3AJRA

Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMFGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
total genus 119
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ajrA00
1FK8A 1SB8A 3QY9A 3DAGA 1E3SA 3D5QA 3LK7A 4DL9A 5A05A 3K31A 7ADHA 3AFMA 3JQBA 3FCOA 3M1LA 4S3MA 3LF1A 3D7LA 2AMFA 4TZKA 3VH1A 3EZYA 3QVOA 1U7HA 3TFOA 4PLWA 2EKLA 4RF5A 3BMCB 4L4SA 3MJCA 1Q0QA 4TQGA 2FSVA 3UCFA 3DOOA 3UVEA 1EEHA 2GN4A 1ZEJA 1N7HA 2VWHA 3C85A 3DBVO 3C24A 2C2YA 4GBJA 2DFVA 1JWAB 1PL6A 1SO8A 1UXKA 4GGPA 4MP6A 3NTRA 3BMCA 3NEPX 5C7IO 4IZHA 2H63A 3KXDA 5KTKA 4YB8A 4BNLA 2ZTVA 1N2SA 1Y81A 5TSDA 1BRMA 4E0BA 4WUVA 3H9JA 3KHUA 3PP8A 4L75A 3PLNA 2IEBA 2PK3A 3PJFA 3ROMA 2G76A 5AYVA 4RJTA 2G5CA 3PYLA 2Q99A 3RJ5A 1R66A 4A10A 1ZCJA 3NTQA 1DIGA 3WIEA 2FR8A 3OETA 2FRDA 3AOEC 1PGPA 3NKLA 4YVFA 2CY0A 2J8ZA 3V5NA 5JFOA 1YWGO 2RHRA 3ZHYA 1XEAA 2PZLA 3JQ8B 3QP9A 4WECA 5FYDA 4XIYA 1HEUA 5C37A 4ND1A 1N92A 1E3JA 4W7IA 4DBVO 1Y5RA 4U8GA 3VTFA 3P5SA 4H7PA 1OZAA 5CPFA 1E3WA 1E1MA 4EJMA 4MIOA 3GZ4A 3VPSA 3GA0A 5CG2A 1R0SA 4NFYA 5I8ZA 3AUTA 4HNHA 2FPPA 1XQ1A 3UKOA 1J49A 3TZHA 2IYPA 3PQDA 4ND3A 4M89A 2VOEA 3JQDA 3QLJA 4PLCA 4MKXA 4BNNA 3HN2A 3K5PA 1DHRA 2PLAA 2AQKA 2DTDA 3U0BA 5A5FA 3GH3A 3I5MA 1VPDA 4E2XA 1O5IA 1T1SA 1ZK3A 5DULA 3AM4A 2EWMA 2X0NA 3KSUA 4FFOA 4DIBA 4DIOA 4UVEA 3EYWA 1DC4A 4AJ4A 3MTGA 4B4OA 2O3RA 5A5EA 3KYCA 3KB6A 2P5UA 4FS3A 3DZGA 3KBOA 1UXGA 4J9VA 1I3LA 2BELA 1QP8A 4RO0A 3WXBA 1UXJA 5DDIP 1GEEA 4UVIA 1DJQA 1MP0A 1NHWA 5B37A 2IODA 1XQ6A 3PRJA 2YHIB 4XKJA 3H5AA 1I32A 1I3NA 5EJ2A 3HQ4O 1YRLA 4GI2A 3ZWPA 3LT0A 2ZB4A 3PFWO 1PL7A 2BGMA 5TLSA 3C7DB 3E5RA 1A4UA 1RJWA 3IC5A 1BW9A 2A35A 2X9GA 3FR8A 3TPCA 3FNGA 2J5KA 2VWQA 5ITWA 5A9SA 4I1IA 5AXDA 3GC6A 3EGOA 3T7EA 2CD9A 2DVMA 2X9VA 1R4NB 4I5FA 1YBVA 2GD1O 3IMFA 1JQBA 3K2EA 4AICA 5L95A 2AXQA 5L53A 5EIOA 4J6FA 5EERA 4II3A 1UDAA 1WW8A 4NPCA 1UR5A 3L6DA 3E5MA 4EUEA 4BNHA 4R3NA 4EW6A 4MKRA 1PJ2A 3QVWA 5HTOA 1GYQA 4B4WA 3BXXA 5IG2A 1GYPA 1VI2A 2A9FA 1H0KA 4PRKA 4WEOA 2EJWA 5JXWA 2X0RA 3ZW8A 2W2LA 3RUDA 4BUCA 4I9HA 1HLDA 3VPFA 5IJZA 3QIVA 3V2GA 1A72A 2JHFA 4ALMA 2DM6A 2GERA 1X1TA 4ND5A 3HZZA 3WGTA 1E5LA 4UUMA 4DA9A 2RCYA 4PLGA 1ARZA 1RYDA 2Q45A 4MVJA 4QECA 1RWBA 4OM8A 4YJFA 2X6TA 2E6UX 2QQ5A 3WMXA 4B3JA 2W2KB 3HN7A 4JJFA 3S2IA 3AW9A 3TF5A 3GUCA 1VM6A 2OOSA 4JBGA 1UP4A 4IJVA 2Z1MA 2Q1UA 2E49A 5ES3A 3AFNA 1LQTA 2UAGA 2FZWA 2C5EA 3NGXA 4NG5A 3V2UA 3GFGA 5JC8A 1U3TA 2PWZA 3E9NA 4MP8A 5T8KA 2FOIA 2ZTMA 1LTHR 1WDLA 5BSEA 1LUAA 4E5PA 1YB4A 1NR7A 4AL4A 5TX7A 4MVJG 3MWEB 1Y6JA 2PKRA 5L45A 4YJDA 4J3FA 5JAQA 5JMWA 4E33A 4OKNA 2V7PA 4L76A 1VL8A 5L4SA 2QRJA 3ROQA 3CMCO 1EDOA 3RUAA 4BGIA 2GYYA 3F4LA 1ENZA 3B1FA 3HSKA 1R15A 2I67A 1BW9B 1RM0A 2YV2A 4IJWA 3RBZA 3GAFA 4KWHA 2D8AA 3IP3A 1EQUA 4CLXA 1Q0HA 4E32A 2I76A 3F1LA 4OOFA 3RUIA 1Q7BA 1K2WA 2QIOA 2OUIA 1ZSVA 4NBTA 5C5IA 1LEHA 3HHPA 5KNLA 3RKUA 1RPNA 3RCBA 3R3JA 4XB2A 4FDAA 2HRZA 3WNVA 4A27A 2X9NA 4ALNA 3A9WA 3GG9A 3I52A 3CEAA 4CPDA 3GN1A 2UYYA 3V1YA 1EFLA 1PR3A 2VYNA 3GQVA 1I24A 2P9EA 1K89A 4EDFA 5L7WA 1EUCA 3WMWA 4PG5A 1LX6A 3W4IA 2VT3A 3NT4A 4Y67A 3ZWXA 5LCXA 1U1IA 4A2CA 2IE0A 4KDFA 2TMGA 1B16A 2IDZA 3JQFA 1LU9A 2IZ0A 1F06A 1HE5A 3I6IA 3BMOA 4I5DA 3EC7A 2J5QA 5K6AC 2Q46A 3GK3A 4DIFA 1E77A 4BMNA 4MO2A 1TVEA 3LT4A 2VCYA 5C3MA 3LC2O 3UH1A 1NX6A 2Y05A 4QXMA 5KIAA 4GSLA 4LCEA 2G82A 1DB3A 2Y1CA 4RDHA 4R1TA 4E5YA 1LSUA 5CG1A 3ITDA 3WJ7A 2VUSA 1BDBA 1YO6A 2TMDA 2AE1A 5IAAA 1C1DA 5DP2A 2XF8A 3WNQA 2WD8A 5BNTA 4JIGA 2WM3A 5CP8A 4ZRMA 4K9DA 4DMMA 3FBTA 4R41A 3WYEA 2VZ0A 4IY1A 3H3FA 3HDQA 3GEDA 5F1PA 1JLLA 4XD2A 5KJ1A 2Q2WA 1DLJA 3PWKA 1ADFA 2X7HA 4NK4A 5JC1A 3AUAA 4YRDA 3OIDA 2VNAA 2VTEA 3WWZA 5KWEA 1HDRA 4YACA 4BNUA 1OC4A 4MVJD 5JY6A 3MJSA 3O9ZA 3RUCA 3TFQA 1BXGA 3VVCA 4CJXA 4RORA 2BLLA 3F6YA 3COSA 1IOLA 1HDCA 1HE2A 1N9GB 1ZSYA 2WSBA 4QQRA 4P4LA 3U9LA 3ZV3A 4NMHA 4OQZA 3O4RA 3WLFA 3WSVA 1PSDA 2BFOA 4AJIA 3UN1A 3PWZA 3JYQA 5MGBA 1B2LA 3VC7A 3RI3A 2DBQA 4R16A 2D5AA 2X5JO 3I6QA 4O6VA 2Y68A 1NPYA 1B7GO 3MEQA 4BNIA 2HSDA 1E7WA 1MFPA 3KTDA 1CF2O 4IIVA 5EPOA 1YQDA 1EVIA 2OL4A 1Q1NA 4OXKA 4PG4A 4OAQA 1FDVA 4CM1A 1YE3A 1C0PA 3Q1LA 5HA5A 1JKFA 3R3SA 1ID1A 1SAYA 1SB9A 3BZUA 3L0DA 4AFNA 4CM3A 4E2YA 3M1AA 4TWRA 4PRLA 5DF1A 4U7WA 3ABIA 5JBIA 3PHGA 2OHXA 1LQUA 4IXWA 4PG6A 5C7LO 4LMRA 1W8DA 2B35A 3WQSB 4PG7A 1HSZA 2BGLA 1P1JA 3AY3A 3Q2KA 2NNLD 4CM5A 1B14A 3SX2A 1IPEA 5JCXA 4BGVA 1WMBA 4C7JA 4AJOA 3H3JA 4RZHA 2IEDA 2NVWA 2D5CA 2W8ZA 1UAYA 3NT5A 1QV7A 3UOGA 4LGVA 1VL6A 1Z73A 3B1KA 4WLNA 5KVCA 4ILKA 3RFTA 2J5RA 3ZWNA 4OOEA 4IUYA 2BKAA 1EUZA 4N7RA 4CLHA 2F00A 3GLQA 2YY7A 3WYCA 4NJMB 1EUDA 1FDSA 4OYRA 4A03A 1KOLA 2C2XA 4B3IA 1YKFA 2PY6A 2YQ4A 4XCVA 3UAGA 4IPTA 3RSHA 2FPGA 1U4OA 2PZKA 1DIHA 2VN8A 1YJQA 3IL2A 4EITA 1X13A 1E5QA 1M6HA 1QMGA 4I9UA 4QSMA 2CDBA 1YH3A 3JQ7B 4J49A 2B5VA 3HB4X 2EKQA 5I7SA 5HRUA 4YQYA 1LRKA 3E6AA 4D45A 4CM4A 3W6ZA 3E18A 2EV9A 2VYND 4AJ1A 3P19A 1VSVA 3GVCA 1U5AA 4R1SA 4DQVA 1F14A 3D3EA 2GRAA 3TZCA 2DPGA 1VLLA 1H5QA 2YHUA 5KVSA 