3H4TA

Chimeric glycosyltransferase for the generation of novel natural products - gtfah1 in complex with udp-2f-glc
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
397
structure length
390
Chain Sequence
b'GVLITGCGSRGDTEPLVALAARLRELGADARMCLPPDYVERCAEVGVPMVPVGRAVRAGAREPGELPPGAAEVVTEVVAEWFDKVPAAIEGCDAVVTTGLLPAAVAVRSMAEKLGIPYRYTVLSPDHLPSEQSQAERDMYNQGADRLFGDAVNSHRASIGLPPVEHLYDYGYTDQPWLAADPVLSPLRPTDLGTVQTGAWILPDQRPLSAELEGFLRAGSPPVYVGFGSGPAPAEAARVAIEAVRAQGRRVVLSSGWAGLGRIDEGDDCLVVGEVNHQVLFGRVAAVVHHGGAGTTTAVTRAGAPQVVVPQKADQPYYAGRVADLGVGVAHDGPTPTVESLSAALATALTPGIRARAAAVAGTIRTDGTTVAAKLLLEAISRAKLAAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyltransferase GtfA, Glycosyltransferase
publication title Chimeric glycosyltransferases for the generation of hybrid glycopeptides
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
total genus 135
structure length 390
sequence length 397
ec nomenclature ec 2.4.1.311: dTDP-epi-vancosaminyltransferase.
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4tA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4tA02
2R4TA 1UQTA 1FTWA 2YJNA 1L5WA 3D1JA 3RSZA 2IYFA 3MT9A 3CUYA 5IKPA 3VUFA 3EBOA 3G2LA 3FROA 1PYGA 2R66A 1NVKA 3MS2A 4N3CA 3DZCA 2XGOA 1NZFA 2AZDA 1XOIA 2F3PA 2X6QA 1FC0A 3UYLA 1L7XA 3E3NA 4M83A 4AY5A 2QRPA 4MHSA 4KQ1A 1E1YA 2C4MA 1VGVA 3L7CA 2VG8A 3MRXA 4YUAA 2FF5A 1EXVA 4WHMA 1RRVA 3G2NA 2QLLA 3WADA 1C50A 2QN7A 1WV0A 3OKAA 2IEGA 1FA9A 3G2HA 4NESA 1GPYA 3L7AA 3SYMA 3MTBA 1IXYA 4BQFA 2XCUA 4NC9A 4QLBA 4N3BA 3C48A 3NC4A 3MS7A 2QRMA 1K08A 1NOJA 1F0KA 3S28A 1NOKA 2AV6A 3DDSA 1P2DA 2R60A 3OTIA 1QM5A 5GPBA 3WAGA 5TMBA 2G9QA 4L22A 4MRAA 2F3SA 2JLBA 3HBMA 3NCHA 2IUYA 3G2JA 5DXFA 3RHZA 1PSWA 2FFRA 2QLMA 4WADA 3G2KA 5DU2A 1SXPA 3H4TA 2GEKA 2F3UA 4YI5A 1XL0A 2G9UA 1NOIA 3E3LA 1C8LA 1P4JA 1IIRA 1Y6FA 4GYWA 2XGMA 3RT1A 4MHOA 3NP9A 2IV7A 5TMDA 4G2TA 4X6LA 4NEQA 4F96A 2XMPA 4AY6A 3Q3EA 4EKEA 3L7BA 1C3JA 2ASVA 2XA1A 1UQUA 2PRJA 5TVGA 1L6IA 3MBOA 4N3AA 2R4UA 2ACVA 3ZCVA 8GPBA 4CDRA 3T3IA 3OKPA 3CV3A 4AMBA 3BD7A 3HBJA 3ZCPA 2F9FA 1KTIA 2QZSA 2QN3A 1GGNA 1P2GA 1JG6A 5C1DA 2XCIA 4GPBA 5JTUA 2JJMA 2ECPA 1NLMA 2QRGA 2ACWA 3T3EA 2QRQA 1RZUA 2F3QA 3NPAA 1Z6PA 3L01A 3ZCTA 3IAAA 4MICA 4N9WA 2XGSA 3BCRA 2GJ4A 3IA7A 5D01A 3MSCA 4W6QA 2WTXA 2X0DA 5TMEA 2SKEA 2BISA 1LWOA 1YA6A 2GPBA 2H1HA 1Z62A 3ZCUA 1GZ5A 3S2UA 4Z5XA 2C1ZA 5HXAA 3Q3IA 2VCEA 4RIEA 2IW1A 2QRHA 4X7RA 3VDMA 1XL1A 9GPBA 2GM9A 4CTNA 2GPNA 2G9RA 1Z8DA 1J39A 4RIFA 2Q6VA 4WACA 1FS4A 1C8KA 3CEMA 3VDNB 3CUVA 2X6RA 4YI3A 3T3DA 2AMVA 4XI9A 3RSCA 1M5RA 3OTHA 3BEOA 3ZCRA 2PQ6A 3EBPA 2PRIA 4EL5A 3CUWA 2SKCA 4LEIA 4RELA 3C4QA 4BQEA 5JTTA 1P4HA 1GPAA 3DDWA 4MI6A 4CTOA 3OTGA 3H4IA 3T3HA 1BX3A 3MRVA 1F6DA 3PE3A 4FZRA 1P29A 1H5UA 4EL0A 5D00A 4F9FA 3PE4A 1O6CA 4AN4A 3NB0A 1GPBA 3BDAA 2SKDA 4RENA 2P6PA 2C9ZA 3D0QA 3VUEA 3NP7A 3S29A 3DD1A 2PYDA 4GZ6A 1WW2A 4HWGA 4GYYA 1YGPA 2GEJA 1A8IA 6GPBA 1LWNA 3ZCQA 1AXRA 1L5SA 2XA9A 2VCHA 7GPBA 1PNVA 2G9VA 1JIVA 1XC7A 4RIIA 3G2IA 3D0RA 4RBNA 4BFCA 3QHPA 5ENZA 2ZB2A 1WW3A 1V4VA 1FTQA 1JG7A 1WUTA 5DLDA 3MQFA 1B4DA 2IV3A 1L5VA 3OY7A 4MI3A 4AMGA 1AHPA 1GG8A 3HBFA 4XIFA 2QN2A 1XV5A 2BGTA 5BNWA 2X0EA 3OT5A 3MTDA 2VSNA 4KQ2A 3MRTA 1Z6QA 1EM6A 1P4GA 1PN3A 1Y8ZA 2AW3A 3UYKA 4M60A 3OKCA 4RIGA 3C4VA 1L5QA 2IEIA 1RZVA 4GZ3A 2BFWA 3AMVA 1XKXA 3HBNA 1L5RA 4EKYA 1QKJA 2VSYA 4X7PA 1K06A 1Y6GA 1FTYA 5I45A 4MI9A 3COPA 3NAZA 1ABBA 2XA2A 3MTAA 4HLNA 1E4OA 3BD8A 1SXQA 2O6LA 3CEJA 1UZUA 1FU8A 3MT7A 1WV1A 2BGUA 5LQDA 2JZCA 3BCSA 4N39A 4LDPA 3MS4A 4REMA 3TSAA 4KQMA 2IYAA 2X0FA 3E3OA 3Q3HA 3CX4A 4M7PA 1HLFA 3MT8A 1FU4A 3T5TA 1WUYA 3L7DA 2QLNA 1NZDA 2ATIA 2GT1A 1JEJA 4GZ5A 2QN1A 4RIHA 3GUHA 3CUUA 4X7MA 3T3GA 1P2BA 4BQIA 2H1FA 3TOVA 1JIUA 1GFZA 3GPBA 3QKWA 3CEHA 2C1XA 2KS6A 5IKOA 3WC4A 2GPAA 3BD6A 4CTMA 4EJ2A 3CUTA 1JIXA 2OFFA 2FETA 4FKZA 3S27A 4PQGA 2R68A 3O3CA 3ZCSA 3OY2A 3TAXA 2QNBA 3BCUA 2QN8A 3L79A 3S0JA 1FU7A 2QN9A 2PYIA 3T7DA 4F97A 2HY7A 3SYRA
chains in the Genus database with same CATH superfamily
1EB8A 2ZRHA 3D7SA 3AJRA 3TXAA 1A9PA 3WY9A 1RC1A 2PMWB 2XNDA 4A73A 3EVAA 1NSTA 4EHBA 3EX7C 5HHTA 3WKCA 4E2YA 1OX4A 4CJXA 4RL4A 3U7JA 2HHAA 2Q8QA 1V8PA 1FXWA 5F9MA 5DDIP 3GGPA 2Q5OA 3RSZA 2ZYAA 3VO1A 3PGVA 5TB5A 3R8FA 1MORA 3Q8XB 1FPMA 2GWRA 4ZVSA 4DC0A 2BM0A 3TM4A 4R7ZA 4B7ZA 2D3WA 1RLJA 1GZDA 2Q50A 2C7GA 4PS1A 4YMWA 1GXSA 1BDBA 4RXUA 4DR2B 3BHIA 3ZS9A 1BDJA 1ONOA 3WBBA 2Q46A 5BUQA 4YCLA 1DC5A 3LFHA 4M53A 3TQIA 1H6BA 2IHYA 2N3ZA 1N9KA 4D98A 1I2CA 1MAHA 5KVAA 4AURA 5M04A 1EG7A 2I1VB 2VAWA 5JIBA 3FKSD 4J75A 2O20A 1JEQB 3SEQA 2YX1A 1KEVA 3DOOA 3ZZTA 4EBFA 3D3QA 3P9SA 4K46A 4RFSA 4RQBA 1M1ZA 1XRQA 2DQ4A 1SIWA 4U9IS 4C0XA 3K70B 1ILWA 3BAFA 1DKUA 3K9CA 3LZCA 3B12A 4XQ0A 1J8FA 4DNQA 3WYAA 4YRBA 1BDHA 1KAOA 1W93A 1QHSA 2JL1A 1Z8NA 2A6PA 2OP1A 2GEBA 1K88A 3OF5A 3QU2A 1JPNA 4JUAA 2VWPA 4C5CA 4W5TA 4INJA 2FSUA 1XAJA 2PKCA 3IVRA 1ZKMA 4MUYA 3DEJA 3FMFA 3ON5A 3WADA 2V7PA 2CVFA 4MV0A 2JCBA 4KLAA 4PLPA 3ZE8A 2QN7A 4XOUA 1VMAA 3FFWA 4B35A 5EHGA 2Q5IA 3GEMA 1QG6A 1YO6A 3AKEA 2WP8J 3HFGA 4ENPA 4GSLA 3C3EA 3UATA 4EUEA 3HVRA 3F7TA 