3AJRA

Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
314
structure length
314
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMFGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 119
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ajrA00
2EHDA 5EPOA 4TMFA 3RUFA 2ZIZA 5ENVA 4AJEA 3BMCB 2PV7A 4J2OA 4KP7A 3DL2A 1XELA 3R3JA 2ZB3A 2JFHA 3KSZO 3FNEA 2X7HA 3BIOA 1YVEI 3GA0A 1YB1A 3L77A 4B4UA 2OGUA 5CEJA 4ZICA 1A5ZA 4YJDA 1LBEA 2XPCA 4K28A 2AQ8A 3LC7O 2AEMA 4L4RA 4K9DA 1QYCA 4M1QA 4BGIA 4CLEA 1LA2A 4BO2A 1N1EA 4IMRA 4PG4A 2RH8A 1HT0A 4CODB 4DIBA 2OXIA 5BT9A 2GPTA 4R41A 3MEQA 3RBXA 5A9RA 3RSHA 4NJMB 1XQ1A 4ZGWA 1EQ2A 1ENZA 5JO9A 1Y8RB 1NPDA 3WQQA 5A5FA 2QZ9A 3L4SO 5BR7A 2I65A 3CSDA 4J0FA 3E6AA 5K6AC 3JYOA 1HL3A 2O4UX 4RVHA 2Q4BA 4YT4A 3G1UA 1LDNA 1DDOA 4YTEA 3WTBA 4B3IA 5G4KA 1MUUA 5ENDA 3ZWAA 3ZWBA 3PJGA 1HYEA 1E3IA 4KOAA 4TRNA 5J23A 1VJ0A 1B7GO 5AXBA 1U4OA 2QYSA 2WEKA 2CF5A 1JW9B 1HTBA 2AE2A 2EKPA 3IOYA 1HZZA 4BB6A 4NI5A 5A03A 4DTIA 1SAYA 1KEWA 1X14A 2P4QA 3UUWA 4NDNE 5TLSA 1E7YA 3H5AA 1YL5A 5EN4A 5GMOA 1FK8A 3QWAA 4BNWA 3OFSA 1OBFO 3C1OA 3VPHA 2D5CA 4HNGA 3PI7A 1XLTA 4DIFA 5FEUA 1TXGA 1YL6A 3M2TA 3FR7A 4OGWA 4E31A 3TF5A 2DFDA 3DOJA 1F17A 1ENPA 2EW8A 1P45A 2W4QA 1Z7BA 2Q1UA 3UFXA 2D0IA 1IUKA 1DC4A 3I23A 4OKNA 4CLDA 4F6CA 1E3SA 1EUDA 2O2SA 4YACA 3RD5A 1ONNA 3PGXA 3DMTC 1D4FA 3C7CB 2EWMA 1Z7EA 3WB9A 4PCVA 3OA2A 1ZK2A 4FFRA 3JD0A 4GSLA 5IG2A 3P2OA 1I3KA 4CV2A 4CLOA 1QORA 3UKOA 3ASVA 5FWNA 3INGA 3TJRA 2O23A 3QWHA 3OECA 1EVYA 3PTZA 2IZ0A 3A14A 5CEEA 5K9ZA 2BMAA 4J1SA 3EUWA 4U0KA 3WGHA 1ZXLA 2C59A 3WJ7A 4J16A 1MP0A 4UUMA 1QSGA 4D45A 2BD0A 5L45A 1DRVA 2UVDA 1BDBA 4RV9A 3BTSA 1VRWA 3SLKA 3FPCA 4DBZA 3JQ8A 4MO2A 1P1RA 3L07A 5C37A 5DP2A 1ZEMA 3DBLA 4WNIA 4CMCA 1C0KA 1R0LA 3H6KA 3ONDA 1T25A 4CQMB 4XA8A 4A0SA 4IQ0A 1PGPA 1ZZEA 5B37A 3WNQA 2X5KO 4WKGA 4CMEA 2FN7A 1DAPA 1A7KA 1BWSA 1X7HA 1MFZA 2GCGA 1GD1O 3U4DA 2ZB4A 4XCVA 2CVZA 1EDOA 2VHWA 4CMGA 3U09A 1LDBA 1YGYA 1VL6A 2JAPA 4A10A 1DPGA 3I9KA 4E2YA 3DTTA 3PHLA 3DBRA 1A9ZA 1ZXBA 1M76A 4E2WA 1CQJA 4MVJI 2H6EA 3KETA 1K6IA 1GR0A 2Z1MA 4KUEA 2G0TA 4QXMA 3RCBA 4J4TA 4J9VA 3WMXA 3P5SA 5CP8A 1NP3A 3ZV3A 4IS2A 4XD2A 1IE3A 2NUAA 5DBGA 1E1KA 2C82A 2J5KA 4DRYA 1LDGA 1UXKA 4IJVA 4RLHA 2Y1DA 3PJEA 3WGQA 4AJIA 1EVZA 4HUJA 1T26A 4ZRNA 4B8WA 1OC2A 1N8KA 1SEPA 3JQ9A 2WWRA 3PZRA 2B37A 4GBJA 4BKPA 4D3DA 1PR9A 2AQIA 4UVIA 4NR0A 4PLVA 4FW8A 4CLHA 1O9BA 4BHTA 1OI7A 1R12A 3WDSA 4WCFA 1ISIA 4BQRA 1LXCA 4MKZA 4RVFA 1CERA 1GYQA 3G49A 3IP1A 4K1LA 4YEDA 4J91A 3IJPA 2R6JA 1BTOA 3ZW9A 2VUUA 1ZH8A 2O3TA 4CMIA 1ZUD1 3OEYA 4RF4A 4Q3DA 2J5RA 3W6ZA 4M86A 5AXCA 3LYLA 2JCYA 3UF0A 3RUIA 3E8XA 1ZFNA 2VOJA 2G5CA 4CM6A 3ETEA 1TT7A 1D8AA 4TZKA 2Z95A 3L6EA 4NU6A 5TGDA 2FWMX 2NQTA 2P4HX 3I9MA 2GN6A 5COAA 2YFHA 4KZPA 4CMEC 2PZLA 3HG7A 4ZQBA 2UYYA 5TRTA 3HFSA 2NU9A 3WBBA 3EAGA 4M49A 2UDPA 1Z45A 2RHRA 4DIOA 4BO3A 3WSVA 1MA0A 4GQAA 2DUUA 2IEBA 1FDTA 2TMGA 4MKRA 3C3XA 3WYEA 1AHHA 3KYCA 1YQDA 1GZ3A 1ADGA 1IULA 4R9SA 3WNVA 2HU2A 4GWGA 1HEUA 3G0OA 1DHRA 4G81A 4YJGA 4U6QA 5F1KA 4DL9A 4TQGA 1NQTA 1R4NB 3AOGA 4EI2A 4OMUA 1UZMA 1RPNA 4BNNA 1TLTA 2LDBA 1C0IA 4ONEA 5A9SA 4D7AA 1N2SA 3U4HA 3RUEA 3I9JA 1N9GB 1Z73A 5EINA 5FF9A 5G0SA 1E7RA 4OQZA 3LC2O 4E30A 1PZFA 4OHUA 2C5EA 4AJNA 1SZJG 1RM4A 3W8DA 4RPJA 4Z9YA 3EZYA 4WLNA 4Y67A 5U1PA 1C1DA 2LDXA 3JQ9C 3E9QA 1I8TA 3ICCA 4IIUA 2VN8A 1UDAA 1RM3A 4E21A 3EHEA 4W7IA 1HETA 4WGGA 1LSSA 3KLPX 4GVLA 1E77A 4I08A 3OQBA 2ZQYA 4RVSA 2FY8A 3VH4A 4NK4A 3PZBA 1YDEA 4NFSA 4R01A 4WCFC 1VL0A 4FSHA 4A03A 4DGSA 1Y7TA 1PEDA 3CMMA 1LNQA 4OXNA 3MJEA 1E1LA 1KC3A 2DM6A 1ZBQA 3U9LA 4PZCA 1QKIA 4E5NA 1T2FA 1X1TA 1Z82A 3GDOA 3L9XA 1U8XX 4QO8A 3A9WA 4BNYA 4QT0A 1PSDA 1PWZA 4FC7A 4BGVA 3C7DB 4E4YA 3ITDA 1U7TA 1NWHA 4UUPA 3WIEA 4EZBA 1NPYA 4RLSA 3CE6A 3S8MA 3GEMA 3IIEA 3H7AA 3WMWA 2VT3A 4CM5A 3GZNA 4OOFA 1PGOA 4GVXA 2VHXA 3SX2A 3W4JA 3ZHBA 5BSFA 3FCOA 3K2EA 2W90A 3DZBA 3JD4A 3VDRA 1XYGA 3DTYA 4HP8A 4IDEA 4CQLB 4OO3A 3WQRA 1LRLA 5IDYA 3UXYA 2GZ1A 5JC8A 4CLRA 4BS9A 4XX0A 4J7XA 1IHYA 1KC1A 2Y66A 3B1JA 3F4BA 1Q7BA 4P4LA 3BMQA 3UCEA 4Q3BA 1JWAB 4DUPA 4JQCA 3DEYX 2PKRA 4UAGA 4BNIA 1LC0A 4CUJA 5JY6A 4D79A 2BFOA 3JYQA 2AXQA 4OAQA 2YY7A 3IS3A 3ROKA 1HDGO 4LRTB 3V8BA 4YT8A 1IY8A 1RM0A 3TOXA 2V7PA 4AJKA 3GEDA 5JS6A 1D7OA 2HRBA 3Q1LA 1H6DA 2CNBA 3ZU5A 3NGXA 4PN3A 2G1UA 3W1VA 1QXSA 4NBWA 1NTOA 3WXBA 4JBIA 5EESA 3ZHYA 4PRKA 4IS3A 4JBHA 1E3JA 1TB4A 3ROMA 3VHRA 3KZVA 2O3UA 2AA3A 1VC2A 4R68A 5CG1A 2NQ8A 3RWBA 1DAOA 1NXQA 1DB3A 2GYYA 4WPGA 4Y9DA 4D43A 4TWRA 3ZW8A 4PG7A 3B1FA 3WGZA 1P1KA 3QA9A 2YQ5A 3P2YA 4HKTA 1VKNA 1FDSA 2H5LA 4I1IA 4ZQGA 4E32A 1HSOA 4I5GA 1UP7A 4BKUA 5DCUA 1DJNA 1GCUA 4JGBA 1P1IA 2JHGA 4IDBA 2Y68A 1QLJA 1PZEA 1LDMA 3UW3A 1B3RA 4R9RA 2UV8A 4FJ0A 2OP1A 3WGTA 2EGGA 3QRWA 3VZPA 2H63A 3F46A 3LC1O 4FDAA 1V35A 2B35A 3BMNA 1H2HA 4CM4B 2J3KA 2PGDA 1LDEA 2DUWA 4FR5A 1NFQA 4DC0A 5BNFA 1HXHA 5KVSA 5KWEA 5L4NA 2CSUA 1AHIA 4EGFA 4ALKA 4RDHA 3RROA 2X4GA 1N7HA 4IUYA 2PD3A 1G6KA 1UXJA 3Q3CA 2BF7A 