3AJRA

Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMFGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 119
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ajrA00
1IB6A 4OL9A 1E3WA 3IUSA 1TLTA 2V7PA 1IULA 1G0OA 2CZCA 3OM9A 5COQA 2RCYA 1S6YA 5JDIC 1I3MA 4FGSA 4BKRA 2C5AA 1U8XX 4ZU3A 2E49A 4MKXA 4L0QA 1W0CA 2EKQA 1DIGA 3P19A 3OQBA 3RIHA 4GL4A 2CD9A 3LC7O 1WZEA 4DPMA 4EZBA 6LDHA 4U5QA 1Q7BA 3AOEA 2FZWA 3QVTA 4NZ9A 1DIHA 3VPXA 1GD1O 2X0IA 1A9ZA 4XYLA 3PEFA 4RO0A 4II3A 4S3MA 5I8WA 3QVSA 2VYND 5JDIA 4J7UA 3ZW9A 4ZRNA 4IJUA 1JN0A 4WJZA 5TT1A 5MDHA 3NEPX 4RVUA 2Q1UA 3PIDA 2ZJ1A 1UZMA 4YRAA 4IIVA 3FSRA 4YT8A 1PIWA 1ONNA 3IJPA 3DL2A 4HFMA 3HDHA 3JD3A 3GAZA 3F4BA 4INAA 2ZCVA 5HS6A 2FPPA 4DMMA 3I52A 3Q9NA 4WNIA 3LQFA 4J43A 3MZ0A 1MLDA 1Y5MA 1D1TA 2FWMX 2W8ZA 3E9QA 1UP7A 5FF9A 3NTOA 2O23A 4Y67A 3AK4A 1XDWA 4IDEA 3GRKA 3LC1O 4DIBA 3H6KA 4GSLA 3SLGA 4B3HA 3QW2A 1WWKA 3ON5A 4OAQA 2HCTA 4YAIA 3V1TC 2Y0EA 4HBGA 3GEGA 4FS3A 5F1OA 3DBRB 1H0KA 1CF2O 3PQEA 5DP1A 4Z9YA 3U62A 3DOJA 4R9RA 3GMDA 4FCCA 2WM3A 3GVPA 3GVHA 3D3WB 4GVXA 3RQSA 1Q1NA 5HWSA 4DA9A 5DDIP 3U4IA 2X0JA 3U4CA 3OIGA 4G81A 1E1LA 1HLPA 3C85A 4K1LA 1PU2A 1EDZA 1LSSA 4A7PA 5KKAA 3GY0A 2JFHA 3HN2A 5C7OO 3LK7A 4FB5A 3H2ZA 2XOXA 1F8GA 1LQUA 1I24A 4ND3A 3K2EA 3RAJA 4PG6A 4BNZA 5B4VA 4GX5A 4WUVA 2YYYA 4R68A 1ZK2A 3TNLA 4WGGA 4FC7A 2Z1MA 3K31A 3SBOA 4GI2A 3DBRA 4A2CA 5IG2A 3WSVA 4IPTA 4JX8A 5DOZA 4CR6A 1ZK0A 2BGMA 4BNTA 2Y0CA 1M2WA 1NPDA 3W4IA 4NNJA 4EJMA 5L53A 3ZWCA 3U4HA 1ADGA 3D3WA 3JQ9C 3HB4X 4TRMA 2H5LA 3PJEA 5CDGA 4UAGA 2NLOA 4CM4B 4PVDA 3VOSA 3EW7A 4J0FA 4RPJA 4ALIA 1B3RA 3PXXA 1T2CA 1U3UA 2AEMA 2EJWA 3H9EO 4I1IA 2NVUB 4F46A 3FPLA 3INRA 1K2WA 5BNFA 2E4AA 4MVJM 1W6UA 4FOOA 3STHA 3WFIA 3INTA 1ZJYA 4IJWA 1X7HA 4IJKA 3FPCA 1DC5A 3QQPA 5T67A 4CUJA 2PZKA 3KXDA 1P9LA 4Z0HO 3EVTA 1DPGA 5G2OA 3WNVA 1PJ2A 1J4AA 5DOVA 1N8KA 3WB9A 2B0JA 2O3TA 2O48X 3GEMA 5BSGA 5L40A 4CM9A 1LQTA 2XAAA 3ZI0A 1GFSA 3ONFA 1I32A 4UVGA 1PQPA 3RC2A 2AHRA 1YQDA 4L4RA 3JD1A 5EMHA 2CVZA 2GERA 4RPHA 3GN2A 1T2EA 2DPGA 2OXIA 4DIOA 1TT5B 4GWKA 3AI2A 4AJ1A 1Y81A 3DMTA 4J1SA 2CVQA 3GQVA 2EW2A 3WTCA 4B79A 1YWGO 2FPIA 5TQVA 4OQYA 1E7QA 4HY3A 2P4HX 2VQ3A 1TVEA 1DSSG 1GZ6A 1NFFA 3F3SA 4CM4A 4BO7A 1W73A 4E21A 3WGTA 1PQUA 1PZEA 1AE1A 2GO1A 4LVCA 5CPFA 3AI3A 5DCYA 3JQGB 1YBAA 4BNNA 5L45A 2NVUA 3U49A 2ET6A 1PSDA 1U5AA 1XSEA 2EXXA 3ADPA 1HE3A 3M2TA 2DTDA 5KVCA 5JO0A 3IUPA 5TF4A 2CDBA 1PGNA 2GNAA 5IFLA 3I23A 2J3KA 2JD1A 3RUAA 4PN3A 1IOLA 1E3LA 4QX6A 1HETA 1BG6A 1Z82A 4XJTA 4YT5A 3ULKA 5G4LA 1T4BA 2IYOA 4DC1A 4MVJI 1WNTA 1YDEA 5T57A 2Y67A 4DQUA 1K6JA 1K3TA 3D4OA 4IJVA 3NUGA 2EP7A 4QO7A 2YQ4A 2CY0A 1TT5A 3NX4A 3HWRA 4BKUA 4IDCA 2C2YA 4M54A 3PWSA 1PS8A 4UVDA 4BKOA 4ND5A 1E3SA 2JL1A 4RVSA 3TPCA 4NBWA 1JWBB 1KC3A 2HU2A 1T1RA 1V35A 4WOKA 4XJSA 2WEKA 1HYGA 3E8XA 2ZYAA 1GUZA 3VAZA 3B1FA 1EVYA 1SCUA 1EBUA 1NASA 2VUSA 4GAEA 1U7TA 1ULSA 1PS9A 2VTDA 3JQGA 4IM7A 5G0VA 4FQ8A 4R3WA 4CM3A 1ZMTA 1NFRA 4RV9A 1P0CA 4EJ0A 1PZHA 4MVJF 4CLHA 5IXYA 1NQ5A 4ESOA 5K0ZA 1JDJA 2GRAA 4UEKA 3F4LA 2OP0A 3KSDO 4YR9A 5T6BA 2JAHA 3K2BA 4NBUA 3TZCA 5L7YA 2IODA 1LLUA 3TZHA 3ANMA 3K8ZA 1PZFA 5CDUA 4DC0A 2X8LA 4O59O 1UH5A 4AICA 5JSFA 2HKIA 4CV2A 4E2ZA 2D8AA 4UUNA 1XU7A 2YJZA 3E18A 5EERA 3MJEA 1R12A 4PFJA 1H6DA 2HRBA 5A9RA 3S2IA 1SOWA 1RM0A 2UV8A 1Z7EA 3PTZA 1QLJA 5TGDA 2Y1FA 1BWSA 4A10A 1N5DA 3PJFA 4GPD1 4NBTA 4ZRMA 3T7EA 1JAXA 1LC3A 4WLOA 4O63O 2GYYA 4R01A 9LDTA 1XQ6A 3PZBA 1R6DA 3SC4A 1V3UA 1X7GA 1B3BA 5I7EA 3DZGA 4CUKA 3UXYA 3DHEA 3WGYA 3GEDA 3MJ4A 3NGLA 5G4KB 4J7CA 4YYZA 4TZTA 3C1OA 1IHYA 3ENKA 4PLZA 5TSDA 3DAFA 1MV8A 2C0CA 3RBZA 4GBJA 1KC1A 1XLTA 4JJIA 4JLWA 4A03A 4AG3A 1ZXBA 3HG7A 1IUKA 1YL5A 2AA3A 3VZPA 5C5IA 3C7CB 1E6EA 4I5EA 5DBFA 4QXMA 1K5HA 4L4XA 1J5PA 4U7WA 3ZU5A 4XCVA 1YGYA 2PH3A 4GH5A 3CKYA 1R16A 2G0TA 3ZWNA 5TLSA 4YTEA 4J4BA 2ZYGA 2VT2A 3E6AA 4R51A 4B4OA 4U0KA 5JDCA 1D7OA 1CETA 3AY7A 3JYPA 4TMFA 1E0DA 3OJ0A 3WGQA 2P9GA 4IMRA 4YAEA 3RUFA 5IDXA 1HRDA 2GR9A 2BHLA 3BXXA 3H9JA 4J3FA 3WBFA 2ZB3A 3VHRA 2WE8A 1YB5A 2NU6A 5BSEA 3TZKA 2O3RA 1NAIA 1Y5RA 4GKVA 4Y6SA 5G4KA 3GVCA 2PWZA 1OFGA 3DQPA 4L76A 1U2GA 5KOIA 5G0SA 5I9MA 2E37A 4P4LA 4OSPA 4KWIA 1R37A 1K0UA 4NU5A 3ASVA 4HV4A 4G2NA 3WXBA 4XGNA 3RUHA 2Y1EA 1LX6A 3JQ6A 1AGNA 1T25A 4PLYA 1QXSA 1V3TA 3GVXA 4IUYA 1PQWA 2Q99A 3ZW8A 1D3AA 1NAHA 4OHUA 3RJ5A 3EC7A 1A4IA 3CMCO 1W8DA 4TKMA 5BQFA 1T4DA 2UVDA 2RH8A 4XGIA 3X2FA 1NM5A 2VHXA 4E0BA 4E13A 1X1TA 1I33A 3VDQA 2JHFA 4RLSA 4RVHA 3C1AA 1VJTA 1PTJA 2QQ5A 5MGBA 4LISA 4LMPA 2NM0A 2NADA 2XXBA 4BB6A 3S1LA 2DUWA 3D5QA 4IDDA 4XQGA 3WG9A 4CUZA 4IZIA 4JNKA 1YBVA 2BGLA 4XDZA 1H5QA 4I9NA 4XD2A 4E31A 4Q3BA 1MB4A 1KBZA 3FHLA 3KUXA 3CINA 3AU8A 4LCEA 4E5PA 1H6AA 2OGUA 4ID9A 5JPIA 3DR3A 4B3IA 4DREA 1R0SA 2QRLA 1P1FA 1RJWA 3OMLA 5I7VA 5A06A 2VNAA 3INGA 3PGXA 4JQCA 1GL3A 2DBZA 2BMAA 3R1IA 1GDHA 3I9JA 3RWBA 3I9OA 4MPDA 1I30A 1BW9B 1ISJA 2VNSA 4H3VA 1BRMA 3EY4A 4M49A 2GN8A 4J4HA 3ZV3A 2X23A 3H9UA 3NRCA 3GK3A 3F1LA 4HFJA 4BQPA 5IJZA 2ZYDA 