4D9MA

Crystal structure of diaminopropionate ammonia lyase from escherichia coli in complex with aminoacrylate-plp azomethine reaction intermediate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
396
structure length
378
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFKMLGGAYAIAQLLCEKYHLDIETLSFMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Diaminopropionate ammonia-lyase
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
total genus 130
structure length 378
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9mA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9mA01
1P5JA 5I7WA 3L6CA 2DH6A 4OREX 5DBEX 1KFCB 3VSCA 1TTPB 3RR2A 3SS9X 3DKIA 2ECQA 1TZKA 1J0CA 4HO1X 1K3UB 5CGQB 1A5AB 1V71A 3R0ZA 4D8WA 4D9NA 3VSAA 1KFKB 5I7HA 1KFJB 1VE1A 4OFXA 1UINA 2CLEB 4D96A 2GN0A 1OASA 1A5SB 1K8ZB 5B1IA 3VBEA 5I6DA 3X44A 4D9CA 2RHGB 4HT3B 1KFBB 1J0DA 5HBGA 2WSYB 2ZR8A 1VE5A 2O2JA 2PQMA 1E5XA 4H27A 5B36A 2CLMB 5D84A 1PWEA 3BM5A 1TTQB 2GN2A 2TRSB 4ZQCB 4D99A 5B1HA 1FCJA 3PC4A 2ZPUA 3TBHA 1A50B 1TYZA 1O58A 1UIMA 5DW0A 5IW8A 5T6MA 4HPJB 1FUYB 5D86A 2CLLB 1CW2B 5C3UA 4QYSA 1J0AA 5I7AA 3VC3A 1TZMA 2CLHB 4HN4B 3PC2A 1Y7LA 5I7RA 5EY5B 1K7EB 1K8XB 2DH5A 2J9XB 5B55A 1F2DA 3T4PA 2J9YB 4KKXB 2D1FA 2BHSA 4NU8X 3VSDA 3IQHX 4PCUA 5JJCA 4ZU1X 1KL7A 4D8UA 3V7NA 3X43A 2Q3DA 2C2GA 1WKVA 1V8ZA 4NEGA 1TJPB 1WBJB 4D9GA 4L0DA 4D9MA 3AEXA 3IQGX 1WTCA 3AEYA 4LI3X 2TYSB 3DWIA 1PWHA 3IAUA 5KINB 1C29B 4L27A 4AIRA 1VB3A 5IWCA 1RQXA 4ZU6X 1TZJA 1QOQB 1V7CA 4I1YA 5J5VA 4XUGB 4D9EA 1TZ2A 1QOPB 2Q3BA 4IL5A 3ZEIA 2CLOB 5KZMB 3FGPA 3CEPB 2TSYB 5CVCA 3R0XA 2RKBA 2V03A 2CLFB 2BHTA 5D85A 5B3AA 3SPXA 4HPXB 4WX2B 4L3VA 2Q3CA 2CLIB 1K7XB 1C8VB 3DWGA 3PR2B 1K7FB 1C9DB 2RH9B 1J0EA 4LMBA 2CLKB 5D87A 5BW6B 5I7OA 1BEUB 4F4FA 1UBSB 2ECOA 3L6BA 3PC3A 1KFEB 1Z7WA 4COOA 4D9BA 4JBLA 1CX9B 2EFYA 3HMKA 5IXJA 5DBHX 5J43A 3SS7X 4D97A 2ISQA 1BKSB 1K8YB 1X1QA 2EGUA 5JISA 1Z7YA 2JC3A 2GN1A 1TDJA 5DVZA 4AECA 2O2EA 5B53A 3IQIX 4D8TA 4L28A 5DW3A 1J0BA 1A5BB 1JBQA 2J9ZB 4D9FA 5E0KB 4D9KA 1D6SA 2ZSJA 3L6RA 1M54A 4JBNA 4LMAA 4D92A 2C2BA 1WDWB 4Y6GB 4D9IA 3FCAA
chains in the Genus database with same CATH superfamily
4WKBA 1IXZA 3DDNA 2FFHA 3STYA 1TQDA 3FPFA 4W8OA 3FF1A 1OYOA 3RNLA 1QQAA 5FWXB 5AOCA 4KIJA 3B1XA 5AR1A 1H9CA 3O74A 2ONJA 4CL0A 5FBVB 5JC8A 1VCHA 2FUG1 4GO1A 4LW8A 1FL9A 4HL6A 3T7RA 1AA6A 2HBRA 4ZANA 1KAQA 3C5WP 3RUAA 5ALEA 4QPNA 4A6XA 3GJQA 3UMSA 1VXOA 2AS0A 2OAQ1 5H5JA 3WHLA 4WUTA 3ZWPA 3RODA 4MLPA 4P2GA 1W94A 3AB3A 1Y5MA 4B75A 4BLWA 3MCWA 3K1TA 2FMFA 3WKCA 2YHUA 3G23A 2CLMB 3M5CA 4XM1A 5J4LA 2AR9A 3CN9A 3E5RA 1LDYA 1CD5A 2EV9A 3LIIA 1T36A 3MWJA 1MG0A 2GN2A 2QLTA 3NHBA 1XCPA 4MUIA 4F8EA 1K8RA 4WLEA 2DE0X 1Z5NA 2ES4A 3EYAA 3T94A 1WMSA 4UMFA 2V97A 4CM3A 3GRVA 1JLSA 5AICA 2Q6TA 3UW3A 2VYQA 3BTVA 4MVJH 1EQAA 1FSSA 4W63A 4E22A 4KOEC 4PSVA 2WD8A 4Q3CA 3S4YA 1JHMA 2WF8A 3Q3EA 3QYAA 3VYTB 2W2NA 4B7UA 2O4UX 4KLCA 1TB4A 2XDAA 5EY5B 1N8KA 5IBQA 4HJRA 4LC0A 2SCUB 1K8XB 4RKRA 4E5DA 3GRRA 4HBGA 2EKZA 5JCOA 1C4OA 4TV9B 3FBTA 1XAGA 4OQ4A 1EVZA 1EFKA 3FUXA 3GEBA 3ON5A 4GS5A 4Y1RA 3U6BA 2QTRA 1BXZA 1AH2A 4L5IA 1YQUA 1QPZA 1N25A 2FPLA 1NYRA 1HDCA 3FMFA 3HN6A 3W2GA 4MV1A 2F8SA 3SU8A 4TWJA 4CQMA 2P4EA 3GLIB 4MB2A 2X8JA 1FFDA 5IM4F 5F5LA 2VDKB 1M2OB 1BEZA 4N3BA 4LWOA 5EHXA 3W7VA 4RYDA 2QNIA 1DV2A 1NMEA 4QTTB 5J5VA 1H6BA 5AQ1A 3EC1A 4IWYA 3ZE6A 2YVKA 5B58C 3ETEA 1J8MF 5CD1A 4MJ3A 2VJNA 4R2MA 5K4HA 4CMAA 4TTRA 2JFXA 3NBZC 1NPYA 2K4MA 2XOEA 3L8HA 3O8DA 3WICA 1E79A 2GJSA 1PLLA 3A2LA 2V6BA 3EVZA 3PA6A 3ZXIA 3NJ8A 3RTDA 1E60A 3E70C 5DBIA 5GV7A 2CXSA 3BL8A 1QORA 2C0PA 3LZ6A 4RYLA 4EGJA 1QE3A 1OX4A 3CH7A 1KNQA 4IVPA 1SBIA 5MGBA 2QJTA 2HV8A 3MC1A 2WT4A 4MI6A 3A9SA 2EBHX 2MHCA 3HGQA 4XASA 1LK7A 1LPPA 2PWPA 4F04A 3G2NA 3QQ5A 1MX5A 4JBIA 3ENWA 2ZU6A 3ENQA 1VJDA 4KX5A 4DKXA 5L51A 1BWRA 5FLXA 1ND5A 4G5SA 4J7UA 4PYJA 1E69A 3KT0A 3LPLA 1FMCA 1ORRA 3IQFA 3PHIA 4I6JA 4XPZA 1CZHA 2R86A 3PKJA 5KJ1A 4IIBA 4KQJA 4O6VA 1S4MA 3D6FA 1Y8QA 4MKHA 3UJAA 1VPTA 2P2GA 3BOSA 4ITUA 3U80A 1EWTA 4LMAA 1DJNA 1GYPA 1WVIA 4MOWA 5EPOA 1JF8A 2AMVA 3URKA 1KS9A 1XZNA 2GEFA 1N7HA 4PZ9A 4C0AC 3TIFA 4L2IA 3KQUA 5J2UB 1I7DA 4ZAGA 1GXSA 1RYHA 4MRAA 1UEIA 4E3ZA 4F60A 7YASA 1TTPB 3MPOA 3AXTA 2D1SA 4Q82A 4S1WA 4QXAA 2GEKA 3DZGA 3SQOA 2H4HA 4NV1A 1YRBA 1Q0SA 3ECCA 3QVOA 3WP0A 3G9QA 4RJJA 4JWTA 3DCNA 5I5GA 4DYDA 1H5QA 3WHPA 1Q20A 4BVGA 5B1IA 2SHKA 1AA9A 2VAPA 4G0YA 1ZGCA 3ZH9B 1EX9A 1TM7E 4RA6A 1K2VN 4QUHA 2PAFA 5J4YA 3BMOA 3DHYA 1C0KA 1ZNYA 2B1RA 5EVCA 4BO8A 1M2FA 5JIBA 1ZJJA 5KTPA 1Z0DA 2QX8A 2B98A 1QV7A 1GCGA 2Q1UA 1JDPA 1N5JA 4E5PA 4X61A 2EL9A 2K87A 4L02A 1EWKA 2RG1A 5AW3A 4KOAA 3FD8A 2GZHA 2BD0A 3OF3A 3ELBA 2JLAA 2D3TA 4OJYA 2P7IA 4Q9LA 2OFWA 4ZPJA 3WVNA 5KYUB 3WLOA 5JTUA 1HLPA 2F3RA 1U02A 5CDFE 3CEAA 4Y9SA 1XU9A 5JQGB 3H3FA 1I8TA 5DISB 5JS6A 1BYUA 1S8NA 2BSXA 1AO0A 3D1LA 1VKNA 4WT7A 2W2KB 1U94A 4W5QA 1X7XB 2A4MA 4L7QA 3E81A 4QPJC 5EXXA 3HBAA 1ES9A 4TRRA 4M1KA 1AU9A 4B43A 1QDLB 3QVTA 4NJEA 1ICIA 3K9WA 4GR4A 2E18A 1ZH2A 3L0ZA 4HH3C 2EGGA 4B32A 