3AJRA

Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMFGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
total genus 119
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ajrA00
4AJPA 3CH6A 1O0SA 4UEOA 4FN4A 4E5MA 1HDCA 3DFUA 4BNUA 3WGIA 4MDHA 1F0YA 4RF4A 2XAAA 3D0OA 4WE3A 4BNYA 4B3JA 3H8VA 4BNLA 4R5HA 4YB8A 3ZHZA 1GPDG 4DLAA 4W7IA 3KUXA 4EGFA 3T4EA 1R4NA 1LDBA 3ZWMA 2HMSA 3WG9A 4YVFA 1EUCA 1Z73A 2NV6A 3E9QA 2AMFA 3OH8A 4RPHA 5IJZA 1I5RA 2QX7A 4XX0A 5JO9A 3WXBA 2YHIA 4JJFA 1HYEA 4UVDA 4DMMA 4FOSA 1T2EA 3ZU4A 1IHYA 1PJLA 1C3VA 3ZHXA 2FMUA 4E2ZA 3ANNA 2O50A 1XR3A 3FN4A 4HFJA 4OIMA 1IZ0A 5FFFA 1KS9A 1R0SA 2ZYGA 1YL7A 4A73A 3LQFA 2C0CA 2LDXA 3DMYA 2Y1FA 1ZK3A 4KUHA 2AW5A 3DBRB 3IIEA 5KTKA 5B4TA 5L7WA 2X8LA 1N7HA 4J43A 5A4DA 2DBQA 4RO0A 1B3RA 4CMEA 3F5SA 2UV8A 2Y1CA 2NNLD 3KOUA 4FFRA 1WDLA 4J9UE 2C20A 4CODB 4KQWA 1AGNA 3R3JA 1OAAA 3UCFA 5LDHA 4ALMA 1RYDA 3GUCA 4ZU3A 4BKQA 3WFIA 2G76A 2OGUA 3ETGA 1I33A 5JMPA 3EK2A 2B37A 1HDZA 5A9RA 2D8AA 4ZQEA 4WGGA 1S7CA 1PJ3A 1ENOA 4EEXA 3WSVA 1R6DA 4YCAA 3BMQB 4CM9A 3PPIA 3JQGA 4DREA 2JD2A 3GK3A 4IJVA 4NJMB 2PD3A 3IMFA 1LLDA 3OEWA 4MPDA 4D41A 4BO5A 5AOVA 3W4IA 9LDBA 1J4AA 3NT2A 1QYXA 2R00A 2NU6A 1K0UA 1YRLA 4B4OA 2EP7A 4F46A 2YJZA 4IJUA 5C7OO 3B20A 2QYTA 3JQDA 1PZFA 2YFQA 1JWBB 2NADA 3H5RA 3PZBA 2GNAA 3VPHA 3GN1A 5KVQA 3I3OA 4XYBA 4YT2A 3B1KA 2OZPA 2D4AA 4BQPA 4IPTA 4OGWA 1XWFA 1V8BA 4IJWA 4NFSA 5A9SB 2EF1A 3H4VA 4IDCA 1EE2A 3IQDB 4W82A 4LMRA 4MIYA 5T8KA 2BFOA 1DSSG 3FR7A 3K8ZA 1OFGA 1FDVA 1NVMB 5I7EA 3NDJA 4FC7A 4FQ8A 4ALLA 4AJHA 5B4UA 5IZCA 2ZTVA 1Q0LA 2X58A 3L9WA 1V3TA 3NDRA 1LRJA 4M87A 3VPFA 4TROA 1HLDA 1GADO 4M55A 3W6UA 1AN9A 4J2OA 3LLSA 4D3SA 5GZ1A 3OJ0A 4A5OA 4RDHA 5JDIA 4Q3EA 2HK9A 3BZUA 4HKTA 4QQRA 3VZRA 3SBOA 1WP4A 4FPXA 3RUFA 2GLXA 2PLAA 4JQCA 1PGQA 1H0KA 3H7AA 3U09A 4I1IA 1XDWA 5H82A 4O5OA 4XYLA 1DIRA 5DBFA 4ZQHA 2PFGA 3DMTC 2GGSA 2FWMX 4YAKA 4YA6A 4EUEA 4J1NA 3E5MA 1EUZA 3TFQA 1M67A 5I7VA 3O4RA 3QVOA 1IZ9A 2JHGA 3L4SO 1UR5A 3FNEA 3CUKA 1YOVA 2EJWA 2B36A 1JKJA 1LA2A 3E9NA 3KYCA 3ZI0A 5DOVA 5CDYA 4EJMA 1R37A 3S1LA 5TC4A 2DUWA 3ZWBA 4CLRB 4XEHA 5AXAA 4OQZA 3AU8A 5EMHA 1BW9A 4YAEA 5HBRA 1B15A 3AK4A 4JK3A 4UULA 2IXBA 4XGIA 4BNNA 3Q9NA 1IYZA 1ZK1A 3QVSA 4KTTE 5L9AA 1D1TA 5JW6A 2X0RA 4YEDA 1FXSA 2BGKA 1K89A 5KWEA 4EBFA 3GGPA 2B0JA 3GDOA 3F5QA 5BNTA 4RZIA 3VH3A 4Z0PA 3PJFA 3KETA 3N74A 3DBVO 5EQFA 2GN6A 4XA8A 3GA0A 2I66A 1A4UA 1O9BA 1BG6A 1DAOA 3I83A 4LK3A 1OZAA 2D0IA 2GCGA 3ANMA 3C7AA 4PG4A 1NP3A 5FYDA 1VRWA 3I4FA 4Z6KA 2VRCA 3D3EA 3BMOA 4KUGA 4C7JA 3OICA 3ZWWA 3PYLA 5I7FA 1R12A 4G81A 5L3ZA 4J6FA 1V6AA 2C7GA 3PHGA 4WCFA 4XRRA 2Y05A 1E6EA 5DBIA 1O95A 1BW9B 1XU7A 4R4JA 4TZKA 4IQ0A 1RWBA 5CG1A 4L75A 1NXQA 1UDAA 4MKZA 4ZD6A 3V2UA 2D3TA 3JQAA 1R4NB 2OBNA 1F8FA 2ZTLA 3MTGA 4IXWA 1N7GA 3ADOA 5G0SA 3GQVA 2X23A 4TVOA 4CM3A 4CM8A 1F17A 3I4CA 5A03A 3AFNA 1GZ4A 2DBZA 4JNKA 3WYEA 1W73A 1D7OA 3IL2A 1KBZA 2P9EA 4GLOA 3FSRA 4OXYA 3D1LA 2QYSA 1NNUA 1V0JA 1DRWA 1RJWA 2GN4A 5CPFA 5ER9A 1VL6A 2AEFA 5JY6A 5ADHA 2B4TO 1KVQA 1DHRA 1XGKA 3LK7A 1E1MA 3E03A 5B12A 2DTDA 4BO3A 3OP4A 1H6DA 2C82A 2QZ9A 3JQEA 1ZUD1 3NGXA 3PYXA 3WDSA 5L53A 4UREA 1LLQA 1Y5RA 2FOIA 3VVCA 4MVJM 3FD8A 3KVOA 4LVCA 2VQ3A 5JCJD 2EHDA 1M76A 1SAYA 3D64A 4LRSB 1H9BA 4YRDA 3TDKA 1C0IA 1GR0A 2HRZA 2EV9A 2Z1MA 5EESA 1E3EA 1DB3A 1BRMA 2J3HA 4DIBA 3LC2O 3I6QA 4K9DA 3RC2A 4PIVA 1ENPA 3MWEB 3L4BC 2FR1A 4PRKA 3M6IA 2QZZA 3H5AA 1HKUA 3EZYA 1YXMA 4BNGA 1DXYA 4WNCA 2G5CA 5IN4A 4YXFA 1QYDA 2VUTA 1GV1A 2BKAA 3GMDA 4D43A 1DPGA 4FJ2A 3K30A 5TF4A 4B8WA 2OMEA 3NX4A 4M1QA 1Z6ZA 1PJ2A 5DULA 1D3AA 1EEHA 2YFHA 5IAAA 3EDMA 2AA3A 3PRJA 4AJOA 1X0XA 4J7UA 3BMQA 1LQUA 3KEOA 1DIGA 3HWRA 2Y1DA 4PVCA 3RBXA 4RQUA 1ARZA 4XJTA 5JDCA 5AQ1A 2G1UA 1U3UA 2YZ7A 3AI1A 4A26A 1BXGA 4DBZA 4CV0A 2VNSA 5T67A 1ZSNA 2VUUA 3LLVA 1GYRA 1J0XO 3GMSA 4IMRA 1JQBA 3UOGA 1LDGA 4NR0A 4YAIA 3IP3A 5HS6A 4AICA 3JSAA 1LEHA 2IYPA 2PK3A 2QG4A 4II3A 3HZZA 3KSDO 2Y1GA 4YAJA 2EW2A 5JC1A 1IULA 4NFYA 4RVHA 4QFDA 2FHSA 2PZMA 5AYVA 3ITDA 3KSZO 4HX5A 2NU7A 2GYYA 1GZ6A 2YUTA 2Q2WA 3WQRA 1JW9B 2EXXA 4ZHSA 2EKPA 1HL3A 1R15A 1Y81A 4ND2A 1Z82A 2VUSA 4BHTA 2EGHA 1N8KA 1P1RA 2JJYA 1EVIA 2VTDA 3QVTA 1NQOA 2JD1A 3GFBA 1MG0A 5K9ZA 4WPGA 3QV1A 4LN1A 3TJRA 3ENKA 1I30A 1B2LA 3EVNA 2C59A 2D1YA 2ZK7A 3CKYA 2JFGA 4EITA 3PQEA 3WNVA 4NFHA 1QSGA 1ZXBA 3LU1A 5HS4A 1J5PA 5HA5A 1E3IA 1PJBA 2ILTA 3HADA 2F00A 4E12A 4MJLA 4D0SA 1ZW1A 1Z75A 3INTA 4QECA 4U7WA 2NTNA 5HWSA 1P74A 4YJHB 4QO7A 1UP6A 4OMUA 1YB5A 3PI7A 2B5WA 2I65A 2VWPA 3GNTA 2QRLA 2VZ9A 3DL2A 3Q1LA 3WYBA 4B4VA 5CG2A 3B1FA 4E5NA 2HSDA 4RVUA 4D46A 2CVQA 4PLVA 4CLRA 1YVEI 1NR1A 1Z74A 1ID1A 2HMUA 3BMNB 2Z1NA 3OJEA 2IRWA 4YT5A 1ZNQO 5BSEA 4Z9YA 3OFSA 4JIGA 2EKLA 5LDGA 3TZ6A 1YOVB 1RKXA 2Q4BA 2CUKA 2X86A 2FRDA 2GN8A 4YDRA 1A9ZA 1GDHA 2X9NA 2P4QA 2BGLA 4MVJG 5KNLA 1Y8QB 2J5RA 3PIDA 4GSKA 2Q1UA 3LT2A 1GL3A 1YONA 2D5AA 4I9HA 5JY1A 5LCXA 1N9GA 3MJCA 4NBUA 8LDHA 3DZJA 1TEHA 4F6LA 3KRTA 5KJ6A 2OBYA 4R1TA 1CJCA 1HRDA 3ASUA 3UF0A 2P5YA 