2JFGA 4LCJA 3IL2A 2QG4A 2O50A 2RHCA 1YBVA 2PTGA 3AFMA 4GPD1 1YKFA 3GHYA 3ZV6A 2QHXA 3H4VA 4PIVA 4DQUA 1XSEA 3ON5A 2YDXA 2DAPA 1WDMA 4ZVVA 4D44A 4RF5A 1HDYA 2C29D 4J3FA 4ND3A 1M6HA 3D3EA 3GQVA 4XR9A 3G79A 1XA0A 2Q49A 4WEQA 2IYOA 3E5RA 2JFFA 3N74A 1HDZA 2PA3A 3ETDA 1HLPA 3UAGA 4PRLA 1NAHA 4R16A 1Y6JA 4BO0A 4L76A 3BHJA 3EGOA 3PWKA 4ND4A 3ENKA 1PGQA 5A05A 3MJVA 1PJ4A 3KO8A 4BO5A 1QMGA 3LF2A 4XGNA 4P38A 5TJ9A 4J4HA 3GVHA 3OH8A 2X0JA 4QX6A 4CMHA 2ZKLA 4BNTA 2WTBA 1KEPA 2GR9A 4AJHA 5T64A 4R4JA 2P2SA 1NR1A 1GUYA 2YZ7A 3K6JA 5JCJA 3VVCA 5B4UA 1KETA 2O3RA 2JD0A 5JFOA 3MWDB 4XJTA 2QYTA 5T67A 4NJOA 1HDRA 3QE3A 4X54A 1I5RA 2VQ3A 3DZFA 1DRWA 1K89A 4W6ZA 4ZU3A 4N5NA 4D41A 1FJHA 1N92A 1IPFA 1NM5A 2F1KA 4MP8A 2EKQA 2NVUA 3H3FA 4G65A 4JJIA 4Z3DA 4E5YA 1V8BA 3ZWOA 3STHA 2PY6A 1ZIDA 3U4IA 4WLVA 3V1UA 1VSVA 4GKBA 4MINA 3FNHA 4FIZA 4UEKA 3RC2A 4BKQA 3L4BA 1B26A 4JN6B 1LJ8A 1MG0A 1V3VA 1PL6A 1QG6A 2FR1A 3PWSA 4GX5A 3IKVA 2Q45A 3JTMA 2GASA 1GYRA 4WLUA 5G2OA 1Q7GA 1ISHA 3TRIA 1Y8QB 2ZQZA 3ZWNA 1YBMA 1T2DA 1QV7A 3CMCO 4BUCA 4A27A 2GNAA 2EKLA 4B4OA 2CDAA 2HMUA 1LTHR 2OHXA 4IDFA 4XB2A 3ADOA 2ILTA 2W98A 5GY7A 4GMGA 3KYBA 1ZCJA 2NV6A 1B8VA 1ZSVA 3DDNA 3ZGYA 1A9YA 1XHLA 2PH5A 1BXZA 1UDBA 3JQ6A 3TN7A 2IRWA 4ALLA 4J7CA 1QYVA 5H82A 2XXBA 5U9CA 1CJCA 1DC6A 2FOIA 2WYUA 4R1SA 3ZNPA 3D4NA 1UXGA 2VTEA 4RPLA 4RVGA 3BAZA 1UXHA 2C5AA 1KY4A 2B5WA 4ZRMA 1ZSNA 1OFGA 3QVTA 1E7MA 3E1KA 3BMCA 3GFBA 1ZMTA 4AJPA 4BMVA 1Y81A 2Y0DA 5IDXA 1M75A 2J6IA 5DT9A 4PLFA 4FB5A 2PKQO 4MVJG 2GERA 3PIDA 4O6VA 4ZHSA 4PVDA 1AXEA 3IAHA 2Q4EA 4UREA 4C7JA 2ZK7A 3JQ7B 4FPXA 3LSYA 3AI1A 2OMEA 4KUGA 1VLLA 2NTJA 5KVVA 3GG2A 4G2NA 3WS7A 3AM4A 4ZQFA 3X2FA 1EVJA 3B20A 3BZUA 3E5MA 4RGBA 2JD2A 4JNKA 1PJ2A 3IJRA 5I8WA 1Y8RA 1KIFA 3KYDB 2NLOA 3VOSA 2HMVA 3B6ZA 3L4BC 3TZQA 3TL2A 5IDWA 2GF2A 2ZTUA 3LZ6A 4ESOA 3GY0A 3WFIA 1LLUA 4CM8B 2BFAA 1XIVA 2Y99A 3JCZA 2HUNA 3I9NA 5TT1A 1HYGA 3W4IA 1DLJA 2W8ZA 4Z0HO 2WE7A 5IF3A 4CM9A 1GCOA 4MIOA 4NIMA 5JLAA 3ABIA 1CQIA 3DBHA 3WG9A 2A35A 2PKQP 2POQX 4YJFB 5JCJD 3LLVA 3NTRA 4R69A 3JD2A 3MOIA 2IODA 3K2BA 2D5AA 1T2CA 3QJ5A 3F6YA 1HYHA 4NBUA 3WBFA 4F46A 4YT2A 4JX8A 5EERA 1DIBA 4U0JA 3BHMA 3AFNA 3M2PA 1SOWA 1YB5A 3AY6A 4H7PA 5TT0A 3K73O 4J6FA 5I7EA 3LT0A 1BSVA 1H93A 2HDHA 1DIAA 3FN4A 3KM0A 1ZK1A 4NZ9A 4XWYA 4BO1A 3DZKA 2G76A 1NBOA 3GZ4A 3RUCA 4GX2A 5T57A 5C3MA 1J49A 3ULKA 4EUFA 4WJZA 1TA4A 1ZK4A 1PU2A 3DZIA 4FGWA 4Q39A 5KVQA 1U3VA 1ISGA 3GOHA 3HDYA 5JCXA 4TRJA 4RDIA 3W6UA 3VVBA 1DFHA 1LLCA 4M87A 3F1KA 4EITA 1W8DA 3DFUA 5L40A 3LVFO 3AU9A 3N58A 1JKIA 5KIAA 1DEHA 3BHIA 3OJ0A 1F12A 1U3UA 1VJTA 5HS6A 5A5EA 4II3A 1J4AA 5DULA 1Q2XA 3PHIA 2X8LA 3RC9A 3ROPA 4BNVA 4D42A 1SO8A 1I01A 4TVBA 1BHSA 1K3TA 4K6CA 4Z6KA 3KB6A 4E0BA 3O4RA 3FNFA 4CMBA 1YO6A 2VOEA 2CFCA 4LK3A 1ENYA 5IAAA 2UUOA 4EJMA 1WVGA 4II2A 5EL0A 4DREA 4H16A 3RC7A 4QFCA 2I3AA 3INTA 1ORRA 5T6BA 1B8PA 3PJDA 1WW8A 3Q9UA 1GV0A 3GDGA 1RWBA 5DDIP 1GEGA 4YJHA 5L4SA 4BV8A 3ZWPA 2JCVA 5IN5A 4PGFA 3NYWA 5DP1A 2DBZA 2G17A 2PD4A 1E1NA 2OL4A 2X9NA 1NVTA 2XF8A 3NDJA 3NJ8A 4UVGA 3I6QA 5CG2A 1JU9A 4FGSA 5I8ZA 3R0IA 3CZRA 5IFLA 3A4VA 3ZH2A 1P74A 4B7XA 4MP3A 5AVOA 2VTDA 1PJLA 4XIYA 4RVDA 4Z0PA 5A1TA 4CV3A 3DAGA 3HNPA 3ZV5A 1ISFA 3DO5A 2WD7B 3C85A 3PYLA 3L6OO 4WE3A 3IC5A 3NT4A 4QO7A 1E1MA 3GC6A 3VPFA 4DVJA 2PZMA 4JBGA 4XQGA 3OQ1A 1L7EA 1U8FO 4OKIA 1GU7A 4PLTA 1KEUA 1RKXA 5F1PA 9LDTA 3ZNNA 4HWKA 1B8UA 1EVIA 1X0VA 3FPLA 4FD3A 4KMSA 3I4CA 4LGVA 4YXFA 1DXYA 3PDUA 2GSDA 4HFRA 4R1UA 2FR8A 1E3EA 4EW6A 3C7AA 1YQXA 2O48X 4WASA 4GKVA 2RIRA 3HN2A 3ICPA 3ONFA 4OYRA 3JSAA 4YYZA 4A2CA 2HAEA 3AI2A 4FFOA 4CM9D 3GAFA 1R15A 3MJTA 5IJZA 4DLAA 1ZK3A 3OSUA 3UN1A 2JHFA 4O63O 1XCBA 2O7SA 1E6EA 2FZEA 2RAFA 3K92A 3V5NA 3QP9A 1X15A 4OSPA 1ML3A 1I3NA 1JKFA 4YWJA 2E6UX 2HRZA 3U3XA 2AQKA 4EUEA 1GADO 3QVXA 4BNZA 4BO4A 5GZ6A 2IEDA 3OEWA 3H8VA 1D1SA 4D0RA 3CZMA 1A7AA 3ONEA 3ZHZA 3QSGA 4LW8A 4XGIA 1O95A 1A71A 1QYXA 3GGGA 3VH1A 4PZEA 3WGGA 3OETA 3OICA 3GNQA 4R5MA 1NNUA 5EMHA 2Y05A 4XQ9A 1CDOA 1YH3A 1LSUA 3KBOA 4DA9A 2GZ2A 5KKCA 3QWBA 1E7SA 5DBFA 4CM7A 5JW6A 1U7HA 4ZQHA 3GVXA 3TWOA 3M1LA 5CEFA 4CV1A 3UICA 4MP6A 5A06A 4H3VA 4OH1A 1BGVA 5FFFA 4D0SA 4A26A 1DC3A 2VHZA 1YDWA 3I52A 1OOEA 1BRMA 4NPCA 3AU8A 3TL3A 3K96A 3H5RA 2O3QA 1M67A 2BFMA 3FD8A 5A9TA 1ZSYA 4RJTA 4BQPA 3UH1A 3EZLA 4PLCA 1B0AA 1SB9A 4XYBA 2NU7A 1RM5A 4LVCA 4ND5A 4CMAA 4ZN6A 4NU5A 3BTVA 1ADBA 1NQOA 1PJQA 3DBLB 2B4QA 1R4NA 4XKJA 4P22A 2A4KA 2E48A 1X1EA 2DPGA 2P9GA 4FFPA 4FOOA 5U4QA 1T2EA 4R5HA 1Q0QA 2I3GA 1V6AA 4FJ1A 1M66A 3AUAA 3KSDO 1T1RA 1NQ5A 5AXAA 3TZHA 3MJCA 1JLLA 4PFJA 1CETA 1K2WA 3C1AA 4NBRA 5JAQA 3QHAA 1HE2A 5CFZA 5TSDA 3O8QB 3D3WB 5KTKA 5KJFA 3PLRA 4QFDA 4B4VA 4XRGA 4J4BA 4TSKA 1OC4A 5CHEA 3LQFA 2ZB7A 1LX6A 1G0OA 3S2EA 4MVJA 4W4TA 4BVAA 3WYCA 3RIHA 1DJQA 6LDHA 5ITWA 2FRDA 2BFPA 3CPSA 2B83A 4HV4A 7MDHA 1XU7A 3W8EA 5G4LA 5T8KA 4XRRA 4YBZA 4N18A 1SOVA 5IXYA 3JQEA 3FF4A 4UEJA 4I8XA 4YAKA 1C0LA 2EJVA 2X22A 1B2LA 2O2YA 2JD1A 1BMDA 4P4NA 4Y6PA 4A7PA 2NTNA 4I9UA 1H6CA 1RYEA 2VNAA 4XYMA 