3GZNB 5U1PA 4JBHA 5IN4A 1I3KA 3PHIA 5F1KA 1JDJA 3FI9A 2EGHA 3ZNPA 3HFGA 4CLOB 4XZ3A 4MVJP 1SEPA 3GEGA 5T64A 3VZRA 4S1VA 1SC6A 4BKQA 4CLRB 3PHJA 4E31A 4UULA 3BTVA 1XA0A 5JLAA 1GV0A 5F3RA 5CEFA 3I83A 1ZFNA 4LMPA 1ZK4A 1X14A 1K3TA 1T4DA 2NVUB 3ZWAA 2DTEA 3WLEA 1ISMA 1A9ZA 2JAHA 2C0CA 3WWYA 3KYDA 1LNQA 5KJCA 3T7CA 2EGGA 3JQCA 4PFJA 2HQ1A 4LSMA 5L4LA 4IGFA 1BXKA 2AQIA 3FPLA 4LN1A 1MA0A 2YDYA 1N8KA 4TRMA 1U3VA 3ETEA 4IS3A 1P9LA 2EERA 4XQ9A 1DIAA 1O9BA 2WMDA 1I3MA 3EK2A 4IXTA 4Z3DA 4ZN6A 4J1SA 4JX8A 2AG8A 1PTJA 4B7UA 2P68A 1P33A 1LSSA 2BFMA 4JBIA 2CF5A 4FJ1A 3DHEA 1BXZA 1MC4A 4L74A 1M66A 4ALKA 4RPKA 3O8QB 3ORFA 3VKVA 2YQ5A 2J3KA 3VH3A 5CDYA 3F4BA 3I9KA 1JKJA 3HFSA 4I5GA 1YL6A 4MIEA 4P22A 1XIVA 4Q3EA 4ZD6A 3OQ1A 3WGHA 1LC3A 1KEPA 2C82A 3IIEA 2Q1SA 2PD3A 4BO8A 3GVPA 5B12A 1DRUA 3DBLA 3INRA 3PWSA 4FSHA 3RBXA 1VJTA 3AK4A 1U3WA 4MVJH 3JV7A 4DC0A 1QG6A 3OH8A 4WJZA 1WLYA 1C1XB 3H7AA 1QYXA 3ENKA 4G2NA 4YJHB 4GL4A 1LDNA 3W6UA 2PFGA 1LC0A 4YRAA 3LQFA 3SLGA 3JD4A 3S55A 1GR0A 1SOVA 3ZI0A 1WPQA 3PGJA 1T1RA 3JYPA 3GVIA 1J5PA 1VC2A 2UV8A 1ZVMA 1ISFA 3BMOB 4FOOA 1YVEI 1YS4A 3IKTA 4I8XA 5U4QA 4RVHA 2JAPA 2P4QA 1CERA 1HF3A 1KY4A 3IOYA 2HO5A 2EIHA 1L1FA 3AUUA 5I7VA 1PQUA 1SPXA 2CSUA 4BIIA 3K6JA 5BR7A 4WKGA 4D3FA 4R9SA 3DHNA 3DBHA 1KETA 4B79A 1B8VA 3LT1A 1Z75A 2X8LA 4CV1A 1KERA 4RVGA 4RCVA 4CM9D 5KJ6A 1PQWA 1ZJYA 3A14A 3OMLA 3QVXA 1ZMOA 4YJGA 2JD0A 4DLAA 1U7TA 1MGOA 2ZTLA 3GMDA 3PDJA 4HUJA 4UAGA 1U8XX 1J6UA 5AXAA 2SCUA 5JW6A 3TJRA 4OH1A 2B83A 4BNFA 1V35A 3QV1A 3SXPA 5EL0A 1JAYA 1ZIDA 4FBGA 1OAAA 3ON5A 1AN9A 2ILTA 4L73A 4KTVE 4BNVA 1WAMA 2I5PO 8ADHA 1BGVA 4CQMA 1HDXA 5CEEA 4EJ6A 4NZ9A 3EDMA 3GT0A 4J1TA 1ZBQA 3DL2A 3F1KA 4J0EA 4RLSA 4Z3KA 3PLRA 4OSPA 4XJTA 5DCWA 4CMGA 4PLFA 2NQTA 2AW5A 3VZPA 1Z7BA 1A71A 5LDHA 1I2CA 3DZJA 1I10A 3IQDB 3PPIA 3K2BA 1TLTA 1X15A 3B1JA 3GPDG 4M86A 2JCVA 4R1NA 3EMKA 1C0IA 1MV8A 2WYWA 1VKOA 1J4AA 3H9QA 1KEUA 2H5LA 3GAZA 2FSSA 4QEDA 5ENDA 3FTNA 5EESA 5HS6A 4CM7A 5DNAA 2G1UA 1E3LA 4EI2A 3I9MA 2BH9A 4MIYA 1NFFA 1IHYA 3NDJA 3DZIA 4DGSA 2Y66A 4J4BA 4II2A 3HADA 2QX7A 2CVZA 3UGKA 4XYLA 5KOIA 3Q6IA 2B5WA 4KP7A 3GG2A 1T25A 1N1EA 3TZ6A 1MG0A 4BKRA 4M55A 3DDNA 4R4JA 5DOZA 1V3UA 3HDJA 2O2YA 1FJHA 4GMGA 3GMSA 4YAIA 3I9JA 4K1LA 1NQ5A 4RV9A 3ZWVA 5L9AA 1P0CA 4NFSA 4J7CA 4NJMA 3E9QA 3ZN2A 1H6DA 1L7DA 4QO8A 3AM5A 3BTSA 1H94A 3KV3O 5JAIA 1QLJA 4WCFC 3CTMA 1K0UA 1E3EA 1CJCA 5G4KB 1A9YA 2C7VA 3RVDA 3GR6A 3G1UA 3K9QO 4IM7A 1MLDA 1NBOA 2W4QA 1Y8RB 2A4KA 1R16A 4IDDA 3BA1A 1KC3A 1RKXA 2NSDA 2AHRA 1O94A 1BTOA 3TOZA 4MINA 1JA9A 1W6UA 2H6EA 3BAZA 4F45A 5DBGA 1PJCA 1GQYA 3JQEA 3LVFO 2OGUA 1H6CA 5TS3A 1AXEA 2AG5A 2XXJA 1PU2A 3QA9A 2QG4A 1XKQA 4J2HA 1ENOA 1XG5A 1GD1O 2PNFA 1WZIA 2RHCA 1F8FA 3U5TA 3RC2A 3DMTC 1LLCA 4CM9A 4E21A 2ET6A 4UUNA 4R5HA 2J3IA 4IDBA 2O3SA 1EK5A 2JD2A 4FJ2A 4B3HA 4WGGA 2CVOA 4BNYA 3NJ4A 1ZW1A 3ITKA 3I1JA 4N54A 1A7KA 1SMKA 4NDNE 4GSKA 5JO0A 1DFIA 2GNAA 1TT7A 4CQMD 2C07A 4D41A 3LC1O 2VHXA 1Y9AA 2HMVA 3ZWCA 1Y7TA 4RGBA 5ILOA 4ITUA 4E2WA 4W7HA 1QYDA 1I0ZA 1QRRA 1T2FA 3DAPA 1BSVA 5TNXA 4OL9A 2VRBA 3B6ZA 3SC4A 5A3JA 3KLMX 3GFBA 1U9JA 3U49A 4XGNA 4BO4A 3S1LA 1OC2A 3ZNNA 1X7DA 3HDHA 4GAEA 2YUTA 4AJEA 5IFLA 2VUUA 4LW8A 4DPMA 4HFRA 1EBFA 1NWCA 2NM0A 3JQ7A 1O6ZA 3S2EA 3U09A 3BYZA 2YYYA 4BKPA 1B8PA 2B36A 5JAZA 1CIVA 1IULA 1I01A 3WSWA 1ADBA 4Q3DA 3ZHBA 4DYVA 4N5MA 4DQXA 5FF9A 2WD7A 4J91A 1V6AA 3P2OA 4J0FA 1GEGA 1ISGA 2NU7A 5JDCA 4CM6A 2EP7A 1XELA 5IXSA 5CFZA 4BB5A 5ICSA 2Q2VA 1UUFA 1NVTA 1QYWA 3D4OA 4BNWA 3PK0A 1T4BA 5JY1A 1NQTA 3NDRA 1C0LA 5GZ6A 4WASA 1GDHA 1XGKA 4K6FA 5B4TA 3G1TA 4N5NA 4EZBA 1R0LA 1OMOA 7MDHA 5JSFA 1LLQA 2FR1A 5ICMA 4WLOA 4ZICA 1P74A 4G5HA 5FI3A 4H15A 5FWNA 2D2IA 4YQZA 1ENPA 2HDHA 3JYNA 3OBBA 3I9LA 4E30A 3JD3A 4D46A 3RROA 1BVUA 2X58A 4DUPA 3FNFA 2B4RO 3KLPX 1DSSG 4OXYA 4D0SA 5DBIA 5IZCA 3NX4A 1I2BA 1TB4A 3OECA 3D64A 3M6IA 1XCBA 5K9ZA 1B26A 2Y0EA 4K28A 4UVDA 5I8WA 1IZ9A 1T2AA 2FR0A 4Y8VA 3KETA 1YBMA 3OM9A 4Y6RA 1JKIA 4MJLA 3IP1A 2UVDA 3MTJA 5KCZA 3L6OO 4ZQEA 4R01A 4P4GA 4ZVVA 4HY3A 5GY7A 4CM8A 1NFQA 3TWOA 4AG3A 2V6MA 4J16A 3RU7A 4NI5A 5JCJA 3WGYA 3BHJA 1EVZA 4GQAA 4WLVA 4UUOA 5TT0A 3D0OA 5F5LA 1ZEMA 4FOSA 4PLHA 3ZU5A 4JLWA 3H2SA 4PIVA 1NNUA 2BFPA 4QTZA 4XJSA 1AHIA 4GKVA 5TRTA 3WTBA 1LSJA 3HWRA 1LA2A 3S8MA 4B4UA 1IUKA 4L4RA 3A4VA 3ST7A 1NWHA 4ID9A 4DLLA 4IDFA 4WNIA 2WJPA 1F17A 5HBRA 3L9XA 4BNMA 2OBNA 3FNHA 3KUXA 3LLSA 4Y6PA 3KYDB 2CUKA 4E3ZA 3SJ7A 3SJUA 1PZGA 4L4XA 1R4MA 3DMYA 4LRTB 2D59A 4NU5A 1ZK2A 1PJQA 1PS0A 3C1OA 4DPLA 4A73A 5A9RA 2C20A 3TN7A 5BSHA 2FP4A 3ZNOA 3TZQA 4HFMA 1U2GA 3FF4A 3K92A 1E6WA 2HJRA 3RBVA 3STHA 3ZWBA 3B70A 3GDGA 6LDHA 4MPDA 3MOGA 8LDHA 4LVUA 2VNSA 4PG8A 1ZH8A 3R6DA 3GZNA 2GZ2A 3DONA 1ZZEA 2AA3A 3BIOA 4BKOA 3I23A 1O89A 4FW8A 4RF3A 2VHYA 4CR6A 2Y67A 3WR5A 1XYGA 4CUJA 1SBYA 4ALLA 3GDFA 3ADPA 1PQPA 4DREA 1V8BA 1V3VA 1XSEA 4A26A 3ZU4A 3QWIA 4JJIA 4E13A 3FSRA 1AHHA 4U0JA 4YAGA 2Q49A 1P1KA 3PHLA 3WG9A 2P2SA 4BKUA 4YTEA 5A1TA 4ZJUA 1H9AA 3ANMA 3PJDA 4GVLA 2HK7A 4IJKA 3ZWMA 