3H4TA

Chimeric glycosyltransferase for the generation of novel natural products - gtfah1 in complex with udp-2f-glc
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
397
structure length
390
Chain Sequence
GVLITGCGSRGDTEPLVALAARLRELGADARMCLPPDYVERCAEVGVPMVPVGRAVRAGAREPGELPPGAAEVVTEVVAEWFDKVPAAIEGCDAVVTTGLLPAAVAVRSMAEKLGIPYRYTVLSPDHLPSEQSQAERDMYNQGADRLFGDAVNSHRASIGLPPVEHLYDYGYTDQPWLAADPVLSPLRPTDLGTVQTGAWILPDQRPLSAELEGFLRAGSPPVYVGFGSGPAPAEAARVAIEAVRAQGRRVVLSSGWAGLGRIDEGDDCLVVGEVNHQVLFGRVAAVVHHGGAGTTTAVTRAGAPQVVVPQKADQPYYAGRVADLGVGVAHDGPTPTVESLSAALATALTPGIRARAAAVAGTIRTDGTTVAAKLLLEAISRAKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycosyltransferase GtfA, Glycosyltransferase
publication title Chimeric glycosyltransferases for the generation of hybrid glycopeptides
pubmed doi rcsb
source organism Amycolatopsis orientalis
total genus 135
structure length 390
sequence length 397
ec nomenclature ec 2.4.1.311: dTDP-epi-vancosaminyltransferase.
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4tA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4tA02
1EM6A 4GPBA 3ZCRA 1XOIA 3D0RA 4GZ3A 5BNWA 1Y8ZA 2QLNA 3S27A 4NEQA 4RELA 4FZRA 2IEGA 2GT1A 1FTYA 3G2NA 3L7DA 1L7XA 1NOJA 2ASVA 4BFCA 3TSAA 3TOVA 2KS6A 4MI6A 1NZDA 3COPA 4YI3A 3ZCVA 1QKJA 3RSZA 1NOIA 1UQUA 3DDWA 2XCUA 2X0EA 1E1YA 4W6QA 5JTUA 4RENA 3RT1A 1FA9A 1PSWA 5C1DA 1AXRA 5JTTA 1K08A 2PQ6A 2GPAA 3NAZA 3T7DA 3HBJA 2VSYA 4RIIA 3SYRA 4WHMA 2XMPA 3MS2A 6GPBA 2GEKA 3MS7A 3MT9A 2QRQA 4M60A 3Q3HA 3NB0A 1PNVA 2ECPA 1P2GA 1P4HA 2FETA 3BEOA 4GZ6A 1Z62A 3CUYA 1FU4A 4WACA 2BFWA 2IV7A 1C50A 4MHSA 3UYKA 3H4TA 1P29A 4AN4A 4EL0A 2XCIA 1JG6A 2FF5A 4GYYA 2QN9A 1JIVA 2AZDA 5GPBA 2AV6A 3CEHA 2G9UA 4KQ2A 3MBOA 2X6RA 3MS4A 3DD1A 2ATIA 2AW3A 3OKCA 3VUFA 2IUYA 2O6LA 4RBNA 2IV3A 4YUAA 2ZB2A 4RIEA 2C1ZA 3CUWA 9GPBA 3HBFA 1NVKA 1E4OA 3CUUA 3QHPA 1FTQA 5TVGA 4RIFA 3Q3EA 4LDPA 1P4JA 4HWGA 1RZVA 3NPAA 1LWOA 3OTHA 1JIXA 1A8IA 3G2LA 3OKPA 1L5WA 3NP7A 2C9ZA 3ZCTA 5IKPA 3CEMA 4AY6A 1GGNA 2WTXA 2PYIA 3C4VA 4Z5XA 2YJNA 1Y6FA 1UZUA 2F3UA 2X6QA 4N3AA 2QN7A 2QN3A 3VUEA 1AHPA 3OT5A 1LWNA 4XIFA 2VSNA 1Z8DA 5D01A 3GPBA 3T3EA 3T3HA 1GZ5A 3EBPA 1C8LA 2R4TA 2VCHA 1WW2A 3G2JA 2P6PA 3WC4A 4F96A 5TMBA 4HLNA 5DLDA 4F9FA 1GPAA 1JEJA 3RHZA 3MRXA 4NC9A 4BQFA 3MTBA 2XGMA 2PRIA 3MT7A 5DXFA 1RRVA 1Z6QA 2VCEA 3BCUA 3T5TA 2GEJA 1HLFA 1C3JA 3O3CA 2PYDA 2G9RA 3DZCA 2XGSA 3Q3IA 5LQDA 1XKXA 1FTWA 5DU2A 5D00A 2QLMA 4MICA 1KTIA 3BCSA 4LEIA 1WW3A 4CTNA 5IKOA 2Q6VA 3G2IA 1FS4A 3S2UA 2G9QA 4AMBA 3NCHA 2GPNA 1SXPA 4N9WA 4N3BA 1FU7A 2VG8A 3E3OA 3OY2A 4BQIA 5I45A 1PN3A 2ACWA 1L6IA 3MSCA 3C4QA 2F3QA 1FC0A 5ENZA 1XC7A 3BD8A 1IXYA 3OKAA 1EXVA 2IW1A 1L5SA 2QLLA 3CUVA 1XL0A 1GPBA 3TAXA 3SYMA 3MQFA 4N3CA 3OTGA 2JZCA 2XGOA 3BDAA 3E3NA 1M5RA 5HXAA 3EBOA 5TMDA 2AMVA 1L5VA 4GZ5A 3L7BA 4X7PA 2XA1A 4BQEA 2H1FA 4QLBA 1ABBA 1NLMA 2HY7A 3DDSA 2X0FA 4MHOA 4KQ1A 2BISA 2QNBA 3D1JA 4RIHA 3WADA 2F9FA 4CDRA 4CTMA 3BD6A 1XL1A 4AY5A 3CX4A 4L22A 3MRTA 3PE4A 1YA6A 1F0KA 2QN8A 3IAAA 2BGTA 4X7RA 2X0DA 1WV0A 4WADA 1P2BA 2QN1A 3MTDA 2SKCA 2QRMA 3HBMA 3NC4A 3OTIA 3G2HA 4EKEA 3T3DA 5TMEA 1YGPA 2ACVA 2SKDA 4M7PA 1BX3A 1QM5A 3L79A 4F97A 1XV5A 1WUTA 3MRVA 2JLBA 3NP9A 1WV1A 4MI3A 2GJ4A 1IIRA 4N39A 2QN2A 1P2DA 2QRGA 4RIGA 3RSCA 3S28A 3T3IA 1NOKA 3CEJA 2SKEA 1L5QA 3G2KA 4X6LA 3L7CA 4MRAA 4XI9A 4G2TA 3ZCQA 1SXQA 3E3LA 3CUTA 3VDNB 1GFZA 2XA9A 1PYGA 4CTOA 1VGVA 2H1HA 3UYLA 1Y6GA 1WUYA 3L01A 2GM9A 3H4IA 1GPYA 1C8KA 2R60A 1L5RA 2QRPA 3WAGA 1K06A 1FU8A 3IA7A 1UQTA 1P4GA 2IEIA 1Z6PA 3C48A 3QKWA 3VDMA 3S0JA 3ZCPA 2R66A 3FROA 1B4DA 2XA2A 2IYFA 3S29A 2FFRA 3AMVA 2GPBA 3PE3A 4EJ2A 3T3GA 2C1XA 2QZSA 3BD7A 2JJMA 1O6CA 3D0QA 3HBNA 4GYWA 2R4UA 4YI5A 3OY7A 1RZUA 8GPBA 2IYAA 3CV3A 1V4VA 4NESA 1GG8A 4EKYA 4EL5A 3L7AA 2F3SA 3ZCSA 4AMGA 3MTAA 3GUHA 4PQGA 2BGUA 4FKZA 2R68A 4M83A 3MT8A 2C4MA 1JIUA 3BCRA 2OFFA 1F6DA 1JG7A 4REMA 3ZCUA 7GPBA 1NZFA 4KQMA 2F3PA 1J39A 1H5UA 2G9VA 4X7MA 2PRJA 2QRHA 4MI9A
chains in the Genus database with same CATH superfamily
1HL3A 1GL6A 1N1EA 2ZJOA 3G59A 4C7KA 2V7PA 4O33A 1NFFA 3BIXA 1HYHA 4H3VA 4U4AA 1KDYA 5IVIA 1HYQA 3FFTA 3OOJA 3QVMA 1ZKDA 3KTOA 1KY4A 1KY2A 4FWIB 1UZMA 5AOVA 5ENVA 3TLGA 4ZZ3A 2FPKA 1IPEA 1AA6A 1N6LA 4JJFA 2P3SA 4WLVA 4YJ2F 3R7DA 3I4FA 3KXIA 3HJGA 2YBDA 1YQDA 1ZMOA 2DX7A 1FTGA 3AI3A 3E9DA 4TN5A 2ZQZA 4WDQA 5F2KA 4BLSA 1J0DA 1G4HA 2XZPA 3LCMA 4GOMD 1L7XA 4WT7A 5KHLB 1ORVA 3K9FC 3O6VA 3AZQA 4P8RA 4GDMA 2W2QA 3GFPA 3SKXA 3TSAA 4NP6A 2Q7XA 3LC2O 2A5DA 3CF6R 1X80B 4FFRA 4DM3A 1AZTA 2MSNA 3DLCA 2YV2A 4HAOA 1RLMA 1M74A 5IH3A 4Z2YA 1L5FA 1OLXA 2HFJA 4ZU3A 2DQSA 4DDKA 3F6PA 2VHUA 821PA 4LOKA 1PKEA 4MR9A 4PG7A 4LV8B 2IHTA 2YWGA 1EWVA 3JWEA 3C6QA 1XZGA 1XJ0A 3FWZA 2DQYA 3I1JA 1LRJA 2R1TA 3AR5A 4EG5A 5F1OA 5FKJA 1PQWA 3I5AA 4RD6A 1CT9A 1CUZA 1WZUA 2GPAA 2V7QA 4KLCA 5CYPA 3TQFA 3DLBA 5ENDA 3SIPA 3EGXA 3VH3A 4B6PA 3CR8A 2DR3A 3HBJA 4OXNA 4BJ6A 1G8YA 4NXMB 1XRSB 4O3MA 4MAMA 4RK7A 1LI4A 2QORA 2VDRB 3L4BA 3AHDA 2WKWA 4XYMA 4IFEA 4Z4HA 1O77A 4ASUA 5IVHA 5EJ9A 1EGQA 2BFAA 3SYTA 1T6BY 4BYMA 4KG7A 1FRVA 4C03A 4C7BA 2CD7A 3VPHA 