1MC4A 1H6BA 3DZJA 3KVOA 4IQGA 2V6FA 2VUSA 1ISMA 3EVTA 4CPDA 4YB8A 1GQYA 4BIIA 4AJ2A 4WCFB 4EUHA 2J8ZA 3DC2A 1O5IA 1VSUA 2Q2WA 3ZU3A 2ZTLA 3G1TA 1E7WA 2GUGA 3HADA 3MJSA 3KRTA 1KOLA 1P33A 2R00A 1F8FA 4PLHA 1ZKMA 5THKA 4IIVA 1G1AA 4WOKA 4U6SA 4CMIB 2DTEA 3JYPA 3GMDA 2Y1OA 3ZWWA 5JY1A 2HK7A 3D1LA 4OXKA 3ITKA 4TRMA 2VWPA 5L9AA 3DHEA 3OJOA 4YT5A 2YJZA 2X9GA 3WYBA 3RKRA 5EIOA 4YRAA 1G0NA 2ZYDA 3VPXA 1AUPA 2EW2A 3JQGB 4IJKA 1Y1PA 2X23A 2FP4A 3VZQA 3H2SA 5CAEA 1WAMA 1PTJA 3VH2A 1BG6A 4L8VA 1MC5A 3ZN2A 4DMMA 4PG5A 1T4DA 1EBUA 3TSCA 5JAIA 2D1YA 3K9QO 4PLWA 4Q3EA 1EQUA 4ALJA 3DONA 4KWIA 3I5MA 5JMWA 3JQAB 2BRUA 3NJ4A 3HQ4O 3U62A 4RPHA 1B3BA 3BMOA 1V0JA 3TFOA 3PGJA 1C14A 3FTPA 1DO8A 4WNCA 3S1LA 3HDJA 1GEEA 5H81A 4DXHA 4AFNA 5T8KC 1HRDA 1I32A 1DC5A 4TZTA 4XYEA 4CL3A 1T24A 1SB8A 3OBBA 4N5MA 2WM3A 2NVWA 3DR3A 5KJEA 3GPIA 4DC1A 5BNIA 3ZCXA 5JDIA 1JWBB 4XEHA 4BO6A 4XDYA 5ES3A 3ZDFA 3OM9A 4RPGA 4CM4A 4BNHA 1BXGB 3RFTA 3A06A 3VPSA 4RQTA 2GN8A 3JD3A 3VDQA 4KQXA 1JTVA 1I24A 2OORA 4WLOA 5L3ZA 4YRDA 5KKAA 2FSSA 2EEZA 3EY4A 5TJHA 2Y1CA 4MVJD 3GVPA 4EEXA 3G17A 4YAJA 1YRLA 4J0EA 2W2KB 2R00C 3D4OA 2X6TA 1YL7A 2XOXA 1WDKA 3DAFA 2C2XA 1U2GA 1PL8A 4L0QA 3C8MA 1YONA 2FPPA 1O6ZA 4WLFA 4JXKA 4BNGA 2BELA 1E3WA 1W6UA 2DVMA 2GN9A 4IDCA 3SEFA 3PRJA 3OMLA 2O3JA 3WR5A 4MVJM 1P0FA 4PG6A 2HO5A 3H9QA 3ANNA 2E37A 2DTXA 2HMWA 2HKIA 3PIIA 1AE1A 4IGEA 4KTVE 3SBOA 2Y67A 3QY9A 1U2DA 2VHYA 1QRRA 4CLRB 2NNLD 3LT4A 3WLEA 4UUOA 4HADA 1Y5MA 5L53A 4Y8VA 4PLZA 3Q2KA 2RBEA 1CYDA 4TROA 1WZIA 4NK5A 4UULA 2PD6A 5TNXA 4Z9FA 2ZCUA 4MVJF 1MB4A 4KWHA 4DPKA 4JP3A 4ND2A 1K5HA 3T7CA 1NWCA 2C07A 3RC1A 3MOGA 4I9NA 5HTOA 1PJ3A 2ZJ0A 2Y0EA 4Y6SA 2CDBA 1WXDA 2I99A 2OBYA 1YS4A 3PVZA 2WYWA 4E12A 3RAJA 5BNTA 2VYVA 4WUVA 1AGNA 2YHIB 3UGKA 3JYLA 1R6DA 3D64A 1TT5B 3U0BA 4E33A 3MTGA 4O0LA 4N7RA 4QSMA 3GGPA 5JDIC 1A72A 2NADA 2Q1WA 1NPTO 3I4FA 2VYNA 4E2ZA 2B4TO 3HHPA 5DCWA 1I2CA 1MV8A 3EC7A 1IB6A 1NFFA 3PQDA 4URFA 4I5FA 4BOYA 4PLGA 3AOEA 1LRJA 5CDSA 1UZNA 1PL7A 2IXAA 1J0XO 4KTTE 2NU6A 4A73A 4CM1A 3Q0EA 4XR4A 2CF6A 4HY3A 1MGOA 4LMPA 1BW9B 1YOVB 2DBQA 2X9VA 3VAZA 1ARZA 2OFPA 4LVUA 3WWYA 5A04A 1R16A 5CPBA 4YRBA 1CEQA 2P9EA 1NFRA 1A27A 3QLJA 1YXMA 3PYXA 4I5DA 2J5QA 1Y8QA 4HNHA 4NQZA 3F47A 4BGEA 4L9RA 4D46A 3JV7A 3OJLA 5CDGA 2ZJ1A 8LDHA 1DSSG 4JIGA 3RJ5A 3KV3O 2I6TA 3DMYA 1X13A 1PJBA 2TMDA 3KEOA 3EYWA 3TDKA 2CY0A 3C24A 2WMDA 3W8FA 4XGKA 5C7LO 3W4KA 5HRUA 2SCUA 3DB2A 3GUYA 3PXXA 3NUGA 3SJUA 2C0CA 3OIFA 3S55A 4E3ZA 5C7OO 4RVUA 5IZCA 3NTOA 4CR8A 3X2EA 3AUTA 2EIHA 3AJRA 1OZAA 4N54A 3F9IA 5JMPA 1TVEA 1VE9A 4YCAA 5ITVA 3FTNA 4IDGA 1BDMA 3TZCA 4ITUA 1PQUA 3BTUA 1H2BA 1F0YA 1Z74A 1MFPA 1K0UA 1QYWA 1PS0A 5JC1A 1U3WA 2V6BA 2XXJA 4Q9NA 2B36A 3FWZA 3KXDA 3ST7A 2VZ8A 3ZWXA 2FPIA 1I3MA 2HJSA 3PHGA 2PGLA 5AQ1A 3PFFA 4C4OA 3DAPA 4JROA 5JXWA 4W9NA 3WJAA 3PFWO 3DZGA 3GNSA 3VTZA 1YWGO 4P8RA 1HDCA 1H0KA 4WCDA 3AOEC 3OP4A 4LN1A 3COSA 3MZ0A 3ZNOA 3V1YA 4JJFA 3LT2A 4LSWA 3QWFA 1UUFA 1Y9AA 2A94A 1UDCA 2Q3EA 4IINA 8ADHA 3CH6A 3B70A 4CUZA 2HCTA 3UOGA 5HWSA 1U28A 1GTMA 3D5TA 4CUKA 4EBFA 1J5PA 4BO7A 2EERA 3IP3A 3WSWA 1QR6A 2DU8A 3OJEA 4BMNA 4IJUA 3PQFA 3EW7A 1CF2O 4YJFA 1WP4A 4ALIA 4TVOA 3AY3A 2BGMA 1JDJA 1EBFA 2VYVD 1L7DA 1B14A 2PGJA 2YDYA 4J90A 4ZQEA 4MVJH 1XDWA 5L51A 4DLLA 3M1AA 4YA6A 1FXSA 2DTDA 3E9NA 2P5UA 1VI2A 3LK7A 3GEGA 3WLFA 3LU1A 1HKUA 3S2FA 2VYND 3CEAA 3D0OA 1CRWG 4ALNA 5G0UA 5JSFA 1PR3A 1Y9EA 1GUZA 2H9IA 5C7IO 2O7QA 3PHHA 1JN0A 3U5TA 3LF1A 2C7GA 1ONOA 3GGOA 4NJMA 4QEDA 2YFQA 2WDZA 2JCXA 4Y6RA 5IZCC 1H9AA 3L9WA 2YHUA 2CUKA 3PJFA 4DLBA 4IDDA 1SEVA 4LISA 4E5MA 1GZ6A 3WGIA 4DBVO 2EP5A 1RJWA 4HBGA 3ZU4A 3EVNA 2PH3A 1DIRA 3GMSA 2HMSA 3H9UA 1GPJA 3F5QA 4GI2A 4OL9A 4ID9A 4HFMA 1TI7A 4WOJA 1T2AA 1KEVA 4UVEA 4PVCA 1ZO8A 1FDWA 5CPFA 4Z3KA 2IYPA 1EFKA 4YQZA 5AYVA 5JAZA 5I9MA 4B4WA 3QVWA 3NTQA 4NFYA 1ZJYA 4RF2A 2UUPA 3E18A 1JVBA 4BGUA 4U7WA 4W9NC 4JK3A 3NDIA 4GH5A 5ER9A 4KQWA 3QQPA 1WMBA 2Q99A 3JD1A 4XYLA 2GN4A 3NT5A 2FHSA 4FFMA 1WWKA 2PFGA 4QTZA 1E3LA 4ZD6A 1HSZA 2Z1NA 3RVDA 4MDHA 5KJ6A 3D4PA 4IXWA 2X0RA 2AQHA 5AXDA 4DYDA 1UJMA 2B5VA 4GGOA 4J1NA 4J9UE 5C5IA 5IXSA 2BLLA 2GDZA 2W2LA 1JVSA 3RASA 1LSOA 1ONPA 2OO5A 1ZK0A 2CDCA 2RCYA 2WD7A 3BYZA 4O5OA 5T5QA 2V65A 5FYDA 2AMFA 1JA9A 3PWZA 4N5LA 3FHLA 4E13A 1ULUA 2IZZA 3SVTA 1ZEJA 3K5PA 3S2IA 1C1XB 4TRRA 4DPLA 2B0JA 2BGLA 2QIOA 5TF4A 3AUSA 3NT2A 1ADFA 1KVRA 1R4MB 5L7WA 2GRAA 4DYVA 3ZU2A 4CMKA 1HDOA 2QX7A 4B3JA 3KOUA 4M55A 4ZA2A 2DFVA 1AN9A 3QVSA 1PIWA 2VWHA 3Q6IA 3AW9A 1XWFA 4WECA 1YE3A 4GX0A 1HE4A 3V2UA 4YVFA 3DBHB 3FSRA 4PZDA 3RBVA 2WJPA 1ISJA 1DLIA 1LLQA 4HFJA 4BB5A 2Q1SA 1P9LA 4CV0A 3FNGA 4CQMA 4YDRA 4EJ0A 2YV3A 5B4TA 2FPGA 5IZ4A 1Z6ZA 6ADHA 2DQ4A 3AUUA 4NMHA 4CM3A 2YQ4A 3VPGA 1N5DA 1I33A 3ASUA 5L7YA 5CDTA 4JP2A 1Q7CA 1QP8A 4OM8A 4JCOA 3RUHA 1P1HA 3DOCA 4L4XA 4ALMA 1H94A 2HLPA 5HM8A 4IM7A 3AI3A 3FWNA 3GT0A 1JQBA 2IDZA 1PWXA 3MWEB 3E48A 1LDYA 2YYYA 3HDQA 4IY1A 2G82A 2GGSA 5I7VA 3GLQA 2D3TA 3ANLA 1GUFA 3QIVA 1GZ4A 3RI3A 1E5QA 4EDFA 3N7UA 3F5SA 3VKUA 3RUAA 5CDUA 