2PTGA 4NZ9A 1YBMA 2AQHA 4XIJA 4GKVA 4I5DA 5J23A 4URFA 2EJVA 2JCXA 3I9MA 3U4HA 3SC4A 5DNAA 4BGUA 3IUSA 5ICSA 3ZWYA 3VPGA 1WAMA 1ENZA 4LSMA 1LSSA 3JQ9A 4CLDA 3WWZA 3UCXA 2O3QA 3AUAA 4NPCA 5EINA 1GCUA 3OA2A 1IUKA 1A71A 2Y93A 4FBGA 4LW8A 4QX6A 3HN2A 3BHJA 4BO8A 2ZTMA 3Q2IA 1SCUA 1B16A 1VJTA 4MVJH 1YBVA 5KKCA 2W98A 4R41A 2X5JO 4D79A 1AXEA 3AJRA 1P1JA 1H9AA 5DCYA 4BO7A 2VWQA 3DHNA 1SEPA 1C0KA 2FN7A 3WSWA 1MLDA 2VT3A 4BO0A 6ADHA 1ISGA 4WECA 2VNAA 1VPDA 3QRWA 3EW7A 4PLWA 3PWSA 4NI5A 2BFMA 2GPTA 4WJZA 1EK6A 2NTVA 3VKUA 3PQFA 5COBA 5DP1A 3FR8A 4K6CA 1SB8A 1QG6A 4CQMB 2R6JA 4Y6RA 1BVRA 4GVLA 4QT0A 1O8CA 5F3RA 1GUFA 3GR6A 4BNKA 3QWHA 4WOJA 2XXBA 5H83A 3UCEA 3F1KA 3C7CB 2OO5A 2PKQO 5HTOA 1U7TA 1E1NA 4D3DA 1HETA 1O6ZA 5EN4A 1MX3A 3PFFA 5I7SA 4EUHA 2BI8A 4N5LA 2VZ0A 3FWNA 3NRCA 2CVZA 4FFNA 3JQCA 1NFFA 1U3TA 3U49A 2JCVA 3LC7O 1TI7A 5TGDA 1T25A 3DAGA 4DC1A 1B14A 1N92A 3O8QB 4N18A 4PG8A 3D4OA 1PGOA 3AW9A 1KY5A 4J1TA 4CUZA 1PU2A 1A7AA 2QW8A 2BH9A 4JBIA 3I9NA 4QO8A 2NVBA 1GY8A 4IDAA 5A06A 4RF2A 1XLTA 5KJ1A 4W7HA 3WICA 1QP8A 3WR5A 1GQYA 3S55A 1WWKA 4GSLA 3SLKA 1Q7BA 2HO5A 1HT0A 5DCWA 1PZHA 4BIIA 3JYNA 4CLOB 2ZQZA 3AOEC 1EFKA 2Q1TA 2X0JA 3ABIA 1X14A 3EMKA 3OMLA 5GZ6A 2BFPA 3PXXA 1Y8RB 2QRJA 5G4KB 1XA0A 4KDFA 1JVSA 1EFLA 1DJNA 1Q2XA 1Y5MA 4UUNA 1V35A 3A06A 3MWDB 4FOOA 2W8ZA 4ILKA 4OOEA 4YR9A 3E1KA 3FWZA 3JQ6A 4Q39A 1K2WA 1BDMA 1R4MB 5ER6A 3ZWXA 3ZW9A 5KVCA 2IEBA 1UXHA 1NAHA 3COSA 4P4GA 3TOXA 1U9JA 4GH5A 4K6FA 3H9QA 2WTBA 3GLQA 3DBLA 3TFOA 4E2WA 2G0TA 3EY4A 3EVTA 1GPJA 4J90A 1NQAO 1FMCA 3IJRA 2TMGA 1HWYA 2NWQA 5CAEA 3PK0A 1XKQA 3GG9A 1B8VA 3DAFA 4J4HA 3ENNA 4IJKA 2ZB7A 1T4BA 4U0JA 2B4RO 4NNJA 5HRUA 3ZHBA 1DC3A 1MG5A 3AFMA 1P44A 4WOKA 5G0UA 5IDWA 1T1SA 4KDEA 4R1SA 3A14A 1CIVA 1M66A 4NJOA 4EYEA 3GF4A 3F4LA 2I76A 1ZJZA 3D4PA 3JCZA 1NFQA 4J49A 4E33A 2W4QA 2EIHA 2Q50A 2ZCUA 1U2DA 3CEAA 3Q2KA 4YJGB 4CMKA 4MKXA 4DYVA 2CSUA 4WLEA 4OL9A 4OXNA 3RAJA 4ONEA 4U5QA 1ZXLA 1EDZA 4JBGA 3M1LA 1IPFA 5EIOA 1ONPA 4GLLA 3VH1A 4MVJD 4WCDA 4L4XA 3RCBA 1NX6A 4H3VA 4F3YA 1K6JA 4BGIA 4RVGA 1QKIA 3LSYA 4DPLA 3I9JA 3GFGA 2P2SA 4A7PA 1DLJA 2E4AA 4TKMA 2GZ2A 3QQPA 4ALKA 5EQDA 4MIEA 3K92A 2Q4EA 4B4UA 3NT4A 3S2IA 4CMCA 3UXYA 3JD1A 4RJTA 1EBUA 1HDGO 2BELA 2J5KA 3KLPX 4ZRNA 4IUYA 3TZKA 3H6KA 5BQFA 4XYGA 3ZV5A 4DBVO 2W2KA 5L7YA 2YQ5A 4OQYA 4Y9DA 3GPDG 1NBOA 4I9NA 5JAQA 1RM4A 3AOGA 4JP2A 1Z45A 1E7QA 2B4QA 5IDXA 1I10A 4J1SA 5F5NA 1ISFA 4FC6A 3ZNPA 2CY0A 1DJQA 2BI7A 5JMWA 2AHRA 1E3SA 3LYLA 1MC4A 4E5PA 5C5IA 3GVXA 4L8VA 5JS6A 3IJPA 4K1LA 1ISJA 4M54A 4MP3A 3DO5A 1BMDA 5HM8A 4R01A 5JE8A 5JBIA 1DEHA 4P4NA 1YB1A 3ICCA 1QMGA 4GX1A 4WASA 3IUPA 2FP4A 3OF2A 4OKIA 3VTFA 3NUGA 4XB2A 3H9UA 3KO8A 4FCCA 5TJHA 4YT4A 1WMAA 4BB5A 2ZQYA 4XCVA 1YWGO 4IM7A 4KTVE 1YDEA 4GPD1 3WLFA 3WS7A 1ZBQA 5BNFA 3FNFA 4YRAA 1LLUA 1A5ZA 3AI2A 4GX5A 1WW8A 4R69A 2HMTA 3G17A 4GWGA 5JLAA 4UVHA 3LC1O 4IDFA 4RLSA 1UAYA 1DFGA 1H93A 3HNPA 5G0TA 1N1EA 4ZVVA 2D5CA 2BHLA 1TB4A 2HDHA 5KCZA 1EVYA 3HB5X 5TT1A 1CF2O 2DFVA 4H15A 1YL5A 3WFJA 1PZGA 4I5EA 4BNWA 4WEQA 2DTEA 4IS2A 2E82A 5JFOA 3BYZA 2DT5A 2O3SA 3AUUA 1OMOA 4D44A 4OO3A 4IINA 2VZ8A 2YV2A 4PG7A 4AJLA 1PTJA 2OHXA 4NJMA 1WMBA 5IDYA 3P7MA 2WYVA 5KOIA 2PWZA 5T5QA 3RJ5A 3KSUA 1DDOA 3JV7A 4YJFB 4CPDA 2HCTA 3OJLA 4J0EA 2EP5A 4E6PA 2B69A 2CFCA 3GHYA 3MJTA 4PLZA 1KEUA 1BDBA 1A4IA 3BTOA 4JCOA 5LC1A 2NSDA 3GEDA 3JQAD 1GYPA 5ILGA 2IODA 2BD0A 2E6UX 4B4WA 1I01A 4FFPA 4LSWA 2J6IA 4CL8A 2FY8A 5IZ4A 4K28A 1SBYA 2HK7A 2HLPA 5L4SA 3W8DA 3FTNA 3BIOA 4BNMA 1ADGA 5JAZA 4XWYA 1LC3A 4CM4B 1BVUA 1PQPA 1P0CA 2C07A 4LISA 1ISMA 2UDPA 4IQGA 3ZWAA 2I5PO 3V1YA 1WDMA 4XQCA 3BMOB 4CMGA 4FDAA 1Y6JA 4L0QA 4R9SA 3U5TA 1YQGA 4RQTA 1YBAA 3BA1A 1XHLA 2YHIB 4AL4A 1B7GO 4CM8B 3LT4A 1GAEO 1NPYA 1UZMA 3DBHA 3EZLA 1F06A 3EHEA 1J6UA 1DAPA 1MXHA 1NHWA 1NR7A 2PD4A 1QRRA 4FR5A 5BT9A 1F12A 1NWCA 4FW8A 4PN3A 1DFHA 5FI3A 2FPGA 3JQ8B 3MEQA 1K6IA 3I5MA 4J7XA 1MP0A 1WZIA 1DFIA 1W8DA 1LRLA 3W4KA 2Q1WA 2W2LA 4MP6A 1GQ2A 1PS9A 3WWYA 1LNQA 4DIFA 3GPIA 3VAZA 4YQZA 2AE1A 2UYYA 3GZNB 1HZJA 3KLMX 3VOSA 1T2CA 1SO8A 4XZ3A 3RUCA 4DMLA 3UICA 1SZJG 1E1KA 1I2ZA 4RPJA 4A03A 4B3HA 3G3EA 3C1OA 1I2CA 1P31A 2YV3A 1U2GA 3V1TC 4L73A 3U4IA 5T6BA 2JAHA 2POQX 2Q46A 3BTVA 3HUDA 1U1IA 1JKIA 1SC6A 2X22A 3VKVA 3AWDA 3ZNOA 1I36A 3FNGA 2J3IA 4I5GA 5H81A 3TN7A 1JAXA 1HSZA 3TSCA 2AG8A 1CEQA 1UJMA 3L6EA 4IDBA 5COAA 1VL8A 1HE4A 3PTZA 2P5UA 2WYWA 1SNYA 1GEEA 4RLHA 3RFXA 4DC0A 3UAGA 1NPTO 4J91A 1DC6A 1KYQA 3WNQA 3PYMA 1U4SA 5DOZA 3O26A 2JCYA 2I99A 3RUEA 2EKQA 3C24A 5JCXA 5AXDA 1C1XA 1C1DA 4PZCA 2OOSA 3IKTA 3DR3A 2WD7A 1X7DA 2VWGA 4Z3KA 4IDGA 4TKLA 4DLBA 4CL3A 2G82A 2GASA 3BAZA 1CYDA 1CDOA 1HE3A 2C29D 2P9GA 2V65A 2VHZA 1TVEA 2BRUA 1SOVA 2NTJA 2O4CA 1D4FA 3QE3A 1LDMA 2Y0EA 2B5VA 2WD7B 2CDAA 1A72A 3ETEA 1XQ1A 4LRTB 4ND5A 5MDHA 4BO4A 1QLHA 5F1PA 3TNLA 2WD8A 4XD2A 4Y6SA 1NVTA 4AJEA 2GN9A 1VI2A 3CMCO 1VE9A 1VC2A 4R5MA 4ZQGA 3C85A 4AG3A 4DQXA 2F1KA 2VYNA 3GVIA 3UGKA 2OFPA 5KJFA 3EAGA 5C3MA 1ZZEA 3JQGB 2WSBA 4W4TA 2PGLA 5I8ZA 3ZH2A 