5MGBA 1PNVA 3BZBA 3CRRA 2A3RA 1P3DA 4Z9XA 1UBUS 3L1VA 3P27A 4JVMA 3ZTWA 3GGPA 4WZAE 3HP7A 3WHLA 5FNVB 2P4EA 2WVHA 4TMZA 4HDNB 4JHLA 3VR4A 1QYDA 3CTMA 3UF0A 2Q5QA 5K8IA 4MPPA 1C9JA 1EXMA 3O84A 3GG2A 4GBGA 2DQKA 1P6UA 1CY4A 4BLVA 5HUJA 1ONBA 3SVLA 3ZHUA 2FWMX 4L0DA 4CLXA 3GOQA 1OYYA 2BM0A 1P1RA 1X74A 3W3ZB 2N46A 4UFNA 3LKVA 3HN6A 3ONNA 2OXIA 2NQTA 2XT6A 1DSSG 2AUMA 4RSMA 1DBIA 1QK3A 1RAIA 3B2EA 3T5GA 4R3WA 2EFGA 3DNFA 3MK31 5LWQA 5HBRA 2NU6A 1G6Q1 3C6YA 4QPJC 3UICA 4YPVA 3QK7A 3TQSA 2I91A 3DONA 2E37A 9ATCA 2EGHA 2H0QA 4H6WA 3BB3A 1YRYE 2D5CA 1FFCA 1RPJA 1SHUX 4L95C 4OKSA 3NKFA 4Q18A 3SLRA 2Q99A 3GMSA 4D44A 2JFUA 2OBYA 3EMKA 2PGJA 1KI6A 2W4QA 1JEYB 2HUPA 2FPGB 4PLPA 1X42A 1NM5C 3RK0A 2AXEA 4JB3A 4KLAA 4Q47A 3FUWA 4NS4A 3M6IA 1Z7GA 2C9OA 2YYAA 1HT1E 1WA5A 4M98A 3O9VA 4X93A 4MV1A 4WW0A 1J2RA 4MAFA 3OECA 1XTTA 5DT9A 5DT2A 2ZUEA 2RFLA 3ZHCA 3B3FA 1W88A 3ZY3A 3CW2A 3FB4A 3KKPA 4G97A 4B47A 3RAFC 3DEAA 2PK3A 3CUUA 3DVAB 1VFPA 3GJZA 3V8PA 4BU1A 2CL0X 2FOLA 3SE7A 1K7SN 1AKMA 5IDQA 4JL6A 4OBWA 1VMDA 2DWCA 2N9UA 2V5VA 3GCZA 4WZAB 3JQBC 3DFUA 3T9BA 3L8GA 4NCIA 1DTWA 5CITA 4DG8A 1DFGA 4X1IB 1U3DA 3L9WA 5CX1A 3NPAA 6Q21A 1LWOA 3D2AA 3L4KA 4JZKA 2XOKD 4DEYA 3HDVA 4AZTA 1ZMTA 5HTKA 2GAFA 5EIHA 1HG0A 4BOYA 5IPFA 1MA3A 3KQNA 3IESA 2BFEB 3ZWDA 1Z0UA 2BEJA 1SC1A 3ZCTA 1U0OC 1OI2A 3NGXA 1VKRA 1H1DA 5K2MA 3AF6A 4MK4A 2CDNA 5BV8A 2VA9A 1FOEB 2JBHA 4UPDA 4WZ6A 5TGTA 2IYPA 4GMKA 1XQ6A 4U8HA 1TJ3A 2YJNA 3D0KA 1MOPA 2FU5C 2O3RA 4OMDA 1A7KA 2N75A 2X6QA 3ELYA 4UVEA 5FWXA 4RGVA 3UATA 3VUEA 5AQEA 1H3EA 2N47A 3VGPA 1GEGA 5K4HA 3DLPX 2JFVA 2YHSA 3HVHA 4UEOA 4WGFA 1NF2A 1TAUA 2ODQA 1M10A 4YAKA 5I8PA 1KY3A 3NRJA 4IP0A 1L0BA 3QRWA 4ZVNA 2IYQA 4EPXA 1KEUA 4NU5A 2F4NA 1CJVC 2Z8YA 3C5VA 3H3XA 4IYJA 2F43A 2O7QA 4HDSB 1U99A 3EHEA 5I9SA 4QLAA 4Z6KA 4CYMA 1Z7EA 2GR9A 2GBFA 2AMLA 2VYFA 2V7TA 4EHDA 3G2JA 2D1YA 2P6PA 4EYSA 2H31A 3II6X 3N28A 5ALGA 3NXSA 3R44A 3V7UA 4CLOB 4FZ5A 1E9DA 1CVLA 1RWKA 3OEEA 4MITA 2IQIA 4OXYA 4R9NA 1VCIA 4URZR 4WBNF 3B1XA 4GNKA 1DKLA 1RJWA 2DBRA 3LL4A 2WPDD 3RHZA 4D6YA 1UOPA 1V16B 2C5FA 3IDOA 1B6GA 1OFVA 2BUAA 3BZUA 2G4LA 2PLAA 1L3CA 3O90A 3QBDA 3MPOA 2DF8A 4BZPA 1ZMBA 3TTWA 5D7BA 1J24A 3FYUC 2D5AA 3T4PA 4A82A 1VXRA 4CMIA 4X44A 4Y0NA 1U81A 1EK0A 4DRXA 1W9HA 3GFSA 4K6MA 4LZPA 5AJVB 4M1OA 5AK6A 3UANA 4K3UA 4Q19A 3PEFA 2PWAA 1MC8A 4PRYA 1C3JA 2AWNA 2Q6IA 4YDSA 1Y5NA 4AG3A 4B17A 1YCGA 3NTRA 4OB8A 2CV2A 3NV9A 2VRWA 1IVNA 1MA0A 2NVWA 2W4MA 3FNQA 4RMGA 4BWGA 3DDUA 2VJKA 1BVRA 4RMIA 2C3UA 1AQJA 1EE9A 1VGRA 3ZWXA 5BUSA 6AT1A 1U28C 1D2AA 4JLJA 2CFOA 1ORIA 2D1SA 2PZEA 3O8OB 4MICA 3ZR4B 1P6QA 2J6HA 3QKRA 4H7HA 3SS9X 3SS8A 1V9CA 1V1JA 2NW6A 3ML1A 1JKIA 2CL6X 3OMXA 1XMPA 3CVUA 3K9GA 5EJ4A 4AMBA 1TJPB 2DRIA 3NCHA 1Q1AA 1MO6A 1LC0A 5B7PA 3DULA 1QG4A 1RLOA 5CXSA 3G85A 1K66A 2PN1A 1K0FA 1ISGA 3O3NB 4QPDA 3NHFA 4N0QA 2FUNB 4LJ4A 2VDJA 4UDNA 3UJNA 3VR3D 4KAAA 4UZSA 1R8SA 2CNDA 4M46A 2A0YA 5F5LA 3M0EA 1NBMA 1QKKA 4ZO4A 3ZYZA 4NCXA 4TXLA 1A98A 5DM1A 1JKFA 1T9KA 4FHCA 3V8QA 1CEEA 1NY5A 5FFNA 2QAGC 3KEQA 1E1DA 2HTFA 4IL5A 3UT6A 2YIMA 3EFOB 1M2OA 4RFVA 1L5SA 3RYIA 2I2AA 4Z1OA 3IEIA 2JC3A 4NFYA 1UMBA 4S1VA 4X9XA 3NQ41 4KQKA 3DV0B 4IIYA 4HDCA 5HUHA 3BXZA 1BVHA 4AJPA 3FJ1A 4O2BB 4YJ3A 5FBHA 4CQMA 4DR7B 3IKVA 2PS1A 5CFLA 2HJHA 3I4CA 2QQEA 1SOWA 2B98A 1XTSA 3VO9A 2PUCA 1Y1RA 2Y8EA 3IPLA 1NNUA 4LAFA 4BVAA 3D3KA 4RDXA 4AECA 3BRCA 4IIUA 1XVTA 3L06A 1CLUA 1TVKB 3QXSA 1DS6A 4A8JB 3P71T 1T5BA 1QR2A 5AVXA 1C0EA 1BOOA 5C51B 3B8EA 1VBFA 1ACLA 3BT7A 4E5KA 1U5BB 3GUUA 3INYA 3ZH9B 4IDGA 5EUQB 2GCPA 3FJOA 3CVXA 5H83A 4DUZB 1KNXA 1PFGA 4RDHA 2ZB7A 3SSOA 4BQEA 5B1IA 3O4JA 4QLBA 4B3XA 1PJAA 5ECWA 1SQSA 5KYTA 2R11A 2FZGA 1ISRA 3I6YA 4P82A 1MC5A 3DDSA 3MERA 2HCTA 3Q0TA 5ARCA 1TMGE 2IZOA 1NZJA 1GIAA 4KN8A 3GNTA 2BISA 1N0HA 1GHTA 4KKVA 3DUWA 4OJTA 3UWKA 2VF5X 5LA6B 3C8ZA 4Z0NA 3RSSA 2C2WA 1RJEA 5FL7A 5EJEA 3ILSA 5LIRA 3QEMB 3PC8A 4TWRA 3DMHA 1EWKA 2GASA 1D6SA 3GYGA 3O31A 1XQWA 3PE4A 3ZWKA 2WWFA 4B7CA 1JHRA 3I9V6 4U2GA 3EDQA 5HJEA 4Z4QA 4ND6A 2I2XB 1EWTA 1JPUA 2CF6A 1SZJG 4P32A 5DW3A 5DTJA 3VR4H 5A4JA 3DTVA 1MRNA 1M83A 4RSGA 3EZXA 1DG1G 1UBGA 1MO5A 1PFKA 3PDUA 4HCJA 3NM5A 4J0KA 3ELBA 3ICOA 3ZJ4A 1UM9A 5KTRA 1LVUA 2XNSA 5TLSA 1PVOA 1TF5A 4QECA 1UWKA 2K4MA 2H4FA 1WXHA 5BNFA 4RE6A 3T5MA 1XHEA 4OJYA 5KTOA 2PMKA 3TM4A 1D8TA 1KHHA 1TEVA 1E66A 1TJ5A 1X1RA 3QFRA 3FPSA 4IIHA 1ISJA 4EIWA 3KYBA 4HS9A 4DMRA 2O05A 2RC6A 2F2TA 4M7PA 1BX3A 2NUTA 1XJCA 4EB3A 1Y9AA 3PPWA 2JAOA 1R1DA 4WOKA 1O94D 4R4JA 2ACKA 3FGZA 4QJ3A 1GCIA 1O57A 1T25A 3FWYA 4M9QA 3O8DA 4TLLB 1OXVA 4OM8A 1PUXA 5J1SB 3GEDA 1NW3A 1E6KA 3EISA 3PPIA 3NFYA 2PMWB 3DEYX 1UOEA 2O0MA 2Q1SA 2FEXA 5E0KB 3RK1A 4YJHB 5GONF 4R2LA 1H0HA 3C24A 5LZ9A 1T2EA 1KK2A 4QASA 1SQGA 3PENA 3HXOA 4MGHA 1TIKA 3MINA 4O4HB 3LHIA 5HRAA 4ZHQB 1A1VA 3ZEIA 2KWIA 3EY9A 3H65A 3BXOA 2XKJE 1XHFA 2VWGA 3RYFA 5BXYA 3OZ7A 1FLVA 1LPSA 1MABA 2WSSD 3KJNA 4OHMA 3PHLA 1FRZA 4X6LA 5TIIA 5K0ZA 1QHGA 3BB4A 3L7CA 1UOOA 4BMPB 5B58C 3TRIA 1Z47A 4DYDA 4HQ0A 4NYJR 3SLKA 4H0CA 5G0TA 3PQCA 3W4IA 2D1TA 4FFPA 1KK0A 3L07A 3OO0A 2XI4A 1E18A 5DNDA 5JD4A 1E5DA 4B3BA 1HWYA 