5CVVA 1SRQA 5DM4A 2C5FA 2G5PA 3VHLB 1OFGA 3R7NA 1LBHA 3EWSA 4BP1A 2B3DA 1HQKA 1U1GA 1NE2A 3ENZA 3H8JA 3R7BA 1VKZA 3CLUC 3PQDA 3ILXA 4JSRA 4BFZA 4CIBA 1M8GA 4Q4HB 5J40A 1KBZA 3SSAA 3H19A 4J16C 3EF0A 5TEVA 4UVHA 1J9EA 3BJRA 3ADCA 1ZK2A 2B4KA 1ST3A 2PBRA 4O4HA 4CCYB 1M1UA 1QCDA 4X85A 4YMVA 3WK8A 2ATCA 2IELA 1Y6ZA 4RY0A 4Q4DA 3BQNB 2G40A 3UJ6A 5K1ZA 2QTWB 2PVCA 1K7XB 3RIMA 1NVDA 2C5LA 4AM8A 4ESVA 1GSIA 2GK3A 5JCOC 1OV6A 1QHHA 3D6MA 3OECA 2ZDGA 2VI5A 4OBEA 4BNXA 3WR5A 4AK9A 2PLFA 2P9EA 2JJ2A 2P9CA 1VL1A 4GPIB 1BX0A 1VL8A 4YH1A 3TM5A 5E8JA 1GCIA 1P45A 5SY9A 2XA9A 1XZHA 5DHAA 3SXUB 2ZSFA 2OZLA 1E2FA 2ACKA 2LDBA 4LA4A 3VNQA 1AN0A 2EGUA 2X5NA 2NTJA 4TKMA 3CRVA 4ZC1A 3QKWA 3E35A 3C45A 2GN1A 2MSLA 4TMXA 3KEFA 4E4RA 2YVLA 5A0VA 2ZRFA 3LH5A 2O3JA 3GJYA 3D2CA 2C9CA 1GT6A 3HYCA 2XB9A 4RH0A 2VHVA 3CNNA 1JSZA 3WS7A 4J9UE 3L7CA 2HA4A 1R8JA 4NBRA 3FVVA 5IVIA 2IKQA 1DUIA 2FPPB 4IDPA 4AF8A 2XJ9A 4C3UA 4EM6A 5ENVA 2R11A 1UZAA 2DF8A 4W82A 5E2BA 4BB6A 2B30A 1LX7A 1W1IA 2E49A 2YWXA 3INTA 1GCOA 1N0IA 3DBLB 3DZBA 4FIDA 3TFQA 4CFZA 3N8HA 3R5SA 5JNRA 1CEEA 2ANCA 2QRGA 3ETJA 4FFVA 2FPSA 3LPMA 4Q05A 2D1YA 4KFCA 4TVKA 5KX5B 1QCCA 1ZX1A 5AI9A 4E5SA 4KDRA 1ELOA 3AUUA 4X94A 2C96A 1E9SA 1E1CB 2VBIA 4J1SA 2JIRA 4BJ6A 1TL7C 1R4AA 2EQBA 1BDIA 1U0EA 4BVHA 1VXRA 2V3CC 1FYVA 3UAOA 2ACEA 3C3JA 4DN6A 2P4QA 2ZR0A 1G17A 2XWBF 4G8CA 4UVIA 3CF0A 1N0HA 3H16A 2I4NA 1YZTA 5T4EA 1CJUC 1MT3A 1VLZA 2OGZA 4ETIA 2H11A 1NW7A 3F3SA 4BQRA 1IUPA 2VVTA 3AM5A 4FSHA 4K9OA 2I7CA 3RK0A 1OD6A 4L57A 5KSYA 2I0FA 4WXMA 1JNXX 2XGGA 2XQKA 5LP1A 3K72B 4I5EA 2H2HA 2NG1A 2ZQ5A 3I37X 1L8QA 1QRUA 3FJOA 1R12A 1K3FA 1XCJA 1LWOA 1E8MA 2YWFA 1OXSC 1U2TA 2R96A 1H3EA 1J5XA 4KYVA 4WINA 2PSEA 1K5PA 2QDXA 3UVEA 4ZZ1A 3EVFA 5K6RA 2DU8A 1YS1X 4OYRA 1VGRA 2Y66A 2GJ9A 4JXXA 2IXBA 5JG7A 5C8XA 1D8AA 4M0MA 2NTYC 3EVGA 3HCWA 1XQ9A 2FEMA 4DF3A 1Y9ZA 2CBZA 2MWMA 3BFVA 5E1MA 3QX3A 1JG4A 2Q0SA 3HCPA 1WBJB 1X7WA 3PIIA 3QY0A 5ECWA 2JH3A 1LV7A 2GZ1A 4YAFA 1RR6A 1N6IA 1SOMA 3QPBA 2J09A 2ZI7A 5IVHA 3PSHA 4NBVA 1ANKA 4QUDA 2D2EA 2NIPA 3B6KA 2CHQA 5FKJA 5HWSA 2GN8A 5JU6A 3I0ZA 1BU8A 2PSFA 2EWVA 3KR9A 1JA0A 3QE9Y 1E6MA 2RGDA 4RENA 3QVWA 1KEPA 4M1WA 1KARA 2KHZA 3LCVB 3GQBB 2QN1A 1NFRA 3QY9A 4TWIA 3ZC3A 3V8QA 3G0DA 3I6YA 4GYYA 4G9GA 4MPDA 5EGNA 1I7SB 3WRXA 2V9CA 3PR2B 3P2MA 4G63A 2O8VA 1MOSA 2C57A 3BCRA 1ODCA 3H5WA 3H5VA 4IIJF 1V5EA 2D0IA 2Z58A 4LNUB 2GXAA 2NMVA 2C9BA 2C8KA 3D8HA 3DPSA 4UAJA 3REGA 3UAGA 2MOKA 4A5OA 4D8YA 5FTKA 1G8PA 2NW6A 2YHIA 3DEJA 1H9AA 5C34B 2O3UA 5DCUA 4GC5A 2UVQA 1TD9A 1TLTA 3GJ5A 3D02A 4FMCB 3NXSA 2V98A 1HQDA 2PN1A 4ZCSA 1KO4A 4E4YA 3QITA 3MIIA 2H3HA 2IXTA 2J0EA 4M22A 4CM8A 1SVWA 4YFVA 2XCQA 4DSUA 1Z0JA 1GPJA 3OJOA 2I4LA 4MNTA 5DTMA 3B9RA 4QT4A 1IB0A 2GD2A 4KFUA 3E3NA 1VYVA 2QP3A 3LD9A 3PJRA 1CULC 4YQFA 5CDHA 3G0GA 3DBIA 4HTAA 4L4ZA 1KP2A 3FSJX 1N78A 4EBFA 3USZA 2JI7A 1WMFA 3BWDD 1CDEA 1P5HA 1T2AA 3QKSB 5IRCD 3L40A 4KIGA 3B3GA 1Y80A 3QELB 1OXUA 2R00A 1N6NA 4W9NA 3UHPA 4XEUA 3DHNA 3IMKA 3IHWA 3V8NA 3JQFA 2HI0A 4IKEA 4FYMA 2H1FA 3PJGA 5TF0A 2M6KA 5AK5A 1CEQA 3Q11A 1IDOA 2ZDQA 4DCUA 3QG5A 4IRMA 2C97A 3CZMA 3ZHSA 3IT3A 3GY0A 4C4PA 4NOJA 2RAUA 2WFLB 1KI8A 5CTJA 5AW0A 4EW1A 2PR2A 2H2WA 2MINA 3D7KA 3L1IA 4KH1A 1M1XB 3OFND 2JLVA 3T3DA 3VKGA 2V96A 3MFQA 1XZGA 2X9VA 3Q6MA 4R31A 1RCTE 3RBVA 2C29D 2WHEA 1U2ZA 1RHMA 3IAS6 4LDRA 4JH0A 4W9RA 4CV3A 2DHCA 1FFHA 3H75A 1Y8CA 2WHRA 4BUZA 5DM60 2XUQA 2WAYA 2IXDA 1EK5A 4PRLA 5EP4A 4D0LB 1SGWA 1ZWKA 4NL4H 2HJVA 1NF9A 3QWAA 5C5IA 2WT8A 1OTYA 2EFHB 1V11B 2K2WA 3N0TA 4TUYF 2G4LA 3KT3A 4E6EA 4FLEA 4WBNB 4M9XA 2DTXA 4O5AA 4G6ZA 3RYFA 1TTTA 2OBLA 5CVEA 3A2NA 3A7DA 1XNHA 4NCIA 3QBVA 5JZSA 5A4IS 1L5LA 2OV3A 1F8FA 3C5HA 1ORVA 1SBQA 2WUWE 4FSXA 3RH0A 2JB9A 5JNLA 2O3SA 1S02A 3U0VA 3NFYA 3GLQA 4R2JA 2RH5A 4HS9A 4U2KA 2Z83A 1AMNA 1DBVO 1SHUX 3K6JA 4D4JA 4G97A 6AT1A 1Z4QA 2B25A 3I2YX 3HXPA 4GICA 5A7GA 1GA1A 1EFVA 1F06A 4MO2A 3CFYA 1RWXA 1XTKA 1L5ZA 2P2CA 2PT5A 2VRNA 3L9XA 3PDIA 4K6KA 2VZLA 4NMMA 4BNJA 4DVJA 3QHPA 2FUNB 3ZJ4A 1U8CB 4IJVA 1A1VA 1WXHA 3GVHA 4YAGA 1GSAA 4P3XA 5ILGA 1NVEA 3BX1A 3QNMA 4F72A 4JC0A 1G4AE 2O7QA 3HB0A 4IMJB 4DZTA 1X8JA 3D8NA 3SZRA 1G5TA 3AYZB 4LY3A 5BQ5A 1KYZA 1W34A 4JI8B 4RTQA 4G2NA 1I6KA 3GHYA 1C3XA 1TJ3A 3ADOA 2JD1A 1J8FA 4WZAB 4OFWA 2WDZA 4TTTS 2JAOA 4UEJA 5E9WA 4DV3B 1RWKA 4QUEA 3FMPB 4QXQA 3CLVA 1XQWA 1ITZA 3ICPA 3OZVA 2CJYA 3W3AD 3Q7PA 4B8WA 4DLNA 1A77A 3PHGA 1SCUA 4EYEA 3QVVA 5AXCA 3S55A 5K3OA 1RKXA 3HZOA 5A06A 1YVUA 3K4HA 2CBGA 2BDUA 3KK0A 4P81A 4Y2SA 3WBKA 4F0JA 5I4IA 1IQRA 4X3OA 3IKJA 1J00A 3EE6A 5EP3A 3ZTTA 1AKQA 2HA0A 1GZ5A 2HDWA 2A30A 2R6JA 1IN4A 1KRWA 3HWX1 1JEJA 5JY1A 4REMA 8LDHA 3VR5A 4R2WA 4XR9A 2Q0HA 1E2KA 1KERA 3ZY5A 4CF3A 3O2JA 2G6BA 1G60A 4ZCQA 3RABA 3WRXC 2GTIA 3RK1A 2JIPA 3P9IA 1FNNA 1L7MA 2FOIA 4NZ9A 5TPZD 1V45E 4BWFB 5BUQA 1U7TA 5H59A 2QTZA 2XIJA 3OIGA 4FFSA 3UAXA 3B89A 2AR0A 3CGGA 4MGKR 1UINA 6PFKA 1OZFA 3CVXA 1PUJA 5ALKA 3ZN2A 3OFKA 3CB2A 2L2QA 1C41A 1YDMA 3NETA 2P8SA 3MFYA 1CNEA 3GJXC 4DSZA 1DRUA 1X8KA 4C2UA 4MGEA 2VT7A 4S05A 5HBRA 5KKNB 4DGSA 