4D9MA

Crystal structure of diaminopropionate ammonia lyase from escherichia coli in complex with aminoacrylate-plp azomethine reaction intermediate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
396
structure length
378
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSFMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Diaminopropionate ammonia-lyase
total genus 130
structure length 378
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9mA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9mA01
2DH5A 4HN4B 5DBHX 5DVZA 5E0KB 4AECA 1VE5A 4D9KA 1Y7LA 4F4FA 3IAUA 2V03A 1V8ZA 4D92A 5I7OA 1V7CA 1K8YB 5CVCA 3VSAA 4HT3B 1WDWB 2C2BA 3TBHA 5C3UA 5B3AA 4D9GA 1X1QA 1WTCA 4OFXA 1CX9B 1FCJA 1TJPB 1PWEA 5I7WA 5D86A 4KKXB 3DKIA 3PC3A 2O2JA 1CW2B 1A5BB 1BEUB 1KFBB 2BHSA 3AEYA 3L6BA 1TZKA 1KFKB 4HO1X 4OREX 5BW6B 2J9YB 5D85A 2EFYA 2GN0A 2Q3BA 1J0EA 3VBEA 3PC4A 3R0XA 5EY5B 5J5VA 1KFEB 2ISQA 1QOPB 1TZJA 3IQGX 4QYSA 3DWIA 5B55A 1D6SA 5IW8A 4D8TA 2GN2A 1KL7A 2ZPUA 2CLEB 4JBNA 2EGUA 3FGPA 4XUGB 1Z7YA 4L0DA 2CLHB 4JBLA 5JJCA 5KZMB 2RHGB 4LMBA 4HPJB 1JBQA 4ZQCB 4ZU1X 3AEXA 4D8WA 2BHTA 1OASA 2DH6A 2O2EA 5I7HA 1TTQB 1TZMA 1E5XA 1KFJB 4Y6GB 2WSYB 3SPXA 1A5AB 1UBSB 2ECOA 4LMAA 4D9BA 3X43A 4COOA 1TYZA 1TDJA 3VSDA 5JISA 4D96A 1TTPB 3L6CA 1VB3A 2TSYB 1TZ2A 2CLKB 1K3UB 1P5JA 2Q3CA 3PR2B 4HPXB 2CLIB 4D97A 4NEGA 5KINB 1K8XB 5DW0A 1PWHA 4WX2B 1QOQB 4L3VA 1K7XB 4I1YA 4D9NA 2TYSB 3VSCA 1J0AA 2CLOB 1A50B 5DBEX 1Z7WA 4L28A 5HBGA 5IWCA 5DW3A 3R0ZA 3X44A 4AIRA 1K7FB 2GN1A 4D9CA 2RKBA 1RQXA 1C29B 1V71A 2J9XB 4D9MA 4ZU6X 3ZEIA 3HMKA 3DWGA 4LI3X 3SS7X 2RH9B 1KFCB 2CLLB 3IQHX 2JC3A 1C9DB 2TRSB 3PC2A 5J43A 2J9ZB 3IQIX 4H27A 4NU8X 5I6DA 3FCAA 1WKVA 5I7RA 4D99A 5B1IA 4L27A 1K8ZB 1J0BA 1FUYB 4D9FA 1O58A 1VE1A 3VC3A 5B36A 1A5SB 1K7EB 1UINA 5B53A 4PCUA 3V7NA 2PQMA 2Q3DA 2ECQA 4IL5A 5T6MA 1J0DA 2D1FA 2C2GA 5IXJA 5D84A 1F2DA 5D87A 1WBJB 5I7AA 4D8UA 1C8VB 2CLFB 2ZR8A 3CEPB 3BM5A 4D9EA 1UIMA 3SS9X 3L6RA 1J0CA 5CGQB 2ZSJA 1M54A 3RR2A 3T4PA 4D9IA 1BKSB 5B1HA 2CLMB
chains in the Genus database with same CATH superfamily
2DH5A 1U7HA 3AP2A 1NBWB 2HMUA 3D8SA 1VL0A 2ZBFA 2ID9A 2WJJA 3MYRA 4QG7A 4X54A 1BS9A 2ZM5A 3PJFA 1PT8A 3BSYA 4C7MA 1GCGA 1HEYA 3U6BA 3HK2A 4CQNA 5CM8B 3QEMA 2O50A 3P4XA 2H2GA 4ZIRA 1G2PA 2IIVA 1MMFB 1RKXA 2Q2NA 4FU0A 3AJ9A 3MHPA 4IO0A 3A1UA 4BVFA 1MG5A 1DOHA 2GBLC 2SECE 4ZV9A 3U7GA 1IY1A 3FTQA 2J48A 2TS1A 4WZZA 2GZ2A 4KRYA 2JJ1A 3MILA 1U9CA 1YIAA 2AFVA 4JJ7A 4MDYA 3ANNA 4FHEA 4KWIA 5A1JA 1BQEA 1LSJA 2EARA 5DJ5A 1BN6A 2EW2A 3P45A 4AB1A 4KK4A 2WUVA 4O2RA 1O08A 3SYRA 2Q4OA 3M83A 2O8FA 4R2IA 4GLJA 1GZ5A 4PG6A 4ZYWA 1Z26A 3NBFA 3TE7A 2VHEA 4GMDA 3HN6A 1T6XA 3B1XA 5FFMA 2HREA 3TGWA 3VNAA 4BYMA 1WW3A 4EHAA 3PXGA 1PK7A 1BMFD 4NMXB 3ZEAA 1WY7A 5TGDA 3NHSA 1GPJA 3DE4X 1G8MA 4Z53A 1IDN1 3D7RA 3WP0A 3LSYA 2UUCB 1Z8NA 2A92A 1CT9A 4ZDIA 4JI8B 1TTQB 3HBJA 3IUQA 4JITA 3ZU5A 3ZS9A 3F3YA 1HMPA 1W44A 2WQZA 3T7DA 4MS1B 1U8XX 3PSAA 4IIJA 2ECOA 3SR3A 5JMWA 4D26A 4XRGA 3QPVA 5A1TA 1YMQA 4BNIA 5LM3A 2B20A 1O0BA 3CUUA 1B8UA 4YMSA 4LF5B 2RGCA 1CZUA 3NJ8A 3LRTA 4IX1A 3OKPA 2ZU0C 3TD2A 1L7NA 3EGCA 3OJ0A 4YBRA 3UT5B 1AKQA 4QUGA 1UBRS 3E0QA 4WKGA 1YL7A 3TNDA 3VZRA 4N1AA 2C5SA 3HWRA 3SG0A 4OJNA 3UTCA 2QUKA 4PR0A 4TTQA 1F8XA 5A7FA 2WM3A 2XQJA 3K1TA 5LMUB 3MOGA 1C41A 5E6SA 3SKYA 4AY4A 1ODFA 3O4GA 4LI3X 3V7UA 4CLHA 1MD9A 4J0IA 2N46A 2JHFA 2FW0A 4JIGA 3BULA 3B2QA 3LLVA 1QDLB 3M4XA 2P11A 3GJ6A 3QYAA 4X7PA 2DUMA 1ECPA 4KPEC 4XTCS 2ACKA 1HOTA 4RE5A 4PZCA 3JTMA 3ZHQA 1SOUA 4RY0A 5J2UF 4WLNA 4YCLA 4KJXA 3MXOA 3L8MA 3AF1A 4P1ZA 3GAZA 4QXPA 3D4LA 4RENA 4L6CA 3G2HA 1NQXA 4Y2SA 1QAMA 1QH8A 4P31A 4XCVA 3GH3A 5JCXA 1DG3A 4GYKA 3U4HA 1QFJA 2QZ4A 5HMLA 3CJRA 4BZQA 3HRIA 4HNHA 2E1PA 5ENZA 1I6LA 1NXSA 1W94A 2X9VA 4HWRA 4ZAVA 5J1SB 1EX6A 2Y2UA 2XA9A 4C2AA 4POOA 4P08A 2VHJA 3VO2A 1UP6A 2OQ2A 3G9TA 1S3FA 4A3SA 2FRDC 1E1NA 1P3Y1 5B3JC 5I7OA 2HKIA 3A32A 2E6UX 2J85A 1CUIA 1VP9A 2JH9A 4RY8A 3F9RA 3LBYA 4PYQA 4QGBA 2XHEA 5LC1A 5EE1A 2CUKA 1U6KA 4E2FA 1H2XA 1K0UA 4I4IA 4N0EA 7MHTA 1GTJ1 2BHRA 4HS4A 4WZAB 3CZMA 1JIUA 2QE7A 3GFOA 3KHSA 3UJ6A 2JS7A 3M3HA 1E5QA 1ZJ6A 2M9MA 3H42B 4WEOA 3TUIC 1D1SA 1QHSA 3PIRA 3M4YA 2J7PD 1AO0A 2E4ZA 1GZVA 1Q1ZA 3ETGA 2HA2A 4PGFA 3FYUA 4L9SA 5GV7A 1V39A 2ZSKA 1SOAA 3DKKA 1DADA 3FOCA 2VPWA 4XQCA 1K2WA 2IYXA 4MV0A 4D0NA 3C3CA 2VUIB 2YJTD 1BG6A 1TD1A 1GQSA 3NT4A 3SDSA 4D82A 1R00A 4X1KA 3MWEA 1TD9A 2IY9A 2QVCA 3P71T 1U2QA 2CHVA 4YRFA 2NT3A 3VKVA 1Q57A 4KKVA 1JI3A 1GPYA 1UPBA 4PC2A 3GHYA 4MZDA 2C1XA 2YV3A 4JFAA 1WF6A 2CJWB 4QJ3A 1F9EA 5INTA 3BWEA 2OCKA 3OLVA 2YJNA 4EI7A 1C2YA 1ES9A 1WEHA 4M9RA 4QREA 3COPA 5GP1A 2FVYA 3WFZA 1O2DA 3U5ZB 5DCLA 5D3KA 4MAFA 1SCUA 3W6UA 2PKXA 3GG9A 5K51A 1GGKA 3I0MA 5E4JA 3H13A 3TAUA 1GZHB 2H4YA 1RXEA 3E1GA 3KKKA 2DXIA 1ML3A 3VMMA 1V5GA 3NZEA 2EKBA 5CIQA 1G21A 4R1MA 3PUJA 1RFGE 2G4VA 1X0XA 4X8LA 5AVTA 5KTMA 1G8HA 1KZHA 3VR0A 3FKJA 4D97A 1E58A 2N1BA 3AEUA 4QNNA 5J40A 2G1KA 1YZUA 3C7CB 4XASA 1QOQB 3UGKA 1FP4A 4A1FA 1UPAA 4J75A 4LVCA 1FXSA 1ADBA 2NQ8A 5BUZA 