 3BIFA 4A0GA 5KPJA 4M8NE 2WJHA 2HJVA 3DPUA 2YZ2A 4FI3C 4MRPA 1G9XA 4US2R 1G7RA 3EPJA 4LBWA 1GKIA 1CJMA 3PEUA 1TEVA 3PUWA 4C9BA 5EQTA 1E4YA 3QKSA 2BV3A 4DCVA 1ZNXA 1Q0UA 2QU8A 3A1VA 5K8UA 4A36A 4LDJA 2HV8A 5CYOA 4A9AA 2VP2A 3RWMB 5LD2C 5HE8A 1ESNA 4TYPA 1F60A 4G5RA 3U2QA 3PUZA 4FW9A 2JLZA 5EJEA 3EA5A 1CP2A 1E9RA 1IQPA 3VTKA 3IPXA 1XTJA 1VCIA 4HAXA 1SQ5A 1W36C 3V4RA 1W0KA 3BORA 1OXXK 2QBYA 4E03A 5IHPA 2ZM5A 3RC3A 1E2PA 2GHIA 5E7IA 3OEED 4WAUA 3FYHA 4EJSA 1Z83A 1AIPA 2G0NA 4NCIA 3BJIC 3A4MA 1ZCAA 2EWWA 3OIYA 2OCBA 3FMIA 4E09A 2VF7A 3Q7PA 2WWYA 2A7QA 2JIZA 2GVDC 1XNJA 4KV9A 4Z8XA 4MDEA 1ZIPA 4BFTA 3GLIB 3K0CA 2ERYA 1KO7A 1I4DD 4PSVA 3THWA 4LC0A 3FWYA 1GZSA 1L4YA 2ZETA 3D6TB 2IYXA 1Q22A 3U44A 4XH9B 5B2ZA 1G41A 1W0KD 3WHLA 4ARZB 3THWB 1J8MF 4RCYA 1Y3AA 2PCJA 3CRW1 1CIPA 1AQUA 4BFYA 1E1RD 4R7ZA 2WWXA 2QP3A 2OUKA 1SHZA 3HJNA 3MD0A 4NONA 5KYKA 4RZXA 4EPWA 1TMKA 2ERXA 2IXEA 1TU4A 2P6NA 2WJIA 3A1TA 4AY2A 2FDCA 2P2LA 2HLDA 3A58B 1L7VC 2P3SA 1FQKA 5CJ2A 5E95A 3VR4A 2F9LA 3RRYA 1N0VC 4C30A 2FU5C 2Z4SA 4JLJA 1ZMXA 1TUIA 4RKFA 4CT5A 2ZVQX 2OAQ1 1KSFX 3ZS8A 5D3MA 5UKDA 1G1MA 3CNOA 5FBRB 4UNSA 5SZJA 3I5YA 4EPVA 4TYQA 1CKEA 3ZIAD 4M1MA 4EPXA 1RRPA 1BMFD 3AVQA 2O8BB 1NLYA 2VSOA 4Q4LA 5L3VA 3VNUA 1P9WA 5G41A 1E1RA 2NGRA 1B23P 2GF0A 1HT1E 2R44A 2RB4A 3R20A 4TT3A 5GVRA 5BW8A 3R8FA 3I8XA 1KZ7B 4QBHA 4XJXA 5TARA 3A6PC 1SVKA 3FHTA 2R65A 4OK6A 2ANCA 2B7BA 2IF0A 4XWKA 3CH5A 2V7QA 3UMSA 2WMOB 3SDZA 3IBGA 2WAXA 1R7RA 2FZ4A 3GLHA 5BN4A 2N42A 4YDSA 3VQTA 3U6BA 3I61A 1Q1EA 2IA5A 1U8AA 5AJZA 4PQFA 3IQXA 1R8SA 3N5CA 5KDOA 3WNCA 2NZJA 3UMRA 3H1TA 4CZ2A 3G82C 1LFDB 3AKEA 4Q4JA 3T61A 1M8PA 4DCNA 2CLCX 4OHZA 2B6HA 1II8A 2ZYTX 4HLQB 1SKYB 4Q21A 3L0PA 4AKEA 1QRAA 3CF0A 1QDEA 3SQWA 4G1UC 4C0BA 5FUVA 3W6NA 1WE2A 1GL6A 4YMWA 1YRBA 5CIQA 2F43A 4I99A 4N0EA 1N5LA 4AG6A 4FMDB 2LWIA 2O0JA 4NYIR 4HAVA 3SYNA 4BASA 3EARA 4QM6A 5DH9A 1G5PA 1P7CA 2JGNA 4AKGA 4DZZA 1D9ZA 2G9NA 5FTLA 2JEOA 2ZSBA 5FBWB 4IVRA 3V9PA 2IYZA 1E9AA 1UBEA 2WWFA 4ZKEA 2PL3A 3EIEA 4FD2A 4Z54A 1OH6A 1JJ7A 2BMJA 4GL2A 2OFXA 1PZNA 2AN9A 1A4RA 3BB4A 5CK4A 3FE2A 3GJ8A 1GNQA 1GRQA 4MQBA 4KBGA 3IPYA 2Q3HA 3SS8A 1NBMD 2GXQA 4OYHA 1SKYE 4IFBA 1N0UA 1NSTA 3K8YA 3ADBA 2WTUA 4JBXA 5AK0A 1JEEA 2ZS8A 1NG9A 1D9XA 1G7TA 1NP6A 1DTSA 1SVOA 2XITA 3AF0A 4BLTA 3L43A 1U81A 4DC9A 1E2MA 3I3SR 2V55B 1N3BA 4TL6A 1OIWA 1E99A 2DR3A 2PJZA 4EFMA 2O8CA 1FNMA 3SR0A 2OXCA 1WB9A 3QF7A 1GVNB 2Q9BA 4P3YA 1P60A 2YINC 5FTKA 3GJ0A 1KI9A 1HE1C 1VMAA 1S96A 4QGAA 4PSAA 5E7MA 4CF7A 1MO3A 2HF9A 3D31A 4L9SA 2Q9CA 2P5SA 4U5XA 4PFSA 5K8TA 1KDTA 2ZI3A 2KE5A 2B8WA 3MCAA 4J0QA 2EFCB 1ZD8A 3IHLA 4ESVA 1YQTA 3GLGB 1NBMA 3AVOA 4LJAA 5FUYA 1CJVC 1QHGA 2AWNA 4TLDA 5EE1A 3S1AB 3NTUA 3LDAA 1NN3A 3GJ7A 1Z8FA 2DFNA 2GJKA 3MWYW 4I1VA 3NDPA 4HLDA 1IN7A 1VG0B 3ND9A 4NH0A 1XEXA 5C2JB 5JI3E 3TGPA 1AZSC 1YZGA 1AA9A 3S1AA 3AUYA 4L5BA 3X1WA 1OLOA 2ZU6A 3DKPA 1KO1A 5FBQB 1KK1A 4H9GA 2G1KA 2W2VA 8OHMA 4DDTA 1JBKA 3V00A 1NJGA 2BCJQ 3RS5A 5HPYB 1EK0A 5CM8B 3HR7A 1GFIA 3CB4A 1UDXA 3K1JA 4GMDA 1KNXA 1GSIA 2WSSD 1WP9A 4KAXA 1LV7A 2CXXA 1T3HA 4LV8B 5DYIA 1W4RA 1FMLA 4PC6A 2IHBA 4TT3D 1R2QA 4CEJB 3GFOA 4O2RA 2FEOA 4KXFB 4JSYA 4WZBE 4CYMA 5E7JA 1NLZA 2WMNB 1T5LA 1EG7A 2YJTD 1VIYA 4KSCA 3L82B 3B8HA 4JVNA 5FOSA 5G53C 4TTQA 