3AJRA

Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMFGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
total genus 119
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ajrA00
1ZBQA 2B4QA 2CDBA 2PR2A 4BO8A 1E3IA 2OO5A 2Y99A 3D3EA 4Y98A 3LLVA 3NYWA 4JK3A 4BNYA 3JQFC 2ILTA 1YOVB 3DBLA 3PJGA 3BAZA 3JQDA 5TJHA 3UN1A 3IMFA 1B16A 4UEKA 1B8UA 1NAHA 4ZQFA 1CERA 2PA3A 4KQWA 1UJMA 5KKAA 2DBRA 3FF4A 1NHGA 4IXTA 4KDEA 2AXQA 4RVUA 5TGDA 3LK7A 4FFRA 4DA9A 1J6UA 3ITDA 4S3MA 3MJTA 3M2PA 4C7KA 4MDHA 1VLLA 4UUNA 2WD8A 1JKIA 1I8TA 1RJWA 2C5AA 1YJQA 3PTZA 3Q3CA 1DC6A 5CG2A 3H6KA 4Q3DA 1LTHR 1H94A 4ZRNA 1EMDA 4OXKA 3HQ4O 1IL0A 2ZB7A 1T2FA 5KTKA 5DCWA 1TXGA 3IDSA 1DC5A 1GDHA 1PIWA 4IQ8A 4GSKA 2DVMA 4YBZA 5HBRA 3VVBA 1O6ZA 5A02A 1LBEA 2PZMA 4H15A 1R12A 1Y1PA 4N5LA 1NQAO 1WP4A 3AK4A 5ER9A 2GYYA 4EZBA 4HY3A 2EJVA 2ZKLA 1WDKA 1P1HA 1I3MA 4RVSA 1HETA 2AEFA 2AEMA 2CVQA 3E03A 5KJEA 2X23A 4DXHA 1HTBA 4TVBA 3OEYA 4PGFA 3AM3A 2J3KA 4FFOA 1QORA 4HV4A 2C2XA 4OH1A 5DBGA 4KUHA 3L6DA 4PG8A 4CODB 1P1JA 3ZWPA 1T2CA 1RYEA 1YDEA 2OORA 2W8ZA 5TS3A 3ITKA 4L4XA 1NVTA 1KEWA 4TROA 3HDHA 4CR7A 4R01A 3WS7A 3NTOA 4FCCA 1ENOA 1KC3A 1U3UA 2O3TA 3UCXA 1PQUA 3RUFA 2B0JA 3GT0A 4CMEC 1U4SA 1E92A 1DRVA 3QWIA 4J0EA 1PZHA 3QVWA 5EL0A 1HDCA 1BXGA 1GZ6A 1UXKA 5BT9A 4FGSA 4YACA 4QECA 3ICPA 2C82A 3INGA 4E31A 1NTOA 3FR7A 4RQTA 2HK8A 5IF3A 5TT1A 3Q11A 1S7CA 1B3RA 3ZNOA 2Q49A 1X15A 4J1QA 2X9GA 1BSVA 4J49A 4CM8B 5K0ZA 1F06A 5BSGA 1HE5A 3BA1A 4R5HA 2JCYA 3I9JA 4E32A 4HADA 2GF2A 4L73A 2X5OA 4FIZA 5CDTA 4HFMA 1X0XA 2NU8A 1JVSA 1KC1A 4D3FA 4E2XA 1EEHA 4EUEA 5HS4A 2X0NA 4MKXA 4RLSA 1IB6A 1A5ZA 2WTBA 3PWSA 1MXFA 3VTZA 2ZB3A 3K31A 3EY4A 4U6SA 1GY8A 1X7GA 2XXBA 4TKMA 1X7DA 1PZGA 2YQ4A 3GOHA 3S2FA 1Q1NA 5T67A 1XQ6A 3AY7A 4R54A 4B4OA 3WGZA 1X14A 2VCYA 2YHUA 2CMDA 1K6IA 4DBZA 2EXXA 4IMRA 1YRLA 3K2BA 2FR8A 2NADA 4IZIA 2GRAA 2NU7A 2EWMA 2BI7A 3ON5A 1BXZA 5C7IO 1OOEA 1LI4A 2D8AA 3C1OA 4CL3A 3SVTA 1A27A 2Q2VA 2GZ3A 1A72A 3HFGA 3RVDA 4CUJA 5U9CA 4JGBA 1KEUA 2B36A 3M1LA 4NG5A 1EUZA 2J3HA 3NDIA 4P4GA 3V2UA 4GAEA 1UAYA 1WZIA 4ZQHA 4CV0A 4IMPA 4X54A 1T2DA 3VDQA 3BYZA 5L4NA 4HFJA 3FWNA 1YBVA 4JXKA 2VNAA 2B5VA 5IZCA 3JD4A 3OSUA 3VZSA 4AJLA 3H2SA 4LK3A 1SNYA 3QHAA 3C7DB 4OOEA 1P74A 4PLZA 2ZQZA 3IP3A 5A03A 3ZU2A 3A9WA 1K5HA 4Q3EA 4Z6KA 1ZK3A 4XQGA 1E5LA 4D3DA 1ENYA 1XU9A 5I8ZA 4B7UA 4HNGA 4MKZA 4YJHA 1K89A 1ZJZA 3GLQA 1H5QA 4J1SA 4PZCA 1RWBA 3RAJA 3UVEA 5ILGA 4OSPA 4AG3A 1SBYA 2BRUA 2NU6A 3GHYA 3L6OO 5G0WA 1KIFA 1I0ZA 2GZ2A 3L4BA 1N1GA 3RSHA 1KBZA 2JFGA 4ITUA 1IULA 2QZZA 3VOSA 5JAIA 3K96A 4S1VA 5KCZA 2VTDA 2DQ4A 1PGOA 3DOOA 1EVYA 2WE8A 3NV9A 3OIDA 2FPPA 1HDXA 3C8MA 2ET6A 2XXJA 3BMQA 4INAA 2ZTLA 3QP9A 4FOOA 2CVOA 4E30A 2YZ7A 4FBGA 1JLLA 4Q3BA 4IQGA 2PWZA 2HK7A 3INRA 3ZDFA 1LXCA 2O3UA 4NBVA 5IZCC 3DZKA 3LC2O 1PSDA 3ORFA 4LCJA 2DTEA 3WGGA 4W7HA 4M55A 2QG4A 3QVTA 4JN6B 4EGFA 4FPXA 1B14A 1QSGA 4IIVA 2Q1UA 2ZJ0A 1I3KA 5T8KC 1U5AA 4OMUA 5JMPA 1BDMA 1RM5A 5IDWA 1DLIA 4Z0PA 3AOGA 1DPGA 5TLSA 2PH5A 4HFNA 3DBLB 1I30A 1ZK1A 4IDGA 1DIAA 4WLVA 1N2SA 3H8VA 3FPLA 3G17A 4CUZA 2PZJA 3QW2A 3AI3A 4WUVA 3JQ7A 1HKUA 3D0OA 4M1QA 4GLOA 3W4IA 3KZVA 4B4UA 2GPTA 2GASA 5I7VA 5F1KA 4B79A 4IJUA 3I6QA 4JBGA 4CMHA 3IQDB 1VL6A 5F1PA 1XGKA 1LDBA 3IC5A 4BQRA 1BVRA 2CNBA 3S2EA 5CDYA 1DIBA 5JDCA 4AJ1A 4I9HA 3RC2A 3AY6A 3K8ZA 1XDWA 4XWYA 2VHYA 2DBZA 3WR5A 1ZJYA 3NDJA 1C3VA 4YDRA 4IJKA 1PJSA 3WIEA 2IZ1A 2FPIA 2FMUA 5JPIA 2VN8A 3JTMA 3OQ1A 4ND5A 3L9WA 3GDGA 2VWQA 3DMYA 4U8GA 4BB5A 2NLOA 1IE3A 5AXBA 1E7RA 2J6IA 3OIFA 2PD4A 3CH6A 1NR7A 4LW8A 5I9MA 4M54A 2FPGA 2X5JO 3VPSA 2NM0A 4FFLA 3IUPA 3OQBA 1H9AA 2CY0A 2GLXA 2GN4A 4DRYA 3QV1A 5C7LO 1KEPA 3FNFA 1UUFA 1UP6A 3L0DA 3MJVA 3I5MA 4BNWA 3H9JA 5KJCA 3QE3A 2WYWA 5TSDA 1BXGB 3U5TA 3U9LA 5JDCC 5ITVA 1D3AA 1XQ1A 3I9OA 5JY6A 1EVIA 2VYVA 2WWRA 2HQ1A 3KM0A 4I1IA 5GZ6A 1JVBA 4CQLA 4NU6A 1MG5A 1P1FA 1NWCA 1ZMTA 4CMAA 1JKFA 2O3SA 3GY0A 5IXSA 5F1OA 4NQZA 4ALKA 3GVHA 3CTMA 4E5YA 1LSUA 1AGNA 5TF4A 1QXSA 1VL8A 4I8XA 4J90A 2BI8A 3DOJA 4LVUA 1LLCA 4J6FA 4NH4A 4PVDA 4WLNA 1E3LA 1C1DA 2X0RA 4J4TA 1A7KA 2YJZA 3I9NA 3JQ8B 2WJPA 1UAGA 2YV3A 2CFCA 3WQSB 1F8GA 4CR8A 4HWKA 3MJSA 1NPTO 1U2DA 5KIAA 3BHIA 1DXYA 5JNLA 1SB8A 4FB5A 4AICA 1LX6A 2OUIA 4O0LA 3PHLA 4WECA 4AJ2A 3CMMA 4RF2A 3BMNA 1E6WA 2V6FA 2AA3A 3AI1A 2ZTVA 1VJ1A 2AE2A 4PG6A 2OP1A 1ZEMA 1Q7BA 3P5SA 2PGLA 1UR5A 3MTJA 5IN4A 5T64A 2I65A 4E6PA 3EDMA 1U2GA 4YT5A 4J3FA 4M87A 2VRCD 5JMWA 2ZTUA 5TRTA 5A9TA 3AU8A 3WX0A 5CFZA 2HKIA 1MA0A 1LRJA 2JD1A 4DMLA 5HS6A 2VOEA 4ND4A 4O59O 3PLNA 2OZPA 3G1UA 3O38A 1XEAA 1HYEA 2GNAA 1CETA 1Q7GA 1RYDA 1UDCA 1T25A 2HRBA 1PWXA 1X1TA 4PLPA 3I83A 1PL8A 2D3TA 1PTJA 3HN2A 5CG1A 2D4AA 3B1KA 4PG4A 4ROSA 3HSKA 3OJOA 4YJHB 3WMXA 3JYLA 5LC1A 2G0TA 4UVIA 1DJNA 2V6MA 2VQ3A 4NK4A 4BV9A 5DOZA 3I6IA 2Y1DA 2O3RA 4FFMA 4H16A 4RQUA 2E4AA 5EJ2A 3PWZA 4HP8A 4BKOA 4TQGA 4KDFA 2CF5A 1CIVA 3FHLA 3LC1O 4W4TA 4DWVA 3BMQB 2Y0CA 3ST7A 4AFNA 1ORRA 3HN7A 4DPMA 2YYYA 1OC2A 1I2ZA 4IJVA 3PZRA 2EERA 1B8VA 1J0XO 1PR3A 3JYOA 