3TZQA 2WDPA 1GCOA 2KE5A 3FDIA 4JI1B 4TKZA 1FDIA 2Z8YM 1V8ZA 1WUJS 3NBZC 4MRSA 4D97A 3N05A 4NMLA 3FCYA 1J2JA 3A9TA 3TWOA 5FPKA 1U9IA 2Q4TA 4L5JA 4M0UA 4EG0A 1JA1A 1N3LA 1KOGA 1P3Y1 3JQAD 1L4HA 2FPLA 1CJKC 3QLUC 4UCXA 3ZJVA 3DOEA 1MB3A 4HQLA 1S3GA 4PGFA 1WZIA 5ADVA 3DLHA 2ZJ5A 3BTVA 2CCGA 4IDAA 1DPGA 4QJ5A 3TPCA 4LF6B 2GEBA 4JYBA 4WLUA 3WAGA 4FS8A 2HTEA 3P2JA 4TZ6A 3B36A 3ZE2B 1BEZA 1UDWA 1FDVA 4ND8A 3RC9A 2PS0A 3K0FB 1JN0A 3KBOA 4AROA 3I0ZA 2FN8A 3JV7A 2C8LA 4JHXA 4ZYWA 4GLFA 4RKEA 3J7AC 4D4JA 4EEZA 2YS7A 2WWXA 2GERA 1YB5A 1WG8A 2FVXA 2HUNA 5DPMA 2XPCA 2XITA 3H2SA 2YMLA 1M1YA 1Q0UA 3RS4A 3CLKA 1IFXA 1JDZA 2XTAA 2YFHA 3P0EA 2QZJA 3VU8A 5JXHA 1C9NA 4W5WA 1VL2A 4G6ZA 1LSSA 2H1RA 3W4JA 1DARA 1DWQA 2NZJA 2XYPA 3NHPA 1MB0A 2ZVPX 1CP3A 4LTNA 4EPYA 4CEJA 1LRKA 2CWDA 1H4QA 2X9GA 5KSPA 4KSBA 4YAIA 5AW3A 3ZE1B 3GA5A 1N4DA 1YDHA 2ANCA 3A06A 5GJCA 4RJKA 3HHPA 3OY7A 5KWIA 2GMWA 3VBCA 2IYAA 1TQ8A 1HY3A 3NUGA 4DLNA 1P1IA 3LC0A 1O8BA 4ZQHA 4DC1A 1RPNA 1UBJS 2R3SA 1J5PA 1RMQA 2Y2VA 1TM2A 3CF0A 3TQTA 1I4DD 1JTFA 3T0FA 5BVGA 1WETA 2XHEA 4CZ2A 2ZPAA 5EIFA 2J8ZA 4B76A 5LOVA 1EUDA 1JU4A 1MB4A 1L7PA 1OAOC 1TEXA 3HKBA 4LRXA 3ZV6A 3D4IA 5B57C 3QXXA 1FDUA 4I4TA 3L8YA 2PX2A 4Q4JB 1D2MA 3IRVA 3VDXA 2HU5A 2BEKA 4BEWA 2CHVA 2WVAA 5HJ5A 5AM2A 5KX5A 4F7WA 4K9LA 3U1VA 4ROTA 4D9GA 4K8OA 1AMNA 2YHAA 2YN0A 2OGTA 3A0RB 4ZCLA 3EOBI 1Y6QA 4KDFA 2HYDA 4BB9A 4TMXA 4BFSA 1B42A 2NQ8A 1S2OA 4C3VA 2YY7A 4NOKA 4LQLA 1E9BA 4MS1A 4QTXA 5INTA 2MMCA 4G56A 2VXYA 4REMA 1SUDA 5BWLA 2IPMA 5IM4F 2I8AA 1CY2A 4X20A 3ANMA 1U4OA 1NZFA 3PVZA 4INZA 1Q1QA 1AKUA 7GPBA 3CONA 1JRLA 4N01A 3RYCB 2JHFA 2IBTA 3ROFA 4I0WB 3CR3C 4XVUA 4RJJA 2G9VA 1ODKA 2J6CA 4ZC8A 1F8XA 1I51A 5HKAA 2PQ0A 2FFQA 4A0HA 1DKUA 1MT0A 1XEWX 1GDHA 3EH2A 3VNVA 3K09A 3MJTA 2OENG 2I1WA 4ZO8A 5EE5B 2ZUUA 2KBEA 3N3BC 4HRXA 5T41A 3VH4A 1EGVB 3RG8A 1T6ZA 3ZDAA 2XB6A 3CUKA 3WXBA 4GI7A 4BFZA 4RFSA 2EDAA 2FMUA 2DFVA 5AM0A 3AV3A 3C3BA 3F3KA 2YWJA 2Z09A 2P2CA 3NHZA 4ARUA 3RSLA 3GA0A 4V38A 4L1KA 2GUWA 3CVVA 2LIPA 2AE2A 4RHUA 1FEZA 2WG2A 1FRNA 2GF2A 3L4BC 3ZGZA 5ERYA 5DGXA 5T6BA 1Q0SA 4OFBA 1ST2A 2WF9A 3COPA 4L9WA 2UAGA 1BS9A 1PEDA 2WFLB 3OCZA 4RANA 2C2ZA 2XQJA 2NVUB 3W2TA 5E9QA 3VKGA 5CEEA 3IPXA 4ZZ1A 1PS8A 3JYOA 3RVMA 5G1PA 1VYUA 2VF2A 3EIQA 3AILA 3VTFA 1KPGA 3TKLA 3KUDA 1SQFA 2WVJA 2XDQA 2DERA 3H04A 4W6ZA 4AMUA 1F4PA 2WNIA 3EVBA 1PJTA 3T5AA 1UBHS 2B99A 2GVNA 4ZT2A 3ROMA 4DV1B 3GVPA 5K4GA 1CUYA 1GQFA 4H1HA 1SKYE 2XBMA 4P3PA 3O2JA 1K98A 5IVPA 2ZQ5A 3MS2A 2ZJ7A 5AXCA 1MO2A 2PEYA 1NUPA 2BBSA 1EEHA 2PWPA 3I76A 3L4JA 4AMYA 4CM8A 4RTPA 4D8XA 2VT2A 4B87A 3GW8A 1I3OA 1U1DA 1P39A 4XQ0A 1JE0A 2XQFA 3IBYA 4WLOA 1EA7A 3N9IA 4C1NA 3DB1A 4RVNA 5LXTF 2XOEA 3CT4A 2AZXA 5AW4A 3DEKA 2JLUA 3H5WA 4JMLA 5G0VA 1BRMA 4C2BA 2W2PA 2OCXA 1V5EA 1NG1A 3HUEA 3P9RA 1WPGA 2V98A 1NAHA 4GP9A 5KVAA 1KSHA 2KSQA 3NO4A 5LQUA 2FR1A 1Z5ZA 1KDOA 2IV7A 4F5DA 1C50A 2XIQA 3GOHA 1D4FA 3P9ZA 1CQWA 1LDEA 1MJHA 2PH5A 2DQZA 5I7HA 2R6DA 1MN6A 1RW4A 1TZKA 4LC1A 2NVOA 1U8TA 2Y1LA 4OGLA 5E6SA 3WGGA 3STXA 2EBHX 4BGUA 3HVIA 4C3UA 3KYCA 2YXNA 4ECAA 2PAAA 4DS3A 3H8VA 3RF6A 1KDTA 3E9YA 3P2EA 4I19A 2FQXA 5BYJA 1N0VC 3OD1A 3A10A 2DTXA 2ZE5A 4QEDA 1U1GA 1OLSB 2P3OA 4R6XA 3S7TA 1Z5GA 2CLLB 3GN1A 4IQ8A 4HTAA 1AIPA 5FT9A 3MCTA 2AC2A 2GKSA 4KQ2A 1HT3A 4UBMA 3V7WA 4OYRA 1T5IA 1XT6A 1RAHA 1CHNA 3DD1A 4G09A 3AFOA 3MXTA 1ZHOA 2X0IA 3ZY2A 2OFXA 2ADFA 2AZMA 3PC6A 5IC4A 1SKYB 4PEVA 4W4TA 1ACMA 1H2XA 2FW0A 3DHYA 3KSRA 5CXUA 4PV7A 2UYHA 4X3PA 2C83A 4B8ZA 2GZDA 1AURA 2J3HA 3C74A 1RJGA 2HRRA 3NBQA 4I14A 1C4KA 4I9UA 2XTZA 2PEZA 3WQHA 1XMOB 5F3WB 1SD1A 3BF8A 5GV8A 1QUFA 3B12A 4JQYA 4PZCA 5JZBA 1M0TA 3OTQA 5F5XA 2E1RA 3HC7A 4P4GA 2O8DB 1KZYC 4MWZA 3VMMA 4IX1A 4D9MA 2G1UA 3QEBZ 4OQLA 2PSFA 3AFGA 4I4CA 3FYHA 2J9YB 2JZNA 2HA6A 2P2DA 3TTVA 5LP6A 1P91A 2IC5A 1XZHA 3WWCA 3SY8A 4ARAA 2PL5A 3UY4A 4MNTA 2V6GA 5BN5B 4B3HA 3D4PA 1M6NA 4FOPA 4YMGA 2Q9UA 2ZT8A 1N2HA 3JZIA 3X1MA 1GLVA 2I1VB 3L7MA 3PFIA 1XTKA 5GOTA 3IMEA 1U0SY 1M0WA 5DSZA 4U7GA 5DM2A 4CXMA 1NRXA 3FPFA 5KB3A 2GI4A 2VRCD 1FK8A 3H3JA 4Z5XA 3Q5GA 1NDHA 1RLIA 3PB3A 1INLA 5EE1A 4BUCA 1VIAA 4HQNA 3SQXA 2M6RA 4X71A 1EVZA 1GPKA 5GTDA 4EBBA 1ZZGA 1SBHA 1RIFA 3ZE8A 2ZLBA 3IV6A 1VMEA 4MW5A 3FPEA 3IAHA 4Q3NA 3IOBA 2GN2A 3H7IA 3KSZO 4RS3A 1HDRA 3LA6A 2XMCA 3GDGA 1UMCB 3MJDA 1SXJE 2FZKA 5EMLA 4MYDA 1HDZA 3QITA 1S3IA 4HWKA 2R4TA 2VJNA 2IXBA 3I23A 4C2AA 2P9ZA 4LYEA 2APJA 3FCXA 1JU9A 3RSFA 4UM5A 1JR3E 1ST3A 4YMTA 1FFSA 5K0TA 4QYTA 2YCBA 3QVTA 1L1QA 5KVQA 1K8ZB 1J8DA 4BJ1A 2I99A 3DVQX 4BRUA 2I7VA 4J0HA 2D2IA 2ZR7A 5DHFA 1Q1EA 5BOSA 2H63A 1R18A 3D6UA 4Q9IA 2HI0A 1R66A 4C0HA 2JJ1D 1A27A 3S70A 2J3KA 3MGAA 5CHYA 3FNHA 2G17A 1YZ3A 4CGZA 3EC2A 3QKUA 4NY1A 1KZ4A 1LTKA 1SK8A 1TZMA 2I76A 5D7NA 4GC5A 1PFYA 1TA0A 4R8VA 3WSTA 1F3LA 3IQFA 1VCOA 1E0DA 4PC1A 1U3WA 4D02A 1JH8A 5EWMB 5IZ4A 3M1YA 3Q41A 5ALLA 1O03A 4B4KA 4EHKA 5K0EA 5EHIA 3TLMA 3AB7A 4ENPA 1XCOA 3SEQA 4DB4A 1FTWA 3IAS6 3HXKA 1TD9A 4N6OA 4CE6A 3RIYA 1VTKA 3JQPA 4DQVA 3BCSA 3PCXA 4FDUA 1WW3A 1T8YA 2DH5A 5IKOA 3FKSD 1XTJA 4QTZA 4UVGA 3R4CA 5E95A 3V4ZA 5BMVA 2O8EA 4BO5A 4NZ9A 3S2UA 1OH7A 4PCLA 