4D9MA

Crystal structure of diaminopropionate ammonia lyase from escherichia coli in complex with aminoacrylate-plp azomethine reaction intermediate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
396
structure length
378
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSFMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Diaminopropionate ammonia-lyase
total genus 130
structure length 378
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9mA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9mA01
3R0ZA 4ZQCB 4OREX 2EGUA 1TZKA 5BW6B 2C2GA 3VC3A 5I7OA 4D8WA 4I1YA 1UINA 4Y6GB 1TZMA 1CW2B 3IQGX 2Q3CA 1K7XB 2CLOB 1WDWB 3L6BA 4PCUA 3VSCA 4D9CA 2DH6A 5EY5B 5I7RA 1UBSB 2ZSJA 2CLKB 3X43A 5J43A 1TJPB 3IQHX 2C2BA 3RR2A 2J9YB 1FCJA 1TZJA 1J0AA 1UIMA 2RKBA 4LI3X 3VSAA 1V7CA 2ECQA 2PQMA 4IL5A 4JBLA 4D99A 5IWCA 5D87A 3PC2A 3AEXA 2ISQA 3VBEA 1A5AB 1A5SB 1CX9B 4D9EA 5B53A 1K3UB 5DW0A 5I7WA 5T6MA 4D9NA 3ZEIA 1Z7WA 1FUYB 3IAUA 5CGQB 2O2EA 2CLMB 1TTPB 1VE5A 4AECA 2V03A 1QOQB 2TYSB 3DWIA 3DWGA 1F2DA 1TYZA 1BEUB 3DKIA 2TRSB 4HN4B 2CLHB 5B3AA 1K8YB 1Z7YA 3VSDA 1K8XB 1PWHA 5B36A 3SPXA 5B1HA 5DBEX 2CLFB 4L27A 5CVCA 2WSYB 1D6SA 1WBJB 1O58A 1KFKB 1WKVA 5DBHX 1PWEA 1KFJB 4AIRA 4KKXB 1C9DB 3FGPA 4F4FA 5HBGA 3FCAA 4QYSA 3SS7X 4HO1X 4D92A 4XUGB 1JBQA 1TDJA 1KFCB 2RHGB 2TSYB 1OASA 4LMAA 3BM5A 4HPJB 1QOPB 3CEPB 4D8UA 5D86A 1VB3A 2DH5A 1E5XA 3L6RA 4L3VA 1KL7A 1J0BA 4HT3B 1WTCA 2CLEB 2ECOA 4D9MA 3AEYA 3HMKA 3R0XA 4D9GA 1V71A 1V8ZA 5DW3A 2CLIB 1P5JA 4ZU1X 1K7EB 2EFYA 2Q3BA 2ZR8A 2JC3A 2D1FA 2J9XB 4NU8X 2ZPUA 1TTQB 2RH9B 4D9FA 3PC4A 5I7HA 3PR2B 5D85A 1TZ2A 1BKSB 2GN2A 1C29B 4WX2B 5KINB 1VE1A 2GN1A 2J9ZB 3PC3A 4ZU6X 1A50B 1J0CA 4HPXB 5JISA 3IQIX 4D9IA 5E0KB 5IW8A 1RQXA 3L6CA 3T4PA 1KFBB 3V7NA 4D96A 4OFXA 3SS9X 2O2JA 4L28A 2BHTA 1KFEB 1K8ZB 5I7AA 5J5VA 5KZMB 5IXJA 1C8VB 3X44A 4L0DA 1M54A 1Y7LA 4D9BA 1J0DA 4D8TA 1A5BB 2Q3DA 4H27A 1K7FB 5D84A 5I6DA 5B1IA 1J0EA 3TBHA 4D9KA 1X1QA 5DVZA 2CLLB 4NEGA 2BHSA 4COOA 4D97A 4LMBA 5B55A 5JJCA 2GN0A 5C3UA 4JBNA
chains in the Genus database with same CATH superfamily
2N1MA 2FRDA 1FSFA 4K1LA 4R1LA 3THXA 4HH3C 2OHGA 3PXBA 3O26A 3TGPA 1KNQA 5K8LA 1VXRA 1WS6A 2YZ7A 2G06A 3VKVA 2G0NA 1OSNA 4QPZA 3U80A 2VDKB 1FUKA 4JVNA 5HIMA 2ZE6A 4R05A 3O8RA 1S02A 4FHDA 5IDYA 3G7SA 3HHPA 5GP1A 2FSPA 3RV4A 1XTUA 3WO0A 4BJ6A 4X54A 3QYPA 3T1QA 3BTVA 3S2GA 3U60B 1NN5A 4W1QA 2JHCA 4BLOA 4CBVA 4BO5A 1HYBA 5IJ9B 3DT8A 1X8XA 5AHRA 4X7MA 3P45A 2D8AA 3SI7A 1GTMA 2OLEA 4FNAA 1VYVA 1B76A 3NAZA 5DGHA 1I4LD 1DAHA 1L7AA 1QZUA 1UC8A 5C53B 3AOGA 5EAIA 4BTEA 3BRSA 1NVKA 5IEJA 4QO8A 4YRCA 2HMVA 3STHA 4ZZ1A 2BGMA 3TLZA 4FOOA 1UKYA 3N8KA 4IQ4A 3OJEA 5JZBA 3OZEA 3L1UA 2WG0A 5L53A 3RVQA 4MUMA 3W5SA 3AV3A 1E3WA 4I55F 3IAS1 2H7XA 5DULA 3TLGA 1QP8A 3QWIA 3F4LA 4XUCA 2CBZA 5GZ6A 3CT6A 3LGSA 3SPXA 1AH2A 3JS5A 4RM3A 5DNCA 1PT6A 5DSZA 3RTDA 2QL5A 4GR4A 2AN5A 2JG3A 3RRYA 2IBTA 4RF2A 1DZIA 1Y3BE 3ETEA 1E3JA 1JG2A 2CHUA 3GPBA 4J7XA 2IV3A 3X1JA 2OBXA 4Y1RA 4F91B 2WWIA 1OX5A 3PFKA 3TNYA 5E2AA 4JWTA 2DWUA 3N5CA 4MV7A 3C5CA 5FUVA 1Z62A 3LLSA 1P9WA 1V11B 1G5RA 3PPXA 4F9TA 2BM0A 4IJKA 1BA2A 4W6QA 2A84A 2FZ4A 3P97A 2XCUA 3HBLA 3NORA 1DMSA 1NQUA 4MKXA 4N5MA 3VU8A 5CYPA 4ABTA 3OAAA 1TU4A 1L4GA 3DDOA 1F60A 2JAOA 1OREA 4EUHA 1M1UA 2G5TA 2HHJA 4OSPA 3FH0A 4QEDA 3OZFA 1ABFA 4UM8B 4DEYA 4ILKA 4X8MA 3PGLA 1EB9A 2D13A 2GCNA 2EERA 4KQJA 1RWOA 3IMKA 4LE1A 1P0CA 3RSGA 4C1BA 1JIXA 2J0SA 1T3LA 4GSLA 4Y30A 3FZYA 2M6LA 3M1IA 1T36A 3NIBA 1UPBA 2QL6A 5ALYA 4AG6A 4CR8A 3LRXA 1G8PA 2Q4BA 1JFVA 4F2DA 1T6YA 2KQUA 5H70A 3DL7A 4QU0A 4O2AB 5JY6A 2WKSA 4RSRA 3SYTA 1V39A 2P11A 3QX9A 3MGBA 3LWBA 1E7WA 1V3VA 1OIVA 4FYMA 1AY0A 1RJDA 2DULA 3WGYA 3P32A 4KK4A 1KI4A 1RQPA 4EHLA 4IGIA 2FMXA 2O57A 4Z4IA 3K9QO 3K8YA 3O7WA 2H4JA 2LUOA 2FTKE 5AXAA 1FEZA 4J1NA 4TYQA 1PJ2A 3LPDA 5A4AA 3HP4A 1X6VA 1R0LA 2E4WA 3FGOA 4JDUA 3COVA 5DM0A 2IF0A 2CWDA 1T9HA 1G3QA 1DC3A 1WD7A 1XZBA 1XZIA 2QKYA 3C8HA 3LRTA 4YB8A 1NMSA 2PSJA 1HZJA 2X1HA 3UAVA 1GGJA 1WDTA 4JJ6A 1DEOA 4WNAB 1XE3A 4I1YA 1U7XA 3SEAA 2VN8A 3VKWA 8ADHA 4XSVA 4UZEA 4ADSG 3EW7A 5KYXB 1V6SA 2H4WA 3Q98A 1H2AS 1XU7A 3E27A 5K01A 1E1QD 5IK2A 4GKAA 1M72A 3WMXA 2E4UA 2Z4TA 1DV2A 4GOXA 2IUEA 1XN1A 1DQZA 2YR0A 3NALA 2BFFA 3UW1A 2XX3A 4LISA 2V7TA 4L1KA 3ILVA 4HS4A 4JL5A 4QYIB 1GNPA 4E2WA 2B3DA 2VJAA 4DMKA 5ENDA 3S2YA 3EZ2A 3GF4A 3LLUA 1WCIA 4K9DA 4DJ5X 4HNUA 2P7HA 3JQAA 1NE2A 5K0GA 2CMKA 4WSOA 2YXEA 4R3WA 1A7JA 1CBUA 3IOCA 4OQYA 4ESOA 5IXSA 3UQYS 1K5PA 2G1JA 2X0JA 1QU2A 3PNOA 4OQNA 3M9XA 1Z4IA 3BZBA 4Y1GA 3E48A 1XVTA 1PYOA 2O8CB 1X7WB 2WJJA 4UHDA 1XQYA 2X0FA 3Q9NA 4A03A 3UJNA 3ILYA 4M9RA 2VWQA 2PEYA 2R751 4HB4A 2BKVA 1ONSA 2ZE7A 2B34A 1PFGA 3LX5A 3RVDA 3WLHA 3N28A 3ZLVA 1EBUA 1WCWA 2ZDGA 3KPUA 1U0LA 1AUOA 4B6QA 3WL6A 4QUDA 3I01A 4EPRA 1CQIA 2Z1NA 2ZAMA 4HFMA 3FLEA 4XB6B 4NULA 2MSDB 4FMPA 2MIIA 4C7OA 3IEPA 2YFQA 1OY1A 1DXHA 4YFYA 3ELBA 4UQPA 1OMOA 1AXGA 4PO3X 1QH8B 2JVJA 2YVKA 3AW9A 1QYIA 2F1RA 2RONA 3IURA 4HEJA 2NZ2A 2HYDA 2DFKB 3KT3A 4JJ8A 3TQFA 3L93A 4WI1A 3PIIA 2I2WA 