3H4TA

Chimeric glycosyltransferase for the generation of novel natural products - gtfah1 in complex with udp-2f-glc
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
397
structure length
390
Chain Sequence
GVLITGCGSRGDTEPLVALAARLRELGADARMCLPPDYVERCAEVGVPMVPVGRAVRAGAREPGELPPGAAEVVTEVVAEWFDKVPAAIEGCDAVVTTGLLPAAVAVRSMAEKLGIPYRYTVLSPDHLPSEQSQAERDMYNQGADRLFGDAVNSHRASIGLPPVEHLYDYGYTDQPWLAADPVLSPLRPTDLGTVQTGAWILPDQRPLSAELEGFLRAGSPPVYVGFGSGPAPAEAARVAIEAVRAQGRRVVLSSGWAGLGRIDEGDDCLVVGEVNHQVLFGRVAAVVHHGGAGTTTAVTRAGAPQVVVPQKADQPYYAGRVADLGVGVAHDGPTPTVESLSAALATALTPGIRARAAAVAGTIRTDGTTVAAKLLLEAISRAKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chimeric glycosyltransferases for the generation of hybrid glycopeptides
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Transferase
molecule keywords Glycosyltransferase GtfA, Glycosyltransferase
total genus 135
structure length 390
sequence length 397
ec nomenclature ec 2.4.1.311: dTDP-epi-vancosaminyltransferase.
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
A PF04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4tA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3h4tA02
2FETA 4MHOA 4RBNA 4AY6A 1P2GA 4RIGA 3E3LA 1P4GA 4RELA 2JZCA 4AY5A 1A8IA 1E1YA 2G9RA 1Z6QA 3IAAA 4X7RA 1XL0A 1WUYA 4CDRA 2QN3A 1C3JA 2QN7A 3UYLA 1YA6A 2H1HA 3L7AA 3CUUA 1JIUA 1FU7A 3T3GA 3Q3HA 4RENA 3TSAA 4W6QA 2IW1A 2ASVA 2GPAA 2AV6A 4G2TA 9GPBA 2Q6VA 1E4OA 1LWOA 1NLMA 3MT8A 4FZRA 2KS6A 2XCUA 4X7MA 3EBPA 1PYGA 2IEGA 3CUYA 3L7BA 3CUWA 1GFZA 2ACVA 3G2IA 2IV7A 2O6LA 2F3SA 1WV1A 4WHMA 3PE4A 1L5QA 4YUAA 2XGOA 3CEMA 4XI9A 4GYYA 4M60A 5DXFA 3G2JA 1UQTA 5JTTA 4CTNA 4RIFA 3L79A 1UQUA 3MBOA 4N39A 4CTOA 3NPAA 3NCHA 3VUFA 3RSZA 1LWNA 3NP9A 3ZCPA 2SKCA 4QLBA 3RT1A 2R68A 2XMPA 3E3NA 3SYRA 3HBNA 3CEJA 5TVGA 3NC4A 4CTMA 3WAGA 5HXAA 1Y6GA 3QKWA 2BFWA 4F96A 3G2NA 2YJNA 1Z62A 2PYIA 3UYKA 4F9FA 1WW2A 1P29A 1WV0A 2X6QA 3E3OA 1FS4A 3OTGA 1QM5A 4EKEA 1L5VA 3FROA 3CV3A 3CUTA 3Q3EA 3T3IA 3HBJA 3BCUA 2SKEA 1JG7A 3S29A 3DZCA 2F3QA 2WTXA 1P4HA 2R66A 4N9WA 4AMBA 1L7XA 1Z6PA 3GUHA 3S28A 2FFRA 2GEJA 2GT1A 1NZFA 2QRPA 3BCSA 1BX3A 2SKDA 4MI6A 2BGUA 3SYMA 3ZCVA 2ATIA 1HLFA 1L5SA 7GPBA 3MQFA 2QLLA 3AMVA 1H5UA 1IIRA 1GPYA 4AMGA 4WACA 2IV3A 4YI3A 1K06A 1F0KA 4BFCA 3CX4A 2C1ZA 1YGPA 2R4UA 1FTWA 1AXRA 3C4QA 4XIFA 4KQ1A 2VSYA 2P6PA 4BQFA 4GYWA 2X0FA 2IYFA 1V4VA 5TMDA 2QNBA 1NOJA 3DD1A 1ABBA 2PQ6A 4LDPA 3L7DA 2BISA 3OKAA 1GPAA 5D00A 3T3EA 3BD6A 1WUTA 1JIVA 3OT5A 3ZCUA 3G2KA 3NP7A 1B4DA 4MI3A 1P4JA 3ZCQA 4HLNA 2G9UA 2C4MA 4KQMA 2BGTA 3MRTA 2FF5A 5LQDA 1Z8DA 3OY2A 1EM6A 2H1FA 3ZCRA 2PYDA 2C1XA 4EL0A 2VSNA 3MS4A 3D0QA 3MTAA 3HBFA 2QRGA 3VUEA 5JTUA 2AZDA 1VGVA 1PN3A 2XGSA 3G2HA 1P2BA 1C50A 2C9ZA 4RIIA 3MSCA 3C48A 1FA9A 1K08A 2ECPA 3L7CA 1UZUA 2QRMA 1GZ5A 2HY7A 2QLNA 1KTIA 1IXYA 5I45A 4HWGA 4L22A 5IKPA 3VDMA 1GG8A 1F6DA 4NESA 3MTBA 4MHSA 3TOVA 1XKXA 2VG8A 8GPBA 1WW3A 3BEOA 2F3PA 2JJMA 5ENZA 1Y8ZA 1XV5A 2PRJA 4KQ2A 2OFFA 2X0EA 3MRVA 3MS7A 2G9QA 3NB0A 3T3HA 3TAXA 1NZDA 5C1DA 1J39A 3ZCSA 3H4IA 3OTHA 4BQEA 3O3CA 3S27A 1FTYA 3NAZA 1FU8A 2XA2A 2ZB2A 4RIHA 3T5TA 2QN8A 1C8KA 2XA9A 3MS2A 2XGMA 1PSWA 3MRXA 2AW3A 1PNVA 1L6IA 2F9FA 1AHPA 1L5WA 1GPBA 3C4VA 2X0DA 1XOIA 2ACWA 1JIXA 1O6CA 2VCEA 5BNWA 3G2LA 3VDNB 5IKOA 4N3AA 4MRAA 3H4TA 3BD7A 4RIEA 4EJ2A 4NC9A 2IYAA 1XC7A 1NOKA 3MTDA 2AMVA 4AN4A 5DLDA 2G9VA 1SXPA 4MICA 3CUVA 2IEIA 2QN9A 3D1JA 1FTQA 3T7DA 5TMEA 3L01A 4F97A 1FU4A 1JG6A 2QLMA 3OKCA 4GPBA 3BCRA 1QKJA 4X7PA 1RZVA 4MI9A 3ZCTA 1C8LA 2QRQA 1GGNA 4N3CA 1Y6FA 4M7PA 2F3UA 3S2UA 1P2DA 3OTIA 3BDAA 2R4TA 5D01A 2JLBA 2GM9A 4NEQA 1M5RA 4GZ6A 4GZ5A 1FC0A 4WADA 2QN1A 3IA7A 2QRHA 2IUYA 3OKPA 3DDSA 2QN2A 2GJ4A 6GPBA 1NVKA 1RRVA 1JEJA 2GPBA 4Z5XA 4REMA 4EKYA 2X6RA 2PRIA 4N3BA 4YI5A 1XL1A 3HBMA 1SXQA 1RZUA 4GZ3A 3MT9A 4X6LA 2GPNA 1NOIA 3MT7A 3QHPA 3D0RA 3T3DA 4FKZA 4PQGA 3RHZA 3WADA 2VCHA 3GPBA 2QZSA 3BD8A 2R60A 5DU2A 4EL5A 4LEIA 3WC4A 3CEHA 3COPA 5TMBA 2GEKA 4BQIA 5GPBA 3DDWA 3S0JA 1L5RA 3EBOA 3OY7A 3RSCA 2XCIA 2XA1A 3Q3IA 1EXVA 4M83A 3PE3A
chains in the Genus database with same CATH superfamily
3TI9A 4ZYZA 1GUAA 3DAOA 3WLAA 5JNLA 3C87A 3G2MA 3LPNA 1E8NA 1V8PA 1VKNA 3AF3A 4YPOA 2PRSA 2ZTHA 4GUAA 1XJWA 2XCTB 3EUWA 3RHSA 4MK4A 5AI0A 1OFTA 1UEXC 2XF8A 4AECA 2VJPA 3R3YA 2YC2C 4OXNA 3EQ9A 5IMSA 2VDUE 3JATB 3L49A 3N2IA 2AOWA 5AT1A 1N6PA 3DTTA 3BPSA 3PC8A 4LJLA 2ODQA 3SEQA 1W8DA 1ZGAA 1YQXA 3VM6A 4L4UA 3UXYA 4B1FA 1O3YA 4R0NA 1M0EA 4OFXA 3BSSA 2GN1A 2OBBA 1DEKA 2FPLA 3A6HA 5BSRA 3ST7A 4HZUB 5C8ZA 3N28A 4LV5B 2QF7A 4I14A 1N2CA 5IH7A 3EAGA 1I3OA 1SURA 1XO1A 4LXUA 1F2DA 1NVVR 4DB4A 2PUFA 1SUDA 4OYLA 1P74A 2RBEA 4JJ6A 4NV0A 2QR2A 4OOEA 3LXXA 2XVXA 1WDKA 2D2FA 1ZH4A 1JFSA 4DRXA 1BXKA 3ZWAA 3SDBA 4REOA 2C3PA 2YDXA 1D9XA 1ZINA 2PX8A 1YI8A 3JYPA 4BP8A 3NTQA 1Z37A 5AM3A 4OAOA 3EBPA 3PEUA 4BKQA 2D74A 3CUWA 1USKA 3D8NA 3RFVA 1FY2A 3VAAA 4WA8A 3VVCA 4MVJE 2V9CA 3UHFA 1B0PA 1PDOA 3WP1B 3U81A 1ZMTA 4WJKB 4AJOA 4FWIB 1XZCA 2HHHB 3AILA 3QRWA 1C7IA 1U7TA 1H93A 1T4CA 3PC8C 2FPPA 1GAWA 1Z35A 2CHEA 2HREA 2I4RA 2KSQA 3NEPX 3NJ4A 4CG1A 3B8EA 4B31A 5I48A 3GBVA 1GDDA 