1ZKMA 3GRPA 1Q0LA 4BNZA 4J1QA 4XYMA 4WLEA 1MXFA 1GZ3A 4JP3A 2B0JA 3OF2A 3DBRB 4XDYA 3ZWYA 2NVBA 1HLPA 1NR1A 4NH4A 2R6JA 2VQ3A 3GNTA 3PZRA 1FDTA 1WDKA 4K6CA 1ZK0A 3VPXA 3H2ZA 4ZA2A 2NWQA 1AXGA 3DWFA 3I4FA 1QLHA 2GR9A 4GMFA 4LVCA 2P9CA 4Z0PA 4BGEA 3C1AA 4CM4B 1HTBA 1AUPA 1GUYA 4Y6SA 1LBEA 5T6BA 1ADGA 3BMNA 4RZIA 4BB6A 4FR5A 5T67A 4YXFA 1X7HA 4TVBA 3TNLA 3RC9A 1JAXA 1F8GA 1HYHA 2Z1NA 4YAJA 4CMAA 2O7SA 2POQX 2NTVA 4IINA 4M1QA 4Y9DA 1DXYA 4EGFA 3ICPA 3A1NA 1YL5A 1ML3A 3JQGB 4YT5A 3L77A 1H6BA 1CEQA 1ZSNA 2R00C 4H3VA 1P1FA 3FBGA 3PYXA 1V0JA 3FWZA 4UUPA 2G0TA 3PXXA 4CUZA 3GGGA 4P4NA 1PJ4A 4YJHA 4YT8A 3W4JA 1N5DA 4R5MA 4YAKA 1DIRA 3WGIA 3HUDA 1G0NA 2EEZA 2XOXA 1B8UA 3M2PA 1KVSA 3D3WB 3JD0A 4WCDA 3EW7A 3W8EA 2YJZA 4DPKA 1SEVA 3DBRA 3WB9A 3RUEA 4FC7A 1F0YA 5CDUA 1KS9A 5T8KC 3MJ4A 2PGJA 3VOSA 3RU9A 3DC2A 6ADHA 1KEVA 4GLLA 3V1UA 4KTTE 1F12A 4HXYA 1PS8A 1M2WA 2EW2A 1VRWA 2AEMA 3K96A 3CKYA 2O2SA 3WDSA 3KRTA 5EMHA 3G49A 5KVVA 4BO3A 1MG5A 2HMWA 3JQ6A 3WICA 1D3AA 2GLXA 1LLDA 4PLPA 4JGBA 4PLZA 5I9LA 1HE4A 4FFMA 4MDHA 5DP1A 2NU8A 3ZNQA 4W6ZA 4OGWA 3WFJA 5C7OO 2E48A 3Q3CA 3ZU3A 4BHTA 2HU2A 4IDEA 4DVJA 3SC6A 2VHZA 3INTA 1Y8RA 4U6QA 5JNLA 4AJNA 1PGQA 3ROPA 1VE9A 1VJ1A 4FGWA 1L7EA 4OIMA 1UP6A 2JJYA 4Z0HO 4RVDA 4CL8A 5L51A 1NYTA 2VWPA 3VTZA 3QJ5A 5THKA 1GCOA 4D7AA 1I2ZA 1R12A 4O1MA 1NXQA 2P91A 1ZUD1 1JWBB 5JYDA 3AOGA 1JW9B 1S7CA 3RFVA 3IAHA 4IS2A 3BTOA 3H8VA 2J3JA 4NNJA 3WBFA 3F47A 4L0QA 4BMVA 2RH8A 1DDOA 1P45A 4XR9A 2FHSA 1LDYA 1EFKA 2CZCA 4TZTA 1YOVA 5B1YA 1WXDA 2X1HA 3AWDA 2QW8A 5H82A 1KVRA 4YR9A 4RF4A 1U4SA 4KQXA 1N1GA 3KVOA 3QWFA 2LDXA 3WGGA 4DXHA 4NQZA 3ONEA 2GN8A 3ASVA 2JD1A 4HFJA 4U6SA 3F5QA 2QYTA 3PIIA 2WE7A 3NUGA 3Q9NA 3DZFA 3OA0A 3E8XA 2V6FA 4Q3AA 3ETDA 1YXMA 3DQPA 1E92A 1WWKA 4QUKA 5COQA 5DOVA 4KUHA 5I9MA 3KSDO 3NGLA 2IRWA 1NVMB 1NAHA 1PZFA 4NK5A 1EQ2A 3N7UA 1QR6A 3GDOA 1Q7GA 4W99A 3AI2A 3UUWA 2FN7A 4IDGA 4JP2A 4W4TA 4BNKA 4KQWA 3CZRA 3WGQA 5DT9A 4B7XA 4BGUA 5TF4A 3MCVA 4RVUA 3W8FA 4Z6KA 3I3OA 4RPJA 3AJRA 1JN0A 2W98A 3JQAB 1PGOA 2ZYDA 3IUSA 5G0TA 2DBZA 5EQFA 4BNGA 1LRLA 1S6YA 3GEMA 1EMDA 3JYOA 3L4BC 5JDCC 5TT1A 2Y0CA 2X4GA 3RIHA 4BO0A 2VRCD 1C1DB 1C14A 4CMKA 1TEHA 2DAPA 1R4MB 3EVTA 1H6AA 1K6JA 3OFSA 4IGEA 2HMUA 3GRKA 3RJ9A 3RAJA 2IYOA 4FD3A 4R3WA 1E1NA 4YJGB 1PWXA 2BFAA 4BS9A 3UW3A 4YRBA 3DZKA 3NYWA 1K6XA 4K26A 4RVFA 3RKRA 4JROA 3WGOA 1U2DA 3NDIA 5I7EA 4EUHA 1LLUA 2EHDA 3GUYA 5LC1A 3EVNA 1GL3A 2O3JA 2P9GA 2Q4BA 3JD1A 3WX0A 4CMIA 5IDWA 3PGXA 1PWZA 2WD7B 4B4VA 3PDUA 1BHSA 2V6BA 2GPTA 2CVQA 1KVQA 2XPCA 2PD4A 4GX5A 1A27A 2H1SA 1O95A 4DRYA 4FGSA 3Q9UA 3S2GA 1XLTA 4PZEA 5G0SA 2PV7A 3GVHA 1C1XA 3UHAA 4CLRA 3ONDA 3HDYA 4RPHA 3PVZA 3PEFA 4XDZA 3H4VA 3SBOA 3GN2A 1DRWA 3DZHA 4F6LA 5J23A 1RYEA 4B7CA 2CMDA 4ND2A 3VPGA 4HADA 2WYUA 3JYLA 2P5YA 1QXSA 1QKIA 2HKIA 1NHGA 3JSAA 4UEJA 5G2OA 4FB5A 2I65A 3E1KA 4A7PA 3ANLA 4MVJE 1U5CA 1D8AA 1DAOA 4KDEA 1UZNA 3MZ0A 3GGPA 4YWJA 5BNIA 4PLTA 2DBRA 4AJKA 5L4NA 2ZJ0A 1PZEA 4BO9A 1ZO8A 1DPGA 2ZB8A 2OFPA 1PS9A 4J1NA 3G17A 4NBWA 1OFGA 4Z0TA 4AJPA 1PJ3A 2Z5LA 1QYVA 3I9OA 3RUHA 3QE3A 2CF6A 3EUWA 1IZ0A 3L4SO 1AGNA 2NU9A 5G4LA 4XA8A 2ZB7A 4XYBA 4TRRA 4Y98A 2AQ8A 2GASA 3EAGA 2HMTA 1PJTA 3A28A 3H65A 2YV3A 3KZVA 4KWIA 2ZCVA 4OXNA 4R54A 4D3DA 1ZMTA 2PD6A 4M87A 2GDZA 3DEYX 1GU7A 2PGLA 4AJHA 5B4UA 3KOUA 3SVTA 4TRNA 1VJ0A 5F5NA 2DUUA 2NVUA 3WTCA 2FMUA 3GHYA 2F1KA 1KVTA 3DOJA 2NU6A 1E7SA 1HXHA 3NV9A 1BMDA 1E1LA 1PJSA 1VKNA 4ZHSA 2FPIA 2WYVA 4BL5A 5IZ4A 4O63O 4XRGA 1IHXA 4XGIA 1LDEA 3OICA 1HYEA 3QSGA 4CL3A 2Y1FA 4ALJA 4CUKA 5JAMA 1P44A 3DZBA 4JNKA 4JXKA 1Y9EA 4BOYA 2VYVD 3WBBA 2Y1OA 1YBAA 3UCEA 2NACA 4R51A 4NBVA 3WFIA 4HP8A 3CPSA 3W1VA 5TQVA 4C4OA 4IMRA 4IDCA 4PGFA 3WS7A 1UXHA 2QRLA 3LLVA 3Q11A 1D7OA 4BVAA 3DOCA 2I3GA 4GH5A 4QX6A 3DHYA 2EW8A 4WOKA 4XQCA 1PR9A 2DT5A 1Y8QB 1BG6A 2V65A 4CMHA 1VL0A 1G0OA 4CM8B 5ENVA 3LC7O 5JPIA 2Y0DA 3PZBA 1HZZA 3I4CA 4OSOA 4O0LA 3C7CB 5L3ZA 4CLDA 1HYGA 1OI7A 3INGA 4NJOA 5ITVA 5G0WA 3OJOA 3UCXA 4Q39A 1Y8QA 2O4UX 2VHVA 2DUWA 4FFLA 4KUEA 2EF1A 4FPXA 3Q0EA 2ZQYA 3VAZA 3AI3A 5F21A 3DXFA 1HKUA 2CDCA 4P38A 2YFHA 1LXCA 4WLFA 3ZV4A 1A5ZA 4CV2A 5CPBA 1FDUA 4J7UA 1HL3A 4FQ8A 9LDBA 3RUFA 3FWNA 5HWSA 2GN6A 1JVBA 3VHRA 1N7GA 1MB4A 5IF3A 4OJNA 4E4YA 5GMOA 1T2DA 1Q7CA 1PIWA 3LU1A 4ND4A 3Q2IA 3BMQA 2BF7A 3JD2A 4WCFA 1WP4A 4MP3A 2R00A 2FY8A 1H2BA 3DO5A 1GPDG 1QV6A 5ILGA 1ZNQO 1T24A 1XHLA 4LSWA 1JU9A 1UXIA 3I9NA 2HUNA 4ZQGA 1KY5A 3X2EA 5AQ1A 1GYRA 1XU9A 4ZQHA 3U4CA 3VZQA 3AU8A 3T4XA 4WCFB 1C3VA 1WDMA 2Q1WA 3L6EA 5TJ9A 3SLKA 3ZW9A 4Q3BA 1Z7EA 4LK3A 1ADCA 2C7GA 1YB5A 3L9WA 2BRUA 3VKUA 5EINA 4HKTA 3FTPA 3ZZNA 4RF2A 1E3WB 3OIGA 1DHTA 3OEWA 3MJTA 4ZQFA 1LRJA 4PVCA 2RBEA 3K30A 5L7YA 4PZCA 4IQ8A 1E7RA 4D79A 2X23A 2O48X 2Q2QA 2X5KO 1FMCA 3D4NA 4E5NA 4H16A 4I9NA 4GX0A 2CDAA 3MJVA 5DN9A 1OOEA 1UH5A 4NBUA 4J90A 2RH4A 4J7XA 5DCYA 2NUAA 4BV8A 3U62A 3RFXA 1W0CA 1HWYA 3LZ6A 1ONOA 2DTXA 3CH6A 1YDEA 3JQ9A 3IJRA 1P1IA 3P7MA 1PGJA 2HRBA 3EZLA 5B4VA 1LJ8A 2Z95A 2DLDA 1V3TA 3FHLA 4CQMB 3KO8A 1PL8A 2JKVA 