3I6MA 5KO2A 1KI7A 4QTXA 1SQFA 2PRSA 2X22A 3T9EA 4N0MA 5CK5A 1KR5A 3GVPA 2YZKA 1WMEA 2VF5X 2PNJA 1B1CA 3KPVA 4JC4A 4I4TA 1QIHA 5JS1A 2R7KA 5FO1A 1Q77A 4MJLA 2G1AA 2ZJAA 2GB4A 4Z8YA 1QFZA 1HL7A 4EZIA 3DBHA 3EGEA 2UYGA 2BM1A 2GTPA 1HFEL 2R00C 3GI1A 4NESA 2WTBA 3P2JA 4W9NC 4QOIA 4CIDA 4CT5A 3ANLA 4D6PA 3BPSA 3JQFC 3CKMA 1L7XA 3OEHD 4LAFA 4MIYA 1XMOB 1Y98A 2ZKLA 1XROA 1CRZA 1Y81A 4XTCS 4DLSA 2GKSA 4DNQA 1GPNA 4OX9Y 1SQ0A 4QBIA 4TSKA 4BZXA 2JLUA 2ZBVA 1YJBA 3R3YA 4M7WA 5ALUA 4GOMD 4K6GA 4FZJA 1NYLA 3AKDA 4HGRA 4MVJE 4QIHA 1WZIA 2EX0A 1B73A 2JHCA 2NVUA 3KU1A 1XEXA 3QHQA 1E6LA 1NW5A 1O0BA 3DOJA 4JVOA 4K9RA 5KNBA 1VBNA 1AO3A 4AIIA 4B17A 2AG8A 3EMDA 4LV8B 3RSGA 2V3WA 1VI2A 4EFLA 1JQDA 1TD1A 4KZPA 4GQIA 4HWPA 3EBPA 3QMPA 4EA6A 1O87A 3FTEA 1PTJA 1WDLA 4KGZA 1U5AA 4D4HA 4ZYTA 3EEOA 1GDDA 3NOXA 3BMQA 4LDPA 5KZMB 3EF1A 2B20A 2JNWA 1ADJA 5IVKA 1HE8B 4BB9A 1OCEA 5C46F 1IAQA 2Y1OA 4DMRA 3GJ6A 5A2QA 5G0TA 4A2PA 2BCJQ 3GZJA 4H18A 4RIGA 4WX2B 3OOJA 4A82A 3X1XA 1GDTA 1CRWG 1DWQA 2P77A 3BWXA 3NHYA 4FHZA 1YR2A 4HEA6 1M74A 1THTA 2VT3A 4Q37A 5GOZA 1U0OC 4COOA 1UK8A 1L3CA 3IUSA 5BSEA 1E3EA 2LR0A 4TKUA 2Q5FA 2YFYA 4QG3A 1NVKA 4R7TA 2O2GA 3C43A 1CY8A 3K9QO 4CRWB 3GJ3A 1U0TA 2NO5A 2PQ2A 4BKMA 1U4SA 2IYEA 1M5UA 2W2MA 3BHIA 5LFAA 1N5RA 2Q0QA 3L43A 1GZHB 4ALLA 1XF9A 1OILA 2QQ0A 4Q7KA 4WLNA 3SX2A 4IW3B 4DLLA 1RVDA 3ZCXA 1RJ9B 5L7YA 1UDCA 4KRGA 3I9OA 4IVQA 3TF5A 4M1MA 5AJXA 2P11A 1XZDA 2M32A 4YJ2F 1ZA2A 1XDUA 4TMVA 1FU4A 1QH8A 3DF9A 4PZDA 2DQZA 2VXBA 3PBKA 3GEEA 1P0CA 1P18A 1SOWA 4NE9A 1UKEA 4LSZA 2C4KA 4S1NA 2V55B 3LLMA 4FHGA 4D41A 4YUXA 3VJRA 1XF1A 2LE0A 1A5AB 3B5JA 4QAQA 4U2CA 4DQXA 5LA6A 4N0EA 4BWVA 2GVNA 1M1YA 3LHKA 1R0XA 2I2BA 2FW8A 4OLHA 5A6VA 3CX3A 3PUXA 1C7QA 1L7EA 1BVRA 1FZQA 4WH0A 4DA7A 1U8YA 2GM9A 1EFPA 4MPRA 2IYOA 4RK7A 1SBCA 1UOEA 2OQIA 3FHJA 2AX4A 3FB4A 3K0FA 2YR0A 3PIDA 4M0DA 2PL9A 3L8YA 1M2WA 4ZI7A 3T0GA 1G7RA 1UJ6A 4K40A 1J49A 1ZZEA 5ALJA 3RYIB 1GN9A 2IPAB 2QK4A 3VDNB 1H8EA 4GP9A 2WYUA 3KJGA 4W7HA 5CVUA 3IODA 1NI5A 2VC2B 4KODA 1RRMA 3MJVA 3TBHA 4D3YA 3AFNA 2GM3A 5KYXA 2QRHA 4UZFA 2P2YA 3D4PA 1VJGA 2XYGA 1U9IA 1NOIA 2FUCA 2ZW9A 3BH0A 3ME5A 2AIRA 4W1RA 2P5TB 2FJPA 3HPRA 3UUGA 3SYRA 2BBOA 2RHJA 1US8B 1ZBDA 3O92A 3GW8A 2NO9A 4Y67A 3FPEA 1E0DA 2H08A 1C1YA 1I4TD 2PKEA 1THMA 3H5LA 1T9KA 3M1AA 1M3SA 4WKGA 1VKRA 5EPUA 1EZ1A 3QKIA 3SFTA 1BRMA 1TCVA 5C1PA 3CNBA 3I2JA 5G41A 2CKDA 2D13A 2VP3A 2HCJB 2C3MA 5HUJA 4GDMA 2XX3A 2F3SA 2OHGA 1BE6A 1I2DA 1Q0QA 3IMCA 2ON6A 1AQYA 4LBWA 4BZQA 4M54A 2ZRLA 2DQSA 4RPJA 4Z1MA 3GX1A 3DBRA 4R0NA 2D59A 2VJPA 4DUGD 2C7GA 1N9GA 3GZ4A 1NJ6A 2O7RA 1SQSA 3L0IB 2GHQA 4KFRA 4N0DA 2XXJA 3S1AB 3L4KA 2BIFA 3I34X 1QHYA 1FTGA 3OIDA 4EA8A 1WOYA 4B31A 3SMQA 1WZNA 2I2XB 1GG5A 4E5KA 4OL9A 3IX7A 4DBLC 2OVFA 2IW1A 2YWHA 2WE8A 3THWA 3TD2A 3GJ0A 2PSDA 3LVFO 4WLVA 1E98A 2ZUWA 3EIWA 3CRRA 3U7GA 1I24A 3QPWA 5JVDA 1EKXA 3GEDA 1N33B 2C61A 2A5GA 2NQ2C 4IV8A 3T7DA 3UT6A 3QE2A 3GLVA 2CL7X 2J30A 1NJ1A 1OB5A 1M8PA 3OP1A 1NMSA 3DDOA 3Q7TA 1IB6A 4IBOA 4OQPA 5D01A 4ZREA 4OHRA 5CA0A 4AFNA 2XRYA 4HF7A 3UT5B 3AI2A 2PKCA 1Z5VA 3CW9A 2A6PA 4R8MA 3D7LA 1PEDA 1Y8RB 3OC6A 4KEAA 4LHYA 4TWBA 4U7GA 5FPTA 3Q8XB 3GLTA 1PTJC 5B3KA 2UUAB 4LNAA 1LEHA 2IODA 3OO0A 1WP4A 3CNQS 3T5TA 3ZBQA 4FINA 2Q9UA 2EJBA 2FU5C 3JQRA 3NPMA 4WNAB 4YV1A 5JYDA 4O1MA 1ZITA 3D4IA 3LUPA 4MI1A 2YS7A 5DT9A 4V0OA 2H16A 4XYEA 2JKZA 3F5MA 4M1QA 2XKAA 3L6CA 1GG8A 4LKRA 5H3CA 2JJQA 4EAQA 1XSEA 2VKQA 5TNXA 5AQEA 1RAAA 3ROEA 1N8SA 2CHGA 2OKCA 2GEJA 4BWGA 4MDYA 4GOXA 4AN4A 4BU1A 1JYEA 1P4RA 2CUKA 2OILA 4AROA 3T35A 4IDGA 3EUEA 3N2KA 3OQJA 1TYAE 1GAXA 3SR0A 2PVPA 2DAPA 1JFTA 1QIFA 3TQIA 3NI2A 3PTZA 1X87A 3AIKA 2DUWA 3LW7A 3KFXA 1G5QA 1TTQB 3DE1X 3NOVA 5JMOA 2KQUA 4QHSA 1UFQA 2VXCA 1UEJA 1IFXA 1FCJA 2HIGA 2ZPUA 1KYXA 1VBKA 5FLEX 4DSAA 3JZIA 2IIPA 1TZBA 3D7MA 3K8OE 3FOFC 4KPGA 5IAGA 1FUYB 4AP5A 1K68A 5A3SA 4CDNA 2VNSA 1WHSA 4EHBA 2B1JA 3ZDXB 1CP3A 3VC3A 3INYA 1K9SA 4W8GA 4IYRA 3R3ZA 4X7RA 2FOXA 4A92A 2XIQA 5HTOA 4BE4A 2X7JA 4Q4AA 5DYTA 1MDFA 2L42A 3WLAA 1W4AA 3GGDA 2XADA 4B85A 3EZ9A 4JEIA 4EVRA 1P3DA 1PJ3A 4M1ZA 4TTPA 1NQ5A 2QX7A 5IJZA 3BJEA 5GWXA 1YBHA 1XTUA 3OJLA 4MCIA 2O1XA 4O4JF 2G09A 4DC0A 4F7WA 2G5CA 5BMVA 4DV7B 4CNBA 4GR5A 1LXCA 4TMTA 3OZFA 3S40A 4PC6A 4ARCA 1JIVA 1WVGA 4EB0A 4Q3AA 3BC1A 3TRKA 4OQMA 2FSGA 3K6SA 3BRWD 3OE4A 4MV0A 2OZPA 2G67A 3UMJA 4BS9A 5JRJA 1FYDA 1CZOA 2A7XA 4QC2A 1EQUA 3JWPA 3LWNA 2WWRA 4BGUA 5GADl 3ZDBA 1PR5A 2Y2UA 2ZATA 3WNCA 2ZYDA 3HXLA 1Z2CA 1AT1A 3HP7A 2FGKA 4QPZA 1U9IC 3KXIA 1I5RA 3FUUA 2AL7A 3MILA 3R0XA 2QPAA 1SHKA 1R3UA 3K35A 3LGXA 4ZRDA 3W1VA 2PKXA 2O05A 2WTXA 3CH4B 2FQQA 5EXEA 2BMJA 4ZT2A 3EAQA 4HVLA 3I8XA 3FNIA 3CZPA 3W78A 1WKCA 3F9IA 1QRTA 3JRWA 2UVDA 3R7SA 2IY7A 2FOLA 1E96A 4ZHQF 2WM3A 2PYDA 4BNGA 4C0LA 5C8ZA 1A9OA 3MLAA 1I7LA 2QTHA 3ZWXA 4RORA 1GQ2A 5IT5A 2V7VA 3JZAA 2NN3C 1SQ5A 4XIJA 2OG1A 3BXOA 4Y98A 5M2QA 1CDZA 2VDJA 1F0KA 3RFFA 3UG6A 2YMMA 3AKCA 3G9UA 3KQOA 2ZRGA 1Q44A 1CEXA 4WGGA 3V1KA 3AKZA 4H3VA 3DM5A 5B57C 1IY1A 5FBQB 4JJ8A 4R1OA 3HUFA 1KAHA 2W0SA 1Z39A 4Y9DA 2QN8A 2Y1FA 