3GXBA 3FCUB 4ZAVA 1II9A 1A8UA 3L7AA 5IKEA 1UFKA 3SYMA 1GNQA 1EFUA 1QWOA 2ZIFA 1QIIA 1D1QA 3ESQA 5LQMA 1DMRA 2XUIA 4FYHA 2RK3A 1FRVA 3CF0A 2W83A 1OD6A 3CSDA 1H2EA 1IPFA 4B34A 3LTEA 1WP4A 3RS3A 3DOEA 5HBGA 1K08A 1WKVA 1F0KA 1Z4QA 2OR3A 5DM2A 1MJGM 3MGAA 1ZUIA 3U40A 1UFVA 3DUFA 1GUZA 3KSZO 4XUDA 2AS0A 5DZSA 1F12A 1M2KA 1NG1A 2IZ1A 1IH8A 2PL5A 3DAHA 3FJOA 5AM3A 1QP0A 3QF4A 2H2FA 3RF7A 1D6JA 1TM5E 3TN7A 1PLJA 1UKBA 2LUOA 4UCQA 4M1KA 4FVTA 4D3SA 2YTZA 3PNMA 4Q4LA 1V35A 4BV2A 3KEQA 1QYDA 3DZKA 3EZLA 2EWMA 2OCPA 3II6X 3T1NA 3V3KA 1B6SA 1NX9A 4EVSA 3OD1A 4C20A 4K8RB 3N3BC 5DCLA 4AQDA 3DLAA 4R1OA 2I66A 3WKDA 3R6DA 3GRZA 1YKFA 2YFKA 2QLMA 3AWDA 3E61A 5B4TA 1YL5A 4U9UA 2RONA 5I7OA 2ASEA 1SBNE 3TD9A 3U4QA 4Y9TA 5K03A 4ITUA 5BPHA 3KOMA 1NBAA 2W98A 2COUA 3BGSA 3HDJA 4LS3A 5C7LO 2D1SA 2FMFA 2XW6A 3U44B 2GBLC 5J47A 4PC2A 1CVRA 2W0MA 2IKSA 3FB4A 3GCXA 2CVZA 1J8YF 3MTJA 4MUIA 4ZZ2A 3ZVNA 1DDIA 3JYHA 8ATCA 3OOWA 2CT8A 5AK3A 4HLUC 3N86A 2CNDA 5E4TA 2OCGA 2VPZA 5K0LA 3TIFA 5I4IA 3SHOA 5DULA 3DFIA 3MOGA 1Z6XA 2OAQ1 3QENA 3Q9SA 5ITZA 5ECYA 1PT8A 1VJCA 1UJ4A 4RGQA 5L9AA 1GQ2A 4XJSA 1K4YA 2GPJA 4G5GA 2IEZA 2FLWA 3KQPA 1BWPA 5BVHA 4MJ7A 4CBVA 2D2FA 5IBPA 4DR4B 1N5JA 3QLVC 1V16A 3EQZA 4JQOA 5THKA 5KB3A 2I4RA 4AF8A 2ASVA 1ARZA 2J0SA 3RF6A 2WU3A 2TRSB 1ZN7A 2CWWA 2FX3A 3OTWA 3ZX4A 4AF6A 2ZJZA 4BBPA 4BWGA 4JUFA 3QG1A 3RW9A 4CM1A 5KNDD 5IULC 3AVYA 3L77A 3RBXA 3BERA 1J1UA 2HRBA 3F73A 1W48A 2JFOA 2ZT5A 2O2GA 2YYAA 4IV8A 1U4SA 4HUQB 3H75A 1NJSA 4H77A 4B82A 1P7PA 1QIMA 3G17A 4ZVKA 2I7DA 4D3YA 1RTTA 1KQNA 1NBOA 3OKPA 2B98A 3OQ6A 4Z6KA 5J2TA 4LN1A 1C9NA 3OX3A 1H3NA 3D3JA 1CF2O 1T9GS 3ESBA 3AFNA 2VYNA 2JKVA 3FLBA 3EVEA 4C4YA 1EBFA 4DWOA 3TZCA 1NLYA 2VL7A 3Q12A 1FW8A 1CJTC 4HZUB 4I0WB 1CF9A 1M54A 1N7JA 4TZTA 3W6NA 1C3EA 1JG6A 2GI4A 4YCCA 2MMCA 2XCIA 3FCOA 4LDJA 4BLSA 1UMBB 2G1KA 1Z6YA 4B79A 1OASA 2HXYA 3P9YA 1XCBA 1Z4MA 3G13A 5IJXA 1VSTA 2J4CA 2HD4A 3QU4A 3EEOA 4KUGA 1VJGA 1DLJA 1G6HA 2EBWA 3I37X 4FFNA 4N5DA 5TT1A 3TSZA 3GDFA 4W5WA 3KT0A 2IBMA 2R87A 2P9FA 1Y3BE 2YS6A 3BGVA 2V7VA 1HKHA 1I9CA 1SGWA 3W1WA 3ZWXA 3TX6A 2MSEB 3NTLA 1OXBB 5EQFA 4MWCA 3UJHA 1R10A 1NE2A 3OKFA 4UHFA 1SCUB 3NASA 4ZGBA 5B1DA 4LMRA 3QLTA 5CDFE 4JYZA 2OAP1 1E79D 1X2BA 4F2DA 1ZXXA 3GLFE 4H3VA 3I32A 4CLRB 1TEZA 4G0XA 2QVBA 5C7YA 1X1QA 3IPRA 3LBFA 1PYDA 4BO3A 3OQ1A 3K9QO 5KKAA 1WM1A 2NNLD 2KHZA 2ZAMA 4LHYA 1N6HA 4M49A 1TAGA 1XSEA 3M6LA 3UKJA 4AIIA 4B4VA 4Z1MA 2JGIA 3KVOA 1CW2B 3O3OB 3ZBUA 1GQSA 3M9XA 1I3CA 2Y68A 2YVKA 1M8PA 3O4HA 2X2PA 3WK4A 3E1KA 3ETEA 1XQYA 2JIQA 3JQ9A 1TAHA 5C8XA 4TYWA 2FPGA 2MYPA 5FBVB 2RH4A 5EN4A 3ZDQA 2ZEJA 1PUJA 3PV0A 3QELB 1NKTA 3U4CA 3KZ1E 2ZFUA 5KYXB 3NHFA 4HVTA 4KXWA 4WFJA 4WOPA 2O50A 1GZUA 3FAZA 2BGNA 2W5UA 4WGGA 1FVHA 2YVAA 3JTEA 4ND8A 3NBYC 4WA7A 1ODJA 3TCNA 1ATIA 2FWIA 2VSXA 4U7DA 3AOEA 2OXCA 4RY8A 4A8JC 4D45A 3D3WB 5HRAA 2JFVA 2PR2A 4JASB 1PT9A 1JYEA 1C1XA 1KYTA 1L7EA 2GAAA 2UVQA 8ABPA 2JIOA 4E4RA 1K8YB 4HPWA 1J39A 2HA5A 3R9KA 1FY2A 4F7DA 1I6MA 1GQYA 1UEXC 3OQJA 4GL2A 2HJRA 3BF8A 4HV4A 4QPPA 2IYSA 4YRTA 1H2RS 3D31A 2G08A 4WAUA 2P9YA 4Q9KA 2G6TA 5CVUA 1KJIA 3IKLA 1AK1A 1RQPA 1NDUA 2IZZA 2Z4SA 3GBSA 1O2DA 1VJ0A 4P3YA 3TRFA 3UWMA 3VNQA 1JHMA 3SZOA 2NUAB 1I2BA 3PFHA 1ZMOA 4L95C 2P75A 2Q7OE 4HY3A 1OXVA 2LXNA 1VI2A 4LHSA 3ZVLA 3ORSA 3OZCA 3IUBA 3EMDA 3OZDA 2IJGX 4H1VA 2VDLB 1Y5IA 5IJAA 3OZBA 2ZJ8A 3QXHA 4AICA 2NN3C 4QODA 1EAMA 2N42A 4KDCA 2H9IA 4F56A 1IXKA 4NU5A 2QIPA 3FVVA 3DDZX 2OPHA 5CM8B 2CCGA 4GFDA 4Q7EA 5J5CA 5CDYA 2Q4RA 2YY6A 1XD2B 3TUZC 2G4CA 2JA1A 3DZHA 5KVVA 1R18A 4PZ9A 2WAXA 2CVPA 2XV1A 3Q72A 3GDHA 3UCFA 3WLTA 4ZYVA 1BMFA 2Q62A 3MFQA 4G09A 4G6ZA 4P54A 1XMIA 3V8RA 4UMEA 2J6IA 4BV8A 4KXFB 1OH8A 4PQEA 1HOXA 1M1YE 4Z2YA 5HJ2A 2Q9AA 3BAZA 1RM0A 4HH3C 5D3MA 1GQOA 1FMTA 1UBRS 2BUCA 2QSZA 2FUKA 4FZRA 4GM4A 3A1VA 3Q15C 5E6RB 5FLEX 2O7QA 3QLEA 4N3GA 4JXZA 3H9BA 1P62B 3FPJA 4B43A 1H4VB 4RFSB 1X94A 3BDAA 1A2OA 4R68A 1T0UA 3FVRA 3I45A 2KWIA 1NW7A 3GLGE 1IZ8A 1MKYA 3DTVD 3GMTA 2JA2A 2NM0A 4KXYA 4XIIA 5BQOA 1TW3A 3NP7A 5GVSA 3DKRA 5A5EA 1R15A 1Q77A 5FO1A 2DFDA 1E2BA 1YQWA 3HNRA 621PA 1Q3HA 5EIFA 5JBIA 5L3QA 2C58A 2G9ZA 1KWKA 1EXWA 2DR0A 2V4ZA 4DWJA 3FGPA 1QJCA 2IE0A 1RW4A 1PG5A 3L2OB 2O0KA 3GGJA 2HSZA 2X23A 2VEOA 2O3SA 3VPSA 1H93A 2QI9C 2VNHA 3V48A 4G9EA 4AF7A 3NH9A 2FP4A 1RFGE 1I4TD 1KYVA 2BRUA 4QELA 2D5AA 4L7VA 4DCCA 5KTKA 5DHSA 3U31A 2OXTA 2P9QA 3K09A 1PEYA 1SRQA 2WD8A 4J2OA 4F8JA 1K68A 4OUDB 2ZB2A 4R5HA 1Z6ZA 2IC5A 1TM4E 2RMKA 3G82C 3LP8A 1PL7A 1D8AA 1FRQA 2FKAA 2FOXA 1VYUA 3UMMA 1T8PA 2HQBA 4D2IA 3QF4B 4X85A 2HLDD 2O0MA 1V43A 1TXGA 3WDLA 3E48A 1SVMA 1XA0A 1ZXBA 1FB5A 4YTEA 4RPLA 1XV5A 3K73O 1E61A 2AFHA 3F3YA 3LT2A 2PT7A 2Q3HA 4IRUB 1G21E 2AOTA 1W88A 3ZE0B 1UC5B 4NF2A 4E15A 4XSHA 3DYBA 5A2GA 1N25A 3ZGXA 4EMSA 3A1SA 3G3EA 4LOAA 1EM6A 2W6OA 3FKQA 4IEIA 2A92A 5DISB 2HW8A 2PGDA 5FI0B 5DHAA 3TSCA 1SZDA 2AW3A 2NU9B 3UYKA 3LC7O 1XJWA 3P20A 3S40A 1ZX1A 2I9KA 1FFBA 3Q3JB 4M9SA 2ZIEA 2ZI6A 3U4QB 3HXQA 4EYOA 1JEAA 2ZRCA 1UM8A 3JZAA 4YXWA 1QHFA 4YALA 4JP5A 4BOYA 5I9LA 1RZVA 2P3QA 3H8VA 4L6IA 4PLGA 4BCCA 1RYHA 4NK4A 1XZAA 4N03A 3LIPA 4W8OA 