1ONPA 4J16A 2ZTMA 4LSWA 4Z0TA 3HUDA 2GN6A 3TF5A 4NK5A 3LZ6A 4P38A 2B37A 1B8VA 4FJ0A 1SBYA 2VZ9A 1T1SA 5L7WA 4KMSA 4CM9D 2NNLD 2PK3A 5LCXA 3VH3A 3WQSB 3A28A 4TRNA 3FBGA 3HJAA 2DU8A 3AI1A 1Z6ZA 3IKVA 5B4TA 1I01A 4LN1A 4L9RA 2GN4A 2P9EA 1ZW1A 1B0AA 3DTYA 3WQQA 3ZV6A 2IDZA 1PL8A 4YDRA 2X5JO 3BZUA 4RF2A 3TL2A 1IE3A 5JAZA 4CV0A 4DIFA 1BW9A 1YOVB 5AOVA 1Y9EA 4IXWA 2E48A 1WDLA 3RASA 4IQ8A 4AJOA 4PIVA 5KJ6A 2DAPA 4IDBA 1YDWA 3ZZNA 5JO9A 2EF1A 1SEVA 4II2A 8ADHA 2W98A 4ALNA 5C7IO 3QWAA 3G49A 4W7HA 3A06A 3DC2A 1YKFA 1ZSNA 3H8VA 4L8VA 2XPCA 3BMOB 3N7UA 3PWZA 3OFSA 2D0IA 3LC2O 1CWUA 3ZN2A 2JCVA 3MJVA 1XEAA 2O3UA 1N7HA 2BFOA 3JD4A 4IGEA 2DTEA 2ZTLA 1I10A 3ROKA 4CMEC 4B4WA 6ADHA 3EUWA 2CDAA 4QUKA 4G5HA 2ZTVA 4J91A 1DO8A 4XZ3A 5K6AA 1DDOA 3WR5A 1VKOA 2POQX 4KUEA 4ILKA 4WK6A 3BMQB 2HMVA 2YZ7A 4B3JA 4MVJA 2I5PO 1M66A 4BIIA 1B8UA 2HUNA 3DDNA 3QJ5A 4TSKA 4BKPA 2ZCUA 2X7HA 1P1RA 1A27A 1YOVA 1ZVMA 1HZJA 3AUAA 1U9JA 1WPQA 5I9LA 1WXDA 3GPIA 5KVQA 1UP6A 1P44A 4W4TA 1E7RA 2R2GA 2W2LD 4NU6A 1BXKA 4TVBA 1E5QA 4OOFA 3E03A 4GX2A 3QP9A 4CL3A 3Q11A 1VE9A 4XB1A 4UULA 4WE3A 3CTMA 1XKQA 3JQFA 2B5WA 4ZGWA 2YHIB 2C07A 1QMGA 1FDVA 1T26A 5GZ1A 3O4RA 1ZK1A 1SO8A 2X58A 3BMOA 3WS7A 3ITKA 3WBBA 3WOHA 2X9GA 2TMGA 1GZ4A 1KETA 3RU9A 1X0VA 4EEXA 4UUMA 3F5SA 2YW9A 2HK9A 4J1QA 3ST7A 3C7DB 5DULA 3O8QB 2A4KA 4BNWA 3BMQA 3VH2A 3ZNOA 1YJ8A 3I4FA 2CVOA 3PDJA 4IY1A 4PLFA 2I65A 3C3XA 4XIYA 2D4AA 2O2YA 4CODB 2W90A 5HS4A 1HYHA 1L7DA 3G3EA 4R1NA 5JXWA 3JQAD 4AJJA 3VPHA 4BO5A 3K30A 5B4UA 3RCBA 1C14A 1IHXA 5BNTA 1NHGA 4L75A 1FDWA 1QYDA 4DTIA 1QORA 4F45A 1KVUA 3LF1A 2GZ1A 1BTOA 1YB4A 3GDOA 1WDKA 2E6UX 2YHIA 2PGJA 3DZBA 1M67A 2R00A 4XR4A 4LMRA 3TRIA 1DEHA 2AEJA 5CP8A 1NWHA 4ITUA 2P68A 4NFSA 2PD6A 2HMWA 4EW6A 3RSHA 4ZQBA 5KCZA 4CM8B 1Z74A 4WKGA 3R6DA 5F1PA 4D79A 1NQTA 4OQZA 4CMBA 2BH9A 1DRWA 4ZJUA 1HDYA 3AWDA 3O8QA 3I5MA 3OEYA 4HNGA 4BNGA 2HLPA 2UAGA 4MINA 3LT1A 3HQ4O 1HYEA 3KLPX 1LEHA 4W99A 4RF5A 1I5RA 3JQEA 3DHNA 3PFWO 5KJCA 5JAQA 4CMGA 1U3TA 3VPSA 4KTVE 1U4SA 1ML3A 1N7GA 1DJQA 4FD3A 4D42A 1E3JA 4BNMA 4IBOA 4Y6PA 5JW6A 1IL0A 4J2OA 4ZHSA 3D4PA 1NFQA 1CQJA 3WLFA 5FWNA 1LSOA 3DZKA 3IIEA 1H9BA 3HB5X 5CEEA 1VSVA 2UYYA 1P1IA 2BI7A 1H6CA 2JCXA 4E2XA 1ZSYA 5IZCA 2J5QA 3TFOA 1GEEA 2OP1A 3M1LA 4U6QA 3LDHA 1U3VA 3DOCA 3Q6IA 1PJ4A 1CEQA 3QVXA 4QECA 4CM8A 1QG6A 4HXYA 3T7CA 4IMPA 4RVGA 1LRKA 4NMHA 1XGKA 2P5YA 3ZV4A 4YT4A 1NXQA 2OORA 3RBVA 4M87A 5C7LO 3PFFA 4D44A 5IN4A 4DWVA 1EBFA 4AVYA 4W9NA 4ALJA 3SC6A 4GWGA 2VWHA 2C54A 3OSUA 3PPIA 3L07A 3OJLA 4PLVA 5EJ2A 4NBVA 4AJ4A 1C1DB 4Q39A 3WNQA 3O03A 4KTTE 3NKLA 1CQIA 2O3JA 4FC6A 2NUAA 4WEOA 4CR8A 1JVSA 2PR2A 4N54A 5GZ3A 4JK3A 4M89A 5A1TA 1UUFA 3V8BA 1UXIA 2V6GA 3UGKA 3JTMA 4AJ2A 4B8ZA 2E82A 2QRJA 4UREA 4OKIA 3JYNA 4PRLA 4JIGA 4OXNA 4IINA 4NHEA 3VVBA 5JY6A 4PZDA 3FTNA 5TRTA 4WLNA 4CMAA 2O3SA 4PCVA 1U3WA 1HF3A 3E9MA 3UAGA 3MOIA 4XRRA 4YQYA 1GEGA 1X0XA 4E12A 2WYWA 1EDOA 3G1UA 5AQ1A 1VL8A 3ZNQA 3O26A 3B70A 1PJCA 3BTOA 4N7RA 2BFPA 4XWYA 3PYMA 1B8PA 4DYDA 4YJHB 4BO9A 5ITVA 2D5AA 1XCBA 2NTVA 2FY8A 2VWGA 3DOOA 3JQBA 5JC1A 1C1DA 5DN9A 1HKUA 2BRUA 3JQ7B 3DFUA 2VT3A 2VYVA 2JAPA 3D3EA 4CV1A 3AY3A 2Q1WA 1SOVA 5DCWA 5B1YA 2C59A 1J6UA 1IYZA 1RKXA 3HNPA 2Q3EA 2PY6A 3LF2A 1P1KA 4XYGA 5L95A 4ONEA 5KJEA 1NWCA 2P2SA 1KOLA 4DYVA 2PA3A 4EITA 2RHCA 3JD0A 3C7AA 3BIOA 1YE3A 3GC6A 4WPGA 1F0YA 4GKBA 1WW8A 3H9GA 3OQ6A 4RPLA 3DO5A 3GA0A 4DQVA 1ISFA 1GY8A 3E5RA 5JNLA 1A9YA 2BLLA 1Y1PA 4D41A 1NPYA 3NDRA 1DB3A 1OI7A 4J1TA 5H83A 2HMUA 3W6ZA 2X6TA 2QX7A 3BHMA 3GOHA 4Y8VA 4CLDA 4NJOA 2HK8A 3TZQA 4YJHA 3DMTC 4TZKA 4FFOA 2IE0A 1DC6A 2FSSA 5JMWA 3JQ7A 4R1UA 3ZGYA 1P45A 4KZPA 1B16A 1HDXA 2UUPA 3AUUA 1DIBA 4D3DA 3IOYA 2GF2A 1GPJA 1D1SA 4MIYA 3RFTA 4D0RA 1XG5A 3W1VA 3EGOA 5EIOA 4YWJA 4OKNA 2VTEA 3HDJA 2Y66A 1EQ2A 2CF5A 3PWKA 4CMJA 2QYTA 4K26A 1P33A 2OZPA 3AY6A 3GR6A 4CLXA 4ZVVA 4J0EA 5JC8A 3QWBA 3WGHA 1E92A 3LT4A 4CQLB 5KJFA 4Z9FA 2BKAA 2GGSA 2WD7B 2BF7A 3VH1A 3ZHZA 4HFRA 3A9WA 4YQZA 5H82A 3L4BA 4EJ6A 1Y7TA 3KYBA 1CJCA 5HA5A 2B4TO 2I67A 3HFSA 5K9ZA 1MFPA 1NPTO 3H9QA 2V6BA 4C7KA 1ID1A 1GV0A 1JU9A 1NP3A 4AJIA 1V8BA 3CMMA 1YXMA 2J3HA 1T2FA 4N18A 2H9IA 4JJFA 5JMPA 1RYDA 4YVFA 2DUUA 2IZ0A 3VC7A 4HX5A 2QZZA 4ALKA 1NQAO 1ZKMA 1HDGO 3DONA 3ZU4A 5JAIA 4WLEA 5CAEA 2H6EA 3ASUA 2CF6A 3UFXA 2RIRA 1LRLA 4J1NA 5HM8A 1P0FA 3D1LA 3PZRA 4JJGA 1LLDA 3UOGA 3LT0A 2FSVA 4EGFA 3ICPA 2VZ8A 3L77A 1QYCA 1GCUA 1FDSA 1UDBA 2EV9A 4CQLA 2GLXA 4BS9A 1HE5A 2WD7A 1HZZA 3ZH2A 2NV6A 2ZB8A 3WWYA 3K6JA 3M1AA 1JA9A 2VRCA 3E48A 5DCUA 3WX0A 4A26A 4YPOA 4DMLA 1FJHA 4UVIA 2WWRA 2I9PA 4DVJA 1A7KA 4Z0PA 5AVOA 4DQXA 1EK5A 1GYQA 3HSKA 1LU9A 1ZFNA 2O4UX 1KVRA 2XF8A 3R3SA 5F21A 1UDAA 3H5RA 5EESA 4W82A 5ADHA 4IQ0A 3NAQA 3KRTA 4FFPA 3U9LA 1BVUA 1MGOA 3KYCB 2GZ2A 1GR0A 3AFMA 4HP8A 2VHVA 4BNJA 3CIFA 1IY8A 4R5HA 3CXRA 3EHEA 4N5NA 3GAFA 3KSZO 5JE8A 2FMUA 4BNIA 4MP6A 4NK4A 1H2HA 2Q50A 3HDYA 4YACA 1FMCA 1I3LA 1OAAA 1TA4A 1ZK3A 2X0RA 1R66A 3F5QA 3ONDA 3NV9A 3NDIA 3AM5A 5IXSA 2Q2VA 1FXSA 4O6VA 5JYEA 4ND2A 2I3GA 