3JYOA 1O96B 3T34A 1I6MA 1PJ2A 1QB8A 1SKYE 4GPEA 1F6WA 1J56A 1L7MA 2WA2A 1C1XB 4F8EA 2B82A 3QNWA 3VQTA 3FCCA 1HF3A 4CUKA 4E46A 3ZHZA 2VS1A 5TC4A 1H0SA 2OLEA 4JI3B 3OSUA 3GRPA 3S1AB 1VPLA 1OBHA 1RYBA 1YNOA 2D1SA 2VYQA 3KFXA 3ONDA 4WFQA 4G5XA 3UK1A 5KYNA 4BY9E 1UMDB 3DM9B 4ZQFA 1RLOA 2AG1A 5G0VA 5C5EA 1K0UA 4D0LB 1EUCA 2QD5A 3HJGA 2OCAA 4V0ME 3UPTA 1LWNA 3KL4A 2QTCA 1TM2A 4LDZA 4EDHA 1CXZA 1HKUA 4MPRA 1YZYA 3OJEA 3QKRA 4GUDA 4OM7A 4PO8A 4HDRA 4JKIA 3U7IA 4BNFA 5HR5A 1Z17A 3TXAA 3OQJA 2EXXA 2WEKA 3ESXA 4ZVVA 1VE5A 1ZJWA 3EOZA 1FP6A 2O48X 3FYCA 3SF8A 3ZVMA 3WZLA 4DGSA 2K2QB 1IUOA 4O4LF 2HOQA 3E48A 2A0UA 4HHEA 4DILA 1E0DA 3UJNA 5IARA 5EIHA 4DIBA 1GD1O 1OROA 1Y81A 2GQ0A 3RAJA 2P8JA 1WSWA 1Z62A 1ORVA 2YJTD 3FPLA 2RGDA 3QBJA 4LHSA 3SN6A 4B74A 5BPHA 1DT3A 3EEBA 1HE2A 4RGYA 3NWBA 5BW8A 1P29A 1JEOA 4EABA 1QH1B 4EY6A 2ASEA 4J9UE 1RE1A 3AETA 1SXJE 2QLTA 1F8GA 1L5VA 3FROA 6NULA 3RRFA 4FUQA 2HF9A 3CV3A 1W30A 5AJUA 5IC5A 1EYZA 1ULHA 4UHHA 3S5UA 1TXGA 4LZZA 3JAWA 4HWOA 3H1GA 3ENZA 4IRUB 3TN7A 2ZKLA 1NW4A 3KHKA 4CQMD 3F73A 2A92A 3RV4A 5B1DA 1CB7A 5ALNA 4N9WA 4OXQA 3ADDA 5BRAA 4FDAA 4EHJA 1S7CA 3H2KA 1C4KA 1FDWA 2IW3A 4TZKA 3TRHA 3WGKA 1T9GS 5DSXA 2QGNA 2H31A 4FYMA 3WNDA 1LPPA 3CNEA 3T1TA 1PUIA 1CZNA 2V8OA 4OJQA 2HJWA 2FFRA 5JFOA 1LS6A 1XE3A 1LK5A 2VP4A 2LIVA 5C7OO 5LUAA 4BN0A 2Y68A 1J1IA 1DINA 1ZFNA 2GCOA 4NMHA 1MJGA 1BX3A 2EG5A 3AEKA 4BVLA 1HFWA 3LA6A 5C18A 2KWIA 4KR3A 4IMIB 1LI4A 2WWIA 2QAGC 1VYUA 3EFHA 3P2JA 2REOA 1Q7CA 5A5DA 2V8BA 1J21A 3LRTA 3OZTA 4WOBA 5CPFA 2C95A 2Q5JA 3AFGA 3K72B 3RVLA 3F97A 3DLHA 4JB3A 3G68A 3WLOA 4BO7A 4D0GA 3A6ZA 1H5UA 2WF8A 3EGOA 2JKYA 5JZOA 1SCQA 3NT4A 2HDHA 2J67A 2WMDA 4B40A 5KYTA 5KTPA 1EZZA 2XF2A 1PL6A 3HVUA 3OMWA 1CUBA 3STTA 1F0KA 2I4OA 3GHHA 5KCMA 4C0LA 1JHRA 1IM5A 1JXMA 4JEUA 5DV9A 4U2EA 5JXJA 4KX5A 1H3FA 3IT0A 4EJ6A 1E9DA 2CZCA 3NTVA 1Y9AA 1J00A 2IXEA 2W71A 3F3MA 1KYYA 4TTRA 2GILA 1B8OA 3RVQA 4CJXA 4J43A 2WAMA 1HE1C 2MSNA 3FN4A 3L8HA 5CTJA 4CKXA 3WKAA 1D2AA 5LQRA 1F0YA 2Z6UA 1PF7E 1G8FA 5AM1A 4P4SA 2GO1A 2VHTA 1ZJ5A 1GL3A 3K9NA 1QAMA 3WBFA 2B2XA 1V4VA 3LCRA 4GMXA 1PNQA 2BEVA 3PJRA 2P6MA 2Y1DA 4A36A 5FLXA 2YZ7A 5TEVA 4V1CA 5L6LB 2VH5R 2CJYA 5HTOA 1OTXA 2V7TA 4DLSA 2HN9A 2GD0A 1RW4A 2PJZA 2XUPA 2CNOA 2DFVA 1NRJB 5D00A 2P9QA 1N6IA 5F9MA 2DTEA 4F6RB 3BD6A 1KH1A 2J6BA 1B43A 4U63A 3WKEA 2FDRA 2W6ID 3CPEA 3OT5A 5EJ7A 1MABB 1R0KA 2XECA 3H18A 1T6BY 3ODGA 2CDCA 1PFGA 3EF3A 4CIAA 3GRZA 4BXOB 5AXBA 2YTZA 1O9GA 2G83A 2VJLA 2H7YA 3DMRA 1DPFA 4ED9A 4EYGA 2WVGA 1P31A 3HYLA 2G25A 2VSNA 3L7LA 4QOHA 5H9WA 1UXJA 3VOSA 1ZBQA 3MJ4A 2JH3A 5D3KA 2FSUA 1W49A 4G1UC 2WWVD 3G0IA 1UBSB 3PQ4A 1YAJA 4NHEA 2R6AA 3VUEA 2PXHA 4RHYA 4C5CA 4IUYA 1FSSA 1JZQA 1T5TA 1KARA 1T3GA 2XGSA 1D0IA 3ONFA 1G5HA 4L8YA 4AIIA 4HFMA 1U3DA 1NVUQ 1P3DA 1B6RA 3T8YA 2ZT8A 3JASA 1FA9A 3FHLA 4IDDA 4PQYA 1W581 2WAXA 1ODTC 3R76A 1OE0A 3WGVA 3L7CA 2CUZA 3GJSA 3PUIA 3V46A 5JFTA 4DUZB 3H97A 1LRLA 3A0RB 3QLUC 5JXIA 5L3SB 4U7JA 5FUVA 4I5IA 3WRXC 1GGMA 4HT3B 3VVMA 4EB3A 3VU3A 3EPPA 3LXRA 1AMNA 4G0VA 1P7ZA 1TKAA 4NZMA 3LO5A 2O1EA 1NR1A 5D2CA 4ZCRA 2FZLA 3M4ZA 5JNRA 1UC4B 5LMCA 4F0JA 2ZS7A 3VDMA 4BNZA 2WJHA 1P7PA 2NXWA 1ZMRA 4URWR 1FP4B 4KO2S 2JJ2D 4FWBA 1GXSB 4ZCTA 3X1WA 1RTKA 1N0IA 2XMSA 4HBZA 4O25A 1W0CA 1MZPA 4CW7A 4DR5B 2BFBA 1Q1ZA 1Z2PX 4ASUD 1FNSA 4D9EA 1FNBA 1W8IA 2ATXA 5C52B 2I8LA 3VJLA 5GJWC 4K6MA 4JLWA 4NJEA 2CLLB 3HJBA 1J9GA 4N5MA 4RWZA 3GEGA 1LNZA 2VNAA 1GPJA 4BV3A 2GB4A 1ONNA 2KQUA 1FRNA 4QFDA 5E6RA 4EHLA 5FULA 1A8SA 2PL5A 3B9PA 2RBGA 1KKUA 1K6JA 3D9QX 5FWXA 5JSYA 1L5NA 4DMUB 3I2FA 3RHTA 4RMHA 1OBVA 4CMKA 4AJHA 4Q4HA 3O91A 3R0JA 5H7XA 1Y0BA 5YASA 5KHAA 1VG1A 1IRXA 3CMMA 4QPZA 1JDUA 4TXJA 3SHWA 5JQGF 3L6RA 1AB6A 1IY0A 2FUEA 4Y2VA 3RYFB 2VN8A 3SGLA 3WGYA 1W36B 2YWEA 2D7CA 3OQIB 4UBMA 4DBLC 2Z83A 4EM6A 1J49A 3SQXA 4J1NA 5C1DA 4L4YA 2WFLB 5J59A 1KIFA 5EJ5A 1PBNA 1OASA 2RGRA 2EJWA 3N0XA 2CMGA 2GBGA 1O6BA 3GC6A 4B73A 3PTZA 2AFRA 4B6EA 2BFDA 3EPLA 3IBFA 3GHYA 2QP9X 1VKZA 4FBLA 1FTYA 2PA3A 2JI4A 2CXOA 3K8QA 1TIPA 1J23A 3GLFB 5H4HA 4ER7A 3A1DA 4U39A 4U7FA 4GRIA 4TM7A 4MXDA 3IAXA 4RXMA 3IKLA 3HCRA 4GI2A 1SIOA 3VZCA 1HE5A 1KY5A 5IJZA 5J2TB 1U8EA 4Y2XA 1ZH6A 4FC7A 2WLSA 5FYDA 5KQLA 2C0QA 2XXAB 2WD7A 5CT5A 1SCAA 2A84A 3ZU6A 4AICA 1RWQA 4ZI7F 2OP1A 5F51A 3QSGA 2B8NA 1X0XA 3I9LA 4HDSA 2CVQA 5JISA 1B3BA 1DIGA 4OREX 2W2MA 2R6HA 5E6SA 4B7ZA 3IIKA 5HUQA 4Q6WA 5HA5A 3A3PA 3UBTA 5TGZA 1AKNA 1XNJA 2ACWA 2I65A 1SBCA 2C8JA 2ZDGA 3BICA 4K5QA 4L02A 4YWJA 5L7YA 1W2HA 3KG2A 1UC8A 3L0CA 4LYDA 4RL4A 1N6KA 1UODA 2IU4A 2VYNA 1J06A 1FUYB 5KSYA 4K9DA 1IHXA 2FPGB 4UPVA 5ALZA 5LKRA 1U2DA 2C4WA 3L7NA 4UULA 1O58A 3A1UA 3I6QA 3JD2A 3JYNA 4E88A 3OUZA 5AOBA 4YXWD 5JRJA 2OAGA 3GT4A 1UK9A 3OF2A 4F1KA 1GSOA 2ZRGA 4IJQA 4LXGA 4D44A 1DAEA 3N8GA 3WYFA 3IA2A 2WKQA 4YS6A 3VC7A 3VZPA 2BMAA 2WJPA 3DE0X 4CUZA 1J20A 2QN9A 4YASA 1DIBA 4DM7A 4NYIR 1KDVA 4PGGA 4IXTA 4MV8A 3NJRA 4OM8A 3PX7A 3SDZA 4UCWA 5DB4A 1XMSA 2EJBA 2ZSEA 4F97A 4PYLA 1COWD 1UDBA 1E3WA 1GPUA 3BCRA 2BSQA 3BL8A 3STHA 4BGEA 4DDHA 3W8FA 3WICA 3ZHCA 5LQAA 5ADUS 5ED4A 1PTKA 2WTBA 4AXBA 2RB4A 1OWOA 1U1FA 4HDQB 2QZ9A 1ZCBA 