2Z3VA 1UADA 3CNEA 1UL1X 3HEAA 2ID7A 3KSDO 4R4JA 5AICA 3GLSA 4DJJA 4DQ0A 1TW3A 3OBBA 5K03A 4OU4A 3PEYA 1MRZA 3SC6A 1P3DA 1JDVA 1TF2A 2V9PA 5H4GA 2ODBA 4EHNA 5JSQA 4OD0A 2QD3A 1CIVA 1X0VA 1SBTA 4RV4A 3GL9A 1BOOA 3OTWA 3CVWA 2BTOA 2YWBA 4FR0A 1XZCA 1G20A 1JDNA 1KP2A 1UDBA 2ZWAA 4FR5A 3Q11A 4G0YA 4REOA 5CA0B 3LKVA 3ORYA 2BI4A 1EA7A 3V8MA 1LPMA 1T2EA 1EFAA 2DY0A 3HJBA 1MB0A 1YWGO 1I2MA 2A59A 2GPBA 3OP1A 4EB0A 1H6AA 5JLAA 4C0AC 1EGAA 3OLWA 5AVYA 2C04A 4BGDA 3PGLA 1ULSA 3AHCA 3I4FA 3M1YA 1DDIA 2I54A 5EGSA 4ZWNA 1NBMD 4J3JA 1X2EA 3QSYA 2HCJB 1T1SA 1M76A 4X1YA 1Z0AA 1K27A 2RJOA 3G49A 1E9AA 4XJTA 1P2UA 2JCGA 3F2VA 3RROA 821PA 2E9SA 5BOVA 2RIPA 4ND5A 4BWFB 5EJAA 3FHCB 2FH5B 2NPIA 4CDRA 2I9KA 2VSYA 4IV5A 3GJTA 4BNKA 5F9HA 2BCJQ 5LDGA 4JGIA 4GYYA 4K1XA 4HP8A 3T35A 5EE5B 4EA7A 1TVKA 1U9IC 2BZ1A 1RZRA 3VH4A 1C8KA 2AG0A 4F2HA 5DM70 1U4OA 3K5IA 2I76A 2OEPA 3VPAA 1XMIA 1Z45A 2ZUWA 1QZXA 2W9XA 5BMVF 1KS2A 2I99A 3G82C 3WLRA 1UJ5A 2AC4A 2VSOA 4DBLE 3BBPA 3CLRC 1OFIA 2CF5A 5LQDA 2NO7A 1S1CA 1SKUA 1DAEA 1PU2A 2J1LA 3GX1A 3VZDA 1Y9DA 1M72A 3MRTA 3N6RA 4NE2A 2VRCA 3D43A 1KH2A 1YE5A 2ONJA 2A0KA 1H2BA 3MSCA 1QVWA 1FDTA 1B2LA 3UGJA 1EM6A 1QYDA 3A1DA 4KH0A 4NCBA 1VFPA 4E5SA 3DDWA 3ZNOA 1MO2A 1VKJA 4JXXA 1Z2PX 4L7VA 1J70A 1RPJA 4M9CA 3TDMA 3AKZA 1PR0A 1H2YA 3VHXB 1J21A 4CGZA 1TO1E 3D8NA 1JDPA 4CG2A 1AY0A 1YBHA 2RC5A 3OO1A 4OXYA 1XCJA 1B3RA 4YRDA 4NPAA 3QU5A 2BHNA 4S1VA 2O8DA 1T5IA 3AY0A 1V1RB 4NXMB 4JUDX 1E1YA 3AEQB 4LZNA 4MV4A 1T36A 3L5OA 1AXGA 2O3SA 1XCGB 2PH7A 4X91A 4NAHA 5L7YA 2F3QA 5HR5A 3THYA 5GZ6A 3IE1A 4A0GA 3SF8B 2CLKB 3R3YA 1P5JA 3OLQA 1KAOA 4XR9A 1QK5A 5IMBA 2JLZA 2PSSA 2YZ7A 3RAEC 3T9DA 2CJFA 3I73A 3A9SA 3IMCA 2D7JA 3AJ8A 3R7WA 4HNRA 4N8DA 4NH4A 4RVGA 4W7HA 3BHMA 5K0TA 1P4HA 1JZSA 1PZHA 2C96A 1GPAA 2A1UA 3I3OA 3ESYA 3PRKE 3IXQA 5IEJA 5T6BA 2FQQA 3KUUA 1M33A 3AVYA 2FZEA 3DFFA 4QGGA 4YCJA 2QM7A 2E89A 1KMCA 3JWHA 1R9GA 2W6NA 3IQWA 1NXOA 3GGCA 3MJ4A 1YB4A 3HBMA 2NPOA 3PC2A 2NSLA 3TDNA 2W2MA 2DR2A 5BQ3A 4X24A 4BZPA 3PGMA 3QKSB 1A97A 1I14A 1VMKA 3EXG1 3WISA 4MVCA 3PTAA 1T1GA 4V03A 2ZDQA 1K8ZB 5HWSA 1DWOA 2H7YA 4Z1MD 1UC8A 2ATCA 3R8FA 5EJFA 1FNMA 1YDFA 4LZPA 4ENRA 3B9RA 1SKYE 5IZ4A 4G4IA 1L7BA 2M6LA 4BO3A 3MIIA 3KZMA 3BGDA 4ZCPA 2ICAA 2CWWA 1EXMA 2RHLA 4EO7A 4HFNA 3QWHA 5IUKC 4XM0A 3FYDA 2XR1A 3FWPA 1PSDA 1T35A 5FD8A 1WDKA 2PM8A 3BM5A 4LDAA 4QX6A 4BQSA 5IKXA 3LY5A 3L6RA 1YQTA 2VCHA 3IERA 3C6KA 2W11A 5CGQB 1E2NA 1MF7A 2GEVA 2H6EA 3KIPA 1U2GA 1P60A 5EYPA 4QE3A 3BRCA 4FGKA 4TZ6A 2ZWPA 4HPWA 1Z07A 5EQTA 2VP6A 1P4AA 3QPCA 5E0KB 3WBKA 3ADBA 2IKQA 2DR0A 3SD7A 1W73A 2AJDA 2CJYA 5C7LO 1E5DA 4OXIA 4F9FA 1XLUA 2XMBA 4LJ4A 1J8MF 4YJ3F 2O19A 3WB9A 2GTHA 5JHGB 3MERA 1CUSA 1TJ3A 3PP8A 1SXPA 1ZISA 1XO1A 5CBPB 5M5BA 2OAEA 3IT1A 1X1BA 5BN4A 1U65A 1JEYB 5EMNA 3PXEA 5TF0A 4LQLA 2IXTA 4MITA 3TZQA 2JHPA 2H7CA 1ZD5A 1BEEA 2PMKA 3LCJA 3AHGA 3FG9A 3H5RA 4FC7A 1M0EA 4RDXA 3MUEA 4M1KA 3T3DA 2QTGA 3AF4A 3OHMA 2VHUA 5DE3A 3V6MA 1N3IA 2DE0X 4Q1AA 1J7JA 4AURA 5KOHB 2OKGA 3DL4A 4FFPA 1U9JA 2V3WA 2M32A 1I3CA 3E5HA 2YW2A 2VK8A 3LBIA 4Q7KA 4PONA 4DIUA 1E79A 2VN8A 5KNBA 4KI0A 5FI3A 3ZDDA 1NYTA 4G5XA 4XJSA 3E27A 1CR1A 2OSBA 2ZTUA 1CVRA 3HJUA 2I1VB 4Z8YA 5DXFA 2PS3A 3W5UA 3ZZTA 4CUKA 1KZGB 3F5SA 4RGYA 3QNMA 3CEJA 4H1TA 3EGEA 2B0JA 3PC8C 1A8PA 3I12A 3KQUA 3QV1A 5L3RA 1KO5A 2FZ5A 5I7HA 1LC0A 5MN4A 3KV3O 4HFJA 2FI1A 4WK0B 4ITVA 5ALYA 1U1GA 2B30A 2X5NA 3KXDA 5KVVA 3OZIA 3ACDA 4YHHB 1VCIA 1SXJD 2O0MA 2PUWA 4JYAB 4D4IA 1W75A 4JA2A 3U1TA 5KC9A 1SUDA 5EERA 4R6XA 2O8BB 2IS6A 5CTAA 4X60A 5EIOA 2XWSA 3BFVA 3NBXX 5HUHA 3NBAA 2DQSA 2CCKA 4OQMA 3D8TA 1JWBB 3BRQA 3KOWA 3OFVA 3VR2D 2V4ZA 2P7HA 4DG9A 1T9ZA 3HP7A 2QJWA 3EWSA 2JHAA 2Q8NA 4UM5A 5PNTA 4OA8A 4NBLA 2X7XA 2GEUA 3NWPA 4DNPA 1KY5A 2JASA 4LVNA 2J33A 4FJ2A 5SZHB 4G5YA 1KEWA 1QE0A 2X42A 3CPJB 3DZFA 2VDPB 3JD4A 2ZVPX 3NDPA 5D7BA 3HMKA 4I50B 2HUPA 3EZ9A 5E7MA 2IHBA 4LWOA 4UVEA 5FORA 3RADC 3ESZA 1GTRA 3IP7A 3P26A 4P53A 1Z18A 4MVJH 4OI0A 1GTZA 4G25A 1KDZA 4CV1A 1WB9A 4KR7A 3K05A 1OT5A 5ILOA 4WI1A 1HYGA 3R3UA 1NULA 4AKIA 5JMPA 2PU7A 1XK6A 1XJCA 5DYIA 2PGAA 5A6SB 3PKJA 3P19A 4C7JA 1NE7A 5C7YA 1SBIA 5LNK1 2JVIA 4DLBA 1POWA 1QIJA 2QF7A 1DJOA 3DO8A 2W6ID 4D3SA 2J87A 4A8JB 1JU4A 4C6HA 2W4MA 2ZM6B 1NW4A 1IOLA 5CTJA 1R1DA 1HX7A 2ANCA 1Y1RA 3M4JA 2PKRA 3WRXC 2PGJA 4FCVA 1P9NA 3GRUA 5EJEA 3VU9A 4LF6B 1B23P 2GKGA 2ZJAA 4WCFB 1F38A 2WWYA 3IIMA 5E9AA 2IYAA 2QU8A 5KPJA 4R2KA 2YS6A 3N05A 5CFNA 2EDAA 2CV0A 1VE5A 4XGRA 1V1RA 2HADA 5BW4A 2QWXA 3D59A 4AYTA 3LW8A 4HDKB 1PNVA 4XEHA 4C2UA 1FTQA 4RIIA 4YLGA 1YS1X 4B4WA 4ZU3A 2O8NA 3HA5A 4UFNA 2ZEJA 2PXXA 2DERA 3CNBA 5K8JB 4PFSA 1TKCA 2VHQA 4BP9A 3THYB 2FSGA 4JJEA 1SZDA 2WKSA 4UM9D 5CT6A 4MH0R 4EY5A 3MPUA 4K6KA 5HQTA 5IVHA 1JW9B 3Q7EA 1CW2B 4I5FA 3AEYA 2HWWA 2FPRA 2P0EA 3EARA 1YZFA 3LT1A 2Q7DA 4ABTA 3TTSA 2ZB4A 5GPBA 1HGXA 2DZDA 5IDWA 3U5TA 4ERXA 2XAAA 2CZCA 4NNJA 2AG5A 3GBSA 2PRJA 5CDFE 4G97A 3R5JA 4L9RA 4NV0A 3QELA 3RJ9A 1UT6A 2AMLA 3ZW9A 2A33A 3GFQA 4GP9A 3S29A 2XZLA 1QGUA 4DCVA 4BNMA 4ND6A 3N7AA 2C84A 1KRHA 3R3HA 