3I61A 1XKXA 2AL7A 2DUMA 3C3XA 1X77A 2PWZA 4QJ4A 1MEOA 1A98A 4ASUA 5PGMA 1Z82A 3LWNA 3PQ7A 3PFKA 5K8JB 2F4NA 3PYXA 1M75A 3NAZA 4UE2A 1DELA 4PC7A 5BVHB 5K0FA 2YY5A 1OBVA 1AXGA 3KELA 4M1EA 1Y1KE 4I4CA 3OIUA 2HNKA 2ZAIA 3H1AA 4R9RA 2OG2A 1U2DC 3QFHA 4K8OA 2B2XA 2ZPUA 3DG9A 3CNNA 4EO4A 3MTQA 1SO8A 3QUBA 3DFFA 2IYWA 1N8KA 3K1AA 1RYEA 1TMGE 1P17A 3OAAD 5EKDA 1YHZA 1DBWA 4D41A 2KB0A 1LDYA 2VDPB 4ZT2A 3TTTA 1KI6A 1ZCFA 1ZLXA 2OZVA 1NN0A 3O0DA 3L7NA 3W05A 1M10A 1IBKB 3DP7A 3CPJB 3KJXA 1WV1A 3DFZA 4MUAA 2P90A 3U16A 3G0HA 4G8JA 2XLBA 2HA6A 1T13A 3TMAA 1T5BA 1AE1A 1RJ9B 2I4TA 1FFHA 1C0LA 3YASA 2XCOA 1XROA 2GZMA 3RYHB 4G5XA 1BD3A 1BROA 2JGAA 3R3SA 4WZAE 3PNSA 1C9MA 5A0TA 2R6DA 5TR9A 5K8UA 1O96A 2GKSA 2WLTA 1T9CA 5CNKA 5CIYA 2E4WA 1UWCA 4P83A 3AXTA 1TA0A 1IK4A 1WCIA 3FRHA 1D9XA 3ABOB 4M7PA 4D97A 1P9LA 1WUKS 2B9VA 4JT9A 2AJ8A 4EB0A 5I7SA 3IMGA 2QLTA 3ET4A 3HSSA 5K4GA 3EXFA 2EZTA 1GLGA 3N2GB 4BVHA 5JS7A 1EFHA 1K5GA 1UDXA 5A0FA 3WYFA 3KVVA 4EHKA 1EEHA 1X39A 4UDXX 1NV8A 5KSOA 3SZMA 2VDRB 521PA 3VPCA 4F9TA 3HU3A 2DRIA 4MW2A 4WD3A 7ADHA 2OVBA 3OM8A 2GBGA 2I2CA 2XUFA 4IGIA 1KAQA 4U9HS 4HYYA 4Q3CA 4CTMA 2IDZA 1IBSA 1DG3A 3PDHA 3ZVRA 3ELWA 1TMOA 5AW2A 2HDOA 4IWXA 2FETA 3GFRA 3LW8A 3G1UA 2QUIA 4RZ3A 4WCFB 2Z0MA 4WK6A 2AG1A 4XR4A 4RTPA 1B26A 3S27A 1ZNQO 1ZJYA 2HPHA 4JOCA 1ECGA 3K70D 4I1UA 1VKRA 4BLOA 2OLKA 4B45A 3VR4D 4BE7B 5KNCA 2IH2A 3AR3A 1T91A 2OFOA 2QT1A 4YRJA 3TIIA 4FCVA 2OBNA 3GJ0A 3PXDA 1CSEE 3NCTA 1SUSA 4MQEA 3SJUA 4OGKA 4EP1A 2UXBB 4ZJUA 4GI1A 3M5WA 1AU9A 2X8WA 4I55B 4FD3A 3VKVA 2P41A 4DA4A 1YQEA 1FNCA 3DE1X 4DUGA 3M4ZA 3DE4X 1TYAE 1U2TA 4L57A 5LDHA 5IDVA 4X65B 4X24A 3G85A 2WVJA 1E59A 2WMYA 3PJGA 1ZK1A 4NJEB 1UT5A 1QLHA 1R6BX 2YC4C 1A7UA 3FFTA 4HGOA 1NPTO 1V3VA 3HZOA 4G5HA 1N6IA 3MWGA 1OY1A 3H84A 5KQMA 3G9QA 4LUCA 5F2OA 4M54A 1RWOA 1JKIA 4PG7A 4BMNA 3OZUA 2O8EA 1V5EA 2APJA 3RG8A 4EFKA 1BG6A 4RK6A 2IBSA 3WL7A 2ZRFA 3TK1A 4EW3A 3K5IA 5L53A 4BLPA 5KWEA 3F4BA 3BB4A 4YCDA 1G63A 5CLQA 1I4DD 4KQ1A 4B3GA 2CXQA 3ADKA 4JBNA 3SM9A 1U3VA 4UPVA 1G7SA 4QOSA 1OYOA 1OXXK 4O8ZA 1FNSA 1QKIA 2HQRA 2XDQA 3FDIA 1UH5A 2NTYC 2WD9A 1MXHA 3K0KA 4M76B 4PC3A 4Q34A 4D9JA 4EI8A 2H4ZA 3WGGA 4N82A 5JZVA 4S05A 4DB2A 1EVIA 1KIFA 2P3SA 2R86A 4H27A 4OP3A 3WAKA 4HH1A 1H5NA 2FUCA 2ID4A 1PR6A 3LSTA 3ECCA 3OKAA 3WWCA 3FSJX 3AZOA 2X6TA 1W9MA 3HG7A 1X0VA 4O2LA 1KZ9A 1DRUA 2CCKA 3DMGA 3VFDA 3R9XB 4KN5A 2Z09A 1KDVA 4HKTA 2QU7A 2GOYA 2BLLA 4YJ3F 1YB5A 3F97A 3MMNA 1U80A 1V5WA 3CPSA 3N59A 4BQFA 2ZANA 1T1RA 1W581 1Q14A 2DHDA 4L73A 4K6GA 3GEBA 1WMAA 5IT4A 1PS8A 4RH0A 1NSFA 3IKTA 4N3BA 1EX7A 1YRHA 1A72A 2CDCA 2R7LA 3I5AA 2FWRA 5LB2A 5KX5B 1Y63A 1E2LA 2FEPA 2OQRA 3BA6A 3CLSC 1USWA 3QJGA 1Q0TA 3ZJYA 1PSDA 2PSDA 1VB5A 4ODIA 1YBHA 4B80A 5KYNA 3C16C 2R60A 1SIOA 1PJQA 4J9UE 1IBRA 2I8CA 1WVIA 3NTRA 4YQEA 1OWMA 5TMBA 5EJ5A 3LUAA 3HA2A 4ZEVA 3ZTTA 5DBEX 1II8B 2P4SA 2Q0SA 3MYRA 4TV8F 4B8YA 5LLDA 2G9QA 4GE3A 2OXFA 2QAGB 4RSGA 2JH8A 2ZRJA 4QPNA 1OZHA 2VNAA 4XDZA 5KX5F 3LBNA 5EVJA 2BFMA 3KOZA 4KDRA 4ZTUB 4YJ2A 2QVLA 4GSKA 1LFDB 4XCQA 5EA2A 3TNDA 4KRYA 3TL6A 3DXXA 2H00A 3HXTA 4MEBA 2NPOA 3GB9A 3AHGA 1L8QA 4K9DA 1X3SA 4JJ8A 4A9AA 4MDEA 1PFYA 2QUKA 4OOFA 5AOVA 5JALA 1Y8CA 2RBGA 2ZYVX 3A06A 4BBZA 4BUCA 2OQIA 3V4PB 1PNQA 1IEXA 2FP4B 2RHLA 3CYFA 5BR8B 2P27A 2FJ0A 5HQ3A 3IUJA 1B00A 3J80A 3C14C 1SBCA 4LK3A 2LVBA 1RYYA 2IHKA 2O1EA 4RC9A 3DDCA 4INOA 5LPNA 1QX3A 1UJNA 4OM8A 3I30X 2F2TA 2O2IA 2WAAA 1OIWA 5DGCA 5A1JA 5FORA 1BVYF 1LBEA 1XDZA 4L74A 4IINA 1Y1RA 1QIFA 2R5FA 1HV8A 4ZQHA 3VZBA 3NDBB 3UB3A 4P35A 2B1RA 3MJTA 1ESZA 4MVJE 3T7IA 5AJTA 3U2QA 4BQNA 3FZEA 1N2GA 1KSJA 4LISA 3E2PA 2WV7A 4I08A 5A9TA 2RHHA 3T1QA 2O06A 3OLYA 3LBYA 1JXOA 2E87A 2HUPA 2VHZA 4DDHA 5LR6A 4CEHB 5JQGB 3TBFA 1VXRA 2R4UA 3IAS6 2CFTA 2LIPA 1FDOA 2ZSHA 3AINA 3R3WA 4PFSA 1SU8A 2VSFA 2B4TO 3HVJA 4KUHA 6YASA 1VPVA 3H1EA 3EIEA 3T3IA 5M5BA 1GKIA 4MGHA 2UV8A 4BS9A 3P0HA 2PCLA 5BN3A 4Q24A 4FWTA 2V7BA 1NBME 4P2BA 1SUAA 5LU9A 4KR3A 3H8JA 3I9FA 4E6PA 5CX1A 2LCQA 1Y4ZA 4Y0VA 1JDPA 3JQGA 4JLWA 3SU8A 3T9EA 1K6MA 3ZWPA 3K8ZA 3R7AA 3T9FA 4ZDKA 3N2LA 4K2HA 2E4ZA 3RS7A 5C4MA 5I8PA 1NN3A 4U7FA 2NQTA 1WHSA 3MSXA 5EJMA 3H2GA 5BW5A 2EKBA 4B74A 2VQSA 1FZQA 1KI8A 3HDQA 3ASZA 3EE6A 5FIUA 3TOZA 2JJ1D 2WWTA 2WVGA 3LT5A 4X6YA 1LSUA 3TQTA 3GFPA 1V8OA 1T9DA 2P40A 4JHLA 2MIIA 1WAMA 1MT3A 1NNLA 4ENSA 3MLEA 5IDQA 1TEHA 2GJ4A 4ZCIA 3JD4A 2JLYA 3N39C 1AQIA 4W6QA 2V6MA 3O4IA 1HZZA 4K03A 4M1YA 1NVTA 1UZLA 2X0DA 4RDCA 5B1YA 1NMZA 1Z68A 2WSBA 2GR9A 2ZYTX 4FN5A 4R7TA 1MN6A 3LVQE 1RRKA 3ZQJA 1FP2A 3S7TA 2FEMA 2P9BA 3QBEA 5A3VA 1TF5A 1Z15A 3ZZ1A 4BGIA 3FJYA 2CL0X 4R0NA 3K1TA 4QHYA 1CP2A 1URPA 5KNBH 5HCUA 1PP4A 1VL1A 1J6UA 1Y4SA 1RRFA 2G7MC 2OYRA 2HZBA 2HCFA 3LBIA 4KO1S 1T6ZA 3TTVA 3SEAA 3D5EA 4DZZA 1C81A 4YJGB 3EFEA 1O96B 5GV7A 1A4UA 2OB2A 5EJAA 2WWHA 3A37A 2CZCA 1R6VA 2V9CA 3ETJA 3WLJA 4F2PA 1QRTA 1WCIB 3Q9LA 2VCEA 3N7TA 1XVTA 4MB6A 4RIEA 5C1IA 3W5AA 3FMIA 3KKQA 4B76A 4JBLA 5IAOA 1IJFA 3GPCA 4JYCA 1MQ9A 2HK7A 3L0PA 2J85A 1GL6A 1ULSA 4NQRA 3G2PA 4XYMA 5GP1A 2I6QA 1N0VC 1XZQA 4P82A 3GH1A 2B78A 2IYQA 2XQKA 4MV7A 3QE2A 4FYMA 2HRRA 4Y6PA 2NOAA 4DZTA 