3RQSA 2J5RA 5ICMA 1FDVA 3F5SA 5JDIA 1VKOA 1F0YA 3AJRA 1ML3A 4WEQA 1EK6A 4M86A 3PYMA 1ZSNA 2VUTA 3RU7A 3TZHA 1P77A 4QEDA 2RH4A 4U0JA 1MG0A 4EEXA 5A5FA 1SMKA 3WQRA 2Q45A 4O6VA 2J5KA 2Q1TA 1UXHA 4KOAA 4K6CA 1D1SA 2D59A 2P9EA 3BHMA 4FGWA 3G3EA 4YVFA 5B1YA 4YJGA 1HDGO 1KVTA 4PFJA 1UXGA 1ADGA 4IM7A 4H3VA 1U3WA 5AVOA 5KKCA 2G1UA 1B15A 1JA9A 2HCTA 2NNLD 3A4VA 3KVOA 2B4TO 1FK8A 4GMGA 4KUGA 4WASA 2QRJA 5T5QA 1ISFA 3ZCXA 2EKLA 3FNHA 1A71A 3JQGA 4BNGA 4BNHA 8ADHA 2GR9A 4Q3AA 2NTVA 2Y68A 3AFNA 1EQUA 1T4DA 1U7HA 1Z6ZA 2DFDA 1M75A 1M6HA 2DUUA 2JD0A 2Y1EA 3GF4A 4RPKA 4YRDA 4MIEA 3RUCA 4BNLA 2P9GA 2WYUA 4QFCA 1ADFA 2ZIZA 4D45A 3G0OA 2PY6A 3TFQA 2IEDA 3LLSA 4ZD6A 3PK0A 3BMOA 1L1FA 1DFHA 4XR4A 5DP2A 3DAPA 3ZZNA 5FF9A 4OO3A 4W99A 3WWZA 2Z5LA 3WNQA 1VM6A 2NU9A 3UGKA 2JFFA 4OM8A 1A4UA 1E3WA 1LSJA 2IE0A 4RF3A 4RVDA 5JO0A 5FI5A 4NI5A 1ZKMA 1HSZA 2ZYGA 5TJ9A 4CLHA 2YFHA 4DPLA 5JC1A 1LJ8A 1YBAA 5ES3A 3KETA 4FN4A 5DF1A 4XGIA 1O94A 3KYBA 1YDWA 3F9IA 4LISA 5EN4A 4AL4A 4HBGA 2ZTMA 2GGSA 3ZHYA 1HDYA 1N5DA 3F6YA 3EVTA 3RUEA 4E5MA 1GQ2A 5JO9A 1KS9A 5BSFA 1M66A 1Q7CA 1WXDA 4UVHA 3LSYA 1IUKA 3NX4A 4CQLB 4ND2A 1LLUA 1BDBA 4E5NA 1PJ4A 1NFRA 2P9CA 4D43A 3DZJA 5DCYA 1A4IA 2C7VA 1YL7A 2E6UX 1H2BA 2O23A 2DM6A 4BNIA 3GA0A 4DGSA 4CM4A 2RHRA 3NJ8A 4E2WA 1U5CA 1LSSA 2VUSA 3ZNQA 5A4DA 4DQUA 1CEQA 3RJ9A 3DTTA 5LDHA 4XA8A 1XELA 1C1DB 3KO8A 2EP5A 1Y6JA 3U0BA 2IODA 4KP7A 2Q99A 4YA6A 5U1PA 3BIOA 4U7WA 1WNTA 4LGVA 5KWEA 4YRAA 1OI7A 2UAGA 2GN9A 3UH1A 3OJ0A 3U09A 3WNVA 4QSMA 5CEFA 1UDBA 4RZHA 3KTDA 4QO7A 4FJ1A 1BW9A 3BMNB 1SZJG 4CMBA 1ZK0A 2OP0A 3H5AA 4CQMA 3L9XA 4XYBA 2DFVA 2X0JA 3LU1A 1JU9A 4XCVA 4ID9A 3U4DA 1UZNA 2IRWA 3G1TA 3WIDA 3GAFA 3PHIA 5GZ1A 1QLJA 3GMDA 5L7TA 3HB4X 3FPCA 1AUPA 2UDPA 4WKGA 4CMGA 2DPGA 2NVWA 3GVXA 3H9GA 4EEZA 5KVCA 5K6AA 4I5EA 2W2LA 2OXIA 2P5UA 3ENNA 4UREA 4EYEA 3D7LA 4BKPA 4WJZA 3TZKA 2NVUA 3VPHA 3HUDA 4ALNA 2GZ1A 4FJ0A 1QRRA 4JBIA 1OC4A 4JQCA 1FDUA 4L4RA 4P8RA 2O3JA 3MOGA 4J7CA 4AJOA 1ARZA 3CE6A 3ZWBA 1V3TA 1JW9B 4L0QA 4CM3A 3IUSA 1HF3A 4NPCA 1JAYA 4BO0A 1ZIDA 3PHHA 2P2SA 1P3DA 3GEGA 1IPEA 2JJYA 4K1LA 1R37A 4TZTA 2PLAA 4NJMA 4UULA 1PJ2A 1RM0A 2JCVA 3ASVA 1LDGA 4BO2A 1T1SA 4YR9A 1GADO 3EVNA 3LT4A 3GG9A 1KVSA 3MJEA 1K3TA 3D3WA 3O03A 4CM5A 4PLGA 1QYCA 4XJTA 3JD1A 4LSWA 2DAPA 5A04A 3P2OA 3GDOA 4BNFA 4BO5A 1X7HA 5K6AC 3Q0EA 3S2GA 1H6DA 1DAOA 3FWZA 4GWGA 4MVJH 5A3VA 3VH1A 4B7XA 5BSHA 3QA9A 1OAAA 4UVDA 5A5EA 4WEOA 3EHEA 2QQ5A 4XYMA 2DBQA 3IOYA 1ZK4A 5L9AA 4WNIA 1LNQA 3V5NA 2QW8A 3SXPA 4B7CA 2J3JA 4DC0A 1XA0A 3DFUA 2GDZA 4NBRA 4I5FA 1HDRA 1ZMOA 2WEKA 1VL0A 3VZRA 4LRTB 2X1HA 3U4HA 2BF7A 4BKQA 1KETA 1HDZA 2X5KO 4NFHA 4CL8A 2BELA 4YJGB 4NFSA 2PK3A 3JQAA 1NQTA 3GGPA 4P38A 2OBYA 1GUFA 5JLAA 2O7SA 4R1SA 3FCOA 5BNIA 3SC6A 1KVQA 3ONDA 2EKQA 4A0SA 1BHSA 2ZATA 2VZ9A 4UUOA 3DAFA 3DZHA 4OKNA 5KOIA 4NFYA 3SJUA 5DULA 1ZVMA 3PDUA 3TQHA 3PGXA 4J91A 2CF6A 3G79A 4MOWA 3WJAA 1BGVA 2RBEA 2IYOA 4Z0TA 2VHXA 2VNSA 3BTUA 3JCZA 4OAQA 5COQA 4BVAA 3BMOB 4RGBA 1EUDA 4PG5A 1YQXA 2OL4A 5A3JA 3QRWA 3PHJA 3VKVA 1B26A 4E12A 1PJ3A 4YXFA 3BMCA 5LDGA 2BFMA 3ZN2A 2GD1O 5J23A 3CXRA 5L95A 3CPSA 5L3ZA 5DDIP 1V8BA 3W8DA 5EIOA 5CDGA 2UYYA 4IDBA 3DB2A 3BTSA 2ZCVA 4YQYA 3W4KA 4B3JA 3AUTA 4RPHA 4CLRB 4E0BA 1VJ0A 2FSSA 4PN3A 3WSVA 4J4HA 3RFVA 3D5QA 5DZSA 1R66A 2ZK7A 3WWYA 4ND1A 3V2HA 3GVPA 1ONNA 1XSEA 3KB6A 3UICA 3TSCA 3WLEA 2Q1SA 3ZV5A 5JW6A 1DIGA 4PG7A 3ZNPA 1M67A 3NJ4A 4A03A 4F6LA 2A94A 2XOXA 4XRRA 3I3OA 1EDZA 2J3IA 3AM5A 4TZKA 5JAQA 3K30A 1P0FA 3RC9A 4R69A 3SLGA 2BD0A 4N5NA 5HA5A 1YL6A 3VH3A 1DLJA 5TNXA 3E9QA 2IZ0A 3JV7A 4WCFA 4DBVO 4CM4B 3CIFA 3F1KA 2O4CA 2I67A 5ENVA 4CMJA 1YVEI 5L53A 1EZ4A 3PP8A 4ZRMA 2X58A 3ZWYA 1YS4A 5JBIA 2HO5A 2VOJA 4FR5A 3WXBA 4PZDA 4AJPA 4DYVA 2OBNA 3TN7A 1GCOA 2PZKA 1Y5RA 4Y9DA 1DC4A 3DOCA 4B8ZA 3DQPA 3D4NA 1LRKA 3LF1A 5G4KB 3WGQA 4A73A 4TRNA 3DHNA 2W98A 2HLPA 2E82A 4W7IA 3A28A 4DIFA 4RPJA 2BGLA 3OJFA 1BW9B 5IXYA 4JJIA 3JYPA 4CQMB 2AQIA 4GH5A 5K9ZA 1TEHA 4XGKA 3CZMA 1HEUA 1LLDA 4L74A 4OQZA 4Y6RA 1MGOA 3ICCA 1KYQA 5G0UA 3E9MA 7MDHA 2FN7A 1QYWA 5AQ1A 1T24A 3R3SA 4JJFA 4KWIA 5B4VA 4OL9A 1FF9A 4TKLA 4WNCA 4E2ZA 4FD3A 1HDOA 4A5OA 4RJTA 4OXNA 4BMSA 1C0IA 1QV7A 1QYVA 1VKNA 1K6XA 1SOVA 3OP4A 2NVUB 2PV7A 1BRMA 2FR0A 2OHXA 4C7JA 1NWHA 4GBJA 1AXEA 5EERA 3U49A 1QYXA 4LSMA 3W1VA 3WBBA 1IOLA 2NTJA 5IDYA 4I9NA 4DTIA 3TL2A 1I10A 1W4ZA 2GUGA 3WB9A 2C0CA 4Y6PA 5I7EA 3EAGA 1MB4A 1DFIA 2CD9A 3DZFA 4WCDA 1DEHA 1PGJA 1UZMA 5A9SA 5L7WA 2D1YA 1A9YA 2PKQO 4PLYA 4JNKA 4FSHA 4BO7A 1U8FO 2GN8A 4BNNA 4ONEA 3O4RA 4WLUA 4PVCA 2P91A 4FJ2A 4L75A 5A06A 2FSVA 3JQCA 1I2CA 4IZHA 4NJMB 2EEZA 5EMHA 1HLDA 2JCXA 4RVFA 6ADHA 2Y67A 5ER6A 3L4BC 4PIVA 4N7RA 5TQVA 1I2BA 1PL7A 3D3WB 5A1TA 3PXXA 2BFOA 1ZXBA 4GSLA 3ZGYA 1ULUA 1OZAA 4PLFA 1YL5A 4BGVA 3WTBA 2C7GA 1P44A 5JFOA 2HMUA 1K2WA 9LDTA 3C7CB 4CM6A 1FXSA 2EIHA 2HU2A 3ABIA 3KHUA 2VWPA 1O9BA 4GX5A 5A9RA 4BNJA 2G17A 3M2TA 4Z9XA 4BNVA 3GNTA 1PJBA 1RM4A 2EV9A 4AVYA 1GPDG 3Q1LA 3B20A 4GVLA 5DP1A 3RC1A 3EC7A 1P33A 4A7PA 3JD2A 5THQA 