4R3NA 2DBVO 2P91A 3CINA 1P0CA 1N7GA 3GAZA 3RQSA 1O0SA 1E6UA 2NSDA 2BGKA 5JNLA 1F14A 3CUKA 1O89A 4NBTA 5G4KB 4INAA 1IL0A 2O4CA 1PS9A 4MJLA 4PLYA 3SLGA 2F00A 5HS4A 1HLDA 4K6FA 2NVBA 2I5PO 5I7FA 2Y1EA 1A4IA 3GG9A 4LRSB 4MIEA 2VZ0A 1T1SA 3OIDA 4LMRA 1H9BA 2J3IA 4BNXA 4E5PA 5JDCA 1VKOA 3EDMA 2DC1A 3EMKA 2EP7A 1T4BA 2EV9A 1X7GA 3NAQA 3KEQA 4KDFA 5ILOA 2IZ1A 1CWUA 3R3SA 1KVQA 4Z9XA 5G0VA 3ZV4A 1IZ0A 2D8AA 3AY7A 1HWYA 3L6DA 3WQSB 4Q3AA 2QRKA 4E5KA 4BNMA 2X0NA 5B4VA 5F5LA 4YJHB 2C2YA 3CXRA 2E4AA 2Q1TA 3ZZNA 3ZI0A 4KUHA 2R2GA 3R6DA 3O03A 3JQCA 3DWFA 4DMLA 4WEOA 3GPDG 5L4LA 3OQ6A 4O1MA 1WMAA 4BNUA 1ZW1A 3CKYA 5A02A 3E9MA 3FRJA 4MPDA 4MVJE 5ER6A 1FF9A 1LRKA 3JQFA 1Q0HA 4XQEA 5G0WA 2OUIA 1R0SA 3D3WA 2ZATA 3O8QA 3PPIA 4CLOB 2W2LD 1KS9A 5HBRA 3ORFA 4I9HA 2JJYA 3KHUA 4EEZA 5COQA 3DOOA 1SPXA 2BH9A 1EUCA 4KDEA 4CLXA 4TKLA 2VRBA 3INRA 1U9JA 3GUCA 3NV9A 1O8CA 1GAEO 2CVOA 1BVUA 1ZJZA 4W82A 3FBGA 2GD1O 2WSBA 2PR2A 5HA5A 3RKUA 3ETGA 4D3FA 1DIGA 5G0TA 3CTMA 1NX6A 5IN4A 5JYEA 3JQ8B 4XYGA 2O3SA 4FN4A 4B7UA 3NGLA 1ULSA 3RJ9A 1DHTA 2HK9A 5GZ3A 2DBRA 5MDHA 4U8GA 3SC6A 4AG3A 2DT5A 3K8ZA 4GGPA 5K0ZA 2DKNA 2JAHA 4FBGA 5EQDA 1IZ9A 5B1YA 3HN7A 1N9GA 5LDGA 4CQMD 1U5AA 1V9LA 4HXYA 1I30A 2P9CA 2AG8A 1DFIA 3TZ6A 4YAGA 2VHVA 1PQPA 2Z5LA 4WK6A 3H9JA 4GLLA 5LC1A 3HB4X 3JQDA 1KVTA 1A4UA 3ADPA 4NHEA 1UZLA 3GR6A 1QLHA 5JDCC 2AEJA 3V2GA 2BKAA 3F1LA 1PJCA 4UUNA 3DBRB 4OJNA 2NU8A 4MVJP 4J49A 2ZB8A 4MIYA 5DZSA 1MG5A 1Y5RA 1PGNA 4R54A 1XGKA 1EE2A 4OQYA 5JBIA 2C54A 1P1FA 3NRCA 4L75A 2I9PA 2P5YA 3MJ4A 4OOEA 3I3OA 2X86A 3CIFA 4RL6A 3Q2IA 4BMSA 4Y98A 1KERA 2D4AA 3JQGA 4NNJA 5JAMA 1AXGA 3KSUA 2P68A 5CDYA 2GO1A 2IE0A 2VWQA 2HK8A 3NDRA 2X1HA 5JE8A 4UVHA 2IXBA 3I6IA 3P7MA 4J7UA 3JQFC 1PQWA 2YW9A 4B8ZA 9LDBA 1HF3A 3OHSX 1W0CA 4PG8A 4BO9A 1E6WA 1WLYA 4BNLA 2V6GA 2QQ5A 3JQAA 3IUPA 4CQLA 4FJ2A 1XEAA 2A9FA 5LCXA 2QRLA 3NKLA 1XR3A 3H65A 3KUXA 3GVCA 5FI3A 1NVMB 4AJOA 4E6PA 1XG5A 2AHRA 1NHGA 1WDLA 5DBIA 5DN9A 2Q2QA 4ZJUA 5IDQA 3E82A 2B69A 3KLMX 3TPCA 1R66A 2EGHA 4PLPA 1LSJA 5KJ1A 5KVCA 4GWKA 4RCVA 3ZNQA 1NVGA 3T7EA 3LLSA 1P77A 1GQ2A 4GAEA 2ZCVA 4L74A 3H9GA 3GN1A 1QYDA 4OXYA 5ILGA 3RFXA 2UAGA 1SNYA 1DOHA 4BL5A 4BNFA 3GRPA 1H5QA 5THQA 4JJGA 1SCUA 1BXGA 5KJCA 4FC6A 4AJ1A 1ENOA 3I1JA 3FR8A 4YAEA 4MKXA 2YV1A 3WWZA 2HQ1A 4D3SA 4UEOA 1UP6A 1E5LA 1GDHA 5F1OA 1J6UA 2HMTA 4GLOA 3KTDA 3WFJA 5A3JA 1WZEA 3D7LA 3GFGA 4J43A 3PYMA 4CR7A 2FZWA 2FR0A 3KYCB 5A4DA 2W2KA 3RFVA 1NQAO 2CMDA 3VTFA 4YJGB 4QQRA 1JAXA 1F8GA 2AG5A 4M8SA 2YUTA 3PP8A 5A9SB 4RO0A 1GYPA 2OP0A 3TOZA 3PEFA 3GDFA 4IQ8A 1X7DA 1GFSA 2WYVA 2Y1FA 4J2HA 2XAAA 3IKTA 2QZZA 5DF1A 3O26A 1GY8A 1EEHA 4LSMA 3GRKA 3A1NA 5KNLA 4J1QA 4P4GA 5L95A 1Q0LA 2Y0CA 2ZYGA 1JAYA 2X0IA 4RZIA 3PK0A 1C1DB 2X5JO 3ENNA 2GLXA 1KY5A 1LC3A 1LUAA 3UCFA 3QVOA 4OIMA 1D1TA 2Q50A 4Q3NA 2FSVA 2I76A 4E2XA 1KVSA 4B7CA 1V3TA 1MX3A 4IGFA 3QW2A 3GK3A 4B79A 1V3UA 3TFQA 3H2ZA 3SC4A 1ZVMA 1HZJA 2CZCA 5I7SA 3TZKA 1E92A 2EF1A 5F5NA 1JKJA 5GZ1A 4RF3A 4GL4A 2D59A 4L73A 1SBYA 2ZTVA 2VT2A 1N1GA 1PJSA 4H15A 2FMUA 3VKVA 3L0DA 3WICA 1P31A 1PX0A 2HJRA 3Q9NA 3LT1A 5F21A 4Z0TA 4BNJA 3BXXA 2QRJA 5COBA 4F3YA 5B12A 2YHIA 3HB5X 3K31A 3BA1A 4CMJA 3HE3A 1TT5A 3GZNB 1PS8A 2Y1GA 1ADCA 1BVRA 3M6IA 2RH4A 4NG5A 1X0XA 1YQGA 3H3JA 1EE9A 1H6AA 1LLDA 3QWIA 3WOHA 5A3VA 1IYZA 2EG9A 4XQCA 1LI4A 5BSHA 1QV6A 5FI5A 1LQUA 3BMOB 3DHNA 2X5OA 4YPOA 1RYDA 3JQAD 2VZ9A 5BSEA 3Q11A 2VUTA 3BMQB 1I10A 1EDZA 5I9LA 1P44A 4MOWA 1BW9A 1NR7A 1YOVA 3WX0A 4QECA 4YQYA 3GF4A 1LEHA 4EYEA 1PGJA 2VNSA 4S3MA 1DRUA 1I0ZA 3WGYA 1MXHA 1M2WA 3B1KA 4XJSA 2HSDA 3OA0A 5ADHA 1VM6A 3C1TA 4ND1A 2PNFA 1E0DA 2OBNA 3H9EO 4UVDA 4XIJA 3NEPX 5F3RA 4AJLA 4JLWA 4OSOA 4AJ4A 3QV1A 2AW5A 2DLDA 1UP4A 4FCCA 4J1TA 3OF2A 3VZSA 4RORA 1LU9A 1GQQA 4XB1A 3HWRA 4AICA 1M6WA 3TNLA 3HSKA 4FFNA 5EQFA 4BKRA 3U4CA 2NWQA 3UHAA 2C20A 1OMOA 1YJ8A 3DZHA 5I9NA 3ROQA 4IPTA 2I67A 3EK2A 1EK6A 4A5OA 2OZPA 4BKOA 4CL8A 4W99A 3ZHXA 1R0KA 4F6LA 1GPDG 2VWGA 1W4ZA 2NM0A 1E3WB 3O38A 1I2ZA 1KBZA 1HE3A 3H5NA 1S6YA 1NASA 3R1IA 3I83A 2J3HA 2I66A 1B15A 1I2BA 2BI8A 3HFGA 5AOVA 5JYDA 5H83A 4GX1A 4DWVA 2Q46A 3F3SA 1LQTA 4FOSA 1CIVA 2WE8A 2OOSA 5TIIA 4R1TA 5MGBA 1DIHA 4HFNA 1P1JA 1ID1A 3BMNB 1GV1A 4NFHA 3AWDA 3RBZA 1SC6A 4GMFA 4IXTA 2VRCA 3E03A 3IDSA 1GL3A 3DQPA 1EZ4A 2H1SA 4W7HA 3SJ7A 1FMCA 3A28A 3V1TC 3WIDA 1R37A 2AE1A 1EK5A 3JQBA 3TQHA 4Q3CA 3WGOA 4F45A 2PLAA 1U3TA 3HDHA 4G5HA 1YBAA 1XKQA 3T4XA 3VH3A 5DCYA 4U5QA 3DBVO 4C7KA 2D2IA 2NTVA 4O59O 1K6JA 3RUDA 3LDHA 4ILKA 1K6XA 1ZMOA 3JYNA 3PQEA 5LDHA 5TQVA 5JPIA 4XZ3A 1Q1NA 2DPHA 2VCYA 1FDVA 2A92A 4R1NA 2V6MA 2EJWA 1ZNQO 1IHXA 3OJFA 2YV2A 2ZTMA 4AJJA 1Z75A 1W73A 4CJXA 1PZHA 1YB4A 3FI9A 2B4RO 3AK4A 1EUZA 3GN2A 4IZIA 4FS3A 3UCXA 2JKVA 1VJ1A 2X58A 5TS3A 1U4SA 3IMFA 3GHHA 1IPEA 1VL8A 2BI7A 2E82A 1C3VA 5EJ2A 3S2GA 3JQ7A 7ADHA 3BTOA 1NHWA 4M89A 1TEHA 5BSGA 2PK3A 1VPDA 1DFGA 3DXFA 1WNTA 2WD8A 1D3AA 3HZZA 4YAIA 4DQVA 4BNKA 2GZ3A 3AM3A 3U49A 1FDUA 4YR9A 4WLEA 2AEFA 2BHLA 3KYDA 2C7VA 3ZWCA 3I9OA 2NACA 3F4LA 4BV9A 3AM5A 4TKMA 