2GN9A 2ZYAA 1TT5B 3RC1A 2QYSA 3IJPA 1Y1PA 2VZ9A 2I99A 2Q3EA 4RQTA 3CMMA 3LT2A 1XU7A 2GCGA 2C29D 5JMPA 1ZXBA 3OHSX 1I5RA 3QHAA 4YT2A 1GPJA 1PEDA 1H2HA 1I33A 4GWKA 2WTBA 3FR7A 3GF4A 3H9EO 1EK6A 4IMPA 1DEHA 1KC1A 3OQ6A 4XQEA 3VZSA 2YV1A 1D1TA 1T26A 3JQ9C 4M8SA 1GZ6A 2I9PA 5K6AA 1H93A 3F5SA 1ENYA 4IJUA 5FI5A 3LDHA 2VYVA 5DZSA 2PH5A 3R1IA 4BO5A 2VUTA 2D3TA 1GUFA 2JFHA 2NV6A 5TJHA 4G65A 4MVJF 1KIFA 3T4EA 3CIFA 4Z9YA 2GZ1A 4YT4A 2HJSA 4AVYA 1RM5A 4IQ0A 5A03A 5KJEA 1TT5A 1SZJG 2BGKA 3JQAD 4OO3A 4J4TA 4EJ0A 4CLOA 4YBZA 3HG7A 2B4TO 3ONFA 5TC4A 3TL2A 1NQOA 3W8DA 4NBRA 1NPTO 3IUPA 2PKQO 1X0XA 3HB5X 4MKZA 4F46A 3ZWOA 1T2EA 2A94A 1NASA 2PZMA 4G81A 4W9NA 3DBLB 1DBVO 3WOHA 4JN6B 4WOJA 1GQQA 1W4ZA 5LDGA 3ASUA 4FJ0A 5IDYA 4DBZA 1HRDA 4PN3A 5BSGA 1X1EA 3VH2A 2EKPA 2P4HX 3QVTA 2DPHA 4Q9NA 1FF9A 1IL0A 2OORA 1NAIA 4OMUA 1I8TA 5KJFA 2QZ9A 2VZ8A 4WNCA 1E7MA 3VPHA 1DO8A 2QRKA 2YW9A 1IPFA 5T5QA 3QQPA 1GTMA 2HLPA 2X0IA 4JCOA 4FIZA 3RWBA 2BD0A 3DR3A 4DC1A 3W4KA 4ONEA 3QRWA 2Q4EA 1E0DA 3H9GA 1B3BA 2I66A 3KEQA 5A3VA 5TIIA 3CSDA 4CMEA 4GX1A 1R4NA 2VT2A 2AQHA 1BVRA 3RD5A 3QVSA 1DFHA 4O5OA 1PJBA 1EVYA 2IXAA 2ZTUA 4I08A 5A9SB 5BSFA 2V6GA 2QHXA 2PGDA 4D42A 1J0XO 2JFFA 1V9LA 1Q2XA 1XR3A 4INAA 5CDGA 3BHMA 2E37A 4XIJA 3ZCXA 3TSCA 3OJEA 4CR7A 1X0VA 5A9TA 4FN4A 4WE3A 1LI4A 5BNFA 3M2TA 3PYMA 5CDTA 4GPD1 3N58A 4YJFB 4D43A 4KMSA 1AE1A 4ZQBA 5A04A 3QWHA 4U0KA 4E2ZA 2O50A 4A0SA 1GV1A 3R0IA 1KEWA 4CMCA 4A5OA 4HFNA 4BMSA 2LDBA 2O7QA 3ZDFA 2VTDA 4BQPA 2ZYGA 3ZWWA 4TRJA 1FDWA 3LF2A 3NTOA 4I5EA 5JYEA 5TGDA 4FC6A 5AOVA 1A4IA 1ZXLA 2VRCA 2YDXA 5IXYA 4RL6A 5BT9A 2PZJA 1M67A 2PA3A 2JFGA 2E4AA 1E3IA 4UEOA 4BNTA 1R0KA 2E82A 3O03A 1IB6A 4E6PA 3V1TC 4DQUA 2GO1A 3ENNA 2D4AA 3CE6A 1HT0A 1R37A 2GSDA 3K8ZA 1RM3A 1VSUA 1B15A 2GZ3A 1Z45A 1DLIA 1UAGA 1E7QA 3DB2A 3TQHA 3BTUA 4O59O 4NR0A 3H5RA 2CNBA 4GGOA 2OZPA 5JDIC 1U8FO 2DBVO 3P2YA 4J4HA 4GVXA 5COBA 3D1LA 2UUPA 5IZCC 4OHUA 1FXSA 4WPGA 1UDBA 3GY0A 5GZ3A 5U9CA 1BWSA 3KSZO 4QFCA 5JDIA 1DRVA 4M49A 4RLHA 3CINA 4DLBA 3QWBA 3C1TA 1A7AA 3PQEA 3UXYA 5COAA 1DC6A 3OQBA 4CMEC 4DTIA 5T57A 1YGYA 4N5LA 1E7YA 2EXXA 4D3SA 4WLUA 2DFDA 3ADOA 2W2KA 3ICCA 4XRRA 3WQRA 5A02A 5HS4A 3OJLA 1HDOA 3OSUA 1CDOA 3U3XA 5I9NA 3JQBC 4HBGA 3FRJA 5I7FA 1CYDA 1Z6ZA 1MUUA 1IE3A 1M6WA 2IZ1A 1EBUA 1UJMA 2C54A 4XEHA 3S2FA 1O8CA 2X86A 2G17A 3C3XA 5KKCA 3O38A 3DFZA 2O3QA 1NVGA 4FCCA 2X22A 1I30A 1YQXA 5A4DA 4D0RA 3TZKA 2C59A 5CEJA 3MJEA 3U4HA 1PJLA 4FFNA 4LCJA 5JO9A 3PJEA 4IIUA 4QO7A 2JL1A 1LSOA 4FFPA 5EN4A 3U4DA 3PFFA 4Z9FA 2VWGA 1M76A 3WYBA 4AJ2A 1B3RA 4CR8A 5CDSA 1P0FA 3QW2A 3G3EA 3X2FA 4QFDA 1XWFA 2XXBA 3ANNA 5GZ1A 4LISA 2UUOA 3GPIA 4CQLA 3AY6A 1HDGO 3E48A 3PQFA 1N9GA 1LDMA 3DBHB 1WZEA 5HM8A 2WWRA 1ULSA 1SOWA 2ZKLA 4JK3A 1K5HA 4XGKA 5DBFA 4LRSB 4PLVA 3DTTA 3IKVA 4MVJM 3TL3A 5CHEA 4HV4A 3CUKA 5JCJD 5EQDA 1HSOA 3E82A 5IDQA 4YEDA 1C0KA 2Q1TA 3GHHA 4UREA 4C7KA 1GQ2A 4YCAA 2NTNA 4D44A 1CQIA 1CRWG 4YAEA 1NP3A 1D1SA 1WVGA 4CODB 2JCXA 2O4CA 4TSKA 2QZZA 1U3UA 4BNXA 3ZV6A 4XX0A 3KYCB 3V2HA 1P1RA 4XR4A 2W90A 3DAFA 1HETA 4EYEA 5DCUA 4AJJA 2H9IA 2CFCA 2VOJA 4XYGA 2AE2A 3F9IA 2GUGA 3ZH2A 2OXIA 4F3YA 3WIDA 1GFSA 4OQYA 2RAFA 4EEXA 1ZJZA 3D5TA 3F46A 1P3DA 5IDXA 5FFFA 1PX0A 1CQJA 2J3HA 3GVXA 5AVOA 3CXRA 4GX2A 2HK9A 4P8RA 5G0UA 2B37A 1KYQA 3VDRA 1I36A 1YB1A 3H6KA 3BHIA 4U5QA 2B4QA 4BNJA 4N18A 5H81A 4TVOA 3TOXA 1GZ4A 3RQSA 3IDSA 1ZK1A 3C7AA 4UVGA 5ER6A 3VDQA 1GADO 1CWUA 1UP7A 1JVSA 1NFRA 3O26A 3UICA 4KUGA 4FFRA 3ZHZA 3AM3A 4HX5A 1SCUA 4OKIA 3KEOA 1TA4A 2NLOA 3NJ8A 3DTYA 2XAAA 1EZ4A 1WMAA 2AEFA 4BO2A 5FEUA 1OBFO 2BI8A 1DC5A 1HDYA 3PJGA 4HWKA 1ULUA 1ONPA 3UF0A 1ISHA 1TXGA 1U28A 1ORRA 2GGSA 2ZATA 3GNSA 4RPLA 3ZGYA 4DYDA 4RVSA 4ALIA 2W2LD 3KM0A 1MFZA 2OP0A 1TI7A 4CQLB 2PKQP 2B69A 1T2CA 3OJFA 4CV0A 2IZZA 1YDWA 2YZ7A 1K6IA 4R68A 4HNGA 4KOAA 1Z82A 2JHGA 1QYCA 2I3AA 4UVHA 4CMJA 1EE9A 2FWMX 3G0OA 5AXCA 3RC7A 4M54A 2D1YA 4NIMA 1X7GA 4JQCA 2WDZA 3HJAA 4XQGA 3L4BA 1G1AA 3PHHA 2O23A 3FN4A 1UDCA 3OA2A 2DQ4A 3OJ0A 3U4IA 4XWYA 4URFA 4CMBA 4DWVA 4BO1A 1QSGA 2RIRA 3OEYA 4GKBA 5L40A 4W82A 2WE8A 4RQUA 1HE3A 1B0AA 3L07A 4CLEA 4YDRA 3VVBA 5F1OA 2BMAA 1GCUA 2AEJA 1DFGA 3D3WA 2OBYA 3D4PA 4TKLA 1DOHA 1DJNA 3JTMA 5G0VA 3E03A 4BV9A 3ROKA 1DC3A 3ZHXA 3HE3A 2IXBA 3MOIA 1RM4A 2D0IA 3GGOA 3HNPA 5IN5A 4E5MA 3G79A 3JQAA 5G4KA 3ETGA 2WEKA 1NM5A 2HK8A 3JCZA 4PCVA 5JE8A 4NFHA 1YL7A 4J2OA 4J43A 1MX3A 3PI7A 4NHEA 4WK6A 3GNQA 9LDTA 3OIFA 3PIDA 3FD8A 3ULKA 2OO5A 2ZK7A 1MC5A 1DIBA 5KVQA 1KBZA 4BO6A 1E6EA 1UZMA 3V8BA 4XB1A 4W9NC 4UEKA 5THQA 2UDPA 2YFQA 3AUSA 2BI7A 2X0JA 2Y1GA 3AI1A 3AU9A 4ESOA 2Y1DA 3B20A 4PZDA 1H9BA 4R1UA 2OP1A 1HZJA 1EE2A 2J6IA 4YA6A 4ZU3A 1P1HA 3O8QA 4KZPA 1M75A 3PTZA 5KKAA 4IDAA 4L9RA 1LDGA 1BDMA 2Y99A 4TMFA 1P77A 2C5AA 2NADA 3MWDB 3IS3A 4RDIA 1YOVB 3N74A 1PGNA 1NTOA 2ZJ1A 1Z74A 3QWAA 4ZRNA 1O0SA 4TROA 3NRCA 3VH4A 5JS6A 3KYBA 4BO7A 4ZGWA 1KVUA 5H83A 1JTVA 1HDZA 2Y93A 3JQGA 4RPGA 2EP5A 3H5NA 4J9UE 2DKNA 4PVDA 4TKMA 4WEQA 1ONNA 1EVJA 3ZV5A 2BHLA 4B8ZA 4JJGA 1ISJA 1P31A 2EJVA 