1Z68A 3FSGA 4OFBA 3RKUA 4JI4B 5IF9A 1COWA 2OLJA 1P9LA 4FE7A 1QH0A 3KYDB 4JDUA 2XGJA 5BSEA 1STOA 2IHYA 4M86A 2DTDA 2WTAA 4UTPA 5L6MB 2PUAA 2VJBA 4FWTA 4DG8A 2O8FA 3EQ2A 2FPRA 1LPOA 5AKXA 1FK8A 4J1QA 2LPMA 5HZMA 1GSHA 2JIDA 3NBFA 4PNPA 3DEZA 5IWAB 1UBRS 1K7EB 4IJMA 2IE0A 2YXNA 5UKDA 2O07A 3A3YA 3E84A 5B1EA 4FOOA 3GQBB 1V1RA 3KQWA 4DBLE 1R2QA 4WX2B 4MW2A 4W9NC 2G7MC 4IXMA 5I9BA 4BRSA 5HKOA 1II8A 4MH0R 5CFMA 4F71A 2AZTA 1ZLXA 2FJ0A 3BD9A 1A1SA 4CF5A 5C5IA 2WJAA 4UMFA 3RGGA 1Q14A 4FQ8A 2XIJA 4EEXA 4EO7A 2INGX 5IDXA 5FEUA 2FSVA 1M34A 3KE8A 4KQIA 1NW7A 1H0KA 5CCDA 4IDHA 4D0SA 3R8FA 2AE2A 2IWHA 3GUYA 4H9GA 4XLLA 1V3VA 4TT8A 3BH0A 4X60A 2GTHA 4J29A 3KTDA 3PNOA 3EIUA 3R24A 4REMA 5AI4A 4BKRA 5CDUA 2XVAA 3GGCA 4ZCSA 3F49S 4TPKA 1VIMA 3QENA 2PT9A 3HLYA 4M1ZA 1RBYA 4LECA 2HFJA 1QO0D 4KFRA 3N0TA 3RK1A 5A4FS 4D25A 1RZUA 1U3CA 3ND6A 4RE5A 4EW3A 4I1IA 3IODA 3SS9X 3SYNA 3KETA 1I2ZA 3DV2A 3VR1A 3L8GA 1OU4A 4FHCA 5THQA 2VXCA 2QQ5A 4BMYA 3F9RA 3PXEA 2D8AA 4TXLA 2WHPB 5DU2A 1H1TA 1IXKA 5CLIA 3HXPA 3IP5A 4Y2JA 5F78A 2JKZA 1KFEB 1RACA 4WLVA 4JFAA 1V7ZA 4D82A 4URXR 4DLBA 621PA 5DTIA 1FNNA 2C00A 3IAS1 2GEKA 2Y9PB 2JFQA 3DKPA 3LA8A 1UJNA 4PYKA 5K3BA 4DV2B 1PV4A 1W0JA 4OKSA 3UHPA 4ZYVA 5CA1B 3RKSA 1KOLA 4FHDA 4U2DA 5CB4A 1ACLA 4DF3A 3HB0A 2XCIA 3BZWA 3K73O 3QVMA 4JQOA 4G01B 4OMUA 3U4AA 1LZKA 2VJAA 1EXVA 3ORYA 3FKSA 1Q21A 4WWHA 1EFRD 1V1RB 4G23A 4GC9A 3JQ7A 5GM2A 1P2VA 3RCBA 1EWKA 2YWXA 2PSDA 2ORVA 2CNWA 1BFKA 4ZU6X 1Z2OX 5JY6A 3S8MA 4RIGA 2OZEA 4CFSA 3GRFA 1TDJA 4J0QA 4LZNA 1C3XA 2H0AA 4MR7B 4KVFA 1YBMA 3GJ0A 4KFTA 3BX1A 2CUKA 5CLGA 2UZIR 3DAYA 5J2UB 3CG0A 4KXVA 2OQ2A 5DW3A 3TGPA 4C3OB 3S3TA 1YL6A 2HYDA 3PUXA 2KBEA 1NJ8A 2HRDA 3EBLA 3IS3A 3TTTA 4CV1A 5C1IA 5KTOA 1CEEA 3WLMA 2XYRA 2NU8A 1CYDA 3LBHA 3F46A 3VR2A 1RFGE 4TSFD 4BIMA 1R18A 1BFDA 1NWCA 1WZIA 3KYJB 1FCJA 1UDWA 4WXMA 4PCAA 3LP8A 1QGED 4LVUA 5B57C 3KWJA 4LZLA 2IYWA 3GEEA 4G0YA 5ALUA 5CW2A 4ND8A 4JI5B 5A4DA 1EJ0A 1D6MA 1VLQA 4YJ2B 2AV6A 4KVGA 2O14A 3N0VA 3QX3A 2Z8ZA 1U65A 2BKXA 1IHOA 3T0FA 4NRDA 3W5VA 4GSLA 4KYUA 2GEBA 3L7YA 4BO9A 5BN3B 3MGAA 1X8KA 2BMEA 3TIXB 2H8KA 1XNRB 3PP8A 2AF3C 3O21A 4QPPA 3UUFA 1Z5UA 4Q7QA 1XKLA 3TZ6A 4DLUA 4B2LA 1TVEA 2H29A 3CRVA 3EZFA 3FYHA 1ZSNA 5IVHA 3T7AA 2ALJA 3HP7A 2NZVG 1XVAA 2ZIVB 4FP9A 2GBPA 2YYYA 1ZNXA 2ZRIA 3BXFA 4IFBA 4AZWA 5JW6A 4KPUB 3LVBA 4W1RA 5CIQA 2QYSA 1E3DA 4RD6A 3H1BA 4LJKA 2ZSUA 3E70C 1ZM4A 2D0DA 1VXRA 4QO7A 2JH8A 2FPUA 3L18A 4GFDA 2B1GA 2BF4A 3A26A 3BXHA 3TX2A 3TLMA 2ZI3A 3AG6A 4UM8B 1J8QA 2Y99A 4LOAA 1UMBA 5CK4A 5AKIA 5E6SB 4ACAA 3RREA 2VCYA 1M2VB 1PYOA 2EDCA 2FAXA 4KSCA 1IBRA 1UC9A 1ATIA 2VZLA 1L5QA 3RLFA 3V5NA 4YUAA 5LL6P 3U0BA 1P4RA 4NCBA 1A8HA 2IF2A 3WDMA 1ISJA 1BYIA 3W0LB 1K8ZB 1U7DA 2J3MA 4MMZB 5CMLA 5BSHA 4MB0A 4MCAA 3ZHOA 4K88A 4RY9A 1XRJA 2HA6A 4FONA 3GJRA 2UVQA 4GI7A 3R09A 4MKFA 5EJMA 5DWQA 1ADJA 5ELMA 1PGQA 4YAUA 4WH0A 4MQ6A 1GVNB 4NONA 3GU3A 1Z8NA 3HL4A 2WICA 4PX3A 3NP9A 5FBWB 4JHXA 5DF1A 3QTBA 5H83A 4YO8A 1LEHA 4Q9JA 2PV0A 5CT9A 3ZCPA 2YHBA 2B8EA 2VP6A 4RY0A 3W6OA 3EIWA 4CTNA 1D09A 2P9GA 1ZZGA 4EFMA 5U9CA 3UJ9A 3WFJA 1JNXX 3QM1A 4BNWA 3RYFA 3QXGA 1OPRA 3FWZA 1PS9A 2ZBFA 1O9HA 4RPIA 4PX5A 2KMLA 3HJNA 4IQGA 5KOHB 3NNDA 3OWOA 4DFDA 3PGA1 4ZYLA 3IHWA 2L2QA 3L8ZA 2GEVA 2YJNA 4DM4A 4HI0E 4Y2QA 1P81A 1UBHS 3QYFA 5J4HA 5JYDA 3QFRA 3M3PA 5JZVA 1Z4KA 5E6RB 3D6HA 3S68A 2AUNA 2Q5FA 4MARA 2CJWA 2W8BB 3SKVA 4LZJA 2P78A 2PMBA 4AL4A 4NJEB 1D1PA 1M10A 2J9FA 4Z0PA 3KSDO 3MMPA 3PS9A 3MTIA 2UYQA 4QA9A 3ZQKA 3L8FA 3ZZ1A 2VHEA 3LJKA 4DMKA 4Q66C 2WIBA 3ZD8A 2QD1A 3AOEA 4G4SO 3UC5A 2VWPA 2NO9A 4WPGA 3CKKA 4W63A 5BMVF 5C53B 1YR3A 3O8QA 1NA5A 1H5NA 1KNQA 2ENUA 2I76A 3DZCA 4KXUA 2F3QA 3BMCA 3M6LA 3OLVA 1VTKA 1Z2NX 3KUKA 4IQ8A 1H69A 2ZR9A 4RNDB 4UDXX 3M5CA 3PUWA 3O47A 1I7SB 3OF5A 4E3WA 3SXUB 2HTEA 3QV2A 1JDBB 4N18A 4FINA 3HYRA 3TG2A 3LKZA 4IDQA 4DNPA 2VNHA 4CR7A 3UWKA 3I5XA 2BUBA 3F4LA 2E4UA 1ZSYA 4N0DA 2AFHE 4TTTS 5DYWA 3TAHA 4Z3KA 4AO7A 1Q3TA 2D06A 4LG1A 1T5HX 4KXYA 4Y6RA 5DX8A 3D7RA 5K3SA 1JR2A 3JASB 4BQQA 3U56A 4WZ6A 3PBKA 1QH8A 3I23A 4MV3A 3L7JA 5E4TA 3K4PA 2IU6A 1YB2A 4MWBA 2BFCB 5C31A 3H8SA 1J2JA 3KT3A 3WB2A 3BCHA 2JF0A 1EG2A 3MQFA 2B5VA 3SIRA 1UBOS 2PLAA 4XVHA 5G4LA 1IIRA 2GLTA 3DL4A 4L2IB 4DSUA 5KDLA 1GAJA 1M1YE 3MCZA 4INZA 1Z9BA 4M9RA 1RXCA 2LIPA 4JOQA 5EI5A 2FMKA 1FFYA 4X1YB 1BQ3A 4FYIA 4KGZA 1KDPA 2D5CA 2I4MA 2ZI9A 3F90A 3GVIA 4E09A 2IPMA 5JDIA 3V1MA 3W5BA 3E58A 2HW8A 1YZ3A 1UPFA 2XUJA 2BGLA 1YZHA 1A50B 1EDOA 2P4QA 3M6FA 4LOJA 2G1PA 2DPYA 5JEDA 4R9RA 1RZ3A 4PFSA 2P6PA 5AKZA 1TAUA 4IH1A 4HFRA 1DUIA 2QMEA 5JAQA 2GAOA 4H7JA 3KB1A 3EXG2 2NO7A 3F7TA 3RNOA 4KAJA 4ALKA 1DC5A 3MINB 3OF3A 4MS4B 3V34A 1E66A 4OYHA 1OXVA 5I7UA 4CMHA 1OV6A 1C0IA 3FNBA 1IZZA 2JD1A 4H60A 4MUFA 2C0PA 1MVOA 2QG6A 6AT1A 2C61A 5KYXA 3GLKA 4TMVA 1E64A 2I66A 2PYZA 1G8HA 4WN9B 5EMMA 5TGTA 1QYIA 3GZJA 3TVDA 5SICE 2JIZD 1JYEA 2YOHA 3LUDA 1XR3A 1ABBA 4XARA 4YDRA 1DOAA 1U81A 3RVBA 3VDXA 3KHTA 3F96A 3R5TA 2QDKA 2KYRA 4YECA 3UQYS 1W34A 3EDRA 3ETHA 4KQJA 3V8NA 2PWZA 5GVSA 1CEXA 1U3WA 2YXEA 3K9FC 1SKUA 3NI2A 4G65A 1JLMA 2FSVC 3BF8A 4UUMA 1R27A 2HTFA 1SXHA 1V1JA 3HXOA 1M1YA 