2Q5LA

X-ray structure of phenylpyruvate decarboxylase in complex with 2-(1-hydroxyethyl)-3-deaza-thdp
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
543
structure length
538
Chain Sequence
VPRGSHMKLAEALLRALKDRGAQAMFGIPGDFALPFFKVAEETQILPLHTLSHEPAVGFAADAAARYSSTLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTEGNAGLLLTLDTQFQVFKEITVAQARLDDPAKAPAEIARVLGAARAQSRPVYLEIPRNMVNAEVEPVGDDPAWPVDRDALAACADEVLAAMRSATSPVLMVCVEVRRYGLEAKVAELAQRLGVPVVTTFMGRGLLADAPTPPLGTYIGVAGDAEITRLVEESDGLFLLGAILSDTNFAVSQRKIDLRKTIHAFDRAVTLGYHTYADIPLAGLVDALLERLPPSDRTTRGKEPHAYPTGLQADGEPIAPMDIARAVNDRVRAGQEPLLIAADMGDCLFTAMDMIDAGLMAPGYYAGMGFGVPAGIGAQCVSGGKRILTVVGDGAFQMTGWELGNCRRLGIDPIVILFNNASWEMLRTFQPESAFNDLDDWRFADMAAGMGGDGVRVRTRAELKAALDKAFATRGRFQLIEAMIPRGVLSDTLARFVQGQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords PHENYLPYRUVATE DECARBOXYLASE
publication title Molecular mechanism of allosteric substrate activation in a thiamine diphosphate-dependent decarboxylase.
pubmed doi rcsb
source organism Azospirillum brasilense
total genus 193
structure length 538
sequence length 543
chains with identical sequence B
ec nomenclature ec 4.1.1.74: Indolepyruvate decarboxylase.
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q5lA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q5lA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2q5lA02
4C7XA 4KXYA 5I51A 2Y0PA 1X7WA 1W85A 1M2GA 3AHGA 4KGDA 3GLUA 4D5GA 4G1CA 4RJKA 4JD5A 5EJ4A 1RP7A 1S5PA 2R8PA 1ITZA 3HWWA 3EXG2 4MPRA 4RMHA 4KXQA 1UMBB 2PGOA 1B0PA 2H2GA 2Q5JA 2C42A 3D81A 4BV3A 1V16A 2OD7A 4L2IA 2BP7A 3ZG6A 2JLCA 2O1SA 3LQ1A 1T9CA 1YHYA 2G28A 2OZLA 1UPBA 4FEGA 4JUDX 2BFFA 3DVAA 1IK6A 1R9JA 2PGNA 5BWLA 4BUZA 1ICIA 5DGDA 3GLRA 2UZAA 1OVMA 3CLTD 2C3UA 1XLTC 2WVGA 2BRUC 2Q5OA 4IF6A 1MCZA 1GPUA 1OLXA 4JUBA 1N0HA 1UMCA 2VK8A 2BFCA 2H2FA 4XEUA 4QQ8A 4Y6QA 1BFDA 1UM9B 2C31A 2A1TR 5MFZA 1NM5C 3U31A 1V1RA 1POXA 1EFPA 2JI8A 2UZ1A 2IHTA 4J16C 2C3YA 4RJJA 3UPTA 3AHFA 3RIGA 2FR8C 1YBHA 2G25A 3RIYA 1J8FA 4BVHA 4JUCA 4BN4A 3EXHB 4JSRA 2QTCA 1NI4A 3U3DA 2QQFA 2Q5LA 3M49A 2BEUB 4L3OA 2AG0A 5FYQA 2BEVB 1V1MB 3GLSA 1Y9DA 4BN5A 1U2GC 4BVGA 2OD2A 2PDAA 4Y6LA 1HZZC 4R8MA 5MFPA 3DUFA 4JU9A 2IEAA 3EXIB 4GP9A 1YTLA 3ZHSA 2H2DA 1ZPDA 1SZDA 2JI9A 3ZHQA 3JR3A 1QS0B 4RJIA 4COKA 1OLSA 2VBFA 4K9PA 2PANA 2NYRA 1PO7A 3F6EX 1E3TA 3ZHTA 1UMBA 4UUAA 2O1XA 1PVDA 2VK1A 4KXXA 2OO5C 5BWOA 2R8OA 1WCIB 1X7XB 4GPEA 5FEMA 2YIDA 4C78A 5EJ5A 2FRDC 4V1CB 3EXEB 1U5BB 1Q14A 4BVFA 5ERYA 2IHVA 3KOMA 4BVBA 4MZXA 4UTZA 1T9AA 1U28C 3DV0B 1DJLA 1M2HA 5HJEA 1M2NA 2BEWB 1JSCA 3D4BA 2C3PA 2H4FA 5BWNA 3AI7A 1S7GA 2JLAA 3M34A 1DTWB 4KXUA 1YC5A 1UM9A 4BV2A 1PI3A 5HYVA 4KXWA 2A1UA 5EJAA 3AHCA 3UK1A 1X7ZB 3FSJX 1W85B 4UU7A 3IAEA 3PKIA 5K6RA 4V1CI 2BFBA 2BFDB 3CLRD 2Q27A 4J1TC 4F4UA 4Q9DA 2J9FA 2EZUA 5MF6A 2H59A 2OD9A 2DJIA 5ERXA 3EXHA 1QPBA 5D7NA 4UTNA 5I5GA 5EXEA 1V16B 5ESDA 4IAOA 2BP7B 2VJYA 1PYDA 1MA3A 1QGDA 4I5IA 5DGTA 2G67A 2X7JA 4KXVA 1V1MA 3DVAB 1OZGA 1AY0A 3HYLA 1V11A 1Q6ZA 1M2JA 3AHHA 1YHZA 4K9KA 3LQ4A 4JT8A 2W93A 3EXIA 2H2IA 3AHEA 2QTAA 2WVAA 3D7KA 3E9YA 1O97D 1YI0A 4Y6OA 2Q28A 4QELA 1QS0A 4MQ5A 1PNOA 1UMCB 3F6BX 1T9DA 4MPPA 2JGDA 4UU8A 5K3SA 3EXFB 2JI7A 1OLUA 5EJ7A 3RIMA 2EZ8A 1OZFA 1YNOA 2Q29A 4X3PA 4ZP1A 3FZNA 1PTJC 1WCIA 4UTRA 1YD7A 5DEIA 4TWIA 1X7YB 3OOYA 4V1CA 2QQGA 1TKAA 5EJ9A 3EXEA 1U5BA 1TKBA 4WBXC 1U2DC 2YICA 1YC2A 1W88B 3AHIA 3EXG1 1EFVA 3PKJA 1UMDB 3CLSD 1NI4B 3EA4A 5EJ6A 3MOSA 1KEKA 3EXHC 4RMIA 2FSVC 2BEWA 4X3OA 2V3WA 1UPCA 3FLMA 2BFEB 4BVEA 