1DBIA 3FWPA 2KBFA 3NT5A 5NLLA 2GJ8A 5BR1A 1YE5A 3FSGD 2LCFA 2ANBA 3RS0A 2GYWA 4WK2B 4CMKA 4MHTA 1UJCA 4C6HA 1NNLA 1PP4A 2XVZA 3KUCA 4FCWA 5ALIA 2ZIWB 3H05A 2XV1A 2ZWPA 3L92A 3ZGLA 4ZMSA 1AHHA 1X80B 2LIPA 3AEZA 4YDRA 3S8YA 1KOGA 5LQJA 4XH9B 2IYZA 3L6OO 4HC4A 1VBMA 3T3IA 3HV2A 2O5RA 1VE1A 3TE7A 3SZ3A 3BGVA 2QLNA 3DE7X 3GAFA 5CAEB 3OJ0A 1KVSA 3ORFA 4HLDA 1NXQA 3W5HA 2WM8A 1QANA 3K31A 3PUHA 4FDMA 3PWSA 4KSBA 2BFWA 5ELMA 1P60A 1NV8A 2WAAA 3I2KA 3Q3CA 4Y2XA 4KUHA 5CB0A 4DWVA 1T2UA 1BW9B 2R7MA 1QIMA 1YJ5A 3E84A 2A1TS 4EW6A 1TCBA 3QXSA 3ZJTA 1X9GA 3II6X 3J81A 2G0AA 1NI4B 1E92A 1OGIA 2A9VA 1IEWA 1SZCA 2XNSA 3LL7A 2F8LA 1QYIA 2VTBA 4CGZA 1E4VA 3RUPA 2QJRA 2J07A 3DMFA 2BVNA 3B1VA 1K97A 1KZ9A 2P9JA 1YNSA 4LHSA 4YAOA 3WYAA 3X1WA 3DZIA 4H15A 4C22A 3PD0A 3B3JA 3LCMA 4NJMB 3QOFA 2A35A 3BRSA 2X23A 4C4ZA 3CKYA 1CUGA 2HB6A 4CFYA 3JXEA 3TYXA 2J85A 2WWIA 1WB4A 2ZJ3A 5CDSA 3FHLA 1U7WA 3VDQA 1GQQA 3GRPA 3I32A 2ZRQA 1FEZA 4QGBA 5DEIA 3ZE7A 1E6CA 1B3BA 5IKOA 5BOSB 2AC7A 4MW1A 3IAEA 4TLMB 3EVDA 4LRUA 4EH1A 4FYXA 2PWZA 2BMEA 3PNQA 4HDNA 5FL3A 2EX1A 1MD9A 4EEKA 3NVDA 2HRQA 4MMYB 3KX2A 1QM5A 3FFTA 1ZN7A 2RHWA 2XVAA 4FGSA 4O29A 4ZYVA 1TVKA 1JIJA 4KBYA 3RVSA 2Z8YA 3UMYA 1OB2A 1HQCA 1YOVB 1W25A 1YAJA 3BF7A 4A0RA 1DRJA 5JD6A 2H0QA 2ZIGA 1T2VA 1X13A 3MRXA 3PNYA 2PPVA 3AUTA 3CKKA 3GXBA 4N9WA 4OSEA 2QBYB 1I3KA 4P83A 4X71A 1A2BA 5JALA 4NECA 2F2TA 1TM3E 4URXR 4NNOA 1KYVA 2CCKA 2AFHA 6NULA 3EFOB 3OQBA 2PZBA 4PU0A 1DIRA 2QX6A 3NHFA 4LHWA 2M6LA 3VH4A 3D3JA 1N5KA 3IQWA 4MWCA 1LZLA 4OAPA 2ZRCA 2EW2A 3OHPA 2RI1A 2A92A 3A14A 5AJTA 1ODKA 1X74A 2NT4A 4NJOA 4JODA 2B92A 1GZUA 1JFFB 2PU5A 4IRUB 4I1PA 2C20A 5AVKA 4M1EA 3K8YA 1L7QA 2WLTA 2PCJA 4OHMA 5IX8A 5F1PA 2ODQA 5KB3A 1YR3A 4Z53A 5LCXA 7REQA 2DCUA 2HZ7A 1TA9A 3OZIA 1BS1A 4UXJA 1ZOSA 1DG3A 4CF5A 4KACA 1EG7A 3COSA 1SBNE 2NU7B 3H6HA 4NYJQ 5F73A 2II6A 4HDSB 4X6UA 2XTJA 1LPOA 1WCXA 3EGIA 5ALTA 1E9BA 3LY5A 2BGMA 3FA2A 3HBLA 5EMKA 5T67A 3P0FA 3TZBA 3NDRA 3RWOA 1Z8DA 4DEVA 4AKIA 4I9HA 4CGYA 1IIBA 2HA3A 4GSKA 4QQFA 4R0VA 3DCYA 4TSRA 3IDOA 5HF9A 5HCUA 3BXZA 1S89A 1PV4A 4ALIA 5E95A 1L5HB 2H7CA 4XGQA 1DBPA 2XOKD 1L3BA 2NSHA 3SJUA 4EQZA 1PJ8A 5DYGA 4G85A 2YHBA 4OJTA 1Q0RA 3WGIA 1XG5A 1HC7A 1MTZA 2W98A 3TTXA 4EJMA 2LKCA 1TUBB 3DEKA 2VOEA 1V9CA 3CWQA 1PX2A 3IBTA 4LJLA 1U9JA 2XUIA 5CM9C 1AMOA 1SQGA 2FI1A 4LDZA 1R0WA 4LJKA 3TTSA 2UDPA 4PLGA 1L7VC 4W99A 5FNVA 1KSHA 2Y67A 4DMMA 5AJWA 5EC8A 2XCLA 4EY7A 1OWMA 2JFVA 1NVAA 3JWEA 2GPYA 1N2JA 4HHEA 1Y6QA 3GCZA 1LLDA 3X2SA 2VYND 3HJBA 3LP8A 1EFUA 4KCGA 5EUCA 3WL4A 3W7BA 4NPCA 5K3CA 4GRDA 3RTAA 2YCBA 3GJ4A 4R05A 3PCXA 3F7NA 1E8DA 5DKFA 1DRKA 2BTOA 2IWHA 5AIBA 5K8LA 4HN4B 4W5OA 1WXGA 2J0UA 3AK4A 2DEUA 1QYWA 5BYJA 2AK3A 4RSGA 4G1VA 1BRTA 4X8MA 1Q14A 5CJ2A 1UJ2A 2QU8A 3WWDA 2OWEA 2ZTHA 3WY9A 1BMFD 2HK8A 3DPUA 3VUEA 2CC2A 3ZZ1A 3O8CA 4D8UA 4WY8A 4PG8A 4L7VA 2AI2A 3EZLA 4LC1A 4V1CA 1EVJA 2X4GA 4LX0A 4NNPA 1WS6A 3ZIAD 1Y89A 3LMKA 2IY8A 1BG6A 2OEPA 3BUSA 5F2EA 3NCTA 3DWIA 3REOA 4B9EA 3MUNA 5BVGB 2Z0MA 1U2DA 2SKEA 4XIYA 4J4HA 1H65A 1O77A 1UC5B 4EUSA 1AUVA 4EZBA 5B3LA 5FUWA 3ZLJA 1ZIDA 2I34A 1R8QA 2D4HA 3S2YA 1Z2PX 5JCZA 3HM9A 4AMZA 4FILA 1S3GA 1VMKA 2AUMA 3GCDA 4PRZA 3ZI4A 4Y6QA 1Y33E 4KKVA 3I30X 1UFVA 2MSKA 3R3SA 5AKIA 5JH7B 3WI7A 3WK7A 3DAPA 3LBNA 4F6RB 1TI7A 2DPMA 3KPJA 2ECPA 3RC2A 2WWVD 2KE5A 1KHHA 4OATA 1B8VA 1PL0A 3LX6A 2RH9B 5EIAA 4I55F 5L4NA 1NOJA 3SZMA 4F8YA 2WFZA 3P8ZA 3NC1C 4AJ1A 4L8VA 2OXCA 4KREA 4RLFA 4OJNA 3FTNA 5K0EA 2FCAA 4B3FX 3UFBA 4F91B 2ZULA 3I72A 3IR7A 3H83A 3QJYA 4D97A 4KE9A 4Z9BA 2JW5A 4ZQHA 1F4PA 3E2MA 4V38A 3S7ZA 1CJCA 1GTMA 2AI3A 3BZWA 3MT9A 4JT4A 4KRXA 2HT1A 3EWAA 1TU0A 2BSAA 1RXCA 4U9UA 2C1ZA 4QDKA 4BC0A 4MP8A 1USVA 1Q16A 3JQ7A 1KKMA 1ULAA 2IGTA 4NMHA 2QSZA 4IX9A 3ESYA 4YP6A 1GQRA 1UDXA 1T6YA 4LJ9A 5GONA 5EIXA 4PZ0A 2R9VA 1TCUA 4XARA 5HRAA 4EI2A 2HW8A 3FVRA 2O8FA 1KGDA 1U5CA 2AVDA 4WXRA 2Z09A 3EPPA 1E9EA 5AHKA 3WWYA 2JJYA 4CM9D 5KDLA 4P35A 5JYCA 2ZG6A 1OAOA 3DYVA 2RHHA 4C7KA 1E2NA 3Q12A 3RAPR 2X2OA 2H2IA 5H3HA 3PQ6A 5FWXA 3WGGA 3T9DA 2OOKA 3EA4A 1FVFA 1P2DA 4DUPA 1TF5A 2NZUG 2YBDA 4FMDF 3U3ZA 2JHPA 1DKLA 1ZUNB 3MWGA 3ZVLA 3ZHUA 1W0KA 4BTLA 2X2FA 1DXHA 2ONZA 1ZW6A 2HSEA 2P6OA 4G89A 2PWBA 4PO9A 1A9ZA 3AVVA 3U7QB 2HXSA 1VZ3A 3A6KA 5K3EA 1IWPB 4MYUA 2EZ4A 4PVCA 2QLMA 1NT4A 4MUGA 1L1RA 2G82A 4FFWA 3K1ZA 5TQ0B 5A3QA 1ESCA 3PCRB 2TMKA 2YY5A 3L3BA 3ESRA 1CP2A 4S1PA 2HMTA 1ZKMA 2QE6A 3A3OA 2JAXA 3AG6A 4ENSA 1IJKA 1OVGA 2ZOSA 4UKDA 3FCSB 4JYBA 2AD5A 3PVSA 4FZ3A 3O9MA 3SD7A 1UM9A 4BNVA 1OYVA 4BNIA 3AFGA 5CB8A 1E4YA 4U2FA 4I08A 3RTGA 3F73A 2SCUA 4FFBB 1VLLA 1YF3A 1CSEE 1Z4PX 1JR3D 2HQRA 4NZMA 1KU0A 2UYQA 3LOQA 4TV9A 1AOXA 5LZ7A 3ZI0A 1AVTA 2SBTA 5K03A 5BPFA 2UYHA 1QGOA 2VBCA 2FUG6 1RAIA 3IQEA 1JLHA 4H7KA 4FOLA 1ZY2A 5LBTA 3GLIA 2JJ1D 2D5AA 1L5MA 1M2OA 3QQPA 1WXEA 4OMDA 3SM3A 2QMEA 3EGCA 4R69A 4ZU6X 3SR4A 4DWJA 1XLTC 3QUTA 2FETA 4H31A 3IKLA 3IA2A 3VPSA 5F7ZA 2VAVA 3VISA 4K9LA 4QEZA 3ZQKA 4CM4B 5FRDA 4BJ1A 1ZK0A 1Z5OA 4MW4A 3C1TA 1LSUA 1L8XA 3QXCA 1POXA 5BSTA 4AMGA 3KC2A 4BFSA 4X1YB 3PXGA 4XUDA 