1SHZA 1TT5A 2C4MA 5LJLA 4E5NA 3NVDA 1EMDA 3O8NA 1QG4A 3E61A 4J7CA 1NI4B 1VSTA 4NG5A 4NIMA 3DOIA 3N6RA 4KDCA 5DYNA 4AZ3A 4P31A 3F4KA 2XT0A 3OJXA 2R6GA 3MAGA 2YZNA 1UBNA 2L0XA 4RACA 4AJIA 2AG8A 1XMJA 2OPHA 1PS0A 3M1YA 4ZO7A 5EERA 4UZEA 5EYPA 4EYKA 2GLXA 4E32A 4NTZA 4Z7JA 4AKHA 1DIOB 1PGPA 1TI7A 3AJAA 3IESA 4B3JA 5C8XA 1ECJA 3HFSA 4HDKA 3NHWA 3HA7A 5EIXA 3JPWA 2P1ZA 5TVKA 3RROA 2VPIA 3WE7A 4Y98A 2HFKA 2FB9A 1QFXA 4JU9A 2IXGA 3K5PA 4QDXA 4M0LA 2ZRNA 4E2XA 4CGZA 1M34E 2FK7A 4LRWA 4R51A 5E7QA 1PSZA 1X2EA 4H7FA 4CLEA 4E4RA 1ST2A 2JKVA 1E3EA 1TQ2A 3BQMB 4U7PB 2HCJB 2O8BB 1S2MA 4K6HA 1C7QA 2R6DA 5FOVA 3CFYA 3EDQA 4C4SA 2E4WA 5IBQA 1FRQA 3EQ7A 1A95A 1BEZA 4MUGA 5DM4A 4BFTA 3C1TA 1OY1A 1EI9A 3JAKB 2OFFA 3JVDA 1UANA 1F0PA 4JMLA 2WKRA 3MTBA 3ONNA 5BV8A 4NLLA 2OBMA 2VG8A 4JX8A 3KQLA 2CUNA 3SMVA 4MTCA 3RWMB 3L0BA 4W5NA 1M54A 1U5AA 4LK2A 5A05A 1P6QA 5GWXA 1RYEA 4BB0A 2OSBA 1T1EA 4HDMB 1RC8A 2NO6A 1KF0A 1SXIA 1X94A 3HCPA 1QH1A 2DOKA 3NORA 4P7BA 4R3UC 5GONA 1G7TA 1C7ZA 4I3HA 3GN2A 3NETA 4ZU1X 3WRYC 3KSAC 4PQEA 2Z56A 3GJ4A 3KWMA 3FVTA 2FQWA 2I6XA 3KOMA 4FK8A 4M76B 2JAHA 3DA8A 2IUTA 4TTQA 3SU8A 1NJ2A 3COZA 4OJMX 2GBCA 4MRNA 1VL8A 4Z1OA 2W6NA 3PF8A 3SF8B 1O03A 2HA0A 1KWGA 3FLEA 1Q5PA 5EXTA 3M70A 1S3GA 1Q1EA 4CIDA 1BDBA 1D2CA 4OBWA 2WHYA 2QAGB 3IVXA 1II0A 2WSYB 4KN9S 4HTFA 1VG8A 3CRQA 3ZPXA 4KQCA 1V35A 4OYYA 4U7GA 3AVWA 4EB8A 1TX4B 3QWFA 4A0GA 2PHZA 1WDMA 1IPEA 2IITA 2ZSDA 3Q3GE 5EJ8A 1E2GA 1GILA 1I8TA 1MQSA 1FYVA 4UEOA 2ZCJA 3QVXA 4Y1GA 2JLWA 2ID9A 4G07A 2FCAA 4P1ZA 1YJXA 2W8ZA 4DMLA 4GOMD 4ND7A 1MO6A 2Z0MA 4EYEA 4HEA6 2JAUA 4JL6A 3T6KA 1RCUA 2DUUA 3AUFA 4C06A 4RVSA 4L8GA 2I2FA 1AIPA 1P9RA 2XMBA 3D6MA 3O90A 3OICA 4BC0A 3TCKA 1XPRA 2Q5HA 3HCBA 1TCCA 1KORA 3KYBA 4YAKA 5JO0A 3C3XA 1O96A 1NR5A 1SEPA 4MGYR 4RZQA 1XEWX 1L6IA 2GAIA 2ZJ2A 4GRAA 2FSFA 3GJ3A 4UCQA 3ZVLA 3UFXA 4L5CA 1T4CB 1MO3A 4JC4A 3UZUA 1OJ7A 1GWNA 1VI6A 4G1EB 3LT4A 2ZBPA 4S0ZA 2C5FA 2C59A 4TWBA 2IC5A 3OZ7A 4HAYA 4P22A 3ZY5A 2WJ3A 1ECBA 2W0SA 2WIGA 4QGBA 2GSDA 5DMXA 1TE2A 1MIOA 2FR1A 2BGIA 2XKJE 1B6GA 1E3TA 4OI1A 3TNYA 2IVZA 2W58A 3F3YA 5EC8A 4C3UA 5FRDA 4W5TA 5CK5A 5HP4A 4UAVA 3REOA 5FHQA 4P7FA 1ZISA 1NYLA 1WLSA 1QC5A 5FNZA 5AWFC 8ABPA 4Q24A 1UT5A 3D59A 4NICA 3RS0A 1Y5MA 2EAUA 4G1FA 1EUDB 4S12A 4DQDA 2YMQA 3X1ZA 1MV8A 4WRRA 1L0BA 1AZTA 1I14A 2C42A 4XR4A 4G24A 4C21A 1AKYA 1PVDA 3GJQA 5SYNA 2ID4A 3T9CA 3NXSA 4R7GA 3ZV3A 2VK2A 4TZTA 5TMEA 4G41A 4YAWA 5AKGA 4Q34A 4PX2A 3HDTA 1SUSA 2Z8YA 1XJQA 3R5JA 1ETUA 4GPBA 1FFDA 4JBHA 5B1YA 5FX2A 4FYWA 5BYJA 3C74A 4JLMA 1Q1NA 4XGRA 4DR6B 2SNIE 4HGNA 2IHZA 1BHQ1 1YS9A 2C58A 4TV8A 1E1RD 4LXHA 1G2IA 2VT7A 2VT3A 1LDNA 1FSZA 2XZPA 3ZV6A 4AXXA 5DYTA 4P4NA 5EUCA 2QL5A 4MS3B 3FZQA 4ZVTA 5JG7A 2IU3A 4JGGA 1XD9A 4ENQA 2OB1A 3VU8A 3UFBA 3NV9A 2NO4A 3P2EA 1HE3A 3F78A 3GA7A 1MW9X 5JXHA 4FEYA 4NEQA 1GL6A 3LK7A 3LQ1A 5IZCA 5HFAA 3HJAA 3VX3A 3TKYA 4URFA 2YDYA 2C0CA 2QTAA 3TTYA 4RH3A 2V5UA 4E2ZA 3ESRA 2YRWA 4FBGA 2NYRA 4L7QA 1HDIA 4R40A 5AJYA 4BYGA 4C6TA 4J0IA 4BWFB 2CYBA 3OZSA 3LOUA 4INPA 1FFXB 3FR8A 4OP3A 2REQA 1OI2A 1OF1A 1PBTA 2H6EA 3PITA 1HI9A 2Y1FA 5FYQA 5KQMA 3GEHA 4B0OA 4R71A 3L1KA 3NHBA 5LQNA 2IXTA 1SK8A 2DBRA 4DWWA 3FTNA 5G3ZA 1U31A 1YS2X 1R16A 1AK9A 4LISA 2V6BA 3KSZO 4RA6B 1O0BA 4AMVA 3N2GB 1KI1A 4IHJA 4KWCA 4QHSA 5BN4B 1KZ4A 4ZYUA 2OC9A 2BKVA 5FLEX 4JH0A 3NUQA 4RGVA 3ICVA 5GJCA 1BD4A 2BJWA 1YZLA 1EDEA 2X4LA 1EWRA 3ESYA 1YFKA 1N75A 1UBGA 3FJOA 4ZCLA 1WAMA 4DLAA 2NMVA 3PHBE 2VPYA 5B36A 1NXXA 2PUDA 1A2QA 2BBTA 3ZXIA 3JV7A 4KYIB 3C1OA 4FGWA 4RVHA 1Z6GA 3DT8A 4FFBB 3ZZTA 3WC4A 3ACCA 1E6LA 1ZL2A 4XLZA 2AD5A 4B6OA 4UNIA 4FLEA 3H5VA 3B70A 4MDHA 4RAOA 1ZMBA 1P1CA 1QZ3A 1E2DA 2ISSD 1UIRA 3FGOA 3Q72A 5JFGA 1L5RA 4WIAA 4P4GA 1D4ZA 1E4EB 3CF4A 2XVZA 4ZQEA 4F5ZA 4DZTA 3ER9A 2Q3FA 4ARZB 1OW3B 2SICE 10MHA 2A1UB 2ZJ3A 4I50B 1BOFA 4KHZA 1DAOA 4UEJA 5JZSA 3KTOA 4MEAA 1E69A 4GICA 3NBMA 4RBNA 1HPLA 3C6QA 3TOCA 5BN5A 2WF9A 5G0WA 4WCFC 3LQQA 2UZAA 3DLIA 4UHDA 4MPJA 3W6UA 3H3XA 4CMAA 1RRMA 1CW2B 2NIPA 1D0SA 3NIBA 4ZREA 4YREA 2I55A 1QU3A 1AGXA 1NJ6A 4XRGA 1XZQA 1EA5A 1T1IA 2H2IA 3ASZA 1DKLA 4B34A 1P1RA 1VYTA 4U6SA 5DGIA 4UM9D 4DR4B 5LQJA 5E38A 1C3JA 1PV1A 2XJ9A 4NMMA 3RU2A 1O4WA 2DHEA 2YASA 1S8FA 2FQYA 3L7AA 1R6XA 2IHUA 2K7ZA 4X8MA 2YJ5A 3WYGA 2WOJA 4AJNA 5KOYA 3K09A 4ZVLA 4DPKA 4PLPA 1R1DA 4EHDA 1A1VA 3NEYA 1XDDA 1JSLA 3DR3A 1HT3A 4EKNB 3H17A 3NBKA 4LHWA 5CT4A 4FD2A 1T2UA 1H2FA 2J9GA 3NH6A 3G2PA 1IDOA 2IYOA 3BXXA 1QE3A 2H4ZA 2VDMB 1Y37A 1LWOA 2EIXA 1JLLB 3PTAA 1NVGA 3GAZA 3HP4A 3B85A 3WGLA 4N48A 3WWCA 1P5FA 4HEA1 2C4NA 5G1PA 1P6UA 1KAHA 3LU1A 1TPYA 4I2NA 3MQ2A 2YXPX 3RLIA 2CC2A 2J9YB 1B8PA 5ELXA 3VNUA 4MLDA 4JSTA 2P91A 2J59A 4Q4AA 5K01A 2NPOA 3GT3A 1L1EA 1X86B 2Q6LA 3DVLA 4TRMA 1XZEA 4FX5A 1QTNA 4UMEA 3DOEA 1C3VA 2NXEA 3TW0A 5JSZA 2AQHA 1QZXA 3MWFA 4CIWA 1QFJA 1FP7A 3K0BA 4G26A 2D0OB 4LMBA 4QRIA 3I6IA 2I6QA 1INLA 721PA 1P5HA 2NV6A 3TW8B 1ZJZA 2ZUVA 2Y0EA 2ZDHA 2Z9BA 2XEDA 3CR7A 1Y7HA 4XI9A 2BJVA 2E6KA 5ALVA 3PLAE 4JI1B 3U62A 1KZGB 3IUBA 3G2JA 1DC3A 1WNTA 4L5AA 5KNBD 5CH3A 4XM2A 1SULA 4L15A 2QGZA 3EPJA 1CRLA 1RADA 3G85A 1SG6A 1O5OA 3K9QO 1EM8B 4ZQBA 