1ADCA 4EW6A 1HEUA 1UZNA 2O3JA 3VZQA 3WGTA 3FTPA 4J1QA 4YBZA 1UXGA 5ILOA 3QY9A 1YE3A 4IIUA 3H2SA 3B6ZA 1GEGA 3H5NA 3HDHA 1MV8A 5K6AC 1IY8A 1UAGA 2V6GA 1PL6A 3DZHA 4EI2A 4N5MA 5DBGA 2Q99A 1FDWA 2HJRA 3F4BA 2C7VA 5JYDA 3OJFA 5KIAA 3JQ9C 4YPOA 1H5QA 1QORA 4CMHA 5ENDA 4IY1A 1DHTA 1PWXA 3OA0A 1JDJA 3ONEA 4BNTA 3OQ6A 3PDUA 4GGOA 2QIOA 3ROPA 2CF6A 3QSGA 1SEVA 3TZCA 5I8WA 4NBTA 2X5OA 3INGA 1X13A 3DBRA 3GG2A 1SPXA 1VJ0A 1K3TA 4JX8A 1AHIA 3JQBC 1EQ2A 2P9CA 2VRCD 3H9GA 2DUUA 4MO2A 1P45A 2V6FA 4IBOA 2CF5A 4YAGA 3VZSA 4PG6A 1P1HA 4DYDA 1ONNA 4BV8A 4ZN6A 5CDUA 3HDJA 4CMJA 5K0ZA 4O59O 3BTUA 5DCUA 3OIDA 3DB2A 3JQ8A 4F45A 3AY7A 3D3WB 1PWZA 3RVDA 3WX0A 2ZCVA 3DC2A 1ZH8A 4TRNA 2YQ4A 9LDTA 2GR9A 3RC1A 5B37A 4AJ2A 1KERA 1NFRA 4EJ0A 1HDXA 1PJTA 1T26A 1ZCJA 2PH5A 2VWHA 4UVEA 5F1KA 3OQ1A 2DC1A 3LT0A 1R0KA 2PH3A 4A27A 4NBWA 4WEOA 4J0FA 4YJGA 5A04A 2PV7A 4U6QA 4HNHA 1FJHA 2GO1A 1NM5A 2O7QA 3RBVA 1C14A 3TQHA 4KQXA 3HQ4O 5IDQA 3RKRA 4PLGA 1HYHA 1BSVA 2X7HA 3L77A 1JAYA 4IGFA 4TRJA 3NYWA 1Y9AA 1JU9A 1LSOA 3OBBA 1N2SA 3DFZA 4QEDA 1MUUA 1MGOA 2HRBA 3GEMA 2VRBA 3LF2A 3W8FA 4XDZA 2RHCA 5CFZA 3WGYA 4E5KA 1UDBA 1ZEJA 6LDHA 1NQTA 4L4SA 5JDIC 3B1JA 3QWAA 2C2XA 4AJ4A 1MFZA 1HLPA 4PLFA 1ORRA 4WLNA 1U4OA 4Y67A 4JBHA 3E8XA 4J3FA 3IOYA 1X15A 2X9VA 3SX2A 2GDZA 4INAA 4BNZA 3OQBA 4PRLA 1E5LA 4WLUA 1R4MA 3VPSA 1C0PA 4GQAA 4RCVA 5I9NA 3K2BA 1DC4A 2HQ1A 3E9MA 1H94A 1P1KA 1ADFA 5G0VA 5JAIA 1E77A 4RVSA 2AE2A 2JKVA 1I3KA 4ZICA 1IOLA 4KZPA 4GAEA 1PQUA 4TSKA 3VVBA 4CLOA 1YH3A 1G6KA 3K31A 1ISHA 3DOCA 3PLRA 2PGJA 1G0OA 3PZRA 2O3RA 3CE6A 3RSHA 1R16A 2XF8A 3RD5A 4IIVA 1VL0A 4IZHA 3GRKA 1KOLA 3RUDA 4DWVA 2X4GA 1ZVMA 2BLLA 4YJDA 1LQTA 3WLEA 3DTYA 3WYCA 4E32A 1PJ4A 2Z95A 2UUOA 3PLNA 4R3NA 1GQQA 1L7EA 1DRVA 1GUYA 4GX2A 5BSFA 4E2YA 3ZU2A 1QXSA 4GWKA 4RGBA 2HAEA 2PR2A 4N54A 2Y0DA 3AU9A 4E4YA 4E2XA 1SB9A 1TA4A 3IDSA 3NEPX 4XQGA 1JA9A 3N58A 2DVMA 1PX0A 5L95A 1IB6A 3ZHYA 3NJ4A 1VSVA 1CQJA 4JP3A 3I9KA 3F46A 1KVUA 2PZKA 5CP8A 1EMDA 5JNLA 1L7DA 4MVJA 3OIFA 1Q0HA 4YYZA 5BSGA 4UUOA 3SXPA 1I0ZA 4D7AA 5A9SA 1YQDA 2Y67A 1DIHA 1SMKA 1NHGA 2J3KA 1T2FA 3ROMA 4MVJP 3FPCA 5G0WA 1YGYA 4R16A 3A28A 3LZ6A 5JSFA 1EVJA 3JD2A 1OC4A 1UH5A 2A9FA 4PLCA 3B70A 3SC6A 3R3SA 4CMEC 1X7HA 1KIFA 3PJEA 4OXKA 1DLIA 4NIMA 3UHAA 4AJNA 1N5DA 3P19A 2NQ8A 3F6YA 5EPOA 2WWRA 3QWFA 4BS9A 4CJXA 4FSHA 4XYMA 4DIOA 4W9NA 1GCOA 4NDNE 4BUCA 4HWKA 1JTVA 3C7DB 4BNXA 4RL6A 4UUMA 4FD3A 2V6BA 1A27A 1JVBA 1UUFA 5JCJA 3ST7A 3JQAB 3W6ZA 3UFXA 2DKNA 4B7CA 2Q3EA 4TQGA 2NM0A 1Y1PA 3NT5A 3PEFA 2IZ0A 4I5FA 5CHEA 3ZU5A 4D3FA 2CDCA 5DN9A 2FSVA 4YWJA 4R9RA 1T2AA 3R0IA 5A05A 4WCFB 4BO1A 2GRAA 4FIZA 3VH4A 4I9UA 5I9LA 1I8TA 1ZSVA 4QXMA 4AVYA 4DQVA 3KM0A 3RC9A 2H1SA 2HUNA 2VHVA 3AM3A 2YYYA 1QYVA 4H7PA 3HE3A 2AEMA 3CINA 3E5RA 3R6DA 4BGVA 4W99A 2ZKLA 5L45A 2E37A 3HFGA 2IDZA 3DZKA 4J4BA 2JFFA 3D7LA 4IS3A 1P3DA 3AUTA 3F9IA 4BMVA 4CR8A 2V6MA 1QR6A 3BMNA 2YHUA 2CZCA 1YS4A 3U9LA 4KOAA 1UXJA 4X54A 4BNIA 2Y0CA 3W8EA 5AVOA 4BO6A 1Q7CA 4JXKA 2GSDA 2PKRA 4TVBA 2NQTA 4BO2A 4XIYA 2D59A 5A02A 2Y99A 2VOJA 3VTZA 4BO9A 2EWMA 4CLXA 3D4NA 4GMFA 4JLWA 4HP8A 1T2DA 3KZVA 5A5EA 1EDOA 3ZWPA 3L6OO 2Z5LA 1WZEA 2XPCA 4FFOA 4TRRA 3V1UA 1E3LA 4XB1A 1L1FA 1XSEA 2CVOA 5TNXA 1PR3A 1E3WB 3RUAA 3VH2A 1NTOA 2G17A 2IEDA 4G5HA 2I6TA 3DEYX 4OSPA 3G79A 4M49A 4ZRMA 4OSOA 5AXCA 4HADA 4DL9A 3KYDA 1Y8RA 2VHXA 2PD6A 1XEAA 4A2CA 5JPIA 2RCYA 1PS8A 3IP1A 1H6BA 4IZIA 4YRBA 3VDQA 3QVXA 3L07A 1HYGA 3A1NA 5A3VA 3K73O 4MINA 2WE7A 4MVJE 4NU5A 1LSJA 3QIVA 4E21A 3WTBA 3E6AA 5C7IO 3ZWOA 4J9VA 4RVDA 4XJSA 1PJQA 2UVDA 3QHAA 4JN6B 4ROSA 1I32A 4MOWA 4UUPA 3WMWA 4RPKA 3FBTA 4HFMA 3TF5A 3MJ4A 1A9YA 1NYTA 3QWBA 5IN5A 5TIIA 4YJFA 2UUPA 4WLOA 1KETA 1PGNA 3MJSA 1BXGB 1DOHA 3GGGA 1BHSA 2J8ZA 3P5SA 3RUHA 4GGPA 3GZ4A 1EK5A 3RJ9A 1E6WA 1RPNA 3GAFA 1AUPA 2X0IA 4MIOA 5ENVA 1F8GA 2C5AA 2CNBA 5THKA 4B7XA 5G4LA 4E30A 4LCJA 4NK4A 2CD9A 4N7RA 5CDGA 2YDXA 4WLVA 3DOOA 4XGNA 3RU7A 1A7KA 3JQ7B 1N1GA 3TL3A 1QYWA 3H9JA 4TRMA 1LLCA 2NVUA 4FGWA 4U8GA 4BMNA 5JC8A 4II2A 5I9MA 5CEFA 2VTEA 1KEPA 1MA0A 1HF3A 4IMPA 3KYDB 3HJAA 2O23A 1LI4A 1ZJYA 3JQFC 2C54A 1NASA 4ZQBA 3Q0EA 1OBFO 4FJ0A 4MVJI 1KVSA 1LJ8A 4TWRA 3DDNA 1X1EA 4XQEA 4XKJA 4JJGA 3GVCA 3WOHA 4ZGWA 3KB6A 3MCVA 3M2PA 1Q0QA 3ANLA 1DIBA 4XDYA 2NUAA 3ICPA 4BVAA 3UKOA 1Z7BA 3KHUA 1HDRA 3V2HA 5ICMA 1ZMTA 2Q45A 1ZK0A 3QJ5A 2BMAA 3TWOA 1QYCA 2NLOA 4XR9A 3E18A 3GC6A 2O2YA 1HZZA 2GZ1A 1CETA 3GRPA 1XQ6A 2EERA 1KVTA 3ORFA 1PZEA 1AXGA 3LF1A 3EUWA 3NKLA 3UN1A 4A0SA 4BQRA 4CQMD 1PJCA 3WGQA 4CM9D 1U7HA 2H9IA 1ZO8A 4J2HA 1UXIA 4KWHA 1Y7TA 2W90A 3GN2A 1TT5B 4C4OA 2AQ8A 1ML3A 2PA3A 3DHYA 2ZIZA 3VDRA 1WPQA 3DTTA 4NMHA 3U4DA 4CM1A 4M89A 4E31A 1E3WA 1LU9A 3CZRA 3GT0A 3PHLA 1N9GB 4WLFA 5T64A 1MC5A 3S2FA 2JD0A 4CUJA 3K96A 2RHRA 3OECA 2FR8A 3RUIA 4R68A 3H9EO 1JKFA 3WBBA 3QLJA 1FDUA 3S2GA 3ZGYA 4QSMA 1ADBA 3H2ZA 3W1VA 3NV9A 2VOEA 1ENYA 5TSDA 2NU8A 3KTDA 1W0CA 3GZNA 4P8RA 2E49A 2JAPA 3AI3A 3I52A 1B8UA 2AXQA 3L0DA 4HBGA 4DGSA 2FZWA 4RVFA 1XYGA 3BMCA 3F1LA 4S3MA 4I08A 1FDTA 2A4KA 