4XWTA 1WP9A 2G28A 2ZBRA 5E6RB 4B6OA 4DA8A 3BAZA 1PJBA 1AQ6A 1SUPA 1WO8A 2XR1A 3M2PA 4FHEA 2ERXA 5LZ2A 4IDAA 1HGXA 5KC8A 3J80A 1FMJA 2Q49A 3B8HA 5HFNA 1P5FA 3HXOA 2H51A 4PLTA 1LDNA 3NBUA 4WVFA 4YT2A 4GUAA 1QONA 3K9NA 1WJGA 1FQKA 3HK2A 3ESCA 3THXB 2J32A 2OPBA 3LHFA 3U62A 1S8OA 2E4YA 1P1CA 1U2DC 4QGFA 4OMFG 3WLLA 2FPUA 1E2UA 5JXHA 3U4DA 1EESA 5COQA 3UMBA 2AFIB 2J6CA 1C3OB 1SD1A 3CLTD 3JU3A 1Z83A 2PRZA 1QB7A 1BOFA 1WVMA 1ZU5A 5DX1A 4HGYA 3NH6A 4TOIA 3TLGB 2E87A 1NDUA 2V7QD 2EERA 4IICA 4KTVE 4A91A 2E82A 2PD6A 1F8YA 2IVZA 2J3EA 3OT1B 3Q2IA 1JIQA 2D2VA 4S12A 3HXKA 1UKAA 2FHPA 2HMWA 1V2GA 3F98A 3PUWA 5B12A 4F4IA 3DOFA 4H35A 4IXTA 4XD2A 3ROTA 1X2EA 1LI5A 2EWWA 1I0LA 1UT6A 1UQRA 2RHOA 1BX3A 5I9SA 3UQYS 1EP9A 1U8UA 2OQVA 3TX2A 1LLFA 1I51A 4NCKA 4ZICA 1E6WA 3I05A 1NXSA 1YAHA 4KQXA 4RXUA 2KPOA 4RXMA 2VUIB 3H7IA 5JATA 3DDSA 1OTHA 3B36A 3T95A 2CL0X 1I3LA 1X39A 1BQ4A 4DZRA 5CDUA 1KIMA 2BFMA 3IBCA 3JSXA 3OTQA 4LBVA 4RTRA 1PCXA 1GQSA 4IJMA 4L3OA 1U8TA 3SOZA 3UH1A 3UN1A 5CCXA 1FTWA 1U4NA 3CB4A 4YACA 1N5DA 1KMHA 2CZQA 5C8DA 3B78A 1TGYA 2QHXA 4GZ5A 2PZAA 4CHTA 2V5VA 3V97A 1NJ8A 1JLKA 2Q45A 2QX9A 1OH7A 1C30B 3V4PB 3HLYA 3G6WA 5C4GB 1BKYA 3I28A 1ZVMA 3GLHE 4FDLA 2H1HA 1CU1A 4FFMA 5T5QA 4BASA 1PD0A 5AW5A 5CEFA 1OAOC 2W4MA 2DFPA 4R8SA 4AUKA 5GJBA 4UEOA 5B1SA 2CDBA 2V4MA 1R16A 4FKMA 4H0NA 2OGSA 3C16C 2J9XB 3MWLA 3QPAA 4ENVA 5JQGA 1J2EA 4YLGA 1I2ZA 1VMDA 1HG0A 3NTUA 4QJIA 3CRW1 4ZEWA 5AI8A 4YRJA 1BN6A 3RLFA 1DCKA 4LE1A 1FA9A 4DJDC 2W2KA 4YAEA 5HKOA 1X7XA 2FA9A 3HSSA 3IV7A 1BHQ1 4KIFA 4MEAA 1XGKA 2O6HA 1K4KA 1CF9A 1VL5A 4DCGA 1EDDA 3KQYA 4HAIA 3MJRA 2HSZA 4UBKA 4IILA 2IZ0A 2J41A 2JD0A 3TBFA 3O9ZA 3GG9A 2QXTA 4IV0A 2R1ZA 5JJBA 4CKYA 2X5KO 4BECA 3KYCA 2VA8A 3CUSA 3OT5A 4HH0A 2MR6A 2BTQB 3A6PC 3MELA 5AHOA 4Q4HA 3HI6A 4JP8A 2QI9C 3FLBA 3T3EA 3BGOS 4NTZA 4LECA 4O63O 1ZMTA 1DIGA 1UFRA 3O47A 2GR9A 2AXPA 2H5LA 4L3VA 5HJ2A 4CCYA 3ELYA 3DAGA 4O2RA 3E05A 4R81A 3EMBA 2WTMA 3AR6A 2Y1CA 4ZAYA 3ZY2A 3EVTA 2YFHA 3WJ7A 4XWGA 3U26A 4F4FA 2XNDA 2BCGY 5EIFA 4MICA 5C35A 1OU0A 4C4AA 1FMFA 16PKA 3VU3A 1J2RA 1N5LA 4ETWA 1LD3A 2F62A 1CUAA 2O07A 2Q9BA 1PK8A 2R6ZA 3UC9A 4Z4QA 4IINA 1J20A 1K5HA 5DTJA 3SXUA 1X1QA 3L7JA 3M6UA 3AILA 3HLTA 1V2HE 5JISA 5KTKA 1C2YA 3SEZA 4AMVA 2HN9A 3LPDA 2JCBA 1NP7A 2WIBA 2B8NA 1TYCA 2JCGA 4A2QA 4QRDA 1ISIA 1CUYA 2BMVA 2IIBA 4FUQA 3WLKX 4D4IA 2O5CA 3UJ9A 2AE2A 1FNBA 4R3NA 1DARA 1DELA 2ZSHA 1COWA 5FOWA 3I4CA 4MUHA 2OGWA 3LRTA 2GYUA 3W5BA 4M88A 5A9TA 4GSYA 2QL7A 3BD6A 3QLEA 4LGVA 4UBIA 5LLDA 2FPPA 3QX9A 4R8LA 3V4FA 4JLSA 3U81A 4HQ6A 1X1SA 2W0MA 1SPBS 3G2OA 5FPYA 2NOAA 2G7ZA 3DBLA 3GOHA 1Z8HA 4GMXA 4H7JA 2BFDA 5DRTA 2F1HA 4FQ7A 4C3OB 4QYIB 2QG9A 2PO5A 4RX1A 2IHUA 1T2FA 1U7DA 1W9HA 1WEKA 2QW1A 1B41A 1E1CA 2WE7A 4HR7A 1OT5A 2JAWA 4YK7A 3UA3A 2WWYA 2I65A 2IZZA 1MFPA 2XYQA 3GJ7A 1NUHA 1Z74A 3M0EA 4ZAZA 3L5OA 3FMGA 4JJ4A 3QTLA 2QDKA 4PAWA 5AK3A 3C4VA 3H13A 4D5GA 1Q57A 1CB7A 4NCAA 4KJZA 3A6DA 4ZO8A 3VR6A 1L8OA 1N2CB 4GKJB 1CYEA 1XKXA 4O4LB 2ONCA 2PY6A 4CF4A 4MRMB 3QSYA 1UWKA 1UPBA 4P4LA 4Y2RA 4WFQA 1DKUA 1XKLA 4BEVA 2FSUA 2OXIA 3HEAA 4KN6A 2WR8A 4H08A 4Z7QB 1MH9A 3NEAA 3HXQA 5DF1A 3OTIA 5F76A 4I4NA 4CKBA 1JQEA 4RE6A 4I2VA 3F6PA 3O3CA 4EMBA 4L08A 5I9LA 4RVHA 4RNDB 3WMFA 3UZUA 3WB2A 5BQOA 4FOTA 3VU0A 2WAMA 2CNBA 2O2HA 5FBHA 2B99A 1XU4A 4CL8A 1GZVA 4QJ4A 4W1SA 5H9VA 1D6JA 4RJTA 1KJQA 2ZBEA 1DDOA 5U4QA 4HNTA 2WZDA 4UEWA 1PBTA 4K5QA 2E6KA 1J8DA 5A5DA 1JUDA 2AYZA 2TYSB 4RMHA 3DEIA 3IAUA 1XD9A 2VR1A 4M8NE 3RROA 2H07A 1JG1A 1W4ZA 2ZFUA 2A0WA 4OMCA 5LLSA 4EHIA 5E6UB 1GRVA 3LVQE 1IMJA 1QOPB 2GESA 4GGMX 4JX8A 4LYAA 2CLOB 3QPUA 4TTJA 5IZ4A 5AP9A 1G2QA 3G8BA 2B5WA 3RYHB 5IEBA 5GIOE 5IBRA 1LNSA 2IHVA 4B3GA 1HO3A 1G6OA 2Q7OE 1D2CA 5ESXA 3CV3A 1EM6A 2G08A 2EP8A 3JZMA 1C0PA 1CJBA 4TZ0A 4H9GA 4TLAA 4E7OA 2D2XA 4I5IA 1TT7A 1CUCA 2CFIA 1IU9A 2I3BA 4KQMA 1KMIY 2CXPA 1AS2A 3HZHA 1NQUA 5CA1A 2QVYX 4LNUA 3H2BA 4DFDA 5IG2A 4F2DA 1NLYA 1V16A 3L1VA 4HKTA 2YWGA 4XB1A 5F3RA 3LUGA 5CX1B 3FNFA 4PHCA 4AG3A 2VYVD 3HB1A 4XCVA 4MMZB 1C1HA 2FQYA 3KUUA 1MB9A 1RP1A 2ZTSA 2HMUA 4B2PA 2PUAA 1ZGZA 1ZL0A 1VPLA 5B4TA 3FWNA 4KIUA 1QUFA 3VDMA 2EIHA 1L5RA 1J0BA 2WB4A 3NUQA 4ND6A 4X84A 3W5SA 1GT91 4QRIA 1K86A 4RY9A 5P21A 2Y9MB 1SVSA 3EIOA 1FSZA 4RGQA 3WJ1A 1TYBE 4YJDA 1V96A 2V59A 5CUQA 9LDBA 4NF2A 1TAUA 4XZ3A 4YHBA 3AC0A 1ZRMA 2AQKA 3QKSA 4NABA 3K8QA 1IEVA 4JLWA 1Y6GA 1OAAA 4BRZA 2O7NA 3EAFA 4YT4A 4K1XA 3I6QA 1PJZA 2OY0A 3OX4A 2X1MA 3RTCA 3ZGZA 4HNVA 5CYOA 3HKBB 2RGGA 1R64A 3C74A 3ZW9A 2QTCA 1GV0A 3P0HA 1GO2A 1Q19A 4J1NA 4TX1A 2WFLA 5B6JA 2JJ8A 1T5IA 2Z2KA 4IDBA 4KE7A 3T99A 5A71A 3ZIUA 1ZD4A 3SZLA 2FQ1A 3K9LA 3V80A 1KXZA 3OI7A 1XCGB 1ZBQA 4R8RA 1VL0A 3UUWA 3B85A 1T43A 2BM9A 3PQ3A 2FFQA 3UKJA 1U1IA 1XJ5A 4YI5A 3O4JA 1NOKA 1ZVQA 3O8OB 1VP3A 3AIOA 3HB5X 3B9QA 1NSYA 5I7SA 1TZMA 3E53A 2XA1A 1LY1A 3RC8A 1H0KA 4BCBA 5HXAA 2AFRA 2AC4A 1K0UA 2VJKA 3R5KA 1SIOA 2PT6A 4F2WA 1V11A 5KVVA 5GVSA 1U65A 2JCYA 5L3VA 2J3HA 3H5NA 4WBNA 2BHSA 3BWVA 2GOYA 3G1TA 4Z3DA 4B4KA 2YZMA 3V7NA 2Y1LA 2RKWA 4TT3D 5IBPA 3QNUA 2CE7A 3OKCA 5KDDA 