2C3MA 3EY9A 1POWA 1DTWA 1NGSA 1X80B 3ZGOA 4HDAA 4GM0A 1X7ZA 4K9LA 3IAFA 4JUFA 5HGXA 4O8ZA 4MPJA 1OLSB 2BFDA 4JT9A 2Q5QA 4ZZIA 1U31A 3ZHVA 3LQ2A 4RMGA 5EXDA 3K35A 3M6LA 2WVHA 1O96B 1L8AA 2EZTA 1V5GA 1X7WB 5AHKA 2NXWA 4GM4A 1YI1A 5MGNA 4HD8A 5I5EA 4F56A 2XTAA 3OE1A 2XT9A 4K9QA 5C4IA 5IMSA 4UTXA 2AG1A 4K9OA 4KPUA 3AHDA 2C3OA 4UUBA 5EJ8A 4FVTA 4RMJA 2H2HA 1V5FA 2BEUA 2OZLB 2EZ4A 2BEVA 2IHUA 2BFFB 1M2KA 2FWNA 5K2OA 1Q17A 2JIBA 2VBIA 3EXFA 1PT9A 3EYAA 5K6TA 1TRKA 2VBGA 4K9NA 4JU8A 2EZ9A 1SZCA 2OORC 1Q1AA 3JWPA 1PNQA 3ZHRA 4IG9A 3HWX1 4FEEA 1OLXB 3PDHA 1Z8NA 2BFBB 1X7YA 2JI6A 3LPLA 2BFCB 4D5EA 2J9FB 3L84A 2HJHA 1W88A 3ZHUA 3CF4G 2E6KA 1UMDA 3GLTA 1D4OA 2R5NA 2H4HA 4K9MA 4C7BA 1OZHA 1X7XA 5I4IA 4UTVA 1V1RB 4JUAA 2UZ1B 4QPZA 4GG1A 4GM1A 1UPAA 3CLUD 2BFEA 4FZ3A 1V11B 2B4YA 1X80A 3M7IA 1TKCA 2FN3A 4TWJA 3DV0A 4C7VA 3AHJA 2XT6A 1T9BA 1V5EA 5HHTA 2H4JA 2JGDB 1OLUB 3ZGVA 5EJMA 2VK4A 3DUFB
chains in the Genus database with same CATH superfamily
4JHXA 3DTYA 3IRUA 5C8VA 2PPLA 2GILA 3H2JA 4KXYA 3B89A 4J16A 4MEAA 4PE5B 3Q87B 4QXQA 5I51A 5HNKA 1E9AA 1PQPA 3F1LA 4G5GA 3BRQA 1A8UA 4KGDA 2OCXA 3DXFA 1W30A 2V9PA 4MUHA 3QU2A 5JUWA 1N78A 2FK7A 1P80A 2JHGA 1XX6A 1JAYA 3RHZA 1OWNA 2ZBEA 3L0OA 4L0DA 5FORA 3T0GA 1ITZA 4FJ1A 1M67A 5B37A 1ODLA 1T6ZA 2PBLA 2BFOA 4URYR 4LF7B 3M8KA 4MB6A 1MU0A 3A58B 2PGOA 3K0AA 4ZI2A 3KKKA 1B0PA 1JJFA 1WV0A 4YCMA 5DHAA 1RKQA 3VDNB 3P2MA 4S1WA 3HUFA 3V3TA 2BKEA 1W93A 4O0LA 3I42A 2HNKA 2ZWPA 3X44A 4BV3A 4CG1A 5CB6A 3HKEA 4JMPA 1E6KA 1KI8A 4P58A 1Q20A 2PXAA 3WB0A 4DJTA 4XIYA 1A9YA 4I1PA 3L0IB 2HIMA 1T9CA 3NHYA 5KYUA 4PZDA 3SLKA 2O3SA 3PEVA 1LPPA 2F90A 2EF1A 2PRYA 1M8KA 3DVAA 3V1LA 5ES4B 1OBOA 5CFMA 1MB4A 5KWJA 4J2OA 2BGNA 1STOA 4OI4A 1YTUA 1JPNA 1UPFA 1L5VA 1CUZA 2B5OA 3L0ZA 3VYWA 4W5QA 3PFIA 3BSFA 3HEMA 1HTTA 2ASEA 2WUEA 1GTZA 3P5SA 5KX5A 3G2HA 1C4KA 1Y5MA 3K0FA 4JYBA 3CLTD 3E8XA 3QHPA 3GR6A 3P27A 2RHBA 3KV1A 1X1AA 3LQYA 2PZKA 1EPUA 4I5FA 3UPDA 3X2SA 4RLQA 5JD5A 1ODCA 1FBNA 1NVTA 2D5LA 5LQCA 1QTQA 2PH1A 3OT1A 5JXWA 1GPUA 1LNQA 2Y93A 3Q8XB 1RCTE 4DLAA 2YOGA 4KXFB 4QDKA 4MQEA 3B3JA 2DQKA 4XFKA 1ZY2A 1R0SA 4RSMA 4GZ3A 1TZJA 3IJRA 1WY7A 1XZGA 4EB6B 2HK6A 2J41A 4Q3BA 3BH6A 3KAJA 3QFHA 5A9TA 2W22A 1ZKMA 3HA5A 4YCDA 1F2VA 1U7TA 2ZVDA 5KIAA 3NBKA 4G6ZA 4FM9A 3TTUA 5A71A 3OCWA 1DI0A 2QYTA 4K6OA 5TGDA 3HPQA 3GZJA 1XRJA 1YBVA 3NBZC 5HBRA 1II8A 2C7BA 1EUQA 1SRRA 2AFRA 3E3AA 4TL6A 4Q1CA 4B3SB 4G0UA 2WY2D 5ALYA 4BU0A 4OP1A 4RD4A 2QG9A 2GAIA 4PLGA 1LU9A 1JDUA 4H08A 1RNLA 1F4VA 4HQ0A 1NU8A 2ZJ0A 3D8HA 4Y1FA 5IYZF 1GARA 1FRQA 4WY2A 3MMPA 4ZVLA 1XT6A 4Y8VA 5LZ5A 1IN6A 3N87A 4KUGA 3U7EB 5FAXA 4BCBA 2HSZA 4NPAA 1E9VA 5GINE 2FW9A 1RC0A 3LWDA 5J4HA 2UXBB 3C6KA 4M0LA 2Q1YA 2DRIA 1SD2A 3KVRA 3VM6A 3I61A 5FA5A 2X1HA 2R47A 3SVTA 2VSOA 1W7AA 1OX4A 2XB6A 3A06A 1AUPA 1U7UA 5IH7A 5AW6A 2ZE7A 3BD7A 5AVYA 4WIAA 4LNHA 4LRTB 5G3ZA 3FVTA 1CV2A 3LY8A 1TADA 4UC0A 3TTYA 2JKYA 3RTAA 1PWZA 3AL2A 5K0EA 4TTRA 3KOZA 4EA9A 5BORA 4LJ4A 3TVYA 1QV9A 2MYUA 3TRKA 1YCDA 4N47A 2O3RA 2YRWA 3S2YA 1IN4A 2B8NA 2E37A 3LY7A 4JU9A 2IEAA 3W7BA 3ZU5A 1YTLA 3NM4A 1YKGA 3SS9X 3CCFA 2V98A 5ALFA 3P9QA 3DKRA 2C07A 4MUXA 1UEIA 3W6UA 4REQA 2BSXA 2ZW9A 2HI0A 1UK6A 5J5VA 4D3SA 1L5WA 1S2MA 1SIWA 2H54A 1GA4A 1PQUA 1GCOA 2GJ9A 4BEJA 1DQZA 4JP1A 3OOHA 3IP5A 2HCJB 2NM0A 4C14A 2D3WA 4X64B 3HXQA 2VC2B 3C8MA 1XMQB 3ZCQA 2ZUBA 1V8OA 4ZI7A 1CE8B 4NMMA 2Q3LA 1NM5A 3LDUA 1LLUA 3WZLA 3HY4A 2P7HA 1JHUA 2PWPA 4WZBE 2EFEB 2VPYA 3OJ0A 3KQWA 2WD7B 2CF6A 5JSHA 4ZCPA 3TE7A 2C7VA 3IKLA 3WKAA 4JQSA 3SF8A 2P6NA 3Q8KA 