2VYNA 3GC6A 4CR6A 3C3XA 3IJPA 3JQAB 1PZEA 1KERA 4L76A 3AFMA 1ZSYA 4HX5A 1ADCA 1R15A 1GV1A 3ZV3A 1TB4A 1YB1A 5AXAA 5G0TA 5IJZA 3GVIA 1TT5A 1VE9A 2JL1A 2OFPA 4JP3A 3C24A 4PRKA 5JCJA 4GKVA 5JC8A 3ZWOA 1NBOA 5TIIA 3F5QA 1I01A 1J5PA 1DFGA 2IYPA 3ZH2A 2DPHA 2YY7A 4AJNA 3DDNA 3KRTA 4D46A 1M6WA 4XGNA 3C1AA 4LVCA 4UUPA 1E1NA 3DZIA 3RD5A 1PS8A 1ZUD1 1P1RA 1SEVA 3AU9A 5DT9A 4XB2A 1C0LA 3ADPA 2GO1A 5GMOA 3WYBA 4B4VA 2O2YA 4BOYA 5G0VA 4J9VA 3STHA 1C1XA 3E82A 3MEQA 3PJFA 2BMAA 3KSZO 4D41A 5HWSA 1E1LA 3ZWXA 3BMCB 4DL9A 1EFKA 1WMAA 1PU2A 2CVZA 3B70A 3PYLA 4GVXA 4ZJUA 3SEFA 2W2KA 1SCUA 1TI7A 2YDXA 1R0KA 2G76A 2WYVA 3OBBA 5L40A 3PHGA 4FFNA 1U8XX 2CDAA 1LC0A 3ZNNA 5ITWA 4NBUA 3MWEB 1P1IA 3K9QO 2C59A 2G82A 5F5LA 3B1JA 2Y66A 2X6TA 4CMCA 4I9UA 2Q50A 2Q2QA 4XDZA 4IIUA 2DTXA 1HZJA 4OXYA 3GG2A 4JIGA 4MKRA 3QWFA 2C54A 2FOIA 3IP1A 1H2HA 3NEPX 2VHWA 3NKLA 1DIHA 1IPFA 2JHFA 3NUGA 1ISMA 3T7CA 1NFQA 5C37A 2W90A 1GU7A 1CWUA 3GGGA 4Q9NA 1PJQA 3ROPA 5DNAA 3W4JA 3FTPA 1E7MA 2Y0DA 3I9KA 2CDCA 1QV6A 3TWOA 2EHDA 4BO3A 5CAEA 3R0IA 2D0IA 4KMSA 4WCFB 3HADA 1I36A 3AWDA 2VT3A 1IZ9A 5MGBA 3QWAA 2AQKA 1SEPA 1U3VA 1NHWA 1YB4A 4YAGA 3DL2A 4YRBA 4A10A 2CSUA 3A14A 1YO6A 3EGOA 5G0SA 1JQBA 1V9LA 3TZQA 2JFHA 3LDHA 3WG9A 3BXXA 1IZ0A 1KVRA 1XYGA 3B1FA 1NPYA 4IY1A 3SC4A 4HXYA 1D1TA 1SC6A 5KVSA 5B4TA 2HMSA 2Y1FA 3WDSA 4GQAA 4ZQBA 3GK3A 3MJ4A 4Z3DA 3ZU4A 2NSDA 1K6JA 1HZZA 2IZZA 5G4LA 1O5IA 5AXCA 4BMVA 4ESOA 3U62A 1JWBB 3DAGA 4J43A 3L4SO 4CUKA 2BFPA 3KXDA 3ENKA 4CLEA 3WLFA 1NVGA 5TT0A 3RFTA 2HMWA 3NT5A 4MVJM 1CF2O 1I33A 1N8KA 5BNFA 3T4EA 2PKQP 3AOEA 1HLPA 3PVZA 1Z45A 2WD7A 3PQDA 3S1LA 4JX8A 2QRKA 4LMPA 3AM4A 2BHLA 3ONFA 1SOWA 2LDXA 2WE7A 4BUCA 2VYND 2Y93A 3WGHA 2P4HX 1LLQA 4HUJA 1XHLA 1G6KA 1DAPA 3ZU3A 1Z7EA 4R51A 1I24A 4NK5A 4KWHA 3LF2A 5THKA 4P4NA 1CQJA 3I23A 5JCJD 4K28A 4MINA 5A9SB 1GPJA 5KJ6A 2HJRA 2V65A 3DR3A 3PWKA 1YOVA 2Z1NA 3Q9NA 3DMTA 3PIDA 3RIHA 4XDYA 3FNEA 1JKJA 4NZ9A 4YEDA 3GNQA 3TJRA 2RCYA 4ALLA 2JAHA 3D4PA 4Q3NA 4R3WA 4EBFA 1U3TA 1EE9A 1MV8A 1WDMA 4RZIA 4GPD1 5AOVA 3KOUA 1MFPA 1UP4A 1Y7TA 2EG9A 3LYLA 3GEDA 1NFFA 3M6IA 3U4CA 4ALIA 3JQ7B 2WMDA 4GGPA 2VYVD 5I9NA 2V6GA 3NTQA 4II3A 3MOIA 4WE3A 2EGGA 4ZQEA 2H1SA 1I5RA 3Q9UA 3GRPA 1HE2A 4J9UE 1PJLA 5H81A 2LDBA 2EKPA 5JDIC 4I5DA 1HT0A 3V2GA 4LCEA 1HXHA 4N54A 1F12A 5JYDA 3H4VA 3WTCA 4MVJP 1U4OA 3DXFA 1Y5MA 4RF5A 4ZU3A 4E5PA 4MPDA 4II2A 1PGPA 3FN4A 4R1NA 2NQ8A 3CUKA 3H3FA 3HHPA 4OOFA 1AHIA 4K9DA 4LRSB 1PQPA 4A27A 2HSDA 3C85A 4U5QA 4WOKA 5JAZA 3ZWNA 3PQFA 4PZEA 3W8FA 5KVQA 4BNMA 3K92A 2RIRA 3ADOA 3GN1A 3HDQA 1TT5B 4BV8A 3LT0A 4RF4A 3SJ7A 3H7AA 1SO8A 3VC7A 1WVGA 3CINA 3RKUA 1WLYA 4AJ4A 4BIIA 5F3RA 4J4BA 3KYDA 2AG5A 1H93A 4IDEA 2V7PA 4WLEA 1RKXA 5LCXA 4G2NA 3TF5A 5ICSA 5IG2A 3KV3O 4CMKA 2TMDA 4IQ0A 5DN9A 3ULKA 4D3SA 3LC7O 2FRDA 5L4LA 3OQ6A 3JQ9A 4AJEA 1E7SA 1XU7A 4YJDA 1C1XB 1TT7A 3RI3A 1EQ2A 4E3ZA 3PFWO 4MIOA 4FFPA 5I7FA 1UH5A 3PGJA 1W8DA 2A35A 4O5OA 3D5TA 3MJCA 4LN1A 4GGOA 1KY5A 4RORA 1PL6A 3DBHA 3KYCA 5JE8A 2W2KB 4B4WA 1Y8RA 4BNZA 2O3QA 1ZK2A 4IXWA 1PJTA 3UW3A 3AUUA 4YT2A 1PS9A 5IZ4A 4D42A 3F4BA 3UOGA 2AHRA 4G81A 1R4NA 1H9BA 3TRIA 3WMWA 5L45A 2J8ZA 4NR0A 3P19A 1ZFNA 2I9PA 2JHGA 3KEQA 2BLLA 1GTMA 3L6EA 3NT2A 1W0CA 4XKJA 4CV3A 2EGHA 4FDAA 2E37A 3QWHA 3C1TA 1VPDA 2DTDA 1NQ5A 2GSDA 3QVSA 4GI2A 2I66A 2FWMX 1BVUA 2B83A 3H5RA 2VHZA 3OHSX 1EE2A 1XKQA 4L8VA 3ZW9A 4EI2A 2YV1A 4TMFA 1E7WA 5IN5A 4Y67A 1JAXA 2EW2A 2HMVA 1CRWG 1XG5A 3A1NA 2Q46A 3ZHZA 3VDRA 3ASUA 3K6JA 3N58A 3X2EA 4DIBA 2XPCA 3HDYA 4EW6A 4YT4A 1PQWA 3JQEA 1KVUA 1H0KA 2E49A 1EFLA 1D8AA 3BTVA 3RC7A 3PQEA 4U6QA 3VH2A 4EDFA 3TNLA 2JD2A 5F5NA 1R0LA 4CLXA 1GV0A 4R1TA 1Z73A 4IDDA 5EINA 2QX7A 4TRMA 4XIYA 3TDKA 1Y81A 4OHUA 2HUNA 2JKVA 4D0SA 5IDXA 5EQDA 5H83A 5JCXA 3VHRA 3WOHA 4BGUA 3JQFA 2VT2A 1YQGA 2YUTA 2DT5A 1C0PA 3Q2KA 1N92A 3WICA 2DKNA 1T4BA 2YV2A 5JY1A 1YONA 3O9ZA 4H7PA 3GNSA 1GAEO 2XAAA 1N9GA 2QYTA 1EVZA 2AEJA 4PLTA 1H6BA 1QKIA 3H2ZA 4BO1A 4IS2A 2C2YA 2WD7B 5CEJA 4XZ3A 5B12A 1QMGA 2RAFA 4NIMA 4BL5A 4CLOA 4YTEA 2NWQA 4DREA 3RBVA 4W82A 1MX3A 4DLBA 3CSDA 4BNTA 4J7XA 2Q3EA 1NR1A 1L7EA 3I1JA 1WW8A 4IJWA 4WLFA 4F6CA 1JN0A 4NBWA 1VI2A 2ZQYA 2Y05A 3WQQA 5CPBA 1O0SA 3QIVA 3QSGA 1BXKA 4BB6A 1IYZA 3ETEA 2V6BA 3JYNA 3O8QA 3OH8A 3PIIA 4CM1A 1K0UA 3FNGA 4UEJA 4L4SA 3DWFA 3JD3A 4A26A 4HFRA 4XX0A 5ADHA 1SPXA 1P1KA 1U1IA 4B3HA 4D0RA 1RPNA 3KSDO 4CLDA 2Y1OA 4XD2A 1GQYA 2D5CA 2I5PO 3PYXA 3IKTA 2OOSA 2ZB4A 4UEOA 4YAJA 2B35A 4MVJI 1D7OA 3FRJA 1ZW1A 4DUPA 4RV9A 4NDNE 1F14A 3LZ6A 4BHTA 4CMEA 4KZPA 5IFLA 1GZ4A 1FDTA 4EUHA 2I76A 2X9NA 4YB8A 3X2FA 3RWBA 1LEHA 3G49A 4QQRA 3JQGB 1FJHA 4MP8A 2EP7A 3WYCA 1PEDA 2IDZA 2D2IA 1NVMB 4M8SA 2B5WA 1A7AA 1M76A 3PDJA 5FEUA 1W73A 4AJIA 3TFOA 4R4JA 3E1KA 4R9RA 3WFIA 2DLDA 2RH8A 1KEVA 3N74A 4MIYA 4UUMA 4IGEA 1Z74A 1V6AA 1UP7A 1ENZA 4IPTA 1UXJA 1VJTA 2Q1WA 1ZSVA 1LDYA 3DZBA 5I7SA 4PCVA 3TOZA 2FZEA 4XYLA 1G0NA 3HNPA 4WLOA 3T7EA 3R1IA 4CMIA 1V0JA 4NNJA 5DBIA 4E13A 2PD6A 3UHAA 5C5IA 5COAA 2GCGA 1E3WB 5HTOA 5IAAA 1YWGO 3R3JA 4BMNA 