3TRIA 5CAEA 2EG9A 3LYLA 3WQQA 4F6CA 3CZMA 2Q50A 3EY4A 1E1KA 2PTGA 1NPDA 2DC1A 1LDBA 3BMNB 3FNEA 3DFUA 4Z9XA 1SNYA 2PR2A 4MVJI 3WJAA 3GOHA 4R69A 1CETA 4ROSA 1IYZA 4L8VA 3AY7A 5L7TA 2JCYA 3NAQA 2FZEA 2R2GA 1GUZA 4IQGA 1R6DA 4DMLA 2HCTA 2YHIA 4IBOA 1MXHA 5K0ZA 3ZU2A 1YQGA 4CMIB 4X54A 1Y5MA 4YPOA 3JQFC 4PLYA 4EBFA 4XYEA 3LSYA 3SEFA 2NTJA 4B8WA 1XDWA 4Q3CA 4QT0A 2I6TA 2OMEA 3BMQB 4NU6A 4AJLA 4YYZA 1D4FA 3C8MA 2O3TA 1PZHA 2Y1EA 4MOWA 3K73O 2PH3A 4E12A 1EDZA 2ZIZA 2GF2A 1YJ8A 3A06A 4IZIA 4Q3NA 1E6UA 1GY8A 4R9RA 4EUFA 1UZLA 4E5KA 5A06A 5BQFA 3EHEA 3TDKA 3UFXA 2A92A 4GLOA 2NQ8A 3OP4A 2DU8A 1DAPA 3AOEA 1BXGB 3DMTA 4GWGA 4BQRA 5AXBA 3RASA 2HMSA 1G6KA 1IY8A 2X5OA 1GAEO 2ZQZA 3E9MA 1ISIA 2VHWA 5MDHA 1QORA 5ADHA 5ER9A 2HAEA 3JQ8A 3NT2A 1NQAO 4CV3A 2ZCUA 1W73A 4EEZA 2O3UA 3F3SA 1WNTA 3FPCA 3H9UA 2ZB3A 1YONA 3WGZA
chains in the Genus database with same CATH superfamily
3P27A 1MD9A 1POWA 3ELUA 4QBHA 4UDXX 3ENVA 2QENA 4JEHA 3W5VA 3RTDA 1NVVQ 3F8TA 1QF9A 1E2EA 2CE2X 4S2UA 6AT1A 1JZQA 1LK7A 1RVV1 2R7AA 2GXAA 4DLYA 4DA7A 1DI0A 3H13A 3M1LA 4S3MA 4EECA 3D7LA 3UENA 2H7YA 2AMFA 3EZYA 3QVOA 1EX9A 1CF4A 3EULA 1G6Q1 1NXXA 1QQ6A 2I8LA 1CUHA 2EKLA 1CE8A 4TWBA 5K1ZA 4W9MC 4UBKA 3WI7A 1L5ZA 4RMJA 5EWMA 2AR9A 2O2ZA 4GWLA 3JS5A 1NNLA 4QJBA 4OVKA 3AESA 4BQQA 1Q0QA 3AIMA 1YNOA 3F7MA 2BM1A 1JSCA 4DA6A 1KAHA 4P58A 3UCFA 1EEHA 5PGMA 4F5YA 2R7MA 5EZ5A 3ZR4B 1ZEJA 2FSVC 2N47A 4D97A 3U39A 5F9HA 1KH3A 3JYHA 3PJRA 3LBHA 2FUG1 4NBSA 2H63A 4LAFA 1RHQA 4UDYX 1WOYA 2OZLB 3PQ2A 1N6RA 3K4QA 4M6WB 4MARA 4MRNA 2A5JA 4MKGA 4BTEA 3PP8A 4GPAA 3R24A 4L75A 2WPDD 3AJ8A 2XTMA 3TAUA 1D6JA 2IEBA 2PK3A 4RSRA 5B36A 3PJFA 1SKYB 1MTOA 1XAJA 4F4HA 4MPJA 2OCGA 1VYUA 3FUCA 4OQLA 2PSEA 3RSOA 1D1PA 4DY6A 4YR7A 3PYLA 4WNYA 2IY8A 3NTQA 3WIEA 3H3XA 1JG2A 5ECWA 2FR8A 2H2IA 3OZSA 5K20A 1W5EA 3AOEC 1C9EA 3SBEA 4ZU6X 5AUQA 2I6QA 3ZHYA 1QHHA 1OLUB 3JQ8B 1EVQA 3I45A 4K88A 4ZMBA 5AJYA 2JLZA 4LBVA 1M6NA 1QE3A 1SD5A 1VCOA 2G9RA 4ND1A 1G5PA 1T6NA 3H9CA 1XMJA 5CLGA 3KR0A 2A57A 4I2VA 3PD0A 4JB0A 4WBNF 1ZAYA 3IPXA 2PXHA 3P0FA 4H7PA 4Y3UA 1E3WA 3F49S 3V9PA 1RFGE 4TWZA 5AJVB 2BBSA 5DTEA 2IUYA 4DDVA 3I62A 1VGRA 4K0RA 3MTIA 3GA0A 3VPSA 2NXWA 1IM2A 4MWZA 3RRYA 1KNQA 4PV7A 3EQ7A 3RVQA 3VJMA 3EFHA 3SQDA 2AN1A 4MV5A 3UKOA 2I7VA 5FO0A 2IYPA 5BSTA 2A7QA 2PSFA 1G8JA 2X2PA 4JJ6A 3K8OE 4ND3A 4WH0A 3AIIA 5J2TA 1PK8A 4YN3A 1JLKA 3EXFA 1WF3A 1RD4A 1T9GS 1VMIA 3NC0C 5JNUA 4Z1OA 3BFVA 4V3CA 2AQKA 4NCNA 1YHNA 4DV0B 2DTDA 1F38A 1DQSA 1WXWA 1SG9A 4KJXA 4PVDA 1ZK3A 1N34B 2DR2A 1V7QA 3L1KA 3GCXA 4DIOA 2EL9A 1DG9A 4ON9A 1DC4A 5J3JA 1ODTC 5DRTA 4B4OA 4JENA 3EC1A 1GQRA 2O3RA 3NBFA 3LL4A 1WSAA 3GLRA 2R7LA 1IZYA 4ZTBA 3AHHA 5B7NA 2YCLA 2VSQA 4OHCA 1G8KA 5AK4A 2BKUA 3ZDAA 4KGVA 4RJ2A 1UXGA 3QXCA 5C7YA 2C9BA 1XAGA 1QP8A 2CL5A 2GJSA 3VM6A 5JZMA 1J2TA 1GEEA 1MP0A 2WWXA 1Y1TA 1RJEA 4DNFA 2IODA 3CN9A 5JRDS 2YHIB 4URZR 1NM5C 1I32A 3AO0B 3H5AA 4XKJA 3UHPA 1YRLA 2CWWA 2WSMA 4JP1A 5IUKC 1HO3A 4GI2A 3B6KA 2VLBA 3LT0A 3ZWPA 4EHBA 2ZB4A 1XXHE 1A1SA 3OMXA 1ID8A 4EX7A 1XQYA 1IZZA 1NY5A 5IUJC 3C7DB 4LDPA 2ASVA 4HAWA 1S8OA 3IC5A 2GTIA 4Q4LA 2J5KA 2VWQA 4AIIA 2FLWA 3GD5A 5E8JA 4AW9A 3OCVA 1R0WA 5D8DA 2GTHA 3GC6A 2CD9A 1CUZA 2DCUA 4P7FA 1R4NB 3CB4A 4G0XA 5BV7A 5J2UF 1YQEA 2GD1O 3IMFA 2OFOA 1H2YA 4NEGA 5HQ3A 5L53A 4J6FA 3X1DA 4P33A 5IH7A 1NMZA 2FPGB 2GM5A 3RWOA 2RJOA 5LIPA 5EXSA 1KK2A 1XAHA 1XJCA 5BPHA 4LXGA 3PI6A 1E9DA 4NJEB 5BYAA 4JA0A 2D3WA 4CCYB 1XVIA 2WW8A 3K16A 4RXUA 4FMCF 1E1DA 2ABWA 4MKRA 1Y48E 3QVWA 1KMHA 4F2DA 4KVAA 4ERNA 5LKRA 5HTOA 2A9QA 1UMBB 2M6SA 4MS1B 1IOWA 2A9FA 1VI2A 3CUYA 4PRKA 1VA4A 2HEGA 3BN3A 1RXIA 2E5LB 2RHLA 1RQ2A 1ZGJA 3WHPA 3RTBA 1T4CA 4BUCA 2M6RA 3DD5A 3IGFA 5DSTA 1WZ2A 4BP3A 2F55A 4QGAA 3VPFA 3S1SA 4REQA 2GD2A 4UASA 3V2GA 4UTVA 1FFXB 1FBNA 2P2DA 1X1TA 5AW4A 3G7UA 5BW4A 4N48A 1JHQA 2GNPA 4B5LA 1LK5A 4P54A 4JT8A 4UUMA 2RCYA 4CCWA 4MVJA 4DA9A 4E1VA 2CHEA 1U2SA 1MB0A 3QLEA 1RWBA 1DS6A 1Z4MA 4QECA 1V4VA 2X6TA 4YJFA 3OF5A 4JYCA 1G2OA 3WMXA 3HN7A 2BGIA 4G8JA 1KYXA 2E5WA 3AW9A 4NP6A 3I01M 3K0CA 5HMLA 4BU0A 2WOJA 3EIEA 3TF5A 1DUVG 1JFVA 4MDFA 2OOSA 4HMPA 5IWAB 3TB6A 5JATA 3ERCA 2J0SA 3LVQE 1YR1A 3PUZA 4X84A 3SEZA 2UAGA 2QAGC 3V2UA 1KQPA 4Q4CA 1S2GA 3BZWA 3KQTA 4WKOA 3PDHA 5LDDC 2DEUA 3UJ9A 2FOIA 4YNBA 3L1JA 3W2EA 5DNDA 3II6X 4XE5A 4P4SB 2XDYA 1LUAA 3TSWA 4EY4A 5BSWA 1KEEA 2OORC 2GEDA 2BR5A 1YJCA 2B4AA 1PR6A 3G68A 4OHZA 3HWWA 3BJIC 4KMMA 1PR2A 2FXVA 1N2HA 1Y6JA 4YJDA 3QI7A 4GVPA 5JAQA 1WB4A 5ALYA 5DX1A 3M3DA 4E33A 5JMWA 1FBTA 1P5JA 2NPFA 3C4JA 5KU1A 1FSZA 1ZD4A 3QXSA 4NYIR 1X1AA 3CMCO 3ROQA 1ZI6A 1NT2A 2GARA 3FZQA 3HSKA 1ENZA 3B1FA 1G8SA 1R15A 2R1ZA 4BPBA 3KB2A 1RM0A 3SU8A 2IGTA 1Z83A 1XCPA 2ZAGA 3E61A 3GAFA 1PQYA 4CLXA 4Q4DA 1Q0HA 1W9HA 2L0XA 4E32A 2I76A 4X1IB 2OAEA 2EBFX 2YWJA 1B41A 4RHEA 4KXFB 4G37A 3FYTA 3PNMA 2OUIA 2C94A 1LZKA 4R2KA 1PRYA 4NBTA 4OUKX 3RARA 4BVHA 4ZZ3A 5AVXA 1OCEA 3HHPA 5C1IA 5EJAA 5KNLA 1RPNA 2GPWA 3AZQA 4KEAA 6Q21A 3ESYA 1XWWA 4PS0A 5HIKA 2X9NA 4CPDA 3LWDA 3O8BA 4DJAA 4YI5A 