4PG4A 1G4HA 2PY6A 2PBLA 3O4GA 1Z0AA 3NTUA 4U6QA 1QHNA 2WM8A 4IMJB 1GCGA 7ADHA 4V1CI 3F4BA 3C3YA 4CKEB 2XD9A 4BVKA 5B6JA 4A8JA 5EIEA 5JI2E 5DJ5A 3DCJA 2EW1A 4KI7A 2RDMA 3AUTA 5EWLB 4PXSA 2Q49A 1TK3A 2EQAA 2R8OA 5TVGA 2VPXA 2A5FA 2Q46A 3T38A 1WCWA 3EPKA 3OPXA 4JIGA 4DB2A 3RYHB 5FLKA 4A2PA 4UTOA 1FMFA 4NE9A 1Z4PX 3TMKA 2R1ZA 3WAGA 1VZ2A 4N5NA 1XHLA 3JRXA 1IK4A 3G2NA 2FSGA 4E6EA 1T0PA 4YAIA 5BQXA 4OAPA 4QUEA 3GLUA 4YR7A 3I2YX 2CLFB 3O3MB 4RHEA 1E8DA 5KYYA 1MJFA 3CX8A 3T7IA 2AI1A 1YWGO 1I10A 1UBEA 2IYZA 3NHZA 4RMNA 4XUGB 5DKFA 3WK8A 2VAVA 4M22A 3WYCA 4YX9A 2V1UA 3Q7RA 4UPDA 3PRYA 3MC1A 3P0RA 2VWHA 3NYQA 4PPYA 2WUGA 4OGFA 2PCLA 5IM5A 4MVJG 3WMWA 3ZWXA 1AV6A 3GLHA 2TYSB 3H2SA 3M5WA 2AX4A 1UAGA 3NATA 4U3JB 4LY3A 5IAKA 3UCFA 2YQ4A 4UJ3A 4ZV9A 4G67A 4KR2A 3O7WA 3SM3A 3T1QA 1V7PC 2CD9A 1WIWA 4MUIA 2XZDA 3IP1A 4ITRC 4OLHA 4ER5A 1FJGB 1PR2A 4G25A 4WTOA 1AQYA 2IHNA 5KNCH 1QGYA 5FP0A 2Z9DA 5F2NA 3P9SA 1NMEA 2Q2WA 4ALJA 4WDQA 4A9AA 3TPFA 1XHFA 1PT7A 2HIGA 1T0BA 1J0AA 3RW9A 3ZGNA 3HKEB 1A4IA 2V58A 2VTVA 3WKDA 2CMDA 4Y2UA 2O2XA 1A82A 4LBVA 1V6CA 4NBWA 3TDKA 2FRDA 2GWHA 3B3AA 4P93A 1H2AS 3N2KB 4YVFA 5DHPA 3BWEA 1H2ZA 4IDNA 4TM8A 4QU0A 5DTMA 4DMCA 2CB0A 3CNNA 1L8XA 4PR3A 4XWGA 1EKXA 2D1YA 5TDHA 2IK8A 4UU7A 5KX5F 3M6VA 1Q2UA 3Q6MA 3UF0A 3V2HA 3OA2A 1VSVA 2QLLA 2Z30A 1IM2A 1JIQA 2UAGA 3P2YA 3R0VA 4QG7A 3GLSA 4AMGA 4C6TB 2JAPA 3T4EA 4KQKA 5LQUA 3R7BA 1ZMOA 3CX6A 2IS6A 4KPYA 4XVCA 4WOPA 3GMDA 3RSOA 1L3BA 5HIAA 4RDHA 2Q0QA 3Q2OA 1K6EA 4A6EA 4ZOLB 4KRGA 4Z1MA 5EWMB 1N92A 1TOAA 3H9CA 3LFHA 4DLYA 3QVVA 1CR1A 3A58B 3VKHA 1SBZA 4HB2A 3GJZA 4X00A 5IM4A 2DH6A 3EE6A 3AR4A 1OX4B 3BWYA 1NQVA 1PT9A 1C4XA 5ALPA 4Z9AA 2NYVA 2IRWA 3AUYA 1VSUA 5FUYA 3TFQA 2ORIA 1TFRA 1G18A 1KI6B 2R6FA 1ZK0A 4ARUA 1CWUA 2PGAA 3DF7A 4WDRA 3WWEA 3WGIA 1VDZA 1MP0A 2DY1A 1UWLA 4D45A 4KV9A 3X43A 5KYWB 3LYUA 1OYYA 1T9HA 2ATEA 1PVOA 1LV8A 1NUSA 1JS1X 1HORA 3JVEA 1A69A 3M4YA 4LCEA 3E4DA 4B32A 4OJKA 3WNVA 4R3NA 4PAGA 4OA8A 3EWSA 1KA9H 3G9QA 4YFYA 2RKOA 1SOWA 1ZAKA 2OD7A 1ISSA 1P4JA 4RJIA 3VMFA 2YN2A 1IBSA 2G9NA 2G9UA 1MDBA 1QXSA 5GOZA 4QYWA 3WNBA 1PFUA 5LXTB 1WUKS 5CNIA 2ZYRA 4X20A 3KQHA 3SFZA 4G8DA 1DDIA 4BZXA 1MIOB 2ZVQX 3FWYA 4RUKA 3FCUB 4UCXA 2JCVA 2XDWA 1DBPA 3GP3A 3QWHA 3AF6A 5BQ3A 5TE9A 4U2FA 4XQ0A 4NBLA 3ISTA 3RS3A 4ZO8A 3CWCA 2EHJA 4U0JA 1VGVA 1T36A 4X92A 3D4NA 1J97A 1KYZA 4PZCA 5JECA 2V5VA 4PYQA 5LJIA 5F4ZA 2ZWAA 1K5HA 3LM8A 1S9HA 4QBHA 5F1PA 5FBHA 3S2YA 2P8SA 1A9OA 5IUKC 2VXYA 5K51A 1KI3A 3EODA 4EENA 1VJCA 3C48A 4KIFA 2M6LA 1PUXA 4OHCA 5AH0A 3RUFA 4A16A 1UMCA 4C1NA 1ZVQA 4L9AA 2WVAA 5ARDA 5DM70 5GINE 3DOFA 4NCXA 1A9RA 2IPAB 3UB3A 1ORWA 3QW2A 3CZQA 1IXYA 2IXFA 2DUMA 2O7RA 3L7OA 2UZ0A 4AP5A 3J81A 3R3VA 3EZ6A 4WXYB 5LLSA 2UYGA 1UR5A 2H65A 4N0MA 2OSVA 2XIQA 2KBFA 3HVHA 2V65A 2QUHA 1MQ8B 4FYXA 1BX1A 3KT8A 4JBIA 2Q4BA 4E0BA 1FW6A 4A82A 3IV7A 4E31A 2YMLA 4LTDA 4CLDA 1XN1A 1T1SA 2IVFA 3KSRA 2Q9AA 4O4HA 5IJ0A 1O94C 4MTLA 2ZUUA 1YE8A 9MHTA 1RI5A 1XV5A 3ZTYA 4ZALA 2J46A 2OD9A 1X7ZA 5I7WA 1BWSA 3LX6A 4AZSA 1FW8A 2H5EA 3FBTA 3CRZA 4TTAA 1XMQB 1LJUA 4I3GA 3RRMA 4FQ5A 4RYDA 2V3WA 3SMQA 1GGJA 2DHDA 4OLBA 3M82A 3KDAA 4CMIB 1U28C 4Q7LA 4Y1FA 1LD3A 2I7TA 5C8YF 1QKKA 4CM9D 5JYCA 5ALTA 5DMHA 3L92A 1SHUX 3GW8A 4FI3C 2YX1A 1XN4A 1IOZA 2C2WA 3GMTA 1XDGA 1ZKDA 1R0YA 1VECA 3FRJA 2UUOA 2J85A 3DKRA 3W34A 3P0EA 3V2GA 2XNJA 1WEKA 2PMKA 2O2GA 4CIXA 1G38A 5J1TB 4BTEA 4KXFB 1GTL1 5FAXA 1IEVA 3N2EA 2R6ZA 2IU0A 2GA9A 4MV1A 3ABQB 4JT2A 2A6PA 4GKAA 4R2JA 2J07A 1WRBA 3ESZA 3E9NA 3L8YA 5EWJB 3PGVA 1AC5A 1C80A 2HSGA 5B12A 2DLCX 4DJ5X 4DYVA 4Z3OA 4N41A 5L53A 1NU6A 3UC9A 3EWIA 3DEYX 3WGOA 3FDZB 2GM3A 1Y8RB 1M2FA 1SRRA 1D2HA 2R6JA 5DBHX 1G7RA 1DMSA 3F9CA 1UMKA 3EZXA 4EY5A 4I08A 2BLNA 3ANYB 4MUBA 2PGOA 2RAPA 3L9XA 4ZKEA 3RIEA 1G17A 4M9SA 4ZCPA 2CNBA 3EFEA 2E87A 3SPXA 2X86A 2JFGA 1OKKA 3HJTA 4O4HB 5IJ0B 4MRRA 3VOTA 4ZMSA 5IT0A 1CERA 3I1YA 4X7BA 1RJDA 3GCGA 3PUHA 1E60A 2AC4A 3QOXA 4Q1EA 1U28A 3VHXB 2EKDA 1JHOA 3FYSA 4JNCA 4E5PA 2EGGA 2VCEA 1Z06A 3PB3A 4L73A 3EGDA 5BYBA 1GN8A 3ZYZA 4P7KA 5T57A 5MN4A 2JL1A 3FNEA 3GAAA 3L4SO 3IELA 3PV0A 3CRMA 3DZHA 1KJYA 1CETA 3H1PA 3JQCA 4HNHA 4OQEA 1E3QA 3THXA 2IH4A 2VP2A 5JQGB 4JP5A 5FADA 1MR3F 4TVOA 1EFPB 5CT8A 1Y9EA 2I34A 4BO8A 4M1OA 1EIZA 1VKOA 3WDLA 2JFUA 1EGAA 4D8YA 1LY1A 5TEWA 2IEIA 4KXXA 1GLGA 3FVVA 4OO3A 5FBLB 3RYIA 3P0FA 1CKEA 1K4KA 1GR1A 4AROA 4PG8A 3PGMA 2W2LA 4YMIA 3LCUA 1FU4A 3BWCA 3LECA 3MG9A 4NU6A 2R8PA 1PQUA 4EUNA 1USGA 1I4DD 1QE5A 1TCVA 4I50F 3SQNA 2MSLA 2ONZA 3F5QA 3PDUA 3U7FB 1DAMA 1Q0TA 2PUGA 1Q83A 1KK0A 5IBRA 4NYJQ 2WUDA 4O02B 4GKVA 4HUJA 4LUCA 3TQCA 3SVLA 4V2UA 1AKWA 5LYYA 1RCFA 4Q1AA 1R3UA 3KXDA 4KR0A 3CLHA 3G79A 4KH0A 4XDZA 4NECA 3BOSA 3OJFA 2UYOA 1CUWA 4PM4A 1C8LA 1CRPA 5E2IA 4LAFA 3WLLA 4C9BA 5FEMA 2CNDA 4EKDA 4EQ6A 5HK8A 2IEBA 1HQDA 5BSKA 1WSAA 2C5HA 2WSMA 4D3FA 2VHXA 3G7SA 3PXDA 2YNMC 3MGCA 3SSNA 1R8JA 2GHRA 2QVLA 2VHUA 3SBOA 1YR7A 3KQOA 4HD8A 4M38A 4CMBA 3TZLA 4X1YA 5BOSA 2COEA 5G2OA 1FC0A 3REFA 3LVRE 2DVMA 4GL2A 1GNQA 2QN1A 4IINA 4JSYA 2D54A 3D02A 1SCIA 1GDTA 1NDQA 1IG3A 2HLHA 4PS0A 3FFTA 1UP4A 1R66A 5C37A 1JDZA 5DEOA 3A6PC 4R8MA 2B37A 