1GQQA 3I6IA 4XR9A 3W8EA 1GTMA 3QHAA 3AUTA 4OXYA 4A73A 2ZKLA 3GFGA 1TI7A 2G76A 3CEAA 3IS3A 5L9AA 4HADA 4E5YA 2JD0A 2PLAA 1GAEO 3DBLB 5AXDA 4YBZA 2GCGA 3WJ7A 2DM6A 3PLNA 1DXYA 2JHGA 1VLLA 1F8FA 1PWZA 3F1KA 3HE3A 5JDCC 2DBVO 3PHLA 2O3QA 3JYOA 3W4KA 4BNLA 2NSDA 4CM5A 4CM6A 1E1KA 3WIEA 4YAJA 4M55A 4R1TA 4BB5A 1BVRA 3BA1A 3KYCA 3GGGA 1P1HA 4E4YA 1U1IA 3C8MA 4QO8A 3WGZA 1DRUA 2IZ1A 1ZUD1 3ETDA 2AQHA 3JD2A 2CFCA 5BSFA 1J0XO 5JCJA 4PLCA 4QEDA 5ICMA 2VOJA 2VCYA 3VPFA 2G17A 2AXQA 2EJVA 2QYSA 3NDJA 1EQUA 3D5TA 1PEDA 3PLRA 4BMNA 3VTZA 4HWKA 5EPOA 5HBRA 4NDNE 4XIJA 4BV8A 4WCDA 1QRRA 4LGVA 2QW8A 3RC7A 3A14A 2CMDA 2GDZA 3FI9A 3JYLA 3DZFA 4RQUA 4PRKA 4NG5A 5CDTA 2Q45A 4YAKA 3DEYX 3UCFA 4TVOA 1EUDA 3IAHA 4D46A 5T8KA 3WFJA 4A5OA 2J5KA 2W2KB 3QV1A 3L4SO 2PZMA 4J4TA 5G0UA 1UP4A 3DBLA 1DFGA 4FPXA 5FI3A 1NHWA 1JWAB 1LRJA 4E3ZA 1PJLA 3RFXA 3LLVA 3V1YA 3ROQA 1WAMA 3T4XA 3FNHA 1ULUA 3Q1LA 2NTNA 1WVGA 4K6CA 1T2AA 2BFMA 4BV9A 2D2IA 4JBGA 1VRWA 3AM4A 1PX0A 1UDCA 5T64A 3SJUA 2Y1CA 2OMEA 1GUYA 3Q0EA 1LLQA 1VL6A 1BMDA 2FRDA 3RC9A 3FF4A 2VYVD 4Y6RA 1VJ0A 4CR7A 3L9XA 1F17A 1KYQA 2JD2A 1FDUA 1ENOA 5FEUA 5F1KA 4FJ1A 4GLLA 4BKQA 4RJTA 3EK2A 3CUKA 3JQDA 2J3JA 2ZQZA 4RF4A 1E7YA 1F14A 2W2KA 1A7AA 2YV1A 3DZJA 4FSHA 2AE1A 4R41A 3G79A 4GGOA 5DBGA 2EGGA 3WYEA 3PI7A 4IGFA 2HDHA 3B1JA 4FFLA 3JV7A 4AJEA 2VYNA 5IZ4A 2C82A 5L4NA 2YY7A 2O50A 5JYDA 4D7AA 4GGPA 4DL9A 5CEFA 2QHXA 1HL3A 1HLDA 1LDNA 4IQGA 4IS3A 3ZWOA 3VDRA 5CHEA 2PD4A 1KEWA 3RD5A 5A03A 1PZGA 1YH3A 1UAGA 3G17A 4WCFB 2H63A 3DB2A 5BSHA 2YV2A 1YS4A 5FI5A 3MJSA 3ZWWA 4BHTA 3DZHA 4QQRA 3GDFA 1K6IA 3B20A 4OH1A 3AFNA 3GT0A 3V2UA 1PL6A 1Y9AA 4W6ZA 5CFZA 5ICSA 3DZIA 2AG8A 1M6HA 2ZB4A 4ZA2A 3PK0A 1C0PA 4WCFC 1U5CA 3EDMA 2RHRA 3OQ1A 2X86A 2D5CA 4AFNA 4AJHA 3PJDA 3I83A 5JAMA 5G0WA 2HSDA 2IXBA 4F6CA 3RUIA 1HDCA 1MX3A 4O1MA 1MUUA 4GLOA 2VHWA 1JQBA 5CDSA 1PJBA 4UEOA 1Z73A 3WQRA 3QWIA 1YONA 5KVSA 1XA0A 3WGGA 5A3JA 5K6AC 1JKJA 2P91A 3HZZA 4XYBA 4BNVA 1NX6A 2IYPA 3ZWMA 2EKPA 4Q3AA 4WCFA 3I9NA 3GDGA 4OGWA 1E5LA 3ZWXA 5A9TA 3H2SA 2J3IA 5TT0A 2DLDA 3WGIA 3P2YA 3EZLA 4KDFA 3FWZA 4NJMA 4CLOB 4ND4A 3KTDA 4RGBA 1LXCA 1EVJA 3PYXA 1IPEA 2DBRA 3ZWAA 5JY1A 3QRWA 5FFFA 2NWQA 4EI2A 3QLJA 1LC0A 4MKRA 4DBZA 1DFIA 2EGHA 4FFRA 1WDMA 5L7TA 1PR3A 2YQ5A 3V2GA 5BNIA 3EZYA 1CYDA 3JQCA 3JQFC 3GPDG 1KIFA 4QFCA 5C3MA 2QZ9A 1E3EA 2DQ4A 4A27A 1RPNA 3SX2A 2NU8A 1RM3A 3OHSX 2VRCD 4B4UA 3DAPA 3FR7A 4PZEA 3DMYA 1ZBQA 2G82A 4ZD6A 2RAFA 4EDFA 1LDEA 3VZRA 4PLTA 3GG2A 2C29D 1HDZA 1CERA 3FN4A 4BMVA 1FF9A 3RC1A 4R69A 2WYVA 4BNXA 2Y1GA 1BGVA 2WE7A 1Z75A 5KIAA 4BNUA 3IDSA 1S7CA 1YL7A 5JFOA 3GUYA 1O89A 4O0LA 3TOZA 2NTJA 3VZQA 2PKQO 1LI4A 4NBRA 4NI5A 4DXHA 5IDWA 4ZN6A 4E2YA 4CLOA 2X9NA 1A4UA 2UDPA 4L73A 3T4EA 4D3SA 2IXAA 2UUOA 2AEFA 4PG8A 4N5MA 4N5LA 1BDMA 4I08A 5IF3A 1I8TA 4BO1A 2GASA 2BGKA 5TJ9A 4MDHA 9LDBA 1ZK4A 2DBQA 2AQIA 5B12A 1R4MB 1A5ZA 2PKRA 4XQ9A 1DRVA 3FNEA 1ZXLA 4YRDA 4EYEA 1DJNA 3E5MA 3GHYA 3GFBA 2R00C 4J49A 3IC5A 3I9LA 4W7IA 4BO3A 2PZJA 1Y8RB 4CPDA 1G0NA 1MC4A 5F5LA 4YAGA 3RVDA 2Z1NA 4IDFA 2B35A 2P9CA 5I7FA 1Q7CA 1R15A 2YFHA 3V5NA 3EAGA 1TXGA 5JBIA 2GPTA 5T5QA 3BTVA 2EW8A 5EL0A 3TFQA 4BMSA 4R16A 2Q4BA 4WLVA 4D45A 4BO0A 3R3JA 2HJRA 4MVJH 1D4FA 3U3XA 2PD3A 3DFZA 4EUEA 1VL0A 2X5OA 1GZ3A 1O94A 1U4OA 2JKVA 2B36A 2WYUA 1DIRA 3NT2A 2BELA 4DPLA 2QG4A 2JFGA 2NQTA 2LDXA 4LRTB 4ALMA 4BNKA 1XELA 1R4MA 5JCXA 4Q3DA 1OMOA 4DRYA 1GYPA 2VUTA 3CPSA 1KS9A 3IP1A 1X13A 2NU7A 4RZIA 5IZCC 4HUJA 4JBIA 1Y8RA 1F06A 1KEPA 1HE2A 3H3FA 5GY7A 2GD1O 1F12A 4BO4A 1XYGA 2NVWA 3PVZA 3ZHYA 1QSGA 3C1TA 4JXKA 4DLAA 4HNHA 4RL6A 5HTOA 1PGPA 2TMDA 3WSWA 3VZSA 1DHRA 4TQGA 4KQXA 3O38A 1ENYA 2GN9A 2I76A 4I5FA 3ZNNA 5CPBA 1Q0HA 3UCXA 2ZIZA 3K96A 4FW8A 5THQA 4NH4A 1NR1A 1VPDA 4ALLA 5DF1A 1HSOA 1ZO8A 2NACA 3KV3O 5EN4A 1LUAA 2R6JA 4K9DA 3GUCA 3I4CA 4MIEA 4W9NC 2ZATA 1GYRA 4FFMA 5CG2A 2V6FA 2Y1OA 2X4GA 1YL6A 3M6IA 3GZ4A 3S2EA 3EMKA 4H7PA 4OOEA 2WD8A 4QFDA 4BO6A 4Z3DA 5IDQA 3GMSA 3KSUA 1AXGA 1KERA 2FR1A 1C1XB 4IXTA 8LDHA 4CQMB 4LVUA 4TKLA 1DFHA 1SAYA 1QV7A 1DC4A 2Y93A 1HDRA 3QVOA 1G6KA 4AJPA 2J5RA 3BAZA 3F9IA 1PJ3A 2CDCA 1UR5A 3B6ZA 3KVOA 1QYXA 1ZEJA 5BT9A 3KEQA 4OIMA 4YJDA 4CV3A 3KZVA 1PWXA 2GSDA 3Q3CA 3VPGA 4OSOA 2AE2A 3MTJA 4WLUA 3TZ6A 1EVZA 3D0OA 3GG9A 4FN4A 2DKNA 2IEDA 5KWEA 5AXCA 3PP8A 4C4OA 3KLMX 1OC2A 1ORRA 3F6YA 2AMFA 2QRKA 4J6FA 4L4SA 1KVQA 2PV7A 5TX7A 3QA9A 5EQDA 2CUKA 4FBGA 1EMDA 5AXBA 5AXAA 4XKJA 1MG0A 3JQBC 1EEHA 3PGJA 1P77A 1Q0QA 1LNQA 2C2XA 2XXJA 2YDXA 2YV3A 3BTUA 3ETEA 4YB8A 4DLBA 5CEJA 3I9KA 2JCYA 4WOJA 5A5FA 1C1XA 3O9ZA 2Q1TA 1ENPA 2Y05A 4CQMA 5ILOA 1WZIA 2Q4EA 3SVTA 2PH5A 2OO5A 2B83A 4R54A 2D59A 4XX0A 3MEQA 1E6UA 3ANLA 3PHIA 3VVCA 1HWYA 2AQKA 3ZU2A 4E33A 1JKFA 4IIUA 4FGWA 3D4NA 1BDBA 3FRJA 1U2DA 2RBEA 3U4DA 4BGIA 1DLJA 3FTPA 5KKCA 4ZQFA 3IQDB 2NQ8A 1LSJA 1ARZA 1ISMA 5DZSA 4CMKA 3COSA 1QV6A 1SC6A 2C7VA 2FZEA 3OJEA 4U6SA 3AJRA 1BSVA 2D1YA 4CMHA 4E5NA 2BD0A 1ADBA 1EE2A 2X1HA 3H5AA 3RUDA 4BNHA 4C7JA 2V6MA 3DHYA 3WICA 3WYBA 1B7GO 4BO8A 4GSKA 5B37A 