2QYSA 4AJHA 1T26A 1OMOA 2F1KA 4CQMD 4IUYA 3KYDB 4IDFA 1LSOA 3E9NA 3UKOA 1E7YA 4IDAA 2B69A 2NV6A 4OSOA 2O7QA 2HMTA 2AG8A 3WGTA 2X7HA 1VRWA 1OFGA 3WJ7A 1ZEJA 5KVVA 4XRGA 4HKTA 3FI9A 1DHRA 1I32A 3INTA 4YPOA 4J16A 3UAGA 2FP4A 2H6EA 2W2LD 5BR7A 3E5MA 3F46A 1ZO8A 4URFA 1R0SA 1DC3A 1KOLA 2FZWA 2FY8A 2QRLA 3DBHB 3KYCB 3OJEA 3O26A 1MC5A 1CDOA 1VSVA 2WDZA 2BH9A 2POQX 1P31A 1Y8RB 4JCOA 4R68A 3UFXA 4RPGA 1ENPA 3K2EA 4ZA2A 3QQPA 3VPXA 1E5QA 1P45A 1DO8A 1PJCA 3DEYX 1P0CA 4IINA 1WPQA 4O1MA 3JQ8A 1GL3A 2B4RO 2PNFA 3GPDG 1R4NB 4Y8VA 1ZXLA 4DLAA 4KTTE 3HDJA 3OICA 4NMHA 1R16A 1X0VA 1B3BA 3OM9A 3VVCA 2G5CA 3ZWMA 1ISGA 3NDRA 3FTNA 4YWJA 3VTFA 4ALMA 1DRUA 1LRLA 2JAPA 3COSA 3RBXA 2X4GA 1EBFA 4XEHA 1ZH8A 1KY4A 1ISJA 3MCVA 1HYGA 1LC3A 2Y1GA 1N1EA 1LA2A 3WFJA 3KSUA 3CZRA 2O50A 4J7UA 2IXAA 4Q39A 1GEGA 1JTVA 2A4KA 2RHCA 4DIOA 4XQEA 5BNTA 4NJOA 1E0DA 1FDSA 3OJLA 3HB5X 4DQVA 2I3GA 2YFQA 5L4SA 1EVJA 5T8KA 4R41A 3FBGA 2EJWA 2TMGA 3MTGA 3HJAA 4MVJG 4WCFC 4CM9A 4YYZA 2X0IA 5JSFA 5HM8A 4LMRA 4GWKA 3ZWVA 5L51A 4FS3A 1I3LA 2Z1MA 4MVJA 2QHXA 3GZNA 3JQAD 1E3JA 1GYRA 4YAEA 4BO6A 1X13A 4K6FA 3UCFA 3SBOA 2QIOA 3PJEA 4E33A 1B2LA 3GUCA 4FW8A 4PRLA 3WGOA 2PTGA 1YBMA 3ANLA 5FI3A 1ADBA 2R2GA 5AYVA 3AY3A 1N9GB 3SLKA 5ILOA 1C0KA 4EJMA 4NBTA 2Y0EA 2X8LA 3ANNA 4P4LA 1ULSA 1LDMA 1I3NA 3RUAA 3ZU5A 4DPKA 1ZCJA 4CLOB 4EUFA 5JS6A 3F4LA 1EUCA 3Q2IA 4RDHA 4XR9A 1HRDA 3U4IA 1NYTA 1LDEA 4R9SA 4BO4A 4BNKA 4CPDA 2EW8A 2UUOA 3K73O 3AUSA 3AI2A 3ROKA 5CEEA 1O95A 4FOSA 3JYQA 4Y6SA 4XJSA 5CPFA 3DO5A 2VHVA 2Z95A 3O8QB 1B0AA 5A05A 2VRCA 4BO9A 3WGIA 5JAMA 2H63A 4W6ZA 2DBVO 3TZ6A 1R4MA 1DDOA 4J2OA 4HNHA 3QY9A 3PEFA 3IJRA 2A92A 3S55A 1HL3A 3NAQA 3JQ6A 3OECA 1E6UA 4RVHA 1QLHA 3DFZA 1CQIA 1D4FA 1E1MA 1PGNA 3RU9A 1L7DA 4GX2A 1ONOA 1Q2XA 2PGJA 4ZQGA 4TSKA 2FR1A 3QVOA 4WOJA 3RUDA 4JBHA 3DTYA 4D79A 4R5MA 1MFZA 3D64A 3CMCO 2DU8A 1FMCA 3KLMX 4QTZA 3I9MA 2AQ8A 1MLDA 2R6JA 1Q0LA 4FC7A 5COBA 1ISIA 3EMKA 1G0OA 4GL4A 5T57A 3DBVO 1Y8QA 2EF1A 3GH3A 2NUAA 1H6CA 4M49A 1UDAA 5T6BA 5C3MA 1B7GO 4XQCA 4MP3A 2C29D 2CUKA 4K26A 3GRKA 4BNUA 1QG6A 1NAIA 3ZWAA 1Q0QA 3BTOA 4ZVVA 3OIGA 2QZ9A 4RCVA 5EPOA 3RUHA 3W6ZA 1DB3A 4ZN6A 3F47A 1NM5A 1W6UA 3L07A 5JXWA 4MVJF 4Z9YA 1G1AA 3H5NA 3H65A 4ILKA 3S2IA 3NGXA 1J49A 1WDLA 3KLPX 3ZHXA 4P22A 1GR0A 1O89A 4QX6A 2YW9A 1E3EA 2DUWA 4CMIB 3EW7A 4UAGA 1UZLA 4NHEA 3B6ZA 1S6YA 3TZCA 1WAMA 4TVOA 5GZ3A 1WWKA 4MP6A 4QO8A 3DHEA 3ONEA 3H9EO 1JWAB 4ND3A 4YAKA 4C4OA 1EK5A 1V3UA 4QXMA 3DONA 3WYEA 5TX7A 2X86A 1ONPA 3E5RA 5TC4A 1LDNA 2VZ0A 2YDYA 2Q2WA 2F00A 1GQQA 4RPLA 1GYQA 4YJFA 3E18A 1Y9EA 3NGLA 1HE4A 3U3XA 4OGWA 1F8FA 1V3VA 2SCUA 1QR6A 3ZW8A 4CM9D 2GN6A 5B4UA 1MUUA 1AXGA 4EITA 2I99A 3GUYA 3GEMA 3LVFO 1P9LA 3QJ5A 4OJNA 3RASA 4R3NA 4IGFA 3DHYA 4MVJD 2O4UX 2O2SA 2I3AA 3EK2A 3PRJA 2R00A 4BGIA 2AW5A 5L7YA 4PLHA 4BS9A 3EYWA 3I9LA 3VZQA 4IBOA 5G2OA 4A2CA 3GQVA 1UXIA 3HZZA 4JP2A 4DLLA 3QWBA 4N5MA 4XIJA 2DC1A 1J4AA 4OKIA 3JSAA 3H9UA 2E48A 3GFBA 3GN2A 4YT8A 2VTEA 3DBRA 2WM3A 4J1TA 1RM3A 3OMLA 3ANMA 3GMSA 4DC1A 4JROA 1IHYA 4WGGA 1TLTA 2NTNA 1HSOA 2VRBA 4I5GA 1T2EA 1AE1A 3GZ4A 5MDHA 4PLVA 3VH4A 4N18A 4B8WA 1U7TA 4GKBA 3UUWA 4TRRA 3CKYA 2AMFA 3F1LA 3PFFA 4JJGA 2WSBA 4ZICA 2UUPA 3IKVA 4E21A 4G5HA 2XF8A 2HJSA 3F3SA 5U4QA 3V8BA 2R00C 3WBFA 1U28A 2D5AA 3BHJA 5H82A 5FYDA 3GR6A 3VPGA 4QUKA 2ZYDA 1EDOA 1WMBA 3FR8A 4RL6A 4PLCA 2PKRA 2YHIA 3I4FA 3KUXA 3ZHBA 3PPIA 1PGQA 4BNXA 4R1UA 1DHTA 1NPDA 5F21A 2PZLA 5BQFA 4GX0A 5FFFA 3GZNB 3HFSA 3CEAA 3RJ5A 1IHXA 3PJDA 4YQZA 1YKFA 1T1RA 3QLJA 4AJKA 4E2YA 4XYGA 4GX1A 8LDHA 3RBZA 3ZWWA 2Q4BA 4QT0A 3A06A 1GCUA 2OMEA 1PS0A 2PD3A 3UF0A 1OBFO 1HWYA 4YAIA 1C14A 3PZBA 4FQ8A 3GVCA 5AXDA 4CV1A 5BSEA 1LQTA 4KTVE 1DRWA 4M89A 4OIMA 4F45A 3LT2A 3P7MA 3IL2A 3GGOA 3UCEA 3AOEC 1XCBA 1O8CA 2A9FA 4BKRA 1JDJA 3ZI0A 2P68A 4W9NA 5DBFA 3W8EA 3I52A 4DQXA 1NQOA 1MC4A 2HAEA 3LQFA 5KJFA 1Y9AA 1Z7BA 3RROA 2AE1A 3E6AA 4DYDA 1HYHA 1XIVA 5I8WA 1GUYA 3HG7A 3PLRA 4J2HA 1R4MB 3FD8A 3OEWA 4OYRA 2HRZA 3LT1A 4WPGA 3T4XA 2BKAA 1PWZA 1YQDA 3I4CA 1N7GA 3JD0A 7ADHA 4GMFA 2OGUA 3PI7A 1XWFA 2BGKA 2C07A 3OETA 3GAZA 1BWSA 4YCAA 1TA4A 1MXHA 4RO0A 3E8XA 2IXBA 1AHHA 1Q0HA 3DMTC 3M1AA 4EJ6A 3HE3A 3D4OA 2NVBA 2ZCUA 4ALJA 2PH3A 1FDWA 1R6DA 3IAHA 1GZ3A 2ZB8A 3NT4A 3TL3A 3IIEA 1VC2A 3N7UA 4CJXA 4XYEA 1NASA 3QVXA 4U0KA 3TOXA 3D1LA 4WK6A 4TWRA 4NU5A 3V1YA 3VPFA 4F3YA 5KNLA 1Y8QB 4L9RA 4JLWA 3ETDA 4RVGA 2C5EA 2IEBA 4W9NC 1YB5A 4B3IA 4DVJA 2BGMA 3V1UA 1X1EA 3EZLA 4UVGA 4F46A 1IY8A 3RKRA 3ETGA 3V1TC 5C7OO 1PR9A 3H3JA 4Z3KA 4J1NA 4CM8A 1YJ8A 1WZEA 1ID1A 1HE3A 3DZGA 5CHEA 4Z9FA 5IDQA 5EESA 2CZCA 1ZNQO 1GYPA 5GY7A 3OA0A 1E3SA 3MZ0A 3H9QA 3JQBA 2NQTA 1Z75A 1GUZA 3K5PA 1QP8A 2H5LA 2P4QA 4MO2A 4RLHA 4Z0HO 4CLRA 1GD1O 5B37A 1BMDA 1F17A 4ZGWA 5CP8A 1PX0A 4XQ9A 6LDHA 3WSWA 1LQUA 3KEOA 1LUAA 1Z82A 5DCUA 3RFXA 3FBTA 2W4QA 2VWGA 3WGYA 4FC6A 4GLLA 4YJFB 3GPIA 4PLWA 4BQPA 3AW9A 4I08A 1YE3A 3MWDB 1SAYA 1T2AA 1XLTA 4KQXA 4G65A 1TVEA 1A9ZA 3GDFA 5JYEA 2PGDA 3JQ9C 4CV2A 3OFSA 4OQYA 1NP3A 2P5YA 2ZJ1A 4O63O 4TRJA 