3CG4A 1CUYA 1BAPA 2ZDHA 2QIOA 4R5MA 4JQYA 3STTA 5FUQA 4IF6A 1XD8A 2WM8A 2EV9A 3P32A 4GT1A 4Q1DA 5F3DA 5HF5A 4UJ3A 1UL1X 2C5SA 3E9EA 2GZSA 4DLRA 5AM0A 2PLRA 3AM3A 3ORYA 3QU9A 2QX4A 5IT5A 5B3JC 3COWA 1GGKA 2ZWMA 4QICA 5H3CA 1NMXA 4C6RA 3JQFA 3UUGA 2X6RA 4QUKA 1YIAA 2WA2A 5ALRA 1EE1A 5F1PA 3CKKA 3FVWA 4X1IB 4R2IA 4MR8A 5AJWA 5B58T 4B46A 2VSOA 4MQEB 2V03A 1D8TA 3NUZA 1K7YA 4XQCA 5KYUA 5BQ3A 3S2GA 5E4FA 1G5HA 3GAFA 4PSAA 2BKXA 1DC8A 4LRWA 2IZ5A 4TTPA 4UBOA 4KH0A 4XDGA 4EHDA 3ZDEA 4CM8B 4F92B 5JANA 1GGHA 3R8CA 3ZHVA 1E1NA 2W71A 3K9NA 1ZWKA 5ALFA 2AN9A 1QF9A 4PWZA 5ED0A 1VECA 4P5DA 3TTSA 5JAZA 4QL3A 1IJBA 3BN3A 4MW1A 1I2MA 3QOYA 4FONA 2G6BA 4BWFB 1EWYA 4INZA 4NBWA 3SXPA 4DLXA 5LWQA 1R4NA 3QVKA 3SQNA 3FYCA 3ZU6A 1R0LA 3IVAA 4D9HA 1DZ3A 3OF3A 4DHEA 2JGNA 4RVDA 4XUGB 3B6ZA 1ISMA 4BN4A 4E1VA 1OZAA 4BQRA 2D1YA 4OYHA 3WLSA 3UAOA 5IF9A 1NY6A 1TQ8A 3KQVA 4D9CA 3N2KA 4DWWA 4DR6B 3JQBA 3RADC 1ZJ5A 1R00A 4CR7A 3DE6X 4JEIA 3EF0A 2BONA 3UW3A 2VOJA 2C97A 3ZHRA 3O8CA 1I7PA 2QENA 2C2XA 1FUEA 2BWJA 2VJPA 4E5PA 3IMCA 4PHGA 1JHYA 3TR5A 2XXAA 4N54A 2X15A 1XN4A 4RZHA 1YR1A 2B8WA 3PFBA 4Z3KA 1CZUA 2P5SA 1U02A 1UAYA 3VJLA 3GAAA 3R5HA 2FUNB 1DRVA 3ESYA 3UJCA 1G4AE 3NHYA 2AOUA 1WW2A 1VE6A 2AVNA 3NWBA 3ZD6A 1L1QA 4JGIA 5GJBA 3ZBTA 1PQWA 3EC1A 1AKRA 3BXXA 5KQRA 3GLSA 4FFSA 3EAQA 1CX9B 2OV3A 4HX9A 4C7XA 2R7MA 4P4GA 3N5KA 1WXDA 4ZYXA 5CT4A 2E18A 5I6DA 2HJ9A 3WGIA 1B15A 2OV6A 3A05A 2QD3A 3IP6A 1I4LD 1RR6A 1NONA 4YRCA 4R8KA 4DLKA 1KJZA 1XC7A 1I7QB 3D0RA 2P4QA 4O2BF 4OXNA 3V46A 3WMWA 3OIVA 1D1TA 2VPTA 3COYA 5IXSA 3LKVA 3WIEA 2FN4A 3I6BA 2W42A 5CNJA 4A23A 2PV7A 1M66A 1ZUNA 4IQ4A 2C29D 2H4YA 1DKQA 1NQOA 3BRCA 4FQ5A 2F9MA 1T3HA 1X1DA 4HDRB 3A9UA 4G1EB 4Y2UA 5IN5A 1JA9A 1IM8A 1Z4PX 3AUTA 1FQWA 2ZB8A 1ZM9A 3OY7A 4JENA 3EFBA 3U17A 3L7KA 2Y0PA 1S7GA 4XIFA 4DMRA 3ZLJA 3DAGA 1YWGO 5FEMA 1DIAA 2XUOA 5I9NA 5CVTA 1Y9DA 2GUWA 3DBRA 2DBVO 2VSNA 4M36A 1JEYB 1CNFA 5G3YA 4GYJA 1WA5A 221PA 4YJ2B 1LJLA 2VHVA 1KETA 1LPAB 2BAGA 3HMQA 1P3JA 3DE3X 3FSRA 3QOWA 4GP6A 4MP3A 4AC9A 1RRMA 1P9OA 5DE3A 2NVWA 4NZZA 1EWTA 1JHAA 1HPLA 2VYND 3GLIE 5GOTA 3MJVA 5C8VA 4BMSA 3LXMA 2ACKA 2BFWA 4RV4A 1EX1A 3SF0A 1YQQA 2QE7A 5CB0A 5HQ3B 4Y6QA 1WXIA 2ZKIA 2F8TA 5EIBD 4GMGA 2C2MA 5KTPA 4QBTA 3ZN2A 4QXAA 1X1AA 4QOHA 3V8BA 3RS4A 3WKEA 3M0EA 1NRXA 1RJEA 2Q1WA 3HCBA 1G291 4EKNB 4GDFA 2WIDA 4QDUA 3FNGA 5E1BA 3KDAA 5EYPB 1JG1A 2IUEA 1CR0A 3R0IA 1TQ6A 1TYZA 3JX9A 1GGMA 3O8OB 5JXWA 1RQNA 1G2QA 2PLNA 4DYVA 2HCRA 4H6PA 1ZK3A 3N8GA 4IXWA 5H1YA 2JLAA 3TDKA 3U7IA 3HDGA 4JFAA 3QSYA 2EARA 2ZVDA 1U0JA 2ODAA 2HI0A 1ULUA 3CEJA 1MO5A 1WEKA 4KVFA 5AJHA 4B17A 3PCTA 4OKSA 1KTVA 2G63A 1CUWA 2HQSA 1TAQA 1PG2A 2RGCA 1K0UA 2ILVA 4QUAA 1GPWB 2IP1A 3LHSA 1QZZA 1LLCA 3UQYS 1NF3A 1WY5A 2WM9B 3IQZA 4E70A 4LDPA 2ZZNA 3LY7A 4R05A 4NDAA 2COKA 4KQMA 3ZX5A 1NWCA 5JECA 5EUCA 4CIXA 4MKHA 1AS2A 3OZSA 4PGGA 3FYHA 1RHRA 1N5OX 3DCJA 4LRSB 5CX1B 1ADYA 1MOZA 2IXFA 3EC7A 4NSNA 1JB9A 3JQAD 1Y3CE 5BUZA 4BBAA 1Z5ZA 2Y1KA 1WHSB 1L7QA 5I51A 4E33A 3RYIB 1V8FA 1XRJA 4IIJA 2I67A 3Q98A 4II2A 4UNSA 2WG1A 2VF8A 3GDGA 4JP8A 1QORA 4WKGA 2VS1A 3OVMA 3VC7A 1Y9AA 2O23A 4BQIA 3FDFA 4W1QA 4JODA 2R97A 2OD7A 3SJCA 1RXEA 2GPTA 4JWTA 1ZI9A 2OESA 4M55A 5TQ2A 3EVTA 4KITB 3CEHA 4IHKA 4XFJA 3JTMA 3ZDFA 3VNUA 4DDKA 2AFVA 1NBEA 3HGQA 5DXAA 1M72A 3OZWA 4AP9A 5CLFA 1NW8A 2OMEA 2R84A 1GA6A 2R0QC 1JIXA 1Q74A 1W76A 2YN2A 2BGJA 4UBJA 3UANA 3FI9A 3MAGA 4MMYB 1VHWA 2ZS7A 2I65A 4PXSA 3TLGA 3VSBA 2I0FA 3PHLA 1HLGA 3CA8A 1SEVA 1L9KA 3E5RA 1ZD2P 3S0JA 2HA3A 4J0JA 1DJQA 2IDMA 1FXUA 2OZLA 4LPSA 4QEZA 4BKOA 4F97A 2HY7A 4ABYA 1ZOLA 1Z18A 4J4TA 4MPJA 1DBQA 1VE9A 1LDMA 3ZD9A 3O2JA 1KP3A 3A6KA 3GRAA 4PIMA 1L4HA 3CVJA 4G3XA 3N2YA 4OMUA 1I3MA 4R2HA 3NOVA 4PPNA 3WK7A 3QZUA 4IPTA 5F1KA 2W6IA 5FH9A 3VYUB 2FWMX 5AM4A 2JLQA 4IW3B 4DPMA 2ZUUA 2O3RA 3DXZA 1XCOA 3WMFA 3K8QA 4ISCA 1KHHA 5E3HA 1I13A 2IXEA 1SUDA 4DR3B 1RPZA 3BMNA 4PRZA 2CK3A 1BHJA 5BN5B 4QKQA 2AKYA 1UODA 1NZFA 5GWXA 1M6HA 3B3GA 2SECE 3NHJA 4RKWA 4OL9A 2AZXA 4V0OA 3O1JC 4ME6A 2Z08A 4HGZA 2ESRA 4LCBA 5BMVB 4GVLA 4OB7A 3ROGA 5AIAA 5JPDA 1VIVA 1LI7A 2JFQA 2ZRGA 4AZ0B 4MVJI 2ZCUA 1QTNA 2OO5A 4FGUA 2RI0A 4H6VA 4LXXA 4HD8A 4ARBA 3RT7A 5HQJA 1N0WA 3FBWA 3KVRA 1Z22A 5K99A 2WKSA 1XDWA 4MR8B 4XUCA 4RVGA 1KHTA 3EW9A 3VV3A 2IX3A 3IOCA 1TLLA 2Q5LA 3HN7A 4ZO4A 3LKBA 2G07A 4YECA 3PEFA 4RZQA 2IS4A 2J6CA 2VDWB 2OZKA 5BMVF 1OVGA 1XZMA 2GDZA 2L2QA 4J1TA 4KI7A 5GONB 5J2TF 1UKCA 2P77A 3PGLA 4MRRA 3ZK7A 2C5FA 5AESA 5JMWA 1N34B 2V0GA 1AZWA 4QUBA 3KP1A 2NGRA 5C2JB 3O92A 3WLPA 1KI9A 5C4IA 5IWAB 1GFWA 2HPZA 1KARA 4ND6A 2XYGA 3ZIAD 3O93A 1HDOA 2P4EA 3IJPA 1G8YA 3GVIA 3C3WA 3G02A 1G17A 1PGJA 1YZFA 1KNXA 2BFDA 3E9DA 4L07A 4NJMA 3AF1A 2AMFA 2NYRA 4O2AF 1T5LA 1ZOOA 2WE8A 3FETA 2OXRA 3AEUB 4D82A 1DO8A 1F51E 2C2WA 1JIKA 2Q2NA 4DBLE 1N3IA 1V7ZA 4HAIA 4LVNA 4PCUA 1BEEA 3C48A 2IV2X 3TOSA 3VYTB 5JR3A 2BFBB 3AI3A 1ACJA 1RKQA 2IUFA 4YBRA 1WCXA 2CE2X 2HA0A 2NLOA 4OSPA 4HCJA 5H8WA 4OHUA 2GAOA 1NMYA 2EIHA 4N40A 4W9NC 5FRDA 5KSPA 2H1IA 3PPWA 2PJRA 3T5AA 4GNKA 3WYCA 4JEHA 4WH0A 1E5QA 4NAVA 4OH7A 3TDMA 3V2HA 3V7FA 1R0ZA 4U7PB 5F52A 2XE6A 3PR1A 3C3AA 