1JR3A 4GP7A 3K70B 4ZIRA 2OZEA 2UZIR 1XJ0A 2JASA 1D6JA 1U9IA 2EWVA 2NO9A 3B60A 4P33A 3REGA 3SNHA 3T15A 3PFIA 3TLXA 1GTVA 4A92A 3UMFA 2V1XA 5HE9A 2FA9A 3DHWC 1EWRA 1FTNA 2WM9B 1T5IA 1W5SA 1Z0DA 3TJZA 3EZFA 1NSFA 3CRRA 2CL7X 4M21A 1RRGA 3C14C 1JI0A 4TSFD 3U7HB 4MA4A 4HDCA 2KBFA 3I8SA 4ZKDA 3ADDA 1EGAA 2GAOA 4BFUA 1AS2A 3LBNA 5FOXA 1FP7A 1AQYA 3T5DA 4A2WA 1GUAA 4MGKR 1GNRA 1XP8A 5FTJA 3VX4A 4ASUA 3C16C 1VPLA 2A5YB 1E79D 5KHOC 4Q7JB 2WWGA 3HYRA 2FG5A 1KK3A 4OQFA 4YLGA 1ZUIA 1SVLA 4KJZA 2VA8A 1F48A 2QTVB 2XTNA 1E3MA 3CPEA 2ZXUA 4DB4A 1G3RA 1Z6AA 3DEFA 1KNQA 5FTMA 1TF2A 4TSFA 3EWAA 1KI4A 3LA6A 2XGJA 4Q7LA 3AUXA 4V0LA 3FMPB 1LB1B 3UG7A 2QRNA 1XCMA 4LJ5A 4U02A 3VKGA 3VFDA 1LS6A 2XZPA 2AK2A 4G01B 1U90A 1N6NA 3FGNA 3FTQA 3RLFA 5F2EA 4D25A 2VSFA 2DB3A 3SN6A 4DLRA 4P4SB 2QAGA 2NO1A 2CE2X 1QF9A 2CL6X 2I3BA 5JZVA 2CCJA 2E1RA 5HTKA 5IK2D 1ZM7A 3VR5A 3K0FB 2QAGB 2WHXA 4O2LA 4A2QA 1TX4B 4V0ME 2ZJ2A 1T9HA 4Q1EA 4B3DA 1E1QA 3B1ZA 1QZXA 2Z43A 4TYNA 2WWIA 1GRRA 4Q9JA 1W46A 3DMDA 2XXAB 2HXYA 3LX8A 4IOMA 5FR1A 1P9NA 1R5NA 5G40A 3FFBA 1NG1A 3EXAA 4KVAA 5DE3A 2R6DA 4JKIA 2ZE8A 2J1LA 4URWR 1KJYA 3VNVA 4G5QA 2IUTA 4FMCF 4PR0A 2E9SA 2KJQA 2MMGA 4GMXA 1KK2A 3O8DA 3Q85A 3OIUA 1JAIA 1ELOA 1XXHE 2GCOA 1AK2A 2ZUDA 4B3CA 3U61B 1MRNA 4C2UA 4GDFA 1TPZA 2FEMA 2VP5A 3NBYC 4RZ2A 1IJFA 2A5FA 2GKSA 1Z06A 4NZYA 2FMXA 1EFCA 2JATA 1YR6A 4XIGS 3R7WB 1T3LA 1OFHA 2Z83A 3QSYA 3U7GA 1EFRA 3AVPA 3TIFA 3I92A 1FUUA 3JZAA 2NPIA 1XMSA 2EQBA 3R7WA 1TQ6A 5EUQB 4A2PA 1KJZA 2QENA 1KK0A 2QG6A 1XD9A 1JPNA 1PUJA 2FX3A 1E2DA 3MGCA 3EC2A 2XZLA 4IDNA 1KDRA 2YWFA 2I4IA 3NKVA 2WSMA 4DXAA 3KXKA 2AK3A 4FWIB 3X1ZA 3A1WA 5FBLB 1RIFA 5AUQA 2ANBA 2J0UA 1CJUC 4UNNA 1VKJA 4M4SA 4NCJA 3IQWA 2J9RA 3T06B 2ZUCA 3CX7A 2FF7A 3K70D 1IBRA 2AWOA 2ZRMA 2IS6A 4JBYA 2YC4C 1TAGA 4M2LA 3RWOA 4BZQA 4Q01A 2P5TB 1DAMA 4DEYA 2CLSA 3AB3A 1DAGA 1QHXA 1E0AA 1ETUA 4GSYA 1H8HA 3D3QA 4LPKA 2O8DB 2GJSA 2HYDA 1K5GA 1XU4A 4TQ9A 4AYTA 1GKUB 1KTVA 3A4NA 2OSBA 4GPTA 2JLYA 3B5JA 4RSGA 3Q3JB 2Q3FA 2ZI7A 3ICEA 5DLQC 4B6FA 1FW6A 1U8YA 4DCSA 2IX3A 4EKDA 2NIPA 2ZUBA 3EWSA 2F3RA 4Q4HA 5FL7A 2VSXA 4PANA 3A1UA 5CM9C 1EFHA 3KB1A 5FL3A 1OFIA 1QVRA 4P4SA 3MMPA 3NH6A 4HDOB 2J0QA 1YJ5A 4S35A 1J99A 2WZQA 2ZROA 2OCPA 1JPJA 4URZR 2PEZA 3QVVA 4D2IA 1E79A 4A8JB 5JSZA 1OJLA 4M1OA 1PV4A 5DNYB 2NG1A 5EZ6B 2PLFA 3BS4A 4PHGA 4EQ6A 4TLCA 1IXZA 1X86B 1E9CA 1N6KA 4Q9KA 4JT4A 4Q9IA 5JHGB 1GP2A 2HJGA 1SXJE 1JQJC 2GK7A 2IXFA 1D8TA 1CR4A 2ZAMA 4UNRA 1JR3E 2PX0A 2C2HA 4DRZA 2BMFA 4QBGB 5FFMA 4LJ4A 1NVUQ 1DPFA 4M9ZA 1NNEA 5BYJA 1KMHB 4QGGA 2F9MA 2DPXA 2EYUA 3FPAA 4R9UC 3SJAA 4D6PA 1EX7A 4PX9A 2C96A 2FFQA 3UKDA 4GP6A 1M7HA 2EYQA 1Z47A 3LBHA 4HAUA 2GETA 1RC8A 4UXIA 4EIWA 3AM1A 1W48A 1ZINA 3AGQA 3DM5A 3EZ6A 1KY2A 4V03A 2ZVPX 1Q1BA 4FIDA 4TZ0A 2JIZD 1KYIA 4NU0A 5JWOA 1N6LA 2OEPA 2C04A 3M4YA 4FMCB 4MRSA 1H65A 4DLYA 3QBVA 1E1QD 4HLCA 2ONKA 2NZ8A 1X1SA 4X8MA 1TTTA 4GOXA 3VX3A 1OXTA 1R5OA 2HF8A 4CW7A 521PA 2G83A 4Q1DA 2AFIE 2NMVA 3KB2A 3QKRB 4JSTA 4RZ3A 3K9LA 3ZD7A 5GVSA 4LWZA 2IS2A 5K8IA 3I72A 1OH5A 2WV9A 1HT2E 4LHZA 3IDQA 4DSOA 2JDIA 4AKIA 5ELXA 4M1TA 4TL8A 2YWGA 1BYUA 4YMTA 1IJEA 3IO3A 5AR1A 1G3MA 3KXIA 5CJPA 1JJVA 5FOWA 1UEJA 3BB3A 4MKIA 2GEVA 1F2UA 1W2HA 1IN8A 3TQCA 4V0MA 1KI1A 1XZQA 2DBYA 4KHZA 1NRJB 5ANRB 