3MCVA 4NFHA 2B4QA 5KNLA 3UCEA 3OECA 1QYWA 4DPKA 1QR6A 4Y98A 3F47A 5COAA 1AUPA 2JFFA 4NR0A 3S2FA 2GZ3A 2FPGA 1C0LA 2AW5A 1T2DA 5LC1A 2DPHA 3FD8A 4LW8A 1P3DA 2FHSA 4XDYA 2OOSA 4BUCA 1AXEA 3TSCA 3RBXA 1JKIA 4R3NA 1ZMOA 3MOGA 4TRJA 4EUFA 5L4SA 3TDKA 3LSYA 5ITWA 2X5KO 4XQCA 3E1KA 1O5IA 1H93A 2A9FA 1FK8A 4ZQEA 3LT2A 4S1VA 4XGKA 1H6BA 1V9LA 1T24A 1KY5A 4IS2A 3WGOA 3FCOA 2DVMA 4JP2A 1M75A 1U8FO 4D3FA 1E1NA 4MVJD 3L4BC 3HADA 1NNUA 1IZ9A 3AM3A 4E5KA 1ISIA 3DXFA 3D64A 3PDUA 3LLSA 1N2SA 1SMKA 5JLAA 3ABIA 3ROPA 3K9QO 4BQRA 3BMCB 1UXHA 4E32A 1GADO 2B69A 4XB2A 4H16A 4JCOA 4U0JA 2VHYA 4PZCA 1G1AA 1TEHA 3L6DA 4PVCA 1CDOA 1VI2A 3DBHB 1EUZA 1I2BA 4RORA 2DT5A 3X2EA 4X54A 5EQFA 1VKNA 5HRUA 1ZCJA 1EVIA 3LU1A 1H9AA 3SXPA 2A35A 3JQ9A 5L51A 4B4VA 4H15A 4I9UA 3EYWA 4BVAA 1R0KA 2OFPA 4E6PA 1DHTA 2P5UA 2O2SA 1K89A 3TN7A 4J9UE 3QWFA 1A71A 1GUFA 3U09A 1UZLA 1UXKA 4CLRB 4YJFB 1Z45A 3GHHA 2IEBA 1E3IA 1WMBA 1KEUA 5THKA 4RQTA 1PGQA 3Q9UA 4GX1A 2OBNA 2QIOA 3MWEB 4R1SA 4R9SA 4RZHA 3VH4A 5U4QA 4I5GA 2Q1SA 4J90A 3TL3A 3VTFA 4U8GA 3ZWBA 4AJNA 4MVJG 1O8CA 3BMCA 3PYLA 1MXFA 1ADCA 2EG9A 1VSUA 1DAOA 3OIDA 3VKUA 4KUGA 4Z3KA 4BO2A 4TWRA 1X15A 3DBHA 4WASA 1PR9A 5ES3A 5ILGA 1HE4A 3UHAA 5U1PA 2X9VA 3ICCA 1X14A 4K6FA 3WJAA 3Q2IA 3K73O 5H81A 1BXGB 4R5MA 4BL5A 2PFGA 1O9BA 3TWOA 3ZV5A 1E7SA 1NVGA 4J9VA 3IP3A 1IZ0A 5IN5A 2W4QA 2HAEA 3MTGA 1B14A 1A72A 3FR8A 1RM4A 4UEJA 1QLHA 1ZJZA 4E2WA 4RDHA 2DFDA 4J7XA 1NQOA 4CLRA 4YJFA 1NYTA 1OZAA 1ZIDA 3C24A 3S8MA 3TJRA 4YEDA 4EBFA 2F00A 4QSMA 3WWZA 3PHGA 4RLHA 2VWQA 5U9CA 5A4DA 1D8AA 5ENVA 3OICA 4UVHA 2FN7A 1DC3A 1Q0LA 3G0OA 1Z7BA 3GRPA 2HMSA 4KOAA 2Q2QA 3RKUA 3SEFA 5I9NA 2WMDA 4FIZA 3UKOA 3WLEA 2WDZA 3V2HA 3ANNA 1AN9A 1VJ1A 2ZB7A 5LDGA 4CMIB 5ER6A 3GGPA 3S55A 3JQAB 3NJ8A 4EEZA 3H65A 4FR5A 1H94A 2CNBA 2W2LA 1PJTA 4GMFA 4ND1A 4F6LA 2HRZA 4MO2A 1MG5A 5A9SB 1BXGA 1R4NB 1K6XA 3G1TA 1H2BA 3L6OO 3PRJA 2VHZA 4I5DA 2J6IA 3VKVA 3OBBA 3ONEA 1HSZA 2AG5A 3Q2KA 2NU9A 4ZQGA 1ISGA 3OEWA 4XA8A 1EZ4A 1ZSVA 1GQ2A 2BI8A 2P4QA 2VRBA 3L6EA 3ORFA 4MP3A 4XEHA 1OOEA 2VWPA 1RYEA 5A05A 1EFKA 1GCOA 1PS0A 4I9HA 5GZ6A 5TIIA 1OC4A 3MJTA 2A92A 1KVSA 3QSGA 1MC5A 4KQWA 4DGSA 3ADOA 3ZDFA 5T8KC 3HDQA 1AHHA 1C0IA 3JQ8B 4RPKA 3UF0A 1GU7A 1X7DA 4CMIA 3F46A 1I2CA 5LDHA 4LRSB 3CE6A 4KUHA 1P31A 3JQAA 4JP3A 3CZRA 4IDGA 1OBFO 1MP0A 3OETA 3TQHA 3IJRA 3ITDA 3OIFA 5A9SA 4RF3A 1R4NA 3OJOA 3CH6A 4OM8A 3ZCXA 4BNFA 3UN1A 3QY9A 4M1QA 2G5CA 4RVFA 1P74A 2VOEA 1HEUA 1LA2A 3GN1A 3R0IA 4E5MA 3KO8A 4LSMA 4ZQHA 4EUHA 2SCUA 4CQMD 1YQGA 1I3NA 3AOGA 2IZZA 3GH3A 3N58A 4Z9XA 1DOHA 3UH1A 2OHXA 2ZTUA 1U28A 4BNYA 3ZHBA 3SLKA 4GMGA 2B5VA 2HJSA 3GGOA 5CG1A 2I6TA 3U5TA 1NTOA 1QP8A 2C20A 2EIHA 1UZNA 2G1UA 3JQ8A 1CRWG 1MA0A 4IZHA 3IKTA 2V65A 1ZH8A 3HN7A 3ZNPA 3GZNB 3KB6A 4I8XA 4RCVA 3B1KA 3ENNA 4WLFA 4PG5A 4AJKA 2FR0A 3OJFA 4KP7A 3ZWVA 1EFLA 2ZK7A 1BXZA 4PLWA 1PL7A 3I6QA 4DUPA 1X1EA 4YA6A 4XYMA 2LDBA 3A4VA 2HMTA 1VC2A 3OA0A 3OA2A 1XHLA 3LYLA 3PQDA 2J8ZA 1LDGA 1MFZA 4FOSA 3LVFO 3I9MA 1SB8A 1LDYA 2YHUA 4J2HA 2PNFA 3W4JA 1LLCA 1SZJG 2C7GA 5COBA 4BOYA 5CDYA 1L1FA 1B15A 1PJSA 1XQ1A 3K92A 1LDBA 3PQFA 3WYCA 1GPDG 5L4LA 1Q7GA 2WTBA 4RVDA 1XU9A 2A94A 2YDYA 1UJMA 5F5NA 2WSBA 4OXKA 4O5OA 1QYVA 3KM0A 3OH8A 2EWMA 1KVTA 4FDAA 3S2GA 3AU9A 4FJ2A 2PTGA 3RKRA 4RPGA 2X22A 4Q9NA 1LSUA 2RH4A 4OYRA 4MIOA 3P5SA 2B4RO 2HQ1A 3IL2A 4Q3EA 4WEQA 4MP8A 1SPXA 1M76A 2O7SA 3E9NA 3GZNA 5TS3A 1TT7A 3ETGA 2VUUA 3I1JA 3DBVO 4B7CA 4Z6KA 3BYZA 2JJYA 4JROA 4LCJA 4P4GA 2FOIA 4QT0A 1Y6JA 1KEVA 3BMNB 4Y9DA 3UVEA 4UUOA 5J23A 7MDHA 1ZNQO 2OBYA 2WJPA 4NJMB 3A1NA 2IRWA 3NGXA 2Z95A 1V3VA 1C0KA 3H4VA 2Y0DA 3JCZA 4HFNA 1B2LA 5JS6A 3GVIA 1ZEMA 3ZHXA 1ADFA 2Y99A 4NQZA 2C5EA 2OUIA 1YO6A 3PHJA 3NYWA 4IDAA 4MJLA 4TRRA 1R0LA 1JW9B 3GF4A 4GQAA 5BR7A 1LTHR 3ROMA 5TNXA 4UUPA 1RM5A 1P1JA 4FFNA 3W8DA 3W6UA 4HKTA 3N74A 1L7EA 4YJGB 4YCAA 4DLLA 1SNYA 4UVEA 3PHHA 5A5EA 1N9GB 3L0DA 2YUTA 4L74A 3ZWYA 2VN8A 4GVLA 4P8RA 1FDTA 5AYVA 5TJHA 4DBVO 4JN6B 3MWDB 3NJ4A 1JVBA 4B8WA 2D3TA 1E1MA 3WMXA 2NVBA 1WMAA 4XQEA 3GNSA 4CMCA 4CL8A 1EUCA 4P4NA 3CSDA 4D43A 3E82A 3DAGA 4JGBA 3FBTA 2EHDA 1QKIA 2FR8A 3AUSA 3BMNA 1HTBA 5A04A 1ISHA 3GNTA 1DBVO 1DAPA 4PG7A 1O0SA 4RDIA 4XRGA 3RJ9A 3TOXA 5GMOA 3WDSA 1N1EA 3FWNA 2DC1A 5FYDA 4CLEA 4WECA 3EVNA 2Y68A 1UAYA 4F3YA 4B7UA 1C3VA 3CZMA 3UUWA 1VM6A 3ZWPA 4A0SA 2Q49A 1J49A 4YJGA 1UXGA 3HHPA 3QVWA 5ER9A 1CIVA 3RUEA 2PZLA 3JSAA 1N9GA 3JYQA 4JBHA 4TROA 3MJCA 5DNAA 1RWBA 4GX0A 5DBIA 3W8FA 4OMUA 2X0NA 5I8ZA 3RI3A 3H7AA 5L3ZA 3M2PA 2I99A 1W4ZA 5F3RA 4MKZA 4URFA 4ZICA 1Y8QB 2Z5LA 2PKQP 1MXHA 3KYDB 4WNCA 1E7MA 2F1KA 1NBOA 4AJLA 1DIAA 2ZQYA 1AHIA 3GLQA 1PGJA 3BHIA 1BHSA 1U7HA 2EKLA 5C37A 1NVMB 1I2ZA 4CM7A 3BHJA 3QE3A 4Q3NA 2OL4A 3RROA 5IAAA 1HT0A 3WIDA 7ADHA 1SEPA 1EE9A 2HO5A 2Y1DA 3H3JA 4PLHA 2I3AA 5DT9A 5KTKA 1NR7A 1UXJA 5TC4A 5A3VA 4CMEA 1HXHA 3D7LA 3FNFA 4M8SA 4P22A 2FP4A 1V6AA 3FNGA 1SB9A 3UW3A 4OO3A 1LBEA 3NT5A 3OF2A 4YXFA 2VZ0A 3NTQA 2O4CA 2H1SA 1M6WA 1PJQA 3L9WA 4PG4A 4AL4A 2EP5A 1B26A 2Q46A 1GV1A 1KY4A 3H5NA 