4Q3CA 3VAZA 4R16A 3GHHA 3UXYA 1E77A 3ZV4A 2PFGA 4D7AA 1CYDA 4QFDA 1E6EA 3P2YA 4ZHSA 9LDBA 4E5KA 3S8MA 3JQBC 1N7HA 4IDCA 1GEEA 3RUIA 5I9LA 1MP0A 4CM7A 1BTOA 4KUEA 3FSRA 3SX2A 2HK9A 4XB1A 1ZZEA 1E7QA 5CDSA 2C20A 3AUAA 4MVJE 2O48X 5EQFA 1DSSG 4UVEA 2I6TA 1V35A 2VUUA 3DBRB 2J5QA 5G4KA 1EBUA 2HDHA 2NACA 2ZYAA 5HRUA 1M2WA 3C7AA 3NTRA 2B37A 1NXQA 3ROQA 3VKUA 3BZUA 5CDUA 3ROMA 1GFSA 4E4YA 2UVDA 2BFAA 4AJJA 2UV8A 4DMMA 3OF2A 3W6UA 4EJ0A 5ENDA 1B8PA 3RCBA 3TPCA 1DOHA 3VZPA 1YGYA 1DIRA 1SB9A 3Q6IA 1AN9A 1H6AA 3NRCA 1NX6A 3ZV6A 1XR3A 4J0FA 1E1KA 1VSUA 1NNUA 3KBOA 3ZWCA 3HWRA 3E48A 1LU9A 3GFGA 3IS3A 1PZFA 2GERA 4BGEA 3L77A 1DJQA 4IS3A 3DC2A 3OA2A 4D44A 2AQHA 2VWHA 1YXMA 1CJCA 2FHSA 2YQ5A 1DBVO 3R6DA 5FWNA 1U9JA 2YHIB 1QYDA 4BKUA 1YH3A 5DOVA 2X9VA 2Y1CA 2X22A 1BG6A 2Q4EA 4MJLA 3EZYA 2H9IA 4RDIA 3EUWA 5KJ1A 2VZ8A 1ISHA
chains in the Genus database with same CATH superfamily
2B4QA 1YKGA 5LYJB 1SRRA 1YI0A 3A04A 3SPXA 3FB1A 4NQRA 4FR0A 4ZT2A 4Y98A 3ROXA 1M83A 4BNYA 1GT6A 1FTWA 4I1RA 4CQNA 3CONA 4AZ0B 1ZI9A 4ZT4A 1F1BA 3QMPA 4LDRA 2C0PA 5EWJA 2I55A 4HH0A 5TJHA 3UN1A 3LY9A 4UEKA 4ZQFA 2A9PA 1B8UA 1E2IA 1F38A 1XNHA 2PZEA 2PA3A 2C00A 4HMOA 2H48A 5LA6B 4KQWA 2ZI4A 2H2AA 4C3ZA 1UJMA 3OQIB 2DBRA 2C8KA 4NJEB 3TX6A 4RE6A 1V7PC 3KJIA 4Y7DA 1YVRA 1W94A 1G17A 2ZU6A 3QXGA 4IXTA 2NW6A 4IIYA 2OUKA 1GRQA 2E55A 4FFRA 3L0ZA 3HCPA 1K7XB 4DSNA 2B2CA 2YOHA 4YNBA 3R5KA 3MNFA 4PQFA 4DCUA 1ZI6A 2HU7A 4MDHA 5JNTA 2Q5FA 1EFVA 1I8TA 1RJWA 1R0BA 3K72B 2V5AA 2GK6A 4OKSA 3LUDA 1FNCA 1QWOA 3CPEA 1GA4A 1H94A 1PI3A 4LYFA 4OAPA 4OXKA 1KY3A 2H2GA 3D2AA 1MOZA 1IL0A 4OLBA 3CZQA 1JR3D 2O0LA 4L15A 3A1WA 4BQEA 3BWVA 1L5FA 2IC5A 4H1VA 2WWTA 1L5WA 3FSGD 3GJXC 3IDSA 4UUAA 4YBZA 4EG5A 3WC4A 3SSMA 1VB5A 2AJDA 2JI4A 2XRMA 3IBYA 5FA8A 5JECA 4CEHA 3STWA 2QLMA 4NCAA 3DTNA 3DB1A 3HVUA 4TV8A 5IBPA 4EZBA 1TYEB 2EJVA 2GTIA 1N6KA 4HY3A 2OFXA 3PNQA 4QNMA 2FF5A 3E03A 5AP9A 3C3DA 4YR9A 1HTBA 1WMSA 3N1UA 5CT6A 3S1SA 3AM3A 1QORA 2REQB 2R6AA 4R2XA 2CC2A 1ZU5A 2VDVE 2W43A 1AF4A 1G59A 1TFRA 1YZLA 4PG8A 3NWPA 3RKSA 4D0LB 1P1JA 1JHOA 2GEFA 3BGOS 5AD1A 1EWYA 1NKTA 3T3EA 2VDMB 3VAYA 3WL6A 3N6VA 1RKBA 1JIUA 1T2CA 4JP5A 3ZWPA 4FR2A 4YX9A 2PRJA 5C18A 2XW6A 4JOSA 3C70A 1RI5A 1H22A 3BILA 4CR7A 3PEWA 3NHZA 2ACVA 3GCXA 5ALRA 3SDZA 2FG6C 3WS7A 3O4HA 4DDTA 2XVMA 3HZOA 4JJ8A 4QDJA 3UCXA 3RTAA 3RG2A 4QXAA 1U4SA 2R5FA 3I01M 2C9BA 3QWIA 5E3IA 4C43A 1N57A 4PFKA 3K70D 1UXKA 1II9A 3S2SA 4QBHA 3Q9SA 1D0IA 2OHHA 4ZP1A 2HXSA 4Q1BA 3AYZB 5EP4A 3PSHA 5AVJA 4AX4A 1Z4OA 1GZVA 1P39A 1G8YA 2IYEA 3AZOA 1K75A 1WX1A 4B9AA 2C8LA 4DJDC 1JFSA 4H4EA 2M32A 2VDJA 3DDOA 5BSGA 3ZLVA 2J0SA 3IIJA 3ZDAA 2HH9A 3IODA 1KP2A 1E4VA 1TZMA 4AG5A 1TCAA 4A6DA 2GF2A 3ESBA 3M4ZA 1JVSA 5HS4A 1EEHA 2BGJA 1KP9A 1UWCA 1EG7A 2HBRA 3HVIA 4JT8A 2X2OA 2XUFA 4RLSA 4TXMA 2OGWA 4NU0A 3ZEAA 4B6QA 5KQGA 1A5BB 4FKBA 4Y18A 1NXVA 3HN6A 5MHTA 1HOXA 4DLNA 3TUJC 4U6SA 3LHIA 4U3JA 5EIBD 3OZUA 3AZPA 2FA9A 4B4OA 1SXQA 3F5MA 4Q48A 2Y76A 2YHUA 2M6KA 5BW5A 2CMDA 4ZHQA 3ZVMA 4RS3A 4NZNA 4ENRA 1V71A 2QL9A 3M0EA 4KH0A 4OF4A 4YMLA 1V8ZA 1W93A 1H1LB 1QH8B 3K2BA 1Z8HA 2WUVA 3OM1A 2NADA 3DEZA 1N0VC 3LQQA 5EUQB 1C9JA 4CKCA 4F1WA 3GGCA 4YV7A 2J4FA 1R50A 4MR8B 1E3MA 2GPWA 1WPRA 1BXZA 1Z6GA 4J75A 4QBKA 5C7IO 1OOEA 4ZVNA 1G8KA 3W1EA 1LI4A 1SC1A 1WG8A 5HFAA 4UHBA 3AL2A 3P0JA 3TKYA 2GZ3A 4I6EA 2V8BA 4QQFA 1UCFA 5U9CA 2CLKB 1RQRA 3MTQA 4JGBA 4LDJA 4LNHA 1DG1G 3G2IA 2FKAA 3M9WA 4M88A 3M1LA 1AHPA 1EUZA 2L82A 3AH8A 5C1PA 2AUNA 5B5SA 2QGFA 4BUZA 4QNRA 2W48A 4GM1A 1WZIA 1XZCA 4CV0A 3K70B 4IMPA 2F90A 2Y6VA 2F43A 5L4NA 4JXKA 1SUSA 3FCXA 2VNAA 3BCUA 3OSUA 1Q91A 4X97A 1Y8ZA 4AJLA 4NE2A 3W2TA 4WERA 5I47A 1VIVA 4OOEA 1SKUA 2HWUA 3ABRB 5FOQA 2A1UA 3I04M 3QJGA 3X43A 2ZQZA 2QR5A 2G1AA 4FXPA 1UT8A 4JB3A 1ONSA 3L84A 4RACA 1EB9A 2BGTA 1RWPA 1K5HA 1MX9A 8OHMA 3GA5A 3NHPA 4RMGA 1ZK3A 3ZK7A 4BQNA 5I8ZA 1TLFA 2ANBA 2BSAA 3OZIA 4QUJA 1RLIA 4YJHA 4R8VA 3GLQA 1KDOA 3UVEA 2WYOA 2FEAA 1SBYA 1WUKS 2BRUA 3L6OO 4M9RA 1F9AA 1DUVG 1NBAA 3L4BA 3NTUA 3QKSB 4P31A 4XGRA 1KBZA 1JIIA 5KYVA 4LOLA 1NGSA 1NF2A 3TJZA 4OTZA 4OYLA 2HHJA 5DH9A 2PZFA 5E1MA 4DW8A 3DOOA 3GRYA 3D6TB 3DLPX 1IY2A 1T2VA 4N5IX 2XXJA 3D6FA 2ZTLA 2IYWA 1FTGA 3QP9A 1X1CA 4FOOA 4XW2A 2CVOA 1D5CA 4N8SA 3RIGA 2YZ7A 3CRQA 4FBGA 1QC5A 3WHLA 1G21A 4PX3A 1TMKA 4XSGA 2HK7A 5FULA 1LXCA 2O3UA 1H4SA 4B74A 4DR4B 1PSDA 3E35A 3B5EA 4LCJA 3MXOA 4FNAA 2YMLA 1M1NA 4W7HA 2QG4A 2IU0A 1M1YB 2OXTA 2HQBA 2WFZA 2XE6A 5KTPA 3LQ1A 5C8DA 1L2TA 2GZMA 5T8KC 1U5AA 3QX3A 1W8IA 3F6EX 3TCXB 4UARA 3OX1A 3IB3A 4UXHA 3MK31 3A1DA 5EVJA 1UBKS 1LF5A 4Z0PA 3NIGB 5AW5A 2XNJA 4D4JA 5EZYA 2OSBA 3ABOB 5DK4A 1L7AA 2V3WA 4Q7KA 1F2UA 3QLEA 5AM1A 1GQFA 1LPAB 1DIAA 1HMPA 2EJCA 4TUYF 1KJ9A 4PQYA 3OOYA 4M6WA 1RPJA 1XLWA 4JI2B 1Z18A 4Q4JB 2DCMA 5C34B 2PZJA 3BCRA 1Y3AA 3QW2A 1YC2A 1YHZA 3CEJA 4NL4H 1TZCA 5AVYA 1DQZA 5BURA 2Q4OA 3W4IA 3KZVA 2QBYA 4B4UA 1XD2B 2SKEA 4NY1A 3K0BA 2QG6A 4M53A 5H3CA 4B79A 1K8RA 4JBGA 1CUYA 4MUNA 1F48A 5EWMA 3IQDB 4M36A 2Q9CA 5K99A 2HSJA 4TMWA 1N9KA 