2EG5A 2H31A 4D0GA 4MI6A 2P1RA 1EHCA 1U5BB 1ZCJA 2OR3A 1HYEA 3G89A 4GQBA 4F97A 2IZOA 2C4HA 1JDBB 3PXAA 4BVBA 1DO8A 2OGUA 3DLPX 3U17A 5K1ZA 2HSWA 5IF9A 4RYLA 5H59A 3N76A 5AI6A 4DCGA 3CZAA 3UGJA 1JYSA 4DG9A 2XXAA 1WB4A 4H6VA 3B51X 1GVHA 4Q4JB 4BBAA 3GFFA 3C3PA 1M2HA 5EPEA 4CV0A 3IOEA 4GLLA 4JKIA 1AUQA 3AEKA 4YRJA 3TH5A 4LOAA 3WA7A 4KO4S 1RLTA 4ZHQB 4UJ3A 3PWZA 4L75A 3PHJA 3BRWD 1IH8A 1NVWQ 4TYQA 4EQ6A 5A2GA 1CVRA 3M6XA 1P7PA 1ZXXA 2C4TA 3HNPA 1O95D 4P31A 4EQZA 2QL7A 2IXTA 3ZWNA 3KIPA 1JU3A 3KRTA 4CEJB 1RDFA 4MI9A 1Z88A 2WP8J 2WU1A 1Q91A 3B5JA 3L6UA 1CLUA 3HR8A 1VXRA 4GMXA 1R4NA 1XZPA 5HYVA 4RK1A 4I4CA 4LRYA 3VKGA 2NXNA 4MVJI 3Q1KA 2ZCJA 2ROQA 1I3CA 1FDWA 5BSEA 3GJ3A 5BR4A 1YMVA 2E4ZA 2PZEA 2RHOA 3FM9A 1WXHA 3L6DA 3R41A 4GPAA 1QP0A 3O0TA 3VYVA 1SPXA 1M1YE 5IXYA 4EKNB 4JR2A 2Q27A 4J1TC 1L9XA 2V9CA 2W00A 2QDKA 4OSEA 4ZK2A 3I53A 2IP1A 4DIBA 4O0MA 3CH6A 4YJ2A 1Q1QA 2REBA 4EGAA 4WNAB 1C1DA 3HVUA 4UE6A 2IKQA 1O94A 3NAGA 3NC0C 1KYXA 4FFSA 4HQLA 4UU0A 3W05A 3L05A 2ALJA 2HQBA 4GMDA 5D7NA 4B35A 4EL0A 2XE6A 4BTVA 2ACKA 2F43B 4L2IB 4YMLA 3N86A 1U0GA 3NBAA 4PZCA 2EU8A 5DDIP 2B6NA 4KXVA 4KRXA 4M9CA 4PZ9A 1I80A 3RTEA 5C4MA 1IULA 3KXDA 1P2DA 2WYWA 2YV3A 4N40A 2ZTMA 1ECJA 1ZH6A 1RC1A 4H59A 2DTXA 2YMQA 4HWGA 4PYOA 4UUMA 2QD2A 4KAAA 3JY6A 3L8GA 5CA0F 3I5YA 1FRNA 3R9KA 4FNOA 3L7IA 3OKCA 4P3YA 4LMBA 4V0OA 1P1HA 3CC8A 2R6AA 1WQ4A 4YPFA 3VR0A 1J0BA 4G56A 2GBGA 1TK2A 1ZRSA 1XNGA 1LSUA 2Y8EA 4LJ8A 5CCBA 4HI0E 1PFQA 1L4KA 3KLBA 3PF9A 1FFGA 3GRYA 3VAYA 2WZQA 5CXXA 3FZGA 5JC1A 1BE1A 3U2QA 3I9V1 3PLRA 1I5EA 2GK3A 1S89A 1NBMA 1Y7TA 2EBFX 3GJQA 3I64A 4UPDA 1CUJA 3V6LA 4NFSA 2VL7A 1M9NA 2C8KA 1SA0A 3EW7A 3IB3A 2GEVA 2R751 2JI7A 4UU8A 4WE3A 4BMVA 2J3MA 1U8UA 4KLAA 3ZOKA 4CLXA 2F67A 3W6OA 2X22A 1AT1A 4H7DA 3VUFA 3FZNA 4TX1A 2CNNA 1VSTA 3CCCA 4HH3C 4WOCA 2DPGA 1YRHA 2O5CA 2J3IA 4JA2A 1PLLA 3ENZA 1A88A 1T4CB 1Z25A 5LJLA 2CE7A 1C8LA 3B8EA 5CJJA 2QRUA 4TXLA 1OH7A 1SKUA 1XWIA 1ZUNA 1X19A 1RKBA 4BEVA 1QQBA 2V7TA 2HB6A 2I67A 1P31A 2CC2A 1MNAA 4YEDA 2F1HA 1Z22A 3KE8A 3FUUA 2XR1A 2H4YA 4MS1B 1AOXA 4EO9A 5F2EA 3MLEA 4XARA 4YJGB 4RPJA 3UH0A 4CQMA 3GU3A 3T34A 3SAJA 2IS4A 3M70A 3E0XA 1ZL0A 2H29A 1FFEA 1ULUA 1AS3A 4UULA 4B46A 1WG8A 2X9VA 5AW0A 3EXG1 3GJRA 3FNHA 5TV2A 1ZOLA 2Q5HA 3M4YA 3N58A 4O4HB 1SCJA 4X61A 2C03A 1TM1E 1EXDA 2LE0A 1T1RA 2JATA 4IUBS 1L5SA 1ZR4A 4C04A 3MRTA 4NBRA 4C6RA 4MAAA 3R8FA 2WHYA 2NX2A 3SYKA 1JALA 2B25A 3B9PA 1N2OA 2IYSA 1G3IA 1NSTA 4ITRC 1F0PA 4BVEA 4RPKA 4EVRA 5BV2P 3AW9A 4KEAA 1EFAA 1VGVA 1ULHA 3RC3A 2ZSEA 5AW1A 1IWPB 3WLFA 1LZLA 1E69A 2IXGA 4OY3A 4ZTBA 4OK6A 3QPDA 1TT5A 3L7LA 4M1OA 2Y6VA 2CUNA 5KKAA 1KIAA 2WU3A 3IJPA 2W83A 3GLHE 1OBFO 4YRMA 3ZXUB 1L4BA 3ETJA 5DHPA 3JQ6A 2HR1A 4RTMA 4S0XA 5CT6A 3VU9B 1UJNA 2GEFA 1N32B 2ZE6A 5EIHA 3A1FA 2JAHA 4F71A 3T3NA 2FWIA 1GPLA 3OD1A 4LUCA 2BIFA 1RYFA 2IF2A 2O6LA 4X6UA 2R7AA 1DRWA 1R0CA 4B34A 4C7MA 3D8NA 1L5MA 4JJIA 4XR9A 3C3WA 4XX0A 5CURA 3RVBA 2EGGA 1E32A 1L8AA 4ZVNA 1NUSA 1X7WB 5JAOA 2OAP1 3T99A 4ND2A 3H05A 4E2ZA 3U4AA 4P83A 4TWAA 4KR3A 1R0WA 3ROEA 3BERA 2C0CA 4IHKA 8LDHA 5HF9A 2XBMA 5CLHA 2Z2JA 1YHNA 2W6JA 4M3NA 3BWVA 1YK1A 1XXLA 4E1AA 1OIXA 2XTAA 4J49A 5CYGA 3T5PA 4F3RA 2QT9A 1IIBA 3KTOA 1TU3A 3F8TA 4FE4A 2CWDA 2FZVA 4L5AA 2O8CB 4HDRA 3IVCA 1R5OA 4UM9B 4PYIA 4ENWA 2CVQA 4ALIA 5IDYA 1MG0A 2VDOB 4PSKA 4J29A 4IOMA 1HDGO 1V5FA 2FRXA 1WZUA 1JR3A 3FKQA 4MR7A 4NDZA 4O2AA 5A0TA 5BO5A 1NULA 4NBUA 3RFVA 2AQKA 5LQUA 4CEIB 4MV4A 2XE8A 3QWBA 2PAFA 3SG0A 4KW7A 2H1HA 1N2HA 2FF7A 2JIBA 2V6FA 2ZDGA 2ZDQA 2VBIA 4Y2GA 4F4JA 3EJWA 5K6TA 