5ALHA 1SCAA 3MRSA 2BI8A 3A9TA 3HV0A 1IMOA 1NP3A 1KKLA 1U94A 3L8HA 1DV2A 3LUJA 1XU7A 4HJRA 2EQ5A 3EXEA 3KWJA 4UHJA 1M34B 5T3UA 1PR3A 2AHRA 1Q2UA 2V7QD 2P79A 2X5XA 3IAS1 3EB9A 2PMKA 3L8FA 3AHFA 3FE2A 4PAOA 1Y6RA 3WB1A 2YR0A 3AO0B 3LWBA 3P9XA 4RA6B 4DADA 3A10A 1OAOA 3QFRA 2X2FA 1CKEA 4RPGA 3ZDDA 4DLLA 2QTZA 1QH8B 4B6QA 1K8QA 1Q92A 1QHIA 5EHNA 3E9CA 1G8HA 1Q95A 3HYCA 5F77A 4C1NA 3NEPX 2VDJA 1QCYA 2G80A 5KSZA 5LZ4A 4NDNE 1RNLA 4KMSA 4H31A 1F20A 2AE1A 2DGDA 1H0RA 3N3AC 1XF9A 4GXTA 3BBLA 4ISBA 1CHDA 1DBRA 1DJPA 1GKLA 2B1QA 2W48A 2XGGA 2ZS9A 3C43A 3JCZA 3EDMA 3K6JA 3KYCA 1ZNXA 3OQHA 1A9OA 4JL8A 4L8YA 3U4IA 4NEQA 2ZROA 2WM2A 1I3KA 4GR4A 4MS4A 1YIOA 1JWBB 3NIBA 2FPPB 1IIBA 3LDUA 4Q3LA 4D4LA 5GTDA 4EO7A 2QEQA 5KWJA 4IFIA 3SBEA 5JSQA 2W2KA 2ZTLA 5EIHA 2MHCA 1P1BA 1WSDA 3HU1A 3WO0A 5EMLA 1WOYA 2ZB3A 3FTPA 1WB6A 2WSSD 3DBRB 3BIXA 2I22A 4DJDC 2R8PA 4XLTA 5ALEA 5JXGA 1TYEB 3LQ1A 3K92A 4MKIA 1S7CA 1Q7CA 4IOMA 1FDSA 4R2MA 1B0AA 4PAQA 5JOQA 4AX8A 2QMYA 4TT3A 5CT6A 2EBUA 4CG0A 4MIEA 4L50A 3WHIA 4ZV9A 1ML4A 1JLMA 3AL3A 3OSUA 3U56A 5EESA 2XWSA 2QR2A 4JVLA 4CKXA 3KQNA 2W4IA 4MYUA 4Z9BA 3FHOA 3EIQA 5DT9A 5H7XA 4QIHA 4UCFA 1N2CB 3VBEA 1GUDA 4B5LA 1OLSA 2NT3A 5EHXA 2W00A 4YUXA 1TIKA 3L4EA 2XPCA 4DLBA 1SG0A 4WJZA 1MRZA 1RBZA 3DL4A 4NH4A 5BVGB 2GCIA 4JC0A 3S2ZA 3ZGOA 1P4SA 1XTSA 3AESA 4RHUA 1QYVA 4I5DA 5HMMA 4J29A 4AK9A 4EJ0A 4JLAA 4EYEA 2Z1NA 3IAAA 5DIFA 3ETCA 5CB4F 3ICCA 4FGJA 2ETVA 5C7OO 4FCCA 2P6MA 1CR2A 2J5BA 5DNUA 2R751 4OHPA 1DEOA 1ZOPA 3ONVA 1KZ6A 3QTTA 3CCBA 4CLEA 2IDJA 1DBVO 2QMZA 3CTMA 2V6GA 2KI5A 3UJ7A 3FUVA 1U2EA 3ZR4B 2WHEA 1E3JA 4E51A 1YRLA 4DSUA 4Z51A 1SQ0A 4X93A 1JYFA 2PL3A 2XHEA 1U2PA 5FL7D 4XYGA 4H15A 1CUDA 1K5HA 1WKCA 3P19A 1EVYA 5CK4A 3LQYA 3W79A 5K9ZA 4V0RA 4J43A 5M2QA 3CX3A 4DV1B 1PFVA 5F2EA 1S9DA 5FD8A 2QROA 4IFEA 1I4OA 5FCDA 3CUKA 3UH1A 4QGAA 5ARBA 4ZJZA 3OZAA 3FBTA 3ZWOA 3GW8A 1GZ5A 3AR6A 3GIDA 3B89A 2C8JA 1U9YA 3GJRA 4NOJA 1D1SA 2C1ZA 3AV0B 3N8IA 4MH0R 4MZDA 4EB8A 3HU2A 3UW1A 1JLLA 3H16A 4H17A 1H4QA 5CH8A 3VDMA 4B3MB 1D2RA 2X9NA 5FPPA 3M6AA 1PR2A 1FF9A 1WO8A 4P3XA 1U0RA 3PA8A 2BJVA 3Q85A 4Q1CA 1T4DA 1CDEA 3R0ZA 2Q8NA 2YVLA 5JSZB 2VZEA 5KJ6A 3AKYA 1XTTA 3NDIA 4F6RA 2RHJA 1QGUA 4PTYA 4EJSB 4WACA 1TM3E 2HZ7A 1LBTA 4RWEA 4LBZA 3LQQA 4IZHA 4D43A 2WB2A 1NNI1 3S99A 3ILSA 1Z28A 2H63A 2QPLA 3L7IA 3T3DA 2EJVA 5IUNC 4RTNA 1TYDE 5D3ZA 1E77A 2P2LA 2P68A 2ODQA 3Q7SA 3CWZA 3GUCA 3RSCA 5KYYB 3C1AA 1T9GR 3TZEA 4O3MA 4IDGA 2E5LB 3WWOA 2NPFA 2PZBA 2WMOB 4QRHA 1GITA 4CU5A 2CBZA 2IYOA 5FPSA 4ZEXA 5HTKA 1ND6A 5DN6A 3U5ZB 1GSIA 3N58A 1L3BA 3DWEX 4MIKA 4E5KA 3Q3VA 4AW9A 2H5LA 4WFKA 3D8SA 5CBKA 3MPUA 3EULA 3FOEC 3SHTA 4TSFD 3TZBA 1KNQA 3NBZC 4RPKA 4BUJA 3ANYB 1Z5GA 5TNXA 1ISSA 5FADA 1H42A 5JWOA 1LW6E 4CFYA 1GPAA 2C5EA 4KQEA 1AA9A 3TW8B 1R0BA 3FYDA 1X1EA 3BMNB 4I7EA 2IIPA 2ZDGA 5CA0F 2OBFA 1D2EA 2X0NA 2Q5JA 4AYWA 2XNSA 3T3HA 1NQUA 1OC2A 2QLBA 3L49A 3LRTA 4H0CA 4PV7A 4KJZA 1GDHA 5NLLA 1WIWA 5IKMA 1DFIA 2XMZA 2Q3MA 1MPTA 2QTCA 2GJ9A 3DKVA 4UM8B 3RU7A 3TJZA 5B53A 2ET6A 4YFYA 3O1LA 1KDPA 3HPRA 3DWIA 4MYTA 4CWAA 5JCPA 1UFQA 5LYYA 4HUTA 2P6PA 3X1JA 3V2GA 4L4XA 5JO9A 4ALLA 4AD8A 4LTMA 4EY4A 2P2GA 3WIOA 3DDOA 3OP4A 3VUEA 3PFGA 1IN4A 4G37A 4OJKA 4BNDA 3UXHA 1HKUA 1RMQA 1UDBA 4Q01A 3AR7A 2XMBA 4RACA 2DZDA 4B1FA 3V4RA 3ZE7A 3HJCA 5CG2A 4GBGA 4GO1A 5SZHB 2UDPA 2GYUA 1P7CA 4P84A 3VR1A 1JSXA 1V48A 1XPUA 1LTQA 4LJ4A 1I0ZA 1W4RA 2FLKA 2OAGA 1AGYA 1HG0A 2A9JA 3CB4A 1FVOA 2FPWA 4FBLA 3QPWA 2BFDB 1XNQB 4X90A 3EXHA 1R9JA 4ZMBA 5LJLA 1SCJA 2GN2A 2C96A 2NVUA 2VNIA 4IICA 4TKZA 1KMNA 4WZBA 4AY4A 2NO6A 3SR4A 5HRCA 3H97A 1EUCA 4AROA 3GGDA 3W5VA 1QOPB 2VEDA 2IYNA 2G4LA 5DKFA 4MROA 1X7YA 3OEHA 2VBFA 3CNQS 2KBFA 3MUFA 3FKJA 3RVNA 3E3AA 4EQZA 5KEIA 2ECFA 4TZ0A 2DEUA 2FCAA 4IMPA 3VI4B 1AB6A 4TTSA 4QG3A 4QYXA 3RTAA 1GG8A 1WXQA 4P58A 1MVOA 3OOJA 3DEHA 1AO0A 2AFIB 3SDSA 3MHTA 1BWQA 3G6WA 1SKQA 1Q3KA 1TVCA 3HYNA 4MS1B 4BNNA 1IHDA 3IQHX 3T1OA 2Y0EA 2C3UA 4KTVE 3F6PA 3M4NA 4IDQA 1DCFA 1PQ4A 1UOOA 2OCLA 2X13A 4R9SA 3RUHA 1EIZA 4ZRMA 5BQFA 5LQKA 5CPBA 3K30A 5G0WA 3IT1A 3L0YA 1V0JA 5D1NA 5K8CA 1YFJA 1F6WA 1Z12A 2EX4A 4NU0A 5CDSA 3MOSA 3NWPA 4JP3A 4OHOA 1L5QA 2A5JA 2CLFB 4RANA 4GZ3A 2PD4A 1WZUA 2QM0A 1Z0SA 3AONB 4MPPA 4PYQA 5HX7A 4HVCA 2YWBA 5I7WA 4FMBB 13PKA 1K5PA 3A11A 3G0IA 3HO8A 5AIBA 3FDXA 5LU8A 1ITZA 3OOHA 2IU3A 4GEGA 3QBJA 2ZRAA 4JT4A 4M37A 1FYWA 2YFQA 2ZS8A 4JT2A 3QM1A 4MKRA 1IB0A 5CLGA 1T25A 3RNLA 4I6GA 3O90A 4OXXA 4BWVA 1PT6A 2P0YA 2BGGA 2V6JA 4WNYA 4LNHA 2FEOA 4G85A 1E4OA 2ANBA 2VUSA 2BR4A 1QQAA 1SXJA 3IVCA 2Y0CA 3QVGB 4W5JA 2AHOA 3HZZA 1N5RA 1ATZA 3SKVA 2PBRA 3ZBPA 1RLTA 5FOXA 3T4EA 3A3PA 2GN1A 2O2HA 4RESA 1MR3F 1RMTA 3NBKA 3OHSX 4P7GA 3S8MA 4J0KA 4OHWA 5LM3A 1HEIA 1DC3A 2PSJA 5JCOA 4D96A 1DCTA 3PUYA 2V96A 2YKGA 4CN9A 1X9HA 2R2AA 4C6HA 2RHDA 5H82A 4RK4A 1K27A 1X9IA 2JCSA 2H7XA 3CEPB 5AI5A 1OFUA 4KQCA 2ZI3A 3OQBA 4XWGA 5FNVB 2J3LA 2V55B 2WEKA 3NYWA 4ZDIA 2QYHA 2FVYA 3R2JA 3LU1A 4Q9AA 4I50A 4QO8A 4YUZA 4NY1A 1EJBA 5G0VA 4ZJPA 4ARCA 1TT5B 2PN1A 5I3ZA 1G3MA 5CG1A 2ATIA 1DGQA 2QGZA 1E6MA 1HZJA 5AM2A 1GGJA 4DXHA 3D1VA 1CJMA 3LFUA 4RIHA 3GUHA 1LQTA 