3U3KA 1CNFA 1I1OA 2K2QB 1Z0AA 1CTQA 1QRTA 1E0KA 2Y9MB 3M4YA 1BVRA 4IFTA 3S2EA 4K0KB 1P91A 3GIDA 1ZHFA 3K8QA 1TU0A 4BCCA 4DYHA 1GGHA 5CDYA 3WBKA 5JDCA 1EZ1A 3DLTA 5HP4A 1JSLA 2RJNA 2REBA 4ESHA 3FZNA 4M8IA 1PFWA 4XWYA 3WK6A 1ILEA 3OE1A 4K6OA 1ZJYA 3WR5A 1C3VA 1C4OA 4QWMA 4YDRA 5T4EA 1E2KA 1PNVA 1F8XA 3E22B 4JOQA 4RLQA 4LE0A 5K0NA 1DCFA 3RRJA 3FB4A 1X2BA 4I9FA 4ND5A 1XZJA 1ZISA 3IAM1 3WK4A 1F4PA 3GDGA 3K94A 4JB8A 1IE3A 3OESA 1E7RA 4ZDIA 1ESMA 2XQIA 2LBPA 3OX2A 4QDXA 2RGGA 3UHFA 1OB5A 3HGQA 4HEJA 3GFSA 3FPEA 3H1GA 3M6UA 1O6BA 4DA0A 3A3YA 3T5PA 2FPGA 3P9RA 3VPSA 2NM0A 3CEPB 5FWYA 1USUA 3N3BC 1OAOC 2GLXA 1N0WA 1PAUA 2GN4A 5DLQC 3IPLA 3G8YA 3EMVA 4RZSA 3O7WA 4CTJA 2ZT7A 3O73A 1XAIA 2Q07A 2ZUEA 1JNYA 5CDHA 4HMQA 2GB4A 3AJAA 5IM5A 1PYDA 3EXHB 3ZQKA 2PH7A 3WYGA 4X8OA 3KKPA 1EFPB 3U5TA 1DIOB 1P5FA 3K4QA 4F7WA 2RJ3A 2VDRB 1L5MA 4CQJA 4YUAA 4NG4A 4BVJA 1Z83A 2QLBA 1IB0A 1TNDA 2H1VA 2WU0A 3CH7A 1K86A 3PFCA 4I1IA 4P0TA 2HF8A 3ZIAD 2ILVA 2CBGA 2H57A 3BQ9A 3FPAA 3HV2A 2XQJA 2DKFA 4ZVOA 5HVNA 1DUIA 1FDOA 3CUUA 2B9VA 4HI0E 1PEKE 5LD2B 2XLCA 4UTOA 3LAWA 3RV3A 4BKMA 4Q3OA 5EPUA 5F1OA 5H8WA 1WABA 3ZY5A 2YXNA 3JR3A 1E1RA 1LSUA 1GPMA 3F67A 3FFTA 1KEZA 1Q1ZA 1XLUA 2HJGA 5TF4A 3FIJA 4WHMA 4L6CA 4W9RA 3TR5A 4L78A 1LLCA 1NUSA 2I3DA 4MQLA 5FQOA 1DCMA 3RRNA 3LGAA 2EEPA 2X0RA 2ZJYA 3DPIA 1UOQA 3G0DA 3L7BA 1BRTA 1KRHA 4HB0A 4RSMA 4EUKA 3UG6A 2YJZA 4S05A 3IE0A 4IJ6A 4QDZA 2IU3A 3JQ8B 1W1WA 1P0QA 2YIDA 3CLSC 3FJOA 3NW9A 1U3GA 2YV3A 2CFCA 3CX6A 2QROA 5JG7A 2A5LA 4M0LA 2LW7A 4TUYB 5BMVA 4HWKA 3EIQA 4LHWA 1P7CA 3MJSA 1PBNA 4PYNA 2VLBA 3BHIA 4ND8A 1SB8A 4FB5A 4RK0A 1LX6A 1RE0A 2VJMA 2NXEA 3WLRA 2YXBA 2JLCA 4HH3C 3QPDA 1E6WA 1WXQA 2DWQA 4KLNA 3W8RA 2ZTVA 2XYRA 1KQFA 2AE2A 2O5EA 1T10A 4IUCS 2QUJA 1E3TA 5IN4A 5CCDA 2I65A 5T64A 4DMUB 3QSYA 5TR9A 2II6A 3EDMA 3GJ7A 2R85A 3GZTB 4YT5A 4DQDA 3EA5A 5JMWA 2ZTUA 3A4MA 5TRTA 1MOQA 3AU8A 3ROGA 5CFZA 3U4AA 1E9EA 3OY2A 3AB3A 3ZX5A 1I7LA 2Q29A 3H1BA 3QK7A 3G1UA 4UBMA 3O38A 1UJ4A 2XCUA 4RTQA 2Z4SA 1Q7GA 1UDCA 3JQRA 3CF6R 4FHZA 4PQEA 4D80A 1PWXA 4IEFB 3H99A 4KMRA 2OKGA 4DT1A 4CNBA 2D3TA 2PL5A 1WCWA 4NONA 4UNNA 3VSAA 1B8NA 4R0MA 1N75A 5IDVA 1N4DA 4KPEC 5HKKD 4ROSA 1I4DD 1PZNA 2CB0A 2QLNA 3WMXA 1XMIA 1Y3HA 1Y42X 3ZBQA 4A2WA 3FHTA 1SZDA 2OHOA 3S6JA 5EXPA 1L6RA 3HP1A 2V6MA 3M5WA 4BV9A 3C4JA 4DJAA 1UOPA 5F5XA 1IOZA 1SK8A 4XWGA 5D6OA 4A82A 3BXGA 1UPAA 4EFLA 1S9DA 1I94B 4RQUA 4DB2A 5GVSA 1Q83A 5EJ2A 2ZUUA 1L4HA 2BSXA 4RHYA 3PWZA 1JL3A 2RCNA 1T8PA 1OI4A 4BKOA 4TQGA 2GLTA 2GBPA 3FPGA 1CIVA 3FHLA 3KL2A 2FPPB 2I71A 1V48A 1CQZA 2PRYA 1U8AA 2YJ3A 1UK7A 2B1IA 1SBNE 5D85A 1JLLB 1OIXA 5KTRA 3RU2A 2YY5A 3IMEA 4Q9DA 3G9ZA 3C74A 1K1EA 4KPUB 5KC9A 3PZRA 5HE9A 2EL7A 3JYOA 2GYUA 2XMRA 3RQSA 1AIPA 1T9GR 3ELYA 3LT5A 3QYPA 1VKOA 4S35A 5ICMA 4QICA 1C7QA 4M86A 3B1YA 2VP2A 4TYWA 1T0JB 2JFOA 3U39A 2Z8YM 1SU8A 4PHGA 4BRZA 3TZHA 1CLEA 5JH7A 4MYDA 5ELLA 3KQVA 1MVNA 1TD1A 4IV5A 3WQRA 3CG0A 3NWOA 3N9IA 1DC7A 3NHJA 1Y5LA 4N3NA 3CLSD 1VKRA 1UXHA 4P1ZA 2V7GA 5HJ7A 1VLVA 4AO7A 1BU8A 1R64A 4LHZA 3VU0A 3G2LA 2D62A 2W6OA 2CWDA 5BSTA 4QREA 5B1YA 3KR9A 1FFEA 2D1TA 2CE2X 4N47A 4D4MA 2IK8A 4A16A 4ZV4A 1IXZA 5TPWA 4PPGA 4FYWA 1U3WA 4MUKA 3GFFA 2FEMA 1B15A 1M2OB 3A4VA 3QHQA 1MJNA 1XTBA 3IUJA 3AI7A 3N2NA 4KUGA 2QRJA 5T5QA 1C9EA 5HG0A 5CD1A 1I1NA 2F3PA 5P8WA 1A71A 4RK1A 5AHXA 3PVCA 1NLMA 1VECA 4BNGA 4CN9A 4DJTA 2GR9A 3BEOA 4FHCA 2G8NA 1XPOA 3ADKA 5EJAA 5DTQA 2NTVA 1BQ3A 3BPSA 1BMFA 2C1EA 2ZRBA 3SQOA 4ZZ0A 1EQUA 1U7HA 4FX2A 1H9CA 1Z6ZA 2I22A 3GF4A 3OCXA 4YRDA 1A9SA 2WHPA 4MIEA 4G56A 4RZ2A 5ITVA 1NG9A 1R4AA 2PQ2A 2CNKA 1VFNA 3VGJA 4V0OA 5J40A 3BBLA 1KQPA 3LLSA 3FVQA 1APBA 1R6UA 2P9ZA 1XFAA 1B23P 1CUAA 4OHPA 4HUTA 4MDEA 3IHKA 2J0UA 5CT4A 3BMOA 1SOMA 5IHXA 1CEYA 4WVLA 3TLKA 4MR9B 3KLBA 3D4IA 4GMDA 3FZYA 4Q6BA 3WL8A 1BH6A 4QPZA 1CZRA 3LUGA 3UGKA 3LRPA 3HUUA 2JFFA 2JDID 2W58A 4KR0A 2PKCA 1O57A 1NURA 2QX8A 5DLDA 3TR6A 3ZE2B 4PWZA 1A4UA 3MMXA 5AI9A 2O8EB 5FI5A 2ZI7A 4Y9TA 5CB4B 1T5BA 1GRCA 1T6XA 1HSZA 3A1VA 4XH9B 3KP1A 4CLHA 2YFHA 2ZS7A 3KJFA 5CFNA 5HF6A 5EHXA 1LJ8A 4WN9A 2JH8A 5ES3A 5JC1A 3KETA 3DAHA 2K7ZA 4FN4A 4ZI5A 2XIJA 1PBTA 3CRW1 3S68A 4U63A 3F9IA 4CWAA 2E4WA 3K16A 1XQ9A 2WHRA 4HBGA 3QTBA 2XZTA 1ZVVA 4L6IA 2G7MC 3VSEA 4KL8S 2GGSA 3FYDA 1ZGHA 3HMQA 1FPQA 3ZHYA 2O6HA 5D51S 3F6YA 3IIMA 5CITA 5KHLB 3U0VA 1QHSA 2Z3ZA 2ZP1A 3I9FA 4JEHA 4UM9D 3OLWA 2HTEA 4QTTB 4E5MA 5JO9A 3T3DA 1ZHOA 2EGUA 4GMKA 1TM4E 1UJNA 1J5EB 2Q3LA 1JSCA 1LLFA 1IUKA 3LSYA 2VSFA 3NX4A 1WULS 1ZW6A 5CW1A 4YP9A 4CQLB 4KRFA 3IEXA 1LLUA 3ZTWA 3RJZA 2BGUA 3FAZA 4NCXA 2EFEB 1G66A 1DOZA 2QN1A 4PYLA 3ZIUA 4CXMA 3ZWQA 2PVPA 3RJTA 1DXOA 4D43A 2HREA 4KO4S 3F6RA 4FIDA 1A4IA 4J0DA 3T4PA 4YCMA 2HGZA 3VHXB 2O23A 5IMBA 3VR6H 3CRZA 5E2IA 2IXEA 3Q5DA 5DWQA 1RZUA 1XEXA 3BFKA 1E5DA 1RFLA 4EFKA 2H2FA 1L7PA 2RHRA 4KQMA 4MV3A 1U5CA 1W1IA 3E5NA 4PZUA 3ZNQA 4E2WA 1VBFA 4RZ3A 1HC7A 1CEQA 2A57A 5LDHA 4ARCA 3HU2A 4XD7D 4EKIA 1KZ7B 1C1DB 2YN4A 4W1PA 2QN6A 1P5JA 4M1SA 4UBOA 2EP5A 5HZGA 2C2ZA 1SVMA 1D09A 