3TZHA 3GY0A 3G0OA 4JROA 5KKAA 4PLHA 2HU2A 1IL0A 4HFRA 3I23A 3OHSX 2WM3A 2XOXA 4UEJA 1GFSA 5A9TA 4CM6A 4R51A 4OYRA 2RBEA 3DBHB 3HN7A 5JDCC 2A92A 3TRIA 1PJSA 1O89A 3EYWA 4CMIA 2R00C 3WQQA 2ZJ0A 2DQ4A 1LC0A 3S8MA 5JAMA 1PL7A 1T24A 2VCYA 3HHPA 4NH4A 1DC5A 2FPPA 3R1IA 1D8AA 1C0LA 2BFAA 4CR6A 4CM4A 1EVZA 2PY6A 2ZTUA 2X1HA 5G4KA 4LCEA 3GDGA 4M8SA 1OC2A 3PGXA 4K26A 3ADPA 3C1TA 3Q6IA 3GAZA 2DU8A 3GDFA 3BTSA 1RM5A 5IFLA 3F3SA 5JYEA 1PGJA 1G1AA 4IGEA 1EQUA 4DTIA 2HMVA 4BNJA 3ITKA 2YDYA 5ITVA 5COQA 2Y66A 4L74A 1NQ5A 1X7GA 1YKFA 4W6ZA 3WGZA 4BKUA 4RF3A 1K5HA 2O48X 3JQBA 1ISIA 2IZ1A 3U3XA 4P38A 4G65A 2ZB4A 1HXHA 4R3WA 2DLDA 5U1PA 3T7EA 2I3AA 1E0DA 1W6UA 1HE2A 1ZK2A 2VN8A 3NGLA 4B7UA 4HXYA 1I2BA 3HDYA 1K6XA 3MZ0A 4OH1A 1F14A 4BKRA 4HV4A 4GX0A 4GI2A 4RORA 3DHEA 4OKNA 3GHHA 3ONDA 4UEKA 3VC7A 3T7CA 1TLTA 2GF2A 2OUIA 5TJ9A 3WQSB 3JYQA 3ZU3A 4PG5A 1EBFA 2J5QA 1NAIA 2NU9A 4D45A 3I1JA 4NU6A 5FF9A 3N7UA 4BV9A 3V2GA 2LDBA 2RH8A 3ZNQA 4ZJUA 1RM3A 3NDIA 4I8XA 4Q9NA 2ZYAA 1HSOA 3WMXA 4ID9A 3ETDA 4CQMA 3QW2A 1YB4A 2PNFA 4LVUA 3G1UA 3O8QA 2PZLA 3JYLA 1JWAB 4L76A 4WKGA 5A1TA 3HDQA 1BWSA 3U4CA 5DF1A 1HDOA 5TS3A 3ZWCA 3WGGA 2Q2QA 4BNVA 3CIFA 3I6IA 1BXKA 3I9LA 3T4XA 2H63A 4KUEA 3AM4A 1PIWA 4CQLA 3GOHA 5L4NA 3PVZA 4PLPA 4PZEA 2WE8A 3FPLA 5K6AA 2HKIA 4Y8VA 3GH3A 3OM9A 2DM6A 3GVHA 4L9RA 1ONOA 3FI9A 5JO0A 1YDWA 3E82A 2DBVO 2WEKA 4ALIA 3V5NA 1B26A 3RU9A 2IYOA 1WXDA 1U3WA 1ZK4A 1BXZA 1ULUA 2ET6A 3NTOA 1VLLA 1J49A 5GMOA 3C1AA 4E0BA 1JN0A 4OM8A 4PLYA 2E48A 4CMBA 1QLJA 5U9CA 1FDSA 3TOZA 1V3VA 4PFJA 2VYVD 2ZATA 4C7KA 3E48A 2FPIA 5TRTA 3PGJA 5G2OA 3KBOA 4EDFA 3SEFA 4Z0HO 3Q9UA 3PP8A 1Q7GA 4CR7A 1KEVA 3A4VA 3NTQA 3CTMA 1B3BA 1LUAA 1ULSA 1DRUA 1B0AA 1V3UA 4CLHA 1LXCA 4HNGA 3HFSA 4DUPA 3FNHA 3X2EA 3ZW8A 5FWNA 5F5LA 1PQWA 1I3NA 4F6CA 1FK8A 2ZYDA 4NK5A 3LT1A 4O63O 3ZNNA 5CDTA 5IXYA 3CPSA 3NJ8A 1PL8A 2PKQP 2Q1SA 4GL4A 4YT8A 5BR7A 3PDJA 1E7SA 2Y1OA 4NG5A 3RI3A 5ITWA 2X0NA 3RKUA 2PGDA 4BKOA 4BOYA 4L4RA 3QP9A 3ZV3A 7ADHA 4XR4A 3ON5A 4U6SA 5B1YA 4ND4A 5T8KC 3H3JA 3ROQA 5DP2A 3PIIA 2ZB3A 4MVJF 5AXBA 4XRGA 5KJEA 3CMMA 1ZIDA 3RBZA 1AE1A 1NPDA 4Z9XA 3OIGA 3GVPA 1IHXA 1ZFNA 2B83A 2V7PA 3MJVA 1GZ3A 1VKNA 3FCOA 1V9LA 2I67A 5F21A 3WJAA 5GZ3A 4P22A 3RROA 4DVJA 5KVSA 3K2EA 4TMFA 5FI5A 3GUYA 4FB5A 5L7TA 4FJ1A 1MFPA 4FS3A 1XG5A 3CSDA 4E5YA 1PGPA 1GU7A 2DTXA 4GKBA 4Z0TA 3PWZA 8ADHA 3JD4A 4J4TA 3BMCB 3RFVA 1R66A 2DPGA 3IKVA 3DQPA 2IE0A 4IDEA 2H5LA 4G2NA 5DDIP 3QVWA 3NAQA 3SJUA 4E13A 1ZMOA 1LSUA 4HY3A 2WDZA 4GVXA 3GEGA 5KVVA 3GNQA 3IAHA 1VKOA 2O4UX 3G1TA 3H3FA 3I9OA 1VSUA 4N5NA 4YTEA 4AJIA 3ZCXA 1B8PA 4UAGA 4EJ6A 5TT0A 1E7MA 1LDEA 4WCFC 3ZWNA 1T1RA 3DZBA 2R2GA 3DZGA 1P1FA 5THQA 5CEEA 4O1MA 1E1LA 1TT5A 1LTHR 2PZJA 3UVEA 1I3LA 3ZV4A 4S1VA 4ALJA 2O3TA 3D5TA 3HSKA 1IPEA 1KVRA 1EUDA 2A35A 4D42A 3LVFO 3MOGA 1P0FA 4ESOA 1KY4A 2NVUB 5BNIA 3ROKA 2O7SA 1E5QA 3WIDA 2EG9A 4IXTA 2YY7A 4CV3A 1NVGA 1VJ1A 4QTZA 3DXFA 1C1DB 3FF4A 2C5EA 4XQ9A 2B35A 3DAPA 1XU9A 2UAGA 4H16A 5C37A 2NVWA 1M6HA 1WLYA 5L4LA 1DBVO 4RZHA 1XIVA 4RF5A 3SLGA 2X5KO 3F47A 3UW3A 2Q49A 3ZWVA 3DONA 4WUVA 4FFLA 5F1OA 1OI7A 4D0RA 3GGOA 4DPMA 3DZIA 1G0NA 1H6AA 2VHYA 4E3ZA 3IC5A 3W4JA 1UZLA 5IXSA 3FBGA 3STHA 2VT2A 4NBRA 2NACA 3DOJA 1TXGA 3AY6A 5A3JA 1D1SA 2EGGA 1QV7A 1LDNA 2GERA 2GUGA 3DWFA 3RWBA 1S6YA 4DLLA 1EE9A 5FEUA 2QHXA 3TPCA 3P2YA 4FFMA 1Y9EA 2YW9A 4KWIA 1WDKA 3FHLA 4BKPA 1GTMA 2FSSA 4XGKA 1T4DA 1NWHA 1E92A 4Q3AA 1TT7A 3ULKA 4BL5A 3O03A 3L9XA 3PHHA 3OSUA 1X1TA 2HMWA 3U62A 3K6JA 4R54A 4TZTA 4ZQFA 4BMSA 3V8BA 5BSHA 1QV6A 3JTMA 5B4VA 2H6EA 1KC3A 1P33A 1P1IA 4W9NC 3ZZNA 1LX6A 1SOWA 2OORA 1HDYA 5EJ2A 5CEJA 4DRYA 4ZA2A 4WNIA 2AG5A 2VYND 3WIEA 3MTJA 1U8FO 1ZSYA 3OEYA 3TZQA 2YV1A 3PFWO 4MP8A 1O5IA 4NHEA 4KMSA 4Q3NA 3RC7A 4ALNA 4CLEA 3JYPA 5C7LO 2FZEA 4OJNA 1W4ZA 2OXIA 4BNFA 1I24A 3QWIA 3CZMA 4O0LA 4Q3CA 1H2HA 3AUSA 2OP0A 3P2OA 5DZSA 1UDCA 3SVTA 3BXXA 1KC1A 3PJGA 1FF9A 3C8MA 1GYQA 3KEQA 4M86A 1CRWG 1X0VA 1HE5A 1JLLA 1P77A 2DPHA 3DMTA 2I9PA 4FGSA 2QRKA 1H6CA 3L4BA 2XXJA 3KYBA 4NQZA 3EC7A 4RPGA 2CDBA 3JD3A 2Y1EA 4GMGA 1GV0A 4CMIB 1Y8QA 2HK8A 3PWKA 3AM5A 1KEWA 4R1UA 1R0LA 3ZV6A 4RV9A 1E7YA 1OOEA 2ZJ1A 4EZBA 4CMAA 3DBLB 4Y6PA 3PQDA 1E6UA 1E7RA 1RM0A 3IS3A 3D3WA 4IDDA 2JL1A 3MJEA 2I3GA 2IZZA 1DO8A 1RYEA 3L6DA 1VM6A 1M6WA 2RAFA 3UUWA 2GD1O 3ZN2A 1AHHA 4LMPA 4PLTA 4U0KA 3VHRA 4OAQA 3BHMA 1PR9A 3WTCA 3O9ZA 2OP1A 1Z7EA 3PHIA 4ND1A 5ES3A 4YJHA 2BF7A 2SCUA 3C3XA 1YJQA 3KXDA 1IE3A 2C2YA 3G49A 4LGVA 5IG2A 5CDSA 3PHJA 3UH1A 1PSDA 4PVDA 4WK6A 1E7WA 4CV2A 1Q1NA 4EUFA 4AFNA 4CQLB 4XYEA 5CPBA 2X6TA 3OETA 4GBJA 4B8ZA 2JHFA 4J7CA 2O2SA 4MKRA 1YO6A 2W2LD 1GUZA 4RPLA 4Y98A 1XCBA 4CUKA 5IZCC 4BGEA 5TLSA 1HTBA 2IXAA 3FRJA 1XELA 3M2TA 3HG7A 5EL0A 3O38A 3VZPA 2BGMA 5GY7A 2VYVA 3H65A 4CM5A 3GNSA 2WYUA 3KYCB 5EERA 3LDHA 1BGVA 1M2WA 4UVIA 4HFNA 3K5PA 5TQVA 2J3JA 1DIAA 3RASA 3K9QO 1YL6A 5TX7A 1WNTA 2A94A 2DAPA 1H2BA 3TL2A 2D2IA 1YQXA 1U28A 3AOEA 4BNHA 3BHIA 2OL4A 2O3UA 5JXWA 4P4LA 3MOIA 1UXKA 3D5QA 4DPKA 2AQIA 2RIRA 4Z9FA 3HB4X 1U5AA 