1UJ4A 4M3NA 4B4OA 1JIKA 3X1KA 2VH5R 4MKHA 5DTJA 3TOZA 4QKQA 2NP6A 4YJGA 2DX7A 2NO9A 3ML1A 4Q93A 3BCSA 1WRBA 5JTTA 1RZVA 1AQYA 1ORTA 2V7EA 3F98A 1E4OA 1XVIA 4P7BA 4KR2A 4IDCA 2I80A 3IJEB 4RZXA 2C42A 2WUGA 2FZVA 3NETA 3FB1A 3LF2A 2LPMA 2I6GA 3WKEA 1ZK3A 3A4YA 1G21B 1XRJA 1DAFA 1KBOA 1UPUA 3F78A 5HFAA 4AUKA 4Y6PA 4YV2A 1QP4A 1L5KA 5HS4A 1N0HA 4EL0A 5L4NA 1A76A 4MVJF 3BJEA 4MPTA 3Q0EA 2ZANA 4FKMA 1FZQA 1CLEA 5FL3A 5LQUA 2YICA 4FTWA 4NAUA 5BN1A 2OV2A 3MWJA 4KN5A 2VSXA 4TMKA 4D9CA 5ENVA 3IE0A 4ALJA 1SUBA 2Q3JA 3LLUA 5HKLA 5I9TA 5IXYA 3WKCA 3JAKB 1NTOA 4R9SA 1SXJA 2PIDA 4B3JA 1Z4NA 2FN4A 3FMPB 4KG7A 1H42A 1Z3IX 2OFWA 2OZLB 4P86A 1PT9A 2QLTA 5ALQA 4RYLA 4CLXA 5AVSA 3ZJVA 5THKA 3BTOA 1I7LA 1Z5UA 4FDAA 3U4QA 1JLLA 1ZQ1A 3UB2A 2ZUFA 1PGOA 4HLQB 4ONEA 2P9YA 1JHMA 3DDCA 4Y1RA 4QSHA 1V2GA 5K0EA 3N07A 4KR3A 2G40A 5B36A 4N4AA 5EHXA 3RRFA 1JQEA 2I78A 2HDOA 5TJHA 4N48A 5FUXA 3K5PA 1ESNA 1U2SA 1KMIY 3RYIA 4DQLA 2F7SA 3HG7A 1P9OA 3Q5DA 1H2EA 3U2QA 3V48A 3B3JA 1E8MA 1Y1SA 3PI7A 5AJZA 1UMBB 3ESDA 2BT4A 2RK4A 4R2LA 1B76A 4MGEA 1QOZA 2LWIA 3UYKA 1CUHA 1UIMA 1MB3A 2HU7A 4IDAA 2E1RA 5EQDA 3TKLA 4I8IA 4LE1A 3TXAA 3ED5A 4FX2A 5MN6A 4G2TA 4BPRA 2XUAA 4YPOA 3TW8B 1SEPA 1YCHA 2F48A 2XSZD 1ZD3A 3QTLA 2AXPA 3QA9A 1LEHA 4LJYA 3FLBA 4LZOA 1TT5A 1WDLA 3ZI7A 3AEKB 5DSXA 3AERB 2IV7A 5TS3A 4GSKA 1IN4A 3DDSA 3TZLA 1SY7A 2G67A 4LGVA 4B46A 1Z2CA 4DWOA 1JDZA 1JPJA 3H9GA 5L8VA 3PCXA 4LOIA 1WLYA 1KZ4A 4BMNA 2R1UA 3KEQA 2A9KA 4YQYA 5HUQA 3GUYA 4OAPA 1FTWA 4FSXA 5TY0A 1CEYA 3KXKA 4G5SA 2ZS9A 4A10A 2BBOA 1E4EB 5EIHA 2HU2A 1FUUA 3NATA 5EZYA 1C8LA 2Z8YA 4WBNF 1MABA 1RBQA 4PQYA 3ZU3A 1YZGA 2CDNA 1DG9A 1I7NA 2G80A 4LJRA 4U3JA 5EZ6B 4EEXA 3IPCA 4OHUA 5EG5A 1L5NA 3RI3A 3GRVA 4KX3A 5KWEA 4G5OA 2HXSA 4L72A 3OOSA 1D1TA 3TINA 1GPLA 3ELUA 1ULHA 2VZ0A 4U1RA 1F0PA 4KVZA 1DCMA 1NOIA 3FXAA 3G5TA 2OFFA 1G41A 2O2EA 1LV7A 5LBTA 4BB0A 4Z3DA 1HDOA 3L40A 3NDJA 4ZOLB 4AIIA 2ZUEA 5LLDA 2G83A 2AGVA 2JI7A 2OXCA 5KYYB 2ZIUB 2ZQ5A 4FIDA 4MAMA 4CMBA 1TYZA 2HJSA 4DDTA 5H68A 5KTPA 3ECCA 4L4ZA 5ESRA 5B7PA 2DFKB 3ZHRA 2GJ8A 4C4SA 1YGPA 4R69A 2YY7A 2Q5QA 4OV6B 2JBAB 1RS0A 3LDFA 3P9ZA 4KJZA 1EINA 4ZYXA 1K3FA 2IOFA 3GFFA 3CPSA 1F0YA 1YA6A 3DMFA 4PZ0A 2X4IA 1FYDA 4ON9A 1Q1QA 1DMRA 2WSMA 2P2CA 3VDXA 4W8GA 1IY2A 4K03A 2FSVA 4Y2QA 4Q47A 4IHJF 4B2LA 2I3DA 2OO5A 4QYXA 3O3CA 3UAWA 4F5EA 2L17A 2J9GA 3JVVA 2I4RA 4OK6A 5T64A 2JLAA 3VPBA 3L4BC 4GVPA 2UVQA 3S2YA 3SSNA 1CRLA 1QO0A 1BZYA 3CX8A 1VL8A 4FN5A 2AYYA 3TSOA 2OL4A 1OD6A 1E59A 3IQIX 2ZKLA 3P2KA 4AJLA 3R7FA 3BOSA 4FYJA 2Q3HA 3PUZA 5JQGF 3HB1A 1XU4A 4UREA 4ZEXA 1HPLA 4IS3A 4W9RA 2GXQA 3KJEA 5T67A 1DJMA 1Y42X 3P9RA 1ZCFA 1NP7A 4EY4A 4Y3UA 2FOLA 3QU9A 4EJ2A 1N77A 2E37A 1MQAA 2EWVA 2VRWA 3FY4A 3T5DA 3NMUF 2AOUA 3K4PA 5JDCA 3KV1A 5LZ4A 4DQXA 5C5DA 2LGJA 2J4DA 1N6PA 2LP4Y 2ZR8A 4BX3A 1F48A 3DVSX 2XRMA 1QS0A 2XCLA 3BMOB 1JWLA 3BQ9A 3DP7A 1D1PA 3UJ8A 3C6BA 4W5OA 4XLTA 3T0FA 1CG6A 1ZS9A 1CP3A 1D03A 2CYBA 3M0EA 2I91A 4X9XA 4NLLA 1CY6A 1PHRA 1FS4A 3UWMA 2QN3A 5DX0A 4CLRB 3CR3C 4CUJA 1YE3A 1JG7A 2YWCA 3KLBA 3O1HB 2H1HA 2G76A 3B6IA 5G1NA 3L7BA 3U31A 4CF7A 2DPXA 2J0EA 2C7RA 1RRVA 5B1EA 2E4WA 1G64A 4NXNB 3TZHA 1J8YF 1QC5A 1ZUHA 4Q34A 4QEKA 1GAWA 4EY6A 5A02A 1R0SA 2HCFA 4M6WA 3PF9A 1FXWF 5CB6A 1LPOA 3K6RA 1FNBA 1WXWA 4RV5A 2EFDB 4GIBA 3UH1A 2HBQA 1SO8A 3HU1A 5T8KA 5LPNA 3VNVA 2IH2A 4G4JA 4O4HA 4WK2B 1VBMA 2YC2C 4LNUA 5GONF 3PNBA 2VPYA 2ZTMA 3C3KA 1Z28A 4UZEA 4ZVNA 3D7LA 4YJ2B 4ZEMA 1ECGA 4OYLA 2GCEA 1DC3A 4UNQA 1HDEA 3UWOA 3K0FA 4HRXA 4N41A 4OHCA 4A36A 3G0CA 3DR5A 2ZI7A 2QVGA 3STVA 4RKEA 1GXSA 1K98A 1Z62A 2OTCA 3C0KA 1GGMA 1M67A 1OI3A 3CVJA 3OOJA 4OFWA 4ESEA 3ZHOA 3PNMA 1DFIA 5DXJA 5HRAA 4OJYA 1Z0UA 1R27A 1GILA 5I4BA 2XCQA 1KFJB 1AK2A 1ZI6A 2GYWA 4Q3OA 3DZBA 3MINA 3CVOA 3CLTD 3A9UA 3E2MA 3A2NA 2W6MA 2WZBA 3H11B 4YDQA 2W2LD 1X1RA 1R5JA 2OUIA 4QQKA 1IZ7A 3W1VA 2I29A 2WNHA 2PKCA 6REQB 5K20A 1HYBA 5EN4A 1I01A 1JP7A 2CNWA 1WUKS 2AK2A 2E4YA 3M82A 3OEHD 5JXGA 2XNCA 5D3ZA 2HOQA 4CM6A 4MPJA 4MDFA 2BPOA 4L28A 1XQ6A 1LVHA 2AF3C 4UTNA 5BT9A 5KYTA 1DT3A 2B69A 4H77A 3AUJB 4BGVA 2O1EA 2IELA 2PXAA 1GGFA 2G9QA 2O0HA 1P0QA 4A6PA 1M8PA 5A5GA 3QWAA 3CUYA 1RYFA 4MYRA 5CG1A 2IZ0A 5EQJB 1C3XA 3G1TA 4J9VA 2I7VA 4DV7B 3UMCA 4ARVA 3E3MA 5HIAA 4XCXA 1UFKA 1S8FA 2OFXA 2FW8A 4REQB 2WAYA 4BJ6A 2OQIA 2CFRA 3P9SA 2GASA 3I6ZA 3O03A 4FGWA 5JNWA 2SCUB 3I04M 4NCXA 4RJKA 2WRZA 1HG1A 1DTWA 3UENA 3H86A 4WOJA 2ZAMA 4TTJA 4F97A 2VPTA 1NXXA 2ZRGA 2Q1TA 2FPSA 1IVNA 1NI5A 2PWYA 3PXDA 4H9GA 1PJZA 2HK9A 4LY0A 4X66B 3M5WA 1KRXA 2CFSA 3EAGA 3WLIA 3REQB 3E9MA 3EOBI 3HQ4O 5BNFA 1EIZA 2EWMA 2GJAA 2ZBRA 1JFTA 4DLKA 3LGSA 4JZYA 4GR4A 1NPDA 1LRKA 3L02A 4J1QA 1YZQA 4IO1A 4G5GA 3SFVA 4EVQA 5FUVA 1IEQA 2A5YB 3PC6A 3A4VA 3L7CA 4GI2A 3DEAA 4MWOA 4KCGA 2WHQA 1FRZA 2XYVA 4K6FA 1A9XB 3PQ4A 3L77A 2XNHA 1EM8A 4KLAA 1GTSA 3IUNA 4FYWA 6ADHA 1M3SA 1P17A 1WMAA 4G6ZA 2Z4RA 4C29A 1ZWLA 4DSTA 4E2ZA 1R4AA 1J00A 4YT8A 2BSQA 3U3OA 3W5IA 1GZDA 4E30A 3FOEC 2A9FA 4QYTA 5COQA 3CURA 4JLDA 2ZBVA 4RVFA 1NSYA 4CQJA 2EP8A 1JZTA 1CZNA 4KKXB 1ZH8A 2PL1A 5CX1A 