121PA 2FH5B 2QUZA 4IW3B 4Q4HB 4E5UA 1YKSA 3MJHA 3MUFA 4NYJQ 3BK7A 3LWNA 1QG2A 2ONJA 4DLSA 2JA1A 5H8WA 4GZMA 4BLSA 1IM2A 2CBZA 1W4AA 3FMFA 4FN5A 1TF5A 3RDPA 1M7GA 1Z28A 4JYBA 3F8TA 5CLLA 1E2EA 2QY9A 1ZBDA 4JLMA 4C3ZA 4OQXA 4QHSA 2GA8A 4RD0A 4DLTA 5JECA 3U44B 2DYKA 2TMKA 3P4YA 3U3RA 1UAAA 1FUKA 1YR9A 4RD3A 3AEZA 4JL6A 5DHAA 4JLAA 4TWZA 2XEXA 2QM8A 3JZMA 5AJWA 5C4GB 1GL7A 4BLPA 4DVGA 3VAAA 4G5GA 2VIIA 1RYHA 1U94A 3REFA 4RFSB 2QZ4A 4POAA 2Q9AA 4QJ3A 4WBSA 4PZLA 1YZTA 3NVAA 4LPSA 1TEXA 3GEHA 5CIWA 4KLZA 1TL7C 2ZI4A 1U98A 1OV4A 1WA5A 1V43A 3FMOB 5H70A 4F7WA 1XD2A 1VHTA 1E9FA 2N46A 2PMKA 2XTMA 3T1VA 2XB2A 1YE8A 1T8UA 1E2LA 1O3YA 2QMHA 3B6EA 3PITA 4QJ4A 1T6NA 4N3NA 3W6OA 3K9GA 4JLKA 1P5ZB 4NCHA 2ZITA 3NHAA 4AYXA 1Q3HA 2KB0A 2EFHB 4MKGA 5FBVB 2C99A 3I4LA 1KMQA 4BEJA 2XXAA 3PEYA 1GRNA 1Z22A 1Z29A 1E9SA 3VHXA 2W2XA 5EXSA 3TUIC 4GNKA 1K5DA 3TE6A 4DSTA 4Q1CA 2WJGA 2HCJB 4NCNA 3SJZA 1TQ4A 3PUVA 5EP3A 5A0FA 3PR1A 2OILA 4R2IA 3THYA 2DWPA 3FKQA 2VEDA 3OESA 3NBFA 3PV0A 3CH4B 3UIEA 1J7KA 3JVVA 2HXSA 2HCBA 4ZDWA 4D4JA 2O0HA 3LRPA 1E2KA 4MGYR 4NKRA 2V4ZA 4TN1A 1P73A 3A8TA 4HB3A 4QHTA 3BC1A 2H1LA 2D4HA 4EJSB 2HDNB 1OKKD 4PPNA 2WPDD 2QI9C 4Q4JB 1COWA 3UWOA 1MOZA 3G0HA 1M6NA 2FGJA 4P31A 1VTKA 1XTSA 2ORVA 4AD8A 3AGPA 3TAUA 2QGZA 4AI6A 3C4JA 1A2KC 1Z0KA 3B1XA 4BZPA 1R0ZA 1RYFA 4MYTA 821PA 1ZD1A 2BC9A 1TUEA 4CDGA 3LXRA 4M1KA 2IYWA 2VP9A 1W4CA 1OPXA 4YXWA 4B47A 3K09A 2H18A 5HCIA 2F7SA 4BFXA 3BH7A 5EE0A 3H4MA 1IY2A 4KU4A 2C98A 2NOAA 2C5LA 1GAJA 2ZI9A 2WIAA 2GCPA 2H16A 4KYIB 1UF9A 4OHVA 5HR5A 4DEXA 1OE0A 2A30A 1CF4A 4NCKA 1A1VA 2ZRJA 1COWD 1KHTA 4B35A 3W8RA 3OEEA 4FCWA 3EAQA 3W90A 3OEHD 5C1BA 1NMZA 4CEHB 2D7CA 4RFSA 4KLNA 3SOPA 2RCNA 1E9EA 4K81B 1Q3TA 2V3CC 2IT1A 1SXJA 2CCGA 4V0NA 4S2EA 3NDBB 4M9XA 4OKSA 2PH1A 2HUPA 1ZYUA 3TVDA 1CXZA 4DHEA 1N2CE 3AP3A 4IDOA 2RGNC 2ZRKA 1R4AA 1FQJA 1N6RA 2R9VA 4UXHA 3Q5DA
chains in the Genus database with same CATH superfamily
4CKEB 3OZRA 4HAZA 4Q39A 3IRUA 2BGNA 3RYIB 1Y82A 2C4VA 1M74A 5CB8A 4JL8A 3EG9A 1B42A 4IMPA 1O0SA 4OJTA 1S3IA 1RPJA 2JLQA 4LHVA 1M0EA 3G5TA 1UCFA 1Z4NA 4RU1A 1XEWY 3OUZA 4RLQA 3WL3A 4PIMA 1WABA 3VA7A 3G0DA 3OIVA 4EHLA 5LQNA 1PUXA 2PE5A 3KEFA 4DV5B 4TV9B 3FWNA 3KEOA 2AZDA 3JYLA 4QXRA 4X7MA 5BN5B 5A62A 4WSOA 5IYZA 3KC2A 2YV1A 3S0JA 2H07A 1PHRA 1KBOA 2GHRA 3RRMA 1K1EA 3ZXIA 2Z0MA 1JG3A 4N9QA 5GIPE 4HDKA 3H5IA 3LA8A 1GZ3A 3QMVA 4JROA 3UN1A 1JHQA 1TU3A 4RF5A 4RMGA 4OJKA 2CJFA 3RUEA 3C6MA 4UNQA 3ER9A 3VMFA 1KXJA 4GEKA 4BRZA 1OZFA 1RS0A 2BEVA 4Y0VA 2R47A 3V1NA 2EBUA 2FEAA 4L75A 5AVJA 3IP9A 1KFEB 4HWSA 2IDKA 5FQOA 5GPBA 3UWSA 5I9NA 4KREA 2Q3MA 3P9YA 1WXGA 3WRYC 2FE1A 1BXZA 2YWEA 3WB0A 4P6VF 1NJ1A 3O73A 4OQEA 4FP9A 3NOVA 1DNPA 1Z08A 2LE0A 2XNDA 3GRVA 4BECA 3COPA 4KRGA 3H9JA 1N0HA 4X1IA 1JQDA 1T9BA 2IXDA 3AUUA 3FKSA 3SNKA 3ZHTA 2GA9A 5FKJA 3SSMA 2I0FA 5AUPB 1DTWB 1A2QA 4ZI3A 5CFOA 4LJSA 1QHHA 2POCA 3A37A 1Y98A 3PX2A 5G1PA 4QG7A 4IDPA 5DHRA 4FGUA 4YRKA 3IQIX 3SM9A 1NMYA 4O6VA 4ASUD 2GKGA 5HGJA 5KAPA 2XADA 1G7SA 2IIBA 1JTVA 3FYSA 2V5UA 1FMFA 1KO8A 4XB2A 3WL6A 3PWKA 1ZHOA 1YJCA 2XR1A 1NW4A 3KDAA 3T12A 1SU8A 3SMQA 4R2XA 2WAOA 3IAM6 4NVRA 1MT3A 1EVEA 5J4VA 3NHJA 3PHGA 1SBHA 2HU8A 2YV4A 3ZI4A 3QVLA 1N25A 1ZM2A 2OD7A 2QQGA 1OKKA 5JH7B 1LBSA 3VBEA 2A1TS 1RQ7A 