4PZDA 5KJCA 5L40A 4PGFA 4CM7A 3INRA 3ZDFA 3WGHA 2DBRA 4NBVA 4DXHA 5U4QA 2CMDA 4ND3A 3CXRA 1MXFA 1CWUA 2QQ5A 4JGBA 4UVGA 4QUKA 5DT9A 4O6VA 2AEJA 3JQ7A 4R1NA 4HUJA 1P9LA 3RQSA 4JJIA 2WJPA 2X9GA 3RIHA 4AJKA 3ASVA 2RH4A 1LDYA 3AY3A 3DZFA 4OOFA 3WBFA 3RFTA 1LRKA 1CQIA 2VHWA 4CV1A 5L51A 4AJJA 1C1XB 3JQFA 2Q2VA 1UP4A 2P68A 4B3IA 3SJ7A 5IF3A 1I3MA 1BTOA 4BB6A 4EEZA 1MB4A 3JD0A 3X2FA 1M75A 3OJOA 2FR0A 4PCVA 5A5FA 1UP7A 3PJDA 3KV3O 4B79A 4AJ1A 5MGBA 4ITUA 2JFHA 1YJ8A 3WJ7A 3ONFA 3WGOA 3EGOA 4J16A 1O94A 4RDIA 2Y68A 2AQKA 3A9WA 3QA9A 1GD1O 1U5CA 2W2KB 1PEDA 4DQUA 7MDHA 2TMDA 4A10A 4YACA 4OHUA 3JYOA 3WB9A 1WVGA 2EW8A 1PS0A 4KP7A 3NTRA 4YQYA 1CERA 2P4HX 4Z3DA 4Q3BA 2WMDA 2ZB8A 2HJSA 1U8XX 5T57A 1LBEA 1ZEMA 3Q11A 4IQ8A 2GZ3A 4DA9A 3VPXA 3Q3CA 2DFDA 1ZKMA 1E3JA 3U0BA 4Q3DA 2P91A 1EZ4A 3M1AA 3S2EA 2EEZA 4QFCA 1U3VA
chains in the Genus database with same CATH superfamily
4AJPA 2GPWA 3DWIA 1O0SA 4FN4A 5I5EA 4X6XA 5KTYA 1PFUA 3QVUA 4UHJA 4BNUA 3WGIA 4MDHA 3FAZA 4RF4A 3VU9B 2IHZA 1JHMA 4BNYA 3LUJA 1BMTA 3DFIA 3ZHZA 1TOAA 1J1ZA 4DLAA 3KUXA 2JFYA 3V7UA 3T4EA 4Q7QA 1DWOA 5D01A 4YVFA 1EUCA 1U8AA 3Q9LA 2AMFA 4X95A 3Q8LA 4RPHA 4Y9RA 3CUVA 3LBYA 4L6AA 4UMFA 3LQ2A 5KBYA 3BGVA 3EYAA 2QP3A 4NENA 4WZBA 4FOSA 1T2EA 2F8SA 4Z4FA 3IQGX 2RHHA 2Y2UA 3O1LA 1C3VA 5AJYA 1H5NA 4DJEC 5JJKA 2FMUA 3DL7A 3ZZMA 3ANNA 1XR3A 3FN4A 3UH0A 1KY2A 1T4CA 4KQ1A 4P3PA 1V96A 4AYXA 1IZ0A 1R8XA 4QYIA 4H59A 5BUZA 2Y92A 2ZW9A 3KLOA 5E7MA 3R76A 4TL8A 1U2EA 3WLMA 2Y1FA 3BS4A 5SZIA 1C81A 2E4YA 3EAFA 4B3TB 3IIEA 4REQA 3RRYA 1NLZA 5KTKA 3LL4A 4HWSA 4R2IA 5L7WA 4J0QA 2DBQA 2XNSA 4RO0A 4XM0A 3OT4A 2FFBA 3RVOA 5T6MA 4ZI7F 1DCTA 1ECPA 2HNAA 3OWOA 4BMPB 3ASZA 2CHEA 3LX4A 1R5BA 2VL7A 4DV5B 4KMMA 2VSFA 4ALMA 3B2QA 3GUCA 3WDLA 3MCWA 4BKQA 2X15A 2IW3A 3ETGA 1VGQA 3WGNA 3EK2A 2B37A 1TNDA 5A9RA 2WKWA 4NICA 4ZQEA 4WGGA 4C78A 1FFEA 1PJ3A 3H04A 4Q3OA 5F9MA 4ARCA 1XRQA 5TB5A 3EOAI 3ET4A 1LS1A 4KVGA 5ALJA 5AVKA 4FWTA 2GAOA 1JPVA 4DR4B 3WL3A 1IRXA 4MGHA 1OHHD 4H1HA 4BO5A 2IZ5A 3VJLA 4UOQA 1RJEA 3QFTA 3GIWA 9LDBA 3P9QA 2X5XA 2WM9B 1QYXA 1QVZA 3PGLA 1K0UA 1YRLA 2O05A 5DLPA 5E3JA 2O2JA 3S6JA 2IYRA 1AGXA 5EHGA 3SZOA 3HYRA 5GONA 3B20A 3ZVMA 2HW8A 2F8TA 5HE8A 1VJ5A 1JWBB 2NADA 3ELYA 3H5RA 1YDHA 3BREA 3INYA 2HU5A 3VPHA 4M38A 4XYBA 1Y0BA 1U7OA 2RJOA 2D4AA 5HCUA 4P7JA 1P6UA 4B75A 5KNDH 4BQPA 3CYFA 2AUMA 3K8OE 3CH5A 1PQYA 5DH9A 4DAEA 1J2JA 5BP7A 5EIEA 3THYA 1QGAA 1V8BA 1QQBA 3H4VA 4M83A 1EE2A 3NFRA 4W82A 4CI0B 1IEQA 3GNLA 4G56A 3SDSA 1SXJB 1ECLA 2A3RA 5LD2C 2C3UA 1OFGA 2HGZA 5BVHA 4E15A 4FQ8A 5CR9A 1KMHB 1H3FA 5TQ0A 4Y18A 3T1OA 2X58A 3N28A 2JDID 2QMHA 4Q0MA 5KKNB 4RA9B 4DSNA 2YOGA 4M55A 5D7BA 1EP1B 3NHYA 3CLRD 3FGPA 2CLCX 3FJ1A 2RC5A 3UPDA 3CUYA 3OJ0A 4RDHA 2UYQA 4YRNA 2IUSA 5I9TA 4L5BA 1R8SA 3SBOA 3QENA 4M1ZA 3RUFA 2XYVA 3SZMA 2ODWA 4I1IA 1Z0DA 4JLAA 2WTNA 4OHPA 5H82A 3WK7A 4XYLA 4ZCPA 10MHA 4JXJA 4RADA 1AKRA 5HX7A 3HH8A 3VVLA 4QBKA 5BY2A 3AF6A 3G2OA 4YAKA 2QQGA 4RANA 1J39A 1R6TA 3F6SA 4GP7A 1I4EB 2PRZA 3QU2A 4J1NA 1ZVVA 1FFCA 2BFDA 4ANFA 2FOXA 3N76A 4KFUA 1P1BA 3TFQA 4DV3B 1VGRA 1JXOA 5I7VA 5MDHA 4OX9Y 1IZ9A 3QLVC 3DMFA 1ULBA 2CXHA 3JAWA 3A9UA 4HAOA 4HL6A 2IS4A 4ZFNA 1F60A 2HHHB 4RU1A 4P82A 5KOJB 4V0QA 2EJWA 2XLBA 2B36A 4AMZA 2G70A 5I45A 2H4XA 2OB1A 1KI3A 1XJCA 4M8NE 3ZI0A 2A9VA 4KE8A 2ZIWB 1XTPA 4H27A 4YRKA 4HWPA 2RAUA 1L4KA 1R37A 1VLHA 1XDZA 2NO6A 1JEEA 1VLJA 3LBHA 2IIPA 2EW1A 5TC4A 4Q1EA 3LQ1A 4OQZA 3WRVA 4AD8A 3R4VA 3ZGVA 4B3DA 3U6BA 1W581 1NMZA 1B15A 3G2LA 4OHYA 3KE9A 2B0CA 1GAQA 2X19A 2NYVA 4ETMA 3EAQA 1BQEA 2IU6A 4GMHA 1IDOA 2VDPB 2FDRA 3AJEA 4YIHA 3DJYA 1D1TA 1SK9A 3B85A 2QN3A 1FXSA 2BGKA 1E9BA 1K89A 2ZUCA 3I2GA 1JHDA 4HGRA 4KQFA 4KLCA 4KV9A 4EBFA 5BNTA 1L8OA 1XDBA 3PJFA 2C9OA 3E7PA 3WKCA 4NDZA 1OTXA 3H18A 4OMCA 3T9FA 1EFPB 5EQFA 2GN6A 3M6VA 1G5QA 1UBFA 4C7MA 1PG5A 5C31A 5AVVA 5HNKA 2JGNA 1DAOA 3G7NA 1OZAA 2GCGA 2X7JA 4WOCA 4BATA 2Z08A 2Q6LA 2B98A 3Q12A 4XPIB 3L7KA 2P3QA 4N6NA 1TJ5A 2VJMA 2ECFA 3T1TA 1Z5OA 2WZDA 1SBQA 4KUGA 4LYEA 5M2QA 1ZG3A 4ZC8A 3PYLA 5I7FA 1SN7A 4G85A 1UADA 3ENZA 2K2WA 1ZIPA 1BD3A 1KZGB 4R2WA 2R7MA 3HNRA 3UMMA 4LGYA 2Y05A 1ES9A 1O95A 4X91A 4FFBA 3G13A 1W46A 5CG1A 2FVXA 3O83A 2WSYB 1QP0A 4YY3B 2IJGX 1DAFA 2D3TA 1R4NB 2ZE7A 2ZTLA 1N7GA 2W8BA 2ZYSA 3ADOA 1J7KA 1G7RA 4L9SA 4UBNA 2X23A 1CJUC 1U2RA 4Q9KA 4NFLA 1V5EA 3NOVA 1L7VC 3EIXA 4HMPA 4JUAA 5M29A 1JR4A 1H0SA 2WWYA 2R8EA 3OURA 4CL0A 1F17A 5BRJA 1XRRA 1IDN1 2MYNA 1GZ4A 3AERA 3BFXA 5B55A 2PSEA 2PFSA 1JQ3A 1QH9A 1W73A 3U3JA 3IL2A 1US8B 2Q7DA 5JHGB 4PICA 3SYLA 1DDIA 4O1IA 5HR5A 4HNAA 3RS2A 3EZ7A 5CPFA 1IVSA 1E2NA 4WGFA 1VHTA 5B3KA 4NE7A 4FTWA 3T1NA 2B4TO 3QPAA 2D54A 5DGIA 5I8PA 4FZJA 3STVA 1DHRA 2WSSD 3LK7A 2I54A 3E03A 5EJFA 3NEYA 3DP9A 4Y30A 1BE8A 5B12A 4BO3A 4NYIQ 1Z37A 3WV5A 1Z5ZA 2C92A 2QZ9A 3PYXA 3O0TA 3RHFA 3IULA 5L53A 1B6SA 1K1EA 3PC3A 1LLQA 1UJBA 1SD1A 1ZIXA 5SYNA 2YN0A 4MAMA 1WOMA 4C6TA 3OESA 2EHDA 1TD9A 1SAYA 3D64A 2JFUA 4OQPA 4B5KA 2XZOA 4Y2VA 1H9BA 4EAQA 4YRDA 1J5EB 1FFXA 2QI9C 4KO2S 2MOKA 