1D2EA 4FOPA 3U0BA 3MVEA 2V4UA 2QYOA 2P35A 2C04A 3LA6A 4M9UA 1L5NA 2BLNA 4FM9A 3U81A 5KC8A 3MWJA 2OTCA 3LOUA 4M3NA 4YRAA 1OI7A 5FPPA 3SR3A 4K40A 2PUAA 2UAGA 1ZD8A 2V59A 3OJ0A 3U09A 3WNVA 3EVDA 2YZGA 1HURA 2PEYA 2XMBA 1H3FA 2RI0A 4QO7A 2C3UA 3BMNB 3CNLA 4JLJA 4BMZA 4B83A 4LJLA 5JRZA 4RY0A 2EBWA 4GYYA 4QODA 4R3UC 2QBYB 2R5WA 4OUDB 2BKLA 1D2RA 5EKDA 5LL6P 3GEHA 4N0EA 4YMSA 4JI1B 1YMUA 4ID9A 3U4DA 3A7DA 3GAFA 4UBIA 2FSIA 4Y2SA 3ESAA 4ZAZA 5EJ6A 5GZ1A 1FDRA 3GMDA 2G9NA 3BC1A 4GPTA 3FJYA 2NVWA 3GVXA 2AOUB 2ISCA 4MW6A 4UM9B 4U9HS 4EYGA 3VU9A 5K6AA 4I5EA 2W2LA 2ZRPA 3LTEA 5JALA 4WX2B 4C7JA 3D3NA 5BUZA 2HWXA 2X76A 4BKPA 3VPHA 5HPYB 5G41A 4HL6A 1BEZA 4L57A 3QF7A 4JBIA 4FJ0A 4A0FA 1OC4A 5KSPA 1XP8A 4P8RA 4HQKA 2IUSA 3MOGA 2FZGA 2IOQA 4GUAA 4K9NA 4S1TA 1H8EA 4AJOA 1Y6QA 2IYAA 5FRDA 1ARZA 2LTAA 3K0FB 3ZGVA 5B6IA 5JROA 3S8EA 4MPJA 3S1AA 4EQ6A 4RADA 3R44A 2JLZA 1JW9B 4BY9E 3W5HA 1E79D 4HYQA 1RZRA 1JAYA 4JBLA 4BO0A 4PCAA 1B1AA 3JTEA 2QR2A 4Q5IA 2WM9B 1YR1A 4PZZA 3A25A 3BGWA 1UQUA 1IPEA 3IEIA 1QF7A 3PR2B 5GJBA 3LX4A 3LUJA 2JGKA 2VC2B 1O6FA 1BQ4A 2JCVA 4Q9LA 1BWPA 1GNSA 1X3LA 2IZ6A 5CCEA 3RSLA 1DGQA 3DE7X 1U0RA 2GX6A 1XN4A 1P4AA 1SXIA 3LCCA 4BZZA 2D0OB 4CM5A 1XT6A 4JJ7A 1KDZA 2P7IA 1N32B 3LFHA 1T8RA 2BJWA 3YASA 3K9HA 5A04A 1SHLA 4F3NA 3IHLA 3GDOA 1MT3A 3IDQA 4M7PA 4P3XA 5KINB 1RCFA 4XX1A 5LWQA 1H6DA 3VPCA 3FKSD 3VH1A 2H2HA 5IC6A 5ALGA 1FVFA 5A5EA 1HLGA 3H9BA 2QQ5A 1QJ4A 4KYTA 1E2DA 1BOFA 1T1JA 1SHTX 2R1ZA 3DEKA 4UTXA 1T8WA 3SQLA 4V0LA 4O4IF 4GNKA 4W5OA 2PUBA 1TYAE 4WNIA 3DHVA 3GPLA 1YTUA 1XTRA 1Q1BA 1CXZA 3CS3A 2GDZA 3DFUA 4I1UA 4I5FA 1HDRA 3B8EA 1MVOA 4H2DA 5HILA 4LRTB 3ZJTA 2BF7A 5DGDA 3OZCA 4KGXA 5EIAA 4EHDA 4G1CA 4Y1FA 2FMIA 1XEFA 3OKCA 4V0RA 4I19A 1OYYA 4YJGB 4UTVA 4NFSA 3JQAA 4OI1A 4JEIA 5BRJA 3GGPA 4P38A 5FWXB 5KQPA 3OPYI 3FUVA 3VNQA 1GUFA 1N5KA 4A8JB 4KDCA 2HIAA 3LCRA 4R1SA 3UYLA 3WADA 3I9V1 5BN1A 4Q1CA 5BNIA 3HXTA 3SQMA 2JBAA 2FSGA 3TNYA 1TJNA 2MR6A 5CIYA 2RE8A 5AKGA 5K0CA 1FSFA 5LQJA 4HYTA 3WK7A 2PZGA 4OFBA 4CKWB 1ECCA 2AW3A 4EYOA 4TQ9A 5EJEA 4OKNA 1RACA 5DULA 3PGXA 2XA1A 3AO0B 2DULA 3H0EA 3GAMA 4X1YA 1R8SA 4K1XA 4NWIA 4RM2A 1G16A 1BGVA 2RBEA 2IYOA 2YWEA 4Z0TA 3T5MA 5IABA 2W2QA 1XRSB 4OAQA 4BVAA 3F78A 2RHWA 1DX4A 3VQTA 2HA0A 4GLJA 3AY0A 1EUDA 4JP1A 4DCOA 2Q4TA 1Z6AA 4W8HA 2OL4A 3NM5A 4TLDA 3CHYA 4HN4B 5A3JA 3QRWA 5K5EA 1KI8A 3H0CA 2QMZA 1MAUA 5JSZA 5J23A 1O4WA 2WJ6A 1M3SA 3DNFA 4OHXA 4P35A 2CHEA 4YECA 2X2FA 3VZCA 4D26A 5K8VA 3I58A 4DJJA 4EW3A 1AO0A 4MYUA 1VE6A 3QUTA 5JV5A 1LI5A 2BGRA 1JYFA 2EYQA 3DB2A 3DV0B 3TD2A 2P90A 3RSQA 4YRMA 1TAGA 2ZI3A 3FROA 3OIYA 2XSZA 3IAS1 2ZCVA 1LFDB 3AUTA 2ZSDA 1FMFA 1SIWA 3MWEA 1QZZA 3LDAA 4M1ZA 5HFNA 4HWRA 2CXQA 3D5QA 1R66A 5FTKA 4EY4A 4MRAA 2AK2A 2O07A 3X1ZA 1JILA 2L17A 3GVPA 1ZIYA 1S3GA 2X5XA 3I0ZA 4S2EA 1ESNA 2AN4A 1KI9A 1LB1B 2Q1SA 1I80A 5FFMA 1VDMA 5A5DA 2RHBA 4EY6A 1XRJA 3BWXA 1QWSA 3ZNPA 5JW6A 3WGVA 5KYXB 3IE1A 4Q1VA 4RABA 1U2EA 3IUNA 4F6LA 4U7GA 1PLJA 3GLGE 4QVKA 1KYYA 4TZKA 1Y37A 2CJFA 1EFUA 1ZNWA 2VATA 4NZMA 4DKJA 2XUAA 5KDLA 1G4UR 1AH2A 1ZX1A 3BIJA 1AUQA 4BPRA 4R69A 3PC2A 2BD0A 4N5NA 3LP5A 3SEQA 3HKDB 1YOBA 4FK8A 3H4TA 1J0EA 4HRVA 3U40A 2OV2A 4D96A 4LJKA 5TNXA 3GP5A 2LXNA 2IZ0A 3MPUA 4ZCLA 3TO5A 4D9JA 5LOVA 4LXTA 1KAOA 2HU8A 5FDFA 1W2HA 2I67A 2YIMA 4ODIA 5ENVA 4F9GA 4O4IB 1V8DA 2W2NA 3TVDA 1IJBA 4MZDA 3WDMA 1VRVA 1OTHA 3PP8A 1N2BA 1SU6A 3LPMA 1YS4A 3OP1A 4MUGA 4E11A 5K45A 4YCSA 2YUIA 3D6VA 4LY0A 3SIXA 3VX3A 2GA8A 3QU5A 4N3CA 5K2OA 1VFPA 3PUXA 3DQPA 3AVOA 3EIEA 4JVLA 1RRKA 2BTQA 5KU1A 1KMQA 2QE7A 1CFJA 4TRNA 3SXUA 4EO4A 3G5LA 3GPBA 2ZJ8A 2KE5A 1RE1A 3HEAA 1XAJA 3N6XA 3P2MA 2JFUA 4FFDA 2A5DA 2N75A 2W98A 3IMKA 2E82A 4L2IA 4W7IA 5KO2A 1KJIA 2IP2A 2JH3A 2W6MA 1KZ6A 4YUZA 4EO9A 1BW9B 2UZAA 3N8NA 2FR8C 4G01B 5E3HA 4DNFA 4CQMB 2AQIA 3KR0A 5HOEA 4EJ2A 4XGKA 3GQBB 5CNIA 2AC2A 4L74A 4PANA 4DUYB 1VZ3A 3D6JA 4MGEA 1JWLA 2JI8A 4MW0A 2P41A 4TV9F 2ZDHA 3PXUA 1VBKA 1X7WA 2OESA 2FSUA 4ZAVA 4E2ZA 3F5FA 4FD3A 1RLJA 4GM0A 3ER8A 2OEPA 2CKDA 2PBRA 4HF7A 3O0TA 1C0IA 1QV7A 1VKNA 1Z0ZA 1SOVA 2ODNA 2Z30A 4HPWA 1BRMA 1M34B 1NG1A 1CG6A 3LLCA 4H3SA 4H0CA 1S96A 4MCJA 5EERA 4ZVRA 3W7VA 3GLRA 4BZWA 1G7CA 3W1VA 4BFWA 5HKAA 5DNUA 3CISA 1IOLA 2NTJA 2VL7A 3RRZA 4I9NA 3RLFA 1Q6ZA 4QJ3A 2H1OA 3R0JA 3WB9A 4MWTA 3M3HA 3OPYA 3LQRA 3KELA 4Y6PA 4YALA 4DDKA 1CP3A 3RYTC 1AS3A 4L0MA 1NJ8A 2DR0A 3DZFA 4WCDA 1DEHA 4KLRA 3R7AA 2YYSA 5LYYA 1T9HA 4I50F 3FYSA 4L0CA 2PKQO 4JNKA 4FSHA 2DF8A 1U8FO 3K35A 1A7JA 4ONEA 3O4RA 4BNNA 1GCGA 2OV6A 4YUVA 3RARA 5ICCA 4M21A 3HWSA 5CXQA 2ZCJA 5CH5A 3NTLA 2FSVA 2DH6A 3RHZA 5JHHB 4NJMB 3GL9A 2JCXA 4RVFA 5FPYA 6ADHA 4G0XA 3K6KA 4PIVA 3D9QX 3CLUC 1WO8A 2XR1A 4AZVA 2A8YA 3L0SA 4YDSA 3D3WB 3F3YA 3SYLA 1EDEA 3L8YA 2JEZA 5A1TA 4ZYVA 2OFFA 2WILA 4YMWA 5H7XA 1SC9A 3DWIA 4YCJA 2OZEA 2PVCA 3FH0A 1OJ7A 1P0PA 1UMBA 2J5BA 4PZLA 3NG1A 4LGCA 2ZRQA 1D04A 4NEQA 4NV1A 4CI0B 2IBMA 2RONA 3NBFA 4MICA 1P44A 5JFOA 3U56A 2HMUA 1G42A 1G1MA 4TS4A 1KXJA 3KKOA 1QIMA 1VKHA 4UAUA 3MB8A 4HB4A 4FCWA 4IWXA 