1TZ2A 2ARKA 2VQ3A 6CHYA 2YIVX 2KMLA 3L5OA 1C81A 2JCYA 5KKAA 3E3OA 2JF0A 1E1MA 5EN4A 5ESDA 4KOAA 2QRZA 3UK7A 2MSDB 4MV3A 3WIEA 3FTNA 3NKVA 1YB4A 3BDVA 1SXJB 4D3ZA 3VOAA 4UMDA 4Q7JB 4LF9B 2MTBA 1KIMA 4LPKA 1JJVA 1J8MF 4DY6A 4YALA 4AKGA 2XXAB 3I6ZA 4UM8B 3PWKA 3AK4A 4FQ7A 5E7QA 3S2EA 1CXZA 1JDTA 4M9SA 4KR9A 2FAXA 1Z4KA 2HNKA 4PZAA 1IQPA 3CUEF 1JDUA 3NAMA 3RARA 3UENA 1O96A 5U1PA 1XSEA 2GK4A 5HJ2A 3PNBA 4F1JA 2G1JA 4QXMA 4N3CA 1AGYA 4DJEC 5JNWA 1G5HA 4WESB 4DLZA 1WD5A 2HLNA 1OW3B 1OF1A 1OWMA 3R3UA 4LHWA 4NFHA 4Y2PA 4OLHA 4B7AA 3DBHB 4U9UA 4MARA 3RSQA 4GDFA 1NMZA 5BSWA 2J0UB 3W5CA 5K05A 4M9UA 4CI9A 4RM2A 1XZQA 2I7TA 5DBHX 5L3RA 2HA3A 3PEVA 3TQOA 3PR1A 3Q9LA 2ON6A 3ZV5A 2A1UA 3A1TA 3CNEA 3EXIA 3KEMA 3CQ9A 4XYEA 2EQAA 4LRQA 5KMGB 5MN6A 3A70A 2QHXA 2VSXA 1ADBA 4I46A 1DTSA 1JR4A 1Z73A 3H2HA 3PRJA 1OA1A 1CP2A 4GZ5A 1P0CA 1JKJB 1L5MA 1T9ZA 4FJ0A 1YZUA 4X7PA 1UZLA 4EP1A 1U1IA 3RC3A 4IFBA 1AQUA 1W93A 2Y4OA 4DCTA 2B82A 1FUEA 5HWSA 4J90A 5JATA 1Q91A 5B1SA 4KOEC 5AVSA 3VZPA 2MSCB 2FK8A 5YASA 5FH9A 1QZ3A 4MIEA 3G89A 2J85A 1GAQA 2V7WA 5KPJA 5DGCA 3BRQA 5AK3A 4HGNA 4X95A 3L6DA 2M98A 3EWSA 1CYDA 1LSOA 2RSLA 3R3WA 3PT5A 4GO1A 4XPZA 3LCVB 2SICE 2P27A 1E2QA 4QIHA 3GIWA 4NYMQ 5BR1A 4BBPA 3OPQA 1E6UA 1P9RA 1UFQA 2WAXA 4LJYA 1TK9A 3PFKA 1G8MA 2AYXA 4B5KA 5MHTA 2KYRA 1ND6A 1MV8A 1HEIA 4MS3B 2I6UA 1RXIA 5KJFA 1II0A 1GA1A 1RMYA 2Z9DA 3N3AC 3GT4A 4PIMA 1L7QA 1CIVA 4R0VA 4Z4GA 1OKKD 4GWGA 1DC4A 1UMDB 5FQOA 2NO5A 1ZD9A 3NYRA 4RA9A 3WGJA 1U0JA 3OE7D 4MP6A 2F9LA 3HBLA 3KVYA 1QFMA 1LI7A 3OTIA 4XX0B 3WLSA 5CXQA 1PV4A 1PVDA 4Y9TA 3IP6A 4N5HX 4UHBA 1RI2A 2A88A 2L0XA 5B53A 1GG9A 2CVFA 1SUCA 4IZOA 4BQNA 4KRFA 4RGBA 5JISA 3CNHA 4YMWA 4PSKA 4AO7A 5TY0A 3RFXA 4DR2B 5BSTA 4EY5A 2HU2A 1AGNA 2NXEA 4QSHA 2XCLA 2C7RA 2ZVDA 1Q7BA 2KLBA 1U9IC 1WUTA 3HA7A 4HRAA 3TQQA 4CTKA 5KWEA 1A5AB 3WGUA 1KFEB 4B8WA 5BN3A 5K03A 5B2EA 5CTAA 4LF4B 4ECEA 1J0AA 2GDJA 1A04A 2Y93A 3H7AA 4OGFA 2Q62A 4MI3A 5ELMA 4OL0A 1CJTC 3VPDA 4YAUA 1HSZA 4YAWA 3G9TA 2C2HA 1CRLA 3MTQA 4MKFA 3BWXA 4WLFA 1D2RA 4WVFA 4F0JA 1PGQA 1V0JA 1C8BA 3DLAA 3WGMA 4E70A 5JI3E 2VL7A 4QBKA 3R75A 4ZA2A 1CEYA 1GZ4A 2K5UA 2YW9A 1MX9A 4CM4B 5KQMA 3RSCA 4EHJA 2OC9A 4H4EA 3UQYS 2BL4A 2A9FA 1R0XA 2FFAA 4MEJA 2NO4A 2BE9A 4WKNA 4FHFA 3HYLA 2OM6A 2YMMA 2YJ4A 3KKLA 3UUFA 2V7VA 4HNTA 1UJBA 1E2HA 2DFTA 5B64A 3VFDA 1BU5A 3UV7A 4HEA1 4QXPA 5AJYA 4XJSA 4CR7A 4K9RA 3GEGA 3OZGA 4FGSA 4S1OA 4ZV4A 1JB9A 3IODA 1G9TA 1PAUA 1ZISA 4KE8A 4MH0R 3ZVRA 4PBRA 1EFHA 3VSBA 3M6WA 4C6SA 4D80A 5DISB 1T6YA 4HWOA 2BGJA 3K70C 4YFYA 4AF8A 2P91A 1G66A 4LJLA 2FX5A 2N1MA 2ZT6A 5B3JC 1MOZA 3NV7A 4MPTA 1QDLB 1AH2A 1EVKA 2OY0A 2QRPA 2VDPB 2JGNA 3TFWA 5DK6A 3HJTA 1BFDA 2XXBA 3QG5A 4LZWA 1UQTA 1KQOA 1WPRA 4MUJA 3LT5A 5DX8A 3ACCA 2C5EA 1IJBA 3E3AA 4IQ4A 2I78A 3ZTYA 1LF5A 5FI1B 3N53A 4EQ6A 5BV2P 1NR7A 1DIRA 1JFFA 1YH3A 3K9QO 5BQ3A 1EHCA 3T12A 1GRNA 1YHZA 2ETVA 2B5OA 4Z1MA 4HBZA 2HHLA 4ZJYA 1R9MA 4DNXA 1Q3TA 1QFSA 1KEEA 2I1QA 1MHPA 2WICA 4L2IA 3X3HA 1ZRSA 1IUNA 1I6KA 1Y63A 2OMEA 1D4ZA 2C8KA 2YC4C 4HAYA 4K88A 2VHTA 2VS1A 3MFQA 3ZDZB 4M54A 2RBKA 1I5EA 4LBWA 3I6BA 4L5YA 2G4VA 5DTQA 1QHNA 3IH5A 5BRNA 5DGHA 2OHFA 3TF5A 1ILEA 3AM1A 3FVQA 4X94A 5KOJB 3T3GA 1LSUA 2C1XA 1PO7A 3P0FA 3DO6A 2ZUBA 4OBXA 4K9KA 3SU8A 3OUZA 1BE1A 1K7FB 4CBVA 1XMJA 3R6WA 1FW8A 1GY8A 3DYIA 3F5QA 2VDUE 2Z4RA 3JQFC 3T0GA 1E96A 1LK7A 3L1JA 3DEHA 3NGMA 4EB6B 5K6AA 2BM9A 1MEEA 1SVIA 3FF1A 3DKIA 3IQEA 2CB0A 2FYTA 1RAEA 2IV2X 3U1BA 2RI0A 3ER6A 1I14A 3HU3A 2FDRA 4R71A 1JHZA 1OWPA 1BHO1 2F17A 1AN0A 1NJSA 1VMAA 3E0QA 3U1TA 1WSAA 2AG6A 4N0DA 1NNSA 2O4CA 3GUHA 3K09C 3THOA 2WJJA 4AJKA 1NVVR 3B89A 5HMMA 1OYOA 4XKJA 2Z83A 4H15A 4JLBA 1S7GA 5AVUA 4TKUB 4LECA 2ENUA 3GRPA 2JJYA 4ID3A 4EJ0A 4KIUA 1MNQA 1RI5A 2NU9A 4R2JA 1JJIA 5DBOA 3L7KA 1DV2A 1O6FA 4RLFA 3GLHA 1T2NA 3EYWA 1QH9A 1AK1A 2XMRA 1X1BA 4M0PA 3FPCA 4QNMA 3FZEA 2HA7A 1JG7A 1AKRA 2C54A 4M3NA 1VE7A 3KYDB 1LFAA 4FBMA 1RC8A 4V0MA 1QF7A 5L6MB 1GZUA 2IYVA 2VDWA 2AKAB 3UEOA 4M89A 1ZAKA 2OB2A 3OX4A 1H5UA 2ROQA 1ELOA 4QTUB 3CPSA 1WKCA 3PFWO 3GFQA 5H70A 2JFHA 1NJFA 4K2HA 2Y0BA 4FMCB 4LC9A 4KXFB 2AEMA 3LQRA 1EM6A 4YRNA 1YZHA 4BBJA 1C41A 1K2VN 2GAJA 5CAEA 4QOFA 3GUZA 4QVGA 1DJMA 4P6VF 3UPTA 3PUJA 4G8DA 4NU8X 5LC1A 3QW4B 4PC2A 4AZ0B 5AW8A 3HN2A 3NNSA 1PZGA 2PXCA 4GPD1 5FI5A 1OLUA 1TF7A 1KKUA 3GB9A 2ZYIA 3I2IA 3O1JC 2JFGA 3HXTA 5DO9A 5L6LB 2OAQ1 4ARSA 1WTCA 3L7DA 1W5SA 3FDXA 1ZGAA 3M9XA 3HFSA 1GUDA 1YZQA 1FUYB 2J6IA 3A28A 1RJ9B 4KNYA 2ZCVA 1XAIA 5ESXA 4NH0A 1OGYA 2FX3A 2C5LA 5JADA 5F2OA 2GWHA 1UQUA 2DKFA 2FRVA 4REQB 3HBAA 5L3ZA 1XZLA 5JZSA 2FW8A 1I2MA 4PQFA 3AM5A 4ZDIA 5AYVA 5JHHB 4WZBE 2QXTA 3DV9A 2PIDA 1YV9A 4WFKA 4JBWA 5FO1A 1QHIA 1YIOA 2IUTA 1B2RA 3K8ZA 4P81A 4EY7A 3RT1A 1KWKA 2JIOA 4H08A 2WA1A 2YOFA 4U7FA 3UFXB 2NYUA 3L92A 3W1VA 5IBCA 1YTLA 1VLLA 4G23A 1DAIA 3D7LA 4HSGA 3ASZA 3Q9SA 4BO1A 3EF3A 2Z2JA 4E11A 5AXDA 1GAWA 1U6IA 2XCQA 1VB5A 3QFHA 2WNSA 1KIFA 1QHHB 1RWQA 3N07A 2ORYA 3PVCA 4HDMA 1VHTA 4LOAA 4EG1A 2YYYA 3K3PA 4F12A 5JEEA 4FFDA 1GGFA 1UFVA 3BIFA 3JARA 1C7QA 1DZIA 3KLNA 4CM6A 3MT9A 1BWQA 2XUHA 5ALWA 1OPRA 3ADKA 3L7IA 4M60A 4MSUA 1JQJC 