3CW9A 2HRZA 1YS9A 3WA7A 4RETA 4F2DA 4ZCQA 3QI2A 1U8YA 2J9FB 5AK5A 5KHAA 1EWKA 3T3HA 1S2DA 3ZOZA 4TMVA 5BN5A 1KAEA 1JIXA 3CZ9A 2MT9A 2PWAA 5B53A 1YFLA 4AI6A 1Z0JA 3L4BC 2CJXA 1Y9DA 2QZZA 3A27A 1GILA 2OCBA 5KYUA 4CU2A 4Z4EA 1TO6A 1YXMA 4S0XA 2YFYA 4MV6A 4RM3A 3IUBA 2ATIA 4KGVA 4ZYLA 5D1HA 1KK1A 1F2DA 1MRZA 1ZW6A 2R8PA 4HR7A 3AI7A 5AKIA 3V8RA 4YCLA 5LXTB 3ZD6A 1CS0A 2OAQ1 1J0CA 3OP1A 3ZKWB 4JKOA 3EX7C 3WRWA 3QX8A 2OMEA 5JASA 3HBJA 1JEQB 4M1QA 2FMXA 2AV6A 1TEVA 5IAAA 2P5SA 4R7TA 4Q4DA 4E51A 4AJOA 4E88A 1XL0A 2J4CA 3UAYA 1HNZB 3BMQA 4R71A 1DIGA 1OASA 4PVCA 5DNDA 2D2EA 4HYYA 1VPTA 5T41A 3SXUA 1ARZA 4XJTA 1W8IA 5CNKA 1BN7A 3G5UA 3U81A 2V7WA 5AQ1A 5JDCA 6NULA 4F4FA 3V8MA 4A26A 1BXGA 3L7JA 5LLTA 5T67A 1TQHA 3AF3A 1CY8A 2PSJA 4Y1RB 3H87A 3GLIA 2VUUA 2VYFA 3J7TA 5B6JA 1J0XO 4ROTA 2O2XA 3AF4A 1JQBA 3THWB 1ZD3A 3IP3A 3TI7A 3VR3A 4NCJA 4AICA 2AS0A 4IVRA 4IIBA 4II3A 3A4MA 5JZMA 2Y1GA 2EW2A 1AGYA 1W1UA 4G86A 1O6CA 1O7JA 4QFDA 4GP9A 2XE4A 1W88B 2Y1LA 1U5BB 3A11A 1VXRA 3ITDA 2GYYA 1GZ6A 1VG9B 3JARB 1LD3A 3KSZO 4F3NA 2JG3A 2NXEA 2Q2WA 2J46A 2BGJA 3KOMA 4RY9A 1RBMA 3TRJA 1IJFA 1Z82A 2VJQA 3F96A 3D8RA 3E9CA 1ZN7A 3WYAA 4CKBB 1SG9A 1PK8A 5IWAB 1EVIA 2F9LA 2VTDA 3ZCSA 4UU8A 5DSZA 2CDNA 2RGYA 1IBRA 4L1KA 5I4KA 3VM6A 4WPGA 5EEHA 3T1YB 3TJRA 5AVTA 4LBVA 1EFVB 3CU5A 1FJ2A 3SZ3A 1J25A 2AN4A 3EOZA 4R2HA 1VZ2A 2GEDA 3EVNA 4KK3A 3RU3A 1R3UA 2O07A 3O5AA 3IPCA 4EG3A 1KQOA 2ATXA 2FG7C 4EITA 3WNVA 2GPBA 2XECA 3LU1A 4EJ0A 1T9KA 4H2DA 1RQPA 4R84A 5ALWA 4DDVA 5E1DA 2ILTA 1ZZGA 4TLMB 1Z0UA 2E21A 3AVWA 2BT4A 2W83A 1C29B 3IJEB 2QLMA 4I19A 5AW5A 2YICA 3FDJA 2WTUA 2UYGA 1E8MA 2PGOA 1NNI1 3OOJA 3KQOA 4QECA 4DCMA 3MK31 3H1BA 3WHLA 1YB5A 3TK1A 2VWPA 4ZV4A 2N0SA 1ZM3A 3DL2A 3K0AB 3MUFA 5EUMA 3JVVA 3QI7A 5IKOA 1WSAA 2BMEA 5H5JA 4TTRA 3I73A 3R3YA 4E5NA 3BF7A 4WBNB 1WXGA 2J33A 1E32A 4LJ7A 4K6MA 3EODA 4YP5A 4FMCF 2OKGA 2IRWA 2XGJA 3P26A 3P9ZA 2I4TA 5BSEA 4J6EA 2JARA 5LDGA 3KZXA 2YXBA 4TN1A 1C3EA 5IPFA 5JAHA 5A6VA 3QLUC 5K0LA 3CR8A 4D3ZA 5J4KA 2OD2A 3CB2A 4EPTA 4EYOA 4E1BA 4K46A 2P4QA 2YN2A 4MVJG 4UHBA 3SIWA 5KOHB 3EDCA 4GSKA 1P2SA 1YONA 1N5JA 1OSNA 2DWOA 2XUGA 1H1LB 2HA0A 4FYKA 3DZJA 1TEHA 3UJ6A 2Q6IA 4X60A 3V48A 3BXFA 3EZ2A 2WD9A 4FR0A 5FBZA 1CJCA 2YZGA 3PFIA 5CM8B 1SCIA 3VR6A 5HOQA 4NZ9A 5ISMA 1TIPA 2AQHA 3IQIX 4I5DA 1LBTA 4URFA 1Y4ZA 4TMXA 2WWVD 1ICEA 2HNBA 1RXIA 4BGUA 4EG7A 4HI0E 5GVRA 2OCYC 1L5FA 1S02A 3ME5A 4X84A 4I6EA 1G63A 4GE3A 1ENZA 1DEOA 4FUQA 1Y89A 3JQ9A 4NABA 3TCNA 1HG0A 1NG9A 2ZJ2A 4LNUB 2N47A 2HIGA 4LZPA 1SD5A 2XGOA 4FBGA 1PF7E 4LW8A 2Y93A 3Q3GE 5EJ7A 4EGAA 3IVXA 1JQLB 4RHUA 3OTWA 1XEXA 4K81B 1SCUA 4NMLA 1PJZA 1NY5A 3FTDA 1VJTA 2YNMC 4RMGA 1AXEA 1K7YA 4DDMA 2IQIA 4BO7A 1JH8A 3A6DA 2V7EA 3KTAA 1Q1QA 1DADA 1C0KA 2V4MA 5DEIA 4LX8A 3IBGA 2HYDA 2VNAA 1VPDA 4JD5A 5GAJA 5K51A 3STTA 5CB6A 2ECOA 2X8JB 3QEAZ 4EK9A 4MDFA 3HP1A 3PWSA 4FDTA 1CY7A 4CG1A 2BHNA 1KO7A 2F3PA 3ZHCA 4F4UA 3ZLTA 1P17A 1IG3A 2NTVA 4GNKA 3VKUA 1OXUA 1VCHA 2QY6A 3FR8A 5DP1A 5HF6A 5AFSA 1EM8A 2YRXA 2RGCA 4K6CA 4MQ6A 2VP5A 1NU6A 3RTDA 2HO4A 2ESRA 1LWNA 3O74A 4XM1A 3S2ZA 2NQ2C 4ARVA 4XUGB 2VPYA 4TKVB 3X1KA 2HBZA 3W9BA 5BV2P 4GVLA 3I2JA 3MGCA 4C4ZA 4HVLA 5CVVA 3G5MA 1O8CA 3IVRA 3MS2A 5F3RA 1GUFA 3GR6A 2NOAA 4MWOA 4UNRA 4AZ3B 2XIQA 3Q0IA 1JI3A 4YRFA 4S1PA 2JFZA 1XN1A 4RMJA 5H83A 1E1NA 1DEKA 1SU4A 2VHCA 5AUOB 1O6ZA 3OLCX 4CIDA 5I7SA 1MX3A 3C45A 3UPUA 5LP1A 2XMCA 2WV9A 2CVZA 5LMZA 3LP5A 1U3TA 3U49A 5F33A 2JCVA 2DHEA 2HCFA 3LC7O 1GZSA 3L7CA 3V4PB 4DLXA 4EPRA 1TI7A 1WM1A 2ECKA 4WBSA 2R68A 6REQA 3MCTA 3UG6A 5EWLB 1SHJA 3Q7QA 1N92A 5JH7A 4FQ5A 1P5JA 2BM9A 2H52A 4YNBA 1H22A 5CXXA 3SIPA 5JAOA 2G72A 4JI2B 4J1TA 5I7AA 5ALNA 2Z5FA 1KARA 2QW8A 3EA5A 5JADA 4L08A 1YBFA 2EL7A 5KJ1A 2GD6A 4JLNA 1HUQA 1AQUA 1Z34A 1GQYA 3ED5A 1WWKA 2Q3DA 3SLKA 3QVGB 5C5DA 1HT0A 1HOXA 5JJCA 2RI6A 3DVQX 3P52A 2TRSB 2Z6UA 5ESDA 3ZI7A 1EU1A 3ESCA 2X0JA 1KA9H 2QNBA 2VXYA 3H4IA 3LUFA 3S5JA 2D1TA 4L51A 5I3CA 1E0AA 1P39A 3OMLA 5GZ6A 1AA9A 1XFDA 2ATCA 2ZE5A 4IIJA 5G4KB 4EYSA 1KMNA 1XA0A 3RTGA 4KDFA 2G9ZA 1QHHB 2MR5A 1PD1A 1V35A 2HLHA 4FOOA 4YR9A 3L6UA 5K4GA 3DDOA 3JQ6A 2JDIA 4H35A 3WP1B 2VXCA 3OZIA 1BDMA 4B4DA 2CE2X 1QHSA 3ZWXA 4PNEA 5KVCA 2OG1A 3FXAA 3JPWA 4I9GA 4E2FA 1SVKA 4A3SA 2WHRA 5LPNA 1GR1A 2DX7A 2PWPA 4P4GA 4QAQA 4QPZA 3TX6A 3VTAA 4D99A 1NLFA 4URXR 4GH5A 4K6FA 3H9QA 2ZUWA 3GLQA 2UUAB 3CCCA 1U0EA 4E2WA 2G0TA 3OPYI 2XQGA 4M88A 5E9WA 1U9CA 3IJRA 5ANRB 3LO5A 2I1QA 1R7RA 2D3WA 3PXEA 5CAEA 1JFSA 2AN9A 4MWZA 4WKBA 2PMFA 4EH1A 4DR5B 1V3QE 1B8VA 2Q7XA 4CKCB 1C7ZA 2ZB7A 4U0JA 4NNJA 1AMNA 2BFBB 2H5JA 1QK3A 1DC3A 1WO8A 2WWTA 3K0EA 5G0UA 3RE1A 4M9CA 3ZEAA 1V8DA 4R1SA 3A14A 1J2YA 3GB9A 1CIVA 2JW5A 3L4EA 4PAGA 2JJQA 4TYPA 4NJOA 3HCWA 3PKIA 2VVTA 4KGZA 7MHTA 1LX7A 2R97A 1E3DA 3KSAC 2JI9A 1VSTA 3D4PA 4YCBA 2F3UA 2BTOA 3BSFA 3MBKA 4LPKA 3Q2KA 2P77A 4DJAA 2YWCA 5IYZF 2FSVC 1V7QA 2E89A 2L2QA 1L5YA 2OVBA 4MIKA 2BZ1A 3C8UA 2ZRGA 4NSNA 2W6NA 5TQ2B 3RGGA 1U0JA 1Y7IA 4U5QA 1GPH1 2UZAA 2EEPA 2ZDGA 4FMPA 1EDZA 1FMJA 2P6NA 