4HF7A 3UVEA 3M33A 5IAEA 3DEAA 3BL6A 1ZN8A 3WLFA 3GUYA 3FNRA 1A97A 1R50A 4G41A 3WYNA 3H3JA 2YC2C 4G4JA 2IZOA 2WUDA 3HYSA 1P1FA 1J0EA 2WLSA 3QKWA 4HPJB 3L41A 4K6MA 1TFUA 1N0IA 4PCAA 3U39A 4UW9A 5DNAA 2YQ5A 3DE7X 3P4UA 3TQFA 3EAGA 1GL3A 5CFOA 1DKPA 4WZ6A 1MTOA 2H4JA 2I2AA 2QMEA 3I4CA 3KKMA 2YXDA 3R6LA 4JCOA 3JWHA 4NRDA 1ZISA 5CBPA 2ZBVA 1P91A 1QQ6A 1P1HA 2GN8A 1B6RA 2OMKA 3IC5A 4R4JA 4CQLB 3TAXA 3C39A 1N2HA 5ALTA 4PO8A 4BZWA 1ECFA 5CXXA 1W8IA 3TI9A 4CE6A 1ZRHA 3UMYA 3R75A 3OHPA 4WTOA 4KVZA 5E0KB 3UC9A 4RMIA 4LHWA 2CWDA 5B7PA 2Y1CA 3B1JA 4EPVA 5DGDA 1TVMA 1LF0A 2FFHA 3IDAA 1ORHA 2FZEA 1T1IA 1X8XA 2D4AA 2HQ1A 2MR5A 2P3LA 2ZR0A 4MLDA 1I1HA 1NXTA 4AAYA 4G0ZA 3RSLA 3VKFA 4ZKDA 3RC7A 2WIJA 3TRJA 3ZGNA 3E22B 1O89A 2Y2VA 1F2TA 3KRTA 1NM5C 4R1MA 3EVZA 3DV2A 1KRXA 2DX7A 4NULA 3S2EA 3KE9A 3QWHA 4PO9A 4I8DA 2CUNA 1K8RA 1SB8A 1PLLA 3QUQA 2UZAA 4FLEA 4HTAA 2YJ5A 1B8UA 1HE1C 1CE8A 1G5RA 4MZXA 4P32A 1X7ZB 4JOSA 4NS1A 4QSMA 1X70A 3R0VA 3QEMA 1WVGA 1U3GA 2HJHA 1USUA 4JR2A 2XKJE 2YHAA 1V8BA 2V6FA 1L4FA 2YUIA 1Q6YA 4LJSA 4UDYX 3X0DA 4C0AC 1ZN9A 4JB0A 4B4DA 2XYPA 4DPLA 3KZKA 3DEIA 2Z5VA 3R23A 1CNEA 5LQAA 1VGVA 1RYNA 3WP0A 5ECWA 2VSQA 3A14A 4HDMB 1VP3A 4BCBA 4OTZA 3ZV4A 1H8HA 1BX0A 2VP0A 3ZW9A 4RULA 4E5YA 3F6YA 4QYWA 1EXVA 3UAZA 1XRPA 3JVDA 3EOBI 5J63A 2XGJA 4DCVA 5GZ3A 3W2HA 3A8TA 1KZ4A 1U3DA 4JB2A 5REQA 1WV0A 4RHEA 1VGQA 1QPGA 5EOVA 2O4UX 5IBQA 3NU1A 3F5MA 2VAPA 4KOAA 2CLLB 3N7UA 2AK2A 1H1LB 5I7FA 1PF7E 1GGFA 1W75A 3BIFA 3DCYA 3IXQA 4NOLA 2BHLA 3A6LA 3PJDA 1VYHA 3ZI4A 5EXDA 2PKWA 4I5GA 2OZPA 3I8SA 3BVPA 5TPZA 1QGZA 3GGCA 3GD7A 2B61A 4XCXA 1U1IA 5JXHA 2GXAA 1MZPA 3CLTD 2P9JA 4WY5A 4TUYB 2HMTA 3R20A 1NXSA 1WZIA 4FDUA 2ZJ3A 2FX2A 3FFXA 2B4YA 3MAJA 4K87A 3VNAA 4QJ3A 1IY9A 4MQFB 3R9IA 1E0JA 1KO8A 1SVSA 1IY0A 2FWJA 1L7AA 1S2LA 3D0OA 2ID7A 4HNUA 5J4KA 4YJ3A 3OD5A 4KQIA 4MW6A 1O9HA 1OSNA 1R3UA 2J0UB 3G79A 3QPVA 5ECDA 2DKFA 4FSXA 5IH7A 3BH7A 5MFPA 1DAEA 1A5ZA 2FW6A 1ZUD1 1QWSA 2ZP1A 4MA0A 1LI5A 5FPQA 4QX6A 3HLYA 3OCJA 4R3NA 4RY0A 1TZ2A 2SHKA 4WBXC 5TRTA 3M34A 4ZVPA 1GTMA 2JLCA 2GO1A 4MAFA 4F2HA 3FHLA 2GEVA 4I66A 2AXNA 4PZDA 3LECA 5DX0A 2ZUFA 1XP8A 3T5CA 3MAAC 2FFRA 3AUFA 3DLCA 5C51B 4P98A 1WCWA 4WJKB 3U6BA 2LPMA 5T4FA 4ER6A 3H4TA 4WLFA 4W6ZA 3VR5A 1T9HA 1XALA 4IH1A 4LZWA 3TJMA 5ALSA 4YAIA 1XN1A 3PF8A 5AKHA 4RX1A 5IUKC 1WU7A 4URWR 4A0RA 1I4EB 2AD5A 1L7RA 1EFPB 3GJQA 4TMKA 4M1TA 3TNJA 4DSNA 3KWLA 1Y3FE 1PZXA 3PZRA 2L19A 3IX7A 1D3AA 1EU1A 3MB8A 1IOLA 5BSTA 5EJEA 5FAKA 5AJUA 5E6UA 3W5HA 4S24A 1E1MA 2DPXA 3WB0A 3I9NA 3BUSA 4RJLA 1VI5A 3EWAA 3MJHA 5F1YA 4TS3A 2XBLA 1FDVA 4XRGA 2FSIA 3VR4H 3O3MB 4LI0A 4UUMA 2UZ1B 2VBIA 3KKNA 4UASA 1CUEA 2UAGA 5A7GA 1Q7GA 3G9TA 3ASYA 4Q7QA 2HR1A 3OO1A 1YBAA 2VHYA 3AX6A 3OA0A 1TUBB 1ZK0A 4IILA 4TTJA 4Z4IA 2X42A 1XKQA 2ZM6B 3I2KA 1YFZA 5EWLB 1E3EA 5CDGA 5KYWB 2HN9A 4QDTA 1PEAA 1T36A 3OFJA 3QW2A 1P33A 3U4AA 4WDQA 3B70A 3RO7A 3L8MA 3C8UA 1UK8A 2B6NA 3FGNA 2DFNA 1T8YA 3DPIA 2OOKA 1GQRA 3HR7A 4WX2B 2H29A 4UVEA 3V8MA 2HMSA 4D0RA 1CETA 1JAXA 2C4VA 2PX6A 2BFEA 3EQ6A 4GQAA 4J0FA 5CXUA 1ORWA 1MO6A 4ZCQA 4EK9A 5JUWA 5A6SA 1DOZA 1G38A 1UDRA 4KQFA 3LVFO 4DFDA 1DWOA 1B3RA 1VFNA 2OWDA 4G5OA 1MG5A 1ZSVA 4LSGA 2GCEA 3WIVA 1RYMA 5LZ2A 3BL5A 4TTAA 5AHRA 3NUQA 2B1JA 2P6NA 2OE2A 1ULTA 3IEUA 4JJIA 3T3EA 2QRQA 1UDWA 3IMKA 5IM4F 4P9NA 2YRFA 4G97A 1C3LA 1XXHE 3QYJA 4ML3A 3T7CA 3RSGA 4F21A 3DDNA 3L01A 2ZG6A 2VQ3A 1VXOA 2N1BA 2VYVD 2LV8A 2P7HA 1JDJA 2GJAA 4Y6GB 5GMOA 1N2JA 1JFFB 1VMEA 5P21A 3ZKAA 4RAOA 4HZIA 4RJ2A 4A2QA 2JNWA 2GHQA 1KFKB 3EDOA 3USZA 3BDIA 3EASA 1H9CA 2XY4A 3E1GA 1ICEA 2QRVB 3MSCA 3MXOA 3FDJA 2XMCA 1MU0A 5JNVA 4EG0A 1JQBA 4F5WA 1A4XA 4ZK2A 4BQOA 5COQA 3CJTA 3IUEA 5EVCA 1H8ED 1WBJB 1SAYA 2JAXA 2OILA 2P9ZA 2Q3LA 2BTQB 3E70C 4KBYA 4LNAA 1YDGA 3UK6A 5DSXA 4E2XA 5H02A 2FXVA 3S3TA 4GKAA 1O6BA 3I28A 3M5DA 2BISA 3M2TA 2JIPA 3K5PA 1J9EA 1TC1A 2QT0A 4FDTA 2EYUA 3PWZA 2XUHA 2Y66A 1U9JA 2XSZA 2QVGA 3BXEA 2O5CA 3OFND 4S1NA 1KSHA 1QIHA 2YW9A 3EIHA 2C9CA 2ZI5A 3PICA 4D3DA 3PXUA 1D2AA 2ZWOA 5IJZA 3P0EA 2RHCA 2FSPA 4KKXB 3FCCA 3BE6A 4OOEA 4UFNA 1S9HA 1OI7A 2DP4E 1T29A 1TO2E 1RWBA 2QTBA 1Z3IX 1BE6A 2DPYA 1A9SA 5EP4A 5EE5B 4AECA 1Q5PA 3PUJA 1RWWA 2VHCA 2PUAA 2WNHA 4IGKA 2FSVA 1B7GO 4RJTA 4NONA 3KKEA 4C6TA 4JI1B 2GJKA 1YOVB 2GPNA 3N87A 5I47A 2W22A 3V3TA 4O4LA 2C98A 2GZHA 1C7ZA 2HFKA 3UAVA 3VVMA 1VIDA 2JIRA 4LXHA 1MAAA 2ZJ5A 1E6LA 3HADA 2O3JA 3D7NA 5LMZA 4ZC1A 5COAA 2J30A 4AS3A 3Q7PA 4H7DA 5CBPB 1RKVA 2IY7A 1NTRA 5K20A 4EHFA 1XGKA 1NRWA 5H83A 4WDRA 4KV7A 5FWNA 5FI5A 4U7HA 2WJIA 1SHTX 3PCRB 4EMTA 3STVA 4F3YA 5J2UF 1DRJA 1ZQ9A 4XI9A 1XCLA 3C1OA 2HU8A 2JANA 5FULA 5GQSA 2K7FA 5DP1A 4IKPA 3I01A 2XZTA 5CJJA 3IQIX 2V59A 1FIUA 1RYBA 4QVKA 1RJFA 2B69A 1CRLA 2R00C 2PH5A 2OV4A 5SV2A 3RLFA 5LIPA 4ITVA 1EFVA 1J23A 2FZ5A 1J0XO 1F2TB 2JEYA 4W1PA 4BNHA 1ZY2A 4Y1RA 5EXEA 1RCUA 2OV1A 2HK9A 5JHGB 2AKAB 2NPIA 4HNHA 3ACDA 1HFWA 2IHTA 3FN4A 4R54A 5E7JA 4FGLA 3U19A 3MCAA 5TMPA 1HQYE 4H7KA 3IEPA 1ESMA 4BPRA 4DIEA 4RKEA 1PW5A 2W6JD 5CCBA 2I7CA 1CE8B 5JEDA 4ND5A 2Q5HA 3SHWA 1JP7A 3UJ3X 1L5KA 4CKYA 1AUQA 2NO7A 1R5OA 3KAPA 4AO6A 4DLVA 2P2DA 2VWQA 3URMA 