1XYYA 3WNDA 1RAAA 1PX0A 4I4TB 2O1WA 1DS6A 1VG8A 2FPPB 4FEAA 5ESDA 1EA5A 1RXSA 3GUHA 3IEPA 3LWDA 4IJMA 4G3XA 2FJUA 4Z86A 2JAUA 3SBOA 1U3VA 4O1MA 5JVDB 3EBLA 1Z4OA 1RXCA 1QVAA 1EDZA 1S96A 3G1WA 3OPNA 4G23A 4TOIA 3Q8LA 1PJCA 1NVFA 2DFLA 3LT0A 2CZGA 5IM4F 4M0MA 2PAFA 3LRPA 4D9JA 1H8HA 3K1YA 4EDHA 1L9KA 1NATA 1TU3A 1YU6A 4S2EA 3SBXA 3SF8A 4KV9A 2ILVA 1ISSA 3GB9A 2YNMD 4D6YA 2Q1XA 1V96A 2F1HA 3BC1A 2OBYA 1R5NA 1P1IA 1ZWKA 4FHDA 2ZDGA 1QCYA 1US8B 1TZMA 4S1OA 4YUWA 4HSEA 3G8AA 2WSYB 1P5HA 1YVEI 3W5JA 1G6HA 5K7SA 1B16A 4LDPA 1QDEA 2HV8A 3ZD9A 1DTEA 1XZIA 1ZKDA 1PT6A 2D5IA 5AM0A 4EFMA 3U4DA 5CNMA 2X1VA 4PZPA 4TKVB 4PTZA 5HKBA 3QE3A 2RBEA 4HDNB 2GR9A 2HLDA 2UYGA 4MV7A 4YQEA 1WSBA 3H1AA 3SZGA 3WHPA 2C2KA 3G5MA 4HQOA 1RI5A 3V42A 4QXRA 4EK9A 3UHOA 2G07A 4EHKA 4CN8A 1YDHA 1ECCA 2C0CA 2I87A 4AN0A 1I4TD 3EEOA 3HCOA 1BNCA 1O5TA 1YR8A 3PWSA 1CDOA 4XKJA 2XMZA 4HF7A 4MDEA 8ADHA 1RXIA 4G4SO 4R2XA 1F8UA 4YQFA 4Z4IA 4HGPA 4D45A 1UWLA 4JCOA 1XLVA 4GX2A 1VCOA 3PNYA 2XXJA 2Q1YA 4OP3A 3DAPA 2QV7A 1BTOA 5KNBH 1A5TA 5CJJA 4OLBA 4DA6A 2XSZA 4RWZA 4IPTA 5TB5A 3KUCA 2GPNA 3LX6A 2AFRA 3B7WA 3IAFA 4RO0A 1GNTA 3BIXA 1DVRA 1MFZA 3F47A 4H08A 4O4LA 3ISTA 4C21A 1YQDA 3K70D 3CW8X 4YECA 3H1PA 3DPUA 2AFIB 1EB9A 1F3OA 4RIGA 5AHOA 4BNDB 1U90A 3M3PA 4DC1A 3RC2A 4QDZA 3ZVRA 2FW7A 3FMVA 1RHMA 2QIOA 5T8KC 4BBPA 2HYIC 3KE9A 3OUZA 1D0SA 3G7UA 3KQPA 2BH2A 1PJRA 3J7TA 2HJVA 2NTVA 1RWNA 3UOWA 1LQUA 1RJWA 1X3LA 3EX7C 3JYPA 1U31A 2QU7A 2XQKA 3T9CA 4E5UA 4KC0A 3G23A 1L5HB 5AKKA 5AM1A 4BMDA 1X39A 1W9HA 4G0VA 4LGMA 3V8PA 3T7AA 1CHNA 3AR2A 1WDWB 3HCCA 2PX5A 2A9VA 3V1NA 2L69A 2Z0MA 4PSVA 1LQTA 2EYUA 4RQTA 2AI1A 1EBUA 2IEDA 4G5RA 5KYXA 1QYIA 3BQNB 4ZVPA 2AQ8A 4CZ2A 1NVMB 2JGJA 1M1YE 3MQ2A 4U6QA 5IRCD 1ZD2P 3KJZA 1IIRA 4UASA 3N0XA 4UPVA 4XQ0A 4GU5A 4WBXC 1TVEA 4BFSA 2ONCA 2Q41A 2WYHA 2H4HA 2ZRNA 3JQBC 4I5EA 5AM4A 5DSZA 4GKKB 1RZUA 2HA5A 5EIXA 4EVSA 2FX3A 1YACA 1KBZA 3INYA 1Q14A 2YIMA 5M3BA 3I1YA 3HKBB 4OG2A 4IDQA 3DMPA 4PHGA 4ZXFA 3ESAA 4GZ3A 1GTL1 2BRUA 3PZBA 5C51B 2JW5A 4K8OA 5TSDA 3WS7A 4FCCA 1RE1A 4TMTA 1SZPA 1XDZA 5B1SA 2QKYA 3NPMA 4OQYA 4UVHA 4C5CA 3D54D 1EWVA 3O4IA 3O8BA 4K3UA 4UBKA 1G3QA 2AOTB 2I1LA 5DYNA 5JSUA 1NP3A 2EG9A 1ONOA 5KQPA 2QT1A 3L4BA 4D3YA 1WB4A 4Q39A 1YRYE 2IZ1A 1P39A 3K94A 3LRXA 3RIHA 4PXAA 3UJ7A 4DNXA 3R4CA 4M8SA 3C24A 1XEWY 3ZBUA 3SWWA 1CF2O 221PA 2JI6A 2FPWA 1MAHA 2W00A 3W5DA 2WTUA 3QMVA 4HJRA 4NZ9A 4COOA 3WWOA 4WXEA 2CNNA 3WR5A 3RPEA 3BFPA 4TVOA 2GZMA 3TLYA 2YR0A 4IHAA 1XNGA 1VCHA 2NO0A 3L93A 4IXDA 4W7IA 4YT4A 2TMKA 1P9WA 5CVUA 3U62A 3F67A 2V7WA 1AK9A 1SKQA 2Z9BA 3B82A 3RYHB 2OUKA 4B3CA 1CDZA 4GI5A 5KVAA 3MCZA 3GZTB 2FK7A 2R5NA 4QSMA 1A50B 4BO4A 2PUAA 1YJBA 3CEHA 3FYUB 3T4EA 2PSEA 4UUQA 2A86A 4ZI5A 5JAMA 3NTXA 1N6IA 1OV6A 2YHBA 5FQNA 2CVZA 1WCWA 2WFLB 4FKZA 1N2OA 4E6EA 3MGGA 5KQSA 1RBZA 5CVTA 5JZBA 1I2AA 4RANA 2ASVA 4JYPA 4MGKR 1XRMA 5LP6C 4F5ZA 1JMKC 3FCUB 4DMLA 3WZMA 4DSNA 4AP9A 4EPYA 2WSIA 4HQKA 4KTVE 1IATA 2IDKA 5D2CA 4YV0A 3GUVA 3V7WA 5I51A 3JYNA 5LR6A 2J3EA 1WKVA 1KYXA 5IZCA 3FNQA 2OXFA 1ZU4A 4HYYA 3Q9NA 1DLJA 1AQ6A 1TT7A 5G41A 4RE6A 3H9QA 2HHLA 2XB6A 1CJCA 5FUMA 2GD6A 3ZWWA 1BJTA 2PH1A 1XEFA 1QG4A 4JLPA 3NR2A 2JK0A 2VQFB 1MTZA 1OBCA 3NW9A 2ODEA 5IC5A 2XBUA 4YJ2F 1LI5A 4HH3C 4Y2JA 4EBFA 4M1WA 3EZ2A 4PVDA 4HNAA 5TQ0A 4C4ZA 4CKBB 4C78A 3WZLA 5I7EA 5HSGA 1XNRB 3MLEA 1DEOA 4FWIB 1VJGA 1U2PA 2H2FA 3RNLA 2R6AA 1ZA1A 4UHEA 3T54A 1QAOA 3ZGLA 2WILA 3IEKA 4K6OA 3T4PA 2NO6A 2Q7XA 2YJ6A 1LI7A 3IQXA 3KWMA 3LUHA 1FFSA 3ILHA 4OAQA 4PYRA 4KFCA 3HLKA 1KPIA 2XWBF 3VU3A 4UUBA 3HYLA 3MTDA 3QWBA 3ZJ4A 2YQ4A 5CDTA 4XQEA 2AZXA 2WMYA 3TLZA 4OH1A 2Q4EA 3DOHA 3MAJA 4OHPA 1M1YA 2C4TA 4B84A 1HFWA 2XMPA 4MYSA 2G4CA 2A1TS 4FLFA 4LJKA 4WGFA 2VZEA 1PKEA 1Z36A 1DMSA 3ETJA 4RETA 1E4YA 3CLSC 3WLSA 4ZCRA 2X0RA 3BDVA 2CNOA 1QHEA 4JB2A 3RU2A 5FWNA 4MP8A 5CITA 2OBBA 1GSHA 4F72A 2HA7A 4LZZA 1IN7A 5KWSA 4FYHA 5KCMA 4H6WA 1ZMXA 4OXQA 3QF4B 3FTCA 4BNFA 5B3JA 1PR3A 3ETLA 3KKZA 4MUJA 1TK2A 1WUIS 2EX4A 3MCVA 4MCIA 3U3KA 1KWKA 2JLBA 3PHLA 1PZXA 3VOTA 3RSQA 3DF7A 4FDUA 5M2QA 1H5UA 2WTEA 3E81A 4INAA 1W35A 4PLHA 3ZCPA 5DHPA 2FMXA 2JLUA 1FMTA 4N18A 1JXOA 1VTKA 2PV7A 1WTAA 3IRUA 4AJJA 5LA6B 2IYUA 2SKCA 3MIZA 2JGRA 3KVRA 1OWNA 5DULA 1F0KA 1CRZA 2VWPA 3LL7A 1DO8A 2AC7A 3PRHA 3I2FA 1KSHA 4LNUB 3SZRA 3OPYB 5G02A 5KNBD 1IPEA 5LD2B 2IQIA 4BHTA 4I0WB 3HCWA 1UXKA 2EC5A 4MO2A 4AZ0A 2VA9A 1E9VA 4B2YA 5IP5A 4HGYA 1AUPA 3PLAE 1Z4JA 1V47A 3RHTA 4ECAA 2ZK7A 1NONA 3NXSA 4RTSA 2QY6A 1PL7A 1IHXA 5I9MA 4FFBB 1ID1A 3D3JA 1YRLA 2H7VA 2PWPA 2G09A 3X3HA 2G6BA 1DTWB 3AWDA 5EKXA 1VMDA 4LSGA 2Q29A 2XOKD 2EIHA 1AKUA 3QFRA 3Q41A 1ZVVA 1GSIA 1GTG1 1B6GA 1JQDA 1YR9A 1E20A 4MMYB 1YVPA 4Q9NA 4W1QA 3H9JA 2QRPA 1IBMB 3UANA 3WE7A 2FEXA 3Q7SA 2EV9A 4E0BA 3IQHX 1G66A 1TAUA 3DD5A 3L0PA 2X1LA 1OUMA 4LQ4A 4Z0PA 3IV9A 5KNLA 4ALMA 4B3MB 1GPDG 4ZYYA 1QWOA 1ZMRA 3A9RA 4UVDA 3FCAA 4H1HA 5FTKA 4X5OA 2O8VA 2C3YA 4FFMA 3OVMA 1J0BA 3UAYA 4ZK6A 1G5QA 5ECYA 1NURA 3QY9A 4M60A 2H3EA 4EOGA 2ONKA 3EW7A 1MEEA 3L0YA 2O8CA 3TFOA 2FFHA 4AZ3B 5C35A 3AZQA 