1L7RA 1XZKA 2RK3A 3DDWA 3M9LA 3N2KB 4NI5A 4NENA 4PPQA 1XHLA 2H63A 3OH8A 2P1ZA 4TS3A 4FT4A 3AB8A 4JP5A 5KNCH 1YZUA 3HI6A 1VL1A 4RY2A 5AKZA 3WGLA 4CG1A 2HQOA 4CTMA 1FOEB 2UKDA 4LBYA 4WEQA 3K92A 1J2RA 4R2KA 5H3CA 1MBZA 1Q17A 2AI3A 3GNLA 4GZ5A 3VOBA 2F1HA 1NQUA 4DCUA 1RR6A 4J6FA 2JIRA 1DAEA 2OV8A 1H6BA 3K0AB 3MTBA 3QFTA 2R2AA 4XX0A 1CT9A 1IM5A 1PWZA 1B0ZA 1EVIA 1THTA 2IYUA 2ZJBA 2ZR0A 3B6IA 3GJ6A 3NEPX 4FC7A 3BIOA 4HX5A 4Q7MB 2GZ3A 2X77A 2JARA 4MUEA 1BNCA 4US0R 6ADHA 1BU5A 2O19A 1C14A 1KYTA 2I3AA 5DNCA 4CM9D 1IN5A 4MI6A 4AIRA 3AWIA 2RHJA 5AHWA 1DQPA 5AXDA 2WW8A 4IIJB 5DN6A 3WGNA 2HCFA 2Z8ZA 1F4LA 3GBPA 4MUGA 5EMMA 3WX0A 1YS1X 2RHDA 1V1JA 5DW0A 1GUDA 2G1JA 4B3RB 3T7AA 1EWYA 4PAOA 4LVOA 2A5GA 3F8WA 1GYPA 5DHFA 4L2IA 3C7DB 3GQBB 2I3ZA 3MJEA 4GOKA 2O8CB 4H1TA 4L3VA 3C1OA 4P5DA 1OLXA 3PCTA 4UUQA 3K53A 2W2KA 5JXHA 1URPA 2JB9A 2R6CA 1B7GO 2V58A 2QRJA 4W5WA 5AJVB 4DG5A 3TXXA 3OTHA 4BEBA 1XRSB 3H42B 2BUAA 3KPJA 4FYKA 1SGWA 3DLHA 2NVOA 4JI8B 2P9BA 4TLBA 4M9SA 4D99A 4ZI7B 2BEKA 1QMGA 2HIHA 4P93A 3EUAA 5C31A 3IHTA 5DNUA 4Z6KA 1CY6A 1R8QA 3CBGA 3EISA 2C5SA 4WKCA 3S5UA 3U7RA 5KBYA 4PZYA 1V37A 1DVRA 2YUTA 4X1IB 3OX2A 3ZH9B 3OP1A 1JVSA 2NU9A 5B3LA 4WKOA 1FXWA 1G20E 3GMSA 3FGOA 4ZO4A 1LGYA 3EDYA 3TZ6A 4EMBA 1TNDA 3WRWA 4LY6A 4TPKA 1N5RA 1C50A 1PFQA 1HQCA 3LDUA 4QDTA 1Z0JA 4ZPJA 1W5EA 3NT4A 1X3SA 1Z13A 1N9ZA 1LNZA 1Z3CA 1UXGA 3DDNA 3NNDA 4FJ1A 1BS1A 3CUKA 1SURA 3THWA 2VT7A 3IT2A 2ZRNA 4QGHA 4XD7D 4AJ4A 4R7GA 2REBA 1BO6A 3KJXA 3OE7D 4DYVA 2WZDA 3TXYA 2VHEA 4LRUA 1FA9A 3WY9A 3CUWA 3MPOA 1JWBB 1P61B 3T0GA 4IEEA 2HF7A 2ALJA 2QRVA 4QEZA 4OEHA 2C1ZA 2YYSA 5KQSA 4X65B 1NT4A 2BPOA 4F12A 1ODIA 4L9WA 1Z07A 5TB5A 3SHWA 1T0BA 2BFEB 2H08A 3UK6A 4X8HA 2EFGA 1JUDA 4NEQA 5LZ2A 1H8HD 4RETA 1ESEA 2O14A 2PX3A 3OLVA 3BSFA 2FQWA 4IDAA 3WGJA 2C3OA 2P41A 5EKXA 4HT3B 3AHIA 4F3RA 1ZIDA 5HWSA 2XIJA 4OGKA 3I6YA 4RVGA 3K9BA 5G3ZA 2MMCA 2XDYA 1Q1ZA 3PNMA 4R8LA 1E4EA 1K2VN 5D51S 2Q3EA 1ZNYA 4L5CA 1HYGA 3ZS9A 5BVGB 3EH2A 4LDNA 4DUPA 4TTIA 2I4MA 3NW9A 4XM2A 4D0NA 2AKAB 3AY6A 3GPCA 2JGDB 4LMBA 4EKGA 4S04A 4ZQFA 2IHNA 1HWYA 1VCNA 1SKUA 1E4OA 3MLEA 1AJEA 5DGXA 1O1YA 3ZDBA 3ANLA 4G0NA 1YL5A 3TQRA 3LT2A 3MGKA 5A4KA 1QH8A 1JSZA 4LC9A 4B31A 5JARA 1S2GA 2EKQA 3F2VA 2P2ZA 1GJRA 1UBSB 2GPNA 3ETGA 3R7NA 1U8ZA 1SHJA 2BLNA 2PX6A 3IEXA 1WLYA 3OIDA 4MKZA 1NY5A 1AKVA 3B9QA 1C81A 4J3JA 4CLRA 2NYVA 3RFTA 1II0A 1QH1B 3QU9A 3MNFA 4DIDA 3X44A 4AN0A 1T0HB 2X58A 1WV1A 2Q1XA 3AJ8A 4P92A 3NHFA 5EN4A 3P97A 4Q47A 3VR1A 1HG0A 1SOUA 1P3JA 2X86A 3FPKA 3TSCA 1ZK1A 5H7XA 4FEGA 4O1HA 3ZV6A 4B48A 4JMLA 3IBYA 1KSJA 5ILOA 1ZSVA 2IYTA 4JR2A 4N5IX 4WZAA 4C4RA 1FRZA 3G8AA 5F98A 1SBYA 3HKBB 2FZVA 2HT1A 4TS4A 1ZR2A 5DM4A 1H1LA 1S2MA 4HS4A 4ZAFA 4JJIA 5AQEA 1OXUA 3TL2A 3WYGA 5KJCA 2WAYA 3CUSA 3KEGA 5KYYA 1XZNA 1Z9BA 4H1UA 2FMHA 3C6BA 4KXUA 3FUCA 2GM4A 2ZDGA 4XEUA 3CVXA 3EZYA 2REOA 4WTOA 5ALVA 2O2HA 3HNOA 1JFTA 3BRWD 1XXLA 2PHZA 4PBSA 3WKBA 4DMKA 2W98A 1ZXXA 1ZZEA 2DWUA 3HWWA 2Q5OA 3OCZA 2DPLA 3TLKA 4YJ2A 4TKZA 2Q8NA 1UOEA 1T4CB 2E5WA 3H5WA 3O83A 5FR2A 3TZQA 3JQ9C 2F4NA 2WG1A 4K28A 2Z4RA 2HZBA 4QYMA 2X0EA 1RQNA 3NX4A 2X9VA 2PMFA 1X0VA 2WU8A 4ZQBA 1W6UA 3O1HB 4NC9A 2EDAA 3NPMA 3G7NA 2CXOA 1U5CA 4D6XA 3QITA 4G41A 3R5FA 1YMQA 5EEGA 2CJWA 4YC7A 1L5MA 2PD6A 4AJPA 