4MVJP 3QIVA 4MOWA 1YB1A 1Y8QA 4NIMA 3KYDA 3WTBA 3U0BA 1YJQA 1YBMA 2EERA 2BFAA 2PGLA 1JAYA 2AQ8A 3PIIA 5KJ1A 1XWFA 1XIVA 1IPFA 2ILTA 3KETA 1TB4A 2EEZA 4CJXA 2I66A 4R4JA 3KBOA 3OP4A 4OJNA 3P2OA 4NFYA 5JCJD 1N92A 3BTSA 1JLLA 1E3WB 4E30A 3V1UA 1I36A 1GQYA 3DTTA 4KWHA 4PGFA 1NVTA 3SJ7A 4B7XA 4M86A 4D0SA 3KOUA 3PJGA 3IMFA 1XR3A 2DTXA 1YRLA 4BGUA 3DWFA 4MVJE 5KVVA 1DLIA 4ROSA 3WMWA 3KEOA 3UICA 1PGOA 1WP4A 3KHUA 4YT2A 4XYEA 1E77A 1EK6A 4QTZA 1HDOA 2HK7A 1JTVA 4NPCA 2Q2WA 1E7WA 2GUGA 2YFQA 1YQXA 4PLGA 2ZJ0A 5IDYA 1ENZA 3GNQA 4YRBA 3RU7A 5G0TA 4BGVA 5EINA 1Q2XA 2PGDA 5A02A 3AW9A 3I3OA 3QWHA 2O7QA 1V0JA 3NTRA 1WLYA 1E6WA 5ENDA 1I3KA 4K28A 5DP2A 4KDEA 1LJ8A 1O6ZA 3NT4A 4PLPA 1ZZEA 1I0ZA 2DFVA 3K5PA 3RFVA 1LDMA 3P7MA 4LK3A 5I7SA 1ONOA 3ZU3A 4BGEA 1O95A 1N1GA 3HFGA 2CSUA 4CM1A 3RUCA 3AOEC 1YVEI 4G65A 4Q3CA
chains in the Genus database with same CATH superfamily
1N2CA 1ESZA 4C2AA 1GSHA 3IUSA 1TLTA 5FI0B 1BKYA 3WYGA 3D3QA 2XCSB 2P2ZA 4DIMA 3AM1A 2G6BA 2RCYA 3HYRA 4BN0A 1NDQA 1Z2NX 3L0OA 1SQ0A 4LV5B 3T9BA 2O05A 4FGSA 4F92B 5EXSA 4MJ7A 4YMWA 1JEOA 4BEWA 3QLVC 5KUTA 2C5AA 2Q9BA 4HS4A 4CIDA 3IP8A 2E49A 4PHCA 2ZUEA 1RKUA 4MTLA 3BT7A 1S4MA 1V5EA 2AN3A 2EKQA 1K2VN 1GTZA 4KNWA 1CQZA 1XTSA 2F8MA 2BVNA 3P19A 3RIHA 5B1EA 1J7KA 4GL4A 3LW8A 2PBRA 2WIAA 4LK2A 5BQ3A 5FOWA 1BHO1 1WZEA 2V6IA 4HXFB 5FBKA 1QG0A 1SHTX 2A86A 2NTEA 2Q6KA 3D1JA 3KLNA 4QLAA 4BFYA 1E18A 3QOWA 1DIHA 2CK3D 4NZOA 5FI1B 2R8PA 4KPFC 3RIGA 3VPXA 4D5EA 1IN8A 4NCHA 2FZ5A 4XYLA 3PEFA 5I8WA 3RREA 4S3MA 4EKEA 4Z4FA 1NVDA 1E3QA 5FR1A 1DG3A 1DZ3A 5JDIA 1OH8A 1DKMA 4DTCA 2M6RA 1YNOA 1CUFA 1JN0A 5IBQA 2K2WA 1PTKA 2VHUA 1BDHA 1V8PA 1D2CA 2R5WA 4N7BA 4W6QA 5TB5A 4EUSA 2NAPA 4YRAA 4C0HA 1Y6QA 1GPKA 3FTFA 1UQTA 4LJ6A 5AM4A 1GARA 1ZRSA 1ZUWA 2X6RA 3TMKA 2YRFA 1FRZA 2V45A 3TR5A 1UC8A 3AF3A 2I2DA 2KI5A 2ORVA 2R1UA 2XTJA 3GAZA 3PD0A 4INAA 3G9ZA 1UMDA 3VC2A 4DARA 2GEKA 5TVKA 1UFKA 3I52A 4Z4EA 5IBPA 3MMSA 5ICGA 3LQFA 4EY3A 4BU1A 8ABPA 1C7FA 5HDQA 4ZYTA 1JNXX 5FF9A 3NTOA 2O23A 1NIJA 4Y67A 4YJ2F 3B85A 4IDEA 4DLNA 4EWLA 4YCCA 3IMEA 3QBTA 1IQRA 5HQ3A 4LC0A 3LC1O 4PEVA 1HY3A 2W0MA 3BF8A 3WLRA 2CV0A 2GRJA 2W2OA 2VKTA 2XECA 3VYSB 3QW2A 5G41A 5ARBA 2H1OA 1R10A 4MSUA 2HCTA 3JRWA 5BY2A 4IRMA 3V1TC 1E9RA 2EVWX 5D87A 5JXIA 1GAWA 4X44A 5F1OA 3U62A 2J1LA 3T3NA 1JFSA 3ICQB 2WFMA 1L5RA 3DOJA 1NVVQ 3G8DA 4R9RA 3T0FA 5K0CA 3Q7TA 4FCCA 3GVPA 1DPFA 5E1BA 2IITA 2OHOA 2JI9A 1KPHA 2GF0A 4UU0A 4JQYA 5DDIP 4CFZA 2Y6UA 4I55B 3ZS9A 3MAJA 1CNMA 1MEOA 3U4CA 3NCTA 3OIGA 3E81A 2XADA 4ANFA 4G81A 1ZHOA 3Q8KA 3Q3GE 3TW4A 3ZPXA 1HR0B 5KTSA 1XVAA 1PU2A 4I46A 1OXXK 1EDZA 1XMJA 1BNCA 2V0CA 4LGYA 2I3BA 1PL0A 2O5VA 2PKWA 2H51A 3ZEIA 1AQJA 3HN2A 2JFHA 4WBSA 1EXVA 3VX3A 4PU0A 2C0QA 4GHWA 4HWPA 5F78A 2XOXA 1Q6YA 1JLSA 3BL5A 2Z4RA 3CX6A 2VJKA 3VNSA 1EIZA 1KOGA 1I24A 2HIGA 3IIJA 3D6TB 3FSGD 3K2EA 4CF3A 4TZ0A 1I6WA 3AXTA 1Y5NA 4UE6A 2DPMA 1GDTA 2XB9A 3T5DA 3DVLA 1A7UA 2G9VA 3BBPA 1T1GA 1H8HA 2A78A 4FC7A 5DNDA 4ZCRA 1V8OA 5LM3A 1QG4A 1EWKA 3UQYS 4GI2A 4BX3A 3GRFA 1U1GA 1YUBA 4PCLA 5DXAA 3WSVA 2ZUFA 1N6RA 2HSJA 1NPDA 4IDHA 3UKJA 3FUXA 3QEMB 3D3WA 3JQ9C 3OX2A 4IMIB 1VMAA 3KQLA 2IELA 1C8KA 1V11B 2CJFA 2QI9C 5JR3A 3F73A 2OCKA 1QWSA 4UAGA 2QZSA 5H3HA 1E4VA 3TTSA 1VRCA 2JARA 3OPYB 3BD9A 3FNIA 3G2OA 4HWTA 4RPJA 2IH4A 5EP4A 3H19A 1B1AA 2NVUB 3H9EO 4F11A 5J4LA 3PT5A 1C29B 5F35A 4ZXPA 3FPLA 4F46A 1ZN2A 1ODTC 3PUVA 1FSGA 4NYMR 2P6NA 3E61A 4MGZR 4Q9AA 4TWZA 2G9UA 1ZJYA 2JFZA 5CCXA 4P81A 1RZVA 3ETHA 4XSHA 4CIBA 5TQ0A 5LDDC 1EDEA 1JG1A 2GNOA 2J9FA 3V3TA 1SUBA 2YZ2A 5DEOA 1J4AA 1A2BA 2DFNA 4UM8B 5DOVA 3U7QB 4KODA 1GT91 1D6JA 1PWEA 2B0JA 2O48X 3D8TA 3GEMA 3QOXA 1S2MA 4KRYA 2RJOA 3ZLUA 2I91A 1DV2A 1G6HA 1YU6A 1I32A 4UVGA 2G67A 1SBZA 3GJ3A 3EOZA 1YQDA 4L4RA 5EMHA 1Q22A 5EPUA 3GCDA 1DOAA 2CVZA 2GERA 3GN2A 1T2EA 3ZKWB 4C6HA 1J2YA 5M7EA 2IF2A 2VPIA 2YWJA 1G63A 4PC7A 5HGJA 1BEEA 3F9CA 2HOQA 4CCWA 4U2KA 2EW2A 1CDDA 4O1IA 2IIBA 3WTCA 2BEVA 3P9PA 3MILA 2FPIA 3AERA 5TMDA 3IKMB 5TQVA 4D1YA 2DWPA 1E7QA 4HY3A 1K0FA 2VQ3A 5AI5A 2ZBDA 3K2QA 4PZYA 3V8VA 1TVEA 1QP7A 4LNAA 3PI6A 1M34B 2J5BA 4JFAA 2XUHA 4B3GA 4FT4A 4MUEA 1YQ9A 3MG9A 3QKSB 1OZ0A 3GRRA 4E22A 2GEFA 2GO1A 4LVCA 4BNNA 3AI3A 3ZE6A 3JQGB 3P0RA 3JQQA 3TGLA 1M10A 1WUHS 4K40A 3WMRA 3H2KA 1XSEA 1G8SA 1EGVB 5CLLA 3M81A 5K3EA 3V7NA 2YBDA 3BKXA 1WSDA 3I5AA 2NGRA 4WA7A 3R7SA 2GMWA 1SM4A 3NXSA 1PGNA 2P75A 3NP7A 2GNAA 3FROA 4DW8A 5C8YF 5IFLA 1CJBA 1GGJA 1V1JA 4PN3A 5GAJA 5K3CA 1HETA 2JGLA 4DUGD 1E2PA 5G4LA 3GD7A 4TWJA 2X0DA 2IYOA 4FNAA 1H23A 4DC1A 2QX9A 4MVJI 1WCIA 5T57A 4LUCA 3AFHA 5BSKA 2XQFA 2Z5GA 4F72A 3YASA 3NUGA 3QMPA 4UDNA 4QO7A 3QXGA 4V0RA 2CY0A 3SFVA 4A2WA 2KB0A 1Q50A 5CU7A 3NX4A 1XNQB 4BKUA 3MCTA 3PWSA 1PS8A 3THRA 2GBGA 3V4PB 4RVSA 1P9RA 3L0YA 5BT8A 1TMOA 2UYCA 1NOKA 1H65A 2HU2A 4OQMA 4QJIA 3CPHA 4WOKA 3IVRA 1E9SA 2WEKA 4MAFA 3R2JA 2ZYAA 1GUZA 3JWHA 1R6TA 4FSXA 1EVYA 3RT7A 3SIWA 4NCBA 2FLVA 2OYRA 4FYHA 4BQQA 2VUSA 2ZBEA 3DD1A 4GAEA 3S0JA 3NM6B 3UK2A 3N86A 3SM3A 3DO6A 3UTDA 2PXHA 