4OMFG 3SBXA 5A3VA 3TUJC 3THSA 2LCFA 3L0BA 3L04A 4EX6A 3U9SA 1PDVA 2W98A 3U81A 5JZMA 4RS4A 2Q2QA 3IURA 1XCJA 3UGKA 4FHZA 1CR0A 2QZPA 2FPWA 4ARCA 4KN5A 1D6MA 1YONA 1Z4IA 2V7UA 3MGCA 2ZE8A 1EGMB 3GJQA 4JP1A 4MINA 2DBYA 1WMSA 4R16A 4R8LA 5PNTA 2ZSKA 5EMHA 5EXPA 1SCBA 2IH5A 3C8MA 3K70D 2BP7A 3OI7A 1FS6A 1CTQA 1PBTA 3Q85A 1VJ1A 4EUKA 1P72A 2IJGX 1G8KA 4ZT3A 4MWTA 4M9RA 4GX2A 4R0NA 4TYMA 4DLWA 1HR0B 4M1SA 4QOGA 4RWZA 3H2GA 3H6GA 2C2YA 3E84A 3H6HA 3F6RA 4KQJA 1QSGA 2XADA 2ZYSA 5TGDA 3SHFA 5T5QA 3W7BA 3STHA 1MO3A 3WO1A 2W22A 5CM2Z 3WV4A 5CT9A 4F11A 3FR8A 1JVNA 4WZBB 1JIVA 2ZTHA 1XNJA 1JEEA 5GPBA 2AV6A 3OZSA 1RWWA 3RUAA 2BEVA 1DAFA 1GGHA 1R7RA 4TZKA 4EG6A 3HA5A 1ECBA 4PSUA 3QE2A 3MWDB 2JH9A 3KFVA 3R3SA 1IN8A 3SX0A 3TQIA 2E3JA 1MH1A 3HJRA 1A97A 1F9EA 3L05A 5JSZB 2E4XA 4IVNA 2AW3A 3L0YA 3LA8A 5AW0A 3VUFA 1DT5A 4LJRA 3BORA 1FYDA 4H27A 4ND3A 2HRCA 4B33A 1O8CA 4YCJA 1TX4B 2IUYA 2VT3A 3DO5A 4I4NA 1F5SA 1XA0A 3BJZA 3T6KA 2F8MA 3A27A 4ZZ0A 4TWBA 2FEPA 5A03A 2JIMA 4ZVLA 1T2AA 4BMCA 5CLIA 1NVKA 3MBIA 4IRXA 2DHDA 1RP7A 1J90A 4JU8A 1AK2A 2N1BA 3VNSA 1XTRA 1BJKA 4PLFA 3HRIA 1ZHFA 4HI0E 4EUEA 3ZGXA 3AIOA 2CMKA 5TT1A 3QI2A 4XM1A 1DINA 3ZXSA 2DH6A 2G67A 1EBBA 3TZHA 1DO8A 2TS1A 3WLHA 4TZ0A 1SXGA 1DXOA 4MVJD 4P4SB 3T7JA 2QNIA 1JFTA 3ZIAA 2RIRA 4FT2A 3V2HA 2X19A 3D0OA 5JCJD 4UE6A 1DCFA 3CS3A 1ZSNA 1T8SA 3NTXA 2FNAA 4CIBA 1AUXA 3OUUA 4LK3A 4WBXC 3MWLA 1AF4A 3KV1A 1LDYA 1RYZA 2BY4A 1EXDA 3X1WA 1FE8A 1UADA 4BFUA 1U3TA 3KWLA 3VKHA 3JALB 2UZ1B 5DMXA 2JGDA 4HPXB 4IDCA 4NE9A 1M76A 4QSMA 1Y6FA 3DUFA 2YN2A 4NPHA 2YJ3A 1P4AA 2QN7A 1EX9A 2JJ2A 2ZS7A 3EGVA 4JI4B 3F1LA 3FYDA 3DWIA 4OF4A 1LZLA 1UDRA 4G9BA 4URUR 3KZMA 2HF7A 3RS9A 1KMQA 2Q5CA 1T1SA 3TVTA 1E7SA 5CA1B 1U31A 1QPBA 1MFPA 1T3SA 2CNBA 3RVRA 3HUTA 4X0EA 5A9SB 2VUIB 3OZVA 5DYWA 2IHYA 2OYCA 2CKMA 4ZGWA 1EFRD 1M67A 4QGFA 4F91B 2CXNA 1A96A 4HB0A 1D5CA 3RVPA 5K3CA 1M33A 4CDNA 1BCRB 1BS1A 2CL7X 2QUBA 1UOQA 3O2SB 3TJRA 4B34A 2XCSB 4I50A 4M9ZA 4F96A 5IJ0A 1OTYA 1AZLA 1W76A 3NUZA 4P2BA 4YP6A 5CFRA 4XPIA 4I66A 4B80A 1GUBA 2GVDC 2VHQA 4LX8A 4QAJA 1YVRA 2G25A 4K7JA 1EWRA 4B81A 2Q1WA 2OV4A 2YH2A 4NC9A 5L7YA 4NAVA 5AXAA 4RD1A 3C15C 1WL8A 1H2BA 3K4HA 1KQPA 3QIAA 2HB6A 1IHYA 2JKZA 2ZIVB 3NVMB 1GSIA 4YJDA 4Q05A 2NU8A 3THRA 3VJKA 4C2TA 1OZ0A 1AY0A 3BCUA 1IHXA 3R9IA 3VVLA 1E3EA 2ZAOA 3SC3A 4YDQA 3AL2A 3QXHA 2QW8A 1WUHS 5AHKA 1O08A 1R0CA 4KGXA 1AA9A 3ZU6A 3ZNOA 4J94A 1V4BA 5I5EA 4BVLA 1P80A 2EFHB 4DJTA 1T4MA 1BO6A 2OEPA 1JIQA 4O6VA 1QGUB 1ZQ9A 2QG4A 1YKSA 4YP5A 3BQMB 3NBAA 3BC1A 2Q4EA 5CA0A 4YQYA 1TTHA 2OYSA 1SC3A 3F5DA 3MWEA 1YJQA 3OEHA 3SBDA 5KDOA 5MFPA 4X61A 2QM0A 2HO5A 2Z04A 3A6DA 721PA 4U3JA 1QIEA 1RABA 1UEIA 1V1MB 3FWKA 4LFCB 3VHXB 4UAJA 4WCFB 3VKVA 3OLQA 4GSYA 3Q3CA 4C05A 5E7MA 4CIXA 2Q27A 4YECA 4BGEA 2X2EA 2QTCA 2VG8A 4U6NA 1GPUA 1EUCA 1R2QA 3E9ZA 1EKXA 3KDPA 3I28A 5IN4A 3DBRB 1T8UA 4QXQA 4MJ7A 1PN3A 3ZNQA 4YV2A 5C32A 1QIJA 3VNUA 4HKTA 4AKSA 4M8NE 1W85A 1O87A 2DECA 3THXB 1QQTA 4YXFA 3D3WB 3NM6B 5ALMA 4MUFA 4EKIA 4X1YA 4OIFA 3UCFA 4CL0A 1HFWA 4JL8A 1SBZA 3A9SA 3AJRA 4YXWA 1WP4A 4BGIA 4ZQIA 1XL0A 2C03A 1FL9A 4I5DA 4C4XA 4F2GA 4N54A 4COOA 3LD9A 2NLOA 2Q29A 4RF2A 1V11A 2G09A 2JZCA 1H2AS 2QJFA 1UUFA 2R8EA 1I6MA 3D7MA 3BDAA 4L27A 4M1WA 5HGJA 4CUJA 2JEOA 4HUQA 3QH4A 2G8LA 1JA0A 2C3MA 1RQ7A 3ZZTA 1THGA 1ZESA 2COKA 4DG9A 4YPOA 1I7SB 3MTJA 3RVKA 3PPXA 1GPJA 5JQGA 1MZVA 4L6IA 5KOHA 3VXKA 5KZMB 1WPQA 1NVGA 2I2BA 2WABA 4F04A 3E22A 4OOFA 4BN4A 1IE3A 1PS0A 1YFZA 1O58A 4BNGA 1E5LA 4M0EA 4WOJA 3AEQB 5AK5A 4BN0A 1MX1A 1X7YA 3B3AA 3MFYA 1I4TD 3SIXA 1YBMA 3QTTA 2C78A 2FZWA 2XAUA 5FLEX 1GQOA 2RGBA 5G0WA 2WHYA 5A5EA 4GIBA 1JF8A 3N2YA 4N03A 2AEFA 1LSJA 2HBQA 4Q6BA 4HEQA 2JVJA 4LMRA 2AOTA 2EOAA 3BPSA 4RW0A 3UQZA 1I9GA 1FSZA 5JXGA 5FLKA 1RXCA 1VKZA 4HAVA 1YT5A 2ZBEA 4PSDA 2O19A 1T9CA 4LZLA 2QNBA 3LNTA 2HCBA 3ZHRA 1FFEA 4WUTA 3KX2A 1DOHA 5KYYA 4KKXB 1XVAA 1XDWA 5AI6A 2QXYA 3FETA 3WQQA 3NEPX 3DDCA 1M3SA 6NULA 4FE7A 2OCDA 1E2LA 4JGGA 1VP9A 7MHTA 4MDFA 1ULTA 2IPLA 1UBSB 4MUMA 4OQPA 4MDHA 3RUPA 3EAGA 5ICEA 1VG9B 3F3MA 2VYVD 3WA6A 4EBFA 1WV0A 3IUQA 3DZIA 4LHVA 2F64A 3TE7A 3W8FA 2P5UA 4Y6PA 2GPSA 3C3CA 3P45A 4GQBA 4XX1A 1BKDR 2VDKB 1QPGA 3PGA1 3IA2A 5JO9A 3WRXC 2P65A 4KV7A 5TMEA 1IB6A 1SCUA 3NRBA 3GPIA 3IE1A 2BRUA 4JSRA 5KSZA 1T13A 5KSOA 1NFRA 1IMJA 4ZI7F 1UEXC 4RLSA 2RK4A 5FPHA 3TFOA 4A2CA 1YDEA 3EC1A 2FEKA 2PT5A 3E9EA 1GKLA 2HRZA 2R8ZA 3EGWA 4Q39A 2P35A 4G5HA 2LRHA 4KSCA 4MW4A 2WWTA 4IR7A 2Y71A 1RI4A 1O6ZA 3AJDA 3K15A 4L3WA 1PEYA 1YKGA 4I9FA 4XW2A 4XSHA 4MGIR 4YHBA 1CY8A 3A31A 5AKGA 3SZ3A 3HCAA 1UBKS 3WB2A 2QN2A 1UXHA 3MNFA 4RPLA 2QD4A 4TVSA 2Z3VA 2C98A 1OYVA 4GWLA 1K7YA 5K8JB 5LDDC 3B6EA 2XRZA 5JECA 1Q16A 2KHZA 1YR2A 3VM6A 2ZUFA 1NV8A 5IVKA 5CNMA 1Q19A 3ZWNA 1PT9A 4PCAA 1DAOA 1QK4A 4HXGA 5CFMA 2I4IA 3G2KA 4Y0AA 1V8DA 3DE0X 1K5DA 3CX7A 4KUHA 2VP6A 4XI9A 2HHHB 1JJBA 1T0UA 1V3UA 2JFWA 3H9JA 3U6BA 3BILA 3O9MA 1Z0JA 1X1SA 3HM2A 1C3OB 5CU7A 2XE8A 3K8QA 4YRLA 4CTOA 4BAGA 1H6DA 3WYCA 4HMPA 3CLVA 1ISPA 3JZFA 5M7EA 4Y2UA 3HADA 4Y6QA 1YVEI 3BH6A 2VK2A 4L4RA 4O4JB 1Y81A 3GY0A 4KPUA 4C6HA 3RYHA 4DXHA 3K30A 2O3UA 4PO8A 3HDGA 