5DN9A 4XTRA 1TD1A 2KLBA 4R9NA 3L0BA 5JU6A 1VLLA 1KYVA 2VUTA 1GYRA 3T3NA 1Q20A 1S3GA 4BZXA 5DHSA 1XFDA 1BXGB 2B37A 3CKYA 1N6OA 4DMRA 2DQSA 4Y30A 1T2AA 3BRQA 1OX4A 1KEPA 3OHSX 3BAFA 4CIXA 5KTPA 1DX4A 1MZPA 2XGGA 4HGYA 3MWKA 1C4OA 1OBVA 5I4IA 1E6LA 4UXJA 1G42A 2V96A 4KWCA 1XFAA 3DMPA 3K0EA 1C0EA 1V45E 5H9VA 2JJ1D 4KGZA 4OJNA 4V0OA 1XPRA 2BMWA 3GRZA 4UPEA 2F8MA 1TMGE 2XOKD 5AHXA 4KO3S 4PR3A 1A9OA 2O9JA 3G0OA 4NQZA 1QOQB 1T1SA 2OC4A 5ICCA 4MW2A 2FVXA 4TX1A 4KFSA 1IM8A 3UCEA 1LLCA 2DU8A 2GGSA 3EODA 3I9FA 4JB3A 3RSOA 1W94A 1BD4A 4TQAA 4A5SA 1BH2A 1IVNA 4IUCS 4UEQA 2C3YA 3MWGA 4E21A 2QE7D 4LYJA 4NOLA 3WDLA 2FMKA 4HQFA 1T9KA 3WDKA 4B4VA 3S4YA 5LNK6 2WUFA 4IH9A 3F6CA 2AGVA 1NUTA 2QVXX 4JOQA 2PPLA 4QDXA 4QU0A 4FUQA 1OBFO 5EWLB 4XB1A 4U3JA 4EUEA 2JAOA 1EFPA 4NL4H 5HDBB 4O4HA 5HS4A 3BXZA 1EK2A 2I2WA 1JU4A 3GJ5A 3V6LA 1OC2A 2O48X 2R6GA 2Z8XA 3GJYA 4MRNA 4WXMA 2ZB8A 1SXIA 3L7CA 4MIEA 4GE0A 3WKCA 1GVHA 4NBUA 3SC3A 2QRLA 2XDQA 5TQVA 3GY0A 4NBWA 5KOJB 1LEHA 3ZDYB 1YQUA 2Y8EA 1M72A 4FZ3A 5BN1A 4EATA 1BE6A 3UANA 1B15A 1YBAA 3O93A 2N1BA 2F59A 5IM5A 1KSHA 2VK4A 3QFHA 2HA3A 3L7IA 5IJ0A 3EIQA 3CF6R 2UVQA 1GU0A 2VYFA 2X8WA 4TMZA 4D6YA 3ZJTA 3URKA 4QFDA 1E6MA 4YMWA 2D2IA 4NICA 4FYYA 4X3OA 4RD4A 4Q00A 3GQBA 2UZ1B 3HCRA 2B82A 2VHWA 3QVSA 4PX3A 4YJGA 4JYPA 4CTOA 4J2TA 3ZQJA 4HWKA 1FNNA 1GZ5A 1IRXA 2VAWA 3CJTA 3MLBA 2O2EA 2WA1A 3ADCA 2FW0A 2PN1A 1QV7A 2P9ZA 3DTTA 4PLPA 3ZTWA 2HPHA 4GI7A 1E66A 1XJQA 4IF6A 2JI8A 4KQKA 4HLUC 2FI1A 1QTIA 3KUDA 4L6IA 2YRXA 1R0CA 1HTTA 4UATA 3S81A 2NN3C 1JEJA 3LW8A 3EFOB 1H5QA 1UWCA 1D4FA 1PV1A 5T57A 3TI9A 3S40A 1XQ9A 3EYAA 4UZFA 1RKBA 4UD6A 3BOSA 4KACA 2IKQA 1IZ8A 1ECBA 1AZTA 1EAMA 3A4YA 5IVHA 2I6FA 1MH1A 4UE2A 1V9LA 3DDCA 1FMJA 3HZOA 2PZBA 3M6AA 4YMSA 2QRZA 4IGEA 4BO9A 4A8JC 3KJIA 4DC0A 3G2QA 4LQDA 4B81A 1TTHA 1USWA 3ZIUA 5HHTA 1E3IA 2C5FA 3DEJA 5F77A 3RSGA 2ZRGA 3PT9A 3GJ3A 2X2EA 2CK3D 3URMA 4YXWD 1O87A 2PGIA 4GXQA 4DRXA 1B73A 1OPRA 5EAIA 5JO0A 5KOYA 5A0VA 5A9SA 1NXOA 5C37A 1ARZA 1IIBA 1M10A 4IZHA 3JQGA 3C3BA 3IXMA 4KODA 4NESA 2OXTA 2AV6A 1CUEA 1JH9A 4YV7A 4V0KA 2MYTA 1UFOA 2Q46A 2C7GA 1B8NA 5JVDB 5B37A 1XMPA 1AB6A 1UBGA 3MWEA 5CTAA 4Q9AA 3A1CA 7YASA 3WGOA 2NO6A 4YA6A 1QTNA 1N78A 1NYRA 3NYWA 4GBMA 4X8LA 3BEDA 3ANTA 4QPZA 4B84A 1XAGA 2FSHA 4BVBA 1IK4A 2IF2A 1OAKA 1RYEA 2PEYA 2QT0A 3HCEA 3ORHA 4FGWA 2BBSA 4FWBA 4PWYA 1PNTA 3THRA 4AURA 2OD9A 3E0QA 4RTRA 4UDNA 2A5JA 2VF8A 5JMWA 3T9AA 1A9XA 3H8JA 4R71A 3HFGA 3LCVB 3M83A 4OHYA 1GKKA 3QMMA 3L8ZA 4RUKA 4MLDA 4XXHA 4OI1A 4DDVA 5ES4B 1XB2A 5JNVA 2I7TA 1TIBA 2NVUA 2H4HA 2PBZA 3NHMA 5IS2A 2WKQA 4BAZA 1EVZA 2FMIA 2VDQB 4B34A 4BDSA 3LKBA 4OFBA 2JKYA 3B13B 3OU6A 3R7AA 3W7BA 2JAXA 3JAKA 4KXLA 3N86A 3W7VA 3RNOA 4UJ5A 3VM6A 1KFJB 3BE4A 1GILA 1BFDA 1R9NA 4BO5A 3THXB 4RZHA 3GROA 4RH3A 1OAOC 3D4NA 1DWQA 4BFWA 5KOJA 3G13A 4HTFA 4IOLA 4MSUA 5LQRA 1KVTA 2I1QA 4DVJA 4MYCA 4AIIA 2CDAA 1GG8A 5F9HA 3ZHRA 1RHMA 1E0SA 2QAJA 1ZU5A 2IP4A 4FHDA 4XGIA 2AS0A 4ZTUB 5J2UF 3KU1A 3TM5A 5IBQA 3BJMA 4GKAA 5I4KA 1BFKA 3MJFA 2B2NA 2CXRA 2GPTA 3MWDA 3R7FA 1CEXA 1C7IA 1JG2A 2ZREA 1F2UB 4RA6A 5BRAA 4IUDS 4BB9A 2RHHA 5JHHB 4A4DA 1H2BA 2FPLA 2OV2A 2C3PA 3F3MA 1IH8A 3IJEB 3DL0A 3L8DA 1R9JA 1ZW1A 3TQFA 5IMSA 1EHCA 5JJBA 1H1LB 1QJCA 5KVAA 4PZ0A 3OFKA 2ZRIA 1XTQA 2DZDA 