2JL1A 4RQUA 1SMKA 3HJAA 3SXPA 3DHYA 4CM8A 4QUKA 4LCEA 3OIGA 4GSKA 1WPQA 5DNAA 1BXKA 3T4EA 5KOIA 4M54A 1NYTA 4HX5A 2Q2VA 2EXXA 4R3WA 3VZRA 3GH3A 1IOLA 2NVUB 4IZHA 1S7CA 3PLNA 4AL4A 1C0PA 3GNTA 4NBVA 1F06A 4ROSA 4DPMA 5L7TA 3O9ZA 5DOZA 4DQXA 2ET6A 1UR5A 1YJQA 1B16A 4IBOA 1HE5A 1PJTA 4AVYA 2PWZA 3MCVA 3RU9A 2E49A 4IJWA 3JQBC 1UXIA 2ZYAA 5K6AA 4CR6A 1MLDA 1KYQA 5JO0A 4BO8A 3HUDA 3GVIA 2Y93A 3K30A 4S1VA 3WTCA 5BQFA 2J3JA 1UH5A 5ICMA 4FQ8A 5DOVA 3VC7A 4B3HA 3ANMA 4IMPA 1U1IA 4R51A 5TX7A 1MXFA 2QW8A 3G3EA 1O94A 3V2HA 3ZWYA 1NAIA 5TC4A 1KVUA 3I9LA 4K26A 1UAYA 4I5EA 4L4SA 1XU9A 5KCZA 1DBVO 1EMDA 3IUSA 3P19A 4NH4A 2VRCD 3PDJA 1U5CA 3UVEA 1C1XA 3MTJA 1OAAA 5ICSA 1L1FA 1R4MA 2CD9A 2PZKA 4FFLA 3RU7A 4IDAA 4EJ6A 4RZHA 4XDZA 3NX4A 3D5QA 3DFZA 3IQDB 2PZJA 1I36A 1I3LA 1HDXA 1P3DA 3DMTA 1UAGA 2CVQA 1E7QA 1XQ6A 3FBTA 4RPKA 3ZWMA 3PHJA 1EFLA 3ZWVA 1PZGA
chains in the Genus database with same CATH superfamily
3BXGA 4TMFA 4AJEA 5ENVA 4JT4A 3ZIAD 2ZIFA 5BORA 2KSQA 5E6UB 4BTEA 4KKXB 4H7HA 5CEJA 1YB1A 2BONA 2GOYA 4RGQA 1A5ZA 1OX4B 1NOIA 4YCBA 2XPCA 1XNJA 3LC7O 4WINA 4K9DA 5EJ6A 1P60A 2GRJA 4CLEA 5G40A 3E2IA 4UZSA 4BO2A 2BBWA 1JGTA 4IMRA 3TLXA 4EHJA 4O0MA 6NULA 5HJ5A 4J94A 4CODB 2YWHA 4LF5B 1A9TA 4IIJF 5AKLA 2OXIA 5EJ4A 1UADA 4R41A 1EKXA 1WKBA 2FI1A 5KSPA 3RSHA 4DJEC 3L6CA 4P32A 1D07A 4A8JC 3FOZA 5JO9A 4IHJB 4A0QA 4ES6A 3HU3A 3DWIA 4HNVA 5A5FA 2QZ9A 2JJMA 2C88A 4G4JA 1ZJ4A 5FWXB 2AN3A 3H6GA 3AFIA 5K6AC 3G1WA 1HL3A 1Q44A 1I5OA 4U9UA 4RVHA 4M2LA 2RHWA 1DDOA 2Y1XA 2CHEA 3FWPA 4L5CA 2IGBA 1XD9A 5KTMA 4KOAA 2OCKA 4TRNA 5F52A 2ADOA 1B8NA 2ZXFA 4Y7CA 5K3CA 5J23A 1EUYA 1OXVA 1L6RA 1U4OA 2UVPA 2WEKA 1S3IA 1NRIA 1NN0A 2CF5A 4DMUB 3W7AA 4NI5A 3GCWA 2O8DA 2P4QA 3NTLA 1SVSA 2ABWA 3UUWA 2QM0A 4NDNE 3M89A 2ENUA 3TAXA 3UEOA 5ERXA 2YJNA 4GQIA 4ZV7A 1OBFO 4LNAA 1F7VA 4MXDA 4L07A 1GG2A 3PI7A 4NYIQ 1PK7A 4O2AF 5EEGA 2JGLA 4ZC1A 2HFJA 1KOJA 3WAJA 1A2OA 4OGWA 1QO0A 4E31A 1FP6A 3ELDA 3SQDA 1MEOA 1DUSA 1RRFA 2Z8YA 3OEHA 3ZJ5A 4ZI7A 1QB8A 1ENPA 5CURA 2W4QA 1IWPB 1LWOA 1WX1A 1YJAA 2JI4A 4CLDA 4YACA 1KMMA 2H4JA 3RD5A 3WRYC 4MW6A 5FULA 1NTRA 2YH2A 3C7CB 5ALFA 4MVYA 4MKFA 3HABA 3COYA 4LMAA 4JS0A 4HOYA 3BFJA 4RKFA 3HKCA 5E4FA 1I3KA 4YQEA 4HBZA 2JDID 4F60A 1GL7A 2RGUA 5FWNA 2NUPB 2IYRA 2RI0A 3FAZA 4IP0A 5DHUA 3TJRA 2BHSA 1PR2A 3HY6A 1R0XA 4DOMA 1A9XB 1WUTA 1II8A 2IZ0A 2GPJA 2ZE7A 1A1SA 2X6RA 2PU5A 2BMAA 1Z38A 3RFFA 3EUWA 3UWOA 4KPUA 3X1WA 2IS1A 3RW9A 4UD6A 1ZXLA 3WJ7A 4J16A 2BGGA 3QOFA 1ADYA 2AOWA 2BD0A 1P9WA 2HUPA 1Q50A 5L45A 3PT9A 4ZGGA 3W2IA 2VJPA 3BTSA 2NPFA 3T6KA 3LKVA 1CXZA 8AT1A 2OXEA 3FPCA 3IPXA 4MK4A 3SBEA 3TI7A 5IT0A 2DPXA 3JQ8A 4PX3A 1R0CA 2ZSFA 5F2OA 2GTHA 5C37A 5AK4A 5DP2A 4CMCA 1E1CB 3VJRA 1R0LA 1P39A 4FHDA 1C8VB 2BFEB 1ZAYA 4QQFA 3WNQA 1H4TA 4U02A 5HEKA 2BLNA 1UBGA 2Y9MB 3K6SA 1OPXA 2BGIA 3WK5A 5TS2A 1SXJE 1ZG3A 2PKYX 3VISA 4Y6QA 1LK0A 5JALA 5AW0A 3V4RA 1EX7A 1UIRA 4WADA 3W2EA 4YRZA 1I7QB 3PQ2A 1PVDA 1VDZA 2ORIA 3A25A 1HZZC 1NLFA 4XWKA 2HHAA 1YGYA 2JAPA 3UANA 4ME6A 4A10A 1DPGA 1FFXB 2XTNA 2D3WA 4DSUA 2B7LA 3G2QA 4INZA 3HRIA 4ZYUA 1T6NA 3DTTA 4C22A 3IKLA 4FT2A 2GYVA 1ZXBA 3EFBA 2PWAA 3DM5A 4HTFB 1BMTA 1SBCA 1QS0B 2WU3A 3N0XA 4EMBA 1P1CA 1XLTC 2H6EA 2JS7A 5CB0A 5KYYB 1A9SA 1PNOA 1QG2A 3FYUA 3U7FB 3AVUA 1L3BA 3C3WA 1GR0A 1TQDA 3CN7A 3MRXA 5J5AA 2A84A 1HE1C 3R5KA 4G86A 3D6JA 1A9QA 1O96A 3BB1A 4FFSA 5JMTA 2WIKA 4RYDA 2JCGA 4XD2A 4OBEA 1JDZA 3RODA 2J5KA 4MQFA 1TQHA 1PHRA 1L5QA 2Y1WA 3X44A 3MVEA 1V7ZA 3QBTA 3ABRB 3PJEA 4AJIA 4OQNA 1CJSA 2XUFA 2YVKA 4OH1A 4QXAA 4UNSA 1BMFA 1SEPA 1ZS9A 2R4QA 2W48A 2WWRA 4FNOA 5E0OA 4BKPA 4D3DA 4NR0A 3SQMA 4KHPB 4KIGA 4KR6A 1Y7IA 4PLVA 3EGIA 3L8ZA 4FW8A 2R8PA 2FRXA 4QUDA 3UAVA 4EUKA 2ZT7A 1GTSA 1Y7PA 2LVBA 1JX6A 4MROA 4CLHA 4EKIA 4I1UA 3VTKA 1V16B 3ODGA 3NALA 2B34A 4BQRA 2HJ9A 3WDSA 4RS4A 3VHXA 4V02A 2QSYA 4D9KA 4MKZA 1ODJA 1GYQA 4Q9HA 4F86A 3O95A 4K1LA 4YEDA 2JH9A 4B45A 2A1TS 1BTOA 3SE0A 4M8LA 3WL8A 5C2JB 4DTCA 4ZJYA 2AKAB 1SXJA 2O7RA 4Q93A 2VUUA 1ZH8A 3PKJA 1MA3A 2G9NA 1SVOA 4RFLA 1ZUD1 3FKSA 3EZ6A 3OEYA 4BNDA 3BD7A 3LIPA 1GRVA 2J5RA 4Q3DA 2OHGA 2NSYA 3GBVA 5DIFA 2ZSJA 2ZU6A 5KCZA 1XCJA 2VOJA 4JL8A 3A04A 5ICCA 2H07A 4OJQA 4A8PA 1D8AA 4U7HA 5BW6B 4K5QA 3L6EA 4ZI3A 3ZK7A 5FBHA 3GZJA 5KDLA 4V24A 2EZ4A 1H22A 2Z6QA 5COAA 2BCGY 4UE3S 2NO6A 1DTEA 2PZLA 5TRTA 3N6XA 1KAQA 4QUBA 1UINA 1ZW6A 3E8SA 1VOTA 2NU9A 4AT1A 3AZOA 4Q02A 2UDPA 1T9AA 5A5DA 3EF3A 2WAYA 4Y9RA 2G72A 3UOWA 4DVGA 3QE9Y 3KR9A 2BBSA 2RGCA 4GMKA 2IL1A 2DUUA 2IU0A 1T4MA 4G09A 1MHTA 1NN1A 3E9CA 2E6KA 4RZQA 2ZTHA 3JAKA 3ND9A 4NY1A 3ERCA 1SWWA 1FS5A 3O74A 3O4FA 3QPDA 4JJZA 1IULA 3BCSA 3BGWA 3OCUA 3V8MA 2ZRJA 1G98A 1U1DA 1OWOA 1TMGE 2M98A 2QMEA 3HR8A 4FGUA 4G81A 4LAFA 4WKNA 5CCDA 3RF6A 3AOGA 4DL9A 3HZOA 3ND6A 5BUZA 1RPNA 1TLTA 2LDBA 2F2TA 3ML1A 3UOAB 1N2SA 1ZY2A 1NUUA 3BIFA 5CXQA 3JZFA 3R0ZA 3RUEA 2AN4A 1QHHB 1TM2A 4HDRB 1M5RA 1SIWA 1JLLB 1DBRA 4MIKA 1I7SB 4QEZA 5JJ5A 2DHEA 4QNNA 3SJAA 3BE4A 2WU8A 3BD8A 3W8DA 2XX3A 2I1WA 4B3TB 1OYYA 4Z9YA 4WLNA 2EL9A 2Z2XA 