3ENZA 3FYSA 2IXDA 4U7HA 1I24A 3IESA 2C99A 5JANA 5KNCD 2MR5A 1E9RA 1BE1A 4RFLA 5NLLA 1P9RA 1TYDE 1TTTA 4LXUA 1RQRA 4FUTA 3P0JA 4ZFNA 2YN4A 1T8TA 3VR4A 4K9RA 1KJNA 1RR6A 1IY2A 1MJHA 3B6MA 1LU9A 2IZ0A 3HA2A 3BJRA 3I6IA 1E60A 2VO1A 4RA6B 3UT6A 1RSZA 4BLUA 2G40A 2YIJA 3TKYA 5K6AC 3T3OA 3K70C 4LHXA 1T4GA 1E77A 1XVVA 1YA8A 1MRSA 3OM1A 4WZZA 1NX6A 2Y05A 3MELA 2IDKA 3O3OB 3OOEA 4QXMA 4RSHA 4ZEXA 4FP9A 4GSLA 2WT8A 3VOBA 4P3YA 4EGCB 4MV7A 1LBTA 2XB4A 5EQJB 2GPNA 4NBNA 4D56A 3KUUA 4BN0A 4I1VA 4ZVMA 1DO2A 3UA4A 2IYZA 1AZTA 2TMDA 3LCMA 1TFRA 4PYQA 2XF8A 3RUPA 3KTOA 2WD8A 2XT9A 2WM3A 5LPNA 4ZRMA 4K9DA 4UFOA 4DMMA 1KO7A 1V5IA 1OILA 2UYHA 1OAOA 2P4SA 3H3FA 4ZANA 5F1PA 3ROGA 1SU7A 2N3ZA 1JLLA 2B7LA 4HLUA 5D01A 3PC7A 1N78A 2MHCA 2WKWA 4JH0A 2DHCA 2FEAA 4M7WA 1RC8A 2H4HA 5JC1A 4N8EA 4LFBB 3AUAA 4EFNA 4MR7B 3FDJA 4QRDA 4Z53A 2OKCA 1AA6A 2B61A 2HT6A 3SGLA 2BL4A 3O9ZA 4CJXA 5D5HA 4RORA 3F6YA 3GLSA 4MRAA 1TZKA 1IOLA 4QELA 2O9JA 4WN9A 4ZAGA 4QQRA 4P4LA 4MW1A 1PTKA 4OQZA 5C34B 1X80A 2WFLB 3JYQA 1R6UA 2PZEA 1B2LA 3NOOA 4JJAA 4ZGBA 1NSYA 3NNDA 5DXJA 2D5AA 3I6QA 4ZV4A 1N0IA 4QULA 1CR6A 3LUJA 5A7HA 1ESEA 1B7GO 5BXQC 3L7NA 3LV8A 1CDZA 2HSDA 3JRNA 4RACA 3NANA 3AETA 4P0QB 2DWOA 4QIHA 1V11B 4RABA 2IPLA 3KS9A 4UHDA 1WDWB 3UUFA 3AFIA 2XYGA 5EE9A 1DBIA 1Q1NA 4OAQA 1AG9A 4EHDA 3OLYA 1QHIA 5JMTA 2VDOB 1FDVA 4CM1A 1C0PA 4E5UA 2V55B 5HA5A 2I1WA 3SKYA 2DPXA 3D6FA 1E94E 1SAYA 3D8SA 1ISSA 3BZUA 3L0DA 4XTRA 4TWRA 3X0DA 3F96A 3EDCA 5I5GA 3TGPA 3U44B 4PRLA 1USGA 1FVFA 4F72A 3ABIA 4FNMA 1E9BA 4IXWA 4PG6A 4QE3A 3KZXA 4LZZA 3CJTA 2XMGA 3GAMA 1GITA 4LMRA 2B35A 1IQRA 2GHTA 4ZQCB 4BLQA 1T35A 2XAUA 1J21A 1VHDA 3K5IA 3ETHA 3FA2A 3CLUD 2H4ZA 3AY3A 1FNCA 3PA6A 4M88A 1FUIA 3ADKA 1Z0KA 1V8ZA 4CM5A 1D2AA 3RAEC 1KEZA 1R2QA 1JDPA 4X92A 2RAPA 5F2EA 3S2UA 3U48A 1WMBA 3UJNA 4QJ4A 1JQAA 4MMZB 1PDVA 2NVWA 2D5CA 1NBEA 4PANA 3NT5A 4QPNA 5A6SB 1SHZA 4LGVA 1Z73A 1N2CB 1PKEA 1YZUA 3B1KA 3NKFA 3OBIA 4I19A 4KPUA 4N12A 4WLNA 4GXNA 1T3TA 1U8AA 4FWBA 1XZEA 3RFTA 2XB9A 1EUZA 4JI8B 4CLHA 4AXBA 4FYVA 4NJMB 4NYMQ 4L5CA 3T99A 3GJ7A 1FDSA 1FUKA 4OYRA 3MIIA 2AG1A 3WIOA 4A03A 3WLQA 3B78A 4UE2A 3TIGA 3UAGA 2CJXA 5KOHA 2ZRHA 2ZRPA 2O59A 4IF6A 4IPTA 2PZKA 4QNMA 3ZVRA 3NQ41 3HU5A 1RFLA 1SUPA 4AO8A 2I7TA 2XUHA 4YQEA 3K1JA 2IDJA 3N6XA 2XZDA 1QMGA 4C6RA 2CDBA 3Q7RA 3C1UA 3ORSA 4J49A 4IILA 4JV5B 5LB2A 5DIZA 4X44A 4D8WA 1U7XA 4MQ4A 3WL6A 3CNNA 2OHGA 3S6JA 1KARA 2OGSA 1CUSA 2DT8A 4IIJB 1AO0A 4CM4A 4MQBA 5IT0A 1YDFA 1ISPA 3K2QA 4D6YA 4JB2A 1DAKA 4KXQA 1QCCA 1DJPA 5CIQA 5CVTA 2EV9A 3LQYA 4MS3A 1W0JD 3V8VA 3P19A 1YZYA 4IQ4A 1ECPA 1YKGA 2P9ZA 4R1SA 2GRJA 1F14A 3D3EA 1ZGCA 2DPGA 4LE1A 4J0QA 1VLLA 3UJDA 1G8YA 1H5QA 1RABA 3HNOA 2IV7A 5U1PA 2JGDA 3ESBA 3FI0A 4JBHA 5DHPA 1U2GC 4IH1A 1I3KA 3PHIA 1MRNA 5F1KA 3ZE2B 2HHJA 3FI9A 3ZNPA 4DUGD 5J1TB 1UPXA 2DMRA 2C9YA 1N6HA 2VP9A 3HP4A 4RFVA 3F97A 1AZSC 5TPWA 1UPTA 2CLCX 3FVWA 3PXDA 3GEGA 3VZRA 2BLNA 5E3JA 1SC6A 4R0NA 4BKQA 3PHJA 4FWTA 3Q5EA 2ZIXB 3RB8A 5K4AA 2PH1A 3OJCA 3B1YA 3A3KA 3I83A 4RZUA 1ZFNA 3TXAA 1VJDA 1SC9A 5GGXA 5M3BA 1I0IA 1BXRA 1H4TA 3WLEA 1BMFA 2XRYA 2JAHA 4WK2B 3E2PA 4LY9A 1Q57A 2C0CA 3O8LA 4QGHA 3QA3E 4HPJB 2G04A 1LNQA 2IY9A 3A8TA 2QAIA 3NTXA 1L5KA 2QP4A 1CPYA 3JQCA 3ICQB 4F3NA 4KYTA 1BE0A 1P5ZB 4NATA 3SK0A 3N86A 4IGFA 3FPLA 1NC3A 3D8HA 2ZRDA 1RRFA 2WIKA 3W5CA 4Q7EA 4BP9A 1V6CA 2BUCA 1O9BA 4O4JB 5BUCA 1I4TD 1FNDA 4N3AA 5E8RA 1OTHA 1NOJA 3WAKA 5CT6A 3WLPA 4B7UA 4OREX 4B3FX 1P33A 3W5DA 1LSSA 3DH0A 3FUWA 3I30X 2CF5A 4LY3A 5CHYA 3BDVA 3WK7A 4DG8A 3NBAA 3GLHE 5GQSA 4KRFA 4L74A 4EYKA 4XCXA 4KQHA 2NU6B 3EGEA 1Y4SA 4GLFA 8ABPA 3TDMA 2VJPA 1F1JA 3TQCA 2J3KA 1UJ6A 3W7VA 4DAEA 2QU8A 5LP6A 2IC5A 2YYAA 3ZE7A 2ARKA 2I6UA 4MIEA 4P22A 3IQZA 1XIVA 4Q3EA 3WGHA 3TQFA 4YASA 1X80B 2X14A 2ZIUB 2GN1A 3IIEA 1ESNA 4F1WA 3AJEA 3ER8A 2PD3A 2ACEA 5K05A 1E58A 1UBRS 4JJ4A 4B82A 2FEPA 4HS4A 3E1SA 1ZJ4A 5GONB 4BO8A 5I7WA 5EXEA 1LPPA 3X1KA 5JISA 2MSLA 5LQDA 1VJTA 2MWMA 1OAKA 3PGLA 1U3WA 1XQXA 4JGGA 3JV7A 4MVJH 1ZJ6A 3PG5A 5E4TA 2H11A 4GP6A 2FKAA 1NP6A 2JANA 2RK4A 4YCDA 2GXUA 2YUIA 3BDAA 4YQFA 5IJWA 5EHQA 4NZMA 1P19A 1QYXA 2B3DA 1U28C 4HAUA 2PFGA 2RG1A 4FCVA 3QM1A 1R5BA 3VYUB 1S7GA 2Y2UA 1KJ9A 1SVMA 2YMMA 1WPQA 1ZNWA 4ZARA 3SZMA 5BN5B 1S01A 1FNSA 1XDDA 5CJ2A 5G1OA 2P9FA 3BF7A 5E9QA 3HACA 3OG9A 4I8XA 1P73A 1NLMA 1QVWA 1CERA 1HF3A 4IF4A 4GP9A 4RTQA 3IOYA 1ZYUA 4TL8A 5CA1A 5A71A 5I7VA 1ZHHA 1PQUA 4EL0A 3SLRA 5JSZB 3QOYA 2F62A 4MHOA 1YCGA 3DBHA 3MQ4A 4MYTA 1KETA 3E22B 1B8VA 2HYDA 3GJ3A 1KERA 3LOPA 4OXRA 4DZRA 3F6SA 4FDVA 4Q93A 4RVGA 1ZJYA 4NCKA 3A14A 3OMLA 3CVUA 2IX9A 1HV8A 2ECQA 2IZ6A 2RFLA 2PVPA 4ISCA 1N6NA 4WW0A 4YJGA 4HJRA 1U7TA 2VF8A 3VNQA 5B3AA 5KHOC 3VMFA 4EGSA 1EFDN 4RDCA 1NQWA 1P2FA 3GPBA 2GUWA 4LY0A 5JW6A 2BGGA 3AYZB 2BFCB 1UKYA 4KPYA 5IHXA 1ORDA 3QV1A 3CUUA 4FBGA 4D5GA 3PL5A 2PMBA 5YASA 4LEIA 1D0VA 1YRAA 3RSZA 1GCAA 1OYVA 4BNVA 3S5JA 1M7GA 4NECA 1BGVA 5CEEA 1WCXA 2OBLA 4G0UA 2IOHA 1ZS9A 3RSGA 4MR9A 3U5ZB 2WWGA 1NV9A 3OUZA 3LPCA 2V5AA 4MLPA 3DL2A 4QPJC 