4PFSA 1NV8A 4ESVA 2D54A 4NZNA 3UATA 3LWBA 5EINA 1E1RA 3JQ9C 3FYUB 4PSDA 2A92A 3IQHX 4KH0A 3UFXA 2OORC 4IDPA 5DWDA 4ARUA 3ZHRA 4AQDA 4K6FA 3LUFA 3QFCA 2Z95A 2ZRCA 2H0RA 1I8TA 1MKYA 4WHMA 1JHZA 3O7MA 2OBBA 2A9OA 4RA6B 2AKEA 4KZKA 2H7CA 2WLTA 3GP5A 3VR3D 3Q8MA 5A62A 2VHJA 2R66A 4HJRA 2NU6A 5K20A 3GDGA 3O9VA 3OKFA 1HDCA 3WIBA 4RACA 2JZOA 3C8HA 1O0BA 5HW0A 1QGUB 2NYVA 2Q99A 1PQWA 2FPPB 2JLRA 3L84A 1RT9A 3K9CA 2YMPA 3LM8A 5JI3E 5BSUA 4ZT6A 1MLDA 1NP7A 3O4IA 4HZUA 5I48A 4ZRNA 1M34B 2ZWOA 2JDIA 2B99A 3FRJA 3H8VA 2IOHA 4JXJA 4DNFA 5B1EA 3RKRA 4Q01A 4C7OA 1D4OA 3TQIA 1L6RA 3G6WA 1RTTA 1ZIYA 4IXTA 1X7XA 3OM0A 5AVOA 3U4GA 3VISA 1F2TA 4WNYA 4DDTA 3GPIA 4O02B 2ISCA 1HT3A 1ESDA 2BMEA 2VPIA 2VRNA 1RYYA 4QUDA 2JFQA 1E1QA 4YCAA 3A6EA 1TCBA 2NUPB 3CLUD 1C0KA 1L1RA 2G72A 3HO6A 5AHXA 4LHWA 1VBNA 1DC4A 3U1TA 1J7KA 4MA4A 4QTYA 2IYOA 2HNAA 2QTZA 3WRYC 5FOQA 2AFVA 1DO0A 2FI1A 2IOFA 5LXTF 1Y6JA 2R9VA 3C1OA 3IV9A 5IZCA 3DNFA 2R8BA 2QR5A 3KVVA 4V0MA 2J46A 4TWBA 2OILA 2GM5A 2CDAA 4HY3A 4ER6A 1HE2A 3CU5A 1UBRS 5IUNC 2C0PA 2PX8A 3PK0A 4B79A 1HL3A 2OOKA 4NZ9A 2I7VA 3BGVA 4U9IS 3IE1A 2JFYA 4AWXA 4HUQA 3GFRA 3VNSA 4F5ZA 3L0SA 4R51A 1PYGA 3LHDA 2WLSA 5EMKA 1V5EA 3RT1A 3ZGYA 3W2FA 3NBXX 1CJUC 2AN9A 1BJRE 3DE2X 3R7SA 4NF2A 5KOJB 5KWSA 5A2QA 1VE1A 2UUAB 1VRVA 1JQBA 3CPHA 3JW8A 4PC1A 3O83A 1PGNA 3SIWA 4X1IB 5U4XA 4RPIA 5CDSA 5BN5B 1USIA 4AZ3A 3U1BA 2OGTA 2CD9A 1BGWA 1DINA 2BCGY 2AEMA 3FY4A 5D1HA 1P1JA 2H63A 2HLNA 3W9UA 2UKDA 2I91A 1WL8A 1KMIY 4INPA 3A4TA 4YQEA 1M2GA 4I81A 4KNVA 2P68A 3MUOA 2IP2A 3KHUA 3ZLBA 3GLUA 1ZBDA 4F92B 1V8ZA 4F6LA 1G6OA 1K6IA 1U0FA 4L07A 4OEHA 3T9AA 4XDZA 1Z0UA 4MPRA 3OF5A 3THWA 2ZROA 3HJHA 3B7GA 4HVAA 2XB4A 3UQZA 4IJ5A 1LW7A 4R4JA 3ZS8A 3L8MA 3AY7A 3MRVA 2XLBA 3C41J 4ZQIA 1H1LB 3GI1A 1X1EA 5HP4A 1I1HA 3MT0A 1HNXB 1X38A 2WDZA 3RSQA 1PZXA 4FBLA 2Q7XA 3MN1A 4M54A 1ONPA 3BQNB 2CCGA 2PKYX 3PU6A 4TTQA 4TYPA 2CB9A 3QXXA 2O8EB 2XYQA 2ZSBA 1SURA 1Z36A 1P0PA 1NVUQ 3MYRA 1KSGA 3V8BA 1Y5RA 4EKYA 1BWQA 2YVAA 4BUZA 2UZIR 1E5DA 2FZKA 2QMQA 3QX8A 3X1ZA 3SZRA 1KRXA 3I9MA 4ABTA 2UZAA 1UAAA 4AYTA 3N0WA 4AJJA 3NEPX 3RAFC 1DL5A 3WLJA 1B4DA 1P9NA 3WYEA 3SC4A 4ZXPA 3UMCA 2J7PD 4IVPA 1U90A 2G5GX 4AG5A 1SKYE 1KMNA 2R79A 1SUDA 1QHXA 3ONFA 3PRJA 4LJ7A 4Q21A 3VJLA 3J81k 2O2IA 3A6KA 1KEPA 3FMGA 4Y2RA 2GBLC 1IY8A 2HRDA 1RSZA 1ILWA 2HDWA 3VVCA 3HU5A 3IDSA 2UYYA 4HFRA 4JITA 5T64A 3SK0A 4K7JA 5E8JA 4KX3A 1E92A 2IEBA 5AOCA 3WGTA 3NASA 3R0VA 1H5UA 3JASA 1C81A 2ID4A 1NVXQ 1EFPA 1YQUA 2PHZA 2XMDA 5L45A 2X7HA 4PBRA 2Q6LA 3E2IA 4LGMA 5E6UA 2UUPA 3WDSA 5HCUA 2BGIA 4YP9A 3FJOA 3D02A 4N3AA 5HDQA 2C5AA 2IVZA 4GPIB 4HZIA 5B30A 3OUUA 4EYKA 1VHLA 5IABA 5FHRA 4UNSA 5EHXA 5CNIA 3RVPA 1B2RA 1JLRA 3EVNA 4P22A 3FVWA 5JALA 1W76A 4C01A 1ZK1A 1M2OA 1LRKA 1H2ZA 1X42A 2P9BA 1Z5UA 2O0LA 3KEFA 3OZ7A 4DLUA 4Q82A 4RIFA 3AKDA 4RZHA 4C4OA 4EENA 2B8EA 3NANA 2TYSB 2MU1A 1DSSG 4LBZA 4Y7CA 2F64A 1DQYA 4ZPJA 3ROTA 2WJ3A 4K5QA 4QXOA 4CLOA 4FP9A 1ID1A 3QEBZ 2ZSJA 5DM4A 1E4EA 2QAGC 2XODA 3H5NA 3U19A 3V1UA 3FW1A 3K3PA 2JGFA 2DPYA 3R3UA 1X1BA 1C2YA 1OZ0A 4KWIA 3DWIA 4Y6PA 4D43A 1I4LD 5IFKA 2UUOA 3PBKA 4LYJA 1L4EA 2AFHE 5LYJB 4L4RA 7MHTA 2XD4A 3BULA 3ELDA 4OAQA 5AJTA 1NQTA 1RYHA 1V8PA 1N2GA 5G41A 2PLAA 2X1VA 4PG6A 1AH2A 1XOIA 1LWOA 5K3OA 3IHKA 1U1IA 3FI9A 2R6DA 3MIIA 4NEQA 4WXRA 1A71A 2L0XA 2XYRA 5BV0A 2GKOA 5DX8A 4KN8A 4KTVE 3F8SA 3IQZA 2ZT5A 4NYJQ 5LCXA 2G09A 2QSUA 4GXNA 4LI3X 4E30A 4EI9A 2FLWA 2CT8A 2UUCB 1RMTA 1ZK4A 2XNHA 2QN3A 4BNVA 4F6RB 4UHCA 4JODA 2G76A 1L8LA 2WBLC 4O2BF 5I01A 5BR8B 4QPDA 1VSVA 3GJ8A 3O8OA 