3D4OA 3N2YA 2JZNA 4L0MA 2FXIA 1H65A 1UMCB 3ND6A 4FQ7A 4L4RA 5CYGA 2VDWB 3PENA 3GARA 1UANA 4YGYA 2VPTA 5KOHB 1BMQA 3AETA 4EB6A 4XLTA 3I09A 4QUJA 3TYXA 2J0VA 1WZUA 3U44B 4KLNA 3RYFA 5AUPB 1XZAA 1F17A 1BWSA 1XLTA 3S40A 4FNGA 4ND8B 5JRZA 1SKUA 1LDEA 3FAZA 4CKCB 3HNOA 4I9HA 4QOIA 1JHYA 5JARA 3EWNA 3GCWA 4L3OA 2MHCA 3NHRA 3EIEA 1TM5E 3PQDA 4D56A 1X1BA 2WTAA 5KWIA 1GZHB 4ZRDA 3UMMA 2PJUA 2V0CA 1JFFB 2L19A 4BXOA 2ZZMA 1NE7A 1R37A 3IESA 2Z2XA 4OLFA 3NUZA 5IAOA 3JD2A 4KXVA 2WP8J 1I51A 5GJBA 3MD0A 1ABBA 1VA5A 5HF8A 2VYCA 1KE2A 4JI0B 1DDOA 3A9CA 5DBGA 1Z9BA 2F9MA 2RSLA 3G82C 2IDJA 3ABIA 3O6VA 4J6FA 3RF6A 4IHAA 2H0AA 1L5HA 1DL5A 3TUJC 4FFVA 4AD8A 1QF7A 5TF0A 2Y1KA 2OENG 4PX5A 2VAWA 4H4CA 3WQSB 1IG3A 2QTVA 4Q0MA 1O3YA 4HAIA 2Y1CA 3Q2KA 4PG7A 1OTHA 3ZLBA 1N5MA 5TEWA 2ZIXB 3P0EA 4IW3B 5MHTA 2CUTA 1WW2A 1VI2A 2IS1A 1SHTX 2PGDA 1BEZA 3EQ2A 4HMQA 4HXEB 2Q3EA 4BX3A 3IGFA 3E9YA 5EHZA 2QP3A 3W5BA 2EWMA 5HRUA 1P4GA 1KOLA 2P9BA 5JMWA 4N7JA 4I5IA 2QT9A 4W7SA 3B7PA 3ZD8A 5A5VA 3TXXA 2RE8A 4ZREA 4O6VA 4YROA 1GPBA 4YJ2F 5HQJA 1OXUA 4RZUA 3OZIA 3FCEA 2UYCA 1GFSA 2RH8A 3Q5EA 4HDRB 5I9SA 3L8HA 3H6KA 1NSFA 3QWHA 4TXLA 3EA5A 1OFIA 1WB4A 3M6WA 4JBHA 5SY9A 2E5LB 2A0KA 3ZCRA 1G4UR 4QYMA 4R3NA 1BO6A 2WLTA 4LWPA 4TXNA 3CPEA 1BHSA 3C6QA 3EDMA 1M8JA 1YDMA 1TLFA 2G71A 3DUFA 3DWIA 1OLSA 4L5CA 4M53A 4PONA 5KQSA 2OQIA 2QYTA 3LZCA 4CR6A 3IJEB 1KC3A 3R0IA 3ANYB 3HS3A 1IAQA 3V46A 1JQ5A 1K27A 1KVTA 3DEAA 3A25A 1N2BA 3PPYA 3LV8A 3PYLA 5IZCC 4RCYA 3HXPA 2P91A 2ZAOA 3ZVRA 3TCXB 4YJKA 1WKVA 2PYZA 4RK4A 4D6YA 4OGWA 4WZBA 1CUSA 1I7PA 1WF3A 3L8MA 3P5SA 1W29A 4HAVA 1FFSA 1VCMA 1TM7E 1EGHA 1KETA 1R1DA 1ATZA 2D5LA 2ZUWA 1ESCA 2G40A 4FGJA 4GOOD 3OQMA 3LYHA 2XNDD 2VDJA 4AKHA 1ZVQA 4MDEA 1ZJYA 2RBKA 3EAFA 2CK3A 2IYRA 1T1JA 4B0PA 2YNMA 2QSZA 4P08A 1Z6GA 3MLBA 1DFGA 4Q7MB 1ISPA 5TGDA 4XOIA 1JXQA 4M6WB 4CIWA 4EQ6A 3BJRA 1Y5RA 4TVOA 2HFJA 5FTNA 4F8YA 3S29A 4MS3A 4XWGA 4EY6A 1O89A 4POOA 2FPPA 4NEQA 2X7HA 4N9WA 4PHTA 4KR9A 1Z2EA 4RWZA 2PD6A 4DANA 3EXHB 1HOTA 1SCAA 4FW8A 3PL5A 4AKTA 2XUJA 3L46A 3UKJA 4DPLA 1XX6A 3GL9A 3IE2A 1ZIOA 2XNKA 4MYTA 3U3ZA 2XQFA 3WX0A 4ZGWA 1XHLA 3D1VA 1C41A 4QG3A 1KIFA 2P1DA 4LXQA 4PTYA 3G0CA 3PSAA 4KIFA 4MCJA 4MYSA 1OVGA 1E6WA 1U7OA 3JATA 2PXHA 4XGRA 4ZOBA 2NPIA 5G3ZA 1EHYA 3H9GA 2O4UX 3KQWA 4W9NC 4Z4GA 2X1LA 4DCMA 1YUNA 3AYXB 3MJCA 2PQ0A 1I9CA 1DPGA 2XRMA 4E22A 3PUJA 1X1EA 1JG3A 1XD2A 1K66A 3IH5A 2R1TB 4NBSA 4TLBA 2FPPB 2FOXA 4GF5A 4YJFB 4WQMA 1OWLA 3TBHA 5IUNC 4NBNA 3WIOA 2C8VA 1EM8A 3LP8A 4L7VA 2FSIA 4FB4A 5EHXA 5CDGA 3B9QA 3HXLA 3QUAA 4LYEA 2YQZA 3DE3X 1WZ2A 2ZATA 3OZGA 4F84A 1UAYA 3G2NA 5AI0A 2A7QA 3C70A 5FCDA 2QAGA 3RUIA 4P92A 1VPVA 1EFPA 4MQFB 2QW0X 2XA9A 4A4DA 4OH7A 2B92A 3KB1A 3UMGA 4Q21A 2JLXA 3FA2A 3NIGB 3DXXA 1VFPA 2BF7A 3B9RA 2BFFB 3T8YA 3EXFA 2YV4A 1B16A 3WK5A 5FR2A 5DF1A 2BMDA 5ALLA 5FWYB 4A8JB 3RHZA 3ZHOA 3ZHTA 5J2UB 4CF6A 4AURA 4P82A 5GV7A 3JYLA 2RKBA 3K5PA 2IKQA 2Y4OA 4MNTA 5ALEA 4NPHA 3L8DA 1VDZA 3B5JA 3E9DA 3P20A 2RIPA 4FMCB 3VDMA 1KC1A 4HF7A 5JQGF 2HO4A 2WAMA 1Z08A 3HP7A 3K5IA 4MB0A 3Q3HA 3W4IA 2G83A 2RI0A 2QIPA 4PC7A 5AJZA 5ER9A 3NHWA 4PQRA 4BBZA 4WJZA 3O1LA 1HBJA 2QNRA 1D4ZA 3FRHA 4Y6OA 2HV8A 4GOND 4D9NA 4RS3A 1TM1E 4LWZA 1UZNA 2Q49A 4K46A 2R1VB 1OYVA 2ACKA 2AHOA 3LA8A 3LHFA 1W2WB 2VH5R 4I1OA 5C37A 1JQDA 1RVV1 3IJPA 3EPLA 5ESWA 4MYHA 3OA0A 1KGSA 4QOHA 2IUFA 4RHEA 4DMCA 2FY8A 2B8TA 4NDAA 4BWGA 4B7XA 1E5LA 2PWAA 1O8CA 5AVJA 1M2VB 2R8EA 4B2PA 2QZPA 2CNLA 1Q3KA 3HA3A 2QX7A 1HGXA 2PR7A 4F8EA 4KDCA 3GQBB 3V80A 4BAGA 2JIOA 1RCUA 3DO5A 3F5FA 5B1DA 3U9TA 4GYYA 1QRUA 4BNMA 3VX4A 3J7AC 3BF8A 3OFNA 4DJJA 4W7IA 2VSFA 1X7HA 2F8LA 3UA4A 4NZYA 3GGCA 5IVDA 4JQOA 4W4TA 5T4EA 3PU6A 4IJ5A 5DOZA 2D1RA 1J0BA 3TOVA 4PZLA 3BTUA 5B58C 1WHTA 3BK7A 1LDGA 1KARA 1T2EA 3BEOA 4DLUA 2NVUA 4EI7A 4NMMA 3OCYA 2G1PA 2BHNA 3DMTC 4UM9D 1SHKA 3LHKA 4WV3A 4UE2A 3R74A 4PLFA 1DDGA 4UATA 1WHSB 3TW8B 4LF9B 4LSWA 4FGZA 4DMMA 2ENUA 4WHMA 2WAXA 1A7UA 3B3AA 1PG5A 1YHNA 2XZDA 1J2JA 3JALB 5ALMA 3TB6A 4C88A 4CKBA 3NDIA 1UBLS 3DBLB 4PXSA 3L1HA 5AQEA 3MWYW 2H06A 2FEXA 2EIXA 5JISA 4E5MA 3DLHA 4LZOA 1E98A 5D1NA 5FOTA 1E89A 2OFFA 3KT6A 5HM6A 4Z51A 3NRCA 4G9BA 4UC0A 5FNVA 1FYWA 3SDBA 2IL1A 1VL8A 4O4IF 2P4EA 1COWD 5C8YA 1SOUA 1Y8QA 5KYVA 4ZHQB 3I39X 1YRLA 1BN6A 3KUCA 2ZBEA 3U44A 3VTAA 2GF9A 5JROA 3D4BA 5HIJA 2BZGA 2OHOA 5EXXA 3MRXA 5TNXA 1B6RA 5KTKA 4WKBA 1DTSA 3SFTA 1KMMA 5IABA 1AZLA 3KR2A 5FUQA 2IXBA 2GYVA 2ZQYA 3BE6A 4TWZA 4JLOA 3RS5A 4NVRA 3OZ7A 1TJ3A 3FE2A 3GEBA 5CHYA 1KAGA 4ZQCB 1QUFA 4D5EA 4DOMA 1C3OA 4KH0A 3UJ3X 1DBPA 4X62B 2GF2A 4LYAA 1OHHD 3PKJA 2WTMA 1U8ZA 3EY9A 2R0QC 2GUGA 1G7CA 2IEBA 3DB2A 1NF8A 5BN4B 4B6RA 4BFWA 4ZIRA 3C2QA 4AX8A 1L1QA 1FXWF 1E8NA 2CLOB 2QLMA 4L95C 2R6ZA 4ARSA 2VTBB 2Y68A 1W30A 3TL2A 3LUHA 2KMLA 1K68A 4F5WA 1GV1A 3E8SA 5KYKA 1J8FA 2D1YA 3KWMA 2XXAB 1QPBA 3K6RA 4BBPA 2CF6A 4QDKA 2ZM5A 2PQMA 3OPQA 1QHHB 1E59A 1RKQA 2QSUA 3OURA 4GMXA 5CT8A 1JHOA 2C9YA 2OCBA 3FMGA 3O8CA 4DV4B 4P4SA 1QZTA 3QU5A 2BKXA 3PXDA 4DAOA 2DERA 4OXRA 1GL7A 1GSOA 2EZ9A 2ISSD 2PTHA 1U9CA 1UJBA 