3KOXA 1O6GA 3ZI4A 4AY3A 2NZVG 4CJXA 4OVKA 1DQNA 5L3VA 2CBZA 1R16A 1STOA 4AWXA 4CU2A 4F3TA 4D74A 3BGWA 3EVAA 1C9MA 4IXMA 5EJ6A 2X41A 3H2ZA 4JN6B 2FN7A 3ZHTA 1DAEA 1J0CA 4PAOA 3OM9A 5BXQC 4C0BA 4QA9A 3IIEA 4TYPA 1NPYA 2HGZA 4LG1A 3ZJUA 3SDZA 2L19A 1HLGA 1P0IA 4B7XA 5BN4A 2GN9A 1UAAA 1CY1A 1U8CB 2VLBA 3DGEC 3NLLA 3EVTA 2C1EA 1IRXA 1Y3DE 4DNOA 2Q2OA 5BWOA 2IGBA 5FOUA 4E4TA 2PD3A 3KT3A 1ODJA 5F1PA 1G9SA 1ULZA 1U02A 1I3KA 2PKQO 2IPAB 2VPQA 2QZZA 3CZMA 4P53A 4IDBA 1RXWA 2NP7A 3LUFA 3C7CB 4E1BA 2AKEA 3HPRA 2FX2A 2F1HA 1G18A 1PJ8A 3FA2A 3WKDA 3FMFA 1PQYA 3G49A 4AK9A 1E2GA 2BEUB 3P7MA 1K5HA 4M1TA 4DR5B 1N2ZA 2G5CA 4MQEA 1FDSA 3UBMA 4BO6A 4U7JA 5TRTA 3ZPXA 2JAWA 2Q6LA 3PKJA 2ZS9A 1IEWA 3JAKB 1XNGA 4BJ3A 4MWDA 1YS7A 3NIBA 3VVBA 2NX2A 4NCJA 3WQBA 2Z1NA 2Z56A 4JR0A 4F9EA 3W6ZA 2EWWA 1I2AA 2OTCA 3RFVA 1E3WA 2BGRA 2SCUB 4J6FA 5C1IA 4FFMA 1F8GA 2OL4A 4HAZA 4KXNA 2BFDB 3A1NA 4P3XA 3CURA 3VPGA 3FOAA 1CULC 1LDMA 4P86A 5CDFA 3ZWYA 2Y92A 4PLZA 1XGKA 3OOYA 4Q1CA 3BMQA 3VV3A 1ODSA 1IATA 4KPYA 2H00A 4L5BA 2R751 5JSHA 1NQXA 1E20A 1L1EA 3EH1A 5B6PA 2ZIAA 5FLXA 1VOTA 2Q6OA 1BGXT 2HJRA 1KYWA 3GVXA 2R7MA 4MZXA 4HH1A 4W1PA 3W8NA 4DV3B 2DETA 2IA5A 2D54A 5F73A 2HR1A 1C1HA 3K4QA 2HQSA 3CZ4A 3FSGD 3B5JA 4AD8A 4DUPA 2H06A 4RPHA 1DX6A 2CUTA 5T6MA 3LLCA 1ZNWA 2BFBB 3GMTA 2JHAA 4J3JA 3U4GA 3G9ZA 3NT2A 3TSOA 1UKBA 1YUMA 3WK8A 2QN6A 3IERA 1E60A 3AVQA 5ALIA 1DBRA 1ZNZA 3T61A 4PLVA 4UBNA 4MW1A 3WHKA 1UPFA 3ZWWA 2FSPA 1ZM7A 2QS9A 3DEJA 1JHAA 2BGIA 2Q4BA 1E0JA 2K2QB 4BTEA 2XCRB 3IOMA 4EJSA 3BSWA 4WXYB 3RQIA 4L3OA 5ISMA 1EFPB 1UXOA 3OCCA 3QUTA 2C5BA 5FA5A 3Q87B 1JHQA 2E4ZA 3D59A 2QRHA 4QELA 3WVNA 4MI9A 1W0JD 3BICA 1UL1X 3DDZX 2E82A 2RK3A 3WTBA 4K6FA 2VUSA 1U2QA 3QNMA 4M8LA 3FNFA 1YMVA 3Q4GA 3QENA 4AZVA 3CF4A 1T0IA 4NF2A 4UHJA 2QLNA 3HYTA 3IUYA 3QE3A 5AI5A 4E7PA 2DLDA 3Q72A 5IAOA 1S2IA 5JNRA 4KMSA 4PGMA 1ECCA 2PS9A 4B3MB 3C7KA 3LPMA 4GL2A 3DL4A 5FOSA 3V1LA 2FPRA 4S12A 3OFKA 4J1SA 5JDIC 4E32A 5TQJA 1Z88A 3CW8X 2GCGA 1OFHA 3IIMA 4KGDA 5LCXA 3ZDDA 5EXSA 4FTWA 1R0LA 2GX6A 2X0NA 2EARA 1A95A 3ZCVA 5K4AA 4YRQA 3RSZA 5HILA 3HO6A 4UM9D 4KHZA 1JG3A 2JFZA 4U8GA 3DYVA 1O95C 1ZGGA 4HGPA 4HLDA 2HDOA 1CIJA 4K26A 5CM9C 4KGZA 4L8LA 2ORED 3D8RA 3WIBA 1KYIA 2BM8A 2WV9A 3L7LA 2EX1A 2XQVA 4KB5A 5KOYA 5DM70 1JWBB 1QFJA 1AXRA 3U4MA 1Y3HA 2HMTA 4L02A 4X24A 4RLQA 1E4EA 1RHKA 1A7UA 2Q46A 3I42A 4NV3A 4Y2TA 4TXMA 5EWJB 1DO2A 4IO1A 4BNIA 4FJ1A 1DWUA 4FINA 2IVZA 3NZEA 1WBBA 2ZRIA 3SC2A 1BWRA 1V7ZA 1I10A 4IGIA 5I7VA 3A6GA 1IG3A 2VJCA 5IC6A 4LJ9A 1VLMA 5AHRA 4IEFB 1TZBA 2R86A 2YBEA 4WCVA 5FBKA 1FLDA 3PZBA 2OCIA 4TS3A 2YRXA 1GTG1 1XRMA 4ZVMA 4J3NA 3A6FA 3CXRA 5P8WA 3I9JA 4IMIB 4JP2A 3Q10A 1L7NA 1G98A 1LX7A 1YR7A 2ZAMA 2W2XA 3JVVA 1O1YA 1O0CA 1VL1A 3IT3A 5JPIA 3UAXA 4NS1A 2K6GA 1IPFA 1CUJA 4M53A 4UFOA 4UMEA 4FCWA 3LQ4A 3K6KA 1J56A 2Y77A 4BX2A 3AOEC 1OT3A 2XJ9A 2IY7A 3A4VA 3E18A 4W82A 1VYTA 4EM6A 3E61A 1Y5LA 4GOLD 3T1NA 4RL4A 1IBCA 3HXLA 4IS2A 4P83A 1UJ4A 2V7BA 3FXAA 3IV7A 3X43A 1CPYA 4C6TA 4YRBA 3T9AA 3U4CA 2ETXA 3TX2A 4RKRA 4EL0A 3VR6A 3UAWA 3EZ7A 2REQB 4ZYYA 2FMTA 1WU8A 1R0YA 4OKNA 1SVUA 2FFJA 3CNLA 2ZWOA 4R31A 4Z9YA 1XRQA 4MWOA 4E51A 5A06A 2A92A 2DUUA 2YWBA 4P38A 1VLQA 3KDAA 4XWTA 4MW7A 2OHJA 3CE9A 5C8YA 2CL5A 1HZZA 4KH1A 5KX5F 4OI0A 2PZLA 3ANSA 1FJXA 1E2KA 1Z75A 3QELA 3ZK8A 2XNHA 5BT9A 5TNXA 4JT4A 4K28A 1IG0A 5F98A 1KMHA 4L6AA 1ZPDA 2OORA 2AJ8A 1NRJB 2V65A 3LY8A 1JIIA 2ZR9A 4I5FA 5AO9A 1AV6A 2ATCA 4OUDB 4EYQA 1TJYA 5SYNA 4D5EA 3FPGA 4L57A 1I2DA 3S1AA 2ZRLA 4OPMA 1XNQB 1ULUA 4JYCA 1AHHA 3OOEA 3BSSA 4MUKA 2OSVA 4C0XA 2MSKA 4RTMA 2P6OA 3IDQA 4D9HA 1E2UA 2P3QA 5A4KA 2MR6A 4R7GA 2C1ZA 3CUWA 1YB6A 1FXWF 2VHWA 4LY3A 2QAGB 4MVJF 2EX0A 2FPIA 4N47A 4H1WA 3LXMA 4CFSA 3AVYA 2XUKA 4GVXA 1C7IA 2CE2X 2GZHA 4N65A 3IJ5A 4I55F 2NUAB 1VKHA 4HEHA 3QE9Y 3DQPA 5EVJA 4MYCA 3R5SA 1BZYA 2ZTLA 3SZGA 4CLRB 4FBGA 4BWYA 1VQ1A 3QVXA 5HQ3A 5JBQA 2AUNA 3G9QA 2WNHA 5ILOA 1L7OA 1NW6A 5ER6A 4BO9A 1NQ5A 4YQFA 1TIPA 4DDVA 3PFHA 1Z63A 4MVCA 8MHTA 3JWIA 5ECDA 2XNKA 5EJ2A 2MINB 3BKXA 1L5WA 5DKFA 5FUYA 3S2FA 4R2XA 3LH5A 1NG9A 2IHBA 4RVSA 5DHPA 4M2LA 4J1TA 2VJYA 3ACBA 5CDSA 4HNAA 3RVLA 1SCJA 3PC3A 5J2UB 1GU0A 2E5WA 3C4VA 1UPCA 2O2GA 2ZIWB 4QBIA 4HQOA 1DQZA 1J2TA 2R65A 2VK8A 2CZCA 3FG9A 3IX7A 5JR3A 3PQ8A 4HTFA 1BQEA 2HSWA 3KYIB 3ONVA 2JGMA 1FMTA 3I09A 2R5NA 4H6VA 4P3NA 4Y2SA 3UJ7A 3U4QB 3NEJA 3BD9A 3WV5A 3UK6A 2HZBA 1N2IA 1E9CA 1Q44A 3DW3X 3JAWA 1EAYA 1W5TA 3PPVA 5D01A 2VKTA 1KAOA 4E03A 3ID6C 4NDZA 1YFKA 3ADOA 1DIAA 4M6WA 4BNDA 1F20A 3FMVA 5HM6A 3GNQA 4POAA 3TD2A 1YRHA 3CKMA 4F9TA 3MLEA 4HZGA 4LDJA 3ZGYA 5C1PA 2ZSUA 2PVSA 4WINA 4X1OA 5DX1A 4YRJA 1NBHA 4AP6A 1ZH4A 5TMBA 4CM5A 1DIOB 3I53A 3IAM1 3F4LA 2VVTA 2TMDA 4JJGA 4EG7A 2VTKA 3K0AA 3PTAA 5LQAA 4KV9A 2IZ5A 3N0TA 4IILA 2PZAA 1EH5A 2DLNA 1W0KD 2O9JA 2WRZA 3GBVA 4TOIA 3C1TA 4RC9A 5DASA 3EHDA 2GA9A 3GUVA 4PXAA 4DLXA 3RSOA 4GP7A 1RRVA 1L7DA 5I7OA 1K5GA 5F33A 5BUCA 6ABPA 4CIWA 1WVIA 2DWQA 4CIYA 3HV0A 1RMTA 3FX2A 2O20A 3E5MA 1B8OA 2X8JA 3AHEA 1ONNA 4ZALA 1I9CA 2JBAB 3HV2A 1UKZA 4ZJPA 1LNZA 3GRUA 1I3NA 1UP4A 1E8DA 1ICIA 2R1VA 3HKCB 5K3DA 1GNVA 3LP6A 2ZATA 2MYNA 