3E84A 5U1PA 3RS5A 2OXFA 2LDXA 3X1KA 1JEYA 1YI1A 1I8TA 3QEBZ 1FNNA 3LVQE 1IG0A 4Z1MD 4LMBA 2NO4A 4W7IA 5TMPA 3GOQA 2R6ZA 1T0UA 1ZD9A 4KQGA 1E77A 1UK9A 4PBRA 4FYKA 4YASA 2PAFA 5BXYA 5JRDS 1V5IA 2NP7A 4RVNA 2PMKA 4NK4A 5LJIA 1YDEA 3C5VA 1QHYA 1RACA 4WCFC 4Y2SA 4MB6A 1VQ1A 4KRGA 1X7WB 1EP9A 2CL0X 4FSHA 1RCUA 1OWNA 2QMOA 3SAJA 2XBMA 5CK4A 1L5HA 3ER9A 1OGYA 1KC3A 1L2TA 1ZRSA 1ZBQA 2DQZA 4YP6A 3ANYB 4PZCA 4PY2A 1WIWA 1X1TA 1GSHA 1CHNA 2QEQA 4Q9IA 2XNDD 4ENTA 2UYQA 1PWZA 4FC7A 3LHSA 4I46A 3NHKA 1TVKB 4YO7A 4ZOCA 4XM2A 3DF7A 1NPYA 1J7JA 4GPBA 4RLSA 9ABPA 2G8NA 3S8MA 3IA7A 2VQSA 4HX2A 1FFAA 4Y0VA 2NZVG 4CM5A 1PRYA 5AI6A 2VHXA 4YFVA 3SX2A 3TCNA 3ZHBA 1EE1A 4WBXC 5JH7B 3IAXA 2FSPA 3NWJA 1LFAA 3H05A 3KPYA 1I1QB 3GJ3A 4LHXA 4AK9A 2ZRAA 3VDRA 3DTYA 3QA3E 4RENA 2AB0A 3PA8A 3TIFA 4UU8A 4ECAA 3F4KA 3BJMA 3BXEA 3A1VA 2GZ1A 1RYZA 1WHTB 1JLSA 4OA5A 4CLRA 4J7XA 4WBNB 4FONA 1UDXA 3GNLA 3HBFA 1KC1A 2Y66A 5CX1B 4YYEA 1Y3DE 2BUCA 2ID7A 3B1JA 1BCRB 3F4BA 1WUJS 2MSNA 3MYRA 1G42A 1YJXA 2JLVA 4GE3A 2AJBA 4PC7A 3L8MA 4DUPA 3VR2A 3DEYX 4QJ5A 1PV1A 2XHZA 3F6PA 1RT9A 4D79A 4BP8A 4KSYA 1JEQB 3JYQA 1CUVA 1H2FA 1YI0A 2NYUA 4OCZA 4KKVA 4I81A 4AZTA 1KI9A 1HDGO 4OXXA 3RR2A 3BT7A 2DOKA 3PRHA 4IV5A 4QATA 1RFLA 3TOXA 2HA4A 1JR3E 5GTDA 2DLCX 4MS4B 4UTVA 3OZIA 4X45A 1YR2A 4TMKA 1F8UA 2F9LA 2QE7A 2X13A 3J81A 1KP9A 1R0WA 3OE1A 5JD6A 4J6EA 3W1VA 1G2PA 2D5BA 4LXIA 2HYIC 1NTOA 2WP0A 3WXBA 2H4ZA 4AIIA 2BTEA 3EQ8A 4RMJA 4LOHA 2PPVA 2RHOA 1OH6A 1KFCB 4Y6OA 1TB4A 1P8AA 4C0AC 3QJGA 3QG5A 1EGHA 1XL1A 4OGGA 1HQDA 3K0SA 3RSQA 4R68A 1ELOA 3WK6A 1DEXA 2NQ8A 4F9FA 4TYQA 5K45A 1KAHA 1DAOA 3EA0A 3E7XA 4D43A 1ZI6A 3K9CA 5HKOA 1O77A 4GU5A 2Z6AA 1T5HX 5JARA 2YQ5A 4GOKA 3B6EA 2W4MA 2X4DA 2WB2A 1H2RS 1D7AA 3N53A 2H5LA 4MWEA 3BKXA 1WOMA 4S2EA 3TLZA 3ZE9A 4BFXA 4E32A 1ODKA 1OF1A 1BJKA 1JPVA 1EESA 3I2KA 3W8RA 2A0UA 1UP7A 1SRRA 4I5GA 4L5YA 3QBEA 4FKZA 4ZYVA 1PL0A 5GVSA 3M70A 5DK6A 4NBKA 4IDBA 2F8SA 4BDTA 1GJRA 3HKBA 4UJ5A 5IFKA 3THWA 1N6KA 1LDMA 1PYDA 3HVIA 1OWMA 1WBBA 2UV8A 2GHTA 5EHXA 3RU2A 1SOMA 2EGGA 2VJBA 1KEEA 1M7BA 5REQB 2ZREA 4PAOA 5BRAA 1VLMA 3F46A 1PFYA 1V35A 5DGDA 4F2HA 3OLYA 2HZBA 2J3KA 4Q3OA 3D54D 1LDEA 2FX2A 5IK2A 4C4RA 1NVVR 4DC0A 3IIKA 1T3GA 1NV9A 3THYA 5F7ZA 3U7QB 2IYFA 2W70A 2O54A 3N1UA 5KVSA 3K2IA 4F4UA 4Q4JA 5L4NA 2HWWA 1FRQA 2YW2A 3D6TB 1SCIA 4N41A 2BTQA 1N7HA 2PQMA 1T6XA 3CVJA 4B8YA 2GVZC 4U6NA 4F4DA 2ISSD 1N36B 2VJYA 4GMHA 2BF7A 2JFGA 3OF5A 3D0RA 2O50A 1YUBA 4FGZA 2ZSBA 4M4SA 5AK6A 2VTBB 1WW2A 2NO5A 3OZGA 3PC7A 4UCWA 1QKJA 3FPGA 4GR9A 3DO6A 2H11A 3DT8A 3G23A 3ZV6A 3V4FA 1WHSB 3REGA 5BR4A 1QK4A 3DXZA 4LZAA 2AD1A 3H4VA 1Z7WA 4PIVA 3ON5A 5PGMA 4C7VA 4Z5XA 4ZVVA 3KJHA 4G5FA 1HDYA 1E9SA 2GEFA 2XE6A 3DFFA 1G3QA 2C29D 5LOVF 5DX0A 4YFYA 5FUWA 3TIIA 4DEXA 3LO8A 5D01A 3G79A 3LHFA 3HCDA 1A9OA 3R8FA 3W5VA 5I7UA 2Q49A 1AF4A 5ARBA 3N74A 5SY9A 3HCOA 1EH5A 5H68A 3ETDA 4M22A 1SG9A 3O73A 4PRLA 2YOFA 1U1FA 3FVTA 1IJBA 3H97A 1Y6JA 3MJHA 4MR7B 3TIGA 4L76A 4ND4A 4AWAA 3PWKA 2Z5GA 3ENKA 1PGQA 4BDSA 4JWTA 1N8NA 2G6BA 4BU0A 3E1SA 4AXXA 2K7FA 3KFLA 1CUAA 4ZGBA 3RGWS 1P5JA 1XPJA 4DLKA 3OH8A 3IEUA 4BBAA 5D3QA 3JRXA 3ZDBA 1J2TA 5ANRB 4X64B 4YRTA 4BMPB 4OJYA 2IYVA 1R6AA 1X38A 1J0AA 1DJOA 4AJHA 5BW4A 5EIBC 1NR1A 4RH1A 1KIMA 3AEKB 1CY0A 2PFSA 3N2LA 4HLNA 4J0HA 4OFXA 4H7IA 3SFZA 5B4UA 5KMGA 4P0PB 4AN0A 3SR0A 5JFOA 4ZODA 2QJOA 3MWDB 3CQ9A 3K09C 1IDN1 4DR1B 3OHPA 1J8DA 2JFYA 3LUJA 2V54A 4RHEA 4X54A 3THXB 3GROA 4KVZA 3DZFA 4US0R 1JHDA 2CE7A 4D41A 4NCIA 5B58C 1FJHA 1IPFA 3H3FA 1DDGA 1G8FA 4NBNA 3OG9A 3NDBB 1FFSA 1ZIDA 4WLVA 3V1UA 3X43A 5J2TB 3LP6A 4GIBA 3BVPA 3R6TA 1YVDA 2ZJ4A 3I58A 4PINA 1EVKA 1G5TA 1CPYA 2VKTA 2A57A 4F9TA 2H1IA 4ZAVA 1Z08A 3L4BA 5DRTA 1BCSB 2C77A 4W8OA 1V3VA 3TMYA 1XXHB 3PT5A 1QG6A 2EZ9A 5EMNA 3UJBA 1CR4A 2GZAA 2Q45A 5BYJA 4AB1A 2GZSA 1MX9A 1YIOA 5EIBD 2ZPUA 2C1XA 3N0TA 3V9AA 4B2IA 2OCPA 5C5CA 4OJKA 2JFPA 3L93A 5G2OA 4GRDA 3UWMA 2HSEA 3T9AA 3BA6A 4HGOA 1Y8QB 4TLLB 1KF0A 4UTXA 5SYAA 3ZWNA 1Q21A 4EUNA 1R6VA 4E5DA 4LKRA 1OX5A 3CMCO 4BUCA 4INOA 2ZSHA 3MGAA 4G4SP 2OZKA 3TQRA 2RH5A 3AMVA 5CH5A 5B3LA 5LQUA 2Q6VA 1EZ1A 2CDAA 1MIHA 2HMUA 1FPQA 2IZ6A 2WUVA 2D2FA 3D02A 1JDUA 4JEUA 4LSZA 3VUFA 3TUZC 4XB2A 1E61A 4JVOA 4D8VA 2FEWB 5GY7A 1AC5A 2QR5A 2QUIA 2HH9A 5J59A 3RRXA 1WS6A 1ZCJA 2X1LA 3DDNA 3D31A 4Q12A 3VU9A 2CEAA 4R1MA 3ZY6A 1AGYA 1KNQA 2PH5A 4R2LA 4PC3A 3DCNA 4B48A 1NVUQ 3TN7A 1P2SA 2FPMA 2DWOA 2C03A 3N70A 1QYVA 3BH7A 4QGAA 3T15A 3GRRA 2XXBA 5H82A 5U9CA 4O08A 1ECJA 1T8TA 4DSAA 4KR9A 1RWVA 2QMYA 3LKZA 1JI0A 4RVGA 2H59A 4ZOBA 1KY4A 4QUAA 4ZRMA 5J1TB 1OFGA 3I73A 3QVTA 2ZYSA 3UK7A 2ORVA 3BMCA 2WF5A 4BMVA 2YVLA 3BDAA 3CCCA 1Y81A 5IDXA 1UMBB 1QPBA 4ENVA 2WTAA 2VNKA 2QX6A 3U4QB 1ZVVA 4PLFA 1IUPA 3QTBA 4FB5A 4Z4EA 2PKQO 4OD0A 4MVJG 4YRKA 3PIDA 3I9V1 4RTJA 4R83A 4PVDA 1P81A 1KE1A 3JQ7B 3PNSA 1JE1A 1QU2A 13PKA 2OCIA 4B6QA 3AI1A 4KUGA 1VLLA 1CIPA 5FR2A 1TIKA 4MTLA 5KVVA 1EP2B 4EB8A 2J7PD 5EZYA 3X2FA 5C4IA 2IYZA 5EWJB 4M1SA 8OHMA 3FZNA 1EVJA 2FKNA 3B20A 3FWHA 4RHFA 1A3CA 1IZ8A 