1NVXQ 3F3KA 4L7VA 4MVJD 3T5DA 2GPJA 2G6TA 1SZCA 3TQFA 4JOBA 4L4XA 4PQFA 4XAQA 1MNAA 3FFTA 2ZI3A 4IL5A 3RCBA 3OKCA 3M3DA 1L6RA 2VDUE 4Q7EA 1UK9A 4RVGA 1QKIA 1YQWA 5EKTA 2DQZA 3MTDA 3CRQA 3ROTA 1DJMA 1PR5A 1SCJA 4AUNA 5CAEB 1FFSA 3USES 3MTEA 4HRXA 1EDEA 4G84A 1G9TA 4F6RB 2Q4EA 1M1ZA 2WWWA 3PSHA 4MW4A 5KTNA 2AIRA 3N0XA 1U99A 1BKSB 2GA8A 3VYTB 4RJTA 1HDGO 2BELA 4ZRNA 1C9NA 1KO4A 1L9KA 2J67A 4MW1A 4G8DA 4J29A 2ZTHA 4XYGA 1T3ZA 2C1XA 2QRPA 2PX8A 4HLUA 4LYHA 5AKJA 3R7WB 2W2KA 4B33A 2YQ5A 1NBOA 1SELA 1N5MA 1RM4A 3SI7A 4ZOLB 1B0UA 5HVNA 1O1YA 3TOCA 1NL3A 2QV7A 3AOGA 3ND9A 4HQRA 1CU1A 1XTBA 2IHKA 4FHDA 4QFMA 3CVXA 2X0FA 2V5VA 5F5NA 4FC6A 4RJ2A 3AUKA 1NUTA 1Z16A 4I4CA 1PT6A 3C3BA 4D4KA 4F11A 4H77A 1AJEA 2AHRA 2WICA 3U39A 4ZYTA 1MC4A 2F55A 5IVHA 1FFGA 3OMWA 4G5XA 4L8VA 1WXEA 4M54A 2X40A 4K1LA 1SOMA 3H2BA 3OFNA 2FI1A 1BMDA 3DO5A 4Y2UA 4XD7A 5HM8A 5JBIA 3GLUA 1LV8A 4N3CA 1QMGA 4WASA 4X3PA 1PK9A 2FP4A 3FKSD 3AONB 2A5DA 2NU7B 3M33A 5IBQA 3VTFA 4A8HA 4INZA 4E94A 3BAFA 3I0ZA 1X7XB 2AR9A 2FWRA 2HJ9A 2OR3A 3ECAA 5C4MA 3F73A 3NHMA 1YDEA 1AIPA 3WLQA 4R31A 1ZOPA 2FKNA 3IEUA 5JZBA 4WI1A 3KPWA 3F67A 4CQNA 4U2BA 5BNFA 3UT5B 2JI4A 3AXTA 1PVVA 3RT7A 1A3CA 1W4RA 3IEMA 1G2OA 2QRVB 2FHPA 3GO4A 3LC1O 1PUXA 4F1WA 3IIMA 2GM4A 1EAYA 2O8VA 4RD0A 1DFGA 1RWXA 2REOA 1U7XA 3EEFA 1WXFA 4C22A 3FUCA 2D5CA 3HCDA 1QQTA 2BHLA 2NIPA 1TB4A 5KSWB 5TT1A 4LOLA 3EQ6A 4ND8A 4AZ3A 3Q5EA 2O8BB 2ILVA 4UFNA 4HDKA 3PDIA 2WJVA 4IS2A 2P7IA 1ISPA 1Z0IA 2PJDA 3LO8A 4NQRA 5DX0A 3VNVA 3BYZA 1P5FA 1SXJD 1YS2X 2Z0MA 3AUUA 1QDEA 4B48A 4OI0A 4OBEA 2VZ8A 2YV2A 4PG7A 5DTRA 1PTJA 3N59A 2ZJFA 3P9IA 1XCOA 1G1MA 4TS3A 3OM0A 3UMCA 2VA9A 4KITB 1GAXA 3VHXA 5IAKA 5IDYA 1JQEA 2AJDA 4YAFA 1A77A 3EF0A 1C7FA 5AK3A 1DTSA 2JHPA 3PX2A 4J0CA 3H0CA 3BDIA 3RJ5A 1CKEA 1DDOA 4MAFA 4QGFA 3R3WA 4UU1A 1E2FA 5E2BA 3EDYA 3L8YA 1JAZA 4D6XA 3LPDA 3DE6X 3ZWDA 2XQKA 2H1VA 3TTXA 2QMQA 3KHKA 3AV3A 4DB2A 4E6PA 3I61A 3W6OA 2VRWA 4MYUA 1ZOOA 2KLBA 3V32A 4GBMA 3V7FA 4JUBA 1R0WA 2NSDA 1M6VA 3GEDA 3JQAD 4J0GA 4U3JB 3ZV7A 2E6UX 1GNVA 4HBZA 2R96A 5DHRA 2ECQA 5K0JA 3W79A 4CL8A 2FY8A 1SBYA 3SJCA 3P96A 5EMJA 1WV0A 3FTNA 5AUPB 4BNMA 3KAPA 4E22A 2PUCA 1LI7A 3DW1X 3N2EA 3ZG6A 2P9BA 1CUEA 4CM4B 1P0CA 1UPUA 3O4FA 1WB5A 4R6WA 1G21A 3AHIA 3PQ7A 2I5PO 3N6RA 2QMOA 3ZBUA 2E0IA 1PNRA 5BW4A 3WGLA 1J00A 2QP9X 4XQCA 3D1VA 1H2WA 4EECA 4QZVA 3DUFA 1Y3AA 4PV7A 1Y6JA 2V6JA 5BV1A 4ZZ2A 5IKPA 1EVLA 4CG0A 5E6UB 1VI5A 1AMUA 2YHIB 4RZUA 5C3UA 1QH1A 4YJ2F 2H2IA 4HT3B 1CQPA 1GAEO 1NPYA 1S9HA 4Q4HB 1TZBA 3W8RA 1DV1A 1F06A 1JB1A 3EHEA 2XUIA 1DAPA 2FZCA 2HWXA 4GNRA 4QATA 2X6RA 1KZYC 1NWCA 3X1XA 4TSFD 3OCZA 5FI3A 5AQEA 2FPGA 5KZMB 3L1JA 1FFBA 4UPEA 1ILEA 1K6IA 1SKMA 4J7XA 1M2GA 3VNUA 1TM2A 1DXQA 3EA0A 2VIIA 1LRLA 3CBQA 1G5FA 1T5HX 4KE6A 4YO7A 3L40A 4PO1A 3IE1A 1MAUA 4DRXB 1L5MA 3HBNA 4HDMA 4E1AA 4PN7A 2QPLA 4AIIA 5IKMA 1EDDA 2IF2A 1RQNA 3DF7A 1RQRA 3L92A 3R09A 2XNHA 4G9GA 4BLPA 5H59A 1FDRA 1SBNE 3UICA 1SZJG 1WSBA 1E1KA 1XZFA 4BRWA 4YV7A 3WO0A 4A03A 3UGQA 4B3HA 2YW2A 3WLTA 3KSBC 3VKHA 4LGCA 1RTKA 3KWLA 4M1WA 5G1OA 5AHKA 1PFQA 1P31A 4BKMA 5AKXA 2DUJA 2YIMA 4DLPA 2EU8A 4IP0A 2QRZA 2BZSA 4L8FA 3KJIA 4OP1A 5L6MB 4UCQA 2RH5A 1EPUA 3AWDA 3ZNOA 2ZIXB 2Q1YA 1NC1A 3D4LA 4UNPA 1R5OA 3OTGA 4G1VA 3E22A 4NS4A 1WCV1 4GR9A 5H81A 2R7NA 5JTTA 4IIGA 3KLBA 1QHNA 4RIGA 1JDNA 4IDBA 5ECGC 1G9SA 1UKBA 3AL3A 4M22A 2JEYA 1QG4A 2ISQA 4PZ0A 1RJ9B 4Q15A 2JFQA 4UW9A 1XROA 1G4AE 3ICWA 3TLGA 3UJ3X 1WUTA 3FTCA 4B1FA 4CKBA 1K7CA 3PTZA 2P5UA 4MV3A 5CA0A 4IYRA 3K09A 4DSOA 1CLEA 3SZLA 1QRDA 1ZMRA 1FTQA 1SHTX 2B1RA 2VUIB 4FZRA 1W88A 3C4QA 3DYIA 2BE9A 2GHIA 3LYAA 1PDOA 2XB6A 4RNCA 4WESB 1TO1E 2J9YB 3PYMA 1U4SA 1D09A 4ZWNA 4ER7A 3QX9A 3UWKA 1Z6XA 3QLEA 5GQSA 2QZSA 2QY9A 2ZRCA 1NBWB 5LOVF 1MX1A 3S1LA 1TQ4A 2OCGA 2WD7A 3SC2B 2BSXA 5CLQA 3T15A 4Z3KA 5AW6A 1R0RE 1TQDA 1CX9B 3IMEA 3U1BA 5JBNA 5KMGA 1W5SA 2OMKA 1Y3DE 3FB1A 2OBBA 2C29D 3CWQA 1YA4A 3AETA 4AU1A 3QUSA 1D6JA 5BMOA 1XWWA 3S1AB 1D4FA 1LDMA 3HRIA 5FUQA 2WD7B 4I8IA 1GTVA 1X3LA 1GRRA 1TADA 3URMA 1CULC 1XQ1A 4LRTB 5H3HA 5EJGA 5KYWA 1KYYA 1O4VA 1KP2A 3CLUC 4MO9A 5E1OA 2WD8A 4BO4A 4Z5XA 5JSUA 1NVTA 2NVOA 1G7TA 4R2MA 1G8SA 3CMCO 4QNRA 5GJBA 3IP7A 4R5MA 1CS0B 3SYNA 1R0YA 5ITSA 3C85A 4ZVOA 4DQXA 4BWVA 1WRBA 4WESA 3OWHA 4R8RA 3U4MA 5C3MA 3Q5GA 3AIMA 1CUIA 2AL7A 3JQGB 1UINA 2GHTA 1OTYA 5E38A 3VZQA 3MNFA 1TCAA 5JD4A 3F7MA 4ER3A 3H84A 4LXTA 1AT1A 2QW1A 4S12A 4C0AC 4IIUA 4EM6A 2ZAOA 3NDPA 1QAMA 2QSJA 5KC8A 2ZSUA 3D3NA 3HDHA 4TYYA 2V6GA 4MRVA 3MCUA 2Q99A 1FB5A 1FDWA 2FWBA 2C7VA 4PU0A 5DHTA 3SD7A 1W87A 3FSEA 3JQ9C 3OFJA 4LOIA 3COWA 4BZQA 5LQJA 2Z6QA 1H5QA 3JQPA 3NHRA 4IY1A 5ENDA 4CRWB 3AVVA 4MPJA 4U2KA 3O2QB 1ZS9A 3OT5A 1MT3A 3RNOA 4H4CA 4P80A 1PWXA 1YZNA 3OA0A 4O4JF 3ONEA 4BNTA 2HA4A 1SVUA 3ROPA 1KKLA 1OTHA 4C89A 3R77A 3U4QA 3NTXA 2IBMA 3KEGA 4X6UA 2AOVA 2XWJI 2X5OA 1X13A 2HHJA 2W0MA 1RABA 2AOUA 4JX8A 1AHIA 1G6Q1 1T0IA 3JQBC 4LC0A 2O0MA 4FR2A 3CZ5A 5KTTA 5DW0A 3EOBI 4DN6A 3NCHA 3CT6A 4IKEA 4PGMA 3C87A 5J2UA 4B2YA 4CIYA 1I0LA 