4CMGA 2PDAA 2M98A 2O23A 3HA7A 2YXEA 1DX9A 5ITZB 2EJTA 4ARZA 4TKUA 5K0CA 3ZU3A 2J6CA 2WYVA 1MRZA 4W5QA 1XF9A 2OBMA 5CLGA 3TCKA 1PFYA 4BNXA 1X6VA 4Z0HO 2FEXA 4B0PA 2PRYA 2YWRA 2A58A 3AM3A 5TR9A 2W37A 4CV0A 3FCOA 1RRVA 4DCOA 4NPAA 3LT5A 1F3LA 3A2MA 3DLPX 3NT2A 2BDTA 3U1VA 4E33A 1ECCA 3IR5A 5LZ8A 4F06A 2C83A 2QPAA 2XNKA 1GRCA 4P22A 1TF7A 3VV3A 2YFYA 4ZAXA 3HB7A 3AV3A 3ZHXA 3W8NA 3P0FA 3RR2A 1UKZA 2WE7A 5CGZA 1DL5A 4L6AA 4LRTB 5EHQA 2WFMA 3IODA 5LP6F 2PR7A 2VP0A 3CSSA 2XA9A 4HYYA 3LUCA 4Q18A 2VBCA 3CZMA 3W2EA 3W5HA 4BDTA 1ODKA 5I7SA 4UHCA 3RC2A 5C53B 3ZTTA 4O33A 5PNTA 5BSHA 4LF8B 3DV2A 1K0FA 5LKAA 3TWOA 2J33A 4HKTA 1Z2DA 3UMMA 2I7VA 4WBXC 5EIBC 1V6AA 1KJQA 1Y34E 3NDRA 4LRQA 4NZZA 2OFFA 1YS4A 4ARAA 2VRBA 4EG1A 3ICQB 2P6PA 5KTSA 4LXIA 3GRKA 3EQ9A 4FGZA 5C5IA 4DL9A 4QXAA 3MMSA 2PUAA 2Q1UA 4ZVLA 4YAWA 3NBQA 3VZBA 4K6GA 3B70A 1NDQA 1HDEA 1MEEA 1QO0A 3NEAA 4FOOA 4FYJA 4GHWA 1RAIA 4H7PA 4B6EA 1XDBA 4AO6A 1V3VA 2ZJ5A 4JWKA 3FOZA 2O7RA 3B82A 1XPOA 4DLAA 4RABA 1OXSC 1X94A 2W2TA 4IWYA 4QREA 3PGVA 2WNIA 5IJ0B 3AWDA 4EYOA 3TL3A 3RVLA 4A73A 4B6SA 2HREA 4EPYA 3BGVA 3L8YA 4Z8YA 1CQPA 4YREA 2PH5A 2RKWA 3D7RA 2FGKA 1OXMA 4F92B 5TEVA 1VYUA 1EE9A 5HZKA 2FWAA 5BW5A 5DMHA 1W88A 1XZGA 2J32A 2Y0PA 1COZA 1U6KA 4GOLD 2O1XA 2CVFA 1B74A 1AMOA 4BP8A 1MKYA 4K9QA 2HW8A 1K6MA 1NJFA 3QIAA 2XYPA 4RS3A 2AQIA 4DV4B 3MWJA 1P2SA 4MWOA 3HKDA 5A4IS 3RU3A 1UWVA 5FI3A 1QZZA 3H2YA 4JJ6A 2I6SA 3QPUA 3CZ9A 4DR5B 2ZRCA 5JLAA 2X7XA 3QPBA 5B4TA 3AH8A 3KT3A 1H9AA 3P2EA 4NU6A 5I4BA 3YASA 4DQXA 3ANXA 3GWZA 1UJ6A 3RK0A 1H22A 5FTNA 2OV1A 3G8BA 3O8QB 6Q21A 1RHRA 4YMUA 5DISB 3WO1A 1LNSA 1PYGA 3PUJA 2GEBA 3I73A 4X20B 4I4LA 3LUFA 3UVEA 3FNHA 2HQBA 5C34B 2IIVA 3COSA 3DXYA 3ZVLA 4RJLA 4JITA 1BVRA 1LBIA 1U2ZA 3ZK9A 2JIBA 3MB5A 5BYKA 2MSKA 3VO9A 3WZMA 4OLAA 4NY1A 1UDRA 1VSVA 1FB5A 2OVFA 2X8LA 3W34A 5HKBA 2FPMA 1ZAKA 2VRCD 2JHCA 4WK6A 2ATEA 4HFNA 5ICFA 5FDFA 1PNRA 1KQFA 4PSCA 2C4NA 1EB9A 1EXMA 1MC1A 2QT1A 2QD4A 3QA3E 4LBZA 5DSTA 5IFLA 5C52B 3U5ZB 4WA7A 4M98A 1YZYA 1QC5B 4U2FA 2RSLA 4L76A 1LPPA 1N9KA 5CDGA 5GP1A 3D4OA 4FZ5A 5JS2A 3LG2A 1WXQA 3TJMA 2BHRA 2Y05A 2Q1YA 1EXVA 3O8CA 3ELYA 1Y6FA 2VLBA 3UICA 5E6UA 3BWMA 5CPFA 4YQZA 2CXSA 4WN3A 3T7EA 3ZHZA 2PUCA 4TYWA 2O8EA 1GPMA 4ZCRA 4XYBA 3ILYA 1W7AA 4Q6WA 1TFRA 1P5FA 3GEEA 1AF4A 1B43A 3WZ2A 1K86A 2F67A 4OBWA 3RHZA 3K96A 1QQ6A 3O8RA 4MWEA 2G1PA 4DV6B 1Z5PA 4E46A 1H85A 5EEHA 5AFSA 2WIFA 2PY6A 3C8HA 3CLUD 2A9VA 2VJOA 1N5OX 5TNXA 1D8AA 4H31A 1E5XA 3T5DA 1LJUA 2YV5A 2CSXA 3PBKA 4A2WA 3SQXA 3DXZA 2JLUA 1FDVA 1OX6A 5HIAA 2YS7A 3QYFA 5LQJA 3NMUF 3GI1A 1NN1A 3WNQA 2ZRLA 5AKXA 4OB7A 1CUYA 3ZWAA 3OAAA 3RRBA 4AYXA 1A5SB 3FOEC 2HHJA 4QU8A 5IUNC 4OKNA 2Q2NA 2SICE 5DJ5A 5KKNB 5LXTB 4GRDA 1FX0A 4ZO8A 5F3DA 3K4HA 4RF4A 3V8BA 2GD1O 5AHRA 5BYAA 5JY6A 1W49A 2RC6A 3NTOA 2ZRHA 1JQAA 3KTAB 3BILA 1GUZA 1OFUA 4ZCLA 3MJCA 1OLUB 2ADOA 1EWKA 4D02A 4B76A 3AQ4A 2NADA 5CVJA 1XMIA 5LUAA 1SCJA 2GTPA 3JD3A 1NURA 2OHVA 2Q07A 4MHOA 4YP0A 5EJIA 2ADFA 3DP9A 1ULAA 2HK8A 2HKIA 2PRIA 2ZYGA 2WVGA 1VBMA 1UODA 1GFZA 4U9UA 1GCIA 3I9KA 5E3IA 2QYHA 5HEKA 2HOQA 4MVJM 3WAKA 5JAHA 1IBKB 2C2MA 4S05A 2Q7XA 5CVUA 4GEGA 2CDNA 4Y7CA 5DI9A 3D0QA 4RD2A 4BQSA 2ZJ4A 4YT2A 4GLFA 3LP6A 3IAHA 1ZJ6A 1DJLA 1OT3A 1P7PA 2A3NA 2EKPA 3UTDA 3WYAA 2P77A 