2WE7A 3QEMB 4JROA 1TCUA 1HURA 4KK4A 5GAJA 1QSGA 5D00A 1QDEA 2TMGA 1O6CA 3ZKWA 2PWPA 4JI3B 3WNCA 3PCXA 3L1IA 1SUCA 1YRWA 4K05A 4QG7A 4BN0A 1E4VA 4LFCB 2SCUA 3LUKA 4HEJA 4P4NA 2PLWA 3PFCA 1XB2A 2BD0A 2FN3A 3B53X 1KQFA 4ZXFA 4A36A 2J3HA 3JQQA 3OBBA 5G4KA 3SN6A 4Q02A 4BO9A 3RV4A 4UUAA 4C4ZA 4TL8A 4YPVA 421PA 5HVNA 4G0MA 4XPIA 5DTEA 1ZM3A 1HT0A 4I3GA 5HKOA 3SQXA 1Z0IA 3JQ8B 3IHKA 4WINA 4EY6A 1Y1LA 3CMMA 1S8OA 4MCAA 4PG4A 4QFBA 4KIFA 4PEVA 3BFPA 5KSWB 4KXXA 5TV2A 2YRWA 5AW4A 1TW2A 4NG5A 2CSUA 2REBA 1COWA 4LGYA 3TLMA 3GLGB 3F7OA 3KD3A 3U61B 4YV1A 4RH3A 2Q9BA 2OFPA 1GD1O 4FFRA 4RHXA 4FK8A 1DX9A 5D86A 4NCJA 4R9UC 5KPDA 6ABPA 2DSNA 1HG1A 3TYXA 3F2VA 5FYQA 4FEAA 4HDOB 3BH0A 4X1OA 4DCMA 2PUCA 4WA8A 2O1XA 5JFOA 3ZD8A 5IMBA 1TVKA 3L18A 2JC3A 1XVAA 1V4VA 1S8AA 4DM3A 2YMMA 2Q49A 2VJMA 5P8WA 4XDHA 4KTTE 2J87A 5T3YA 3OJFA 3WVNA 2HIAA 1Y7TA 5JAOA 4NFLA 4UARA 5H16A 3H13A 3HXPA 4FYIA 3FPBA 4CMEC 4ZI7B 2ZXUA 1Q57A 5TT0A 4UHDA 1RRPA 3S1SA 2DR2A 1Q17A 1R3DA 3X43A 1XQXA 1YI8A 1DUIA 4MI3A 1Z26A 2DBQA 3C6MA 1DC4A 2JD1A 1JQAA 4ANFA 4EYGA 4AKHA 1GAQA 2GEFA 2GK7A 2JZNA 2WF6A 3SJZA 3C15C 1PUIA 1GUYA 1D5WA 1E4EB 1QAMA 2RKWA 4G36A 1GPH1 2NU7A 2X58A 4ZI7F 5TJ9A 2ANCA 2PLFA 3FX2A 1E3SA 5G4LA 3ZQ6A 1YI1A 1KOJA 4NFHA 4TZKA 1N92A 3DC7A 3NR2A 4FKBA 2D1FA 3QVLA 3RTBA 4GMFA 4CMHA 2G4VA 3RJZA 1JPVA 3CRQA 4HT3B 2IIBA 1WZ2A 3TKAA 1N5IA 3MJEA 5CX4A 4K1LA 1U81A 2N46A 2NTVA 3I05A 3NRBA 1KKMA 3HBNA 3ZTWA 5ALXA 1FJXA 1FYEA 3E9MA 3K1JA 1KO5A 1KQPA 3GBVA 2WHQA 2CGEA 4MQLA 5M34A 3F46A 5BNIA 4DJTA 2WYUA 1OOEA 5AM5A 1CPYA 5D87A 1PGQA 4KZKA 4BB9A 2IPNA 4NNOA 3W4JA 2ODEA 3F6CA 3WNBA 4PONA 1PQUA 3PDWA 1ORRA 2ZSDA 1CRPA 2M2IA 4X95A 4JXKA 1ID1A 4MKGA 2V6IA 2C20A 1N2OA 2AQKA 3KT8A 2P1RA 2PUTA 2HEGA 3UJPA 4BP1A 2HBYA 3VKHA 3ZHXA 2G71A 2J7PD 4MYHA 5LP6A 1J1ZA 2ZTUA 1UZUA 1YZLA 2C3OA 1DIBA 3R44A 1Y7IA 5DVZA 5SZIA 4DIMA 4HX2A 4EGJA 1I80A 3PNYA 4CMIA 4PFJA 1Z29A 4FS8A 4ZA2A 4ZVVA 4FM9A 4AN1A 3S81A 2G9NA 1AQYA 3GA7A 3IERA 3AEZA 3FIUA 3OZ7A 2HK8A 4RGYA 4RK1A 4B32A 3HBAA 4JC8A 1T9BA 4BJHB 2G8NA 3KZXA 4N39A 5E9AA 2BHNA 1K5DA 3NIFB 1L7NA 2A5LA 4HBGA 2IY8A 3L84A 4PNZA 2WVAA 4M88A 1V2GA 4AZSA 4AKTA 4FXOA 4WCFC 5GZ6A 2ZXEA 2V4UA 4O59O 3W2EA 4DR7B 2RHWA 1XKLA 2COEA 2I34A 4MITA 5DN9A 1HLFA 4OBWA 1QTRA 3MT8A 2WYHA 3BJEA 1VL0A 1XDGA 3FCEA 4IIVA 3HYTA 3A9SA 4CYMA 4EHIA 3HSKA 5F51A 2B7BA 1J21A 2WJJA 5CUQA 5DW0A 3ZXIA 3U3RA 2ZIUB 1KS2A 2VK1A 4MUBA 3W1EA 3MN1A 3PPVA 4YAEA 4EA7A 2WHRA 1PZMA 4IAOA 4YT2A 2XTNA 5K3AA 4QBKA 3VDQA 1TYCA 1M5TA 3HQ4O 4IXTA 3JQ9C 3L07A 3QBTA 1QQ7A 4AUNA 3S1AA 1NVGA 2PZKA 4V0MA 3KQYA 3QMVA 4UEJA 4Q4HA 3SS7X 1TKBA 1KR5A 1UBLS 2A0FA 1ZM4A 3AB3A 3IOEA 3FWNA 4NENB 2C0PA 2UYHA 4B7UA 5ILGA 4YP7A 5KQSA 2HYDA 1HETA 4MR9A 4M22A 1H05A 4X6UA 5FL3A 1RPTA 1J0CA 4D26A 3AOEC 3V6LA 3TR6A 4BO8A 2YJGA 3CLUD 2QY9A 3EWNA 2OGWA 4XCVA 1G3IA 2VUIB 2VXOA 2JATA 5FOUA 1W94A 1X87A 1XVUA 4XSVA 5G0UA 3QE9Y 1Q1BA 1TMKA 2I71A 4KN6A 5A9SB 5AVVA 3OLXA 1N5MA 3IIEA 2ZYGA 1X92A 3C3YA 2AJTA 3AQIA 3NDJA 4Y7CA 1N5KA 2WFZA 2XVZA 1ZINA 1HYQA 2GFHA 3I2HA 1MW9X 3AM5A 3IT2A 2BP7B 1LKZA 1SHUX 4FEYA 3SXJA 4NHEA 1DQRA 2ACEA 3M9LA 2OSVA 2PRSA 5G02A 3BE4A 1LNQA 2HSGA 2C1EA 1QH1A 1JHZA 2ATXA 2LDXA 5JAMA 3FROA 3KQSA 3RIGA 1FVXA 1U2SA 1V26A 2QTAA 1J0BA 2YXNA 1NQ5A 3HI4A 3IUSA 4JX9A 4Q18A 5F4BA 2YZNA 1TTHA 2X2OA 1DSSG 1JNXX 2BFFB 2QSYA 5FHQA 1VKNA 1Y7HA 2JW5A 2XWJI 2OV2A 1DC6A 1WETA 3DT8A 3OA2A 2FDCA 4UUBA 3U4GA 5E2AA 5FWAA 4BGUA 2N47A 4N41A 2WPDD 1FCJA 3EJ6A 1NVAA 2R7KA 4ZXPA 1MNQA 4EHJA 3EXAA 1B1AA 2LWIA 2Z57A 3GWGA 3MK31 3N53A 3O82A 4NCKA 3HN6A 4UMDA 4C22A 3FUWA 3B78A 2EP5A 2Y99A 2AR0A 2C84A 3VPXA 4R1UA 3VOSA 1EK1A 4RQAA 3TB4A 1SUFA 5KKCA 1W36C 2QLLA 5BOSA 5GGYA 5TPWB 4NPCA 2QG9A 2C7VA 2QS9A 3V8VA 4BUZA 4N7RA 2FEXA 4Q9JA 2MINA 4MGIR 3DR5A 2AD1A 4BJ1A 4ZYZA 1E1QD 3SSOA 3W4IA 3T5MA 5MDHA 2YHBA 2GK4A 3EIXA 3NHPA 1QAOA 3B1XA 3ADCA 2QAGC 1BH2A 1ZUHA 3JQRA 4FUTA 4OXIA 4Y1RB 4YMIA 4EPTA 1T3GA 4KFUA 3WWPA 3FG9A 4IDCA 4B8ZA 1J00A 1ABFA 1C8BA 4L8FA 4M0UA 4ZAWA 1KSGA 3TB6A 3VKWA 2X5JO 4B2PA 2HJGA 3E8MA 1FOEB 3NKVA 1LSJA 1NNUA 3HI6A 4NZMA 5EAIA 4C5BA 2BOVA 3V5NA 1HDZA 2O07A 3KHUA 3GT0A 3K2QA 3OT1B 4YONB 3I2FA 1E1CA 3B20A 5G1OA 4ENWA 1CQPA 3PLRA 1Z5UA 4Z3OA 1ENOA 1CZNA 4YHHB 4QNNA 2B7LA 1Y3DE 2Z8XA 3JATA 4MGEA 1UPFA 1YVUA 2EHJA 3EG9B 4QVGA 4PS0A 3T35A 1KP2A 3JS5A 3R3JA 4G4SP 5JMPA 4N47A 4O2AA 3ENZA 1YKGA 3G8BA 3VYSB 1CUGA 1ZD9A 2HLPA 2VKTA 2CL7X 4BGVA 2W58A 2FQQA 4M1WA 4OHBA 4YJFA 5G4KB 1P9WA 1T0JB 5ELLA 1UOEA 4IQ8A 4XB6B 4GC5A 1V4BA 2PKQO 3SCZA 2QW8A 5DXFA 1U1EA 1XTJA 3R3UA 5A06A 1TKAA 4D9KA 3O91A 1PCXA 1UWKA 4GPD1 5J4HA 5DU2A 2VWGA 3M6FA 4J1NA 2GXQA 2AWOA 1DAGA 2HBZA 2XYQA 2OYSA 2PUWA 3CC8A 3F7MA 3H3XA 3PF9A 1ODFA 2RGGA 1J5EB 1KI7A 4NZ9A 1V6CA 1RQ7A 3ITEA 4QOGA 1P4JA 2CLHB 3BJMA 3PT9A 5EI5A 5JSYA 2ABWA 3CNBA 2WYWA 5K6RA 3N07A 1D4AA 3VC1A 1NNEA 4ALIA 3C8DA 1TVKB 2E9SA 1DS6A 4MQ5A 4QOFA 4ZIRB 2VJMB 4XWAA 1IRIA 4LVOA 5KPJA 1GRQA 5UKDA 4C7KA 2X5KO 4JJZA 3AU9A 3G5UA 2Y1OA 4Y8VA 2LCFA 4K3VA 1JLHA 4L5CA 1RWNA 3WLRA 2JIDA 1GIAA 2ODNA 1Q0QA 2Q4DA 3KR1A 5DGIA 5DV9A 3T7KA 4Z49A 1HYBA 4IOLA 1U0NA 4KPUB 1EK0A 2BEWA 