3TXYA 3F4KA 2HWXA 5AR1A 2CVQA 4UEOA 1P74A 2BM0A 3UKDA 3JVEA 3U4QB 1ULBA 2P40A 4YXWD 5IS2A 4RKWA 4X97A 4Z1OA 4M1OA 1XN4A 2B5WA 2OV1A 3NC0C 3P2YA 4N5HX 1E3WA 3BE5A 4ML3A 1L9XA 1COWD 1L5WA 1YV9A 3ORFA 1FRVA 1J2JA 4FP9A 1PFQA 3VAYA 3MPOA 4V0NA 2A88A 3L4JA 3DLHA 4ZVTA 4KO1S 3TLCA 4D9IA 4WOBA 4H4CA 2DM6A 1GL3A 4ZT6A 4ZQIA 2JH8A 2KJQA 4PX9A 1EZ1A 2C0PA 3BKXA 1KAMA 1JHZA 5BR1A 3BK1A 1XZGA 1NBAA 3HBFA 4GUDA 3V4LA 2HJ9A 4Y8VA 1OC4A 4DXDA 4R9RA 3TBHA 2QMEA 4JS0A 1DSSG 5IJ9B 2O5CA 2WTXA 1U4NA 4GW3A 1X8KA 4QQRA 2I4OA 5AW3A 3S7TA 3IUYA 4QODA 4R1QA 2Y92A 4WERA 2C1ZA 2EKDA 4J0FA 4C6TA 4O2AF 4RVHA 4J2TA 4BJ3A 4CM1A 4DIKA 3HYNA 4GR5A 3RK4A 3TLMA 2ZSDA 5HP4A 1RLIA 2I4IA 3UVEA 4E7PA 1Q19A 1KO1A 2K2QB 2MSDB 1QYVA 3IIIA 4QJIA 2BDTA 2PZEA 4XFDA 3TIXB 1ZN2A 1PVVA 2FWRA 1SCAA 2RAVA 5FLEX 3GARA 4PLGA 3LKBA 2NPFA 4G0MA 4NQRA 4DSOA 5CFLA 1IXSB 1HL7A 2ODNA 4UQLA 3I3SR 5IBRA 3CN9A 3KXLA 1QHYA 4JP1A 4B43A 5HQ3A 3QEBZ 2WFLA 1XD2B 3SEFA 2CXTA 2WUEA 2PLNA 5EVCA 2ZUUA 1VLMA 3IHTA 1D6SA 1LF0A 2IYEA 3GVIA 3PXCX 4R2JA 2IP1A 4AJ4A 1PNRA 4PV7A 3U13A 2V1UA 4G0UA 1K7CA 1Y1LA 1GNLA 2NO5A 1OX4B 2QTZA 1NT4A 5HDQA 3O91A 1PYDA 2XXAB 1YL6A 1Y8QB 1O6BA 1NQ5A 2YWRA 3FOFC 9ABPA 3Q8XB 4FHCA 4ZQCB 4OK5A 3SAJA 4F1KA 3H2IA 2WVAA 3OPMA 3JQCA 2TECE 3D0RA 4UTZA 1W76A 2GPYA 4WMLA 3LBFA 2IHJA 3PT9A 5F2NA 1T6YA 4UUOA 4F46A 1YJXA 3JARA 4IP0A 2OE2A 1A5AB 2OR3A 3TF5A 2V7BA 1M6VB 3VVCA 4DUYB 2MCFA 2CHUA 3G0GA 4U7HA 4LGYA 3LHFA 3N6XA 2YXNA 2RGNC 3PNLA 5COBA 2QMOA 1AC5A 1RWKA 3M9LA 1YBMA 3OC6A 4HX9A 5HJ7A 4IX9A 2ZIZA 2ZT5A 3KJHA 3GHHA 2WK1A 1C3EA 1KI8A 4BNWA 1FSFA 1WZEA 3JWPA 2YNMA 4G9BA 3SIRA 2DKOA 5DBEX 3WKAA 4BO8A 3K0EA 1C80A 4V0OA 3ZIUA 3OZVA 1JAYA 3QXHA 2OB2A 4UC0A 5E95A 3MS2A 2C4HA 4R0VA 5FL7A 1LSSA 1SVSA 4NABA 2GJ9A 2FG5A 1K6IA 2WVHA 4KQ1A 5FNVA 3W05A 3W6PA 1A9PA 3GEMA 1I80A 1EX1A 4NICA 1V16A 5J43A 4G36A 4GOMD 1D7AA 1AN9A 2WSSA 1U3UA 1K88A 2PZGA 3CX6A 4BQPA 1W36C 3FBGA 4XWGA 4X64B 1U7ZA 1LDYA 3ANXA 1R4ZA 4PU0A 5LCXA 4BNVA 5FV4A 3LKZA 1FUYB 3Q9LA 5IT4A 1TEXA 1O9GA 3SKXA 4K87A 1N5DA 2Q45A 3ZWOA 2ZJ6A 2C82A 1DQYA 5E1MA 5IJXA 1CJKC 4IF6A 5FA5A 3CX7A 1J0DA 1A7AA 1F9AA 1NN0A 2MSCB 1XLWA 2XF8A 3E7FA 3FHLA 2FEPA 1GV0A 2I2BA 2IPLA 4UBIA 4CMAA 1U3CA 1GRRA 1IQUA 4IHJA 2AFIA 2IPNA 4C04A 4HLCA 1GTMA 5EHGA 1DIHA 4XYLA 5JNSA 3B12A 1IM8A 3KJQA 3R23A 1VLZA 1ZOPA 2OAQ1 4HXYA 4F2PA 4CEIA 1RI2A 4DQVA 2AFIE 3RBAA 4GZ5A 4YAFA 1S8AA 1OYYA 4OQEA 4ZFNA 3GLFE 1PTKA 2Y4NA 3VR6H 1NGSA 4JP8A 5LA6A 4A8TA 4FBMA 4B7UA 4AUEA 4EWLA 4UTVA 1BVRA 4ZQGA 5ALZA 4EKDA 4MW6A 4LHZA 2QAGC 4QVIA 4HT3B 4DZTA 1C7ZA 5JS8A 3EXFB 2BGJA 5B7GA 5JAOA 4YEDA 4MVWA 1U6JA 1PE0A 4OGLA 1WTCA 2MR6A 1G4UR 2PY6A 2W6JD 5DP2A 4ZC8A 3UBMA 1FXWA 4QTYA 5K01A 4Y9UA 3T5GA 1CUEA 1BD3A 3K0CC 3EYAA 2XT9A 4OJQA 3T5MA 1TTTA 5ICGA 3OQHA 3QFTA 4CI9A 1KQPA 4PN7A 3FWNA 1BROA 2Q1WA 3D6NB 3ZV5A 5BSWA 3OQJA 1MT0A 1EESA 1NI4A 2ODTX 4YWHA 3MJFA 4HAUA 4NBRA 2Y1FA 3DWEX 2AR7A 4FUQA 4WBNA 3GFRA 2OLEA 2VXOA 2QN9A 1T0IA 3E9NA 5HCNA 4IJVA 2AN3A 2VQ3A 3PITA 4O0MA 4QYSA 1U1IA 3HLYA 3M34A 4DPMA 2NW6A 3ORSA 4JT9A 1EVKA 1R74A 3CX3A 1ULTA 4R98A 3DMYA 4WESA 4FI3C 4GXQA 4G2NA 3SLGA 4C87A 3G5LA 1CETA 1JH8A 1QE3A 2I4TA 4HZGA 2NTYC 3ZLUA 3WYGA 1NJ2A 2NM0A 4RHTA 2E82A 2J7KA 3R5HA 1RYNA 4IIEA 4O25A 4Q4HA 3TVYA 1SG6A 1U7UA 3P9QA 4PAQA 1CRQA 1DFGA 1PG2A 1TI7A 2VFAA 3PGXA 2FUG1 1F6WA 4MP3A 4AROA 4AT1A 3BHIA 3IR5A 4QU9A 4G37A 5TNXA 2IUYA 4HGRA 3NVMB 3E5MA 4OJTA 2HLHA 4M0DA 4D9BA 1Z6AA 1WZIA 3B1JA 1N2HA 3T38A 3WDMA 3WAKA 3HKEA 5EJ8A 3NDIA 2RHWA 3OC0A 5FPTA 4EHHA 1DC5A 1ICIA 1VB3A 4KTTE 5CU7A 5LBIA 4WADA 5DLPA 3RWBA 4CMHA 5GZ3A 3BH6A 3CR8A 4S1WA 3PHBE 5EP3A 1MC1A 3JALA 1UKBA 3I4CA 4I99A 5EWMB 1KK0A 3CMCO 4K9SA 1JSRA 3B9QA 2ZAOA 2C5LA 3LFUA 3STUA 2ZXFA 3X44A 5EUCA 4IEEA 3ZD8A 1PUXA 5CA1B 3GRKA 1XTIA 4CMJA 2HQOA 1SOVA 2WI8A 3GP5A 4EO4A 1J2EA 1ZOSA 4TLBA 2VF8A 2I6UA 3AXSA 3U1VA 3WQRA 1UDXA 3PEEA 1QYCA 4I4TA 2CLDX 1L7PA 4F4DA 1XVTA 4PNEA 3IAHA 4L5AA 1EUQA 2R87A 2QL9A 3TIVA 4TM7A 2L0XA 4K0RA 2BRUC 4KMOA 4RHUA 5C1IA 4B5KA 1E1LA 3PQ5A 2P91A 3I83A 4QEZA 3A26A 4Q9DA 2QP3A 1GNQA 3L3BA 4N7MA 4ETMA 3S1SA 1U0LA 1SBYA 2JGIA 4OFZA 5LZ5A 2YTZA 1DBIA 1M1YB 3OE1A 1ZKMA 1JB1A 2UDPA 1A9XA 1FJHA 4DJAA 3WIBA 1JEOA 1FFBA 2ZSIA 4NE7A 3TM5A 2Q1SA 3C1AA 3ABZA 3ELYA 3A1TA 4NI5A 4TMXA 1PAUA 2JJ8A 5LLSA 2FU5C 1JHOA 2C4MA 2IYOA 1DAPA 1PRYA 1TZCA 4F4HA 2UYQA 1NVBA 4G1CA 4IMPA 2PVPA 1Y7LA 2BDUA 2ZS8A 2HT1A 4Y98A 1QKKA 5DMHA 3IV7A 5LDHA 2J31A 4UTOA 2LCQA 2AUTA 3I28A 2MYPA 3HA2A 3PXBA 4FEEA 4H4EA 4WNYA 3A6PC 1PJQA 1S2GA 1FXUA 5AI9A 1G9XA 3FFWA 2VZ9A 5ARDA 5FOVA 1QNFA 5JVDA 3EXIB 5JD6A 3BBLA 4I5IA 1NL3A 3DUFB 5AESA 3U1BA 2PSHA 5C8YB 3LCCA 4GI3A 2RI1A 1GQOA 1GVNB 5C8YF 1SHJA 3TTTA 1W5AA 3NP9A 1QNLA 1E9SA 2CUTA 5AKIA 5JG7A 3HCEA 5C7IO 3KETA 5EFOA 3K1AB 4F3CA 4F56A 1C2TA 1E89A 1BE0A 3CUTA 1US8A 3O84A 4L3OA 1BFKA 4R8VA 3ZHBA 4GOKA 1K6EA 4C7VA 5AVWA 1XEXB 1Y5RA 4NE9A 4P92A 4LOHA 2AMVA 4HFMA 4UUMA 5LQJA 1M6VA 1SQFA 2OECA 3K0FB 2XB2A 4HUJA 2YXPX 4AICA 3I6QA 3E35A 3PB3A 3Q7IA 5JI2E 3K6SB 2CXQA 1YZKA 2DRIA 1KWGA 1JDTA 2XDYA 4CIAA 