4RK5A 2OXIA 1TW2A 1F6BA 2GYUA 4C0LA 1HL3A 4A2CA 1GGNA 3ZOZA 4E4YA 2PVSA 2NUAB 2JIDA 1N92A 2GQ0A 4GRAA 2ZJBA 3IMEA 4FKMA 4HNRA 4AN0A 1H6AA 1TEXA 5IKEA 1UT5A 5TQJA 5BWMA 2XQJA 1JMKC 1KR2A 4L2IA 3WISA 1J1IA 4LJ4A 1NFQA 4PO8A 4H1WA 5ECDA 1FFWA 2MMGA 1IHYA 2ZRAA 4JSYA 2QORA 3FDJA 4I5EA 4KGVA 3BK1A 1E2LA 1LF5A 1ULZA 2XVMA 3ZHUA 2AFIA 1QV6A 1ID8A 4LHEA 3QOWA 3NHMA 2OCDA 3IR5A 4QBFA 2QAGB 5BSMA 4YMHA 4RCVA 3T3PB 4EA6A 2D54A 4NICA 4V1CA 5LMUB 5T4FA 1G6OA 3CX6A 2P3OA 1USVA 4QODA 3W6ZA 4G1CA 4OYYA 3RFCA 3MRVA 3NWBA 3EPKA 1IN8A 1GLGA 1Z56C 2YJ6A 4YHBA 1TNDA 3SZLA 4B3TB 1UJMA 2CJWA 1VL6A 5CIYA 1RZVA 5TQVA 4W9MC 4HT3B 1WTCA 5MFPA 4WNCA 2OPHA 1X70A 5T41A 3DKRA 3H42B 3BS4A 3E22A 4G1BA 4PAOA 4J03A 1MJHA 2HT6A 3I53A 2AWNA 1YA8A 1WWKA 1KP3A 1K6JA 2O8DA 1Z0JA 3KJFA 4TRRA 2W2NA 3ZHYA 3A3KA 4A10A 5GVSA 1XCOA 4URHA 2GR9A 3GJ8A 5L4LA 4B31A 2F3SA 1C29B 2UYGA 5L3SA 2NZYA 3U81A 1T5LA 3RC1A 3HB7A 2WFZA 4NCXA 3IQIX 4X93A 5HA5A 4GI2A 3E1KA 1OA1A 1H69A 5K0EA 2Q8NA 3P94A 3D0KA 3FDZB 4G2TA 3VYSB 2EQBA 2V8OA 1RLIA 1EFTA 1T1GA 4DA9A 1I4DD 4BIIA 2G09A 2BCGY 4GD3Q 4PSKA 4JJ4A 3ZGVA 3JARB 3K2BA 2BFPA 5CYFA 3OQOA 3D2AA 1KF0A 4BOYA 5L51A 4RIEA 3SZGA 2NUTB 5HHTA 4TL8A 4ZVVA 2RJOA 1ZN9A 2G5PA 4YMSA 2D1QA 4BAUA 4EX7A 1P80A 2W6OA 3WMFA 2UXDB 1E66A 3M1YA 3O4VA 5BWNA 2Q5FA 2R68A 1KTIA 3WL7A 3C7CB 1CP2A 2GJKA 3AKEA 4JBNA 4TROA 4EI8A 1JEQA 4JGGA 2BTEA 3GFFA 1LFAA 1BXRA 3A04A 4JJKA 5ALUA 3P8ZA 3SX4A 3I9MA 4HXYA 1BDMA 4N9QA 4UVIA 2PNJA 3ZBUA 2YHUA 4BV2A 5ICGA 3DOIA 1BE6A 1QHYA 4GE3A 4OM7A 4KX5A 2A2ZA 4GPEA 1HWYA 1NRXA 2AJBA 3X43A 1WNTA 4ARIA 2P0EA 3DE6X 4PFJA 2HLPA 1T1SA 2QGFA 3WLAA 3UY4A 3DUFB 2BTOA 2RGBA 1RLJA 2GZSA 4V0QA 3IQXA 4DQXA 5AVYA 2FCRA 5IUJC 2Q6OA 3DYBA 5E3JA 2XJ4A 1BGVA 1PJTA 1QDUA 2H4ZA 3G8YA 4YTEA 4EJSB 4E70A 1K4YA 1NBWB 1P1KA 2PSFA 3UWKA 1JBKA 1TAUA 2WFAA 3C6XA 3RWOA 3IQWA 2WUFA 1P1IA 2AFHB 4X0EA 2WDPA 4GZ5A 2ZQ5A 3UMYA 3K0CC 2QG6A 1EVYA 3KB8A 2XYRA 5HW0A 4UUMA 5JU6A 5PGMA 1YZGA 3TR5A 1FFBA 2VK8A 1OV6A 3IOEA 3VZRA 1C0EA 2I6TA 5M29A 1QIDA 2IOFK 3ETCA 4Q1CA 2Q28A 2MTBA 4QU8A 1WUKS 4G89A 4RGVA 2WJAA 2YY7A 4WBNF 1NQOA 2HSJA 5CITA 3HWRA 2O14A 1AN9A 1L0BA 1H8HD 1XLUA 2OZEA 3UFXA 5EIBC 1T9ZA 5C7OO 3FF4A 1X80B 2H1IA 1E9BA 1FMFA 4INZA 4ZAFA 1I5EA 5BWOA 5BW8A 1Q7EA 4LVOA 1H23A 4BCCA 5FI5A 4A6XA 1GADO 3CWCA 3FZNA 5J47A 1DNPA 2PGJA 5LU9A 5BYKA 3E0XA 2GDJA 4DCUA 5KQMA 1A9PA 1Z6QA 3MCTA 4ML3A 3AIMA 1LQ2A 1XJQA 3CJRA 3WDLA 4W8HA 4GT1A 4F3KA 3OMWA 2I4OA 4YT5A 1GA4A 5JNRA 1Y7TA 5EGNA 1JMYA 3W1WA 1XELA 3F0TA 4C7MA 1WB5A 1JKMA 2IXFA 1L5LA 3VQTA 3IJRA 4AQ7A 1MHPA 5HTKA 1XZLA 3SF8B 2MT9A 4K9SA 4CFZA 4NH0A 5CJ2A 3V8NA 4ECAA 1EWQA 1WUHS 2J9ZB 3BHJA 4ND8A 4LYDA 4QBTA 3M4NA 4J3FA 3MNFA 3TZLA 4XOUA 5IVIA 4IM7A 5IDVA 1FUIA 5E0KB 2CXHA 2Q4OA 5CA1A 2BMAA 3G7UA 4H18A 4EMTA 2ZANA 5FX2A 2W90A 4DMFA 5TLSA 2ZRIA 1ECPA 4KN9S 5FHRA 3FFTA 3IRVA 5BVHB 1U81A 3L8EA 3VU3A 3P9QA 3FUCA 4YO8A 4JN6B 2ZI3A 3BXOA 5CK4A 5FWAA 5FI1B 1NLMA 4BPBA 4TV9A 1VBMA 2JKZA 1PR1A 1L7OA 1B6GA 2O50A 1FLVA 5C8XA 2AIRA 2RGNC 5IARA 3UMJA 5IU6A 4II7A 5DE3A 1DLIA 4UZSA 4ZT3A 5HS4A 5CDTA 4LKOA 3OIDA 3TNLA 1T2FA 3RT1A 3VKGA 4CQLA 4Q7EA 3GUUA 1MDBA 3P9KA 3QA9A 1JE1A 1YI8A 4M1QA 4U7JA 4WUTA 2O7QA 3IIMA 5DN9A 1THTA 4CODB 4E33A 1CDOA 2DYKA 1IFXA 1O6CA 2OHJA 3KKNA 1SEVA 2KBFA 2X23A 5JSHA 4YYZA 5GGYA 3DE2X 3OAAD 5CH5A 3ZH2A 4EYQA 2B2NA 2PUVA 3S5UA 5IT9A 1JNYA 3D0RA 4WRRA 1T5BA 2DUWA 4OGLA 2WWHA 1TVKB 1MO6A 2B5VA 2O0HA 2ZE8A 1EVZA 2OMKA 3JXEA 1EGMB 2V58A 4OLAA 3LT1A 4EELA 3IERA 2QMUA 1QAMA 2Z5GA 1QIJA 3MGCA 3D7KA 4IMJB 3T7KA 4DJTA 2HIAA 3VYTB 4NENB 4FOPA 4MCHA 5AKXA 4YCJA 1GU1A 4W1RA 4K9OA 1CJUC 4IMRA 1G38A 1LRKA 1TF2A 1MQSA 2LIPA 2FEPA 2ZI7A 1PV2A 1WSAA 1PP4A 1W4ZA 3DV2A 3FTPA 3KEQA 1YS4A 3KJEA 4OMUA 1PUXA 1KSGA 5H9WA 1DWPA 4QPNA 3KVYA 5LZ9A 4PGAA 2VF8A 1NXXA 3K0BA 3QY0A 5CGQB 5DCYA 4A26A 3LOQA 2PUGA 2QI9C 4E5KA 3AVOA 6REQB 4MR8A 1P9RA 3ZV6A 4CM3A 1ML3A 2CXNA 3FGNA 2QW8A 2G82A 2R8OA 3NH6A 4JP1A 4L02A 4Q7JB 5I8ZA 3TD2A 1UXGA 1W87A 5EZSA 3GVIA 1NJSA 2Q2OA 4BMYA 1IM5A 1SCDA 1UJNA 2DVMA 3C98A 3M6AA 3OICA 1GQYA 3WNBA 3B1YA 1IBKB 1NXTA 1PWXA 3DSRA 4XRGA 1JFSA 2R62A 1BG6A 2DOKA 2OLJA 1IRIA 3OHPA 3R40A 3HU2A 2FMFA 5AI5A 1YF3A 1T34A 2PV0A 1AE1A 4UD2A 2C29D 1I8TA 3KZKA 3Q7TA 1E5QA 4O29A 5A4MS 5KHLB 4WBSA 4NENA 1EFVA 1P3Y1 3DLTA 4J16C 3EEFA 4RIIA 2OV2A 1UP4A 2JH3A 3ZPXA 2DLNA 2HBYA 2WKPA 3TM4A 2VT7A 5D6NA 3SZ3A 5AVSA 1WPQA 3K15A 2PUEA 1R0SA 1YRBA 1MX5A 2HSEA 4B76A 4O02B 1C0PA 1V9CA 4DKJA 1DRWA 2V4UA 4G63A 2J31A 2R84A 5GJWC 1WM1A 3RLIA 3AZPA 2IW3A 2RAFA 4NLLA 4RA9B 4L0QA 1XMOB 4EUFA 1KH3A 4LBZA 1I6WA 1IN6A 1L8OA 5T4HA 1TM2A 2WA1A 1OBVA 3HCOA 1IBCA 2HIGA 3QP9A 3PQ3A 3VNBA 1G55A 2VATA 5JTUA 3HPRA 2Q1UA 5F23A 1PFVA 3X44A 4MVJA 3UHOA 2V7PA 1QZXA 3IHKA 3N7TA 4C4TA 3HUTA 3FTFA 1MW9X 2YQ5A 1YACA 2ZVDA 1E2GA 1TUEA 2SBTA 5KCZA 3UAWA 4ZQHA 1MVOA 4C7VA 1KH1A 2QQFA 3DDNA 4IDNA 1MAVA 3G0IA 5EE5B 3V1TC 3K6SA 4HP8A 2CYCA 5CB4B 3DDWA 2FPRA 2VHQA 3NT5A 1F8UA 3MWDA 5I01A 3DFIA 5IDQA 3TWOA 2CXRA 1SG6A 3KR9A 3FYUA 1EDZA 4TMTA 1QP7A 1CNMA 5EWJA 1KTVA 1C7JA 1NMYA 