3A4VA 1YQEA 2P5TB 4RXUA 3GX1A 3RF7A 3TOSA 3NVMB 4DDTA 4JXJA 3KEMA 1PK9A 1JGTA 1IZYA 1OX4A 1L7DA 2NQ8A 2RKWA 4BFSA 2CSXA 4F3TA 2WG0A 3NWEA 1QH8B 2HIAA 4PSCA 2CFOA 4JLAA 4BAUA 2NTVA 4QNMA 4OQXA 2QRKA 4WNAB 5ALRA 1CZUA 2BKLA 1LLDA 4FFWA 5JMPA 3D3JA 4WFJA 2BM8A 3CPJB 2YVAA 2QV7A 3GROA 5J63A 1EDDA 2HWWA 4FFRA 3SEZA 4A1FA 3ZS9A 2W4QA 1PQPA 5DK6A 4RQBA 4L76A 3I0ZA 1U2GA 3MELA 1XZHA 2IDMA 3GEBA 2V7PA 3LT5A 1DL5A 4ZJYA 1DWQA 3ETCA 2HMYB 2M32A 1WULS 4PQGA 2ZRLA 3O2NA 4UUNA 1XT6A 3GPBA 4BFVA 1W36C 3BMCB 3BTUA 3GFRA 1NUUA 2Z2JA 4H1VA 1OWPA 1P73A 1Y7LA 2IE8A 1N0WA 2Q21A 5KYKA 4YMTA 1FXSA 1OFGA 3B60A 4J4BA 1SUWA 3SHQA 3ZBUA 1KJJA 4IHJF 4ACBA 2GZ1A 4GBMA 4ETWA 4H7DA 3S0JA 5BSWA 3R7FA 1XTJA 2FW0A 5FWYA 3E23A 2ZIEA 1G7CA 3AP1A 3U7GA 2R47A 1LA2A 1RQLA 1F1BA 3PE3A 4P8RA 2XBMA 2LW7A 5DNYB 3Q9SA 4NPCA 4J0DA 5JAHA 1G20A 3DL0A 1ZWLA 2ZRAA 2ZJYA 3H4VA 4IY1A 4JEIA 3L0YA 2XOKD 1R37A 2E7ZA 4GECA 2PJUA 3QBTA 4ZKDA 1RYDA 3W5AA 2ECQA 3UA4A 4C76A 2O2CA 2RH9B 4PHHA 4CMJA 3LGXA 1E8MA 1I2CA 1Z0FA 3DLCA 3OZEA 1KU6A 1J24A 4CKWB 3VOAA 2QORA 1EX6A 1XD2A 3QLJA 2NU6A 4RZIA 1SUIA 1WUYA 1E1KA 3CLRC 1C2YA 4O4IB 4Q3KA 3AJRA 2W6CX 1ZD4A 1FLVA 2QN3A 2H1WA 3RSHA 3TR5A 1N8NA 1DG1G 3D5EA 1YZUA 3UYLA 4I1PA 1ELOA 3FDZA 1H2EA 4NCJA 4F72A 1PG5A 5KYYB 5EP2A 2VDWA 1AO0A 1E1CB 1GU7A 3CB4A 4Q3CA 5A0FA 5ELLA 4P83A 3WWOA 2P67A 2E4AA 2HPVA 1GTVA 3BSWA 4YP0A 4QAJA 1UJMA 4DA6A 2YN0A 2QX9A 2QL9A 5LA6B 4TXHA 4D9KA 3PQ5A 4PHFA 1K7SN 1OLXB 3AM5A 1NQOA 3B48A 4Q05A 3U44A 1MKYA 2JATA 3EDCA 4MUHA 4EG1A 3BB4A 5I7FA 5KOJA 1L7NA 2PKWA 1CUGA 3LL4A 5BMOA 2Z6QA 2GTPA 1LBIA 3OFND 5T4FA 2OWDA 2ZS8A 3WL8A 3EHDA 2ERCA 3C5HA 1LSSA 3CGWA 4HLUA 4X44A 4Y67A 3FDFA 2X9NA 4FYKA 1LI5A 1U2DC 2CFSA 2G80A 4OQMA 3ZVRA 4DY6A 1Q0QA 2IQIA 5BVGA 5K9ZA 3DHWC 2VNKA 2XXBA 3ETDA 3UMSA 1TTHA 3LW8A 3R23A 3R3JA 5I3ZA 1UDRA 2H4JA 2ERXA 5EPEA 5I7VA 3HWWA 3EIEA 2FWJA 3GRAA 2AVDA 3CJQA 4MOWA 1P61B 1E63A 1VI5A 3MCVA 2QMOA 4W5WA 3THRA 1SRQA 3WL3A 1SC9A 1M8JA 4JKYA 2B78A 5DT9A 4Q3AA 2F3SA 4ZVMA 3L8MA 3L04A 3MMNA 1PJZA 2WDPA 3BE4A 1U2RA 3MWJA 3DPSA 5FR2A 2CF6A 2H3HA 3UPUA 5DYYA 3PE4A 4XSGA 5KHLB 1HEYA 2Y4OA 4AJPA 1NXOA 4FB5A 5AW5A 5EE9A 5JCJD 3D8BA 3CSDA 2VTBA 2JGMA 5T4EA 2JCBA 4B2PA 5LYJF 2FHPA 2FFQA 5NLLA 2HH9A 2AI3A 1CT9A 1MTOA 2AMYA 2DQSA 2OESA 2QJOA 3H8VA 4NFLA 4PPQA 3GFQA 2WM2A 4YXWA 3IMEA 5DCLA 4RCZA 5HUHA 2QTNA 4UZFA 2PLWA 1ID8A 3OQ6A 2CJXA 5EESA 4ECEA 1BHJA 1VLLA 3ZDYB 3O1HB 5EHIA 4HLUC 1CJBA 1S5PA 4NV1A 4MROA 2B0CA 1Z8FA 1RWMA 1Q16A 2HMTA 2NN3C 3BK1A 5EY5B 5IVPA 4FS8A 2X9QA 3JCZA 2FEOA 4MV7A 1P0FA 2DU8A 2QK4A 3EVNA 4JWKA 4R05A 5AKKA 1RAHA 4BNYA 4BZPA 1JSRA 2J3JA 4XPZA 2G0AA 3ROGA 4EJFA 4B09A 2UYHA 1GQRA 1W48A 2O4UX 5FBQB 4JI2B 3JQGB 1BNCA 5ALFA 2PRYA 1LW7A 1JKIA 5LYJA 1ISMA 3JQBC 3A3NA 4AYWA 3WLPA 3R8CA 4FFPA 3ZS8A 1E92A 3KOWA 3LI2A 2OV4A 4NU8X 5BV7A 1QUEA 4F9FA 4MVJD 3FCOA 1GPDG 1PFVA 1Y8AA 2JFXA 1PK7A 1YJ8A 2P4EA 4QO8A 2FEWB 2GHTA 5E4JA 2CFTA 3GJ6A 2WP0A 2QB5A 1DJMA 4E5SA 3DOOA 3ER6A 4IJWA 3K0CA 5FWNA 4WY2A 4A8PA 4Z2AA 1VP3A 1E0SA 3S29A 4PN3A 2HBQA 1A96A 2N47A 3A36A 3FFBA 3M5PA 4O08A 4V0MA 5DN6A 4Z3DA 3C45A 1JA1A 4M1TA 1ENZA 2BOVA 3P0JA 1L7XA 3QUSA 4JLJA 1X6VA 3RVMA 5IEJA 2QRVA 1SPXA 4RX1A 5KYWA 1KFCB 4URVR 2ZRMA 4AI6A 2Q9BA 3Q9UA 1QQAA 1M2JA 3OZFA 2EBUA 3IBGA 3U1BA 4WL0A 1KI6A 1LPAB 2X8AA 1KP2A 4ZEXA 5IABA 1I24A 2A33A 2C8KA 1M0SA 3KVRA 3KVNA 3WJ2A 5LU9A 2AFIE 2Q9CA 3PR2B 1DTEA 2HLPA 4LY0A 4RMIA 5K0ZA 1XZNA 1EIWA 1TO2E 1OIWA 2IOFK 4LSZA 4B43A 3PXBA 1FYWA 2OKCA 2GUGA 3H1TA 1TCUA 5JATA 3GLIA 2OBNA 1W7AA 3QWAA 1Z82A 2QPAA 2QV0A 2N46A 2VDPB 2WHXA 5EWMA 3T35A 1P44A 1LUAA 3ES9A 3M6WA 4HAXA 3O8RA 3OMLA 3I9JA 4B4KA 2Q0XA 4TLCA 5E3JA 4L28A 5JAOA 2A5DA 5LMUB 3PEWA 3DHEA 1FZQA 1NW5A 4ZAWA 1U8AA 4DBZA 3QVJA 5LOVF 1M83A 1Z7YA 1JKFA 1DV1A 2FN7A 1J22A 2JLCA 3OM0A 4HN9A 4KQGA 4CLHA 4ML3A 1XYGA 1CQZA 1R6BX 2BE9A 3CJRA 1AXRA 2CHGA 3HVRA 1OLOA 2BSAA 2QTTA 2ZUWA 3ICPA 3IDZA 5IAOA 1YDWA 2Z43A 4B4VA 4CTJA 4IWNA 4A0SA 3ME5A 3ML1A 2JFYA 1XCBA 2ZBDA 4Y1EA 2X41A 3BN3A 4X0EA 1VE1A 4IAOA 3BRWA 3LPDA 2EBWA 2O5RA 4JGBA 4MJ7A 4DA0A 2CNLA 2FSSA 2H63A 3BFXA 4P82A 3PUJA 5BUCA 1GOTA 1SFRA 1ZMXA 3H0CA 1KH3A 4YMSA 3NO4A 2VT2A 4V0SA 4XYGA 2M98A 5B2FA 221PA 2MU1A 2B2NA 5JCPA 1JQ5A 4BLVA 1HZZC 4G4SP 3SC4A 4HNAB 4RFVA 2BISA 2XKBA 1Q74A 2X5JO 3KCQA 4FD3A 5BURA 2FQ1A 2HF7A 5REQA 4ND1A 1T3ZA 5DM1A 3TUJC 4BRZA 3U80A 2OO5A 1V1MA 3IPRA 4HVCA 1Z3CA 3K7EA 3MWKA 4ZANA 1QMGA 3UMVA 3EZNA 1RM4A 3RHFA 2J8ZA 3L0PA 3AFOA 3HY3A 3JSAA 1P3Y1 4MR9B 4YNBA 2VAXA 4NZOA 4OMDA 4WKNA 2JGIA 3B5IA 3FTFA 1ZP6A 3UV6A 4WNIA 5ESDA 1EEXB 2ZVJA 2PGLA 4RULA 1QYXA 4I4LA 2H1FA 1P2FA 1QUFA 1T8YA 4ZARA 3FPJA 3U4IA 4PFJA 4EF4A 1D07A 4NARA 3WGHA 4EL0A 1I4EB 5F3RA 4XWOA 2AQKA 3A31A 1N9GB 1NG1A 3FOBA 4I6EA 4K8OA 4O2AB 1C9JA 3HV2A 4P5PA 1WXWA 3IAM6 3VV3A 2VHVA 4C0KA 2AMFA 3CZ4A 2LTAA 1HDRA 2WUEA 3HV0A 1Y3CE 3FIUA 4C08A 3O73A 4F3YA 5F3DA 3MAAC 4W5OA 1ARZA 2XRMA 5FFNA 1EGQA 4CDMA 1I9CA 3P19A 4ARCA 1E2LA 4Q1CA 1DQNA 1ZGBA 3GIDA 6LDHA 3N0WA 4RPGA 2PJDA 1JBKA 4K46A 1ZJJA 1WCYA 1SWVA 3NS7A 4CKEA 4S1TA 1ST3A 1M6NA 4FJ2A 3RFTA 1KTIA 2GEFA 2RE8A 3PUYA 4JUDX 4HWGA 4XGIA 2XADA 3BEDA 