3R9WA 2EFJA 4MRNA 5AW7A 2B82A 4URWR 3Q10A 1CRZA 1Q57A 2ZRBA 5BN1A 2VK1A 3TD6A 4CJXA 4D9EA 3KC2A 4AUNA 4RE6A 2BGGA 2QDXA 1DXYA 1MPTA 1G7SA 4OM8A 5REQB 1D09A 2GK4A 3OTHA 4WL0A 3NCHA 1WDKA 1B8OA 2G08A 2ZK7A 2JVIA 4MWSA 4ENPA 1FTYA 4GPEA 4IDCA 1TW2A 2P6MA 4Y6GB 3W7AA 4P33A 2RGDA 3OPYA 2P4QA 2GZ3A 3E70C 3DKKA 3HUDA 4TTTS 3UB4A 4D0LB 1U1EA 4GUAA 4F2GA 5BWMA 1YQQA 5ENVA 5JFTA 5LMNB 4EUSA 3WGJA 4I66A 1KKLA 4GO1A 3CEPB 2JGMA 1GSIA 1ZJ5A 3F3SA 1ML3A 1DKOA 4NQRA 4NPHA 2J1LA 4QQKA 2PSDA 4UBLA 3TJMA 1O6GA 1LI7A 4BC0A 5G02A 4ZJZA 2CL0X 2DP4E 4G1EB 1QFZA 5JQGF 3CVYA 4B31A 3K2QA 4O1IA 1NOKA 1GLVA 1SVKA 2PMCA 2FPMA 5K3EA 3HUEA 4I8IA 3UGTA 4EZIA 4UHKA 3V4LA 4CR6A 3CNNA 3SC2B 4M83A 2YJNA 4KQWA 4P5EA 2WSLA 3ZEAA 3HLTA 4O1HA 4D1YA 1NJSA 1LDBA 1A8IA 1JSCA 1VJGA 4WINA 4ECAA 3W9YA 2Y66A 1TUIA 1GNSA 3T4XA 4HXEB 2OCBA 3NAQA 4XOUA 5BN5A 3C7TA 1XKXA 1AKNA 3F4LA 3RIHA 2IY9A 3H0CA 4M8IA 1Q22A 2G7ZA 1TIPA 2GZMA 4D9GA 2BYTA 2R6FA 2GM9A 3B6MA 2C5SA 4IWNA 4IKPA 4JJAA 1WABA 1P2TA 1FIUA 3GEBA 1UK7A 3I0MA 3F6CA 4Q6WA 1EFRA 4N6OA 3OIYA 5B58C 4IHAA 1PW7A 2PRJA 521PA 3I6YA 2QYOA 1N1EA 5AP9A 4MKHA 1XDZA 3RUAA 1HMYA 1P0QA 2BFBA 3LZDA 4B3GA 3BAFA 2XTMA 4IPTA 4FEAA 4NTZA 3VR2A 1YJBA 4GL4A 3CZMA 3REOA 1G2QA 4KN5A 1QXSA 1SXJE 1T5TA 3VRHA 4B8ZA 1IOWA 4IHJF 2JVJA 3TM5A 3E18A 1DUVG 4RVHA 2ONCA 1TVKB 4MEBA 4XX1A 1PWEA 2I03A 5K4AA 4Q1BA 2OWEA 1J09A 1ZD3A 3D6NB 4ITUA 4O2LA 4TQ9A 1K3UB 1JS1X 4K3VA 1SUFA 1SB8A 1WP4A 4CMCA 4EHKA 1LJ8A 4FWTA 1N5IA 2HQOA 2QZ9A 3EDRA 4L95C 5IYZB 1E58A 1TQ2A 1BEZA 4MVJP 5JD6A 2OC9A 1NE7A 2WMYA 5T41A 1OLOA 2YWEA 3HE3A 3IIJA 4MVJD 4ZCIA 3SHOA 1P4RA 3E2PA 5CD1A 1QF7A 3GGSA 5IHXA 1C80A 1VE7A 4KO3S 2FWAA 1YHZA 2Z3ZA 1ULAA 3LYHA 2EKBA 4F5EA 1QANA 4G4IA 4JT8A 2W6CX 4K6HA 2GD6A 3PYMA 4IHQA 3STVA 3ZE6A 1KDOA 3AUUA 2DUWA 5TQVA 2OC4A 1F17A 3TLKA 2NZJA 2A84A 1CY6A 3AXTA 3QLVC 3JX9A 3OLVA 1EHIA 1XZFA 2P1DA 4FGSA 4TYNA 3E8MA 3OFND 3D3KA 4Z9BA 2QRJA 3H5RA 3D3EA 4MQ5A 2B4TO 4S2UA 1X3LA 3WL7A 2TMYA 3CEAA 1CK4A 4JCOA 3OQ1A 2XOKD 2NT4A 4AI6A 3HACA 3JYHA 3ZNPA 2FQXA 2FJPA 3W5CA 4KQ9A 4A9AA 3DMTC 5AKXA 2VTKA 2ODPA 2ASVA 3DL4A 1NVEA 1PUJA 3WJAA 4B9AA 1S3FA 1OGYA 5EXTA 3OZXA 1A4XA 4F3CA 2E82A 3I5AA 1MP0A 4TZKA 2CXXA 1U2ZA 1YB5A 2FF5A 1XU9A 2XE7A 1UZLA 4IQGA 2I4TA 4BC1A 4RADA 4WBNA 3F5DA 3EPHA 1PK7A 3FRHA 2FMHA 3FPFA 4PYRA 1YKFA 4BGIA 1BCRA 3QE9Y 4CHGA 5G2OA 4Q3EA 2IU3A 3WGMA 4QC2A 3OCVA 4YRNA 4D98A 3F3YA 2HA7A 1WCWA 3NHLA 4NJMA 3AEQA 4NWIA 3GCXA 3HVKA 3GCZA 3T3IA 1NHWA 1EG2A 1S96A 2ZETA 3H11B 3V2GA 4Q1AA 4MVJH 5K8LA 4ZO9A 2VYVA 3ZWQA 1TU0A 1SB9A 2I4IA 3BA1A 1YXMA 1FUKA 1I94B 1KZ6A 4X7PA 2E5WA 3W77A 5K2MA 4NFHA 3EAQA 3K0CC 2XGSA 4HAIA 2C1ZA 1JH9A 2YZMA 3R7FA 4BNLA 1F8YA 4K1XA 1PGOA 1W96A 2P2LA 2AZTA 2VZ0A 1OU4A 1LK7A 2XSZA 1R64A 1JQAA 2GH1A 4MR9B 4YK7A 5COBA 3RD5A 4MUFA 3S5UA 3HL4A 2V0NA 3TL2A 3LVQE 2IL1A 4EY3A 9ATCA 4G67A 3SZMA 5JS8A 4J7UA 2WJ4A 1NJ6A 1ND5A 4Y9DA 3IGFA 3TQRA 4N49A 3UKDA 1H8HD 1VHWA 1E8MA 1YV9A 2VI5A 4MOWA 3N2NA 1XLUA 3K96A 4BP3A 3WJ1A 1P8JA 1NP6A 3UAYA 3WZMA 5ARBA 5L4LA 1ISIA 4G24A 1Q0LA 2GEJA 3FPHA 2CNDA 1IJBA 2EJCA 3ODGA 1GPDG 4Q66C 5D6NA 3MAGA 3H2KA 1TC2A 3HBAA 2W8BB 3KUDA 3TLCA 2WJPA 3W5HA 1IXSB 4NQZA 5KYXB 3F96A 4WX2B 2OXIA 1EZ1A 2FJUA 2YN0A 4JWKA 3B82A 1KDZA 3ZWVA 3HR7A 5AKZA 4Y9RA 3GVCA 4WZBB 4W9NC 1XDSA 3D2AA 2V45A 3VDMA 4AJLA 5BT8A 5DBOA 3WAGA 4M38A 4ZIRA 1IYZA 4GM4A 4ZT2A 1D3AA 2VUIB 3A4LA 3DOUA 1M73E 2Q46A 3WGUA 3BTVA 3PQFA 3U3KA 3K70C 4JI4B 4LJRA 1NY5A 1XHEA 1KGSA 5IDQA 3R0JA 3B78A 2HWYA 1ENOA 1DVRA 3FCXA 5C7YA 4HHEA 3D3WB 4ASUD 2I2BA 4MKRA 1KDVA 