4RSMA 1NFRA 1SOMA 5C1IA 1XN1A 2F3UA 4CM3A 1P0CA 1NKTA 2NUTA 1PZHA 5CVVA 1VL5A 3AYZB 4MVJF 1GIAA 2R1VB 3LBIA 5FBHA 3LXMA 2I3DA 4M8LA 1L5LA 4CU5A 2A9OA 2BTEA 1KS2A 2HWKA 4HGRA 2PSHA 5FTKA 2J3QA 2OBBA 3FWPA 4MWDA 4QHYA 2JAHA 3DCNA 3K2BA 3M33A 4YUZA 3TZCA 5IT5A 4PYNA 2BTOA 4XGQA 5EIXA 1C8LA 1VE1A 4M0PA 2J87A 1OI2A 3ANMA 3ANYB 1W7AA 2FN3A 2PL1A 4OHXA 5CDUA 4OEHA 1QHGA 5GJBA 4E2ZA 1Q83A 1LZLA 3DVAA 2JH3A 3MJEA 3QOFA 3ZX5A 1H6DA 1Q1ZA 2WKSA 1QUEA 1RM0A 4XARA 3U4QA 3BCSA 3ES9A 1EWRA 3T6KA 2UV8A 3L7BA 2Z56A 3PTZA 2JGEA 2Q62A 4IVRA 1ETUA 4FHCA 3TD9A 4A10A 1N5DA 2QWXA 3L46A 5BV0A 2AX4A 3T7EA 3OX4A 4OJQA 2HA5A 1J0AA 3M3HA 2YYZA 2YIJA 4Q16A 2QVLA 5FTNA 3FJOA 1ELOA 1V3UA 2Z30A 3OT4A 5H68A 4Z7OB 3V42A 3IQZA 1EA5A 3DOFA 5IS2A 1G3UA 5K99A 1A50B 2F9MA 3DHEA 4IH9A 1TJ3A 2GJKA 3MJ4A 3NORA 4LDNA 3HXQA 1Q11A 3MRXA 1KJNA 1UMCB 4G1MB 1ZGBA 1ADJA 1CUWA 1NLFA 3NYQA 5FNVB 2FPKA 1MABB 4KPUB 1X7WA 1CE8A 4DJEC 4JVNA 1VA5A 1KC1A 3ICWA 4JJIA 4JLWA 1L1EA 1ZXBA 3HG7A 4L08A 1Q0UA 3ZBTA 4DNXA 2AA3A 1IMOA 3QNUA 5LZ8A 3LC0A 4YJ2A 5LLTA 4DR4B 4C4PA 4EABA 1EX7A 4HMOA 4QXMA 2R1TB 1CVIA 3RADC 1J5PA 3T15A 3WL8A 3A6FA 4XCVA 2BCEA 3INYA 4ITVA 2DUNA 1PG2A 3E6AA 2QR2A 4B4OA 4BBJA 1GG5A 4Q15A 1D7OA 4RIGA 3X3HA 3AY7A 3LQ4A 2WYOA 4F4UA 2Z9CA 3JYPA 1E0DA 5B2ZA 4IQ4A 3NBFA 3OJ0A 2O8FB 4PPFA 3K32A 2X76A 3OIVA 4R05A 1O96A 1XTTA 3FPFA 4US1R 3RUFA 2GR9A 4DLWA 2B1GA 4QQ8A 4D4GA 4PBSA 3BXXA 3LECA 3WBFA 1V8FA 4FWTA 3VHRA 3ASZA 3VTKA 5BSEA 2G1AA 1YS9A 1RYBA 3HVRA 5G4KA 4Q24A 1ZGAA 3UMVA 3WLPA 3I9V1 1U2GA 4DBLC 4Y2SA 4M8IA 1N0IA 5TY0A 2ESRA 2C8KA 3B60A 1XF9A 2DHRA 4OSPA 3GU3A 3CC8A 1RTTA 1XTBA 3DD5A 4MYDA 5LU8A 2RK3A 3M6MD 1NJ5A 3GP3A 1ZR4A 3F7NA 5GOTA 3HVJA 4IUYA 2WU8A 3GVXA 4IX9A 4BX2A 1PQWA 1YAJA 2HDOA 1DL5A 3TPFA 2Y8EA 3TIGA 3HKDA 4B74A 1UOPA 4OP3A 1ZZGA 2DLNA 4ODIA 4UTXA 4PNPA 5C8XA 3D6VA 1FP7A 1GITA 3LZCA 1R88A 1Q0TA 1VPVA 2FVYA 1PW5A 2OECA 2UVDA 3VR2D 1NE2A 1T0JB 2NUPB 3DB1A 1WXIA 4TMVA 1EEXB 3MSCA 3UAVA 3ZLTA 4F71A 4QVKA 3EVCA 4M88A 2JHFA 4RLSA 4RVHA 2H1VA 1DEOA 1G5HA 3UK1A 2CGEA 3FCAA 2BUBA 2FUCA 4WRRA 4BB6A 1U2QA 3S1LA 4G4SO 3RGWS 1PD0A 3WG9A 1CIPA 4H1HA 3CY6A 2PJRA 4XDZA 3R8XA 5K8LA 4I9NA 4XD2A 4Y9UA 4E31A 3GXBA 1YRAA 1FTQA 2C97A 2ST1A 1FW6A 5TMEA 1KBZA 3FHLA 4DCUA 1GNSA 2QTMA 3CINA 2EZ8A 1H6AA 5JPIA 3DR3A 5DRYA 4AKIA 1R0SA 4JOQA 4WOPA 4AYTA 2J46A 1NNEA 1E2DA 4JYMA 3R7WB 3L7OA 5A06A 4TTAA 4CKWB 2VNAA 3INGA 2CUZA 1X77A 3HCBA 3NGMA 3CW9A 5C18A 3S5UA 1W34A 1N7IA 2BMAA 3PE3A 3QFTA 2FDXA 3JXEA 1YK1A 3R1IA 1GDHA 4QRHA 3ZCSA 2V9PA 1CJVC 1X2EA 4IIFA 1UK9A 1BW9B 4WZAB 5J2UA 2OILA 4M49A 1BRMA 2PS1A 3EY4A 3SVLA 3ZV3A 2X23A 3NRCA 3BFKA 3FWKA 3P9IA 3H5IA 2ZTMA 4J16A 1RS0A 1A5BB 1NOJA 4LSWA 3EN0A 2HCFA 3MUNA 3CG0A 3IEIA 2IX9A 3TF5A 2H2GA 3N07A 4ID3A 3AHDA 4EA6A 2ZYSA 5DI3B 2B37A 1SBYA 4F3KA 4F2HA 1T1SA 3N0WA 4UOQA 5L7WA 4J0KA 3U6KA 4CM9D 4BLPA 2O19A 5JROA 3WQSB 4DADA 1XNJA 3P2MA 1Q3HA 3WK6A 3HJAA 2I7CA 4NBSA 3FCYA 1G20E 1ZMXA 2C4WA 2DU8A 1Z6ZA 3LY9A 3OC0A 1B6TA 4OBXA 4QOHA 4EQZA 1IAVA 5B4TA 1SC1A 1I01A 1ZD3A 1VGQA 3HUFA 3Q5EA 1CKEA 4L9RA 3ZZ1A 2V7QA 2QW0X 1UJ5A 1KH1A 1QH1B 1ZW1A 2AKAB 2GN4A 3IPLA 3CNHA 3K05A 4P7FA 3ELBA 1VL2A 4QD3A 3TQQA 1VPWA 3M9WA 2QMOA 1OX4B 3WLNA 2E3JA 3DTYA 1CZUA 3PNYA 4BZZA 2OXRA 1WXFA 3F6PA 1KP9A 3BZUA 4RF2A 2ZYUX 3EMBA 4IUBS 1T9AA 2R65A 3E3OA 2PBZA 1SXGA 1ZW6A 2F1JA 4KLAA 3GA5A 3QFCA 1YOVB 4WZBB 3LY5A 5C8YA 1G7CA 5KX5A 1K8ZB 1QCZA 5H7XA 5J4VA 1ZN7A 1WDLA 2E48A 1VHQA 3N5KA 3TRDA 1P2VA 2P2YA 5F1YA 4PIVA 3UHPA 1O5TA 1J42A 1T5BA 3ZZNA 2W2NA 3LA6A 5JO9A 1SEVA 1CR0A 5B1DA 4C3UA 2W98A 1DX4A 4QPDA 4F3NA 2X2EA 4W7HA 2FEWB 3DC2A 4PO8A 3QVGB 4RKYA 4YAUA 5IVIA 2E4YA 2JVJA 2XV1A 4AY6A 1CD5A 1S2NA 3BMOB 3N7UA 5FOVA 3GGCA 1Z4PX 1Z0ZA 3ORHA 4JXJA 5SZJA 3PXGA 1CWUA 3ZN2A 3A3PA 1LTQA 2RGAA 1L4HA 3I1FA 4UM9D 4A8JA 1GG8A 1Z0IA 2JCVA 3MJVA 2Z6UA 1Y7IA 2L17A 2O3UA 3ZBQA 3LXUX 4NOMA 3G7SA 2UUBB 2VNHA 1I10A 3HL4A 3PA6A 4L9AA 4B4WA 2EATA 3EUWA 7AT1A 2I2CA 2CDAA 3DO8A 4RY8A 4QUKA 1A9OA 3C6QA 5HTKA 2BGGA 4PSAA 1E0JA 4TTQA 3N0RA 3OE4A 5I7HA 4WKPA 3NHAA 5F2EA 1ZLXA 2BR3A 4IH1A 1X7YB 4MVJA 1AV6A 1FRNA 2Q3MA 1BRTA 3RARA 5K6RA 2J0QA 2HUNA 3DDNA 3QJ5A 2G09A 4BKPA 4GM1A 4YCBA 1TZKA 1HZJA 5G1NA 3I76A 1K7FB 2OKCA 2ZSHA 5I9LA 2GHIA 3HA7A 3IQXA 4OHZA 2CJYA 1M6VB 3O4IA 3OPYI 3OZWA 2F6RA 2ZRMA 1N0UA 4ZMRA 1E5QA 5HIIA 5KB3A 4GX2A 2J9GA 3Q11A 1PCXA 1VE9A 4XB1A 4ER5A 3DF9A 4NLLA 1HH4A 1VXRA 3M5WA 1K8QA 2QF7A 1FP4A 2YHIB 4N6OA 2C07A 3ZZMA 1QMGA 1CF9A 2CXQA 1S01A 1VZ3A 2WKPA 4DMFA 1ZK1A 1SO8A 3WS7A 1KA9H 1KPGA 4X45A 2G77B 2TMGA 1TIPA 1LK7A 2WC1A 3N0XA 3PS9A 5EAIA 3SJBA 2AFRA 5J63A 2JLAA 3CISA 4KNYA 1QVAA 4EPWA 4UUMA 2A1UA 4UASA 1RYZA 4RAOA 4HDSB 1M1YE 2ZVJA 1IN4A 1I6KA 3EGVA 3LA8A 4M7OA 4ZCQA 2OQVA 3ST7A 2XMGA 1FFYA 4EG6A 3O8QB 2HWWA 4BNWA 3N2IA 3BMQA 3QPCA 4L8WB 3ZNOA 3FWYA 1YJ8A 3LQYA 2FV8A 1MGPA 4Y2UA 1OWMA 3KDSE 4GEGA 4IY1A 1NW5A 2D1SA 2M6LA 1PFWA 3C3XA 3R8FA 3ZQKA 1X7ZA 1NT4A 1QCYA 4IHKA 5HS4A 2AUTA 3V32A 4Q37A 3Q3HA 1HYHA 2OV8A 2YJGA 2A88A 2WU4A 3AIKA 1S1MA 