2RHGB 1V5WA 1IUKA 4HDMB 5IAJA 3PFHA 1VJ5A 5JALA 5GGYA 1JYFA 4OEHA 2AQIA 3HBLA 2XDAA 1FY2A 4OPMA 2JD0A 1LV8A 1JDBB 2MYUA 1VCNA 4DLNA 1TGYA 3HB9A 1O7JA 2B83A 4GWKA 4KXNA 2AJCA 3ZDBA 4PQGA 3ZKAA 3OTHA 1DXOA 4FCWA 3AI7A 4OJKA 1WQ3A 3IOMA 4EKGA 3HUDA 1UK9A 4ESHA 3U56A 3JAKA 4IS2A 4Z9AA 3TD9A 2GJSA 1LRLA 3TKYA 5IF9A 1W2WB 1DBSA 2Q3CA 5TDHA 5JHHB 3QEJA 3ZI4A 4E09A 5C52B 2INGX 2VQDA 3F7MA 4M7PA 5KWVA 3BD8A 2WWFA 2XADA 1W30A 2R2GA 4M0EA 3OG9A 1UMDB 2A35A 1U11A 5E7IA 1ZG3A 1LDGA 5IVKA 3QBJA 4L8LA 4DCCA 4K46A 5KYWA 5MDHA 1NUPA 4TTPA 1PTJA 3OCJA 4B4KA 4CKWB 4WTOA 3GEGA 2GN1A 2G63A 4O2BB 4ZCQA 1W5EA 1Y7TA 2RFLA 3DFKA 3HKBA 3MRXA 4DA8A 1OR8A 2DFPA 1LY1A 2L19A 3GLHA 2VTKA 4PR3A 4Q6WA 4Z6KA 3WJ7A 4Z54A 3CO0S 1IBCA 3ICWA 1EUCA 3HSKA 1VXOA 2JB9A 3LWNA 4L4XA 1E0SA 3KZNA 3WLQA 4BFXA 1HNWB 1C1DA 4JT2A 4R83A 3GLVA 1V11B 3NUQA 3HU3A 4AKEA 3GVCA 5EJ6A 1EUDA 2OLJA 4UU1A 3D64A 1M73E 1KDPA 2W58A 3O4RA 1KOJA 2XCIA 2AKEA 4UEJA 5HIMA 2XEDA 4BMOB 1E2PA 1SUAA 3R0VA 4QAJA 3DL0A 2VF4X 4OI2A 3WRYC 4JODA 2Q4BA 3R20A 1BQ3A 3I5MA 4G9EA 4RM3A 5I8WA 1NUHA 1RW4A 2IPOA 2QE6A 2Z43A 3IP9A 1OZ0A 2PX2A 5I3CA 1KKMA 1ZI8A 4UDXX 2EFGA 3A4TA 4MRPA 3L7MA 2LBPA 1SVIA 4GPBA 3P32A 2DTEA 1RQ2A 1C14A 1Y89A 2GN6A 2DPMA 2H0QA 1CJSA 2QPTA 3IKMB 4ZU1X 5KAMA 2C1EA 4JI1B 1IBKB 2F8TA 1P1CA 2DSNA 5ECGC 5BSTA 5BR4A 1AG9A 2VJYA 4RVOA 5F5LA 3AZOA 2BDEA 4BNNA 2ZYTX 5LQSA 4R51A 2W70A 1BXKA 2DMRA 3DNPA 4MWCA 4BMSA 3ETCA 4FYKA 4YRLA 5JSZA 1DAOA 3W5SA 3KHKA 3AHIA 2H1RA 5ECDA 3G7SA 3QITA 3VV3A 3HACA 3I62A 3PQ3A 1QGYA 4YONB 4B6SA 3N2GB 4US0R 2ECPA 5EC8A 5CPBA 3G2LA 4K9QA 2VDOB 3TNFA 1TYBE 3FVWA 2AEFA 2GUGA 1R6XA 3ZVKA 1OVGA 4P3XA 3L5KA 5JZMA 1KOLA 2LIVA 2CKMA 1GG9A 2GNPA 1XX6A 2V55B 3DYIA 4P3PA 1PP4A 3O8RA 4FE4A 4B2IA 5TT1A 3OZUA 1U7DA 1GITA 3OZ7A 2GI4A 4RC9A 1NF3A 3JPYA 2H18A 2X0FA 4OL0A 1WKCA 4BFZA 3F6PA 2QUAA 4C0LA 2HPHA 1MJ5A 5FBZA 1IOZA 1X92A 2QYSA 4A6EA 4DM3A 1Z8FA 5CXXA 4N3AA 4CLRA 1MCZA 1E3QA 2WOJA 1XPJA 4B3XA 1DBWA 4LY9A 4URXR 1AKYA 2R8BA 1T8YA 4D0RA 4OK3A 1XYVA 2V8BA 1WMFA 4ZCSA 4CCWA 1AGRA 1DE0A 1FDWA 2YMQA 5A0TA 5DN6D 4RJ2A 2ZB3A 2QTVA 4M9ZA 2GQ0A 1J6UA 2OFPA 2E2WA 2Y0EA 2X2PA 4KIUA 1DAKA 3AJRA 3ME5A 4FJ0A 4J29A 4KE7A 4CL2A 2QM8A 3QLVC 3PDCA 3WWYA 2LIPA 4EPVA 2PSDA 1RQRA 2O2IA 5CT9A 3Q6NA 2ZVQX 4W5NA 1O6ZA 1AT1A 4R7TA 3LT2A 1QC5B 2BSXA 1V9LA 2H2AA 1CEXA 1GEEA 2DLNA 3FGOA 2I8AA 1Q77A 1YVUA 1EGMB 1GG5A 2ORVA 3EE6A 3JYQA 4N82A 4LYYA 3C7AA 4ID3A 1XJWA 3IL2A 5ULLA 1C7RA 2NU6A 5HE8A 3TFQA 2IZ7A 2GYYA 2GLXA 4WHMA 1PGNA 3LI2A 2FZLA 4CDNA 5KBYA 3ENKA 4MB2A 2XJ9A 4CKBA 2IJGX 2TRSB 1L8OA 3OKCA 4FOSA 4MI9A 1LW6E 1NBEA 1HEUA 4UTPA 1GG8A 1FS5A 3FOBA 4GO1A 4ZDKA 1EDDA 3C3WA 9GPBA 5B4VA 2JFQA 3G59A 2I55A 3P20A 1MDFA 2WWHA 2XJ4A 2JDIA 1LJ8A 2VXYA 3Q9UA 3UK6A 5CFRA 1HT1E 4L76A 4PLCA 3QXCA 4UDYX 1QPBA 4WL0A 5CFQA 5JNTA 1NBMA 3NWBA 4YRTA 1KDVA 3ZD6A 1CZLA 3CEPB 2NSHA 4R31A 1IVSA 4PCVA 3OJCA 4KIGA 4RHXA 4MCAA 3UUGA 1PZNA 3W5HA 4O1IA 3D4BA 1I9CA 3MMPA 1JPVA 1XF1A 3KG2A 1MV5A 4I1VA 3WWZA 1I32A 1Q83A 4TLMB 3VJMA 5EZYF 1GZ7A 1E63A 3WP1B 1EBBA 3H4MA 3WL3A 4GC5A 2R86A 2XVXA 1U8AA 5B7NA 3S8YA 2L2QA 1PV1A 5KMGB 1T3GA 3QKWA 5JWHA 1N2GA 2V58A 3F7TA 2ZULA 2EQBA 5T7BA 3MCAA 5KYUB 4PS1A 4ZT7A 5KX5B 3ZXIA 1B0PA 3Q85A 2DLCX 2M2IA 5TGTA 2JLVA 2Q3FA 4DM4A 4AFNA 4PHTA 3GPCA 1P33A 5FO0A 4C7BA 4FXOA 5CJ2A 1C1YA 2WY2D 3L6BA 4EG4A 4NBWA 3TNYA 2EJWA 5F9MA 1JLSA 1WPRA 2C7VA 5B64A 3HO1A 2B78A 3PVZA 4MUNA 2UXCB 3NGXA 2PNJA 4HL6A 4JFRA 1SBHA 1XQWA 5FKJA 1TZJA 2VXCA 1AZLA 4WDQA 3E3NA 5JBNA 4A6XA 1WUHS 3T9BA 1L1QA 3VPGA 3A1VA 3H87A 4QO7A 5T57A 1K06A 4D98A 4QTUB 3VU1A 4L0DA 4BQEA 4O02B 3G9ZA 3JATB 2FTKE 1ZIDA 2JKYA 2XB4A 2HHJA 3N87A 2JZNA 3EY9A 4PYLA 4XGKA 2C8KA 2HWUA 1HNZB 1HL3A 2AD5A 5HEKA 1I6MA 1IMJA 1N2SA 2HUNA 3R3ZA 4KN9S 2DY1A 3IAXA 4L4YA 4QTTB 1ML4A 1F60A 4V3BA 4XARA 5FULA 4FS8A 3KDSE 1G3RA 3L1HA 4HB3A 1YS2X 5CK5A 3HZRA 4ITRC 2HB6A 4LDZA 3RHFA 1HORA 2B2XA 3BN3A 1HE8B 3DE7X 3MD9A 1DP4A 1D6JA 2Z1NA 3BORA 4OSOA 3S2UA 5AUNB 2R8EA 3AT1A 1CJMA 3K0AB 4KQ9A 3T0IA 3PJGA 1PG5A 4RX1A 2ZRDA 2FJ0A 1X94A 3SKVA 4HAIA 5HE9A 3RVSA 4DIEA 1X9HA 4IOMA 5AKYA 1E6KA 1SULA 2POCA 2UZIR 5JD5A 1Z22A 3R0JA 5EMLA 4ZRDA 1CQJB 4LZWA 3EN0A 5CYOA 5IN5A 3R9XB 1MX5A 2IYQA 1EDBA 3CKMA 2RB4A 2A94A 2EZUA 3EIUA 1DAMA 2W2KB 4LV6A 3WRWA 3MMSA 4LRUA 1IU9A 1EGHA 4B3BA 2GPJA 2PJUA 2P6OA 2PR7A 3BL6A 2NZVG 4MW1A 1QZ3A 3V33A 4BFLA 2P2ZA 1T36B 3GJ4A 1X8XA 4JHLA 5KTSA 5DGXA 1RPNA 4NZYA 1YZNA 2DPGA 4M8NE 1YFLA 1RQGA 2BJWA 5HCUA 5LP6A 4BY9E 3I39X 4DIOA 3AB3A 4PSKA 2O3TA 3Q3HA 2QSYA 1X1EA 1GNRA 1Q7RA 2XKJE 4BE9A 4C43A 8GPBA 5KAPA 3RFTA 4QUJA 4AMGA 2P4SA 5B2ZA 2D74A 3IOBA 5GVRA 5KEIA 1SUSA 4MQ4A 1GKUB 1Z15A 2VAWA 3O8OB 1QGDA 5GWXA 4P4SB 4ASUD 2QLNA 3TYXA 1NUSA 3BUSA 1X1AA 2VJOA 4BIMA 3H8JA 5KX5F 1L0BA 2J6BA 3V32A 4FN4A 4I1RA 1VRVA 3ZTYA 1GN8A 4RH0A 3SS9X 2YRWA 1HTWA 4B0OA 3PA6A 4JENA 4KZKA 1IIBA 5BNTA 1FSPA 2KX7A 4IIJF 1V43A 4GKAA 4ISBA 1ADYA 1EE9A 1A4RA 3AOEA 5TS2A 1HR0B 1NXTA 2BZ0A 1EHIA 2Z2KA 3P97A 2H1OA 3BZWA 2NV6A 1ZIXA 1N6LA 2XE8A 2C3UA 1EFPA 1L7RA 2RHHA 3RBVA 3OLYA 2DWCA 