2GA9A 1ZNXA 3CVWA 1ENYA 1BXGB 2BKLA 3E8SA 5AHRA 5J2TB 1ZUWA 4YGXB 2WJ6A 4O4IA 5DLEA 2HDHA 3LHIA 1XYVA 5EJ8A 1SIUA 4ALLA 1U1DA 3UAOA 3OOWA 4N5IX 1V7ZA 3UMJA 5ITWA 3KDPA 2QX9A 4OFWA 1XTJA 4JJEA 1JSZA 2RCYA 3DV9A 3OZGA 2DQZA 2EYQA 3KHSA 4NG5A 3TLGA 3KAPA 3WGVA 3HB0A 4JJGA 4N0QA 1GA6A 1Q17A 2O6HA 4IIHA 3SIRA 1FLNA 5EL0A 1RLJA 3S2ZA 4MGYR 3O75A 1J9EA 2HK9A 1JHDA 3U3OA 1RI1A 1MRSA 2R6R1 3CWZA 3GEGA 3I9KA 3PT9A 5C31A 3ZDAA 2O8FA 4FYHA 3W7VA 4K40A 2LCIA 5JCJD 3EF0A 1O77A 2A14A 3EWAA 3OG9A 4FEEA 4WK2B 3NGXA 4I4NA 4P86A 4YMIA 1S4MA 3P97A 4J7CA 4WNCA 5KYYB 1GZDA 1OLXB 2C1EA 2K5UA 4HB0A 1MEOA 3CZQA 4NMHA 5JZOA 3AF6A 2H1LA 3FZEA 4D8TA 4B3DA 2BFCB 2GVZC 1N2CE 1X77A 2JFFA 2Q0HA 3D6UA 1M1YB 1XR3A 2EYUA 3MTDA 3GOQA 1ZGGA 2NUAA 4BYMA 1ZGJA 3D54D 4RELA 4CQLA 3Q7SA 2VXOA 4INAA 1I4OA 5HBGA 3HKBB 2E6KA 3GLTA 3DNPA 4LVCA 2BTOA 4OQMA 5DX0A 2GCGA 5TARA 2Y1FA 4R69A 4Y6RA 2AZXA 4OGFA 4R2JA 4E15A 2EFGA 2PCLA 1E18A 4HVTA 3OFVA 3L79A 2IOQA 2NU9B 4C08A 5K3BA 3Q5GA 2P8JA 4ZQEA 3QOXA 5FO0A 2BFEA 1JG7A 5ADUS 4YV2A 1JAXA 1TGVA 1Y1SA 3FR7A 3GN2A 3CSUA 5EHIA 2FPWA 2J9RA 3X1DA 2ZI6A 2AK2A 5DNDA 3B1XA 4YV0A 2CF5A 1G3MA 2O20A 3KR0A 3EN0A 3KL2A 4OM7A 2B4RO 4PXYA 5TMDA 4I50F 2VSNA 2FN3A 1M6WA 4GXQA 4LJLA 1BXKA 3T7AA 3OJXA 4QDTA 1B42A 2PLRA 3EDCA 2H9AA 2FPXA 5CX1B 2Q7DA 3HC7A 8ABPA 1T8RA 5EMNA 3GA7A 2RK4A 4JMLA 2FMFA 4M1SA 3ERCA 3KLMX 1MEJA 1DKMA 1JPJA 1L7OA 1D5CA 5DW0A 3TSZA 4QSMA 4UFPA 3VA7A 3UMGA 1FMJA 4JXKA 1OLUB 2FPIB 2V6GA 4EUNA 3KQYA 4CCSA 4I1YA 2OQVA 4KSYA 1SELA 1LXCA 4CI0B 2YXPX 2VHUA 3MJTA 4JC4A 4UNNA 5DHUA 3DTVD 2DHQA 5DM60 2VKTA 2AV6A 1A2KC 2AI3A 2FETA 3M3DA 5HIIA 4D4MA 1P2VA 2VDKB 2WFZA 3ET4A 1UXKA 3GUUA 1T35A 3FWNA 1EDDA 1SQ5A 2FR8A 2HXSA 2PU5A 3ONDA 2AC4A 2VDJA 3GCGA 3R3HA 4B5KA 5FULA 1CEEA 1KY4A 1UKYA 2I6UA 3HWWA 1IUKA 4EA8A 2R60A 3M83A 1FXWA 2H18A 2HHJA 1LPSA 3IUNA 3KKEA 3OIUA 5F76A 4Z1MA 1FVFA 3K72B 1U2PA 4XQCA 1U8CB 3COSA 3FZYA 3LZ6A 2ZQ5A 1RBMA 5CDFA 3K0KA 4G1UC 3TLXA 2QP4A 3SMVA 2P6RA 2NZXA 3H99A 1SBZA 3WMXA 3RHFA 1TE2A 2Y1GA 3VI3B 1EXVA 2HN9A 3T95A 3MSXA 1A2OA 1UAGA 3OIFA 3HCRA 4FS8A 1J2YA 2HPHA 4S1PA 5D6OA 2PRZA 3BE4A 4H1TA 2IH4A 2ZG6A 3MB8A 1WVMA 4Q03A 3EMVA 4IVRA 5JWOA 5K7SA 3GRPA 3DEHA 4BGUA 3RFFA 3EBLA 3OJWA 3GNQA 4LV6A 2XGMA 4YRPA 4GOJA 1S2IA 4KR6A 4PNPA 1H9BA 1ICIA 4DUGA 2YJTD 2ODTX 2P9QA 1EFHA 3SZOA 5AM3A 1WBBA 3HCFA 4P54A 4W99A 3H5AA 3LH5A 1XLTC 1P1FA 4GGOA 5E6RB 3Q3CA 5TT0A 4DPLA 4ENUA 5FFMA 1G5FA 2GMWA 1QHIA 2FUCA 4HQOA 4NBTA 5JCZA 3WDKA 5L3QA 3GLHB 5JNUA 5J2UB 3QXJA 5AIAA 5K3AA 4BCCA 2B37A 2O3QA 1O5TA 3L1JA 3NDPA 4ACAA 4EG6A 4E12A 3ZVNA 2AKYA 2XYGA 2OO5A 5IM5A 2V3CC 4MYUA 1R88A 4QQ8A 3RTCA 5B2EA 1E79D 1DKQA 2AA3A 3VSBA 1Z5NA 4EY5A 1YS9A 1BC5A 2AG8A 2G9ZA 4GMGA 3JD4A 5K3DA 1ZH4A 3TX2A 2O3JA 3S5JA 3EOZA 2LGJA 4A26A 2FN7A 3LT5A 1IMOA 1TFRA 2IPLA 3CZRA 1IM5A 2OUKA 3OLYA 4DGSA 1PS0A 1I1QB 2A57A 3LPCA 4UUOA 5CA1F 9LDTA 1QO0D 2VJDA 3QJYA 3DDOA 3IT3A 4UQOA 3P0RA 4E22A 5HKKD 5B4TA 4MVJG 1XA4A 5HIKA 4PV7A 4PYLA 4JI0B 1NMYA 3NVMB 2OFFA 4UBNA 1F6WA 1D2HA 1TTTA 2ZYRA 1D6NA 4JBNA 3TZQA 3THYB 2EKLA 1J39A 3PC8C 4MYHA 2OCLA 3ZW7A 3DVLA 4OFBA 3TW6A 3HBJA 1QC5B 3C3JA 2NU7B 4DXAA 3R6GA 3DMFA 2P9FA 5JDIA 2CUKA 2X5JO 3PUWA 5JXIA 1ANKA 3D4PA 4B81A 3BMNA 4RNCA 2P6UA 1JX6A 1XQYA 2YFHA 2Q9BA 2Q3DA 2BOVA 3C1AA 3MMSA 1D1TA 3AR9A 1RWNA 1GADO 5LXTB 2HLHA 1VSQA 4AZVA 4GKKB 1I4DD 2QNIA 1H1DA 1DKUA 3C2QA 4N0EA 5DXJA 1MIHA 2HIHA 2GRUA 4RIIA 2VK2A 4U9HS 4XA8A 2ZR7A 4LE2A 1B6SA 3A7EA 1VCIA 5PGMA 5JWRA 1HR0B 3QKTA 3QWIA 4KYUA 4R3NA 5K01A 2CKMA 3X43A 3ZCXA 2AXEA 5TPZA 4TWRA 