3A37A 2W0SA 2B0CA 1FPMA 2WHEA 5DZSA 4E32A 3W78A 4PM4A 3SYLA 4E6PA 2FPSA 1FF9A 4LZAA 4QNRA 3RYHB 4Q00A 1VXOA 2JIBA 3K9BA 3I9OA 2EBWA 2Z4SA 3EXG1 3PDIB 2NNLD 1N4AA 4EABA 1GQOA 1IQ0A 2OC9A 3SSOA 2UVDA 1PJAA 1YB1A 2ZPTX 3H65A 4WERA 3RNLA 3CNBA 1GITA 2XXJA 4LHWA 5HJ2A 1IZ9A 3ASVA 4IFBA 1QHNA 1N7JA 3BYZA 2PUHA 3JVIA 3GRCA 3R20A 5C4GB 5BOSA 1RM3A 2J3LA 3E61A 3KZVA 2AFIE 3I1YA 4IX9A 5K0JA 3NVKI 3A9RA 3WIVA 3U5TA 1VPEA 4MGIR 1T2VA 1CUBA 3GJXC 3GW8A 4M54A 3W5VA 1YZYA 2EFEB 2IP2A 2XF2A 5DYIA 2QTTA 3ZLJA 3OESA 3DOUA 4QQNA 5EZYA 2Q5QA 3FVWA 4ARCA 4N8EA 1CWUA 4JJFA 4WADA 2ES4A 1G2OA 1S7CA 3FTQA 2ZSEA 1D6SA 3G8DA 1O9BA 3DDCA 4F5ZA 2NOAA 3AI7A 5J5AA 3VR1A 5KSOA 1TOAA 4IDHA 2J3EA 3UB3A 1JJVA 2H48A 3ZZUA 5JCPA 2XTMA 4BFVA 1YHZA 1V26A 1ZOSA 3FSEA 3JYNA 4NFLA 5JC1A 3T7RA 3T7CA 1NP7A 1S0UA 3ZU6A 4JI3B 2QX6A 4R71A 4MEJA 3THSA 4KXQA 4YRRA 4YAIA 2QYOA 5BUZA 5FLYA 4IXWA 4AB1A 3CUKA 1TB4A 1Q12A 1D07A 1QH9A 3FNHA 5EUCA 4MCAA 3U17A 1OWOA 4Q7LA 2ESRA 4XWYA 3Q4GA 5L6LB 3W05A 1ZGBA 2FP4A 4TWAA 4QM6A 1N8SA 2E87A 3AERA 2FU5C 4P3OA 3MWGA 5CM8B 2QUBA 2NU8B 3ZE6A 1TTQB 2FQQA 1GL6A 2HZ7A 4X20A 3UEOA 1UC9A 1DTWA 3QXHA 1AUXA 4NHEA 2PBLA 1AV7A 3OCJA 4J43A 4EDHA 3PNVA 2DUNA 2K87A 1G20E 1JSLA 1LSOA 2VDLB 1LD3A 1A76A 4O4JA 3VZPA 1ZU4A 2MSWA 2O2DA 5DYNA 5EWMA 5TEVA 4FFLA 1QS0B 4Y6RA 2QT0A 3X2FA 4GSYA 1UPXA 5HJ7A 5A05A 4QFBA 2PUBA 3E23A 2C7RA 2QUAA 5LN1A 2VHUA 3ORFA 5T5QA 5B30A 5EKUA 3DHVA 4TN1A 2VP2A 4CUKA 3OM9A 3RDPA 1D4OA 2Q6IA 3D4IA 2PJDA 3DE7X 4KBFA 4WPGA 3OM8A 3JARA 3ISTA 3NHZA 3AEKB 4JLJA 2E0IA 3U49A 5B7QA 3TTWA 1MX1A 3K72B 1U5BB 3A2KA 3T7EA 2O2HA 3D8SA 1VI5A 1W52X 1M7BA 2CVPA 2GCOA 4INAA 1G5HA 4RXUA 4KU4A 2JFXA 1MABA 4RK7A 1NVXQ 1M9NA 4Q4HB 4TRNA 5J3JA 4B0OA 3G0OA 1R4AA 2ACEA 4CCYA 1SXIA 4L15A 4Q3NA 4YP5A 3CWZA 1YVRA 3NPMA 3H5OA 4AO7A 3NM5A 5IKPA 1LV8A 3U7QA 2FWPA 1MH9A 3KPJA 2GTPA 3JW8A 3OCXA 1SBNE 2CFIA 4INPA 5F73A 5H16A 3R7FA 3RGGA 4YRBA 4DIUA 2RD2A 3B20A 4DLNA 5EXEA 5JVDA 5A7GA 4J0QA 2WTXA 2IU6A 3TRDA 3D8BA 1P0QA 2YICA 1EIWA 5C5IA 1YKGA 2XTZA 2XTNA 1EVLA 1HDCA 4JQYA 4U7TB 2WJVA 1SVOA 2HRZA 3RJTA 5BSUA 1WEHA 2V5VA 3FPLA 3TZKA 2AF4C 2GERA 1SQSA 1V2GA 4E5VA 5TVKA 3BC1A 1E4EB 4IIJA 4A23A 4V1CB 3RS3A 3T95A 1B0UA 3OWHA 3IP1A 2V5AA 4FOLA 4J1QA 5KSPA 4PLVA 2XA1A 3R7SA 1JQLB 1UBRS 2PMDA 1VPLA 2OP0A 3AUXA 2HK9A 3ORHA 4GVPA 3T0GA 3TVDA 2K7FA 4FHZA 5EOVA 3ANMA 5AXBA 3HB9A 5K6AA 3RC2A 4AICA 3OOWA 4JLVA 3M4ZA 1LJ8A 5AW4A 5LP6A 4BJ1A 4WOJA 1T0IA 1BA3A 2H8GA 4L2IB 4S1OA 5F76A 3VSDA 3QVMA 4XGQA 3O8LA 1U7TA 2W5UA 4RU1A 2JIZA 2GBFA 3EH2A 4Y2TA 4IHQA 1A9XA 1AKRA 2WSYB 3ON5A 3NTUA 5BPHA 3U1TA 4BNGA 3SE7A 3KR1A 5J5CA 3T9FA 3AI1A 3VV2A 1VPWA 4KHPB 1QFZA 1GTJ1 5FJJA 4YXWD 1SZPA 4DL9A 1X13A 3I73A 1QF6A 1E1RA 3M33A 4FR2A 1N0VC 2VUUA 2FPGB 3HFRA 1MIOB 3OPNA 3IEMA 1G9SA 2GEUA 4GKJB 2FKAA 3DTTA 4WIAA 2GZAA 4WXYB 3A9VA 1PS9A 4RQBA 1VFNA 1E4EA 5JYDA 1HRKA 5IBPA 4D9GA 1SXPA 1F0KA 3EMVA 2C61A 2DFTA 4JEUA 1NBHA 1SD5A 1XRNA 4IXDA 4P34A 3IHTA 1IEVA 5FKJA 4EMSA 4PG4A 5H80A 3MWJA 4I5GA 5TMEA 1V5WA 3X3HA 3IC5A 4K6CA 4PYQA 5MN4A 3RW9A 5CTJA 3VZCA 1LC0A 3OJWA 1VE1A 1CF2O 4ZOLF 4F96A 2F4VB 1LBEA 5ITZB 5IG2A 3IKLA 4OKIA 4XYMA 1XDDA 1UDAA 2OBYA 3EGDA 3KAQA 2ZIFA 4KJXA 4TM8A 4MKRA 5DGXA 3TIGA 4RTSA 2WT9A 2O3UA 3CLTD 3AR8A 4MWOA 2A35A 3EWAA 3NVMB 5KJFA 3OH8A 2H3EA 1ZP6A 4MVJP 4MVJF 4Q37A 4WN9A 3O1HB 4ZO8A 3NG1A 1H66A 2HM7A 2IIVA 3ST7A 3L92A 3TSCA 3VR6H 4CMBA 4LTDA 1G291 3DEYX 5JRJA 1G6Q1 2AG6A 3FN4A 4ND4A 5JV5A 2JK1A 2Y6UA 1N5JA 4XPIA 1CUGA 3ET5A 2PH5A 3MTBA 4G0XA 4B3JA 1Z0IA 1POXA 2GZ3A 3Q3GE 2HKIA 4REMA 1UBMS 1A8UA 1BAPA 3CS3A 2R9VA 5AM3A 1RAGA 4IJQA 4YCNA 2DCUA 3CUYA 4HRYA 221PA 2PJZA 3LLCA 2WRZA 1IXYA 3BPSA 1JDUA 2X1VA 3F90A 3A0RB 3B8HA 5HILA 2Q3CA 4RANA 4C2TA 1CETA 4QGHA 5TC4A 4UHJA 2J4DA 3EF3A 1RJFA 3SKVA 1PCXA 4AMUA 4XWKA 5AW8A 4EHAA 4H7DA 3GWZA 2ZIZA 3UPTA 3CCCA 4KWEA 2WQ6A 3VAZA 5GZ3A 3I1JA 4E09A 1GNVA 3HJGA 1ZR4A 3PE4A 2EX1A 3W79A 3LBIA 1LRJA 1L7XA 3BMQA 1NW6A 1E1DA 2BI7A 4G0MA 5GJVC 4JBLA 4XR4A 3DF7A 1P6XA 1UMCA 3EDOA 2G07A 3LQ1A 2HA3A 2JGFA 2QLNA 2V9CA 5GVRA 3WYBA 2WJWA 3GVCA 3PDCA 4BKOA 1GARA 2GLTA 2YYSA 3O47A 3QE0A 3QEKA 4Z8XA 3PGXA 1RI1A 4BLWA 3NC0C 4OQ4A 2FI1A 1XRQA 1M0WA 2G6BA 1I2AA 3GELA 1YOVA 5C4MA 3GFSA 5F9FA 3JQ9A 3OKFA 2FX2A 4R9NA 5L3RA 5JFTA 2EOAA 3GC6A 5G0UA 1GQFA 3CXRA 1K2WA 3ER6A 3H5IA 3W8DA 1MZPA 1DCMA 4PTLA 1S8OA 4I50F 4QXOA 4DT1B 5CJPA 5KVAA 4R7ZA 4B3MB 4NYIR 2IIBA 1KHHA 1UXKA 5AP9A 1LXCA 5H81A 3X1YA 4AZVA 2ZXUA 5ED0A 2A0YA 1SHZA 2QXUA 1CRQA 3HC7A 1J39A 4AO6A 3PXXA 4HI0E 5T8KC 2CLCX 3B9BA 3UAGA 3WKEA 2XGJA 2N46A 3HJBA 4DNXA 4QOEA 1VJ0A 3QPAA 4U8HA 1STOA 4XEHA 1Y48E 1XVIA 1ZNQO 1R6XA 2A0UA 5ANRB 2AZMA 2D2VA 4IPTA 5L4NA 5A9TA 1QWOA 1L6IA 1YXMA 1Z35A 3MWEB 1I4WA 4Q9JA 3PITA 1ZSNA 1IN5A 4YECA 3T38A 4ER6A 5B2ZA 4HOYA 4RD6A 1FNSA 3GJRA 3H4MA 3A1SA 1RD4A 2ASVA 3NT2A 3P4XA 1V1JA 1R6VA 2FQ1A 4TS3A 3TW6A 4D8YA 2W2QA 1DSSG 2I6GA 5NLLA 1PTJA 1VCNA 1YAJA 1M8FA 3D7SA 3C8DA 1U98A 3E70C 3E9NA 3T61A 1GFIA 2J9XB 1U4NA 2QVCA 5K3SA 4CQJA 5JSUA 1FLAA 1ORIA 4CNBA 1JKJA 5TDHA 1GTRA 3AVVA 