3G8YA 3M7IA 2G5TA 5D85A 5H16A 1MH1A 2GAJA 3MJDA 2O4CA 4B3RB 2V5AA 3IYLW 4LBYA 4QD3A 4YJDA 3ZKWA 3GLFA 4D8TA 1J1UA 1KEWA 2YXBA 5HJ2A 4B3MB 1VJ5A 1T9ZA 1Z4LA 1LLFA 1WY5A 4MHSA 4OJTA 2DQZA 2X77A 1U1CA 3O2QB 4NBRA 4Y1RB 1A9ZA 1TK2A 4ALLA 1REQB 4ZYXA 1FYDA 4CG3A 4OXKA 2LGJA 3WGJA 5C80A 3LV8A 3TNLA 1DTWB 2K87A 13PKA 4DLPA 3T5PA 2NXJA 1YZGA 1ORIA 1GYPA 1U8YA 2JI6A 3FCAA 4A5SA 4M9QA 2BMDA 3ZHRA 2EW8A 5JOQA 1N1MA 3M5DA 3NRCA 3E9CA 5JZMA 1MRNA 1X7DA 3KLNA 4JD5A 4RA9B 5HUJA 2GD6A 2HHAA 1NM5A 3SQOA 3GFOA 1C9DB 4BX8A 1VLJA 4R9UC 4AZ0A 4E94A 1B3RA 1QIJA 2JBAB 3BF7A 3A04A 3ICQB 2BAGA 3NB0A 1VHDA 4EX6A 5B7GA 1KMHA 4UUQA 1N2XA 2WINI 3HU5A 1IJKA 2DKNA 5B7QA 2A0YA 2IDKA 2YINC 5ERXA 1ZKMA 5AM0A 2YWHA 4RHCA 2D4HA 4ESVA 2O7QA 3H4IA 3DR5A 4MDFA 1GG2A 2F64A 3OA0A 3LPCA 3NGLA 3B89A 2WJ4A 5JCOA 4TKVB 4CF6A 2FMTA 3I72A 4J1TA 5EP1A 4CM4A 1YBVA 3TZHA 4DC9A 2XA2A 1OC2A 4UATA 1H8EA 3OEWA 3DOJA 1TT7A 4NAHA 5BOSB 4DHWA 1U2SA 1SUBA 2Y0CA 3Q8XB 4JLDA 5JHGB 5JV5A 3W7BA 4B6GA 4MHTA 2J7PA 2JLUA 2ZOSA 3KKNA 3ORFA 3HDHA 5BVGB 4TUYB 3AQIA 4NZZA 3H87A 1H4TA 3OPYA 1LC0A 3L40A 4XJVA 2OCDA 4XYLA 2WF5A 3G1TA 1IN6A 5JSUA 3SWWA 3IV6A 1ETHA 3W2EA 3WK7A 5G0SA 5AJHA 4H4DA 1O6FA 4RTMA 2WM3A 4GQBA 5JZBA 4GZLA 2C4KA 2I6TA 4WFIA 1CDZA 3ZZ0A 2P65A 4L74A 3U44B 3LAWA 3LYAA 4LGVA 1Q7GA 3V4RA 2R79A 1EK5A 5BN5B 5C34B 1USWA 2AOVA 3H2JA 1ZICA 3CW8X 4JUFA 1H2YA 3QKIA 2ZE7A 3ELWA 3HSSA 4PC1A 2O8CB 3BHMA 2IPLA 2OR3A 3JU3A 5ICFA 4F4CA 1Y34E 2ZSJA 3ZD6A 3W8EA 2PUHA 3GB9A 3HB4X 4BFUA 4CM8B 5JMTA 1GR0A 5L4NA 5JROA 4O4IA 5DI3B 2P11A 5HF8A 3S7ZA 3WG9A 1C7JA 1GL7A 1NQUA 2WJIA 3FRHA 3UJ8A 2PX5A 3EMBA 4HQ6A 4CHTA 1GAXA 3CUVA 2HQBA 1KBZA 1EB9A 2IYYA 2QZ4A 3PQEA 3THXB 1T43A 1HLDA 3K0FB 2F8LA 3MTEA 1H1DA 5LPNA 3S70A 2FWBA 3USZA 3AVYA 2X4GA 3TE7A 3F2IA 5GAJA 2MDTA 4BFZA 4P3YA 2H51A 1G8JA 3AYZB 1KMIY 3HN7A 3V6LA 3K6SA 3D1VA 1M0WA 2O7SA 2VFAA 5FL7D 1PS8A 3IERA 2PDAA 3W5SA 3VO1A 4UTNA 5ADHA 5K4GA 3WR5A 2PFGA 1WQ3A 1YQ9A 1B2RA 3HLKA 3I9FA 3K0FA 5LMNB 4MLZA 2SHKA 2JGNA 3DZ8A 2X2PA 4FR0A 3KJEA 4F2DA 1ZD8A 5KCZA 4UHFA 1U8XX 2PXAA 1M6VB 4Q9IA 5A4IS 1YI1A 2XW6A 2B4QA 3K6KA 1GGNA 2O0KA 1GKKA 2F3UA 3IDSA 4G0OA 2JB9A 4TKMA 4C6HA 2BFFA 2ESRA 2PTGA 3G89A 3S2UA 3UWMA 4G0XA 4ILEA 4CCSA 3AKZA 3FNQA 3KAJA 4NMLA 5HGXA 1GITA 3N39C 3D5QA 1HYBA 5BWCA 1MDFA 3SX2A 1NVEA 2MYUA 2RHGB 4EPVA 5GIPE 1CUJA 1PFWA 1JWLA 4E70A 3GK3A 2Q6TA 2AYZA 5I9MA 3RRYA 2ZXUA 3ZW9A 4R54A 2G72A 4QTXA 1EVJA 2OO7A 3CKLA 3O8OB 4K05A 1Z0JA 1F51E 1TJ3A 4PVCA 4BO6A 3H9JA 2B7CA 4LSGA 3DAGA 4F3KA 2J0SA 2XLBA 5AXAA 2FPSA 2QN2A 3CGGA 2P90A 4S3MA 4R16A 2AXEA 2AKYA 1JA0A 4A27A 5DBIA 1FUEA 3C3JA 1ND6A 1XJ5A 4BP9A 5CXQA 2E5FA 2HBYA 2JJ1A 3JWJA 3W9UA 1PNTA 2V98A 4AWXA 2IZ5A 1BN7A 4F86A 4KPEC 1BFUA 3ZJVA 2BBSA 3OZXA 2A0WA 1IUNA 2X1MA 3CNLA 5ES3A 3DEKA 1GQSA 2BGNA 5IKEA 3L0DA 5SY4A 3KB2A 1I6LA 4IDPA 2PIAA 2HRBA 3U61B 5A3QA 2WU4A 1IFXA 1YC2A 2I1QA 4HEHA 4PC2A 2CJFA 2ZJ6A 4BTVA 4C1BA 4EGJA 6ADHA 1BE1A 1V4NA 3QU2A 4A0HA 2V6MA 4GOOD 4X6LA 2V7QA 2O8DB 3F5FA 1KRWA 4CM4B 2PVCA 1X7ZB 2PH7A 3CF2A 3E7FA 3RBAA 3SICE 3WLTA 2ETXA 3ZIAA 4TKVA 1S2IA 3H9BA 1Q57A 3T1NA 1G2PA 1AGNA 1P1FA 2FSPA 4NDAA 4WOJA 5IDVA 1Q1QA 4Z0HO 1O97D 1AY0A 1UPTA 1N7HA 3HKDA 3NAGA 4PSUA 4X1OA 3RS5A 5FPKA 1B8UA 1OI7A 2FG5A 1PWHA 1KY4A 4B85A 1FFSA 2DSNA 3L1UA 1Y33E 4AC9A 4RQUA 1OHHD 2O8NA 3BQNB 3Q11A 2EW2A 4MW0A 1UJ4A 1A7KA 2YZMA 1N36B 1QV6A 4UUPA 3TX6A 1Z33A 2W6ZA 2C77A 2QVYX 4YAFA 2ZREA 4AZ0B 4YMGA 4GGMX 2G06A 3C15C 1QBGA 3RVRA 1XMPA 3EA0A 4ZHSA 4RGBA 3OCVA 3RRXA 3M6UA 5IM4F 1ZK1A 3DDCA 4FZJA 2HZ7A 3AVOA 1H5QA 3HYTA 4IIEA 4LRTB 1Z8HA 5KNDD 1AF4A 2J3DA 3KQMA 3E3LA 3DZBA 4AG6A 1T5SA 1WVMA 3QHQA 4JOSA 4UUAA 3DKVA 1IM8A 2CMFA 3IAAA 3PPXA 5ALXA 5NULA 2I9PA 5EE0A 1VMAA 3FZYA 4DQUA 4CV0A 4ZHQF 1QG0A 1FFHA 2OHGA 2YS7A 5KNLA 1PDWA 1Z0DA 4BP1A 3A06A 1T36B 4BEWA 4P84A 4H35A 1RRPA 3E81A 1NRIA 2V74B 2ZSBA 3OM9A 1V26A 4XPIB 2VEDA 3N6XA 2QMZA 5ALEA 3LHDA 1DO2A 2GEUA 3C16C 4HZGA 5MDHA 4J91A 3HTXA 1PT6A 2CJWB 1A9QA 1I3KA 4W1PA 3LBFA 3TZCA 1ZNQO 3CZ5A 4PLFA 1LVGA 1SC4A 2Z6VA 3LZ6A 4HYYA 5F1KA 2XYPA 4RENA 1POWA 1UAYA 1NBIA 1U8CB 2P0EA 2D5AA 3LC7O 1YVDA 3PGKA 4OQ4A 2IUUA 2G6BA 4QPNA 5A62A 5DWDA 4Q3OA 5HS4A 2DEUA 3NHMA 4WLOA 1BS1A 1FX1A 2IFTA 3OIWA 3VH4A 4XTRA 1Q91A 3BTOA 4R1MA 4QX6A 5IK2D 2OORC 3OTQA 3K0CC 1D6JA 2Z5FA 2ZU6A 2I3DA 4DCSA 3F1LA 2WJZB 3E2IA 1WSBA 2EX4A 3EY4A 3OX2A 5K0LA 2GCPA 3EZ9A 4F4HA 1SB8A 1Q15A 2R11A 2ZTSA 4NNPA 4QU5A 1L4LA 1AGYA 1PYGA 1W9MA 1BROA 2J31A 2PSFA 3L7BA 4LF6B 1GFZA 2ACVA 1BDMA 2XRFA 1DVRA 2TMYA 2JANA 3S2GA 1I0ZA 1NQAO 4YRJA 4HWPA 1IK6A 4M1QA 4WK4B 4EQZA 1N2HA 4Z4EA 1HLPA 4HGYA 5BP7A 3RFFA 3WGNA 3I32A 4MR9A 1N2SA 4G3XA 1F06A 1JMYA 3EGXA 3PLNA 2X8JA 4TV9A 4ZQHA 3V8VA 1BWPA 4C3VA 3FLMA 3LDGA 2FEAA 4ERNA 2ZVDA 4MKXA 2Z4SA 3V7YA 5C3MA 1FVOA 3JXEA 4Z51A 2C57A 2ZT5A 4K9PA 1ANKA 5CA0F 1WNFA 3QKUA 4BKUA 5JYBA 2BGGA 1C0EA 4F84A 2DZDA 4EWLA 4HNAA 2W6QA 3L4EA 4ZEMA 1SEVA 5F1OA 4FOLA 4ETNA 2P9FA 1GQQA 3BXPA 5GQSA 2AG0A 4I1UA 5HQJA 1TQHA 2WPDD 4U7TB 1NHWA 4OIMA 4M0FA 2XUIA 1G6OA 1CUFA 1ZVJA 2XE7A 3O2JA 5K7SA 3D43A 1YXMA 1LJ8A 5TT1A 4AJLA 5EUQB 4A2CA 4H31A 4YMVA 1HK7A 2WUWE 5A3VA 