2H9YA 4F60A 1PS9A 2JI9A 2XWJI 3B1FA 2OENG 1QS0B 4RJIA 3LMKA 3QV1A 3ZNOA 3ZQ6A 2R6JA 3Q7PA 1AIPA 1GNPA 4YCLA 3RH0A 2CKDA 5IDVA 4DGQA 3JQCA 4YMSA 1VSBA 2IS1A 5GAJA 2IE8A 1Z82A 2ODWA 4AKEA 1UEJA 3BZWA 4W5TA 3ILHA 4EFLA 3ZWYA 5BMVA 2HF2A 1LQ2A 3HSSA 3QA3E 2I34A 1WMAA 3CNOA 4UBJA 4OLHA 3RODA 4LXUA 5JSZB 3KSBC 4DR2B 4CKWB 2RGYA 3WLSA 3KZKA 2GRAA 2JIMA 4M7WA 3ZS9A 1KC1A 5HOQA 2XRMA 3OOSA 3GLGA 1N6OA 4C78A 5DLDA 1QCYA 3HA2A 3V7FA 1OXSC 2YBDA 1WSBA 5JJKA 1Q14A 4LE1A 4BNGA 4U2FA 3AONB 1T0PA 5CHEA 5E1OA 3KOMA 3FUWA 1GTL1 3T7TA 1Q6YA 3RRXA 3I92A 5A4DA 3Q72A 4FDLA 2JPDA 3EMDA 5IAEA 1OKKD 4JOSA 3WLKX 1SUCA 3N05A 1XSEA 2AFIA 2X5XA 1AXEA 1TM4E 1DJLA 1JKJB 1WBJB 2QQ5A 3OEHD 3OURA 2FFJA 3G0BA 4CNQA 4PQYA 4CNBA 1ZR2A 3L7NA 4D0RA 3R6LA 2HDOA 2G9VA 2NVUB 5FPYA 2PKEA 5EIFA 3GV0A 4Q9LA 3C4JA 1RZRA 5DYWA 1CJMA 1MAHA 4P0QB 3AI7A 3U7HB 1FFAA 4MGEA 3QLEA 2QJWA 3F3KA 2V5AA 3GEDA 3KSUA 3M9XA 1JF8A 1LA2A 2XCUA 3H9CA 3N2IA 4TRNA 2AJCA 2TSYB 3MJHA 3O92A 3ITEA 1P72A 1TF5A 2HLPA 2ZIVB 1SBHA 5DBFA 421PA 3K6SA 4L0MA 5DTIA 4RF2A 4R1OA 2NSHA 1X7ZB 4D2IA 1L7EA 1QKIA 4PHTA 3G2LA 3NBFA 2F9FA 3R6TA 4OYRA 4V1CI 2WA1A 3HKDA 4MHOA 4UQLA 3E48A 2YTZA 4C2AA 3S81A 4H3SA 5LNK1 5EKSA 2GEDA 2EOAA 2O2JA 3CLRD 4REOA 4KPYA 3O0DA 3Q2OA 5DSZA 4GNRA 2JA2A 4LYDA 2J9FA 4HNUA 2B83A 3TDNA 1YOVA 1ECGA 2MCFA 5ELXA 1JBQA 1NT2A 3I73A 4LYAA 5C5DA 3DAOA 1YDEA 3JYOA 4XDHA 3RANA 1QPBA 4PW0A 1QG2A 1QTIA 5DCUA 1ONOA 5JATA 2AXPA 1MC1A 4TMVA 3KFXA 1WXIA 1D2GA 5CPFA 5L7TA 5EHNA 3O82A 2XDYA 3N75A 2O8BB 4AQYB 2NQ8A 5BT9A 1YDGA 2DBRA 1GTJ1 2ET6A 1R1DA 3MTEA 1PZHA 4HTFB 1VC2A 4XYGA 1DC5A 2QT1A 4DZRA 3P9CA 2P9JA 2QV7A 2CN1A 3OP1A 4AG3A 2WWGA 1RM0A 1RWBA 2XVAA 3BCHA 4ZAXA 2F3RA 4MCAA 2ZYSA 3R8XA 5FEUA 2WIKA 2AS0A 1CZHA 1NMQA 1E99A 2W93A 2X4DA 4IV0A 2A0KA 2H2IA 2YQ5A 1XHFA 3V9PA 1AN0A 4BE9A 2BONA 2RGRA 3N1UA 2NSDA 3QXCA 3DLTA 4Y6OA 3NV9A 2RJOA 4ZQHA 1U7OA 4CQJA 4U2KA 1JDVA 4KK3A 2NSLA 1GSAA 2R6CA 3F47A 3UN1A 1SKYB 4XPIB 5BYAA 2UZ3A 3QVSA 1TK9A 1WNFA 3AR7A 3NIWA 2X58A 3EXFB 2QUBA 2NVOA 3K0HA 2GARA 3EQZA 5JNVA 1CUYA 2BMVA 2Q29A 4UUPA 1SJ9A 5IBCA 3K1ZA 3DEAA 1TTQB 4PQGA 1AQJA 2YCBA 4FK8A 3IKMB 4FLEA 4MW1A 2WD7A 4A8JB 5BN4A 3SBOA 1YE5A 2DWUA 1ZMXA 1G4AE 1L3CA 2MIIA 4J1TA 3WK8A 5LQNA 2OBXA 3KJGA 2C5GA 2RD2A 4BJ3A 3DKVA 4FMBB 3I52A 1WEHA 4O2BB 1ZGZA 4QGBA 4EG3A 3ZIUA 3OWXA 1G8AA 1U5BA 4ZGWA 3FDXA 1GYQA 4QOGA 1BS9A 2IUYA 3GJYA 4NZMA 4KU4A 4BO3A 2P77A 4DN6A 6ADHA 2HX1A 4L3VA 4NE7A 4UMVA 2JFZA 721PA 4JAVC 2H07A 4XUDA 3K7EA 1DHTA 4EGFA 1KDTA 4FC7A 4NXNB 3D64A 5KJ1A 4WJZA 4E3WA 5LP6F 5E9WA 1UMDB 1WSWA 4IYJA 1DQSA 2D74A 2VJCA 2JH8A 4Q4JA 1OI3A 2BH9A 4QTUB 5AW2A 5BV1A 4KJXA 2VDVE 3I28A 4LQDA 1RKXA 5CIQA 1NJ5A 3O21A 2NAPA 3UMYA 3K8OE 1DG3A 1FSGA 2B92A 2ZVQX 3JSAA 1M7GA 2CLIB 2WEKA 3VDQA 3W5IA 3IUPA 2QM0A 5LBIA 5BN3A 5JQGB 1T9HA 4M9RA 1R4MB 4R7TA 2ZRIA 1NQWA 3C8DA 1QIFA 3QHAA 1KI4A 4AMZA 1EWYA 2JF0A 3Q7QA 4CMJA 3WGHA 4CEJA 3T94A 1ZEJA 2Q1UA 2AFHB 4AK9A 2H85A 1E0JA 3EEYA 2P5UA 2C5BA 3LGSA 4MVJM 4E5NA 1DRKA 5J63A 1UBSB 3ZH2A 3UCEA 2X8LA 1VKJA 1LSJA 5BWCA 3W3AH 4FGLA 4RIHA 3LCVB 3IAFA 1ZAYA 2HA4A 2ZWIA 1ABFA 2LV8A 2Q1TA 1SVNA 3IBCA 3U49A 4FD2A 1O58A 2BGLA 2C88A 3K4PA 4YRRA 3VR6D 3V7YA 3W5VA 1VIDA 3T1TA 1M5RA 2PV0A 2YXLA 1TUBB 3OIDA 2HJVA 1M7HA 3IQFA 4RXTA 3PC2A 2OG1A 3W90A 1E3JA 4EHFA 1V95A 2WW8A 3AETB 2WSIA 1NJ8A 4GHWA 2ZRDA 3V42A 1MJFA 4TLCA 5LDDC 3KJXA 4BFCA 4WNAA 4PAWA 2GHTA 2HSJA 1T5LA 1DLIA 2I76A 4C76A 4DMFA 3L8FA 5FUQA 2G82A 1Z2EA 3ET5A 2F43A 4KN6A 2X6TA 4GPD1 1J6UA 4GKAA 4IUDS 2WZDA 2M2IA 1CR2A 1UP4A 1M83A 2V6BA 5KOYA 