1P1HA 5CA0B 3Q6IA 4OOFA 3NKFA 3L0IB 2HEGA 3C3AA 1APBA 4ZT2A 2E2WA 2WF6A 1I6LA 2B0JA 4HV4A 4LSMA 4IMPA 4BNIA 3MGKA 4IZHA 2CJYA 3B85A 4FBLA 5BSKA 1JLRA 2K6GA 3T1NA 2WIFA 3GLHA 3A2MA 1F2UB 3DFFA 4LHYA 1VLZA 4MA4A 4HLNA 2PL1A 4E88A 1EEHA 1QZZA 1VP3A 3L43A 4JR0A 5TPWA 2AG5A 3J81A 3BE5A 3KUKA 2FZWA 1RWXA 2B30A 2HBRA 5HOQA 1JDBC 3CG4A 3L40A 3I6YA 2DT5A 3MAAC 3IDZA 3AFNA 3L01A 4MIKA 1JLMA 1R4NA 1NM5C 2PL3A 2VQ6A 1UQRA 1YVEI 3I8OA 3OZRA 1OI2A 3BFPA 1W94A 2W98A 4MUEA 2XMGA 1LBSA 4YNBA 4P84A 1Z5GA 1T24A 4LDRA 4HGPA 1XZMA 3PQ7A 3HP1A 5KWJA 2C7BA 3EGDB 1J5EB 4D97A 1LK7A 4JZYA 4XD7D 1C7RA 1MAUA 2BOVA 3GFPA 4R01A 1JIUA 2UUPA 1QRDA 2DTEA 4ODIA 5JSFA 3B3QA 5TSDA 4JB2A 5KBYA 3H4TA 5JJLA 4J16A 3L7JA 4R2LA 2CHEA 3DAGA 2C2GA 2ZJYA 1QQ6A 1EWYA 1I10A 2CHVA 3UMVA 5EJEA 1SKAA 5HIAA 3X1WA 1NR5A 2OCAA 1X2EA 4R84A 3ZGLA 4MAAA 3RSHA 2OCLA 3JAKB 4DNFA 5J43A 2IOHA 2QMHA 4D02A 1E2KA 1YQQA 2GN6A 1TK9A 3EZNA 3N8DA 4GAEA 1PO7A 1SXJE 2HQOA 4JIGA 2BGJA 3GHYA 2OA0A 4AP5A 5A9SA 3ZNQA 5A3QA 2PZFA 5JAOA 5JIBA 2HB6A 1W76A 2JHGA 1J1UA 1NNSA 5I9BA 1NZFA 2VZ8A 1NYLA 2P9EA 3D9QX 2YJ3A 2CD7A 4Q18A 3C8MA 4YPOA 4KQIA 4Y67A 1Q1NA 2LV8A 2P2NA 4ON9A 4M7PA 1R5NA 4GLBA 2PLNA 1K7YA 2O2EA 4MV0A 1Y6JA 2J59A 2C97A 2JGKA 3SZOA 1HLPA 1KP9A 2ZJFA 1YFJA 4FGWA 4PRZA 4Q3KA 1T4MA 1VZ2A 4FFNA 4JQZA 3QMWA 4OMFG 1OXMA 3GQVA 5J2UF 2JJ8A 4GZLA 4HVAA 4GG1A 4WDRA 1AKYA 2DFDA 1DCKA 1JB9A 2PH3A 4C2BA 2DXIA 1FDWA 3WV4A 2FSSA 4EEKA 1B4DA 1RRGA 3IBTA 1ODIA 3E15A 2OV3A 5K51A 1XLTC 2WIAA 3KE8A 3S44A 4NK4A 1OPXA 3HVHA 1I0IA 4RAQA 4UCXA 3GLTA 1IBSA 4KKXB 3V2HA 5BV8A 1UBGA 1RWPA 3CPSA 1XZDA 3CTMA 3F3SA 3MMPA 3OEYA 3F2VA 2NVBA 2G9VA 3C48A 4DQ0A 3GH3A 3WJ7A 1YWGO 2JASA 4YI3A 3UQZA 1ZNYA 2HAEA 4PANA 1L9KA 3U19A 1TVCA 1EK1A 4Z5XA 1ZXXA 1T4BA 1V7PC 2X2PA 3R3HA 4KFSA 1Z4PX 1LLCA 3PYMA 1CR6A 1NUTA 1R4MA 1MEOA 2XIQA 4QICA 1X19A 3IBSA 5JVDB 3H5VA 1VLHA 4DTIA 4G26A 2ZPUA 1ADCA 2C7GA 3HPQA 2WHQA 4FFRA 1MLDA 2P2CA 5IVKA 2JHAA 2IP4A 2ET6A 5FBRB 3OJOA 2GTHA 4DLBA 1LNZA 4LZNA 2AUNA 8ABPA 2V7XA 2B61A 3KPVA 4ZEMA 1TPZA 2JB9A 3F1LA 1SHJA 4OAQA 2C7PA 4HWRA 1I1OA 4BE9A 1TKCA 1QHSA 2HBQA 1Z25A 3QLEA 1PGPA 4L5AA 4C6TB 4I3HA 4WFQA 4IDDA 2FA9A 2XECA 4CGZA 3QELB 3R41A 2IHKA 2O3RA 5F3DA 5FPYA 1AQLA 4IHJA 2YV1A 4ROTA 3E9RA 1T1RA 2FQYA 4IKEA 1FDIA 1VKRA 3L7LA 3CX7A 1O03A 3IALA 4RPLA 2J5BA 3VYVA 1LW7A 1J0DA 1J5PA 1Q83A 4AK9A 1H9CA 2SKEA 4HEA1 5BV1A 2JFPA 4RWEA 3RU7A 1E6MA 4LJ6A 1JSZA 4OMDA 1LZKA 1M6VA 5MGBA 2O8BA 1HQCA 4IS2A 5IWAB 3UOAB 1ESDA 1CUVA 1UMDA 3CZRA 4MGHA 5KTOA 1KI8A 4O8CA 4X1OA 2IZOA 4INJA 3QQ5A 2GFQA 1W0CA 4MH0R 2PFGA 2XOEA 4EFMA 3ZKAA 2A0XA 3OE4A 4RTPA 1GAQA 1S8FA 3HCNA 2WJ4A 1XZQA 1CVRA 4IUBS 1M6VB 4FHFA 3NBYC 1BVRA 1W4AA 1EWKA 1JDVA 3IQGX 3KYCA 4A82A 6GPBA 3DBRB 1RDFA 2WTNA 3F9RA 4JROA 4MVJI 4NZ9A 2JGJA 4I14A 2P90A 4YRQA 4EYKA 1NMEA 2IX9A 1Q16A 2FR8C 4E08A 4DWJA 1TJ5A 1ZM4A 3HJUA 1YRYE 4FE4A 4QL3A 1Z4OA 2H3HA 1AGNA 3QKUA 3M3DA 2P30A 1DKPA 1Y8AA 1LLUA 3OY2A 5B7PA 5EKDA 4ZTBA 1RMYA 1RAIA 3CKLA 5FWNA 1T8PA 3QX3A 2ZROA 1N1GA 3M7IA 2B35A 5C7IO 1TAQA 3ZS8A 2UYOA 4B34A 3WGUA 1OJ7A 2WINI 3OQIA 2DJIA 4BU1A 4QDZA 3PWZA 4OFZA 4NJMA 4C7OB 3ORQA 3CBGA 5LBUA 2ADFA 2H18A 3SHOA 1XNQB 5KC8A 4ZPJA 2PZEA 4PFSA 2JLRA 4BMXA 2BEJA 1GR1A 1TYZA 2LNDA 1DC8A 3W77A 3T0IA 5CXSA 5JH7B 2QW1A 4HEHA 3NTRA 2PUTA 4ZQIA 2W8ZA 1QG0A 4H1VA 4AMYA 4FJ1A 3V4FA 2ZJ5A 4AUNA 4JKIA 4OIFA 5CCDA 3CHYA 2X0NA 4KQFA 4DLKA 2C3PA 4IIUA 3RVSA 3RNOA 3UHFA 1VIMA 3UMCA 5B6PA 3WA6A 1L7BA 1Q7BA 3AFHA 4MJ7A 2XCRB 4LX0A 3CLRC 1E63A 3AEQB 2OD7A 1TA4A 3K73O 2QNBA 2OUKA 3LPLA 4AN1A 1FNBA 2KB0A 5CNIA 4AMZA 2OQ2A 3FMPB 5K8VA 1ISRA 1RXCA 1U9IA 3UTDA 1CG6A 4R8RA 5ALWA 2C95A 5GONF 1O0BA 3V8EA 4LTMA 1KL7A 2GZ1A 2I3ZA 2REQB 4M36A 1MTOA 5AI8A 4ESHA 2F3PA 2ONKA 1L4BA 3AEYA 4Q39A 3PA8A 3PYXA 2D0IA 5SYAA 4QHTA 2UZIR 1Z73A 4K9RA 3HJRA 1U31A 2ZR8A 5JAMA 2VQFB 2CXXA 3ZU3A 2B5OA 2JI7A 4LK3A 4O1HA 3O95A 4DYVA 2OY0A 3EEIA 4KO4S 2JLWA 4X85A 2YIDA 3L04A 4XLLA 5E38A 1MT0A 2QNIA 5AESA 3CQ9A 4LDZA 2ZTSA 3RVLA 1MOZA 2ZDHA 1RYYA 1M2GA 2X5JO 3EW9A 3H5RA 3OEED 1G21B 3E5RA 4K1XA 5E9WA 4YR9A 1NL3A 1GHTA 2R5FA 3I04M 4GDMA 3T5CA 1V3TA 3ABQB 1E2PA 1QH0A 2P9ZA 2DFVA 1EVQA 3WMEA 5B3KA 3IE1A 5KOHA 3CRQA 4AJNA 3ES9A 1WMSA 3F6BX 1FFGA 1ULTA 4HDNA 1AV6A 1XTTA 3OLWA 3QJGA 4F97A 2B1QA 1P44A 2NV0A 4L0CA 2VRNA 1ZL2A 3VA7A 2NU9B 1EUCA 1GKUB 1RP1A 4A8PA 2IW1A 4HDOB 3DEJA 2PRSA 1ACMA 4NAHA 4Q3BA 3CLUC 2RH5A 4EJ0A 3CSDA 4LW8A 3N9IA 1XZGA 3O38A 2BHSA 2X9QA 4R69A 1Q15A 4LIPD 1KAOA 1NDQA 2E85A 1GZ7A 5IAEA 1K97A 1N6LA 2FEAA 2IKSA 2JAUA 4TZKA 4Q9IA 4RSMA 1T35A 2GETA 1YGPA 2DHRA 4DRXB 5JS6A 4H0FA 5EMJA 4TYWA 1KDRA 2EW8A 3RUPA 1TE2A 2AYYA 3L6UA 2NVWA 3MCVA 3ZIDA 5B6IA 1ADFA 4BQFA 4NP6A 2ZSBA 5FT9A 5EJ8A 5REQA 1PZMA 3L7NA 1JHAA 1ZBDA 3D3JA 1R9NA 3U0VA 1OWNA 4R31A 2Y77A 3TQRA 2EWWA 1U5BA 3DBIA 3LF1A 1PJRA 5DTEA 2E6UX 5EYPB 3OSZA 3DL4A 5LDGA 4RUKA 3IDFA 4GBED 3GRAA 2BFEB 3CPJB 1SIOA 5CK5A 5TT0A 1FSPA 1Q0QA 2HV9A 1ZCJA 2VF4X 3FSJX 2F8MA 4EKGA 4B3GA 4AN4A 4N47A 1K3UB 2WPDD 1FW8A 1E1YA 2YHAA 1YKFA 3HB0A 5MF6A 4URFA 1SJ9A 1QLHA 4MIYA 