1D6NA 2J41A 1EZZA 2DUUA 3H9GA 3NAZA 2W4MA 2CF5A 3N2GA 1DCKA 4DYDA 1IQUA 4GPBA 4BV8A 1E9SA 2ZIEA 3HDJA 4JVLA 2FUKA 4U00A 3LIIA 1PEYA 5K0ZA 1JHPA 1WIWA 3KLNA 3O75A 1XAHA 2M98A 1ULAA 3AERB 3OIDA 4N3BA 2FPGB 3PD7A 2GRJA 4GE0A 5SY4A 5LKRA 1M2FA 1PWZA 1N9ZA 4TRNA 3SG0A 3TJMA 4DR6B 4M9UA 3EIEA 4KYIB 3RC1A 5DLQC 2PPLA 1YACA 2IWHA 1NRJB 3D2AA 4P7GA 1Z4JA 1HDXA 2VWHA 2PH5A 5EWJB 3RSLA 2WT9A 2ACVA 2Q5EA 1WW2A 2PH3A 4MUXA 4NBWA 5ELXA 2AMYA 4WEOA 4J0FA 1UDWA 2PV7A 1RWQA 4FD2A 2L42A 5A04A 1KWKA 3LM8A 1FJHA 5FTWA 2B99A 3RBVA 1UIMA 5BW6B 1YUBA 3IAFA 1WDWB 4D4LA 2Y0BA 1HTWA 2GDJA 1QIJA 1HYHA 4PLGA 2X7HA 5E6UA 4IGFA 4AZVA 3AVUA 3N6VA 1Z4NA 1QE5A 1UT8A 3DUFB 4BFUA 1Y9AA 3KQHA 1OLXA 1LSOA 3OBBA 1N2SA 2YMPA 4OAPA 4C7XA 4ZYZA 2YR0A 2HRBA 1NMXA 2VRBA 2E5FA 1KMIY 2VSNA 3LF2A 3WA6A 1Z5UA 4C87A 4DDKA 1QIKA 1RQ7A 1RZRD 5K8TA 1V2GA 2RGNA 1AGRA 3WGYA 6LDHA 1NQTA 4WXEA 4INPA 2XVXA 2B3TA 3B1JA 4P2BA 3TZLA 3FOZA 3IV6A 4U3JA 4AJ4A 1MFZA 4PLFA 1ORRA 3N05A 4ZO4A 5EHNA 2CMHA 1U4OA 2ZR0A 4EMBA 4L5CA 4C0KA 2G7MC 4JLVA 1G3IA 4C21A 4DLKA 1JS1X 3SX2A 4BNZA 3Q8MA 1XAJA 4GYKA 3OOEA 4YFYA 4BQEA 1XKTA 3IO5A 5ARCA 5FUVA 2LWIA 4KPUA 1TCVA 4RCVA 4IOJA 1KMMA 4C0HA 4X92A 1ECCA 1Y5IA 2A14A 2HQ1A 3HCOA 4QREA 2AKYA 3E9MA 3AGPA 2VHTA 1P1KA 1KH1A 2NG1A 1Z26A 3RVJA 1E2DA 3MJFA 2X42A 5EGSA 4GEGA 1XRLA 3WNZA 1JHVA 3QOFA 4OP3A 4GAEA 1PQUA 3NWOA 3VVBA 2PUEA 4CLOA 1GZUA 2I4NA 4V0OA 2Y76A 3LUBA 3RJMA 3UA3A 3L3BA 4WY5A 4ZOBA 4RKYA 5I01A 1WVIA 3H11B 3II6X 4LOAA 1GNQA 2AFRA 2OC4A 4PRZA 2XB2A 3OC6A 1VL0A 4H7HA 4DA8A 3T5CA 1AG9A 3O2JA 3HR7A 3RUDA 4N7JA 1QK5A 1X19A 4KQ9A 5KWJA 3GLVA 1BA2A 3PDIB 1ZVMA 2BLLA 3A70A 4NBLA 3W5HA 1FSGA 4DJFC 3NOQA 2JZCA 2XW6A 3B53X 3DTYA 4H0NA 2IEAA 1GQQA 2VNIA 3O1IC 4MV8A 3T9DA 2PT9A 2QJOA 4UARA 4M4SA 3O7WA 1XNGA 4XVHA 1TU0A 2I2BA 3U1TA 4M0CA 5DGXA 2Y0DA 2Q8QA 2G88A 4B43A 3IDSA 3L41A 3SPXA 2H7CA 5MFPA 4K9MA 4YGXB 5CFOA 3FSGA 3JVDA 1IB6A 4QDZA 1BS2A 4EABA 3GDWA 1FJXA 2X4IA 3I9KA 2ONKA 3JWPA 4U7TB 5JJ5A 3F46A 5F7ZA 4KXUA 2PZKA 2XUJA 1QCYA 4GT1A 3HXPA 5HTKA 1X7XA 4OK6A 2G08A 5FI1B 5BSGA 1QC5B 4ZCLA 1TZKA 2QL6A 5AR1A 1CUXA 2QDKA 1FDOA 3WKEA 4TMYA 1SMKA 3NBZC 1NHGA 2C3MA 2NTEA 3CW8X 5F3WB 1EUDB 2WUGA 2IYZA 3QUTA 1T2FA 4WZZA 3ROMA 2PLFA 1UFRA 5HJEA 1TGVA 1W4LA 2WINI 3NKVA 3I9V6 4JYMA 4ZAZA 1QE0A 4YCSA 3H5WA 3GAAA 4PAQA 4R16A 1EXVA 3LZ6A 4PBSA 1NOJA 1T4GA 2JIRA 5FV7A 2AI3A 4PLCA 1YQTA 4QGGA 2H00A 3GA5A 5BNZA 3MGKA 2JGEA 1X7HA 1KIFA 1L2TA 5KPDA 2PE5A 3NC0C 2VPPA 3PNVA 3ZLBA 2BW0A 1D03A 3NH6A 1DLIA 4NIMA 1KZ1A 5EG5A 4AJNA 2D0DA 4H3KB 3N70A 3P19A 3R7WA 4ZHQB 4KNWA 1M5RA 2WY2D 4CJXA 4FSHA 2PLNA 1TYDE 2A0FA 4D81A 2JC3A 3FOCA 3EPPA 3UGTA 1Y1QA 4QEZA 4BUCA 7ABPA 5DJ5A 5LZ4A 3AVXA 4N03A 5BPHA 4BNXA 2VBFA 1T5TA 5DWDA 3A6ZA 4AT1A 2QTCA 4JHXA 3VR5A 4CEJA 2C9ZA 1U98A 2V6BA 2O2GA 1A27A 1JVBA 5JCJA 3ST7A 4UM5A 2INGX 3UAOA 5C8YB 3BXHA 4EY8A 3HABA 1W1IA 2Q3EA 1WJGA 5K0TA 2Z3VA 3Q7SA 3PEFA 3P2JA 4HF7A 4QOSA 5F35A 4HNUA 3HR4A 2GFQA 1Z4IA 2ORED 3QFHA 5DN9A 3HDVA 5DM60 2YOFA 4R9RA 1SURA 2WG0A 4LDPA 3MUNA 4I9UA 2PKWA 5I9LA 1ZSVA 3DULA 1XQXA 2CHUA 2FMIA 4AVYA 1QO9A 5D3MA 1X3SA 3KPUA 1Z33A 1L5LA 1YIAA 4B76A 5FFMA 5DHUA 2YYYA 1KYZA 2A5LA 2IGBA 2VH1A 4H7PA 4YAWA 3OQMA 3P5BA 2R6CA 3LBFA 3E5RA 4X94A 3ITEA 1RJDA 3H0EA 2YCBA 3Q7RA 4PINA 1SHKA 3O90A 1KEEA 1BU8A 2BFFB 3NJRA 2W93A 4D9JA 1FX0B 5M34A 1XTZA 1YI0A 1SM4A 1U1DA 3QPVA 4NOKA 1JQKA 1GZ7A 4J4BA 4S1WA 5AVYA 1NM5C 4IS3A 3U17A 1P3DA 3A6FA 4JLBA 1PNOA 4BMVA 1FQJA 1MB0A 2V6MA 1U11A 3AL2A 3BMNA 4ED9A 1AMOA 3FRHA 1YE8A 2NO4A 3N0VA 1FYFA 1UXJA 1G4HA 2A33A 4KOAA 5C0OE 5D3MB 3U9LA 4B6OA 5IS2A 3AF5A 1FJGB 1KRXA 1Q7CA 2BC9A 3CUEF 1R0CA 2O7RA 4UTOA 3FPBA 3NYQA 4QG3A 3IBSA 4BO2A 3KJEA 2OHFA 4LYAA 2VOJA 5JQGF 1E1QA 1GU0A 1NNLA 3MLEA 1WU7A 4HPXB 3PCXA 3OY2A 2VKTA 4Z4HA 1DBWA 4FYHA 3Q8KA 3K32A 3WHKA 1P4AA 4JLWA 1T2DA 2ZJ5A 1EDOA 2WAOA 3SF0A 3NOXA 3UMFA 2QOEA 3M9LA 2CNWD 3ROEA 3SKXA 4C5BA 2PYZA 5FJJA 3D6AA 4XB1A 1XSEA 2CVOA 1URPA 5TNXA 4U9IS 4M9RA 3RUAA 1OIWA 4N49A 4AROA 3TCKA 1M6EX 2R5WA 5DTMA 3GROA 3NVMB 3FKSA 3FETA 2WUDA 4HS9A 4OSOA 1ECGA 4I4IA 3UWMA 4HADA 3TW0A 1OWPA 4DL9A 3KYDA 4TT8A 4QSHA 1UOQA 4DCGA 2WT4A 2JAXA 5JPIA 5I7OA 3IQWA 3FYTA 3R0JA 3K7EA 2WTEA 3I04M 3PHBE 3K0BA 1PL0A 2ZIAA 3AW8A 3PC7A 4A91A 5BMVF 2IPLA 5HKOA 4AQYB 2P6PA 3BE6A 3T7KA 2JRCA 1VHQA 3EXFA 3HXKA 2F1IA 2AZXA 3ZE8A 3SICE 1KH2A 1RHJA 3RQIA 1TPZA 4NU5A 1LSJA 1KKUA 2X77A 5BWBA 3QIVA 4E21A 5C7IO 3L8CA 5H1YA 4J9VA 5CYGA 1GNSA 1PJQA 1NBMA 2PL1A 4ROSA 1O0CA 1KDVA 2W6JD 1JEJA 4QUEA 4P0PB 3O92A 3FBTA 3LCJA 4CF5A 2CJWA 5LVAA 1VBMA 1R9GA 3A1VA 2WB2A 2EBHX 3QWBA 3WFZA 3VAAA 3NUZA 1TJ3A 4LJ4A 3C3WA 3WHIA 2RE8A 3AHDA 1QIDA 3WZ2A 3G02A 1SUPA 2PZGA 3JR3A 4RH0A 3GZ4A 2Q1XA 4KXLA 2Z5GA 4C3VA 5CU7A 5JT1A 3GAFA 5EE3A 2X0IA 3WZLA 4RX1A 1CIPA 1YRAA 2C5AA 2XQFA 2CL0X 2CNBA 4KAJA 2QENA 2ADOA 3KR1A 4GI5A 4P98A 1IOWA 5H3LA 5THKA 4DFDA 5A1JA 3QX3A 2XXAB 4J76A 4QYSA 5DLEA 4Z49A 2XRYA 4N7RA 1R3DA 2GTPA 2EYQA 3D0KA 5DGTA 1DJPA 2GEKA 3M4YA 2FLKA 1N1GA 2GYUA 3EQZA 1D1QA 4LAFA