4IIJB 1FRQA 1O95D 2PGNA 2WA2A 4JLSA 3D8UA 3QPVA 4ZOLB 3W5VA 2OCYC 5F4BA 2W8BB 4UNIA 1ECJA 1W1WA 5IDYA 3KVNA 1YU6A 3C5EA 5TQ0B 3RT7A 1JHXA 4N7BA 5CFNA 4IEEA 4D3DA 2G9QA 2G83A 4JK3A 4TYWA 5IF3A 3GAZA 3IT1A 3LFTA 3PIDA 4UOQA 3UT5A 1TU3A 2AXPA 3JVDA 3NJRA 1W1UA 1NW7A 1YRAA 1KSGA 2G82A 3O0DA 4NBNA 5BVHA 1C0LA 2JZOA 2B3TA 4DLPA 1ITZA 3VNRA 1N6PA 1LLFA 1MQSA 2FA9A 3B7GA 1TQDA 3KXDA 3MSCA 1T35A 2BUCA 2R6CA 3PU6A 1ESCA 4B09A 3KUKA 4B79A 4DGQA 1KVTA 1NL3A 1GZDA 1EB8A 1CDOA 1UJCA 4M21A 4HPWA 4TUYF 3TTYA 4X6XA 1EXVA 4TT8A 4K9MA 1QV6A 2FPUA 3O8QA 4M8KA 5K0NA 2LWIA 4YCMA 2I6XA 1YASA 2GK7A 4I9NA 3M5CA 1H6BA 5G53C 4AUKA 4LSZA 2IOFA 2IIQA 5FQNA 4AAYA 2B37A 3GWGA 3HYRA 1QFZA 3GJ6A 1V48A 3EVDA 1I1NA 3AIKA 3GLIE 4QDZA 3M6MD 1WKBA 3RGGA 3F6BX 3NALA 4WA8A 3T9FA 4GZMA 1T4BA 1LBSA 2X8WA 1KR2A 1YS4A 3CZ5A 4BASA 5HQTA 2WIDA 5IT4A 4Q15A 5MDHA 2A7XA 1M5TA 5ITZB 3HH8A 3MGKA 3HRKA 1FMCA 1LW7A 1NKVA 1CX9B 1FJHA 2D0OB 4WEQA 1EG7A 4Q7MB 3V34A 3DE3X 1SR8A 1SUSA 4R9VA 4Y18A 5CH8A 2XUGA 5ARDA 5B2ZA 3ZH2A 3LYAA 2VP5A 3SZOA 5AW7A 4MPRA 5H1YA 3NVKI 5BRJA 4LJSA 5GQSA 4NHEA 1YNSA 2XA1A 1ESEA 1J2UA 2GK3A 2X8LA 2XMDA 1ZXLA 5EUMA 1VGQA 2O8CB 1JI0A 1Y8RA 4ZYXA 1CG6A 4AQDA 1Q50A 4CQLA 1KAHA 1KSFX 1E4VA 2ZZKA 5CURA 5SY4A 1SVKA 1T3HA 1WZNA 1RXYA 2XYVA 3NHAA 3SR4A 1G3UA 2QVXX 4J7XA 3BWYA 4WNYA 5D3QA 4LF7B 2IGTA 1CUWA 1M9NA 2F9FA 3LJKA 3DC7A 4EUFA 3U3XA 4EARA 3V48A 2PWZA 4W8GA 3WJ2A 1BMQA 3MRTA 3WYAA 4GHWA 1VJTA 1XZFA 1ZU5A 3SQWA 4UMFA 2PVCA 3CH5A 3REOA 2GN6A 2W2LA 3IQWA 5DNAA 4XYBA 2DR0A 2YQ4A 3AH8A 2IODA 5D1NA 3WYGA 3S55A 2VUTA 5KJ1A 3COJA 3H1EA 5J2TF 1NONA 3FZQA 3P9NA 3ANNA 3INRA 4Z7NB 5TMPA 3G5MA 2A9RA 1CUGA 3HJFA 5LQSA 4IDEA 2B36A 4MVWA 4Z8XA 1KBOA 1N0WA 4EI8A 3VR6H 5CD1A 2EU8A 3VTKA 1QZTA 3GLIB 5M04A 4MUIA 1JQDA 3DE1X 4U63A 1Z15A 2AA3A 4UE2A 4LYGA 2NSJA 3UN1A 5E1DA 3H11A 3ORQA 5JDCA 1TAGA 1P0MA 1NRWA 2BMJA 3DM5A 4PYLA 4TMKA 4XLLA 5HRCA 4EYKA 1D1PA 4JC8A 3TEMA 2EATA 4BKPA 2HSDA 2PX3A 4RE5A 3TLGB 2OHOA 1XPUA 1PZNA 5HFJA 2BDTA 1QQ5A 1WD7A 4LHXA 2FSSA 4B3FX 1KP3A 1E92A 2V58A 3OMWA 4I1YA 5BURA 5FPPA 4IIXA 5WRFA 1A8PA 2HSJA 3RVQA 4XQCA 4C4YA 2W90A 4BECA 4UHEA 2PXHA 1IK6A 2W6CX 4RZQA 3VU9A 2UZ4A 1N57A 3A7EA 4BNYA 4EI7A 1OLXB 1TB4A 1L5QA 1HQKA 3AESA 4OP1A 1OFUA 1UAYA 4C29A 1DAHA 1KI7A 1SC4A 4E31A 5FULA 3EGDA 3RWBA 4C9BA 3U6KA 2W6PA 3QEJA 1L7EA 3JASA 4M86A 4MR9B 4E5NA 1TZJA 3AERA 3O95A 4B3GA 2ZXUA 2EX4A 3R0IA 1AQYA 1CRQA 2I54A 3DDHA 4XWOA 1DELA 2R1TB 4H0NA 1T34A 2I22A 1JWAB 3ZGLA 2Y27A 3S1SA 1N7HA 2W6ID 1GCUA 2XV1A 3C2QA 2ICAA 1B43A 1M1XB 1JG2A 3W1EA 4O29A 2ZJ0A 1FYWA 2O5EA 3EGXB 1HLPA 4CKYA 1YJAA 4PLWA 3ER8A 4D9BA 1OIXA 1XEFA 4L73A 1G3RA 2E85A 4LWQA 5JFOA 2WP8J 3A4NA 4OXKA 2Z9BA 4WXMA 5F21A 4KEAA 5KYNA 3ERCA 1YBAA 2IPXA 3ND8A 4JROA 5H0IA 2WZCA 4D8YA 4FKBA 1U5AA 2DPHA 2VWQA 3CZCA 4KU4A 4PQEA 1E0SA 3SIRA 2HJSA 4MW0A 5CLQA 1ZDMA 1MOQA 4LGCA 2IX9A 3NIDB 3Q7TA 4RZIA 4PAMA 4BFWA 1BC5A 2H4HA 1Z6PA 4QXOA 2QVYX 3AVVA 1PFUA 2CNOA 2ZRFA 3MUOA 3AUAA 5DLPA 4IEIA 4OHPA 3W5JA 4LXXA 3LP5A 4M7RA 5IARA 2HA2A 1GPLA 3LBIA 3V3TA 3SG0A 2PT9A 1ZCJA 2WW8A 4ZEVA 1HTBA 1ES9A 3X2FA 1G59A 1QO7A 2W6ZA 4Y6SA 2ODAA 4B6EA 1ADFA 3W79A 4BO7A 5GJVC 4PZ9A 4G07A 3GJ7A 3OVMA 3U17A 4DMLA 4F6RA 3DJFA 5K3OA 3IKMB 4EW2A 2FG5A 4EWLA 1G16A 3IVCA 4GICA 5TV2A 5E4TA 3CPJB 3TDMA 4LYYA 3MMPA 1K9VF 1O6CA 1YI0A 3PJEA 3VI4B 2XZLA 3MUFA 4KWTA 4WY5A 3I05A 2NU6B 2Z5GA 1GTVA 1TPZA 1FS5A 4JA2A 1AN9A 4RPKA 1Z5WA 4IQ0A 2EZ9A 3NVDA 3GCWA 4KBYA 4LUCA 5A3SA 4U2EA 3HB1A 3AY7A 2RD2A 3K5PA 3E0XA 3Q1LA 5FWNA 5DULA 1SCNE 1GG8A 4LE1A 3C7AA 1KI6B 2JGFA 1SIBE 1J06A 4MO9A 2D6FA 5DRYA 3LQFA 3WMGA 4DIBA 5B3AA 4CM9D 1KY5A 1WQ4A 3HTXA 3KR2A 1X87A 1YQGA 4F38A 2I4MA 4DMKA 3K72B 1F8YA 4IZIA 3KWJA 3R7WB 4EVQA 2OD7A 4HDKA 1HFJA 1JSXA 1W88B 1PJCA 2JGLA 2OBLA 1KO5A 3AQ4A 4BX0A 2JHPA 2SECE 1I0ZA 2Q0XA 2Y6VA 5A9RA 2FDCA 1W0CA 3KQWA 3T9DA 2FCAA 1Z0ZA 4JBIA 4Y2HA 4HQRA 1V71A 3LPCA 5CLGA 4DYVA 4HN9A 4X00A 1IMOA 2NN3C 3UWDA 1B2LA 1OH6A 4RULA 1FNSA 2A0WA 4PYMA 1DTWB 3BTUA 3IVRA 4G65A 4NARA 6REQA 1KP2A 4G4GA 5CX1B 3OCVA 2WK1A 3N7UA 1HDIA 3ND5A 2HJGA 3ZGNA 2C9BA 4C14A 4GOOD 4P0TA 2AIRA 4Z53A 1O97D 1NUQA 3IDAA 2ZRMA 4ZCRA 2CW5A 4RVHA 1IXSB 5GM2A 5K0SA 2Z58A 1MH9A 1ZOSA 2PMCA 2PMBA 1DQRA 2YVUA 1DIHA 3OTOB 2YJTD 2PRYA 1Z17A 4WOPA 4N76A 5G40A 3BERA 2A8YA 4QEZA 3WIVA 1AT1A 2B0CA 5FWXB 2FZEA 5LDHA 1H9AA 2I6FA 3CJRA 5ILGA 4AJJA 1JECA 3IB6A 5EE3A 4ZI5A 3RTAA 1AMUA 3EYAA 3LOPA 1EFVA 3FY4A 4GKVA 1P45A 4P98A 4HK4A 1DB3A 1QZZA 2IEGA 2UYGA 1E3DA 3QMWA 1XRJA 2PV7A 1NPTO 4DADA 4CLRA 3B9QA 2LE0A 4TV9A 1YO6A 4PYRA 1CC1S 2F43B 1NBME 4BFCA 2ASVA 2QSUA 3TW8A 3WDLA 3G5LA 4XWKA 4JLPA 4R68A 1NZDA 2G72A 3A9RA 2X8AA 2FUG1 2PKWA 3OQBA 4LZZA 4NR0A 1HDXA 1K1EA 1ZICA 4J03A 4YI3A 2XYQA 2IP4A 4L4XA 2WJYA 1J42A 1JEQA 4AT1A 2QR2A 5A3JA 5LJIA 4JXXA 2YXEA 2R0QC 1POXA 2MT9A 3JATA 2QXUA 4PVDA 4F92B 4IV8A 1HMPA 3UMRA 2PD4A 3TDKA 3O75A 3AC0A 5KQLA 1VA4A 5BWMA 1Q7RA 4D4HA 1XRNA 4ZAZA 3ESAA 2TMYA 1HE5A 3GRAA 4GEKA 4X92A 3SEZA 4LJ6A 1TT5B 1GAEO 2C0CA 4F9GA 2IYZA 1SU7A 5EJ5A 2O1WA 1MCZA 2XJ4A 3BL8A 3EWIA 3L1IA 3NAQA 3CGGA 3PICA 3BWEA 3DKKA 4BVBA 3SJAA 3T35A 1EB9A 2K87A 