1KO7A 5JI2E 2WFAA 1KIFA 4KH1A 4WXYB 2AWNA 3GRAA 4FEGA 5CVUA 2JLWA 3VOSA 2HA5A 3B6ZA 4MW9A 4N7MA 3W5BA 2BMVA 4F5WA 3TL2A 1SN7A 4LV8B 3IO5A 1KZ7B 3IPAA 5EE5B 3WKBA 2Q28A 4L28A 2P75A 5TT1A 1IY1A 2OBBA 4L1KA 2HPAA 3KQHA 2W8ZA 4NOJA 1E5XA 3I53A 2G4LA 2YY6A 3BBLA 1OA0A 5KHAA 4NIMA 5GAJA 5IF3A 5JLAA 1RHQA 2O9JA 3IALA 3ZIDA 1CQIA 1YRHA 2VKQA 5KI6A 4P0TA 2C00A 1SQSA 1PT8A 2POQX 5BSTA 3IAFA 3U31A 3NTRA 2P65A 2OGTA 3GRCA 4KMMA 2ZRKA 2D5AA 3HCWA 4NBUA 3F6YA 4O3FA 4P7FA 5JSYA 3HM2A 4C20A 1W5FA 3N59A 2PZEA 2GFIA 4JYPA 3U9SA 3P9RA 3E22B 3BHMA 2ZBUA 3M4YA 3ORSA 1SUIA 4IUDS 4LZZA 4QEKA 3AY6A 4H7PA 5BWCA 4GYKA 3N8HA 3TOSA 2XD4A 4BEJA 3PE6A 1DWQA 5CK5A 3OKAA 1AZSC 1H93A 1Y4AE 3HCNA 5F3DA 1XZDA 3NBQA 1R0BA 4YJ2F 1GXSB 2PUDA 1G20B 1KI4A 4CF5A 5KYNA 4NZ9A 1N2CE 5LWQA 4DB2A 2GZHA 3DZKA 1NBOA 2IHNA 4DCOA 3RIGA 2PUWA 4MB0A 5FPQA 3RUCA 4B33A 5HPYB 1SXQA 5T57A 3MMPA 2FWBA 1GGJA 2A86A 3WB2A 3BUSA 1M2OB 1SUWA 1HRKA 2EF0A 2R6HA 4WJZA 4CYMA 4FGWA 5AMXA 3RYIB 4CIWA 2IUTA 1IN4A 1U0HC 3LPCA 3OMWA 1XZJA 4MR9A 4E09A 2IIQA 1DFHA 3KSAC 4M87A 4Y9TA 1W8DA 3EEIA 3N2KA 4EX7A 2V3CC 1JKIA 2JEZA 5KIAA 1MPXA 2VCHA 4LJSA 1KKUA 3OJ0A 1JUDA 5H70A 4DLSA 5IASA 5KTRA 1W34A 2B4AA 1NOKA 1M2NA 5FBVB 4II3A 3ZHQA 4I66A 4S1PA 2X8LA 2H5JA 3I92A 3W2HA 1ES9A 4D42A 3RC8A 5J47A 3SHFA 2B6HA 1XJCA 2JJ1A 2V0NA 3HYRA 4RETA 3RJTA 4Z6KA 3KB6A 5FTNA 3ZY5A 3O4RA 2VOEA 1JIKA 1Q91A 2HF7A 4HGQA 1ABEA 4FBLA 4WZAE 1NW9B 4F4FA 3M8KA 1AU9A 2CMFA 3PDCA 5EJ7A 3RVPA 3FOEC 3B89A 4JWKA 1BYUA 3A1DA 5ALGA 2AC2A 5HQJA 5A6SB 4F71A 4H16A 2FMFA 3PXEA 2I3AA 1COWA 3INTA 1ORRA 3K9NA 1CJBA 3R20A 4KWTA 1WW8A 2VA8A 2PKCA 5DDIP 4YJHA 4WY5A 5JPDA 1A76A 1AF7A 1PCXA 5K6TA 4X1IA 2QAGA 4PGAA 3NHMA 4OQXA 3B85A 4P34A 1E1NA 1KR2A 2X9NA 5CG2A 1JYEA 4UVGA 3SMVA 5I7WA 2O6LA 2DEUA 1O4VA 1JIIA 2FYTA 1JU9A 1CULC 2QTCA 2XGGA 2JGDA 5HFJA 3SDZA 5E4JA 5I8ZA 3R0IA 1N2CA 4C0KA 2WMOB 4B7XA 3T99A 2IOYA 4MYHA 4XIYA 1W4CA 2WMYA 1AMOA 1YZLA 2JI7A 4N03A 5A1TA 3DAGA 1GPAA 1P4JA 3ZV5A 2VSQA 2V5AA 2YVUA 3DO5A 1CZNA 1T3SA 5LP6A 4GSYA 4CEHB 3NIDB 3H5TA 4REOA 4DCGA 2QRMA 3GP8A 1JECA 3VPFA 3UTDA 2DY0A 4JBGA 3SX4A 4OQ4A 4YGYA 1ZI8A 1U8FO 4OXQA 4FX5A 3AHEA 3SICE 1Q6ZA 1RKXA 4LC0A 5F1PA 2YTZA 1R9NA 4HWKA 1N0UA 3ETCA 4Y2XA 4L5JA 4LGVA 4ZVPA 3C4VA 1BGWA 4D3YA 5LQRA 4ENSA 4FE7A 3FE2A 4B3DA 3CLUC 4DG8A 4B0OA 1U0NA 1EYZA 3CNNA 1XP5A 1E3EA 3FXAA 3HMKA 4PNEA 1L9KA 1T9GS 1JQKA 1X1RA 1MO4A 1YQXA 2C9CA 2CFIA 2JIBA 3BXFA 3W6OA 2EVWX 1GVHA 3BWEA 4WZAA 4EFDA 1UM8A 1IU9A 3HN2A 4OYRA 2J1LA 5J2UA 1CRQA 3GYBA 4CM9D 2FPGB 1BMQA 1G7CA 2VLIA 3DBIA 1R15A 3FTCA 1FW8A 1U80A 2QP9X 4FT4A 5D85A 2APJA 3OZDA 3OSUA 1S2OA 2VXCA 1XEFA 2Q5LA 3UN1A 1H8EA 3NPAA 1YRAA 1L7RA 1CJUC 4JSTA 3VZBA 1LNZA 4UTPA 2O7SA 1FJXA 1QPZA 3BSSA 4ZT7A 2RAFA 1KRXA 4TUYA 2HMAA 3AV0B 5KNCD 4U7GA 4XLLA 3GLHB 4OSPA 1ML3A 2LWIA 1ULZA 3TKYA 4YWJA 2TMYA 4LA4A 3IT2A 3ZHRA 1L7AA 1GADO 4BO4A 1XPOA 3HJFA 1E0JA 2VPPA 3HEAA 4D0RA 3CZMA 5EXDA 2XJ9A 4OQFA 5JPCA 4F2GA 2HPVA 1CJTC 3FDFA 5J4YA 3HI6A 5HF5A 4OI2A 2B5OA 1EHYA 3WGGA 4UHFA 3OICA 3GNQA 4IRUB 2CJWA 4IHJF 1CDOA 2A78A 3AFOA 3JVUA 1Q3TA 3LTEA 1YH3A 4K2HA 4P9NA 4YUYA 4RHYA 3OTWA 3R6GA 2ECFA 4KQ2A 4DA9A 3L7KA 5B7GA 1YR1A 1WZNA 3L41A 4K9PA 3HKCB 4AMBA 1U7HA 4ZQHA 3GVXA 5CEFA 3M1LA 4PYOA 1ZVJA 2TSYB 3BFXA 3I8SA 3KPJA 4MP6A 3KOOA 4KE8A 2F67A 3GI1A 4H3VA 3ZZTA 1N9ZA 2XGMA 4A26A 4D8WA 2OV1A 5IC4A 1USKA 1TM3E 4WI1A 1YDWA 4L72A 5K03A 1BRMA 1GUDA 4NPCA 3HYLA 3BEDA 3AU8A 3N6VA 2BUAA 5DGHA 5LB4A 3TCKA 1P8JA 4FI3F 3TL3A 4FINA 2VPZA 1CDEA 1YFKA 3A4YA 4QWWA 1KGSA 1E18A 5A9TA 5HM6A 5JNRA 1U1EA 3E61A 4DV0B 3FBWA 5DK4A 1YTUA 3GQBA 3N86A 4PLCA 1TO6A 5CJPA 1SB9A 3KQSA 4PM4A 3CVUA 4DR2B 1WXWA 3S1SA 3CXUA 4ND5A 3GJSA 2R1ZA 3AEYA 2Z2YA 1PJQA 1XJQA 4RJIA 3FZEA 1R4NA 2WJWA 1BHO1 2A4KA 2E48A 2WJ4A 4FFPA 5U4QA 2EBUA 5CLLA 1P73A 1T2EA 3DTVD 4QOEA 2EW1A 3U3MA 4B47A 2P2GA 4AI6A 1Q0QA 1RSZA 1V6AA 3TQFA 1DQNA 1QF6A 1M66A 2WPDD 1T1RA 4FHGA 4UQPA 2XMZA 1GTVA 1CETA 3PIRA 3Q7TA 2WV7A 4MHOA 5CFOA 2WF7A 5M7EA 2XYVA 3PNBA 4WRRA 4QOJA 1L5GB 5CFZA 1HE2A 3DLIA 5TSDA 4US2R 2FG7C 2OTCA 2C3OA 4R8KA 2D2XA 3KHTA 2VQFB 3G85A 3PLRA 1YZVA 3PR3A 3KZKA 4EB6B 4RAOA 4CIVA 4B4VA 2E21A 4LTNA 5DWDA 2PUVA 3KOZA 3O0DA 2AJTA 3S2EA 4BVAA 1CFJA 2REOA 3NHBA 3RIHA 6LDHA 4QTUB 2FRDA 5ITWA 3U1TA 1Y3IA 4F3RA 1YZYA 1AQJA 2XF2A 2PKEA 3FYUB 1FNBA 1TIBA 1JPNA 4G1UC 4MRVA 3WIOA 3KAQA 4BC1A 4XRRA 5LKAA 4V0ME 1R6XA 4GZMA 4Q6BA 4ZAYA 3AVWA 2WJVA 5JJKA 1X1DA 4PX5A 1XVUA 3CLVA 1TZJA 1EDEA 2HT6A 2UYHA 1GDTA 1XN1A 2XB8A 2IOQA 3FF4A 1L4YA 3GJ8A 3JQEA 3M6AA 2GJ4A 3M5PA 1VBMA 2OVBA 4H6PA 1XMXA 3LQYA 3W1EA 1M6YA 4LXUA 4YXWA 4Y6PA 3HCRA 5SZKB 1H6CA 3KYJB 2VNAA 3O3CA 3Q41A 2Q7DA 4U2CA 1U31A 3RUPA 2VDNB 3T3GA 4EPRA 5B3JC 3OURA 5B55A 4YHHB 3KVOA 1H6BA 1KQ3A 4GD3Q 2V4ZA 2ZANA 1N6HA 3L6BA 4CVNA 1TCBA 2EYQA 2CNWA 3QIAA 5CT4A 2AF3C 3SYKA 3V8VA 2O5RA 5DXAA 3VHXB 1D9XA 4CN9A 1ACMA 1C29B 1VSUA 3NANA 2BE7A 2HDOA 1AKVA 3GFFA 3G1TA 1CUDA 2QUAA 2HX1A 3MJSA 1KXJA 3N7TA 4HH4A 1P2BA 1KOLA 3V1KA 1O97C 2HBZA 1P33A 4POOA 3RFCA 1Q16A 4EIWA 