2YV5A 4CKEB 1RJFA 3AHJA 2PA3A 2PBLA 2E5LB 3P7MA 1GL7A 5EVJA 4MA0A 2X13A 2OBFA 1O3YA 4AJEA 1PWHA 2NVBA 2DKFA 4A0HA 2GLTA 1JJBA 3FGZA 1M75A 7ADHA 1BFDA 1V7CA 4ZTUB 3Q5DA 3LYHA 2B1GA 1RLUA 2GGSA 3PEEA 4TYNA 3Q3IA 3VBCA 5LDHA 1Y5NA 2VNHA 1WU8A 2B2XA 5D8DA 2OC9A 1MAVA 3O21A 4GZMA 4RH3A 4PO8A 3GROA 3M82A 2DBVO 3IXMA 4EL5A 2JIZA 2AF3C 3B6JA 4OI4A 4U3JB 4AKEA 4YYZA 2XZOA 2Q3CA 3MD9A 4DW8A 3GMIA 3GEPA 4BGIA 5LD2B 1ZA1A 3H4TA 1S4QA 3PI7A 4UUAA 4ZOLB 4BVKA 3ORHA 3VI4B 4KXUA 2VG8A 1UBSB 3PXXA 1BD3A 3ESXA 1DDIA 2AMLA 3C24A 2R87A 4XVHA 3Q8MA 2N3ZA 1ZEJA 3ZDAA 1L5VA 4II3A 1CV2A 1WSAA 2CJPA 1V41E 2C5AA 5M04A 2B78A 2BZ0A 4UHFA 4WZAA 1Y37A 3OFJA 3JQAD 1OE0A 4IGEA 3W5IA 3BHNA 4IF4A 1W48A 4YXWD 1BWSA 2AI1A 1P0PA 4RCZA 2GYYA 1V9LA 1NQXA 2JGMA 3HH8A 5C7LO 5I4BA 2BGUA 2WJIA 2O2EA 1L4LA 4TTIA 2B35A 2FFAA 2IS6A 4YGXB 1J0XO 1CLUA 3KTDA 5TQ2B 5T6BA 3SZGA 1YIAA 1G4UR 4DLAA 3L6RA 3V55A 1GU1A 4RF2A 4Y6RA 1OQAA 1WL8A 1Y6JA 1A2KC 1QTRA 1WPGA 3A3NA 2L82A 4BWYA 1L5WA 3GGJA 3C3YA 1XD2B 2XYPA 2GPAA 3F46A 4M0CA 2VZ8A 4WOBA 4XSGA 3TN7A 4BBPA 2VPPA 4DR1B 5CX4A 2YRWA 3VZRA 2DG2A 2ZAOA 1OBFO 4RPGA 2WHXA 2VSNA 3U9TA 3KZMA 1ARZA 3CZ4A 3IUYA 4GOLD 4OSOA 4RUKA 1N77A 2DBQA 5JAMA 3ZCVA 2QTBA 3FFAA 1SCBA 1Z07A 4O8ZA 3LPCA 4RIFA 4CQJA 3DDHA 4OFZA 2IXEA 3NBKA 4D96A 4KQ1A 5C18A 4RTKA 2BHRA 1YL6A 5AJUA 5BW8A 1GIAA 2FEXA 1M1NB 3DC2A 2CUZA 4BP9A 2XHEA 3MB8A 1CVRA 1SO8A 3DDCA 1YONA 3A58B 4ER6A 1YQEA 5ITWA 5FI1B 4RULA 3UK1A 1BNCA 3ZOZA 4KQCA 3FWYA 5CTAA 2VCYA 4KAJA 4PAMA 3SEQA 1YFLA 4YMTA 1BOOA 3CPSA 2Q46A 4JT8A 2HTFA 4MDHA 4I50F 4OHZA 4LZZA 4PONA 1PWYE 4EPXA 3WAJA 4G81A 1GVNB 3DV9A 4BNMA 2E4XA 5GIPE 3N5KA 1Z16A 1GQFA 3JSAA 3ASZA 5AKHA 1FS5A 1XIVA 1D03A 4IS2A 2EDCA 4ARVA 3FKSD 4XSVA 3HU1A 4MPTA 2ZBDA 2N1MA 4H77A 5EZYA 3KJNA 4CR8A 3AM1A 2E1PA 3IJPA 3SIXA 2DLNA 2PD4A 4NU8X 4PSAA 4FYWA 4V0QA 5DM2A 3IP6A 3WAKA 4RK4A 1JDBC 1BGVA 1JNYA 3FPSA 4HQOA 4MUMA 3NATA 5T4FA 4BLOA 1JQBA 3MUOA 4MP3A 3GFFA 4OHXA 1WXWA 1XRNA 4XFDA 1WQ3A 2OV6A 2PX5A 3ESZA 1XRRA 1G8GA 5DBFA 3U60B 3GLFA 2HA5A 3E7DA 3RW9A 4TSFD 2EQ5A 2PSJA 1NIPA 3AF3A 3IVCA 5BW4A 1BQEA 1CCWA 1JQ5A 1E5TA 3TI7A 4RFSB 3B5EA 1PSZA 2Q4RA 2C88A 4AT1A 3A1UA 5DN9A 4QLBA 1J5PA 1VJ1A 4XUCA 3ROMA 4GKAA 3FW1A 3MWEB 1NP3A 2QB5A 4TXNA 2WRZA 4RAOA 3UV6A 1B6SA 4UQPA 5DLYA 1IBRA 2VTVA 5LIPA 5FOTA 1HNZB 3LDHA 2A5FA 2CNWD 2HXGA 2VHWA 1S2GA 3MOSA 1HDZA 1ZGGA 2W71A 3VMFA 3AERB 3AVTA 3T0IA 2GZ2A 2P4HX 2XQGA 4M60A 2V7WA 3VZBA 2A59A 1XQ6A 2JA1A 3F6CA 3A2MA 2W2PA 4X54A 3FSRA 5CRIA 2ASVA 5AJHA 4EYGA 5IKEA 2V1XA 1U6KA 2BEKA 3GLRA 4RK6A 3H8WA 1RRKA 1DFGA 3JQEA 3TTYA 3F9CA 4M98A 1MOQA 5GP1A 4EJ2A 4OGGA 1AQJA 3NHUA 1MG5A 4R1PA 2B37A 3MHPA 1QWSA 1U3UA 1L4GA 4KBFA 3UKDA 2M98A 4LCEA 4RQTA 5CVDA 2W2XA 2ZSBA 2H1LA 4H6WA 4AKGA 4JT9A 1Z18A 4KGXA 2GBPA 3D8TA 3GA7A 3HLKA 2JDID 1RJ9A 2DECA 4Q7QA 2HMAA 3R9XB 3T61A 4BN0A 4DQLA 4Z7NB 1D5WA 2JGIA 1UFOA 2HO5A 3HCNA 4L5AA 4N4AA 1UBGA 3IDQA 2WQ7A 2DFTA 4BTVA 1HA3A 1JVBA 1TW2A 2DFLA 3VSCA 2QR3A 2PH5A 3ZKWB 1C2TA 1VTKA 1ZQ9A 2HBYA 2HIMA 1KIAA 1J70A 1M33A 3B2EA 1C7JA 4PZEA 1M0WA 3U4GA 3WIOA 1H1DA 4AKTA 3U7IA 2ODAA 3HBNA 1WA5A 1DT5A 5BV7A 1D2NA 9MHTA 4AZTA 3PFKA 3HABA 1ZS9A 3U7JA 2JFQA 3W4JA 3SX4A 1S2LA 3G0IA 4PBSA 4IF6A 5EJ8A 2ZRIA 2JRCA 2WD7B 3MGCA 3TCKA 4PINA 3KAQA 1OI7A 3TSWA 4D99A 3HJFA 1PVDA 2ATIA 4NK4A 2EFEB 3M5DA 2WWTA 3PUYA 3Q6NA 1RZRA 4AKSA 2Q5EA 1WUHS 5IU6A 4PNEA 1JJFA 1YRHA 4MWDA 5DM70 3L8ZA 2P4UA 1EXWA 4TLCA 4HK4A 4TS3A 4RTNA 1C9EA 2FLWA 4WXHA 4ZTZB 2ZSKA 1OIVA 3BEDA 3HADA 5BSRA 1XTIA 4TV8F 3HU3A 5JJ5A 1NVVQ 1XKQA 3E7FA 2PX3A 2F48A 3N2EA 3D8UA 3DVQX 3H5RA 3QKRA 2EC5A 3QYPA 4G8BA 1R37A 2AFVA 1RBZA 1US8A 3BILA 3HSKA 3CYFA 1RWNA 3T5DA 1I14A 3TLXA 3UOWA 5I51A 1L7AA 3DFFA 2ID8A 3NBMA 1U3WA 1NXPA 2BFFB 3LY9A 4XLLA 5ER6A 1SBZA 2VN8A 3CW8X 4UE6A 4DEYA 1WSWA 4IKOA 4CXMA 4XGRA 1YL7A 1CUWA 2CNOA 2FQWA 1FRNA 3PYXA 1U2PA 4FYHA 2C4NA 4U6QA 5E2AA 4YP1A 4IM7A 4TT8A 2QPLA 5H16A 1XP5A 2AEFA 3M33A 2Q4TA 4EF4A 4N0QA 3QUQA 4P22A 2G9ZA 1RQXA 1E1KA 4IMIB 3IJEB 1T4BA 1B3RA 1EP3B 1QG2A 2XT6A 2YHAA 1DXQA 3MYRA 3N86A 1DPGA 4JGIA 3VU1A 3W5UA 2Q5CA 2RFLA 5BWLA 5JRZA 4LXYA 2OXEA 1T8RA 3W1EA 1RWPA 4MWTA 2RK4A 3MS7A 1U63A 3BZBA 3CSUA 4GOKA 3GR6A 1X2BA 3A4VA 4QA9A 1FFCA 2BM0A 2DFNA 4RQUA 1AGRA 2XEDA 4U9HS 4WFKA 1U7ZA 2XMBA 4HAXA 4AYTA 3NNNA 2ZT8A 4NMWA 3IQXA 3G8DA 1Q7GA 4Q3KA 4AQ7A 5HZMA 2QZSA 2WNHA 4KWHA 1G64A 2QM7A 3KV3O 4Q7EA 5FUBA 3UUEA 4UQLA 1NU8A 1RNLA 1NJ2A 3K94A 4EK9A 1UZLA 2QAJA 1U8FO 4TLEA 1IHPA 4BFVA 4ZJPA 1PFVA 1QLJA 1RADA 3EF3A 3F5SA 3IEIA 1WMDA 3N8NA 3UT5A 1DZIA 3DD1A 2VH1A 4CFSA 1KE1A 5EKSA 1XL1A 1Y8RA 4ZAWA 1FX1A 4GHWA 1JXMA 3WL6A 4GI5A 3RSOA 1PT9A 2FSFA 2VF2A 1HXHA 2YIJA 2WUDA 4BYMA 3KQWA 4LXQA 3CRZA 3D3EA 4WNAA 4AQDA 2WQZA 1V47A 1NRWA 4V02A 2HLPA 1YACA 1YB4A 3A6EA 2XI4A 1IDN1 4C0BA 3ZU6A 4GBED 3RS2A 4CIXA 1U3CA 3DE6X 4ZYXA 3SS9X 8GPBA 5LQAA 2HRZA 5CB4B 2P2DA 4EPTA 2VHQA 2YJ5A 2IEYA 2FN9A 3Q5EA 5CLGA 4ZVLA 5C51B 5EZSA 1MMFB 1C9JA 5EWJB 5M29A 4DKJA 1OKKA 3C48A 2X41A 2JJMA 2WSYB 4Y0VA 4EMSA 1G1MA 1N5MA 1OH5A 2IUSA 2ZE5A 4CU2A 1SUDA 1R4MB 1ZM4A 