4AQYB 2QL5A 3E2IA 4R3NA 4P36A 2P3QA 2P9EA 3RHSA 2E5LB 4DARA 1US8B 2XSZA 2MINB 4K9DA 3N2IA 3A6ZA 5ADUS 3QX7A 1UBTS 4QDOA 5BVHB 3ZJVA 1TW2A 4IIVA 1AQNA 3GDHA 4OUDA 2I2FA 4YQFA 1PN3A 2J3KA 3KZNA 4PZ9A 3QVUA 4QRIA 4C0QC 1VECA 4DMMA 2YWDA 2ZULA 8GPBA 4XPZA 5G02A 5L4LA 3T8YA 5LDHA 3AVUA 1LVGA 4R1UA 1YC5A 5AIAA 3OIWA 3GEBA 2C94A 5AUOB 1B6TA 2DLCX 5JNLA 1P0QA 1GFSA 4RJJA 1UMCA 3JQBA 4CKZA 5IN5A 2D2XA 1A5AB 2G8LA 4KTTE 4KQCA 1NFQA 1N0IA 4J6EA 2C9MA 1Y4DE 2X22A 4DUYB 2FWIA 3UHPA 2IL1A 4KR0A 4O4JB 1XK7A 5JJKA 4IZOA 3J7TA 2VL7A 3DO5A 3MXTA 3K72B 2BMVA 1LH0A 1S2OA 1G8AA 2AD1A 3HUTA 3ISJA 3SHOA 1PDOA 3SBDA 4A5OA 2X5NA 4E94A 5P21A 4BS9A 4WINA 2DT5A 4JJKA 5JADA 2JGEA 4HQOA 4YJ2B 1ONBA 5KWVA 4IDFA 1II8B 3JSXA 1MORA 2PCLA 1DOHA 3KYJB 2FW8A 2IYRA 2YHAA 1GCAA 4LISA 2C7BA 3QNUA 2ZANA 1VXOA 2CV0A 2AJBA 3TAHA 2DULA 2KMLA 3UWKA 5D5PA 3QVKA 1U3DA 4OX9B 4YR7A 4ARVA 3ZNNA 5I51A 2CJWB 2B4QA 1L6IA 3DF7A 3DLCA 5HILA 4NNJA 1DBSA 4HPWA 4Z7QB 4TWJA 3ZWCA 3FFWA 4BZWA 1DCKA 4YGXB 3DUFB 5D7NA 5EJ2A 2NQ8A 1EFLA 2W83A 1Z6YA 2BMDA 4X66B 4CMCA 4KMMA 3TRFA 2GAFA 4ETIA 5BN4B 3CW2A 1TZKA 3DCIA 3L4BC 3L7AA 4IH4A 4QRDA 3DZKA 1OXKB 4Y6SA 2I4NA 1JA0A 3DEIA 4MKFA 2RH9B 3MVEA 5EC8A 4TS9A 1E9BA 1VMIA 1RC0A 2C8VA 2X1HA 4RVFA 1ISSA 3EDOA 3NVDA 3OZGA 2QROA 5I7EA 1BS9A 1DIRA 1GR1A 3O95A 4DUGD 4KXQA 4MVJA 4N41A 5LSAA 4IY1A 2WJVA 4UDXX 1T8SA 3L1VA 5AOAA 2NPFA 3CN9A 3GLHE 2IVFA 3E18A 2E1PA 3D0RA 4FN4A 1CRQA 3WXBA 1V8ZA 2ZRPA 3CJRA 1R3DA 2C00A 3AP1A 2VH2A 3IQZA 3ME5A 3C48A 3PCRB 3QKUA 2XDAA 4HMPA 4LTMA 5CXXA 1LJLA 3C3DA 3QLVC 3R6GA 2CSUA 2XPCA 1G21B 5EIHA 2ZS9A 4OOEA 5AJYA 3RO7A 2DLDA 1SXGA 1YS6A 4L28A 4LDAA 3TW4A 1P39A 4JBWA 1WDTA 3DCJA 4XWOA 4ZICA 1OGJA 2AEJA 1LF0A 5CB6A 2CHUA 2E4WA 3NNNA 3UFXA 2MINA 4EO9A 4QO8A 2XAAA 3R9XA 2ZATA 3UPDA 1TLLA 2YN4A 1WBJB 4R9SA 1PNOA 4KXXA 5FPHA 2FW6A 1KOJA 3U4HA 3M4ZA 1GQSA 2XRMA 1NVVR 3PCXA 4E5YA 3W2GA 4I4TF 4GR9A 2Y9MB 3BWXA 4O4LA 5E4JA 3U48A 3QOFA 3GO4A 4N6OA 2F90A 2TECE 3EEFA 2H5LA 4BGDA 4B82A 5LWHA 1MHTA 4MDFA 4QICA 3MUNA 5EKTA 3LOQA 4Q1BA 4UVEA 5B1IA 4F3TA 1G8HA 1NT2A 1DKNA 1YHNA 5DCYA 1IEVA 4HDMA 5YASA 2INGX 3D6FA 1YL7A 5JBQA 3EVAA 3OFJA 2O05A 4EX7A 1FXWF 4DMGA 1U2EA 3Q7EA 1CU1A 2J5RA 3FZEA 3SE0A 2Q4DA 3HB5X 2C7OA 2CVQA 4K9NA 2FHPA 3NHPA 4QPCA 4ITUA 4KDEA 4JA0A 1VDZA 3D5QA 1IK6A 5T8KC 4RZUA 3D54D 3V97A 4RPIA 2XLCA 3HA3A 4EUKA 1S9HA 2D74A 2CNWA 1PS8A 3F47A 4Y1RB 4B74A 2ZBRA 1JFLA 3R7SA 1QMPA 4Y3UA 1KU0A 3PLRA 5REQB 3V5NA 4RF2A 1G8YA 5IDQA 3R3SA 2AN3A 1RWWA 3ZU2A 1BQ4A 5DI3A 4DA7A 3R3UA 3PQCA 2UYCA 2JJMA 5A2QA 3R09A 4M1EA 3AF3A 3F5DA 1NMQA 4I7EA 3I32A 3LO5A 2WG2A 4R1MA 5FJJA 1YDEA 3UJ8A 3QVJA 3SICE 4P9NA 4REQB 2JVIA 2B20A 2P9TA 4IDCA 2HSZA 4QNNA 5J1TB 2X4IA 3O8BA 3VHRA 1Q83A 4ZIRB 4RY0A 3IUYA 1IBLB 1G8MA 3QXCA 4M0UA 2FPKA 2YY5A 2ZJOA 1EE2A 4X91A 5F3RA 2PRJA 4PFJA 4O63O 5I5EA 1C4XA 2G0AA 2VAXA 5T3UA 1G9SA 3DL7A 4D1YA 5CYGA 5KNCD 1EVJA 2P4HX 4TMXA 4XEHA 2ZB2A 1TD9A 3U3JA 4QOHA 1PK9A 1B0UA 2JK1A 3ENNA 1DIAA 3AUKA 1P44A 2YJ3A 4JL5A 1SC9A 4JAVC 4LBVA 4MEBA 2ES4A 1ODSA 1ZK2A 1R5BA 4JEIA 4ZO6A 1JZSA 1BX3A 2X5KO 1P74A 2OCDA 3K9HA 2EZUA 1YCGA 3DHEA 2X1LA 3FG9A 4JU8A 4L0DA 5JJCA 1UEXC 2EAUA 4U2BA 5I3CA 3C8UA 5JZSA 2IYYA 3Q3GE 2QR2A 1UMBA 3EB9A 1IAVA 2PR2A 1O08A 4WY2A 3RVKA 1XTVA 1M8JA 5JROA 