1QVZA 2WZQA 3FVRA 3G3EA 2H3HA 3H1EA 3L43A 4YAOA 5FL7D 4M0CA 3RCBA 4V2IA 1K9VF 1D03A 1NHGA 1ZC4A 3QQ5A 3IA7A 2DXIA 5EGNA 3AKCA 2GZ1A 3MB8A 3C45A 2A6PA 1BTOA 4DJFC 2FEMA 2AG6A 2CJWB 3R0ZA 4A5SA 1WDKA 1KO5A 2B8TA 2E6UX 3A4MA 3A70A 3NONA 4K87A 4M1SA 4RFVA 1M67A 1THTA 2R00A 2YZGA 4YRQA 5EVCA 3P2EA 4LMRA 3L1HA 2SHKA 3MSXA 4CDMA 4ZK2A 2DX7A 4X1YB 1PT8A 4DCMA 3WL4A 5K0JA 1ZUIA 1U0FA 1J8QA 4H31A 5CP8A 5B36A 3E1GA 4KITB 3W9UA 3FSEA 3TIFA 1M2HA 4KVFA 1H42A 4UU1A 3NBKA 2FEOA 5H9WA 1AMNA 3GX1A 1ES9A 3R6DA 2V5VA 1J0DA 1C9KA 4G9GA 4K8RB 1B43A 2GRUA 1SXJB 2ADMA 5F1PA 1NQTA 5CFOA 1Z0JA 3ZTWA 1ECBA 4DR2B 1Z07A 1YDHA 4B31A 4LWQA 1Y3CE 2ZYTX 3I5MA 2WA2A 2MIIA 3K4HA 4C22A 4ENSA 2UAGA 3TEMA 4MINA 4V38A 5ITZA 4J3JA 4EVQA 2DETA 2PVPA 4W99A 5AJWA 4XIFA 2HEGA 2OG2A 1ZH4A 5KJCA 2WSIA 2QQ0A 3VPSA 3AP3A 3E9YA 4KTVE 1U4SA 3WKBA 2OLJA 1E8DA 3GQBB 3HDGA 1IVNA 4GOOD 4GPAA 3LQ2A 4IBOA 4KMOA 4EG8A 2VDJA 4E4RA 4HTFB 3RKSA 4DJJA 1W0JA 2A58A 3R0VA 4TMTA 2NUAB 2JG3A 2ECOA 1P1IA 3GUVA 3N0TA 3W2TA 2BI7A 1H6CA 4OAOA 5AK4A 2JCXA 3LM8A 1RYFA 4OB7A 1XA3A 4ENUA 2J5QA 5IZCA 3NOXA 2PBLA 2GKOA 4LQLA 2IF0A 2C2MA 4I4TF 1JYSA 4P80A 1GEEA 3CM0A 1KI6B 1TM5E 4U6QA 1Z39A 1HDEA 5F77A 4X3OA 1PJ4A 4TM8A 1UBMS 1CEQA 3NHFA 3L05A 1TVCA 4CQJA 3GL9A 2C2GA 4WKOA 1QG6A 3KFLA 5DLDA 5DM70 1G3QA 3F6BX 2I1VB 5AW4A 2XQVA 2XOKD 4RH0A 2IBSA 5AKLA 2X4LA 4RACA 3IHWA 2YR0A 4WGFA 3TTXA 2OORA 3EZ6A 1PJ8A 2VCEA 5LB4A 1WO8A 5C7LO 3FFWA 2I7TA 3I6ZA 3PFFA 3RRBA 4DWVA 1K97A 1P7PA 4MRMA 2BCGY 3VR6D 2VYCA 3ADCA 2FSPA 1WY7A 3V4FA 1JHVA 1V41E 1W4LA 5CCDA 1XRPA 3DPIA 5D2CA 2BEKA 1BCSA 2I22A 1PW7A 4KQIA 2EF0A 3RF7A 4GWGA 2FLKA 3DNFA 4IMJB 2YWBA 3KDAA 4YAWA 5J5VA 1X74A 4J7AA 1WG8A 3EYAA 2AOXA 4UJ5A 1M2FA 2HX1A 1CQIA 4Q0MA 3IYLW 1GRNA 1AO3A 4Y1RA 2ZJBA 4FC6A 2J08A 4BCCA 4CR8A 1NW9B 3CKMA 1XLVA 2BY4A 2P5TB 3CJRA 4PPYA 5KNCA 1QK5A 3THWA 1KR5A 5IYZB 1WABA 2PVSA 4AJ2A 2E82A 4MLPA 1XLUA 1RBZA 1APBA 4QBFA 2MWMA 1Y42X 3KDPA 2I6GA 4IINA 5DYIA 4NHEA 4LA4A 3QUSA 2UU9B 1JKXA 2VA9A 4PZDA 5DW3A 1UBKS 1G4HA 2O3SA 5TS2A 4BX8A 4F9GA 5ADVA 1QQAA 1GAJA 2FMXA 4L5JA 1UJ2A 3PNOA 4ETMA 2ZWAA 4MA0A 4GRAA 1OLXB 2D1TA 3AHHA 4ZO8A 1WR8A 3WNZA 4FBMA 4XIIA 2XNHA 2EZUA 4K81B 3RTGA 4QC2A 5JOQA 1EDOA 3G1UA 5HR5A 4OF4A 2UKDA 1XLWA 1RQ2A 1WXGA 3VYVA 3ZNQA 5CW2A 4ZDIA 3M83A 3IHLA 3GRCA 4N7RA 4L3WA 3UV7A 3W77A 3OQOA 3OZGA 4RKEA 4X9XA 3EWSA 3PYMA 4CI0B 2FPSA 1DJPA 4DYDA 2AKYA 3EOAI 4YJHB 2YH2A 2D5AA 3QENA 1KKUA 1XCBA 2NTVA 2OHJA 4LVNA 2QENA 5DYWA 5TQ2A 1MO5A 1EA7A 3SKYA 1YE5A 1DQNA 4AZ0A 4OFXA 4QOGA 4EB6B 2BRUA 4R7ZA 1KZ6A 4LJ8A 5EIFA 5IKMA 4B17A 5DGTA 1Y89A 4Z8YA 3NWBA 1MEJA 3FG9A 4XD7A 1CUXA 4QNNA 5DCWA 5B1YA 5L6LB 4MQFA 1IYZA 1G18A 1PDWA 1RKXA 3AETA 2Q3EA 1IY1A 1P2UA 2W4MA 4ECAA 4EHNA 3WRWA 4XYGA 3D7RA 5KJEA 3S4YA 1AC5A 2WUEA 2XZLA 1KOLA 4Z7NB 2QVZX 1H69A 3X1XA 3AEXA 2FZCA 3BIOA 4OAPA 3B2QA 2BPOA 4CVNA 4WPGA 3HUTA 1F0YA 3NRJA 3SF0A 1SQ5A 4KPGA 2J3DA 3H9GA 3OQ6A 3QELA 4RPLA 3QSYA 3V80A 3H0KA 3TG8A 1G8FA 3HBFA 1ISFA 2FN4A 3KFXA 4OK5A 2H4ZA 3VGPA 3C2QA 4UNRA 4PIMA 1T0UA 4YRLA 4D41A 3WI7A 3NDRA 1GZHB 1DB3A 1OI7A 2H7YA 2HADA 4TQAA 1T4CB 3FNRA 2VEDA 4BB0A 2ZI5A 2G0AA 3T3OA 4CLDA 1RRKA 4NJOA 1Z06A 1N5JA 2H18A 2R8BA 3WV5A 2XQKA 1XVTA 1Z5PA 1Z37A 3FYUB 3RVJA 1LVGA 3RM3A 4OX9B 2GZHA 3JQ7A 4J0HA 1FUIA 4D9FA 4S05A 1JFFB 2WF8A 4W8GA 3RABA 3F8WA 5HFAA 1VI6A 4B5KA 4RK6A 1PR6A 2FFHA 3IIMA 4KWTA 2VSFA 2QDXA 1NXOA 1QZUA 2GF2A 3T9FA 2AT1A 3IOCA 4Y2PA 1XG5A 1K4YA 4B71A 4YP6A 3VNBA 5ALWA 4BQFA 4YWJA 2Q3JA 4OKNA 1WS6A 3HDJA 2WINI 4GRIA 5CAEB 1DUSA 2Y66A 1N3IA 4JYZA 3PWKA 1S8OA 1T1JA 2QYTA 4FEAA 4MUXA 2OZPA 1TK9A 3KAPA 3LSTA 2PGXA 4L8GA 4ARBA 1GQRA 3IILA 2VJMB 1JZTA 4ZVVA 3U44A 4URHA 1QFJA 1D0SA 1EM6A 2YMPA 5BMVB 1E6LA 3FB1A 1BFKA 3CCBA 5KJFA 4Z9FA 1D1PA 1RWOA 2BTQB 2AXNA 1V4NA 5KTTA 4FNOA 2VJCA 3C3YA 3WL5A 1JXAA 1YBFA 3PQ5A 4Y0NA 5TPZA 3ZHZA 4BPBA 4GMXA 4EI9A 4LS3A 1G7SA 1H1DA 1Z4MA 3MVEA 1TA0A 1EDBA 1F1JA 5LYYA 4B4KA 4BVHA 2PMFA 1VA4A 2R8ZA 1YR9A 4G25A 3HFSA 3AJ9A 4WN9A 5IVHA 3R7LA 2QTRA 4D92A 2YWCA 2BV3A 1YHYA 2HF8A 4HPWA 5JWOA 4JB3A 3KU4A 1YXMA 4M1YA 2J3HA 4LHSA 1UBTS 1PI3A 3G9UA 1QH8A 4N18A 1GT6A 1D1QA 2H9IA 2QLFA 3LLMA 2ADOA 4JJFA 4K9LA 3MWKA 4PC2A 4YVFA 5LKAA 3URMA 4BUZA 5JFTA 1QIHA 2WWHA 4I1VA 1OPRA 3JZMA 3T38A 3UT6A 2PRZA 1S0UA 4YLGA 1GGMA 3A1DA 2PMBA 4OJKA 2AC4A 3HFRA 1KDTA 1RC8A 3ITEA 3MWGA 3ZXXA 1NRXA 3W1WA 3ZOKA 2YFKA 4NCIA 2RIRA 4J1NA 5D00A 3M3PA 1D6MA 1WHSB 2IBMA 1YR7A 3PDHA 4QYIA 4TL8A 5B7PA 1VTKA 3UOAB 4EH1A 1NVAA 5LN1A 5I51A 1WCYA 4H7DA 2GLXA 4BS9A 3HUUA 2WD7A 5C1OA 3SP1A 3VMMA 3ZH2A 3I62A 1W2HA 1JECA 1XQYA 4LWOA 5K8IA 1QTNA 4CIWA 1HGXA 1QB8A 2ZTHA 3M1AA 5FWDA 3RAEC 4JUBA 1T5SA 4EI7A 1UWLA 3HBLA 4RM3A 4JR2A 3MTEA 5B6IA 4ZJYA 1EP2B 1FYXA 2WT4A 1J20A 1RWNA 4DVJA 2VP4A 2EBWA 4KIUA 4OJMX 2IIQA 1XNRB 2XA1A 5BUSA 3OTWA 4MUYA 3HSKA 3UANA 1ZWKA 4MQMA 3BWEA 3M4XA 4WL0A 3TLGB 2BJVA 1DXQA 1XRNA 5EXEA 1X1BA 2ZRFA 3GARA 2VDPB 2VIIA 4H7JA 2OY0A 3U1TA 4R2HA 4CN9A 4LRWA 5DASA 3P9XA 4H7HA 5FIUA 3EPJA 1IATA 2YZKA 3NAQA 6REQB 