3E7WA 4PLZA 3IEIA 3GAZA 3PFIA 2HY7A 3H2IA 5LP1A 1J21A 1DJOA 4PR3A 2XMQA 3JSAA 5DNDA 5FOUA 1XD8A 2XUDA 4TWIA 1DT5A 1MZVA 2OG2A 3ZW7A 1PSZA 2YL2A 2BFDB 4TMVA 4XRRA 4OI1A 4B7ZA 5CCEA 1XB2A 4G0PA 3LG2A 5CMLA 4YASA 1W4LA 2ATCA 3ZIUA 3EGCA 2WDZA 2QV0A 1L2TA 2J87A 2HW8A 1EESA 4AZSA 4WA8A 7REQA 2HJVA 1DQPA 3KIPA 3WLPA 1YZNA 3IODA 3FTDA 1ACLA 3R6DA 4ZQGA 3RIHA 1K88A 1WD5A 1N9GA 1L5FA 3QLJA 4DR3B 3D0OA 4I6EA 4RABA 1RQ7A 4RX1A 3ZH9B 3D6MA 1VM6A 2GD2A 2HIMA 3AFGA 1VKHA 4B6FA 3OQBA 4BNWA 4UPEA 4LXGA 1WW8A 1MMFB 1HI9A 3E1SA 4HNGA 3DMYA 3JTEA 3E5NA 2AUTA 3NFYA 4DLRA 2BPOA 1EE2A 1HFWA 2I9PA 5FOWA 4DC1A 4DCTA 2VYQA 1RZ3A 1FIUA 4EI2A 3RM3A 4WTOA 1GSHA 3H19A 3KAJA 1T1IA 2QENA 2X41A 1MH1A 2WMOB 1Z6ZA 1Z4QA 2PEZA 3ED1A 4DNPA 4B74A 2GB4A 1P9NA 3K1ZA 4EUNA 5CBPA 3MMNA 3EHEA 4MV5A 1BQ4A 3WB2A 1SB8A 4O4LF 4PZUA 1UEIA 2M1ZA 4YCCA 5LMNB 4Z0PA 1XWIA 4N6NA 4PICA 1HNNA 4CHTA 5KYUB 2J8ZA 5EIWA 3K71B 4BJ3A 1GV0A 1XMVA 4CQMB 2NSYA 2N9UA 2UVPB 4BQSA 3EFOA 2H00A 3CSSA 2CW5A 1G8SA 3MT0A 1GD1O 4MUGA 3N7UA 3ZQJA 5EPOA 5EERA 4NH4A 3AFIA 4EKYA 1LW6E 1M76A 3EF0A 4MVJE 3K1AB 2P78A 2QR2A 4LHSA 1KI6A 2C04A 4DSTA 1H1LA 4G09A 2FR1A 5T8KA 4PLWA 5AJHA 1PJ3A 1J49A 4KMOA 4CTMA 4U5XA 2IYAA 5DYWA 3Q9LA 4IIVA 4EPVA 4EG4A 2IDKA 3CH6A 1JQEA 2C2HA 1MQ8B 4II3A 5AUOB 1WXQA 2MJLA 4G5QA 5EINA 3HO1A 1QMGA 2EV9A 3LC1O 1RRMA 3CH7A 4AJIA 5BN5B 2EGUA 4RK0A 2AQ8A 1KIMA 5DGTA 5I48A 2Z8XA 3VDRA 1PV4A 1XAGA 4I4TB 3ZU2A 2XWSA 4YAWA 1K2VN 2AC4A 5KYTA 4PCUA 4Q19A 4OU5A 4IDPA 4RPGA 3INYA 1DKOA 2QL9A 3ENKA 4HFNA 3H2JA 1EVKA 4KX3A 4TZ6A 1VMAA 3RR2A 4C7KA 3B1VA 1BU5A 1H0RA 3S7TA 4R0VA 3HL4A 3KU1A 1RI5A 4NYJQ 4HKTA 1R3DA 3C6YA 1E7MA 5DYGA 4AF7A 3O8OA 2IYVA 3VPAA 5F9MA 1XTJA 1UBUS 2ISQA 2Z1MA 4KXXA 3UIEA 5C7LO 1II8A 1A04A 5D5QA 4A1FA 2AUMA 4ZCQA 3KQNA 1G16A 2NUPA 3HKEA 4J1TA 3OKAA 3SQMA 3WP0A 1B74A 3MTAA 4FFWA 3K09A 3E2PA 1C3JA 1NVGA 3W06A 4C0HA 5A2GA 4B4DA 2RHRA 3QA3E 3HXOA 1JLKA 1VYUA 3D81A 2DHQA 5LLSA 5SY6A 5J4LA 3G7NA 3HJCA 1NLZA 4C3UA 1JQAA 1XNJA 1J07A 3OCVA 2CLFB 3VJMA 4B48A 4DLXA 1B41A 1EUCB 2AXNA 2REBA 5C35A 3K70C 3VHXB 3F98A 3M4JA 1EXMA 4MZXA 4MPPA 3F49S 4RMIA 4KWTA 2VBFA 2LE0A 3SEZA 1O95A 2IK8A 2C4NA 5IASA 1YRAA 4EJFA 1KQFA 3CEPB 3VUEA 3KKLA 3JQ7B 1U7WA 1UM9A 3KSUA 3QXXA 1NBMD 4LJ5A 5H7XA 3WMGA 1XMSA 3KQKA 3RTBA 4NMLA 5JNUA 2FX3A 4HDMA 3GCGA 2ARKA 5C31A 5IT0A 1E7RA 1O6BA 3IXMA 3WGOA 4I2NA 4AUEA 1BE0A 1C7ZA 4PE5B 2M6SA 1ZC3A 1UMKA 4FTWA 5DCWA 1ZMBA 3SNHA 4DC9A 4I5DA 2RH9B 4L8YA 1IXZA 3W5IA 4P3XA 2FGJA 4ND2A 4TYNA 1GNSA 2GTIA 5L45A 1M8PA 2BI4A 4L4XA 5J2UA 4L72A 3ICQB 1LI4A 4MUHA 1M0SA 3ROFA 4RDXA 2GN1A 2ZBQA 5CFQA 3IQDB 1YK1A 3LS2A 4Y9RA 2CNDA 2XZLA 4FLMA 4MITA 4NF2A 2R11A 4PZPA 4IIGA 2J33A 3SBEA 3CLRD 1NIJA 2QVBA 2GPAA 5CVUA 2YS7A 3AHEA 3QXJA 3H75A 3NH9A 2GBIA 1SRQA 3R3VA 2WM8A 2I29A 3QVGA 2QPTA 4CMAA 3WYCA 5BNTA 4JH0A 5I4BA 4OK3A 2YYZA 4PSVA 2VBCA 2REOA 1WZIA 2VK1A 2ZT7A 2HTFA 2QDKA 3NKVA 4J75A 3O4HA 4Y6PA 2ERCA 1H2ZA 3NNNA 3B6KA 3B5IA 1Q1GA 1WQ4A 3BSWA 4FNMA 4Q4JA 1U9JA 2FK7A 4J4TA 2BT4A 5G1OA 1A9YA 2R7AA 1IU9A 1EXNA 4WZBE 4U39A 5REQB 3CNOA 3K94A 2P6RA 1ZVMA 4CG2A 1O6GA 5KJEA 5JMPA 1H2WA 1E64A 1KY3A 3ESZA 3RAFC 1U1IA 4E94A 2GXSA 3WKAA 5KYWA 4IOMA 1ZRHA 1KO1A 1VECA 3DT9A 3Q7QA 5F4BA 1KMNA 4DMLA 4Y2UA 4UNSA 1SAYA 1JHQA 3MT7A 1QTIA 2C3MA 4Q47A 4A0FA 1T5IA 4PQGA 3W5UA 2L0XA 3SX0A 3Q8KA 1FC0A 2O3QA 1YJ5A 1I0ZA 1PSWA 2XTJA 3QWAA 5I47A 2AJ8A 4EKEA 1R0XA 5JWRA 3ONDA 3I6MA 4V0RA 2YIJA 3AG6A 3ZXYA 2IH4A 3QKTA 1NOIA 3MS7A 4KE9A 1WBBA 4FVTA 4QNNA 1C3EA 4WXMA 1WULS 4ETNA 2AOUB 5JNSA 2C8LA 5AKHA 3F5MA 4DCSA 2XKKA 2FMIA 3QFCA 3DNPA 5EWMB 4QQFA 1IEWA 1WPXA 2EJTA 1UAGA 4IFTA 3SFZA 3LUKA 1YH3A 4L4ZA 1KZYC 5ADHA 3W6PA 2Q4DA 4ER3A 4PS1A 1M74A 3JWEA 4P2BA 3QY9A 5TIIA 1M34E 2QYHA 4XI9A 4HEA6 4DDKA 1OOEA 4F4JA 4QTUB 3NMUF 1G21A 2V7QD 3EG5A 1PR0A 5DK6A 5AVXA 4HTAA 4HB2A 2FR0A 2D1SA 2H54A 4YO7A 2VCYA 2BISA 2VJBA 3PNBA 1SWVA 2PXCA 4MPJA 4NTZA 5EMMA 5CVEA 121PA 1I3MA 1IAVA 3LP6A 5C1OA 1VHTA 3UGJA 2H1HA 5I4IA 3ILSA 1JECA 3GRPA 1JALA 3GEHA 2H4YA 4MI1A 4C4SA 1LUAA 1J6UA 1JEOA 1M66A 1QLJA 3TG8A 4F4FA 1QYWA 3F6PA 2BKUA 4WFKA 1MX3A 1PL6A 2ZAYA 5C2JB 1DXQA 2IHYA 1SM4A 2PZMA 2D2IA 1AO3A 2CT8A 1J23A 3BMXA 4DBVO 4ES6A 5JCZA 4BNYA 1DG9A 4HWPA 1L9XA 3I04A 2BKAA 4KLCA 1GTL1 4Q1VA 2P9FA 4DLLA 4XYLA 2OCIA 4B4VA 1IHUA 3A3YA 3IRUA 1U1FA 4B3IA 3DTVB 1UBEA 4TWBA 4HCJA 1NULA 4OHWA 1SA0B 2QRVB 3HMKA 4IIBA 1N3IA 4UM5A 2VQ3A 4ZU1X 1F8YA 1A8SA 2O7NA 5SYNA 1CDEA 5A4IS 2VTBA 3FI9A 1T9AA 3HN7A 1Q3HA 1R18A 3LT4A 2W6JA 3QWBA 4M0PA 4MWBA 3A06A 4EMBA 1PZFA 5AKIA 1VZ3A 1SPXA 3EHDA 3ICCA 1J9EA 3WLSA 1N9GB 3ZE0B 3ENZA 1L5WA 2XAUA 3IEXA 3WK7A 4DEXA 5LLDA 1CNFA 2WV9A 4JU9A 2OAGA 3I6QA 3QJYA 1ZMRA 2QD5A 1E61A 1W8IA 5A6VA 5G02A 5CAEA 1YZTA 1KR5A 4Y1EA 2ISCA 3FHCB 3GLRA 4MRSA 3GLFE 4KR3A 3E7XA 2EZ8A 1ZGAA 5A7FA 4IX1A 4PYKA 4X1IB 5J5VA 3RSOA 2QIOA 3AVPA 1ID1A 3UH0A 3EWIA 1IUNA 3HWWA 1GKYA 4ITVA 4M4SA 5C1BA 1C8VB 3WJ2A 5GV8A 2W2TA 3T99A 3P9CA 1IH8A 5BQ5A 1XVUA 5DNAA 2RGYA 3E0QA 4R7TA 4TS9A 1H2HA 2AG0A 2I3BA 3P9YA 3G2QA 4OYHA 2CLDX 4M0FA 3BK2A 4HN9A 4JT4A 