2D0PB 1DKPA 2O54A 2EGHA 1QJCA 5K3FB 3V33A 1XA0A 2WHPB 5KTTA 2V1UA 1P1RA 4RTLA 4ZOQI 2P35A 4MA4A 3QZUA 3OOSA 4Q34A 5JAQA 3EGVA 3JWJA 4Q4JB 1DTSA 4XPIB 5DSZA 2W6JA 1USIA 3NS7A 3EQ9A 3FUWA 1T5TA 4N5DA 3OZUA 5K6AA 3PVCA 1PGQA 5FWAA 5EAIA 4ARAA 3BN3A 1AK2A 1FIUA 3IUMA 4LSMA 5I5EA 4JK3A 2QLFA 1NBHA 2FV8A 2MSDB 3H1AA 3LC2O 3SYLA 2OHHA 5SYMA 4DT1A 4MV7A 1SBHA 5DTEA 2HDHA 4GRIA 4RD1A 3DZ8A 2R7AA 4A6PA 5A5GA 3DMDA 5EIWA 2AOUB 1NSTA 4AJPA 3AUYA 1HFJA 1T34A 2OBYA 4RD4A 2A78A 4M9QA 4N7MA 1RAEA 1JEQB 4GT1A 5E4TA 3FTCA 4MK4A 1JIKA 1GPYA 2ET6A 3X3HA 4DCNA 3B2NA 3DOEA 1GWNA 2PMBA 2A8YA 4YJGB 3E7PA 3T3HA 2QNBA 5MN5A 1UT5A 1WUJS 1BA3A 3SX0A 4HATA 5EIEA 1RSZA 1MVNA 3QUCA 3FGNA 1EEHA 5F2KA 1M6WA 4RVUA 1ZD9A 5THQA 4BNDB 1PFUA 2QAGB 1Q84A 3N3BC 3PGKA 1DAPA 3FE2A 4KMOA 2QORA 1TM2A 1CUUA 3ERCA 1Z28A 4DR6B 3NP9A 1CJSA 4ALJA 2COEA 1M83A 1N9ZA 4JLVA 4WMLA 4HQNA 4EJFA 3RSLA 4ZDIA 3RADC 1MRZA 1VLMA 3EODA 1AG9A 1BN7A 4EI9A 3GH3A 5LZ9A 1SKBA 3A10A 5AW9A 5HKAA 4R1UA 3HVRA 2ONYA 2WNSA 1MH1A 4TMFA 4LE2A 2J67A 2HD4A 3KBOA 2FZLA 3KT8A 4CTJA 4IIJB 3M1IA 5T3YA 1OY1A 5C5CA 3ZPXA 1MJ5A 2EFJA 2W5UA 3U6KA 2G07A 2O59A 2F1OA 4UHJA 3ZDZB 1L7BA 2LBPA 3QBEA 4IQ8A 5AMXA 1NMYA 2G06A 1KJ8A 2QRNA 2VPQA 4LFCB 1CJMA 3EW7A 5B53A 1TK2A 1NONA 3RU3A 3ZWKA 1JALA 2A4KA 4EHAA 4JJFA 1YBVA 2VJCA 4ETMA 2B83A 5JS8A 2FF5A 3BE4A 2W83A 3G88A 5FH9A 1V5IA 4JLAA 5AK4A 2OGTA 3FTFA 2EKBA 2WD9A 4O2AB 1P62B 5J1TB 3EG5A 1M76A 4YRPA 1IN8A 1V35A 3LWBA 4K6HA 3WLSA 5JO0A 4RKWA 2UXCB 4R1QA 4ZT6A 1X80A 1UXJA 1EVEA 3K2BA 1JPUA 3FBWA 3LZDA 3NAQA 3PQ5A 4LXTA 4CW7A 4DJ5X 1JE0A 3DHWC 4IG9A 3IT2A 3NJRA 4FR2A 3KSBC 2HUNA 1XCOA 4HFMA 1ZM9A 3AR7A 3TGLA 2QT0A 3KQMA 3R3VA 2VJOA 3GD5A 3MXTA 4YCCA 3QXJA 4P3PA 2CUTA 4CR6A 1PR4A 2VHCA 1YZKA 2SNIE 4HLQB 4GGPA 4DG9A 4EMTA 1ZSYA 721PA 2JFYA 3P4UA 2B8EA 1W8DA 4CETA 1N32B 1STOA 3HR7A 4INZA 1NI4A 1FBNA 2DVMA 2H6EA 2GMWA 2G83A 2X8LA 3B1WA 4KX3A 5BOVA 1LNZA 4YIHA 4KPEC 2XEXA 3RS3A 4HUJA 2FMTA 1ODIA 3KSUA 4KLNA 5CPBA 4RELA 5A2GA 2B69A 1CTQA 1DRVA 1TZCA 5LSAA 3WV4A 1ZJYA 1BE1A 1M6YA 4NJMA 2ZVJA 3N2LA 3HKEB 4NOMA 3H8SA 3ENNA 4X64B 1G9TA 4LZWA 2EZ8A 2VIIA 3N74A 4AJKA 4LVUA 5IBCA 2G5GX 5KMGA 1QTQA 2NO0A 1W19A 4C0HA 2LP4Y 1Z36A 4FK8A 4ZEVA 7AT1A 3WMXA 2CDNA 3X43A 4YCMA 2ZJ2A 1Z4KA 4D3SA 4JJZA 3FNRA 3MGBA 4BLPA 3F8TA 1DNPA 5BOSA 2R1VB 4ISBA 1J2YA 1XPUA 1TQ2A 3LGAA 1I4OA 4FGJA 3W9YA 3WLEA 5E9QA 3HKCB 4P5DA 4BP8A 1F2VA 2HQ1A 3FM9A 4KSYA 1C9NA 1CXZA 3QYFA 4RVFA 2ZWAA 1Q0UA 3NTVA 1CK4A 1JHZA 2QF7A 3RTBA 1P0IA 1MJGA 4N3GA 4US0R 3HBMA 2NUTB 2P90A 3IUJA 1K88A 1J2JA 1M7HA 3KSZO 1W9MA 1WWKA 1YOVA 4LI0A 2DLCX 2F4VB 3LW8A 3DNMA 4YRFA 5K6AC 1OHHD 1EFHA 4V1CI 2P1RA 2VJBA 1YCFA 2Y3IA 1KC3A 2Y76A 4UOQA 3TL3A 1HDGO 3RSZA 2QBYA 2CSXA 1KK2A 1E2PA 1OWOA 2C2HA 3AGQA 4NPHA 1G7CA 1RXYA 3HI4A 3I1YA 2J1LA 1KAEA 1TQ4A 4BB0A 1OBOA 3MCUA 1BEUB 4G86A 4II7A 3LT2A 3ZDDA 2XCRB 2NO1A 3H11B 1SBTA 1GNSA 2XHZA 3NU1A 3NO4A 3WKBA 1UK9A 2Z4SA 4O4HF 1DEKA 2C4VA 1BDHA 2BBWA 4OBXA 3SN6A 3AOEA 5BWCA 1JFFA 4IOLA 4RF5A 3UWOA 1A5ZA 5ES3A 4ZQEA 3GHHA 3JQ8A 3DOUA 5F2OA 5AJVB 1LVUA 2F59A 3RFUA 2O5EA 3TTTA 1MT0A 2XZTA 3ANMA 1KQFA 2J9FB 4DG5A 1BSVA 1I2AA 2GCPA 4IX1A 2NU7A 2R4TA 1JAIA 4PGFA 4HDSA 1RJWA 4QTYA 3IR5A 3KYIB 1MP0A 3OX3A 4RVCA 2FPOA 3C3XA 4N49A 3U49A 3FCCA 1WDWB 3ZWYA 4GGOA 1W5AA 1ADYA 1DAFA 4FMBB 4MJ7A 4QLAA 2F3UA 4POAA 3EARA 5IAEA 4QOJA 4HEQA 4C7BA 3CEJA 5B6IA 4L9RA 3UPUA 1Q1ZA 4LVCA 5CGQB 2GK4A 2GBLA 4P98A 3AONB 1ZD5A 2EEZA 2PZEA 1ZNWA 4I1IA 1L5HA 2Z3VA 4YMLA 4B3RB 4L6IA 4R8VA 2AUNA 3DP7A 4YRDA 5B2EA 3GL9A 3A4MA 4M8LA 5EKDA 4DGQA 5DIFA 2ZIFA 3EW9A 1XMVA 4GLFA 1I1HA 1JR4A 4JR1A 2ATVA 3V2HA 5BV8A 5BWMA 2GZ3A 3M2TA 3NAGA 1W93A 3SHWA 2ZREA 1KA9H 1MB4A 4YRKA 3AP2A 1T1RA 5K2MA 4K9QA 1Z34A 5DX0A 4EHJA 5LQCA 4EHHA 2VHZA 4PW0A 3GRAA 4GSLA 3ZJYA 5JDCC 2O48X 3UB4A 1Y3AA 3C41J 3CF6R 2NQTA 1FFGA 5KOJB 4MVJG 3MM4A 5CT6A 3WIUA 4E5YA 4A8JB 4NEQA 3E2IA 4HNHA 4J1QA 1YQQA 4YASA 3SLGA 2OHJA 4UARA 4ZMRA 4OOFA 4DIOA 3EZXA 1DJPA 2YVUA 1ZIOA 5D3MB 2BMDA 3LPAA 2EP7A 1NP6A 2CK3A 4B4OA 5IMBA 5AK6A 2AMYA 1QKKA 2NZVG 3W90A 1QK5A 5JJCA 1VIYA 3EA0A 5K0JA 1EI9A 2VH5R 2TMGA 1CUZA 4OXIA 1O97C 2PPLA 1JR3E 1TO6A 1X1AA 1Y5LA 3VU9B 1NZFA 5FWDA 1FXWA 2BBSA 1RP7A 1LVHA 2VPZA 1JIUA 1FY2A 2DP4E 5L3RA 3NC0C 4ZQIA 1NULA 5A4DA 5BVGA 1J09A 1F1BA 4L27A 4PANA 1A69A 1KI6A 1EX1A 4UPEA 3HTXA 4MSUA 5A0TA 2DSTA 3UAYA 1MNQA 2EJTA 4E33A 1UC8A 2CUNA 5CFQA 1QG0A 3UOGA 3RRZA 2UVPB 1BD4A 1SUIA 3AY0A 4ME6A 4A10A 4ISCA 1GTL1 5IM5A 3U56A 3H9BA 4JJAA 4ZKEA 2WWGA 3KLPX 5AKYA 4ZV4A 1G9SA 3C1AA 3LUDA 5K3DA 4CM1A 2Y99A 5JH7A 3MWKA 4NKRA 1R4NB 1Z75A 3EWNA 3MGAA 3O0TA 3A4LA 4F6RA 1DG9A 4HYYA 4LZLA 1B2RA 1UK7A 4LMBA 5GINE 1WCIB 1XCMA 3IYLW 2RI0A 1YDGA 4OHKA 2HNBA 4ZCTA 2WQ6A 3V3TA 2F1KA 2OV8A 1EA5A 4KVZA 3RUEA 1Q1EA 2XKBA 3V5NA 1IRIA 1CLEA 2EFYA 5DP2A 4XOUA 2I4TA 2H1WA 3WYFA 4MYSA 1ZNXA 2GFHA 1OIXA 3B6EA 4UCWA 1PQYA 2R2AA 5FEUA 4JLOA 4YUZA 4HNUA 1YWGO 3DDZX 1OZGA 3CURA 1MENA 2IOFA 5I9IA 4OGLA 1D0VA 3GP5A 1Y3FE 3EIFA 3DZHA 1T4CA 3QFHA 1T36B 4N3CA 4RD2A 2EF0A 2I4IA 3G0CA 4NR0A 1T2NA 1EB9A 3P4YA 5H80A 