5BYBA 1BVUA 1FU4A 3HCPA 1Q1QA 2AI1A 1BE8A 3CTPA 3EXIB 4JT4A 1GR0A 4X91A 1GTJ1 1EP9A 2ZFUA 2BM9A 2VHVA 4IGKA 4TWAA 4HDOB 2V6JA 2KMLA 4NV0A 3KUUA 4Q34A 2B94A 1NQWA 1ONSA 1AQUA 3QBEA 4MR9B 2G83A 1P17A 3UJ3X 1FVHA 2Q50A 4I4TA 5TF0A 1JPJA 2HA0A 4OM7A 2X77A 1KZHA 1OAAA 3ONDA 1W5TA 1LNZA 1R66A 1RWVA 1TZJA 2ZDHA 3EJWA 3NDIA 1E63A 3MLAA 3NO4A 2NPIA 1SBHA 3PQ2A 4JJ6A 5F5XA 2ACWA 3SBXA 4ND2A 2RHGB 4MYHA 2ZIUB 2C00A 3RG8A 1W49A 2CLHB 2NXJA 2WJ3A 3MM4A 3HR7A 1JSRA 4MWOA 4XR9A 3FOFC 3HJFA 3DMGA 4F2DA 5KYXB 2YRXA 1FB5A 2WSLA 3GRAA 3K09A 3MWFA 2A5DA 3GEBA 1DV1A 5BPFA 1JR3E 1TI7A 5F12A 3AF0A 4CL2A 1EUDB 2A14A 2XNKA 1L5GB 4Z51A 4KOEC 4UOZA 3BWDD 3IERA 3LPLA 5JQWA 2QGFA 1FBTA 1ZOIA 3CG4A 3DBLB 3KELA 5AXDA 1V7QA 2GCGA 4L15A 1MMFB 1JUDA 1R64A 1Z0AA 5H4HA 1GCGA 3KEMA 1VLLA 1P0IA 3HE3A 1F8FA 4O2BF 5C31A 4BBAA 1E79D 2X1VA 4FM9A 3UT5A 2GBLA 1R8SA 4B0OA 4Q9HA 4BNLA 2NSDA 3EY9A 1J56A 4W5QA 4M55A 4R1TA 4BB5A 1BVRA 3PKZA 1Z17A 3GGGA 3KPJA 1YDMA 3KYCA 2CZQA 2QL5A 4G5YA 4G65A 4E4YA 1JEYB 1QO7A 3QY0A 4R8MA 3L7YA 1RCUA 2OQ2A 3JD2A 4NARA 4U2DA 3PT9A 5T4HA 3OHMA 1NRWA 5JCJA 3EWIA 1P7CA 4FXPA 4ZYZA 4GI3A 1U2GC 7YASA 1GVNB 2EJVA 3DL0A 2QYSA 3SF8A 1OBVA 2XEDA 3TI9A 1ZVKA 2PGAA 2ZE7A 4C1NA 3R5HA 4WCDA 4JWTA 4DYHA 5AK3A 1DEKA 3U4GA 1O6CA 1NT2A 2GDZA 2HWUA 4PRKA 4BVKA 3KVYA 2QMHA 4FI3F 2Q9CA 4YAKA 1NW7A 1ISSA 1VBMA 1RI1A 4X95A 3SDZA 1Z7WA 2ZR0A 3IPXA 4Q3LA 2FPLA 3L4SO 1E4YA 2PZMA 3A6HA 4PFKA 2AW3A 3DKIA 2CWWA 3CUSA 4RXTA 4WINA 4C88A 4JYBA 4HLDA 2FMTA 1F7UA 3SNKA 1UKZA 3PENA 1OAOC 3WYAA 4D9EA 5IEJA 2XXAB 4M21A 4B3BA 5B58C 1AKUA 3LX4A 2KM1A 3C5EA 1QVWA 3PFIA 3ROQA 3Q8MA 4XI9A 3ET4A 1UK6A 2LIPA 2NTNA 1WVGA 1NZDA 4K6CA 2FMFA 2BFMA 2XA9A 3H8JA 1U0JA 4BV9A 4CKBA 4IRXA 1RJ9A 5LMCA 3CNNA 3DCYA 2O8EB 1MORA 2H4JA 1FC0A 3AM4A 2PUBA 1PX0A 4N6GA 1WXHA 3SJUA 1XTUA 1UC4B 1V25A 2QRNA 4PC1A 3JATA 2OMEA 2H2HA 3U80A 4KO1S 2UXCB 1VL6A 2FRDA 5HKKA 1BMTA 2VYVD 5TEWA 3RPEA 1C2YA 3DDZX 1P4JA 3DP9A 2X2PA 3RS8A 3EIFA 2REOA 5ICCA 3I5UA 3BDAA 5LLSA 5LJLA 1KAMA 2ZUWA 1XL0A 4PRYA 4CI9A 5FEUA 3D3KA 4ZI3A 3BK1A 2JVIA 3NU1A 1WUYA 4HT3B 4QUGA 1PZNA 3VU9B 3JQDA 4J16C 4Z53A 2CLEB 4RF4A 1ZQ1A 1F14A 2YV1A 4LHXA 4U3JB 3DZJA 1TNDA 5DX8A 3AVXA 3KSMA 4WOBA 5D6OA 4EEKA 1A5SB 5DBGA 4GGOA 2WHEA 1POXA 2DP4E 2RCNA 2D5LA 3F7MA 4OY3A 3WYEA 5BWCA 1ZNZA 3PI7A 2M6SA 2Z9BA 4UM5A 5BN3A 4HB3A 2PH1A 4FFLA 4NABA 4F1KA 5A62A 4AJEA 1R4AA 4DMKA 5EHZA 4D0NA 5IZ4A 2ZAGA 4K0KB 1XRJA 1W36D 1P1BA 2YY7A 2IJGX 5GADl 3GBVA 2ZIXA 3WKDA 3L8DA 4D7AA 4RE6A 4DL9A 4R71A 2QHXA 3S1AA 4BRWA 2F55A 1LDNA 1SQ6A 1Q0ZA 5AI4A 4J0QA 5KX5B 2PWAA 4IXDA 3OZTA 1TW3A 2WIJA 5HYVA 4XJXA 1JKJB 2G25A 3VDXA 1EJ2A 4ADSG 2N47A 1FDIA 5JD6A 1DBIA 4IOLA 2HRRA 2B98A 2FRVA 1NYRA 2H63A 3C6MA 1GWNA 4YJKA 1TEZA 1UINA 3HB9A 3MJSA 5LMZA 5AVKA 4MPJA 2Q0QA 3OOEA 3K16A 5K8CA 1H3NA 1K6IA 2C9MA 4PYKA 4KFUA 1XQ9A 3OFJA 1RC1A 3GT0A 4RSRA 1FYFA 2QUBA 4HX9A 4RTNA 5FWXB 5CFZA 1KO1A 3TLMA 1KXJA 3WRXA 1ZJWA 3E35A 3BQNB 1Z6PA 3ZYCA 1ZOSA 4FFBB 1JI0A 2G6TA 1U5CA 2OT3B 2FJPA 2OE2A 2MT9A 1OI3A 3QA3E 3Q3IA 4JIMA 1HE1C 4O4JB 5C8VA 3EG9A 4AFNA 2NV2B 3DE2X 1DBSA 2WZBA 2DH6A 4WNAA 1XAIA 4EOGA 3I83A 2WTAA 5FQNA 3WJ2A 5E3HA 2BEJA 3EAQA 4X6LA 5LKRA 2W2XA 1ACLA 2IXBA 2OBLA 3CLRC 3QJYA 5D1HA 4MNTA 5TGTA 3RUIA 2DY0A 4A8JC 4ETIA 1T6ZA 5C80A 3HGMA 2Y92A 1MUUA 2O5RA 2VNJA 4N3CA 2ZRBA 1JQBA 5CDSA 1PJBA 3FRHA 1FTSA 1Z73A 3FUCA 4B09A 3D6MA 3QWIA 4DF3A 3QKRA 4EG3A 3PGMA 1G8PA 4ZZIA 4Q47A 1DCMA 2P91A 3HZZA 3E7XA 4XYBA 5CM9C 1FFEA 1KYZA 2IYPA 4MV1A 3ZWMA 2EKPA 5KBYA 3E9RA 3T94A 4WCFA 1RVDA 3I9NA 1EX6A 3KEGA 4MKIA 1NMZA 1P6QA 3PUHA 5CM8B 5TT0A 1BROA 2J45A 1A1SA 3EZLA 2BLNA 4CLOB 3UPUA 4KQEA 1M0TA 3SIRA 2BDEA 3A26A 1OFUA 4B45A 3QRWA 3LX5A 5FFFA 3PQ6A 4MITA 3HCFA 2HHLA 4EI2A 3HRIA 1KMIY 4DBZA 1REQA 1ZRMA 4CT5A 1DFIA 1IQ0A 1GZVA 1WDMA 2YQ5A 4R1MA 4IOJA 5CVEA 1CYDA 4WK0B 2UZ4A 2BKUA 2PXCA 1VLJA 1KIFA 1QIJA 3BULA 2CT8A 4HSEA 2QZ9A 1E3EA 2QY6A 3P2IA 4F97A 3ELYA 1RM3A 4XTRA 2NU8A 3W5BA 3DAPA 4LF5B 2JFXA 5TPWA 4RTJA 2XAUA 2RAFA 4PYIA 3U56A 5ALGA 1Z8HA 3WB1A 1I4WA 4MUMA 1HDZA 2PUCA 1CUYA 1K7XB 1KBQA 4J0CA 1SVWA 1WV0A 2WMNB 2WYVA 2ZT8A 4KJZA 4R69A 4DJ5X 4QUEA 1BGVA 4DIEA 4KR6A 5HFNA 1SVSA 3BC1A 1Y6ZA 1YL7A 3E3LA 1HFJA 3B6MA 3GUYA 2RGUA 4O0LA 2AC2A 3MMPA 4M0KA 5EG5A 4HYEA 3TOZA 1M6YA 4PGMA 3D8SA 3TKYA 5HZGA 5IDWA 4E2YA 1WY5A 2X9NA 1A4UA 4DNFA 4O4IF 4CYMA 4QA9A 4G0UA 2QEQA 1J1IA 3T4EA 4D3SA 1NG9A 1R0WA 2M98A 1QZTA 2H29A 1QIIA 1EG2A 2Z0MA 3PQ3A 1K7SN 1NX9A 2QNBA 1MC1A 2XYRA 3DDSA 4I08A 4N5LA 1I8TA 5F33A 1JDBB 1C30B 1SIBE 3AFIA 2LBPA 3CWCA 3QX9A 1JLRA 2DBQA 4EPYA 5AMXA 1SCKA 5CD1A 1H2ZA 1R4MB 1JQKA 2AHOA 2DR0A 2PKRA 2ZJ6A 4HGZA 2H07A 2C88A 4ZZ3A 1SHJA 1VG8A 2LZ0A 3GEIA 5F4BA 2R00C 4WZAE 3ZCRA 3I9LA 1O3YA 2D00A 4BO3A 3H17A 4CPDA 1RWKA 3VU8A 2HXSA 4O2BA 1G0NA 1MC4A 5WRFA 2JRCA 2Z1NA 4IDFA 3ECCA 2B35A 5I7FA 3OQVA 1CY1A 2EJTA 2UYQA 3QU7A 5E6RA 3V5NA 3V8PA 1NF9A 1ND6A 3ZY3A 5JASA 1RYNA 2FW7A 2O8VA 1LVUA 3GFQA 1RWWA 2Q6TA 1A9PA 2A0KA 1FEZA 3AWIA 3ZDAA 2ODEA 4JI0B 2FB9A 5ITSA 4RLFA </