4OL0A 4U2DA 4XJVA 3CH5A 4I66A 4H7FA 1MC4A 4GQIA 1NPYA 1YA4A 4MQ6A 1JVSA 3VRHA 3IXQA 2AFRA 2JD0A 4BKPA 2HMUA 1JFFA 2DBRA 1EFKA 1VJTA 4BASA 2YJTD 1NU6A 4E14A 2Y3IA 3QVWA 1WZNA 1IZ0A 2BAGA 1OU4A 4WH0A 1JR3A 1JEQB 3UGQA 1IVNA 2Y27A 3DFZA 3GGOA 1UP7A 3CISA 1Y7HA 4MV9A 1KI6B 1Z38A 3BXFA 5KNDH 4X7RA 3EFHA 1G98A 3LUCA 1W5TA 4JB0A 1EDDA 2NZVG 3HN6A 3PI7A 5EJ2A 2BM8A 1DAMA 1G63A 4EG5A 1Z26A 3BORA 4RKRA 1KWGA 7ABPA 5FFNA 3HCEA 1TEHA 1PHPA 4P53A 4BMOB 4JAVC 2W48A 3RO7A 2FNAA 1UC5B 2IS4A 2W2PA 1WF6A 5KKAA 2V6BA 2O0JA 4LF5B 1KYVA 4JEMA 4TKUA 3UB2A 3EY4A 2VDRB 3P2EA 5BR7A 5CW2A 1FMCA 2I6QA 2EX0A 2O2ZA 3FDZA 4HDSB 1PZXA 4QBIA 4E1BA 4LF7B 4V24A 1XROA 4NG4A 3ASZA 1M75A 4BO1A 3DR3A 4RXTA 3ZXSA 1HO3A 2GA8A 2BL4A 2XBLA 3EOZA 3MD9A 3UFBA 2B8JA 3LBNA 3V3TA 3DC2A 3NHLA 1MOPA 1UQTA 2CCGA 2QY6A 3NNDA 3BGSA 3ESXA 3OFVA 2WW8A 3GT3A 4MWZA 5CR9A 4YAEA 1K8YB 1R8XA 2GXQA 1NVTA 1RYNA 3WLIA 1FBTA 4DZTA 4F85A 3PEWA 2Z3ZA 4RELA 2J3JA 4I99A 5DV9A 1YBFA 3DDUA 3EIHA 5JWOA 3CVVA 2I87A 2ZRHA 3FFXA 3DO8A 3KOYA 5CU7A 3GEGA 3MYRA 3ZBTA 1UP6A 4NPCA 1TFRA 3KYBA 4MQBA 3RFTA 3NHYA 2P9HA 1JBQA 2G3YA 3LDUA 1X7WA 1PBTA 2RHGB 1MR3F 3AJ8A 1YNOA 5JXGA 3BD8A 2ZYTX 5DLDA 2Y93A 3BWVA 4R54A 4O0LA 3G0HA 2E4AA 3RQSA 3HG7A 2EQAA 2H5IA 2QN9A 1L5RA 1O2DA 3QNMA 4BNXA 1DELA 1FRZA 1KK1A 1KY2A 3D2CA 2B5WA 3X1ZA 1R0RE 3T1YB 3H13A 2OL4A 4DY4A 1KJNA 4AYXA 1DIBA 1MCZA 3G9TA 4FZVA 5CA0A 1T1EA 3MBOA 1MEJA 5JS7A 4FXPA 3IT2A 3ZVLA 3B51X 4JL8A 4NXMB 3O1IC 4OY3A 1AN0A 1PLLA 4KIJA 3PQ2A 4QDOA 5CLIA 1UBJS 2GARA 4Z1OA 1ZJWA 3AJDA 3OLQA 2PX0A 4KGXA 4FSHA 1ONOA 4BDSA 5EQTA 1U7PA 1G8MA 3NBUA 3REFA 4KUHA 3C1AA 1I32A 5EWLA 3AO0B 2HD4A 1ZMXA 5IW8A 2J6BA 1JKIA 3R6LA 3U09A 3Q7SA 3PWSA 1MQAA 3TSZA 5LA6A 1LBHA 3NTVA 2ZRBA 2PH1A 4U0JA 5AVQA 2XMDA 3ONFA 2Q1XA 1ZM9A 3P9NA 4BEBA 5LIPA 2IYQA 1DC6A 2ZREA 4GKKB 4NV3A 3WIEA 2ZIWB 1M6WA 4ALIA 5FUYA 2PDAA 2D62A 2H4XA 2R2GA 2X8BA 1TKBA 4FS3A 1Y4DE 2EZTA 4Z4FA 4MCIA 2JA1A 3O3OB 4IQFA 4EPXA 4YVFA 3DLBA 2YIVX 4FZRA 1CJTC 2YMPA 3DL2A 4M83A 5CM2Z 1CEYA 2WFMA 3SSAA 1C9NA 2WR8A 2ICAA 1TD1A 4EWLA 5K3EA 1FRVA 1T4GA 2WSLA 5EE0A 1VCOA 5GJCA 5ARDA 5M3BA 4JA2A 2Y9MB 3K4PA 3QNUA 4US1R 5BQOA 3L5OA 4JVMA 3OU6A 2PZKA 1P7ZA 4D8XA 3CNHA 2XEXA 1PHRA 3LWNA 2DJ5A 3PQFA 5IFKA 1BW9A 3N2KA 3GJSA 4UTRA 3EQ7A 3EIOA 2PWZA 3Q7PA 2QU7A 4QPDA 3ZXIA 3C4QA 3STUA 1JLHA 4NBWA 1YT5A 4E12A 1NDUA 2CJXA 4C0WA 4F46A 5D6OA 3V48A 1AA6A 4IGAA 2NSHA 2OV4A 2ZLBA 4FS8A 4MV8A 4ZHQA 5C8YB 1VSVA 5CM9C 4M7WA 4D41A 1BS1A 4JU8A 5J2TA 2Q3JA 1ZGZA 2J08A 4AJPA 4EX6A 1GNTA 3JYPA 5HDBB 2O5VA 1T9CA 4KRXA 4NSNA 2IHUA 2HU2A 2EBHX 1VJ5A 3VR3D 1JDZA 2R7LA 1I24A 4JLNA 3VR4A 1JILA 3BXPA 3LD9A 2GK6A 2Q3LA 5J9FA 3WLOA 4WKCA 5T57A 1AQJA 3EUEA 4M22A 1DWUA 4PVCA 3PUZA 1OIXA 1VLVA 4JHLA 1FS6A 2F48A 5EN4A 3TLCA 2G8NA 3OQNA 3OUUA 3DJFA 4AMGA 2AOVA 3TW8A 4AM8A 1HL7A 4O4HF 1FXSA 3K2QA 4OSOA 2FUG1 3TSAA 5D00A 5LD2B 3T52A 1TLTA 1HYHA 2JIPA 3E53A 4L9RA 3VU0A 4A27A 4W1PA 3HA7A 1W9HA 4CDMA 3G13A 3CLTC 1V16A 2HXSA 4KXNA 1E1QA 4P3PA 5BT8A 5JMOA 1QCZA 1TDJA 3WSTA 3ONEA 4LXHA 3CUUA 4MW2A 1CDZA 1KJZA 2Y76A 3M0EA 4DIMA 3T4UA 2D0DA 2HA0A 3OF2A 4X3CA 4A7PA 1YGYA 1QP4A 3VUFA 1DQRA 2L17A 6CHYA 1XT6A 1DIRA 3OOEA 4S04A 3DYVA 3C3JA 4YEDA 2R86A 2EF1A 3GFOA 4V0KA 3DPSA 5LYJA 1MVNA 2VRWA 1L1FA 3SY8A 4Z3OA 1L8XA 1LJUA 2JGMA 2K7ZA 1XD9A 3GLHE 2QMQA 1EDEA 4RQUA 3TTUA 2V45A 4WEOA 1K9VF 4EEXA 4IGEA 3P0FA 3PQ4A 2ZFUA 3OCCA 4FMBB 5LIRA 2PBRA 2ZB3A 4LOAA 2IGBA 1MC5A 2Y66A 1ZVJA 4R8LA 4XJXA 4X64B 3HHEA 2ERYA 1FS4A 2K2QB 3OIUA 3QUTA 1BKDR 3F97A 3P2OA 3ZK9A 1MIOA 2JBAA 3HJHA 1XQVA 3AU8A 3ACCA 1ZNWA 4KQ2A 1X3LA 2E4XA 4CF7A 3LXXA 1AGPA 3C4VA 3AEUB 4FILA 1IC6A 3DJYA 4V2IA 2JJ2D 1RIIA 3L7KA 1U65A 3FMFA 4URWR 3N0VA 3VZDA 4Z53A 5EJGA 3KJIA 4FT2A 3VPCA 5IC6A 2NZUG 3OT4A 2X5KO 1L5QA 5EZ5A 2MWMA 4BGVA 3RBXA 4JXZA 1T6XA 1U4SA 3O4FA 5LP6B 3OUTA 5F5NA 3GCXA 3H0CA 5BSRA 3EIQA 1XDUA 4Z9YA 1D9ZA 4BB0A 3D5TA 4KC0A 1T5OA 1N2ZA 2AOXA 3EEOA 1OCEA 4GKBA 2W2KA 4G8DA 4YCDA 1LDMA 1Q95A 4EDFA 2OZPA 4P7BA 4MA5A 5DDIP 4PZDA 4WESA 4KQCA 4JA0A 1SHUX 3LM8A 5LQKA 1EM8B 2B9EA 2VXBA 1UK8A 4JSRA 3U7EB 1YBHA 5KQRA 5EMHA 1JZTA 1OHHA 4U8GA 2ZOSA 3CZ5A 3IIIA 4RNCA 4JS0A 2C5BA 1KVQA 1P2DA 2CNOA 5DTJA 1ZD5A 2ROQA 2Y1GA 4AX4A 1P7PA 1RAEA 3KCQA 4GR5A 5I8WA 3OC0A 1N6PA 1PR6A 4C3OB 2QN3A 5KHAA 4IV8A 2OM6A 5K4AA 2V9PA 5DW0A 4X65B 1ZEMA 2QRGA 2V55B 3C43A 5JSKA 2VK2A 1YBAA 4Y2VA 3UT0A 3A32A 3L1JA 3RU3A 5ALRA 2WHXA 1CERA 1DFHA 3MS2A 2HA5A 3OP1A 2PWYA 4JCOA 5FI0B 3RRZA 2WJ6A 1W1IA 2H31A 5A5GA 4P0PB 3AILA 4IJ6A 3ITKA 4CEIB 3TSWA 3ELUA 3K92A 4OEHA 4TVSA 5CDFE 4B40A 3QTBA 1E0AA 4FMDF 1F2UA 1IY1A 2XV1A 2BEVB 1TC2A 3LL4A 1QVWA 3ANNA 4WESB 1R0BA 4Z7OB 3ZE1B 3IT0A 2HQBA 1G4HA 1IQUA 1T5HX 3HDGA 4ITUA 3BMCB 3W4KA 2QROA 1K92A 3FIUA 2BE7A 2RGRA 4F2WA 1O97D 2NO4A 3TB4A 1H6CA 1KAQA 1QUEA 2Z3VA 1ULUA 4LA4A 4IUCS 3WYDA 2QQGA 4BFTA 5LJIA 1ULBA 2JGEA 1CXZA 2Y1XA 5EZ6B 1CUZA 5MN5A 1P2VA 3U7HB 3KZCA 4ZVPA 1LLFA 2X9GA 4LOHA 4S12A 3RABA 3U3JA 5LMZA 3KD2A 3GI1A 4FCWA 5T4BA 3WO1A 3AUKA 1DTWB 1C1XB 1Q77A 2E1PA 5AK6A 3U31A 1TM3E 2E49A 3ZVKA 