1XFAA 3BXZA 2QT0A 4RHUA 3LYUA 1W2GA 3WNCA 3HGMA 3GMDA 3ET5A 5H5JA 2Y1OA 4KFTA 3ZWWA 5I47A 4UD2A 3NR2A 1A69A 5JY1A 2HK7A 2YRWA 2C0PA 3D1LA 1E2QA 3F71A 3MM4A 4I1SA 5CA0F 1ILEA 1INLA 2JEYA 2P0YA 2NXJA 3DHEA 4EYOA 3NTXA 5AI8A 1EWYA 1G0NA 1LWNA 2RI6A 3F97A 3FDXA 1MOZA 3VZQA 3OU6A 1G21E 1JR2A 3C3YA 4GZ5A 4HVAA 5K8UA 2V7BA 2VR1A 2AKYA 4X91A 4IW3B 2PIAA 2DPYA 3HN6A 4L8VA 3EGWA 4L85A 4MUKA 4W1SA 3ZN2A 1K27A 1PK9A 4QHTA 4CTKA 2FB9A 5C4MA 2YMPA 4MGYR 3TFWA 1B0UA 2JGMA 3FYHA 1UBSB 3K9QO 3QPBA 1MU0A 1B6TA 1KGDA 1NMEA 5JZMA 3GUZA 1OREA 1GPWB 4Q3EA 4QUHA 4X66B 3DONA 3KZMA 5H0IA 1O97D 3CNOA 1DJPA 3IVGA 3QVUA 3JQAB 3EWIA 3TB4A 4DUGD 1EXNA 2ZI7A 3HQ4O 3Q4GA 4DV1B 1WR8A 5JATA 2OWEA 2R4TA 3OOEA 1RHUA 4XTCS 3N39C 3QUQA 5AW3A 3QKTA 2BM8A 4O2LA 3S1LA 1O7JA 3HDJA 5H81A 3LCCA 5EUQB 3MN1A 4ZFNA 4DXHA 2ZBVA 2F9FA 4HO1X 4MAFA 4OYYA 1HRDA 3PR1A 3IAS6 2EYUA 4UMVA 5T8KC 1D2CA 3RHZA 3TXXA 5ECYA 4TZTA 3V4ZA 3VR3A 1I13A 2FAXA 1T24A 1ORVA 2B6NA 2IYUA 2NVWA 1NVFA 2WVAA 2IT1A 3GPIA 5BNIA 2QR2A 2NW6A 1NXVA 2JC3A 5H8WA 4PYLA 1PE0A 3UC5A 4X8OA 5JDIA 1HLFA 5BN4A 2KHZA 2HJWA 4XDYA 4EJFA 2C9ZA 1JEYB 2QLFA 1U6IA 4C2BA 3NW9A 1RQPA 1CUIA 5LMUB 4C4ZA 5FNZA 1U8AA 4FCVA 2GM3A 3HO6A 4DLNA 2K4MA 5KYGA 3H1TA 2IXDA 2GN8A 3G0BA 5IJWA 2A0WA 3K4QA 2G06A 2MHCA 3EJ6A 4MKGA 4O4LB 4LX0A 3UA3A 4LOJA 2P11A 2WFLB 5AD1A 5L3ZA 1L5HB 3KVVA 2FSSA 4B5KA 2OCAA 1NBIA 2POCA 2Y1CA 3HYTA 3LW8A 1W19A 4CQJA 4L0CA 1EDDA 2MSWA 5AKGA 5IM5A 3G5AA 2W2KB 2R00C 4FMDB 4D56A 2XDQB 3OOSA 4HDCA 2QD5A 4NCXA 3IGFA 4RV4A 3FPEA 4HMQA 4X93A 3SR4A 1WB4A 3E3OA 3DVLA 4FEYA 4D82A 4L0QA 1R8JA 5IJ0A 3WO0A 2AUNA 1IQ0A 1O6ZA 4WLFA 4BNGA 4CDMA 3SEFA 1W6UA 1TJ3A 3PRJA 3GLUA 2JLYA 2O3JA 1ODFA 3KJIA 4PZZA 4WFKA 1SKMA 2BISA 4D74A 1A8IA 1F2UA 4B1FA 1J9EA 1HH4A 2HO5A 4NXMB 5C9ZA 5BSRA 3HSSA 3ANNA 4BQEA 4K3VA 3AR5A 2GCIA 4IGEA 1AE1A 2IPAB 3OPVA 4FE4A 4EQ6B 2G7MC 1KO1A 5I8PA 1D6MA 3H2HA 1KI2A 1KJ8A 2F3UA 3P9KA 4JNCA 5T4FA 2HW8A 4CLRB 1VA4A 5LBTA 5L53A 1B0ZA 1E2LA 1FYFA 2RBEA 2ZYUX 4UULA 4B3FX 4C0HA 2QSJA 1TU0A 2JHAA 4E14A 3K7EA 5IWCA 3PEYA 1VI6A 4XB6B 3EPLA 3K70B 1HYBA 4ND6A 4C76A 2O7NA 3P0EA 4RMNA 5JR3A 4ND2A 3AL0C 3T7CA 1MB0A 1JHXA 1JMYA 1P29A 1ZGCA 2Q3DA 2RAUA 3P9SA 4TOIA 3RC1A 2TS1A 1JKJB 2NX2A 2Y0EA 1U90A 4M0EA 1Q1BA 2JLRA 2CDBA 4Y2TA 2I99A 3DKVA 2F1RA 3EIFA 1Y98A 1Z5NA 3DE4X 2JFBA 4E12A 1S2LA 1SXPA 3K0CA 3CX4A 1NYLA 2OV2A 3PNPA 2CZQA 2BFBA 2C94A 4EHHA 3L1JA 4F8YA 1HG0A 5HRAA 2BHRA 3D64A 3M4NA 2O2ZA 4OJMX 3R0VA 1E0SA 1NW4A 4FVTA 1NPTO 4MUIA 1V4VA 4X3CA 4MV1A 1XRJA 3B1VA 5G1PA 1ZOLA 3RYFB 1VKJA 4URUR 1MV8A 1E8NA 4A15A 1JLRA 1E6CA 5JH7F 2DFKB 2QX9A 1NVAA 4JYZA 4LDRA 3B9RA 2V55B 3NBYC 4GF5A 1GGVA 2KMLA 2XT6A 2M9MA 4K6HA 1UZNA 3A37A 1PL7A 3PE4A 1J0XO 3LKBA 3WI7A 4KO1S 3QHPA 1N2IA 4UM7A 5B6IA 3B2NA 2OORC 2PLFA 1UJ6A 1U1GA 3H11A 1Z5OA 3QOYA 2ZYIA 4HY3A 2DKOA 1BW9B 1JAHA 1YOVB 2ZJBA 1T6YA 3EDYA 3IR7A 4D0NA 2GM5A 4PQFA 2YCBA 2OFPA 1Z6YA 3BH6A 2P2CA 1DV2A 4KACA 3CFYA 3HNOA 4QRDA 1R16A 3OEED 3HL4A 4GEGA 3JWEA 2P9EA 5CPBA 1NFRA 4BQOA 4YRBA 2IEYA 5HCIA 3DCIA 3ESQA 1FPMA 3OLXA 4QYTA 2J5QA 1EB9A 3QV2A 4W5NA 4UAUA 4WJKB 3TRFA 2LP4Y 3F47A 3H1PA 4MVCA 3PF8A 4L9RA 3LQQA 1FYWA 3O6VA 4D46A 4Y7DA 5BOSA 4JYBA 3QPUA 3L6UA 1YRYE 5CDGA 3HXOA 2ZJ1A 8LDHA 4J0DA 4QC2A 2P6NA 1MNQA 2QLJA 2I6TA 2OHHA 2H18A 2W11A 1VFPA 2AG0A 2WTXA 3CEPB 1G60A 3EFHA 3LFTA 4QLOA 5EAIA 3WLPA 4I55F 3A1UA 1M72A 3JXEA 5JYBA 1ZM9A 2PKXA 3C6BA 4QHSA 3LIIA 1U63A 4TWZA 2TMDA 3KEOA 3EYWA 3TDKA 5DNYB 4QLBA 5CYFA 3P9PA 4GYWA 4K87A 3PL1A 5C7LO 3W4KA 4QFMA 2OO7A 3WY9A 3GUYA 3NUGA 3CWQA 3O1HB 2IW1A 3AJRA 1OZAA 4UXIA 5K3OA 1MCZA 4LRQA 1TVEA 3BK2A 4EK9A 4HWSA 4YCAA 4BWFB 4IR7A 4IFTA 4OK5A 3ZY4A 3AF6A 1IMOA 1AKQA 1MZVA 1I3OA 3W78A 2ZUUA 1LCIA 1H2BA 4EYQA 5K0TA 1QG0A 3D6UA 5E6SB 1HFKA 1Z74A 1MFPA 4S1NA 3JZDA 3LW7A 3WV4A 1NYQA 3QUSA 1DMRA 2V6BA 2WUGA 2XXJA 4ZCPA 3ST7A 3FWZA 3KXDA 3SC2A 3ZWXA 1Z16A 1JQLB 1I3MA 4ZT4A 2DB3A 5PNTA 3M34A 2HCBA 3UK1A 2GETA 2PGLA 2WA2A 1XA3A 3R0XA 3PFFA 4E08A 1JDNA 1MT0A 4KMRA 5AQ1A 4JROA 2O14A 5AKZA 3K20A 1RAEA 4NMXB 3PFWO 4FOLA 4KIUA 3VNVA 1R9GA 3UJ6A 2YYAA 1YWGO 3UJNA 3E15A 2V7UA 1XCPA 1YZGA 1GZUA 3AOEC 2F1JA 5EKDA 4Q9AA 3IHTA 1IC6A 1YZNA 4RTOA 2A9KA 5ELXA 4C89A 5K3AA 3QWFA 2Q3EA 2A94A 1DAHA 8ADHA 1UWKA 3OSZA 5FBLB 1D2RA 3UOGA 3FHOA 1U28A 4BECA 5KMGB 621PA 5HW0A 1DQZA 4HYEA 1Q19A 2C97A 4JB3A 2DU8A 2HL6A 2IYNA 2FZGA 1PJRA 3EW7A 3MWLA 1CF2O 1YE8A 4D97A 5JSZA 1HFEL 4ALIA 2WYOA 4TVOA 1CYEA 1GTG1 4IIGA 1YKSA 2VYVD 1L7DA 1QGOA 1J8QA 3RTDA 2YDYA 2H29A 2ZDQA 4YMHA 2IHUA 2O8FB 3DOHA 3QEMB 4ZQEA 1XDWA 2XIJA 3HBMA 2PEZA 1GPMA 1PT7A 4A8JA 3IULA 3KBBA 3Q3GE 1Q83A 1XN4A 3M6FA 4A4DA 4CQNA 1S2GA 5CCXA 5CH3A 3S2FA 3B3GA 1K4YA 2ZZMA 4P1ZA 1J07A 2B2NA 3OQIB 5EWLA 3DL7A 5AR1A 4WERA 1PWHA 3U7EB 4E7PA 2H5EA 4QASA 5EJIA 5G0UA 5KYUB 2FEAA 3MWGA 1GUZA 4DDKA 5AVSA 2G1KA 4BRSA 3DOEA 2XR1A 4MZDA 3U7RA 1CSEE 3L0OA 4OI0A 1WLSA 4QEDA 1IK6A 1OZ0A 1IN6A 1RMYA 2JCXA 1QFYA 2WDZA 2ILVA 1RD4A 3P20A 1Z6AA 1JHZA 1XZQA 1FZQA 4TXJA 1H9AA 5IZCC 1IXZA 4P84A 4YAWA 5GJVC </