4YROA 4EFMA 3NC1C 3DO8A 4BAGA 2VWPA 3EF3A 4MYHA 2N46A 5A9RA 2PLFA 4NENA 2QGNA 1TAUA 5E6UA 3M2TA 4Z9XA 4BNVA 2GWHA 5CRIA 4G8BA 3LFUA 1FMLA 4OMDA 3EPRA 4AVYA 1J24A 2PTHA 4X6YA 3T61A 1J2RA 3Q1LA 2ZROA 2O8BA 4ND7A 2DHEA 2QX9A 5DP1A 3TG8A 3SZOA 1WTAA 1DVRA 1T6ZA 2NUPA 1Y4UA 2W4IA 4M1YA 1IBKB 1OD6A 1VLHA 4JYMA 1P33A 4R2KA 1D7AA 1XXLA 1FLVA 2P4EA 2XNKA 3NGMA 5ESRA 4JDPA 1USIA 4RVCA 1F20A 3MGCA 4GNRA 1E9VA 1GCAA 2AJ8A 1RJ9A 2Q0HA 2MTBA 4BJ6A 5IJ0A 4BPBA 4R2WA 2R8BA 2ZBEA 2YJTD 4AF8A 4HX5A 2DZDA 2XZOA 1J0DA 1GRRA 2UZ1B 1DWQA 2ZUBA 1H66A 5G0TA 1YJXA 4ZEWA 4HEHA 4BB9A 1T5LA 3QEOA 3C24A 3MT7A 5JC8A 2NYVA 3PXCX 4H31A 1XTVA 2OCXA 3MPOA 5B1IA 2FJPA 2WJVA 5CT8A 3C3CA 1SXHA 4LRUA 4N8EA 3U7EB 4D8WA 1JIXA 2JLYA 3D7MA 4XGNA 3C1AA 1TQ4A 4UUPA 1T1IA 1PS8A 3DSRA 5D3MB 1IY9A 1AQUA 3VPBA 3VYRB 2BF4A 3E0XA 1WXHA 2Q5QA 5GMOA 2GO1A 1O0BA 2QE6A 3UHOA 4Z7NB 2ODBA 3H2IA 3LHDA 4BOYA 2YICA 4S1PA 3Q88A 4J9VA 3IQGX 3UJ8A 1AS2A 1GLVA 4FS8A 1GSOA 2ZRAA 4U2EA 1W581 1ZS9A 2QEQA 5BYJA 5HWSA 3WTBA 1Z6PA 3MQFA 4CKBA 3BMCB 1OB2A 1TZKA 2DOKA 1W0JD 3ZI7A 1WMAA 3B70A 1PU2A 3KZ1E 1FTQA 3DJYA 4IL5A 3ZWDA 4ZJUA 1SCUA 2M6SA 5ERGB 5EKTA 1R0KA 3IBSA 1E4OA 4R8SA 1Z0DA 2YV5A 4TLCA 5DV9A 4E09A 4MJ3A 2CDAA 3VR2D 4V3BA 4QA9A 2CYAA 2XTNA 5ITWA 3PQ7A 1OHHD 3MWYW 1NRXA 5ED4A 3CLUD 4MZXA 1G4HA 1P1IA 1E3DA 3K9QO 4I50B 4M8KA 1UK9A 2G0AA 2FWNA 4ZT7A 1G8AA 2G82A 2Y66A 2I8CA 4WMLA 1YNOA 3SN6A 3AKCA 4UEWA 2VNJA 3EXEA 1UDXA 3MWDA 3ILVA 3S4YA 1UMDB 3VYTB 2FRXA 2PUTA 4IR7A 4OU5A 4AZTA 5IJAA 2C54A 2BBSA 1C3EA 1DIHA 4RSHA 1B6SA 3FYUB 3THRA 1ISMA 1RI4A 4FSDA 2QZ4A 3D8SA 1NUPA 5HMLA 4LZLA 4GZ3A 3B6JA 4L8GA 4RFVA 4X60A 5EMLA 5TPZA 3FTPA 4DDMA 2HD4A 3LBFA 5LP1A 1SK9A 1QH0A 3FCAA 1ZRHA 2EHDA 1N5MA 4GXTA 4BO3A 3EPHA 2MYUA 3C45A 4YUXA 4A5SA 2VKQA 1N5IA 2WVJA 4YN3A 2D0IA 1L5SA 1HQKA 2DPYA 4GRAA 4KSBA 4QOFA 2VT3A 2WAOA 3ILSA 3QWAA 3HLKA 5MGBA 3M81A 1QGUA 2ATIA 3HYLA 1VSBA 4WGFA 1AU9A 1YB4A 3RIMA 4CCAA 2I87A 2CJYA 4Z1MD 3SR0A 3ZDEA 4WY8A 1M1YE 2JI6A 4A10A 2EW1A 3A14A 3PGKA 2AGVA 4K9SA 5G0SA 1V9LA 4DMFA 1CULC 2JFHA 4YCLA 4ZTZB 3LDHA 4IJQA 1G19A 1QH1A 1XYGA 2YRXA 5EZ5A 3EX7C 4F1KA 3HKBB 1XZHA 4TWZA 3SC4A 3ED5A 1X39A 3VNSA 2ECQA 3ICVA 1ZM9A 3C5VA 1W59A 2HMSA 4JD5A 3WDSA 4QGAA 2H52A 4BFUA 2NSDA 4IJ5A 5IF9A 4PAMA 4QRHA 2IDJA 3I12A 2NXWA 1V2HE 4DR7B 1AN0A 4TT3D 2A5YB 4DMLA 5LFAA 3ENKA 4CLEA 3G7NA 4N6GA 1ISSA 3W5JA 3WLFA 5EXXA 4Q93A 4KGDA 1NVGA 1ZJ4A 2CL0X 5TT0A 5JNSA 2B61A 2Z9CA 3IOCA 3E9RA 2RG1A 4LC0A 4OUKX 5BNFA 5IC4A 3F8WA 3E7PA 2PDAA 4G09A 1HLPA 1XAGA 2NSJA 3E9YA 4PX5A 3NXKA 3S1LA 1PG0A 2QRKA 1I4OA 1S0UA 4LMPA 4TKVB 1WETA 1J39A 1UKEA 2BHLA 5HM6A 1WA5A 1Q19A 4FE4A 3L8MA 4EHBA 1J2TA 1MRNA 2M6RA 3HB1A 4DBLE 4FILA 3DBIA 1JPNA 3NAMA 5E1OA 2WIAA 3VBCA 1M2VA 3N3AC 3TJMA 1K5GA 4DMGA 4XM2A 4B46A 1CB0A 3BICA 4D8XA 4KWHA 4WI1A 2ISSD 3LF2A 5AW1A 3QW4B 5I3CA 4P4NA 3DWEX 1GKUB 5EE5B 4FWTA 3I23A 2JFZA 3DMNA 1KSHA 1RI1A 3PF8A 4XDHA 2V65A 1RRVA 3JWHA 4F11A 5KUTA 1HNZB 3WGMA 2HPAA 1GHTA 3DPUA 3BK1A 5A0TA 1M54A 2RGCA 3AF2A 2Q7DA 3NH9A 4ZOCA 2FWJA 4XDYA 1QGOA 5LA6A 4DZZA 4UDXX 3DFFA 4C6RA 4NJEA 4P3YA 2JAHA 3LUHA 5C35A 5IKPA 1U3TA 1XXHB 2BCJQ 1WDMA 5JATA 4PRZA 4XSVA 4FI3C 1LWOA 1W4LA 4RZIA 2RB5A 3WKCA 3LM8A 2R87A 4P84A 5J43A 3EZNA 4GGPA 1OBCA 2VYVD 2NPIA 1DINA 3JZIA 5B55A 4V1CB 1WNFA 4R98A 1W6RA 4N41A 2V7EA 3HV0A 2BR5A 5A71A 4BC0A 1G38A 4YI5A 1NMEA 2PM8A 3KK0A 4NYMR 1BE8A 1HV8A 2Y8EA 1XYVA 1I5RA 2W2MA 3MW8A 4LGYA 5FNVF 3T4UA 3LFTA 3ZKAA 1ZAYA 3KJNA 3GLIB 2A0FA 4I5DA 1HT0A 3HUFA 3KLOA 3OJCA 2BFWA 3PC8A 1JHMA 1UPTA 5JYDA 2B94A 2QAJA 3WTCA 4A92A 2R8RA 4ED9A 1KGDA 2WU3A 3ZBUA 4C1NA 3DXFA 4RF5A 3LO5A 3EIUA 4ZU3A 1PHRA 3F7NA 4Q1DA 2XDQB 1JIJA 2D1RA 4II2A 3M1IA 2AJCA 3WK8A 3IP7A 4OOFA 1NZFA 4RNDB 5D6NA 4HXFB 4ACAA 5BVGB 1PQPA 1I7NA 2O52A 2RIPA 1K4KA 4H7IA 4DCMA 3C85A 4U5QA 4WOKA 1LBTA 1H2AS 5JAZA 2BI4A 3SGLA 2C94A 2I2FA 3I8XA 3SYRA 4BNMA 3ADOA 1J90A 1Z2NX 1OIWA 2O2ZA 3KFLA 4CF6A 5L3QB 1SO8A 4YP5A 4KO8A 1WVGA 3CINA 4FI3F 3RKUA 4JZKA 3MYRA 2Q41A 3OLCX 1ZGAA 2WV7A 3QUAA 4H7HA 4RPCA 4JBWA 4V3CA 5IVDA 5BQPA 4J4BA 1JB9A 3TXYA 3REOA 1YDMA 5HCUA 1HDIA 4D56A 2ATCA 1ZM7A 1U8EA 1RKXA 5LCXA 4O2AA 2ZE5A 2Q0SA 4YPFA 2WTNA 5TVGA 3T7TA 4CMKA 5ICSA 1AVTA 1JSRA 2PBFA 3LC7O 1M2KA 1RR6A 4OK5A 4PSVA 4GP7A 5L4LA 2V7VA 4G1BA 2PSFA 4LOHA 3FNRA 4YFVA 1GDTA 4KE7A 2YC2C 4HDQB 5LQSA 2XYVA 2O7NA 3DOUA 1C1XB 3IYLW 3HP7A 3M5PA 4A8TA 3FDIA 3WGKA 2BHNA 3PFWO 4L50A 4U2BA 4FFPA 4LQ4A 4AULA 4FKZA 1JV2B 4GXNA 3PFKA 4PE5B 5CVUA 1UH5A 1PKEA 4HQ0A 5AI8A 2DY0A 1XF1A 3MJCA 1FBTA 2QY9A 4JLPA 4ME6A 3A26A 3DAOA 4HC4A 5F76A 1U6JA 1JR3A 1Y3FE 4C03A 4P6VF 4PO3X 2Q27A 4G3XA 5EIWA 5BP7A 4HUQB 1BFKA 1ZK2A 1KDTA 3CNEA 2XY4A 4MV0A 3ANYB 4YV1A 3JU3A 5TVKA 2WKRA 3AUUA 3IXMA 4YT2A 4FHDA 4D42A 3EFOA 2I6XA 4AIIA 2J87A 3F4BA 4CKZA 5EJGA 3ZJ4A 1JEYA 3F6BX 5K0JA 1H1LA 3A1UA 3P2KA 2J8ZA 2CZGA 2ID8A 2VAMA 3P19A 2SKDA 3Q5GA 2I9PA 4UAJA 3NLLA 3QVGA 1JS1X 4Y9SA 4PYQA 1HTTA 2OY0A 4CV3A 2EGHA 3QUCA 4FDAA 2ZJ7A 3QWHA 3DWGA 1QPGA 3KTOA 5FYQA 1RXCA 3W5CA 2QSUA