3EEIA 3CR3C 3E4CA 1XZLA 3FYDA 4RDXA 2IEGA 5EMLA 5TX7A 1CS0B 5JPIA 1N0UA 2JIMA 1S8FA 3RANA 4ZEXA 4I81A 1KDYA 3BKWA 4ZDKA 3QVGA 3J7AC 3FNQA 4RAQA 1UJMA 2QV0A 4G67A 1HLDA 2JBAB 5KC9A 1JH8A 1T6XA 1MAWA 3H2HA 4TLBA 3H99A 2W9XA 2H00A 2FW9A 4F86A 3AOEC 4XQGA 1ZUNA 5COAA 1C0IA 5KS2A 4OLAA 1N3LA 4DYVA 1QG6A 2ASEA 4TVBA 2QM3A 1V6SA 3K9GA 3U7QA 1RWMA 4KTTE 2WNIA 1GKUB 1K75A 1KZ1A 5KCMA 4MKGA 1G2PA 2P0EA 3TTVA 1U0GA 1ZXBA 4IQ0A 1G3MA 3ZHZA 3IKTA 4ZO6A 1B93A 4H4DA 3PRKE 1O58A 2QL6A 5TQ0A 3K32A 5TARA 2QAIA 1QCYA 1KI1A 5B7NA 2VDPB 5DK6A 5LUAA 2C04A 2WIKA 1N4AA 3Q3JB 4EITA 3HL4A 1X77A 1Z0UA 1TW3A 2EKDA 3QOYA 1A7KA 3QPCA 1TAGA 3B6MA 1J33A 5DNYB 5LYJB 2ENUA 4RVGA 1I80A 3A0RB 2GBLC 3DL7A 3EAGA 3GUHA 4QXRA 2JBWA 2E37A 1XL0A 4RL6A 4RJIA 4UVGA 4ZV9A 2ZUFA 4EY6A 2X7HA 4FFBA 5LBIA 2C54A 4DAOA 2EJUA 4RS3A 1Z2NX 2BSQA 2ID9A 4HQ0A 2Q3DA 1OX4B 1GGFA 3MS4A 4RLQA 2AR7A 2GAAA 1C14A 3NONA 4YRBA 3G13A 4A1OA 2P2ZA 2A5LA 2EARA 2WM2A 3IQGX 2Y0PA 3SAJA 1DBRA 4QVKA 2M2IA 2Z1NA 1PW7A 1SNYA 3E5MA 4PX3A 1GPDG 4NWIA 4PCLA 3H17A 2A5YB 4XDZA 3JR7A 4WHMA 3RSSA 1EIWA 1USWA 4I1YA 5JEEA 1VLQA 3P1JA 3K5WA 2J4CA 1EMDA 3F8SA 5LKRA 1ZJZA 3OE1A 3C3KA 4BNWA 4CM4A 3AUXA 2QN6A 4KHZA 3A4TA 1Y8QB 4LRXA 3AV0B 3T7TA 1IZZA 1I7NA 4KO4S 1HYEA 1I7PA 1PEKE 2V4ZA 3M4YA 2QJFA 4X1YA 4BVFA 5E6RA 1G21B 2Q1WA 3O4RA 2AE1A 4CM5A 3GEHA 1GUBA 1DTWB 2R44A 3V32A 4E2WA 4FOPA 1A76A 1LU9A 2GERA 1KEEB 2YV2A 2I1QA 2OC4A 3O7WA 4D43A 1GPMA 4KWCA 3W34A 1XTSA 2H4YA 1WPRA 5L45A 3ZDQA 4YBZA 2C2KA 2V7BA 3NTXA 1T1GA 2XYHA 1GUAA 3THXA 5HQTA 3GFQA 4QZVA 2DY1A 3RO7A 2OYSA 5KCZA 5MF6A 1ZGHA 4Z4FA 1B15A 2PFGA 3BF8A 2D5CA 4PLVA 4G56A 3O8BA 3LQYA 5HIMA 2J5KA 3NBFA 1G55A 2AFIA 2BE9A 2NNLD 3BMOB 1C3OA 4LSWA 1ZR4A 1TJ5A 2BMFA 3PPVA 3NHPA 5EUBA 2C31A 4WJKB 3TLGA 1W2GA 2ACVA 4PPFA 1NMXA 2QG4A 3LUFA 4DQ0A 3OT1A 3C15C 1N6HA 2GF0A 3R5TA 4R54A 3WGLA 1PJQA 1VLVA 1NRJB 3PXDA 3FVTA 4IMRA 3WRYA 3M89A 3ZCRA 1PAUA 3P0RA 1GARA 1RPNA 3HUDA 1NQWA 2WFMA 3O7MA 1KYQA 1U9CA 2F1JA 5DBOA 3NRJA 1HV8A 4QSMA 1DCFA 2O06A 1HEIA 3IE2A 4WLFA 1VQ1A 3HHEA 3MTAA 4MITA 1E77A 4Y2VA 4GPEA 1AXEA 1DX9A 2OFXA 1AQLA 2OFOA 2GSDA 2ZSUA 3PLAE 1OX6A 3NNSA 2HQBA 2O2JA 2Z6VA 2YQ4A 3HNRA 4JOQA 1EUQA 4P92A 3EVNA 4NJEB 3KWFA 5D84A 2ZUTA 6YASA 1KDRA 2FX2A 2IE8A 3KTFA 4M1SA 4RHXA 3QVLA 4EQ6A 1O0CA 5IASA 1NY6A 2CJWB 3RV3A 5G1OA 1AK1A 1N2HA 3QFTA 1VM6A 4HDAA 5F5XA 3C4QA 3RVQA 4CUZA 1C9YA 4PC7A 1WABA 4V1CB 1C30A 2BGTA 5BRAA 2XUJA 4RA9B 1MB3A 1G3UA 1RFLA 1E20A 3PC2A 4ON9A 1GUZA 2XCIA 4MW5A 2IU0A 4LZOA 5LXTB 2GILA 2RGNA 2WPDA 2IHKA 4GC9A 4F93B 2OHXA 1H2EA 3PP8A 4P9NA 4MR9A 3S28A 5HVNA 1M5RA 1B26A 2N0SA 1YI1A 4MUYA 3E3MA 4KFSA 1EHIA 4AF6A 4YV0A 2XE6A 2HPAA 4RCYA 2NSLA 1MPXA 4S1TA 4ZU1X 1TC2A 4D3DA 4DBZA 4F3YA 1LPBB 1X19A 3OUTA 3SP1A 5DNDA 4Z9FA 3FI9A 1HOTA 5C1DA 4C01A 2Z98A 1CUVA 3DFMA 2OCBA 2OCYC 3L5KA 5JSFA 4WL0A 3PEYA 2JGRA 3RFVA 2MSEB 3AI1A 3ABZA 3QEAZ 4J0EA 3V2GA 1AZWA 1E2QA 2OZLB 2CLSA 2E48A 2IBSA 1EE2A 4DRYA 3ND9A 5DGTA 4KK4A 5KIAA 1WD5A 3W3AA 1MX3A 4QUIA 3TLEA 3D8RA 1J7JA 2BTQA 2VQEB 1OR8A 4P8RA 4PPGA 2LRHA 2ZXEA 2VWGA 1KVUA 4Q15A 3ROFA 3RHSA 3RS8A 4RWZA 4L9AA 1DINA 4I5GA 3VSBA 4A7PA 3MJHA 1EGAA 2QIOA 1Q7TA 1SCIA 2MYUA 1Q50A 3M3DA 4JYZA 1UPXA 1XFDA 2C99A 2RB4A 3NM6B 2JPDA 4BIMA 3HO1A 1GLGA 3DTVB 5DB4A 1PZMA 5T7BA 5FF9A 2A0XA 1YZVA 2ZUVA 3ODPA 2WYHA 5ARCA 1AQNA 4KR2A 2QPTA 1IY8A 5AVWA 1TTHA 5FX2A 3PC3A 1ZN9A 1M2JA 1Q1QA 3X1KA 4DLUA 1HX7A 2R25B 2XQJA 1PNRA 2P6RA 5JADA 2CN1A 4S2EA 3GQVA 4O2BF 2HJRA 4JJ7A 1Z4MA 3VV2A 3R2JA 1ZH6A 3KUDA 2W2OA 5KTSA 1EX6A 2LGJA 3FVQA 1V25A 3I2GA 2GSWA 1H05A 4TMYA 3F90A 1QGYA 1IPEA 2JZCA 4DMKA 3OAAA 3CR8A 3CN7A 1RRFA 2YL2A 4BFLA 3CM0A 2AOVA 3I42A 4EX7A 1U0NA 3ZNPA 2WAXA 4HBZA 4IHJB 2RKOA 3LY8A 5KUTA 1Z5UA 3FCAA 2EYUA 1RS0A 4W6ZA 3RSCA 3WISA 5INTA 5M5BA 1IQ0A 3HG7A 3LCRA 1NX9A 2I80A 4E7PA 4BMVA 3U3MA 2NTEA 3G79A 1NG9A 3DW1X 3EOZA 2EHDA 3IMGA 2XUOA 2G4CA 2VDMB 4L4RA 2V65A 1IZ9A 3HGMA 4Z51A 3H7AA 4RTJA 4QARA 2FRVA 4PLCA 4BCDA 3OEHA 4FTWA 1H6DA 2HAEA 3DO8A 1GRQA 1GGKA 2FPMA 4FEYA 1DOHA 4LOIA 4XR4A 1U1EA 1R5BA 1ENYA 4IHKA 4LCBA 4PCVA 2RHGB 4GEKA 4QYIA 5KAMA 1VJRA 1FRZA 4QTUB 2QVGA 3GT0A 4DZZA 2Q8NA 2PIAA 1ZL2A 3ZCUA 2GZAA 5IUJC 5EMJA 2G1PA 1Q6ZA 3G0HA 5LA6F 4FWBA 3HS3A 1KAMA 5ECGC 1R5NA 3VTFA 3W2IA 2DUJA 2FN3A 1N2CA 3N58A 2ZM5A 2ZRNA 1TEHA 3BXPA 1NN5A 4O4LA 2HDNB 4FEEA 4MRMA 1IZYA 2LVBA 3ETCA 3LY7A 4H7HA 5E3JA 1EP2B 4DLVA 4E46A 5M34A 5G4KA 5FUVA 4QDJA 4DM7A 1R18A 4M89A 1XYVA 3QLJA 4LNHA 1NQAO 1MB0A 2QYHA 3HA3A 3WRYC 4ZI7F 5A7FA 5IZCA 1K5DA 1XTRA 3IH5A 5DT2A 3L4BC 2C9DA 2ZJZA 3B9BA 4Q9HA 3S8MA 5ADVA 3SZOA 1SHJA 3DEFA 4R7ZA 5DLPA 4G5QA 4EFKA 3WFJA 1Y5IA 3IUNA 1XXLA 3DONA 2H06A 3WIDA 4K2HA 2NU6A 3E9EA 4C7JA 2F55A 3KQQA 3Q4GA 4FZRA 5WRFA 5BWNA 1BMTA 3U3DA 5HQJA 3H84A 1XEAA 5IH3A 4UBOA 4E2XA 4LXIA 1PNTA 1VCOA 3ED5A 3CF4A 1NJSA 3I73A 5JAZA 1PTKA 2XLBA 2IDMA 1U80A 1P0QA 3T5GA 5E6UA 4OUKX 1HTWA 2GYVA 4D9EA 5KREA 1FF9A 2X76A 5AVVA 1TXGA 2Q5IA 3AB7A 1RWWA 4BTEA 5CURA 3RYHA 3CPHA 4B34A 3OEED 1E9RA 1SU7A 3Q40A 4EF5A 2AG6A 4ZYWA 3DW3X 4IGKA 4Q1CA 2RGNC 1GPLA 4YUWA