2AOUB 1EA5A 2H06A 3SICE 4J0EA 3LKVA 3D4BA 3OZVA 4B6JA 1OV4A 1RT9A 2J48A 2VPXA 2ODWA 1YUNA 2NQTA 3FG9A 2RAUA 2CYBA 5K3FA 4ASUD 1X9GA 1AD2A 1Z15A 3VZPA 3RRXA 5LOVF 2IHNA 3DBIA 1ZUHA 2EX4A 4KR2A 4MLCA 2R2AA 3A3OA 5LDHA 1ZIOA 1I2CA 1I10A 1PL0A 3CLTC 4LSZA 3IFSA 4ZVPA 1WPGA 1KI1A 2JGNA 4TL6A 1Q3KA 4UHBA 1GGJA 4MS3B 1OBVA 2ETVA 2WYWA 1RAIA 3BXHA 3TBKA 4FHGA 3SS7X 2BEKA 4G8DA 3QNUA 2PX4A 2BH9A 4JGIA 2ZJ5A 1IHYA 3NDJA 2NO4A 4UATA 1NT4A 2PJDA 3EUFA 3F74A 4ZVTA 3RREA 3RT1A 4DGSA 4Z51A 3NBZC 5JT1A 5T41A 4II2A 3HADA 1J8QA 3U1TA 5CD9A 4HDRA 4RWEA 5CH5A 4BZXA 1U0GA 3VHXB 2B5WA 1KFJB 2FMIA 1Y5IA 3NTUA 3ZY4A 2C2OA 3L4JA 4MUXA 3IOCA 1V3UA 4RJIA 1VG8A 2VDJA 5DYNA 1FJHA 1PBTA 3I9JA 3U1BA 2JFPA 2ZP1A 3ZWVA 2ZRAA 4Q6BA 3T06B 5KNCH 3MD0A 2Q8NA 1NURA 1KZ7B 1H6DA 3H04A 2D7CA 3NG1A 2CV0A 4JUBA 2E5FA 5E6SB 4F11A 3OIWA 1UBUS 1BE6A 2WT9A 2MT9A 3ZY6A 2FFJA 1I5EA 3I2JA 3L7MA 5G4KB 3QEBZ 1WY7A 1N6PA 3O82A 3K9QO 4IM7A 1MLDA 3BICA 5LLTA 1D7AA 1NBOA 2GVDC 2ZM5A 4MI9A 2W4QA 2A4KA 3D0QA 3I1FA 1R16A 4IDDA 1EUCB 1STOA 3ICOA 2BOVA 4YRLA 3TIVA 4EA8A 1N5IA 1RKXA 1UK6A 1Z88A 3EFBA 5LOVA 1O94A 2PL5A 3N59A 4TV8B 2Z3VA 2O8DA 3KDAA 4FHZA 1KI3A 1GKIA 2JGMA 1IK6A 1U0TA 3IBCA 4R2HA 4V03A 1RPJA 2X77A 3EB9A 3R7DA 1PK9A 5TS3A 4CGYA 4IJMA 4MJXA 3ICWA 1I1QB 1I80A 3QA9A 4EG0A 1XKQA 2FVYA 3CUTA 5D3MB 1XG5A 5FOUA 4C4AA 3KJGA 1F8FA 2XUAA 4RBNA 2ONJA 2PGNA 2N1MA 1IZ7A 3OPXA 1KAEA 3QYJA 1NI5A 2Q0SA 4ZI7B 2ES4A 3UMFA 4DQDA 3KCQA 1W76A 3DE0X 3MGGA 4X24A 3VPAA 2O3SA 1EK5A 2HH9A 2OHHA 2M6KA 4EG4A 1FMJA 1BGXT 3ZE9A 1XE3A 4GICA 4L8GA 3LCUA 5DWQA 2F8LA 3N2GB 1TYBE 1IBCA 1J5EB 3I1JA 4N54A 5FBLB 3EG9A 3MWLA 3GLHA 4QU8A 1SMKA 3O92A 4FTWA 4NDNE 1QB7A 5JO0A 1CRLA 1QGZA 1DBRA 2Q3DA 2VP2A 1TT7A 3MAJA 4JLOA 4DCGA 9ABPA 2QD2A 2C07A 3B2NA 2PCLA 1TRKA 4OQPA 4XPIA 3EHDA 4DRXA 5K3FB 5GP1A 4HNUA 2EFGA 2PBZA 1CK4A 1YDHA 1B6GA 1TM2A 2CMFA 2J9ZB 4C4YA 1T2FA 4YI3A 2BAGA 2AG6A 4OL9A 3ZGOA 1V1RA 3FKQA 3QKTA 3SC4A 2W48A 1XA4A 3DA8A 1U9JA 1QTNA 4URHA 2XW6A 2HF7A 1QH0A 1H8ED 1W49A 2VDLB 3OAAD 4HPXB 4INZA 1V1JA 3HDHA 1VKJA 4GGMX 1PFWA 4G1VA 4DPMA 2ZU0C 3AVVA 4X90A 5CMLA 1KOGA 1FLAA 2R8ZA 1K3UB 3JQ7A 1DE0A 4HDNA 2CV2A 2G67A 3S2EA 3U09A 1IFXA 4TMVA 3BYZA 5FLXA 2B36A 4KN6A 3VU9A 3ZHBA 3DCYA 3OFKA 4KFRA 1WSDA 4Q05A 1XD9A 1R8XA 4TGLA 2WD7A 5C8XA 4ZVNA 3W9UA 1AU9A 1Z47A 1CLUA 1DUIA 2ZGVA 3AVPA 3H4TA 3NEYA 4IICA 4XB6B 2ZUDA 1MPTA 2EP7A 1XELA 4C2AA 1RYFA 4BB5A 1TKCA 2FZLA 1USUA 2Q2VA 5MHTA 1NVTA 3K6RA 1O95D 3D4OA 1E1QA 4CWAA 4RTLA 4BQIA 1APBA 3NDRA 1C0LA 2BF4A 5FB3A 1RJGA 5AI4A 2ATEA 2JGIA 3BGSA 3G1TA 4EZBA 3TO5A 1L8LA 3BX1A 4ARVA 4E22A 4XM2A 5H5JA 5JR3A 1MABA 3NEAA 4WLOA 4G5HA 1LI7A 5FI3A 1ORIA 2OB1A 2XMCA 1T3SA 1WVIA 3FCAA 1ENPA 3LZDA 3PCXA 5CTAA 1JG7A 1OXXK 2D0DA 3Q5DA 4YQZA 5HF6A 1K97A 1NP7A 3JD3A 3KSRA 4CG3A 5LP6F 1ATIA 3EA4A 4IIHA 1BVUA 1K0FA 2W6JD 5FO1A 3TX6A 5K3EA 1DSSG 2ZRMA 5FNVB 3OLWA 5DBIA 5IZCA 1TVCA 3NX4A 5FBVB 1EZ1A 5JQWA 1XCBA 2AN3A 4DMGA 1VZ3A 1B26A 2I4RA 3V00A 3TMKA 5C1DA 2I7XA 2QEQA 2Y0EA 4REMA 1T2AA 3BQMB 4Y8VA 3P0IA 3DS8A 5KPJA 3C74A 4KFUA 3MINB 4ZOEA 3LW8A 1SXPA 3VSCA 1CUVA 3AL2A 3MTJA 3QNMA 5KCZA 1R8YA 1EA7A 3Q8WA 1YZQA 3EFOA 3PTAA 2EW1A 3RTGA 4P4GA 3CNHA 5FWDA 1BYIA 2J46A 5GY7A 2C8LA 1NFQA 2IA5A 3HKDB 3N2NA 1ZGZA 3RTEA 4J16A 3F7TA 2HTEA 3AT1A 5AKXA 2GM3A 2HWXA 4HN4B 3WGYA 4ZO9A 4Z9BA 3T7SA 3BHJA 2FCAA 4K1XA 3OOSA 1JVNA 1QP4A 5HRCA 4MAFA 1GILA 4FOSA 3EFOB 4PLHA 5DO9A 2I4OA 3RC3A 4MTLA 3A4YA 3PITA 4JLWA 1L5RA 3HCOA 3FFXA 3KKZA 5B3JC 2IHZA 4XJSA 1AHIA 3QX8A 6CHYA 4JIMA 2Q3HA 4PGGA 5LA6A 2JA2A 1U2EA 4MUHA 4B4UA 3A4VA 2OESA 6YASA 1BWPA 4KKXB 3CY6A 4J03A 4M6WA 4IDFA 4WNIA 5P21A 2M98A 1WW2A 3BH7A 4EKNB 5KTOA 5KYGA 1P6XA 2JCBA 1SU4A 2OBNA 3L9XA 4QDOA 2VA8A 3ZI4A 5AW1A 1Z0SA 2H2FA 2JFWA 1UC4B 2W7TA 3ABQB 4XARA 1XMQB 1L8XA 1ZXXA 3LM8A 5E2BA 3IX7A 2RHWA 3SJ7A 2SCUB 3OIUA 3E7DA 3IVCA 4BC1A 4LRTB 4ENQA 3CEMA 3G6KA 2F3PA 4DIKA 2QX4A 3C1OA 4A73A 2C20A 2QZPA 3ELYA 4LWZA 3IODA 3HKCA 3ZNOA 4Z4EA 2AL7A 4HFMA 3WMGA 1N2JA 2C4WA 2RIPA 4FNGA 4WI1A 3HCDA 4G0PA 4Q19A 3DV9A 1NLZA 2E85A 3NORA 4YRSA 5IW8A 3RBVA 1OFTA 3OZEA 4HUQA 3ZWBA 4YX9A 5B3KA 3A4NA 4MPDA 3MOGA 4MV6A 2VATA 4QPPA 3TD9A 4DWJA 4IGKA 4PG8A 3E9DA 3P1JA 4EHIA 4PBTA 1UFRA 4WKBA 3UT5A 1MZPA 3DONA 3KK0A 3Q3JB 3T5AA 1GN8A 2Q6VA 2R6DA 5K51A 4BKOA 4ZDIA 2AN5A 4CR6A 2Y67A 4I8DA 3QJYA 1JSXA 3IP6A 5IC5A 1BFKA 4DREA 1AKTA 4RTPA 4OJTA 4MWGA 3DD1A 3UZUA 4A26A 4JJIA 2O8BA 3UO8B 2Q6LA 4U9IS 4AECA 4B44A 2Q49A 2O1SA 1KZHA 2AS0A 3OLZA 4G5XA 2HSGA 3DW3X 2CXUA 2P2SA 3WV4A 2VHQA 1H9AA 2BP7B 3ANMA 1SWVA 2CLDX 3LL7A 3TPFA 3F3YA 2JBAA 2QN7A 2PXXA 2Y1XA 3BE6A 3G2PA 3IT3A 3QXGA 2GVZC 2F8MA 4HWOA 4IJKA 3UKDA 4BNZA 5AUOB 5D51S 1NMSA 2I0FA 4B85A 5A6VA 4DCNA 3I37X 4HAVA 3L84A 3U37A 2JIQA 1GZ3A 3CUWA 3JATB 1JKXA 1WHSA 2B0JA 3OWHA 2P1ZA 1ZLXA 4JP3A 3V4LA 1K4YA 4XDYA 3ZWYA 4IFIA 3GL9A 2R6JA 2YZ2A 1FDTA 2A5LA 4K6CA 1ZK0A 3H2ZA 1N57A 2PWYA 4ZA2A 1NVBA 5FQOA 3HKDA 2IUFA 2VSFA 5JQGF 3QKSB 3Q9LA 4GOXA 2BFBB 2GXSA 3MS2A 3OZIA 4HNAA 3DWFA 4GMFA 2Q0XA 4NL4H 4G5FA 