4CL3A 5JY1A 1W1IA 2J4FA 3DEHA 4QIHA 2X15A 3ENQA 5A4DA 1RAHA 4ITUA 3CIOA 2A4MA 4YAUA 1E2GA 5IT9A 1JSXA 1QP7A 3GA0A 2CV2A 2P3LA 5REQA 3EZLA 2PKQP 4DQDA 1G98A 4GKJB 3K2QA 2E5FA 4XIIA 1N9ZA 2GUWA 3E05A 4KVGA 4MV1A 5E7JA 4AQ7A 5T41A 4LXGA 3L1JA 5DWVA 1A95A 3RCBA 1DL5A 1DJPA 5BP7A 4Z1MA 2C9ZA 3DC7A 1KK3A 3FNEA 4X63A 2G9ZA 1CY4A 4X6LA 5T4EA 2GILA 1T4CA 1IHOA 1UANA 2X5XA 3RGWS 5KNCA 1BCRA 2BE9A 2G36A 1FNCA 1JZQA 2XA1A 3CWCA 2RCYA 1Y6JA 2N3ZA 3NXKA 1NY5A 3ZUPA 4KODA 2O2HA 1JAZA 1YTUA 2XGSA 2AMJA 2FSFA 3RTAA 4IH9A 1U0HC 2HBZA 5JV5A 1P1KA 3A2LA 3ULKA 2A0WA 4I55B 2FWJA 4MUHA 1SD5A 1FPMA 2DUJA 4UU8A 2W6QA 5G0WA 3FGPA 3STTA 4DNOA 4E12A 2VAPA 4IMIB 1WUJS 4LMPA 4M89A 3DVAB 1DOZA 2NTJA 4PYJA 2XECA 4FDLA 4N40A 2O54A 2YC4C 3DOCA 3IIKA 3O0DA 1F2VA 2J5QA 3FTPA 3G2PA 2P2DA 3GOHA 2Q6VA 3VPXA 4DMFA 4EB3A 5I7UA 4WW0A 5ALGA 2HD4A 3A70A 1XEAA 4IXNA 1IH8A 1P72A 1Q0SA 4JQOA 5DHRA 4ZQFA 5IM5A 2OMKA 1V48A 2SNIE 4PZAA 4C5BA 3ZU2A 4ZGGA 3Q2IA 2A5LA 1N3LA 1OZFA 4L4SA 1NUTA 4ANFA 4E1AA 1MXFA 4JBXA 1N8TA 3THSA 1ZK2A 3UM9A 4BNGA 1Y80A 4XX0B 3OOWA 4KDCA 2YQ5A 1V8PA 5BYAA 4UMVA 3MN1A 5F98A 4DT1A 2FGKA 2Q9AA 2Y05A 2JJQA 5C4MA 1WD7A 4W5HA 4OSEA 4NSNA 4CKWA 1ORWA 2WFMA 1ZBDA 4HX5A 3IESA 5AW4A 2ZZNA 5K0SA 3D1JA 1YNSA 4Z4FA 1DEHA 3A05A 2XUZA 1NVAA 5C4GB 2C99A 3U0BA 2VG8A 4A4DA 5IKEA 3SYNA 1LBQA 1PGJA 4XVHA 1Y8RB 5IVPA 1NXVA 2GHTA 4LWZA 4BV2A 1PJSA 1QG2A 3UWPA 4YJHB 1R4MA 2O2CA 2X2FA 3KHTA 1P8AA 4I1IA 4XX0A 1F1JA 1QJ4A 5GJBA 1N0VC 2SCUA 1AURA 1DHTA 4W63A 1P0PA 1BN7A 3L7OA 4HXEB 1CDEA 1J33A 1NVTA 1XZDA 2M1XA 2ZP1A 3AHHA 3ZI0A 4EUNA 3EDMA 3A3KA 3NHUA 1G38A 3EVNA 1F7UA 1QV9A 5BSEA 2DHRA 4HQRA 4ND7A 2C59A 1F1BA 1Z7GA 3A27A 5P21A 1EFKA 1XD8A 1OFUA 4J0DA 3WZ2A 4C4RA 1WCXA 3AEKA 3M1LA 2P27A 1IY9A 1JB9A 2AN9A 2AOWA 3BMCB 3GLRA 5FB3A 2LKDA 4XIJA 1VLQA 3PWKA 5AUOB 4TV8B 6LDHA 1G8GA 1NOJA 2CNKA 3DE2X 4NG4A 5E6UA 4MIYA 4P4TA 2Q0XA 4PZZA 4A73A 1BH6A 4EARA 3HXMA 1VPTA 2R65A 1CQJA 1DCFA 3JD1A 3PDIA 1NRXA 3TIFA 3MJTA 4RVDA 5KTKA 4PW0A 5ERXA 4ESVA 4RJIA 5BORA 4WN9B 5WRFA 2Q9CA 1AF4A 1GR1A 2FFAA 2D1YA 3RFXA 8AT1A 1RSZA 1OBHA 3RGGA 4QBTA 3WLPA 4BATA 2GCIA 4H31A 2HK8A 4BCDA 2X4LA 2BGTA 1YL5A 3MCWA 5HK8A 5EUMA 1C3OB 1VGVA 2XTZA 5JU6A 4RNCA 2ZZMA 3AV3A 5ALVA 4EGJA 2X19A 4Y67A 5AQ1A 4HFRA 3RTBA 1QMGA 1GGJA 2QZSA 3DV2A 2UUBB 3D81A 4ZVQA 1YIOA 3R5SA 3REOA 3HBAA 4POAA 5TT0A 2AXQA 1CR2A 3D2CA 5DTEA 1E7WA 3W5CA 1NT2A 3I61A 3C6MA 2Y4OA 4B81A 1RQNA 3L92A 2YV2A 4WFJA 4CV3A 1E9CA 4S0ZA 1L8LA 3NBQA 5ADWA 2YOFA 1YB7A 3LUCA 4Y2VA 3DCYA 4H0FA 3VU8A 1TLFA 4FB5A 2QR3A 3AF2A 3DM9B 3L82B 4CIDA 2GVNA 1U28C 1QPGA 2A5FA 2QL5A 1Q0TA 4AKHA 1D4ZA 3KT8A 1D2MA 3RRNA 3OU6A 3N59A 4HNQA 3QVSA 1HZJA 3EVAA 3ND6A 3PHIA 1KO8A 1QZTA 2QW1A 2OGWA 3R77A 3PRJA 4MCJA 3LYLA 4MMXB 1RWQA 4Q05A 3T3EA 4EIWA 1TA4A 2C83A 4PPQA 3IULA 4YIKA 4FGUA 4LCBA 1D2HA 1Y63A 2P6MA 4XLLA 3ZW7A 5J5CA 4TRRA 3SNKA 5C81A 2DTXA 2GEDA 4MIOA 1ATIA 1DFHA 1P4SA 1K97A 4OQFA 2PX0A 5EZSA 2REQA 4NFLA 3N6VA 4HMOA 1AKTA 4C7XA 3ZTTA 2J08A 1VSUA 1J25A 5SY9A 1QQ7A 2B3TA 3R6LA 4FDVA 3V1LA 2C58A 4ZRMA 1EFPB 4OU5A 1NMQA 1OTHA 4KRGA 1H8EA 3CQ9A 3D6TB 2IF2A 4CLDA 2AKAB 5AI5A 4X84A 4UCXA 2PZFA 1H1TA 4ZT3A 1QX4A 2BBSA 2E55A 1Z12A 3CT6A 1AKVA 4MQLA 1JR6A 1WS6A 3MSXA 3CFYA 5AJXA 4KPUB 4Y30A 2O3JA 4BX8A 1X1SA 4E31A 3D6AA 3KPJA 1VDMA 3LPAA 4R1NA 4BMVA 1LF5A 1VPEA 3ZE0B 3KFLA 5TQJA 3HJCA 1OCEA 3PENA 3IR7A 2ECKA 2WE7A 3LP5A 2AG6A 2XVZA 3QVTA 4DDKA 4RK1A 1PTJC 3FKQA 4GH5A 4W5JA 5LYYA 5K6RA 5FX2A 3NHJA 2Z1DA 2HIMA 1KI6A 4D56A 1L3IA 3RC9A 2WJHA 3I6BA 1B2RA 3FGNA 5K1ZA 3VZSA 4TS4A 1I2DA 3BERA 4NBKA 4AX8A 3QA3E 4HD8A 1FJXA 5U1PA 1MGOA 3IHKA 3B6ZA 4URYR 3Q3GE 2FSSA 3C5EA 4X44A 3UV3A 5KKCA 3GAAA 4LZJA 3CNOA 5KTYA 4YCSA 4TMWA 2DUWA 4RVNA 1WCIA 2PL5A 1RM5A 3ID6C 3NTLA 3R3WA 4I5DA 4ZCMA 1N2ZA 4A8HA 5A03A 5IAAA 3QV2A 4CM5A 4BAZA 3BIFA 3F6RA 3ESBA 4RHYA 2XCTB 2V98A 3P5BA 1P7PA 4U7PB 1CQIB 1HYHA 2IHKA 1FYVA 4JXJA 1U8EA 5FL7D 1R7RA 1X7WB 5B1DA 2LR0A 4JNKA 3WGVA 1QHXA 4OHKA 5DISB 3WYDA 4EX7A 2B1JA 3N2IA 2GWRA 2ZJFA 1B74A 2G0TA 5B6JA 1LJUA 1NJ6A 3RIEA 2IEYA 1YC2A 1JJIA 3F97A 5E6RB 4CMEA 1VZ3A 4GE0A 2DT8A 1OROA 5EXPA 4PGAA 3CSUA 2CMFA 1L5FA 3FBWA 4PTYA 5J5VA 4B73A 4Z4EA 4NP6A 4RCZA 5CFMA 5CXUA 2B2CA 1OX6A 3DQPA 3FUXA 1AE1A 4YR9A 3H8SA 4P0QB 5IW8A 4JJ6A 3LBHA 4A0QA 3FCCA 3QENA 4NF2A 5D1NA 4C9BA 13PKA 4E5PA 1J06A 1FUKA 2Z09A 5G4LA 5CEFA 4KLZA 4JL6A 3QP9A 4ALKA 1T2FA 4MWGA 2Y77A 1Y6GA 3DZGA 1WWKA 2PTGA 4P32A 4TL7A 4U2DA 3KR2A 3ZE8A 3T1TA 2BGWA 1I3LA 2ZKIA 1VG9B 3WL7A 1BE8A 1Q0QA 3GT0A 3JSXA 4BVBA 1S6YA 2P5UA 1D4AA 4DB4A 3WICA 3MJDA 1H66A 2WAOA 2NU9A 3DEIA 4YRBA 3R3JA 3D6JA 1JKXA 4KBGA 4D6XA 1UM9A 3OEED 3QLUA 3PWZA 2V6IA 3S4YA 5DXAA 5JJIA 4U7TB 3UTDA 3Q7TA 1NOKA 2G77B 2P9BA 3FNFA 3GNLA 4RAOA 2BKAA 3WWEA 5BURA 5L3SA 2HMTA 2OO7A 1Y1TA 2E5LB 1B6SA 4KYUA 4JC0A 2QG9A 3Q15C 1U0OC 5A9SB 2QR5A 3TEMA 4FQ7A 4E22A 2XGJA 2AF4C 3ANMA 1NVUQ 2WJ4A 4KUEA 2C4NA 1AGNA 2R7NA 3DZKA 1IUOA 4U8HA 1ZL0A 2GTPA 3MFQA 1SUFA 3N86A 4E5KA 4EG6A 2PUBA 5C8VA 3R0ZA 3JR3A 4G85A 1REQA 5IJZA 4Z5XA 2FSIA 3BA1A 4OLHA 1NN3A 1EJBA 