3MVEA 3RSZA 1GM5A 2FTKE 1WMEA 3D8TA 1KDTA 2F1KA 3NIGB 3GG2A 1I01A 5B1IA 3RT1A 2OK7A 2ZRJA 3EPHA 2BFFB 2PH1A 1RRKA 4L78A 2H57A 3V7UA 3HBNA 3NBAA 4JNKA 3ICEA 2MYTA 1NMSA 1A7UA 5JZ9A 4PFKA 1DDOA 4GM0A 4XWAA 4PG5A 3V8MA 1T9CA 1NP3A 1MAUA 3FPBA 3K09C 1MVLA 1WDTA 4ZTBA 4DG9A 1W5TA 2DWUA 3TB4A 1DJQA 1CHNA 1WMBA 4PIVA 2XUOA 4EUSA 1HA3A 3AKEA 2BEUB 2HEIA 2CXRA 2R7MA 3FHOA 1N2EA 2B9VA 3AI3A 1WW2A 3PU6A 2WLTA 4IILA 3UYKA 1W0KA 4PONA 3CVVA 3PF9A 4F3RA 4DCMA 4DV3B 1B73A 3E3OA 3GFBA 1Y5LA 1E32A 1G3UA 2QJFA 3NAQA 4ARVA 4EKEA 5ESWA 3WWYA 1A77A 1HSOA 1KEEB 1M1YB 2FKNA 3KPJA 2VBCA 4CI0B 1U0JA 2OGWA 3HBJA 3WXMA 5J2UA 4QT0A 5EMLA 1MF7A 4B8YA 2RGBA 3IT2A 3MMSA 5K0TA 1PYDA 4XA8A 1PFKA 1QIFA 2VAMA 2WTXA 5TQJA 4LE2A 3T12A 1SCKA 3Q15C 4ZFNA 4DR2B 4IIJF 1P7YA 3WHPA 1X14A 3X2EA 1EFHA 3ACDA 3BORA 4H59A 1JB1A 4PBRA 4Y2PA 3REQA 5LLTA 1JG3A 3K70B 4MA5A 1W59A 3V4ZA 3GUHA 5DTQA 4J0CA 1IN7A 3P52A 2GGSA 4LSMA 3HKBB 3TLCA 2EFGA 3ZHTA 1VMKA 3AOGA 4CHGA 2KLHA 2BR5A 2IL1A 2WWGA 3JQRA 2OO3A 3EQ8A 3RYTC 3D64A 1G1AA 3VZRA 4L5IA 1CPYA 4GP9A 4HZIA 3RF6A 4IDOA 4FW8A 4HNGA 5EWLA 3ZCVA 1ID1A 1FLNA 2I2AA 2I80A 5B1SA 4TUYA 4Q9AA 1FXWA 3WBJA 2ZYSA 3P9CA 5FKJA 7GPBA 1CFJA 1LLCA 3QX7A 3FTCA 3O1JC 1OQAA 3KZ1E 2JGDB 4N3GA 4CL0A 1TEHA 1R00A 1WXFA 1ES9A 1EM8A 3R75A 3IVGA 2J3EA 2JHCA 2XUQA 2J6HA 3EZGA 4CCYA 4E7OA 1K06A 2YJGA 4IXWA 5JBIA 2XT6A 3DW1X 1Z2DA 1D4OA 2OV6A 1IYZA 1X9GA 2R4UA 3TEMA 1J5PA 4OBEA 2P2YA 3WNQA 4GRDA 3VTAA 2W11A 2D7DA 3JZMA 3K96A 3QNUA 1CFZA 2FWNA 3FHTA 3UAOA 3PCXA 3DXYA 1YQWA 4Q0MA 1G66A 4KQ1A 4DN6A 4NBVA 2ZIGA 4OGLA 3GCWA 1M34B 2HA2A 2Y1XA 2W4IA 1Z36A 1CR0A 2VP0A 3U16A 3GG9A 3WWPA 1Z34A 3I62A 1PJ4A 3C24A 4LJYA 4J16C 4P5DA 1K3UB 2EKLA 4KSYA 3PQ6A 5FPQA 1BZYA 3WIBA 4YMHA 4ZHQA 1UK6A 1OFIA 3K31A 3W9SA 4A8TA 2ZU0C 4M1YA 3R4CA 3SBDA 1WHSB 2OENG 1A9XB 3E7WA 5ITZA 1DQSA 3WA7A 5CB0A 3N2NA 1J0EA 1ZWKA 3C7CB 5FUBA 3ZDAA 2OWEA 3DEJA 3N87A 1KI4A 1W29A 2VNIA 3K5IA 1JAYA 1E79D 1H2XA 3IP8A 3Q4GA 4Y1RA 1XLTC 4JJFA 1WU7A 1CJSA 3N59A 2A78A 1JQEA 4TGLA 2C4UA 3AV3A 4YMWA 3BL5A 4BWGA 1T13A 2CNNA 2YC4C 3I5MA 4INOA 4WNCA 2OHFA 2QX7A 4HAWA 1VC2A 1Y1SA 2RI6A 2XUHA 5E9WA 5DASA 2H11A 4OFWA 4X71A 1K3TA 1JFVA 3K0HA 1UKVY 1FXWF 2X3UA 3NYIA 1U98A 3VYTB 3PFWO 3KDSE 1I3LA 4FB4A 2JAOA 5BPFA 2I71A 2ZETA 4TQ9A 1GA6A 2ON6A 3SIXA 3SC2A 1RBQA 1AJEA 3DYBA 1IEXA 4RIIA 4ZRNA 2A3RA 3SIPA 3OJLA 4Q1BA 2WBLC 3DVRX 1F9AA 4CM9A 3GVCA 2WABA 2GK7A 2Y6VA 2YYSA 4L0MA 1VE9A 4M0KA 1VRVA 1CIVA 4O2AA 5ALDA 3NV7A 1HURA 3E9EA 1RWWA 1Z0ZA 2DYKA 2EKPA 1J09A 4LOIA 2ZRKA 2HSWA 4XD2A 5A03A 5ED0A 1CRZA 4A73A 2XEXA 1Q0RA 1JH8A 1NXVA 1G9XA 3LY5A 5JJ5A 2JLZA 5CUQA 4EJMA 1UAAA 2E4YA 4TV8F 1CQIA 3RWBA 1GA1A 4M37A 4TSKA 5K4AA 4DCVA 5DLPA 4W5HA 4L3WA 4H7PA 1HDOA 3ABOB 3ODPA 1AUXA 1IRIA 1L9KA 3OC6A 2A1IA 3U4MA 3ENNA 2BDEA 5DGTA 3VPSA 1GUYA 1GSAA 1TJPB 4CF4A 1PQ4A 5HHTA 2CV2A 2OXTA 2WIFA 4X97A 2NPIA 4IKPA 2C96A 1EPUA 3PNKA 1RR6A 1BU5A 2PA0A 4QJ5A 4ZT6A 3WMXA 1CVIA 2IHJA 4UFNA 1SQSA 2IIQA 1TLTA 2WQ7A 4UD2A 1Z63A 5CEEA 4LF9B 4CEJA 3CLTC 4AZVA 2VF7A 3C3PA 2IBTA 5BSUA 4RA6A 1W0JD 4CQMA 2XYGA 4G5YA 1K27A 2X1VA 2YV4A 4I55F 5A4JA 1HM5A 2QW1A 1H66A 1Q19A 4I4TA 4YACA 2O2SA 5AR1A 4F91B 5I5GA 3AZPA 3CKMA 1HV8A 3L6UA 1TZKA 2DFKB 3INTA 3QYAA 1T4BA 5K6AA 3JYHA 2FFBA 4ESEA 5CXXA 4JT9A 3THSA 5IXSA 3BE6A 2H0RA 5TSDA 1Y48E 1GEGA 4JY7A 3OZUA 4M4SA 5AICA 5DWVA 4ND8B 2OOSA 4YJ2A 3HJFA 2OFWA 4KAAA 3THWA 4QZVA 1V3QE 1GGKA 3V1UA 2TMKA 3IHLA 4IIVA 2HQ1A 4NJOA 2C54A 2NACA 3UMJA 1VFNA 2ZB2A 4Q9KA 4ZHQB 3DB2A 2ZRFA 4XM0A 5JAUA 1U2QA 2MSKA 2XE8A 4N5DA 3WL6A 1RYMA 5PNTA 1T9GR 2AK3A 4AU1A 3TUZC 2YWDA 3PFIA 3DQQA 5F2KA 3GLIB 2DM6A 3IJRA 4BJ5A 2AW3A 3OPYI 1RYNA 5E9AA 3B8HA 5DTEA 2XNDD 5A6VA 5EMJA 1DPGA 2F1OA 4Z6KA 5K8TA 3MHTA 3E2PA 4XQGA 7ABPA 2I1LA 2NZ2A 3I73A 4L0CA 2PMEA 4MB2A 5ALLA 3FTQA 1AHPA 2H1SA 5F2OA 3C97A 4HX2A 2X23A 1Q1GA 1E6KA 2OB2A 3PZRA 3W5CA 3HO6A 1OV4A 2H2HA 4EA9A 1Y9ZA 4KE9A 5KHOC 1JQLB 2XVYA 2HT6A 2J3IA 4N3AA 1HRDA 3L8CA 4QPJC 1MO2A 2ZRHA 3ELUA 3F5SA 5J4YA 1QX4A 1WXGA 3VSCA 3INNA 1CX9B 3P26A 1EX9A 4L9RA 5C8YB 1H9AA 4HUQA 4OUDA 3PFHA 2C3OA 1AH2A 4LHYA 1WB6A 1NKTA 2JFFA 1DC7A 2XQVA 4OQDA 4M2LA 5SY9A 3FDIA 3E7DA 3LUBA 1WVIA 1G64A 5ALYA 2NOAA 1L1QA 5DX1A 3T7DA 2O23A 4FZ3A 2IHVA 3LVQE 2TRSB 3C5CA 1QP8A 5JWOA 1N32B 2BZ0A 3P94A 4O3MA 2CDRA 2BEWA 4E5YA 1UBTS 1D1QA 1KDOA 4ZVNA 2A1UA 4NX2A 5TIIA 3RR2A 2QM0A 4ARZA 3LX5A 1DEOA 2QE7A 3PXXA 1L4NA 5F77A 4H3HB 1ZS9A 2PLFA 3DW3X 3H19A 5LYJB 4I55B 3IX7A 3OWXA 5IWCA 4ZT2A 1JDSA 2GZ3A 4UU0A 3DKIA 2CXTA 1T34A 4MWSA 1MOQA 2FW7A 2P9ZA 3UOWA 2DQYA 1ZCJA 3BWBA 4DCNA 5IKXA 5JNVA 2JVKA 3M6AA 2ZSAA 4H0NA 1P2DA 2P3LA 3QTLA 4KWIA 4AY4A 3IJEB 1DBIA 1N5RA 1I3NA 2GM9A 3A7EA 3DZKA 3MCTA 5D3MB 4JR1A 5L4SA 1X1AA 2C83A 1U2PA 2VSQA 1N0VC 4V1CB 4ZQIA 3T7SA 5CJPA 3FYTA 1V96A 1QYVA 1Q0SA 1O89A 2BY4A 2O57A 1HT2E 1XKTA 3HEAA 4LWOA 3EGDB 4XSHA 1A8UA 5SZIA 3ZBQA 3HZHA 6CHYA 3AHIA 5MGBA 1L5KA 1YFLA 3IA7A 1R0XA 1JIJA 3DNFA 3CLSD 4NENA 4YLEA 2I4NA 3WLNA 1YR1A 2P5YA 4JJKA 1LNSA 1K7XB 1QRDA 5IXYA 3FOZA 2F43A 3CF0A 3WMRA 1FDIA 3HB7A 2DCMA 4AAYA 2IF0A 3AR5A 4D4JA 4Z5XA 3TL6A 5T7BA 4NBKA 3RRBA 5EQDA 5B5SA 1CZLA 3F8WA 2ZJBA