5LYYA 1KAOA 1RLMA 1A8SA 1H05A 3CF4G 3MS7A 4M1ZA 4UTZA 2EWWA 3C1AA 4PX3A 3U7QA 4BZPA 3QK7A 3BMNA 2E0IA 4F9TA 4BB6A 5JNVA 1AKVA 3IP7A 1X7HA 4MRMB 1L7MA 1JQDA 3IRUA 4N4AA 2CLIB 2F3TA 3FVRA 4KO1S 1PN3A 4IOLA 1UOEA 4XGQA 4B17A 4Z1MA 5HCUA 4NLLA 2H57A 1Z0UA 2P65A 1F6BA 2ON6A 3FDZB 4Y9DA 1ULZA 5DHFA 4DLVA 3TD6A 1THMA 3L46A 2WJJA 2ZAIA 5EZYA 1DBSA 3E3NA 3TEJA 3IMKA 1XZBA 5I4CA 2DQZA 1L5FA 3HY4A 4YT5A 1S02A 1O97D 3L77A 4RKEA 2B1JA 2D8MA 3B6JA 3ZE6A 3LZCA 1XAIA 1ITZA 2GD6A 2D1QA 3X2SA 1V0JA 3R5XA 5KQRA 2BTEA 4UUPA 1JAIA 1Z35A 3TVDA 2G0TA 4JUIA 1WP9A 1Z34A 4YJHA 1Z13A 3DDSA 4YAKA 4G67A 5J2UB 1IB0A 4XVUA 1GM5A 1P8JA 2ADOA 2EEZA 2XOXA 4HMQA 2WB2A 4A0FA 5CB4A 1TF2A 2VPTA 1YS1X 4J1TC 1V25A 5FPHA 1EJ0A 2QF7A 1P4GA 2YJZA 3KKEA 4YP6A 1XT6A 3RUEA 4DW8A 1JLHA 3VYSB 3B53X 4Q7QA 1QZXA 1KS9A 2WZBA 3IOMA 4I1RA 5T8KC 1KZGB 2XNCA 3MCTA 4WSOA 3TCNA 3V32A 2JFVA 1XCJA 5DE3A 3WP0A 3KTAA 4ZU1X 3T8YA 4AY5A 1CNEA 1PR5A 1Q74A 2NG1A 1F12A 4ZVOA 2EW2A 2IZOA 3GLFE 2OXRA 3C8DA 2E1RA 3AR5A 4WL0A 1HTWA 2C9ZA 3MAGA 3TPZA 4KBYA 2O2SA 3KRTA 1XRLA 3KE9A 2WIGA 4AY3A 1DC8A 1D3AA 2H59A 2LUOA 3NWBA 3JR7A 1LLDA 2PYDA 4G09A 3A1CA 4KLRA 4AJ9A 4CCYA 2J6HA 4H77A 4JGBA 3KZKA 4JVSB 2P6MA 3SBXA 4B43A 3G59A 1L7OA 1NJ6A 4BATA 2PJZA 4PXAA 1LTQA 3CW9A 2NU8A 1WZNA 5BV8A 3MUEA 4OGWA 3WFJA 5IM4F 4AP6A 3S8YA 4ZK6A 4MMYB 5JALA 1QX3A 2W2XA 4EAQA 1KH2A 1QPBA 2FZCA 3NYIA 4BYGA 3ZQJA 1ZGHA 4Y9SA 3ZCTA 1GL7A 1SXJE 5DBHX 4DF3A 3H4MA 5FADA 5CURA 1FJ2A 1XLUA 2QM7A 2XVXA 1VLMA 5CDHA 1IHOA 4UU1A 3SY8A 5EWLA 3S4YA 4AJNA 5JNLA 3FHCB 3GUVA 5KYVA 1VJ1A 4FGWA 2ZBEA 5KWJA 1ZOIA 3ZHVA 3Q3HA 4O2LA 2JJYA 5KTRA 1MOZA 3QVJA 5L51A 1JP7A 3TIFA 1OIXA 2VWPA 2O7VA 4WAUA 5THKA 4D7AA 2RC5A 3I6YA 2DPLA 5IBPA 4CEHB 2JB9A 3VKWA 4XEUA 1SBTA 2AEEA 3IUEA 4NONA 3KQUA 4M0EA 1GHTA 2IPOA 3RFVA 2HHCA 2W93A 4R2LA 3BTOA 4NNJA 4G0WA 4KBFA 1XTKA 3LBFA 1U81A 3GFPA 4W5HA 4KU4A 4C04A 3PEWA 4UQOA 4BMVA 2H2HA 1C7ZA 1EHCA 2W6ID 3PWTA 2FHSA 1WCWA 4TZTA 2CZCA 3R7WA 4CYMA 1YOVA 2IS2A 1I6MA 1K2VN 2P67A 2R4TA 2QW8A 4FWIB 4YR9A 4O2BF 4TTVA 1M7BA 5EOVA 4US0R 4IRXA 1U4SA 3R5SA 4KQXA 3KVOA 4UCQA 1HFWA 2AKAB 3WGGA 3ZHTA 4KAFA 2SKCA 3OLVA 4DM3A 1AF4A 1MJ5A 2G8LA 2GN8A 3C6ZA 1XTIA 1HG1A 3AG5A 5IM4A 3OF3A 1FFWA 4U6SA 4X5OA 3MIZA 2OLEA 3FMOB 1RXUA 4KI7A 1SKAA 1RWOA 3E8XA 4TTJA 2VP6A 2FPMA 1PZNA 3I9V6 5TMDA 3HKBA 2NZ8A 3AJDA 1FNNA 1QGDA 1ZZGA 2IXGA 3RIGA 1U4NA 3TNFA 1ZGAA 4MQEA 1E92A 1V5GA 1WWKA 4JLDA 1T9GR 1IJBA 5COQA 3D59A 5DOVA 4N9QA 2EVWX 3GARA 1AKEA 1NVMB 1PZFA 2AOVA 2B20A 1Q7GA 3GDOA 4MB6A 4CHTA 5JAMA 4LV8B 1EFPB 1LJLA 1W0KD 3IT1A 4FKMA 4KK4A 1FUUA 4KQWA 4BGUA 5JS7A 3W8FA 1FYEA 1P9WA 3I2FA 4HOYA 4YV2A 2XWJI 1OWOA 2HGSA 1PGOA 2YRXA 2XLBA 3B7WA 3GJQA 3IUSA 3JQAB 1ZJJA 5EQFA 3VYRB 2Z2XA 3PUYA 4A0HA 2BDUA 2V54A 3JYOA 4H7KA 5LUAA 3TW6A 4RKRA 2Y0CA 3BD7A 3UGQA 3RIHA 1ZG3A 1J09A 3E9EA 3UQYS 3P96A 2VXCA 4RNCA 1HE8B 3IPAA 2H1CA 3EVTA 1D6NA 2IF2A 1TAUA 3OT1B 4IGEA 5E1MA 4LHEA 2HMUA 3GRKA 3RAJA 3ZOZA 5JU6A 2A6PA 2IU4A 1N2BA 2IYOA 4FD3A 4O2BA 4R3WA 4XJVA 1HBJA 4WFQA 1D6SA 1JEOA 4Y6LA 4YJ3F 1Z29A 5DEIA 1PWXA 3NJRA 4Q1CA 3UW3A 4YRBA 5L6LB 1K6XA 2X40A 3PCRB 4RVFA 3D7RA 1TVMA 1TYEB 1QONA 1U2DA 3TLZA 3NDIA 1NJ5A 3EPLA 5H0IA 5I7EA 5GJBA 3GUYA 2EHDA 3QZUA 4PRYA 1I7PA 1EUQA 1VYVA 1RI2A 2QR3A 3L8MA 3WX0A 1I0LA 3H0CA 1PWZA 1RWMA 2WD7B 4G0QA 4OUDB 4B4VA 4D8VA 3JZMA 1ULHA 4D9NA 2V6BA 2G08A 1UODA 2XPCA 2CNWA 1H2ZA 3PXBA 1R6AA 3DJYA 3L6RA 4CEHA 3I64A 2CXQA 5ECDA 2OYCA 2A8YA 3CCFA 2Z2KA 3S2GA 5I01A 2PT7A 1BYUA 2KE5A 3A6JA 1TJ3A 3NHWA 4RPHA 2XY4A 2AUTA 1UJ4A 3GN2A 1QVAA 1XOIA 4EJFA 1T9ZA 2GHRA 4KBGA 3HZHA 1NVAA 3FOEC 4Z9AA 2FPUA 2WYUA 4JOQA 3F0TA 2OBXA 1TLFA 4Y2SA 4CHGA 3IDZA 4EA7A 4LRUA 1DKNA 3PVCA 5JD5A 4JAVC 4JMLA 4OP2A 4ZJZA 2I65A 3ANLA 1SZPA 4A6EA 5FUXA 2FMTA 3FSGA 2HHAA 3QELA 4LHSA 4KDEA 5EMKA 3OE5A 5F78A 2JJQA 3MZ0A 3GGPA 1HYBA 3MSXA 2IS6A 2DBRA 2K6GA 3ASYA 4O4LA 1XZIA 3LQ4A 2ZJ0A 3CLSD 2OV1A 1E6MA 3FTEA 5IC6A 3OFVA 5JNWA 3K0AB 3UPTA 3FNBA 2OFPA 1V8PA 4IVPA 4P3OA 2A9KA 2CXXA 4WA7A 1XX6A 3IUJA 3AVTA 4HGZA 2A88A 4C2TA 4X60A 3BBLA 4CTMA 2BHSA 2CF6A 1IZ0A 1E20A 1PR4A 1AGNA 5G4LA 5IKEA 4CI9A 1II8B 1RE1A 2XT6A 2AQ8A 1IQUA 3I04A 3A28A 2L69A 3DE5X 4KWIA 4DV1B 2NO9A 2TYSB 3DM9B 2ZCVA 2RK6A 3M34A 1WMEA 4FYWA 4K6GA 3M49A 1KDOA 4OXNA 4M87A 5EHGA 4IIFA 1DXHA 1O94D 2PGLA 4B74A 4G01B 3AG6A 4AJHA 3MD9A 1FW8A 4WBNA 1L6RA 2RGEA 3N3BC 3N8GA 5F5NA 1C9NA 3UPDA 2C4VA 3RLIA 1O9GA 2YY6A 2FMUA 3JVEA 2G0NA 1WXQA 1KVTA 3GHYA 5FLKA 4GRIA 4GOJA 5HFAA 3DOJA 3GYGA 5K8UA 1KGSA 1FE8A 1QZ3A 3LC0A 3N05A 4GMXA 3UMRA 2R6GA 4MAMA 3GRUA 1PJSA 4G5OA 3GRZA 4BMCA 4U6NA 5HXAA 3CF4A 3KIPA 3IAS6 4URWR 4XGIA 1KSFX 5EFOA 1TADA 4YYEA 1MN6A 1U5BB 2HCJB 4RK0A 1J7JA 2GRUA 2XA1A 3D0KA 4ALJA 4CUKA 2X8AA 4EG7A 5BSKA 2INGX 1O97C 3GDWA 4BDTA 4JXKA 4BOYA 3PR1A 4AX8A 1VLHA 2O0JA 2Y1OA 4JT9A 4KV7A 3OZBA 2C3PA 2ZDHA 2AVNA 4LY6A 4NBVA 5BRNA 5CR9A 1ZM2A 3SQMA 1YCDA 3CPSA 4LGYA 1QHSA 1Z5OA 3W1VA 3GJYA 4PTYA 4IMRA 1TM7E 3MERA 4IDCA 5FPPA 4PGFA 5DTJA 4C4OA 1P1BA 2QRLA 4AMZA 2VAMA 2ZSKA