2CHFA 5ALFA 5DO9A 2P9EA 4A23A 1WL8A 4DHWA 3PXUA 1K5HA 4OHOA 2WHRA 4B09A 2P1RA 1F7VA 4JU8A 2ZUBA 3CBQA 3PXXA 3GDWA 4HDCA 4BEBA 2F1JA 1IBRA 1ZHOA 2NUBA 5CLLA 3OQNA 4PO9A 1KVTA 4XX1A 2DQKA 1WLSA 1ZD9A 3BA6A 1C7JA 3EVFA 3QX9A 5CW1A 3NVAA 5J59A 4FMPA 5BUQA 2ZRCA 3OCWA 4DIMA 1ZNQO 2J8ZA 1BU8A 3FKSD 1T0UA 3PSHA 4U9UA 1NVKA 3MT8A 3IPLA 4LK2A 4M87A 3A4IA 2NXEA 4OB6A 2YHUA 3VAZA 2A9PA 3LL4A 4COKA 3R9WA 4J0JA 1E61A 1ITZA 2EKPA 1PEAA 1PLLA 1ZH4A 2GXSA 3C1UA 3OEEA 1OKKD 4KAJA 4NZMA 5CX1B 3WGTA 4DLTA 5DLYA 3DFMA 2FOIA 2PXCA 3O2JA 4EQ6B 4RADA 2CN1A 4DFDA 5M34A 1VKNA 2OHFA 2XQGA 4KDFA 2FR8C 3NDRA 1P6XA 4Y6QA 5DM2A 1H2FA 4K0KB 1XKTA 1GRCA 2X4GA 5DTQA 3ZGNA 3ZJYA 4RHCA 3SQWA 3T7JA 4X1KB 4UM7A 2NZ8A 2NVUA 3BGIA 4E33A 4KPYA 2VBCA 3ER9A 4L22A 4AJ2A 4MGHA 5GONB 3OD5A 1DKNA 4JUAA 4R54A 1O4VA 1TIBA 2I65A 3ILVA 2R47A 3KZCA 4YAEA 1SMKA 5K2OA 4TKUB 3A37A 1O8BA 3H5NA 2VT2A 2Q0SA 3H5VA 3RE1A 3R5KA 4W99A 1I7DA 4OGKA 2ZE7A 3OT1A 4F3YA 4IVQA 3GUUA 2G8NA 4JT4A 5HJEA 1IN6A 1CBUA 1I6WA 1Z5NA 5EZ5A 5EAIA 2FSVC 5E9JA 5FRDA 3RF7A 4JLWA 2Q21A 3P0FA 1AQLA 1R3UA 2F67A 4ARUA 1VA5A 4PCLA 5MGBA 1PJAA 2IUTA 2CBXA 1DELA 1C9NA 1KI1A 2HFKA 1RXUA 2DT5A 4RWEA 3DZCA 2YJ3A 5ED4A 1G42A 5KKNB 3C39A 1BVHA 1RJGA 3MOSA 2WR8A 4E14A 2QBYB 3EAQA 1IXRC 3NNSA 3ZGVA 4JP5A 3G17A 3RRMA 3SHTA 3WGNA 4ZARA 5AVVA 1L7XA 1JRLA 1XEXA 3VBCA 2RHBA 4XDHA 2JRLA 3LW7A 4FT4A 1N33B 2D0DA 2Y9MB 3K70C 4JN6B 2RDMA 3AWIA 1K4MA 4OP2A 4ACAA 1U63A 4BQOA 3SX4A 2X22A 4INZA 1I13A 4XWYA 1NDQA 4MJLA 5CCBA 3OOEA 4M8IA 1BWSA 4QQFA 1L3CA 1RHKA 4ZJUA 3RV4A 5IWCA 5IT0A 2W6ZA 2FA9A 1QHFA 2A67A 2C31A 3QU4A 1GT91 1NR5A 2B2NA 3RAJA 1UDRA 3BMCA 3DG9A 4D41A 1Y8CA 2PGNA 2DFDA 4X1OA 4ZAZA 4HDQB 3H1BA 3OMLA 3HKCA 3VYWA 2W6CX 1U0NA 1J0XO 5F73A 1VIYA 1QIDA 3K32A 4N47A 1OQAA 2ORYA 3EFHA 3WLAA 1QKIA 1LWNA 4AW9A 1GV1A 1Z83A 1PDVA 2BSAA 2ZAYA 5KTNA 5KVSA 1T8PA 5KS2A 2GFHA 3AR5A 3MTGA 4F7DA 3BZBA 3CLRD 3FVVA 1FSGA 2JARA 4KWCA 3G2JA 4P83A 3UMBA 3Q87B 3R8CA 4HUTA 1YZHA 4ZKDA 1NR1A 1ZRNA 3B5IA 3FMIA 1GKIA 2C20A 1P7VA 3UV6A 3D0QA 2WZQA 3NBYC 5FUWA 1J1IA 1E9EA 4RMIA 3N0TA 3PLRA 4YLEA 3LC7O 2PRYA 3IP6A 4MV8A 2JFNA 3EPPA 3HKCB 4HAZA 1A8UA 2G5CA 1PQUA 2VBGA 3LSTA 4PZ9A 3BL5A 2Y8EA 2VHTA 3WLOA 3QG5A 2JATA 2EOAA 4AN4A 3OEHA 3ZS8A 2H9IA 4DRXA 3ICEA 4ILKA 4MB0A 4G65A 2W2KA 1MEOA 2BFBB 1AKWA 4C30A 3R41A 1U7XA 1FTSA 1K63A 2D2XA 4HUQB 4I4CA 4X90A 1R9JA 3KPUA 4I50A 4D1YA 1JLHA 1SURA 4ETNA 3ZN2A 4LPKA 3BT7A 2N47A 4OB7A 1MV8A 4BNLA 2BFMA 4U2BA 3W8FA 4FFSA 2Q49A 4MUMA 3TRKA 3ACBA 3TLEA 1Z6TA 4F6RB 2J0VA 3UUEA 3FR7A 1CF9A 4LYAA 3SR0A 5FI1B 5IF3A 1RYHA 3TLGB 2JEYA 1L4GA 2C3PA 2LW7A 1DOAA 4IDNA 4CTJA 4PRZA 3F6SA 3UPUA 3KKLA 1C0KA 5SYNA 3EGWA 3GT7A 1WSDA 5CA1A 3JX9A 4BO2A 5KKAA 3P0RA 5AWFC 2V59A 3RTDA 1BHQ1 4DJDC 1DZIA 3S2GA 4TTAA 1QF6A 4Q9AA 1N2EA 5FTWA 1W8DA 3SVLA 2Q3EA 3UK1A 2UUAB 4RK5A 4LVUA 3QXJA 4M36A 3JALB 4RMJA 1UQRA 5L51A 1GYRA 4DSUA 4C2TA 2QD5A 4WVLA 2Y66A 4PSAA 2ODPA 1O96A 2ISCA 4URHA 5DNDA 3FUVA 1G5FA 3VNSA 3R7WB 5BV2P 4IINA 1VL5A 5CXQA 1LC3A 2L82A 4BO0A 4CM7A 2R1ZA 1UBSB 1M2VB 2YDYA 2F17A 5B30A 1L2TA 6NULA 2R97A 4P4GA 1JE0A 1S2DA 2WU4A 1ADCA 1ZK0A 4B8YA 4YMLA 3ONFA 2H57A 1VFNA 5TPZA 2NGRA 1T8TA 4EP1A 5LQMA 4W5TA 1L7EA 4MGZR 1GFSA 5JC1A 3JQ9A 1YE8A 2NVWA 1A9QA 2HNBA 3D8HA 521PA 3UMSA 4KXQA 2FP4A 3TR6A 4L4RA 1IHUA 1N2BA 5CIYA 3LYHA 2XD4A 4UPDA 1U8UA 1Q1EA 4IV8A 2H9YA 1HE3A 3CXRA 4BWYA 1CVIA 1KY3A 4HWGA 2OC4A 3ZDRA 5G3ZA 4D9MA 1OT3A 3B5JA 3U39A 4IG4A 2Q9BA 2O1SA 3TTVA 2IE8A 2F3SA 3E6AA 4IGAA 2YBDA 4MJ3A 1U5BB 4FUTA 4MLCA 3K0HA 1A9RA 3BILA 2AE2A 3KT3A 4FXPA 5F7ZA 3HI6A 3EW9A 5H81A 2UVPB 2HF7A 4H6PA 1CSEE 4KU4A 4KI7A 1KH3A 4D5EA 4I3GA 3FZQA 3PUYA 4KO8A 4B3HA 2BKUA 1OB5A 1DHRA 3FUCA 5CDUA 1N9GB 1YQXA 5AOBA 3B70A 4AZVA 1XZEA 3EHEA 1BIFA 2YYZA 4JUBA 3CLSD 1KEPA 3ZYZA 4TTSA 4CIBA 4OHRA 1V16B 3LT4A 4RM2A 1IXZA 2QNRA 3KYCA 4R7GA 5HIJA 2C8LA 2VYNA 4J8PA 2JFUA 3RSOA 3WNBA 3E3LA 4JYZA 1Y34E 2HRCA 1POXA 3O6VA 4KYVA 4TKLA 1N7IA 2Y1CA 4RIEA 1W47A 4LWPA 3ICVA 3T8YA 2G9VA 3NB0A 1CY8A 1VHJA 3PNQA 2ZIXA 4O4IB 3HVJA 1S2IA 1L5SA 2CDRA 3NHFA 1PFKA 3F9CA 3LHKA 4QNMA 5K3FB 5AW5A 4MRAA 3ZY3A 2WFAA 1E9BA 5ALKA 3TX2A 1DCTA 5LJLA 3N2KB 1KU6A 1M6HA 1SIBE 1HURA 2R48A 4EUKA 1BA3A 1NSTA 5KHLB 1YSCA 2H5LA 3SI7A 4L6IA 4MS4A 2V7XA 1EFRA 4W1RA 1P1HA 2VDLB 3RTGA 1JKJA 4CQMB 3U7FB 2BBWA 4CFSA 1FDIA 3FCXA 5ALRA 1SBCA 3RRBA 1M2HA 1VSTA 3OZAA 1YI8A 3RUAA 2G5PA 4QVGA 5HW0A 3JQ7A 2PMDA 3AFHA 5D85A 2IW1A 2ZT7A 4R71A 5IFKA 1S3GA 4IWYA 1U8CB 1I5RA 2XE6A 1XZHA 3I01M 2HFJA 3IXMA 4JK3A 4RD1A 1P2BA 5DU2A 1JTVA 3RTCA 2XKKA 4ZT4A 2O59A 3ZKWA 2ZBEA 1GPBA 3W8DA 4U4AA 3ORQA 3B60A 3E03A 3LO8A 2VDVE 3KLNA 4L2IB 4XDGA 3B38A 1NVEA 1MKYA 4C1NA 5KYUA 3ROKA 3WLMA 1L4BA 1ZAYA 1M8GA 3LX8A 4HRAA 4EF4A 1TE2A 1FE8A 3I58A 3KVNA 3QYJA 4YRJA 3SX0A 1Y7PA 2KHZA 5KNDD 2DUNA 4HMQA 4DL9A 3FA2A 1HDRA 1VKOA 2F3TA 1BSVA 4DM7A 3SLRA 5J4LA 3C5VA 3NRBA 5E6SB 3ZWPA 2P77A 2ETXA 2IC5A 4LHSA 3ZNPA 1B0AA 4D3DA 1M2EA 1TCUA 3DMRA 2IODA 3NDBB 3IMGA 3QPAA 3ZX5A 4PNHA 4G41A 2XZTA 1IOVA 1F5SA 2I6XA 4RDHA 2WNIA 1K92A 1TF5A 4FZVA 1C30B