5GVSA 1YIDA 2VJMA 3DA8A 3G8AA 4HEA6 3SYRA 4CVNA 2R6GA 3COVA 3WSVA 3M6VA 3I9OA 4HX9A 4BXOA 4XTCS 3PTZA 5C8DA 6GPBA 5THQA 4D5GA 4PICA 3MS7A 3WYFA 3UOGA 2J0QA 2Y2UA 3D6HA 3IEKA 2B8NA 3TL2A 3EGEA 5JW6A 3QKRB 2EQ5A 1QCYA 5DB4A 3CFYA 3U40A 4CLDA 1G5TA 2IK8A 3Q7RA 5CVJA 2FETA 2I7DA 5NULA 1RHRA 4RCZA 3W2EA 4ZCTA 5I7RA 1G3MA 5E1OA 1NKSA 1Z62A 4Q9HA 3THYA 2QJOA 5KJ6A 3MTGA 4DCNA 3CWCA 3WMFA 1WF3A 1EHIA 3PC7A 5AUOB 3C5CA 2XE7A 4ZVSA 4KP7A 1JA9A 1DJQA 2ATEA 2WJ4A 4GEGA 3F8TA 4D26A 2H9IA 1LPMA 2D06A 2ZJ8A 2QTVA 3B82A 2DBVO 3NTLA 4INJA 5H5JA 4BVFA 5CIQA 1LDNA 1VIDA 2WKSA 3ZCXA 1G6KA 3AX6A 3TW0A 1CUCA 1QQ7A 1M72A 3ZU4A 1KJ8A 5FUWA 5DRTA 3BHMA 1MW9X 1M2OB 3MM4A 1AC5A 3RYIB 1NLFA 3V33A 3K9HA 1UMBB 3ECAA 1XVIA 2G7MC 4UEQA 4IJVA 4FGZA 2X5KO 1N5LA 4F8JA 2RGGA 3ZJ5A 4CM4A 2YMQA 4N18A 1Z4OA 4NU0A 4YJ3B 4BN5A 1PJBA 4CQMB 4KCGA 5JLAA 1H9CA 1LC3A 2DVMA 2VHEA 4JI2B 1H2HA 4J0GA 1IVYA 1E6WA 4ZVTA 3TBHA 4IDHA 1KYYA 3DZJA 1PJZA 1UEJA 4TLAA 4UTXA 1M2WA 1NIJA 3RWMB 1I24A 1X39A 3E1SA 3ZIUA 5E38A 5FNZA 2ZSHA 2H2GA 2HXGA 1MG5A 3WAKA 3V1YA 4D92A 5ED4A 1JPJA 3N2NA 3W06A 4YUZA 2HT6A 3C6ZA 1FUKA 1ZK2A 4UQPA 1E2IA 4IS3A 5CB4A 3SE0A 3P19A 4Z3OA 2PYZA 2D5IA 2IYRA 2FK7A 3QXGA 1T9BA 4RIEA 1LPPA 1R0ZA 3EE6A 4KQFA 1GPMA 3HBFA 2ZJ3A 2FQQA 4Q4LA 1W5AA 2Y1XA 4HNSA 3GVIA 1F6WA 2ZQYA 4RIFA 3EPKA 3WNDA 2OCPA 3H8WA 3IP3A 1OXKB 3KJXA 3R7LA 2WT4A 3D5QA 2RG1A 4HWGA 5EZ5A 2JD2A 5DBFA 1JIXA 1FP1D 1I13A 3AUSA 4B3CA 4TM7A 2FSVC 3FFWA 3SSAA 5TEVA 4RTQA 2IP2A 4BMYA 1VG0B 2FJUA 2DKNA 4JX8A 4WY8A 2IUSA 3GLTA 3ES9A 1GAJA 3DTVB 3KM0A 3KVRA 4JLNA 3V42A 5AW6A 1K8YB 2IPOA 2C7QA 4DIUA 1DJNA 2CJYA 2OWDA 4P08A 1UM9B 3I2KA 4N3AA 2IS2A 3OH8A 3VR0A 2AEEA 2ZDQA 4G1FA 2VP4A 5LBUA 3KHKA 1NP7A 3TAHA 1XKQA 5T67A 3X1YA 3V8BA 3FNGA 5B4VA 3CMCO 4DW8A 4PG8A 2KPOA 4BGVA 1OVMA 1MUUA 1ULBA 4F4IA 4PTZA 5DHTA 3GZTB 4LJ5A 1NQVA 4P7JA 4YONB 1RR6A 2NUTB 3EBPA 1WCV1 3P0HA 3OPVA 4NK4A 3IMGA 1N25A 3I3OA 1VXOA 3DZHA 3TM5A 5HK8A 4ZMSA 1RKUA 5DN6D 3BQNB 5L4NA 4H4CA 2R47A 4EZEA 5L8VA 1VLVA 4K6KA 1CUBA 3AR2A 4HLNA 1M1YE 5DLDA 4LKOA 3R77A 1H85A 1NVAA 1J2EA 3ZLVA 4RY2A 1UANA 1K3TA 2ODWA 1XWWA 4KNWA 4ZVOA 3HFJA 4I3FA 4QTYA 2A5FA 4MGZR 1R3UA 4D99A 4L72A 2VFAA 5G0UA 2PRIA 5JANA 3MT7A 1QO0A 2HNAA 4ML3A 5FXMA 4PF1A 3RYFB 2XSZD 1G2IA 1P9LA 3AGQA 2DPLA 1MABB 5KO2A 4A0FA 2XH8A 2OK7A 3DMRA 4DSTA 1JUDA 2FLVA 4NYIR 4GMGA 3ZBUA 1QVVA 4Q3LA 2H4XA 3O3CA 3U7QA 3JQ9A 3JRXA 3KVVA 2NG1A 1S01A 1QXSA 1ZNXA 5TPZD 5E7IA 1VDZA 1M2VA 1HX7A 3K0SA 2AFHA 4FYVA 1R0KA 4QRDA 1HM5A 3A1VA 4BLOA 2J5XA 4PONA 1GFIA 3PD1A 2QTFA 3IUEA 3TSCA 1WOYA 3WKBA 1TRHA 5IXSA 5LN1A 3PS9A 1EGAA 1LV7A 1KMMA 4XM0A 3I8XA 4J6EA 1WDMA 1ZN9A 1SXPA 2VNKA 2P8SA 4N9WA 2CLSA 4YJFA 1T1IA 1RLJA 2GD2A 1E2BA 3CLUC 5MGNA 5CT8A 3SK0A 1QH1A 1Y0BA 4ND8B 3ITEA 4GYJA 3H9BA 1G63A 4HVLA 1KPIA 1A8UA 1DZ3A 4A8JC 1PFVA 4NJMB 1L6IA 3KHSA 1KU6A 2CK3D 4I6EA 3WA7A 1L7BA 3PL5A 1GG5A 2XDWA 3QPAA 4FOOA 1FC0A 2A4KA 2JL1A 5IX8A 2OGSA 3QFCA 1XROA 2WIAA 2FZVA 4A27A 2AYYA 4ZOEA 4HT3B 3PNPA 1EDEA 3IXMA 3OICA 1CJBA 3K5WA 5ILQA 3WJ7A 1EVQA 3C3AA 1M1YB 3PLAE 3Q3JB 4NG5A 5BSMA 2P69A 3KQUA 3BRSA 3ODPA 3SN6A 3LBAA 3T5PA 1OVGA 1E1CA 2IYEA 3BBPA 4WXRA 3JCZA 4KQEA 3OCUA 3E3NA 1X38A 3N75A 4RPGA 4CEJB 1PFWA 1EX6A 1M2KA 3QA9A 4WN9A 1QE5A 2QY9A 3C1OA 1E64A 2P9YA 5HXAA 3UH1A 4ED9A 2XNCA 1JZQA 1X0VA 2HWUA 2P77A 1Z35A 4NJEA 4XCVA 3ECCA 5HF9A 3LTEA 1K6MA 3PWZA 1VPTA 1ZJ6A 4YX9A 3V7FA 1KAQA 2Y66A 4GI3A 2FEWB 2ZBUA 4O2RA 1NWHA 1ISIA 1VE9A 1YCDA 2VN8A 3QUBA 3NCTA 4G5RA 3IVAA 5EOVA 2J48A 3ND7A 3NOXA 4FJ2A 3FAZA 4MIYA 3N8NA 4PX3A 4AN0A 5BVGB 3OX2A 2IKSA 4HMOA 1TADA 2B3DA 1JZTA 2FZ4A 2IOYA 1EUDB 5LOVB 3HKBB 3A9CA 3I83A 1N77A 1GYPA 3VZRA 4AMZA 1Q2UA 3OSZA 1L7RA 1AQ6A 1MB9A 1PTJA 2R2GA 3K2BA 4FR0A 4I4TB 4JSYA 5EXTA 3U31A 2B8JA 2NTJA 3PF8A 3OJXA 4KQ1A 5AKJA 4ZV9A 4F5WA 2VEOA 2IE0A 1OI4A 5IHXA 4CRWB 2X22A 1CUXA 1ZUD1 2Q1XA 3CSDA 5KX5B 5H8WA 1EWQA 5AW5A 2LVBA 4XASA 1SIOA 2VF4X 2FV8A 3GQVA 4NJOA 4UHKA 1M6VA 3KDSE 1E6CA 5LQMA 1F0KA 4N7RA 1LQ2A 2A3NA 2C92A 2QN8A 3MAGA 1V5GA 4X3OA 5AP9A 4AJ1A 1CD5A 1KAEA 2G6TA 2QMHA 2VCYA 4MS1B 2MSEB 2XNJA 4OO3A 3UWOA 3AKYA 4AMVA 3ILXA 3T7AA 4INPA 4D56A 4X20B 4MW6A 4NMXB 1KAGA 3D6TB 3E82A 1Q1ZA 4DR3B 3HABA 2QN1A 5C5IA 1NX6A 2YNMA 3QVKA 4D0NA 5H4GA 3QBTA 1CVIA 1HNWB 2IXEA 5EYPA 2EP8A 5E8RA 4CCYA 1NXWA 2OO5A 3G2HA 1BRTA 1I5RA 3F49S 4PFSA 3HZOA 4UTNA 2V0GA 1H1TA 4GRIA 1Z26A 4WKGA 2ZYTX 1SQ6A 1X9HA 3VOTA 1H22A 3ZKAA 4CI0B 5D6NA 2XYGA 4CV0A 4KX3A 1ACJA 1AUPA 5ALJA 2VPTA 3WGOA 4ESHA 3R0XA 4RFSB 2IHKA 2Q8NA 3C3MA 3RKUA 2E55A 5KNLA 1PK7A 5HOQA 5KNDD 4YRTA 2YINC 1UDXA 4U7HA 3AHFA 4MQLA 1DGQA 3U7EB 1OCEA 4RU1A 4EB0A 4ZFNA 3C98A 3PUHA 4Q16A 5ALXA 1EFDN 3NTOA 5JY1A 1R6UA 2ZUCA 5A7GA 5JZ9A 5DSTA 2EKZA 1PJLA 3A6HA 2QR5A 3V6MA 8LDHA 4CL2A 4X90A 1FYFA 4TWIA 5FBQB 3SM3A 2H9YA 5T3YA 1Q7TA 1R10A 4KQGA 2J7PA 4RIGA 2BGNA 3GO4A 3A3KA 5CFOA 1Y98A 2B61A 4O1IA 1B15A 3OKFA 5IC5A 2WYOA 4DCPA 1K63A 4K5QA 1BH2A 2NT3A 2OCGA 4HF7A 3TOSA 1WIWA 3ONWA 4QYIA 1GFZA 3VDNB 2XDQB 4L74A 3I39X 3G88A 4UBIA 2D1RA 4Q1VA 1P0PA 3WR5A 3FTCA 5KJEA 4N5DA 1W4RA 1E89A 3L01A 5AI0A 1XK6A 2CNWA 3WOHA 1TO1E 4V1CI 2ZDGA 4UQLA