3MT0A 2H31A 1QG2A 2PS1A 2B21A 2XUJA 1U0FA 1YR2A 2JIMA 2I3ZA 3CVXA 3LCRA 1KEEA 1Y8RA 3EZ9A 1E9DA 1YB7A 5DNWA 2VTKA 4EDFA 8GPBA 3UMGA 4U0KA 4RMHA 4N0DA 5F76A 2NU7B 2JCXA 1G41A 1LY1A 4B40A 4QYIA 3AY3A 3BK1A 3JW8A 3LXRA 1LI4A 2Q3CA 3MOIA 4YP9A 4WVLA 3CH6A 3ZZMA 4AMBA 4KP7A 3O5AA 5HWSA 5DHFA 3ETHA 2Z4TA 3DONA 2CVOA 1XI2A 2X2EA 3CZ4A 3ZLBA 4O1MA 8AT1A 2ZUTA 5HKKD 4OGFA 4KXQA 1HDEA 4GPBA 2OHGA 2R6CA 1DX6A 1OV6A 1XTVA 4X7BA 4YPOA 3A0RB 5IABA 3P9NA 1AQNA 1P3Y1 2F3QA 2VXYA 1R6DA 1VJTA 3AUKA 1CVIA 4JVOA 2GZ2A 3E82A 3NPAA 4D02A 3NMUF 2UUBB 1U5BB 4NZNA 4CFSA 2JLRA 3N2NA 4MVJF 2EJBA 4KACA 1VL6A 1SCNE 1Z0JA 2ZR7A 2QRJA 3WGUA 4IO1A 5IUJC 1UMDA 4K2AA 4RD6A 4JIMA 4EYQA 1PJAA 3FCYA 2CJFA 5C3MA 2XIJA 4L15A 3G0BA 3RTGA 2A0XA 1IBMB 4QNRA 5ESWA 5B3AA 5LP6B 1G8SA 1J5XA 4X3OA 5E1MA 2DPMA 3OJ0A 3ROKA 3UCEA 4Y9DA 5H9WA 3S2SA 4HQRA 4DNPA 4IKEA 4P7BA 1EFRA 4KR0A 5FTLA 3O84A 3SBXA 1KFBB 5I9TA 1L5HA 4CMIB 3V1KA 2H7YA 2O8DB 4N4AA 2P6OA 2W2LD 1C3OB 1NU6A 5BMOA 1UMCB 2CSXA 5HDBB 5AP9A 3STXA 3HB4X 1O94A 3QVJA 4LYJA 2QUBA 2V3VA 3I04M 4OO3A 4BB6A 5CB4A 3E35A 4OSOA 3GELA 1IMJA 4UHEA 4JI6B 3O0TA 2CMHA 1E66A 1X7XA 2NUPA 2QJOA 2ZJ0A 4YT8A 3AVXA 1GSHA 2DUNA 3GFFA 3LZDA 1YA6A 1G0OA 3NORA 3ZCUA 4HB3A 2N0SA 1S1MA 1AZSC 2PS9A 4HAZA 1Z37A 4IDBA 4K3UA 4D0LB 1XKTA 3V2UA 4X7RA 3QLUA 2A0UA 4QGSA 1HEUA 3TSOA 3V7YA 1Z63A 1EM8A 1OXSC 2GX6A 3I2IA 4ILEA 3Q8LA 2FN8A 2IVZA 3KL2A 4BJ5A 5JC1A 1EWQA 3AUYA 2QUAA 3KJGA 2QI9F 4HRAA 1ACLA 4NJOA 2C42A 4HP8A 4ZVRA 4X8HA 4BB5A 1GYPA 2ZRDA 1U8CB 3VR6A 4M87A 1NF9A 5B6IA 4OKIA 2B0CA 3AR5A 4OFWA 1FSZA 2ERXA 4N5IX 5T4HA 2VQDA 3S1AB 1XMVA 4R2WA 2QXYA 5TX7A 3EJWA 3RC2A 1P1KA 5JH7B 1JVNA 1NUSA 3K2EA 3MHPA 3JR3A 1PLKA 4XSGA 4B3TB 4L78A 3RCBA 1H9BA 4QQNA 1XQ9A 4PF1A 2B5OA 4YB8A 4MLCA 1VKHA 3GLHA 4NXMB 5FUXA 4QGBA 3WLQA 2EKLA 3L46A 5AJYA 4TYPA 1O54A 4Z54A 4NCXA 4GX2A 1N6KA 4B4UA 3A0UA 3JPWA 1QB7A 4V03A 3R9WA 1YS6A 3W5UA 1V25A 1YSCA 2VA8A 5FO0A 4UJ5A 1J42A 3WIUA 1NP6A 1T5SA 2WP0A 1VBKA 1YMUA 1NRIA 3GLRA 4OHYA 2JJ2A 4DEYA 4OYLA 3KYJB 4Q4CA 5JSUA 5C34B 1P6XA 4IH4A 3CF6R 3U60B 2BMAA 5FA8A 4AXBA 4B48A 3CCFA 4IJMA 4JLBA 3RSSA 4PYKA 3K7EA 3KR0A 1EK6A 4WCDA 5EP2A 3IP7A 1ILEA 2UUOA 5GM1A 1QH1B 4Q9NA 1E89A 1G5IA 3MERA 4UM9D 3WGLA 5TPZD 4P4LA 4UD6A 5F7OA 1QUFA 3L6UA 3I4FA 3HY3A 3RE1A 1VG8A 2P2ZA 3EH1A 3ZZ0A 1LGYA 2IGBA 3WWEA 4BDSA 2ZAGA 4MUJA 3F5FA 4BY9E 1H5UA 1JQ5A 1R8SA 3OQPA 2R9VA 1AGNA 3FTCA 4AYTA 4HR7A 3T9CA 4TN5A 3KXPA 5BT8A 2ZR8A 4MCHA 2A9OA 1JDBB 4HB2A 2D5CA 1ANKA 1QZTA 4B44A 1VMKA 1PK8A 4CV2A 5CA0A 1V7QA 4L5YA 5A9RA 4YH1A 1T5OA 3ACCA 3AEQA 1FSPA 1W2GA 3QP9A 3O9VA 1JBKA 4IVNA 1XHLA 1NYLA 2X0JA 3DD1A 4H08A 3I9LA 3PHHA 2HEIA 1T6NA 4PW0A 5F23A 1SQFA 3KT6A 3TD2A 2XD4A 3ICOA 2MR6A 3MWJA 1ZVJA 3UK0A 2G0AA 2BH2A 2YIJA 1LWNA 3KLOA 2I6SA 5L3VA 1QKKA 4ZT4A 3CF2A 3VR5D 2HF2A 1QUEA 1O95D 3TCXB 1I4WA 3GHHA 1L0BA 3HY4A 4GR9A 1JQEA 4I4TA 3WI7A 4PZYA 2X9VA 2IPXA 2XXBA 2PFGA 3OZIA 1M2VA 3NPMA 2H9AA 3N2ZB 3B2EA 2JAUA 4N6NA 3KPUA 3TLBA 1KMHA 1WQ1R 4D3FA 3FF4A 2HHJA 4M7RA 1EAYA 1ZICA 1KS9A 2FR8A 3GZTB 1QP8A 3DMHA 5KNCH 4OF4A 1BS9A 2YZ2A 3JQ7A 1XJQA 2HXSA 1QRUA 4NCIA 1ZGCA 3NBMA 3OLQA 4XLZA 2I29A 4D4MA 4UTRA 2V54A 3CCCA 4IJVA 1JH9A 3FTEA 5A4DA 5BWNA 2QL6A 4WPGA 5AJZA 4DEXA 5BV1A 3EGWA 2BCJQ 2REOA 2ZBEA 5HE9A 4DLPA 2O5RA 2PGXA 4HXGA 1AHPA 3HU5A 4L0QA 3LO8A 3DV0A 5INTA 5ALIA 4QJ5A 5CHEA 4MDHA 1VHTA 4RKFA 1DU4A 3RVPA 3U48A 5E7IA 5CFPA 3S44A 2LRHA 2GPYA 1G5QA 3RV3A 4JV5B 1TLFA 5ARDA 3TIXB 1IN1A 4Y2XA 1K1EA 3ZBQA 4C08A 1YUNA 3MWKA 2E6UX 3Q6IA 5J9FA 4PGAA 3D81A 4ZGWA 5BORA 2JIZD 3V1TC 1U6IA 2J9RA 4U6QA 4LZNA 3QEOA 4FZJA 3MJRA 4RZSA 2IEIA 2A3RA 1RIIA 2QX9A 2EW2A 5DP2A 2RHTA 2Z56A 3QXGA 1PFUA 2FGKA 4ETMA 2XKAA 2D1TA 3DE5X 3GXOA 2PSSA 3LT4A 4JQCA 4RXTA 1Y4DE 4ZVOA 3SIXA 4EKYA 5KDOA 4ZHQB 3K5WA 3IQXA 2QYSA 2IH4A 3HK2A 2XF2A 1O87A 2YWJA 1M0TA 2FOLA 4U5XA 3QVTA 4OK5A 4KHPB 1CS0A 4QECA 3ECSA 1CIVA 3FH0A 1C41A 4MW4A 5PNTA 1OB2A 3KTAA 3MF4A 3O8QA 3QI7A 5BSWA 3COPA 4GW3A 1U1GA 2EEPA 3CH5A 3EEQA 1FBTA 2FU5C 5EMJA 1JWLA 2XA2A 4N5HX 4FINA 1QBGA 3NOOA 4ZOLA 3TEMA 4QLOA 3DSRA 1M2NA 1JLKA 4EBBA 2ORVA 2HV8A 1VG1A 2BFOA 3HP7A 3ZK9A 3TG8A 4HLDA 1NTOA 2RGUA 3IJ5A 4LZPA 4QBIA 2W6NA 4BRZA 1XX6A 4ZAXA 4RZUA 1KH3A 2PX2A 2YIDA 2QZ9A 2DBRA 1KAHA 3KZMA 1KEEB 1N4AA 2Q4OA 1TD1A 4HNRA 4JXJA 1YB1A 3L6DA 4J07A 1E6CA 3PDIB 1KZHA 3SMQA 4PYMA 5LQDA 2OD2A 1BD4A 1WX1A 1UPAA 1E9BA 2JGDA 4UZFA 4QYIB 3PDJA 3UKOA 2FPMA 1I7LA 1RI3A 2FAXA 5ALVA 4OGLA 1HZZC 5KNLA 2RHRA 5HUJA 4K6KA 4HAUA 1A9XB 4KR9A 2O2DA 3WLLA 1KMIY 3SF8A 1JMYA 3WRXA 4EF5A 3HCPA 1Z4JA 3FI0A 2RG7A 1HE2A 2H06A 1QIJA 1T0PA 2FPOA 3KJZA 4Y2YA 4KX5A 3WMGA 4CV0A 5IAGA 4DQUA 1SBHA 3SLRA 1EA5A 1JQJC 3DNPA 2D0DA 3LT0A 3E8SA 2QN1A 3ZY3A 4EWLA 2QQFA 3WBKA 3VX3A 6LDHA 1PWZA 1QFZA 3ELBA 4QXRA 1KFCB 1B16A 1QGAA 3NVAA 1PJTA 3IAM6 1QYXA 5AUPB 1TX4B 5BYJA 4DMMA 3IA2A 1I7SB 3UN1A 3IQGX 3RU3A 4Z9YA 2OC9A 4YMLA 5K2OA 2QB5A 2C1XA 3GVHA 3OI7A 4NBKA 5IKOA 3K4QA 3LZ6A 2NSJA 2BT4A 3BXZA 1BTOA 1M73E 1T9AA 2PGLA 3FNFA 3I53A 2DPHA 3QUSA 4JLPA 3B1ZA 5DBFA 4DSAA 4LQ4A 4RABA 5E95A 3P9RA 1QC5A 1HGXA 2VLBA 3OY2A 2V0CA 3AZQA 4X71A 5LVAA 2IQIA 1MQAA 1EFAA