1CTQA 1GAWA 1Z63A 5L7WA 4DIBA 1T25A 5E95A 1H2XA 1PL7A 3H84A 4JJEA 3LI2A 4Y2YA 1KEPA 1VSBA 5BSHA 2EP5A 1S01A 3ROXA 1E32A 4HVLA 3USCS 2EG9A 1Z2DA 4N41A 2DWQA 3WBJA 3U9SA 1P19A 1KYIA 1Y6RA 4KXYA 5FTLA 4EYGA 4M9ZA 1WKBA 2J9FB 2VCHA 3OUZA 4MLPA 3KRTA 2G7MC 3HR4A 3IUJA 3DWFA 1N8TA 2WWXA 2QJOA 4PINA 5JDIC 4QT4A 4WXRA 4EAQA 4V02A 1VE6A 2GBGA 3R6GA 1Z4MA 4D9BA 4RPHA 2H7CA 5TY0A 1N6IA 3LBFA 1CV2A 5DNVA 5K0ZA 4Q03A 3ET4A 3GK3A 4BDTA 3BEDA 4OHMA 3FB1A 3KTAB 3FPHA 2NG1A 2M32A 3CRVA 4NARA 4N40A 1NXWA 4K6GA 2GHTA 3V8MA 4JUAA 2BRUC 3GT7A 2AC7A 2R6CA 1XK6A 4YUZA 3LBHA 4MUNA 2DQZA 3PUYA 5EIAA 2FVYA 1XP8A 5A4DA 5CDSA 1E96A 2D74A 2ZCUA 2PWPA 2R85A 1GPH1 4RV9A 3CRW1 2ST1A 1IIBA 1DUIA 3C3WA 1F2TA 4V0ME 2CV0A 3JR7A 2CN1A 3OJ0A 1Y4UA 2YJNA 4ZMRA 1U9ZA 1TXGA 3LQQA 2WILA 3Q40A 3NETA 3TRKA 2I6XA 2NAPA 4XIGS 3QRWA 3WK6A 5KCMA 3SQLA 3NYQA 4LQCA 4H9GA 4U0KA 1EEXB 2E3JA 4HATA 4O4HA 5BV2P 5KOYA 2ORED 2XYHA 4GDFA 2JI9A 3WKCA 1O94D 3WYEA 2FEKA 3BUSA 3RHTA 3LC0A 5IKXA 3MB5A 3L6EA 4LF6B 3WADA 2Q0HA 3KEMA 3FOBA 1PYDA 1PFQA 1FFEA 1H2RS 4P5DA 3T1TA 2PGXA 2B1GA 3F4KA 5DPMA 3UK2A 2ZR7A 4LXXA 1GPYA 4X1KA 1UFRA 1YA6A 4C3VA 4ZANA 2NO5A 4IIHA 4ZVUA 3BQNB 3K6SB 1G1AA 2HWWA 2ZBDA 3WA7A 3H3JA 4ZQBA 5MGNA 3FZQA 3H1PA 1ZG3A 1V6CA 3E1GA 1T9GS 5J63A 4F5YA 3HLTA 3KLPX 2HPHA 1CY1A 4BFUA 2JIZD 3LJKA 4GUDA 2QMEA 2Q6TA 4ZDWA 1UBFA 5HTOA 3FGPA 3FHJA 3ZQ6A 2NO9A 5H3HA 3R7WB 4N3GA 2CVFA 1GAEO 3SQOA 1SBTA 4Q6WA 3CJTA 3ROKA 3VR5H 2AEEA 3UO8B 3UJ6A 2V74B 5F5LA 2OGUA 4IFEA 2PYDA 1T6ZA 3TNFA 1UXJA 4IP0A 3WE7A 3WXBA 2P6OA 4HRAA 1QFXA 1UZUA 3HZOA 4JEIA 1UZMA 1Y6ZA 4OXXA 4Q9NA 3PD1A 4S1VA 3MPOA 2QN2A 4NOLA 4UNQA 1MRSA 1KHTA 3RG2A 4B35A 5KPJA 4WXPA 3U1VA 3FRIA 1G1MA 4E1VA 3S5JA 1GNRA 4KPUB 3RKUA 1TQHA 3GPCA 4YRSA 2HN9A 2HLDD 4QEKA 3AOEC 2DKNA 2QF7A 3C7AA 5LM3A 2NX2A 2CXOA 2BMVA 3GJTA 3KYDB 1R6TA 4QULA 3VHQA 3B6ZA 4J0GA 5LL6P 4YQZA 3DEKA 1AO0A 5JAUA 3I9LA 5F1OA 5F35A 3S8YA 4I2VA 3AQIA 2VOEA 3WWEA 1EA7A 2A57A 2YASA 4FI3C 5EJFA 3OECA 5ABPA 5F2EA 1F38A 1KZ6A 3UNXA 3KLBA 4L28A 3QW4B 4JUDX 1MPXA 2G36A 1DLJA 1PGJA 4J0DA 1F1BA 4PVDA 3VTFA 1D2GA 1HSZA 1VKZA 4UBJA 3JZIA 2R8BA 4NZPA 3EPJA 3BVPA 7REQB 1CIVA 2HRDA 3R5JA 4IVPA 4KODA 3QFTA 4I1PA 3E9QA 2O4CA 1EZZA 3QBTA 1X1QA 4L3WA 4OUDA 4LF8B 1F48A 1T8UA 4PEVA 2I2BA 2FRDC 5D7NA 4BBJA 1SULA 3BQMB 4O3FA 3DZIA 3NBQA 3FCCA 1AK9A 1VJ1A 3HXKA 3R7LA 4F3RA 2A1TR 2FMUA 3MWLA 3MXTA 3LQ2A 4QX6A 2GHRA 4G0VA 4FD3A 2G88A 2GUWA 4RENA 1TIKA 3ORSA 2VPIA 2WTBA 4ZK6A 1M2KA 2Y1OA 4DUYB 4NFSA 5ARCA 3A6DA 4E5NA 2DQ4A 3EWSA 2G9NA 4OHYA 2ZSHA 1MGPA 5E6RB 4LE2A 1AUVA 1CZHA 3SSMA 4K6KA 1YQDA 2Q5JA 3GVPA 1NI5A 5DWVA 5EHQA 3VSAA 2PL9A 4IHKA 1J2EA 3CRZA 4DARA 3CJQA 4LGCA 3TQSA 5IFLA 1CK4A 2F90A 4B3CA 1NMQA 1XAJA 1ZJ4A 2IU4A 2OWEA 2AMVA 2V7UA 2Z5LA 4C4AA 1HX7A 3LPAA 1DG1G 5D7BA 4E2FA 1B6TA 1JH9A 2H0RA 2HK8A 2DAPA 4UJ3A 3LY9A 3PGKA 2ZYDA 1R64A 4JB3A 1YZQA 3Q0TA 2OE2A 5DCLA 2KLHA 2OORC 4WEQA 2RKWA 4NECA 4RVHA 3WLRA 4BWYA 1N9ZA 2ZJAA 4GX1A 4P4TA 3P9ZA 4RTRA 3INRA 3I2HA 1YDWA 1I13A 2WE8A 1A1VA 1ZMTA 4EEZA 2WI8A 3IMCA 3GNQA 1XR3A 3A1DA 4LAFA 4QQKA 1NR1A 4XFDA 5E6UA 3GMSA 5E4TA 1N36B 3VR2A 2FRXA 3E9MA 4LZJA 3L7MA 4B3XA 2P2GA 2R97A 4HDNB 3BCRA 1L4HA 4KTVE 1ODFA 1ZICA 2IPMA 4E4RA 1F14A 5F1PA 2H16A 1EDOA 2W4QA 3C6BA 3OQ6A 5H0IA 3WWDA 3T5TA 4E7OA 5DSTA 1F4VA 1KEZA 1RIFA 4HPJB 2QWXA 3NUGA 4IIYA 2X4IA 1VB3A 1D2EA 2XCSB 1FFYA 1D1SA 3MGGA 1NTOA 2XWQA 1OBOA 4EATA 1BX0A 1IXRC 4AZ0B 4CKEB 3LWZA 2DBYA 1HY3A 1U8AA 4FDTA 2AW3A 2ZRCA 1KI7A 2WOOA 2CNKA 4LJRA 1L5VA 3JWHA 3D7LA 3B48A 1LPPA 1OXVA 2VNAA 2WD7B 2Y8EA 4YRMA 3L7CA 4MJXA 2IHZA 1T9DA 2IA5A 3CMMA 3K0KA 4PIPA 5BUCA 4EENA 2DECA 4BKUA 4CW7A 1F12A 1Z39A 2G08A 2P2YA 4RAOA 2XUIA 4UDXX 2UAGA 5LOVF 1G2PA 3K35A 2OK7A 3ZCVA 4BQQA 2P35A 3R3JA 1NC3A 4KITB 1PW5A 1H0KA 3S2ZA 4I0WB 4EHDA 4GXTA 4TV8F 2VP0A 2WPDA 2ZXFA 1Q20A 2GVNA 4HX9A 2NP6A 1K63A 3DEIA 4PZAA 2XDQA 4XE5A 4B32A 3OE7D 2DCMA 2WT8A 3V8VA 3NW9A 3A6LA 4MZDA 4HNHA 2AE2A 3Q5DA 1FP4B 4H3VA 1CKEA 3U7QB 1FP4A 1ZRNA 3OFKA 2YXBA 3P71T 4IJUA 4L07A 1PI3A 4X6YA 3SR0A 4J3JA 1QHXA 4HUTA 1CYEA 4F4HA 5JH7A 5GQSA 2A0FA 1KMQA 4PIMA 1FU7A 1L5HB 1UDWA 3NFRA 1OGYA 4ILEA 1DKRA 4XFKA 4TL9A 4R7GA 4PX2A 5DI3A 3LF2A 1GKKA 2IT1A 1OBFO 2G0TA 2QN8A 1EI9A 4JI7B 2ORYA 4AJHA 1S7GA 2R7MA 2B37A 4WFIA 4NMWA 3O1JC 3R5FA 4M8KA 1TKRA 4XAQA 4WNIA 3KOZA 5K2OA 3L4EA 5A5FA 5DYTA 3HKCB 1VMIA 3IIEA 4LI3X 4PLYA 5KNBH 4D26A 5ALQA 2EX4A 1SIUA 4F56A 3SLGA 3P0RA 1L3BA 1NQWA 3EMDA 3G1WA 5EHGA 5TMPA 5JD5A 2HSWA 4RKFA 2BJWA 1G4AE 3PFGA 4O4IA 4ARZA 1RBZA 4DUGA 1O9GA 1CX9B 3F3YA 4D9EA 4FR0A 1BJKA 5CIQA 3DBRA 3NEYA 4JP8A 3WJAA 5JCXA 3ANLA 4G4SO 4LRYA 4EIWA 3LNTA 1GM5A 5G0SA 5CNKA 1B3RA 1FYEA 1VSUA 3QEBZ 1P62B 4P7KA 1ZPDA 1FRQA 2YWEA 4Y6LA 1Q0ZA 1UK9A 3GYBA 3HLKA 1I2ZA 1BGXT 5E6SB 3AKDA 2XCTB 2J3MA 3EVZA 4NZNA 2FWJA 3DE1X 5GTDA 4TMKA 1U2DC 3ZXUB 2GFIA 4KXLA 1SN7A 3HGMA 3LUAA 1ZUHA 4PLGA 4UCQA 3WYAA 4HUQB 2NXWA 5PNTA 2O5CA 1F4PA 1PDVA 5ALHA 5KYUA 3KVOA 2NT4A 4LOLA 1P4JA 2IYSA 2GN9A 3PFFA 4YMLA 3DZFA 1XMJA 3U62A 9ATCA 1J8VA 3WRVA 3BRWA 2P9TA 4D92A 2HH9A 5G53C