2NXJA 3J81A 4XSVA 1A5ZA 2AX4A 2W4IA 1XT6A 2X3FA 4G8BA 4JOBA 4PO1A 2NPOA 3KL4A 3RT1A 4BBZA 4D43A 4DSUA 3E9CA 2YHSA 3CVVA 5D3QA 4EHBA 3FFXA 4ZVKA 1NQTA 1KR2A 1RRFA 3A1NA 4MH0R 4OB8A 3T6KA 4MOWA 6AT1A 3LBYA 1EA5A 2XAUA 1IDN1 1X7GA 4BE7B 1G63A 5ADWA 1EWQA 2XVYA 2EG9A 5I8WA 1EH5A 1J9GA 2GXUA 3DOEA 3NIWA 4AZ3A 3FFTA 4QG3A 5E9AA 3ICVA 4D9MA 4F2HA 2BKEA 3P2KA 2P79A 5BR1A 3SZGA 3HXKA 3MPUA 4NQRA 3DPIA 4JR0A 4C01A 4ZV4A 1Y9JA 4WK2B 5DTRA 3PX7A 3HU2A 1U9JA 3QOWA 4D97A 1EP9A 2J31A 4M1YA 1B8PA 3FGZA 2ZS7A 2GVZC 2Y1KA 1FRQA 2DWOA 3B7WA 3O31A 5FV7A 1P3DA 4EECA 5GTDA 5KOHA 1F2DA 1WXEA 5AOVA 1Z5OA 3H04A 4DCCA 2UYOA 3N3BC 2SKDA 2R25B 1IJKA 3P2JA 4AICA 2PRKA 4Q4AA 5GJCA 4BGIA 5FLKA 3BZUA 1W5AA 1T9DA 3CCFA 3D02A 5K5EA 1NP7A 2PU7A 4C0SA 1GGHA 5AT1A 1LSJA 1Z38A 3JWPA 3MOGA 3F0TA 3N5KA 1G5TA 1YIAA 3ETLA 1JAXA 1JLRA 1KI6A 3I1FA 1CNEA 5KS2A 4Z3DA 1M2VB 2HGSA 3WBFA 1W0JA 2R6FA 2WU0A 1HF3A 3E8MA 3VPBA 1I24A 3I2IA 1TA4A 1N6HA 3GP5A 5BOSA 3DD5A 4I4CA 5HIJA 4EW2A 5BSFA 1L5VA 4FFRA 2ZZNA 2BZGA 4DQ0A 1H2WA 1V1MB 4ZZ2A 1E1CA 1S0UA 4Q7QA 1EFUA 1CF9A 4B46A 4ER6A 2W58A 4RDXA 1EFRD 1NBAA 4TXJA 3B1WA 4MPJA 2Q8QA 1NZFA 2RARA 4Q0MA 3V32A 3QJYA 4F5YA 4DV7B 2QVLA 4CM8B 4RDHA 4MRAA 3GGOA 3ITEA 1U7PA 3MGAA 5IJXA 4OHMA 3RD5A 1ZN2A 3FWZA 2IVZA 2WJJA 3INTA 4R6XA 3GPIA 4BTEA 4Z3KA 4JYZA 2XLBA 3P32A 4YP9A 3C98A 1M34A 2ZYHA 4QX6A 5L6LB 4RKEA 4XPIA 1U0LA 2Q0XA 3MYYA 4PBRA 1UZUA 3U39A 3ZZNA 4EHNA 4YMGA 3SC2B 4J91A 4LHXA 4WCVA 3WKAA 2B1RA 3M34A 5K0SA 2BONA 1KAHA 1F38A 1EM8A 1ORRA 3AM4A 2GK6A 5LIPA 3GFTA 2FJUA 1RKQA 5G3YA 2JIPA 3LP8A 1JBEA 2W00A 5DM60 2Y68A 3RYFB 3JQ6A 1N1DA 2X5OA 3RU2A 4C0AC 1BW9A 3D8BA 3BB1A 1OJ7A 3K94A 4KX3A 5L3RA 1PQUA 2UYYA 3EZ9A 1JQEA 2FV8A 3OOWA 1CTQA 1YDFA 4PXAA 4Z49A 5JAPA 3P1JA 1QG0A 1CVIA 3PIIA 5ARBA 3MTEA 4CIVA 3QKRA 4OHOA 1MJFA 2HMYB 4E1BA 3RYHA 3BXEA 4CR7A 1UANA 2VNAA 4AZ3B 3U19A 2BDUA 2VQDA 3PTLA 4A7PA 2AMJA 3UBTA 1BEEA 2GN2A 5HZGA 4DLKA 2BFNA 3RTGA 3CZAA 4YPVA 5WRFA 5AW6A 5AW7A 5AKHA 5BPFA 2Q3BA 4MUFA 5ALQA 2CZCA 3EVBA 4WXHA 4JJ8A 1SKAA 1QGOA 2BIFA 4PXYA 1B4DA 1G5QA 2IH2A 1SM4A 3H5TA 2EERA 3EX7C 2A9FA 1EIWA 3FVRA 3KPVA 2EJUA 1PYOA 4BAGA 2ECPA 4G2NA 4S1WA 2A9KA 1HE3A 3L1UA 3LCJA 4NWIA 5FPTA 1FL9A 1LF5A 3VR6A 2Q2VA 1VL8A 2H2WA 2R8RA 1C7QA 5T5QA 3K2EA 3UHOA 3ZNPA 5BSVA 3LGSA 5DV9A 2JCYA 4YCSA 2CMKA 3UJ3X 4MWZA 4QYIB 4AJLA 4EPRA 4JI3B 3G2NA 4FGJA 4B4UA 4G3XA 2BR3A 4I08A 4XOIA 3OFND 3HCCA 3LXXA 5HIMA 4BP9A 3OTOB 4HDMB 3SYLA 4UHHA 3EQ8A 4A16A 2FWPA 4B8ZA 1A8QA 3HDQA 4UUPA 1U65A 4RK6A 1I2ZA 4AP9A 1ZVQA 1RYDA 1PQPA 2GCEA 3GT3A 3N2NA 3DHVA 3PDJA 5EHGA 1CUDA 2JBAB 3O3NB 3S2FA 1DEKA 1NN5A 2WK1A 4MQMA 2M2IA 3WGKA 4AJIA 5GZ3A 5JEEA 3HLYA 1KGDA 1G3QA 2ZYUX 3DTVB 3L46A 1F06A 2JJ2A 3DFZA 1ORTA 3QVMA 1OLSB 4TQGA 4URUR 4WX2B 5FAXA 2VRNA 3TQSA 4H35A 2OBLA 3LBIA 5JCOA 2V7TA 3UCXA 3BXFA 3IOYA 3QMPA 4K86A 2AEEA 4KWIA 4OA5A 5K2MA 3RHTA 5LL6P 3U31A 2XCIA 4GWLA 2IW3A 2OYCA 4YAIA 2VHQA 4IYJA 2OC9A 3ZHCA 5KWSA 5KDLA 1R5JA 3ZLUA 1Y3HA 5K99A 1C3EA 4A0RA 1TCUA 1VKNA 4H3VA 2E4UA 5DI3B 1G7CA 5AVVA 1YK1A 1KARA 1U6JA 4S3MA 5H4GA 5CA0F 4F4CA 2M6RA 1U7WA 4OIFA 1BXGA 2X0DA 2RGAA 3RVRA 4AWAA 2JGAA 1ZLYA 5CDFA 3MTQA 4REQA 2Q49A 3OJEA 3SJUA 2A35A 1CJSA 3PDHA 1CJBA 3NR2A 1AGXA 1TUGA 4HG2A 3A9UA 4KVZA 3SHQA 4MYUA 5J9FA 1QNLA 1A2BA