4N7BA 2IBTA 1PS8A 4IHJB 2O7VA 3GUHA 3ZU3A 3AO0B 2ZPAA 4UMFA 1DELA 1BE0A 1E64A 1VHJA 3BFVA 2PYZA 4R9UC 1RQPA 3QU9A 4AF6A 2IYNA 2P62A 1UMKA 5EJIA 3TXAA 3GT4A 3ZXYA 4DQKA 1MH1A 2GZ1A 1K27A 2W2MA 4FFPA 5CBKA 4UUBA 3N2KA 3DYVA 3HU1A 4FVTA 2XHEA 4UJ5A 5DTJA 1ZZEA 1KP2A 3VR4H 5KVCA 4C43A 5A9SB 1QQAA 4OL0A 2ZULA 1C41A 3PRYA 5KCMA 5BNTA 1O5IA 2MSEB 1O7JA 3PI7A 2GT1A 4JVNA 3WLQA 1MOZA 2YDYA 1Q3KA 4DR5B 2CLFB 1NXTA 2VYNA 3OEYA 3LNTA 4HS4A 2VTEA 1M0SA 3AOEC 1DNPA 1H6AA 3B38A 4JVOA 4BJ1A 1RPZA 1SZCA 1L4NA 5JMOA 4Y67A 4RSGA 3DOEA 5FA6A 2H52A 4IG9A 1PD1A 5B3AA 3IIMA 3TZKA 3SQLA 2AR0A 5EZYF 4CG0A 1T4CA 4Z4EA 3R7WB 1U98A 3FUTA 2ODAA 4U7PB 1W5AA 3CNBA 4OQEA 3SI7A 3CUKA 1RXUA 4ARZA 1GNQA 3VNVA 3BUSA 3LPLA 4IQ8A 4K6GA 1ZRNA 5ER6A 1HXHA 3TIFA 2FGJA 1U7XA 1SXJB 5ELMA 4BZXA 4PVDA 5H9WA 4F46A 5HF6A 3IT1A 1RAEA 3O03A 2OZPA 1BO6A 4RWZA 4DF3A 5K5EA 2YXEA 4RPGA 2NV0A 5C5IA 4UVGA 1CG6A 2AH5A 5B1DA 4C7BA 1L5HB 4DEXA 2QX6A 3QE3A 4U0JA 1KI2A 3KEOA 3TECE 3BGDA 3VQTA 4LK2A 2PUJA 4K9DA 3U80A 4HWKA 4LZOA 1QRSA 3V4FA 4AZTA 3R1IA 4TLAA 4GM1A 2QK4A 2QYSA 5EXXA 5HFAA 1O4WA 3U0BA 5FJIA 2XWPA 3OQOA 1Y9EA 4C3OB 4E46A 4ER3A 1L8XA 5DEOA 3B3GA 4KN9S 2H00A 4IM7A 1EUYA 1ZOOA 1YJ5A 1JA0A 1K8XB 4CM8A 5KJ6A 2BRUA 1AKYA 5I3ZA 2W6QA 5A4MS 4NZZA 1UCFA 2GWRA 5EG5A 4ARIA 3RVJA 3DTTA 3W4JA 2AC2A 3VDRA 2OG2A 3QKRA 3PZBA 4CM9A 2CJXA 2HAEA 2CHEA 5TLSA 1N0VC 4MS4A 2QTNA 1E61A 1ST3A 3GVXA 4QUKA 3BL8A 4RZ3A 1KDPA 3VU9A 4KO2S 4K26A 4RUKA 1B15A 2VHWA 1ODJA 3Q40A 1W75A 4J7AA 2GDJA 1WMBA 3FA2A 3OZSA 4S1OA 2IZZA 2NZ2A 5EPOA 2JLVA 1R3DA 4RGQA 3MFQA 3OI7A 1TC1A 2PX2A 1H23A 1ACJA 1LUAA 3AF4A 1BROA 4QOEA 2I2WA 4RBNA 3THRA 2HMWA 2QPAA 2ZJ8A 1X7WA 1R37A 2PX0A 5JD3A 3UCXA 3AHGA 4ZPXA 4DQUA 3DT9A 4B4OA 1E2GA 2VQFB 1YDFA 2B0JA 4I36A 1ZK0A 3OO0A 3SP1A 4QAJA 3HK2A 4JD5A 3LX8A 4FZJA 4BE4A 3A1SA 4INZA 5EP4A 3DH0A 4JYCA 4AJEA 1VJTA 5JSFA 2A67A 3GEIA 4YRKA 2SKEA 2FVXA 3NQ41 3MSCA 4NX2A 2YFYA 3O95A 4BBZA 3CUYA 2EKQA 4NZYA 1P19A 2PZMA 3BXOA 4J6EA 4NHEA 4A8TA 5ALHA 3WWOA 4DMKA 5BOSA 2O8CA 2A8YA 1SULA 5HK9A 4UE3S 1Y8RA 3UUFA 1RVDA 2BP7A 3ZG6A 1C9NA 5K0JA 3PWTA 2M6KA 1NY6A 3WLAA 3BDAA 1NU6A 2OP1A 5LU9A 2WNHA 2PL9A 4CEIA 1HZZA 4OATA 3ZE7A 3U5ZB 1AGRA 2PGNA 3TQHA 2QG4A 1QYCA 4Z51A 2WSYB 1XQXA 1RQXA 4NJOA 3AKZA 3RBXA 1QFYA 4NCIA 1ISFA 3FYUA 3BIOA 2OHHA 1YQ9A 4L0CA 1G63A 2H5IA 3CPEA 1DMRA 3A6LA 3DGEC 4C0AC 2FHPA 4C0WA 4YT2A 3N5KA 4PO1A 4TMTA 2HJWA 1VJCA 1DLJA 4ISBA 2MSCB 1SC1A 4GH5A 3QBJA 4JI6B 3FOFC 4JUBA 1W5EA 3OBBA 4YALA 5F52A 3DZGA 4HGZA 1L9KA 4DSZA 1D6MA 3E15A 2WHPA 2HBZA 3T12A 1E9EA 1NNLA 1QGUA 4KQCA 5H5JA 2FPPA 4BO9A 2BZ0A 2F55A 1YVDA 2PKQP 4L76A 2Q0XA 2WMOB 1Q92A 4PFQA 5DGIA 4ZYLA 2NTYC 3U39A 4L8VA 4D9IA 3JATB 1M34A 2YC2C 2ZAGA 3TL3A 3PPIA 4BB6A 4BQIA 1DV1A 3M4ZA 4LRQA 3LT1A 4P3OA 1AGXA 2ZTUA 1CQXA 4X00A 3ABIA 3W6ZA 3ZWPA 4ZQBA 3Q7EA 4KXLA 2GK7A 3EQ8A 4KPGA 5GV8A 3GAZA 1CTQA 3HV0A 1POXA 1DXQA 5K0GA 4US0R 1MG5A 1FP6A 2JI8A 1F6DA 4R0MA 2B1GA 5BUCA 3GRFA 4EJ0A 5ETJA 6GPBA 1CY8A 1CUXA 2WABA 2NYAA 3S70A 4DV3B 3FWYA 4DLKA 3E9RA 4IDGA 4YP7A 1WB6A 2RHRA 5AVUA 3I83A 2OAQ1 1NDQA 3JTMA 1K1EA 2FN9A 5E9QA 5B64A 1V8DA 1E2FA 3FNBA 1ZVMA 3TKAA 3V4RA 4NCJA 4JSRA 2YNMC 1ZK3A 1DZ3A 2XCOA 2YWXA 5K8TA 3O4RA 5KX5F 4RVDA 2JB9A 1N6KA 2Q5LA 3IJEB 3NP9A 1XPJA 4JLNA 3S1LA 4CETA 2AMJA 1SD1A 1E0DA 2GLTA 4NY1A 3FRIA 4RZSA 4A0GA 4BB0A 4L1KA 3HADA 5C3UA 3DFFA 1WETA 4CKCB 4XAQA 1BEEA 3T15A 5CD9A 3KJEA 4S35A 1JDPA 2G04A 5KOJA 4ND5A 1Y9DA 4UFNA 3BSSA 3VSEA 5TF0A 3R7BA 4LYEA 1EK0A 3LWZA 1Y5LA 1ESEA 3CPJB 1SCAA 1JKIA 4I50B 3RU7A 4PC3A 2ZSHA 1A0OA 2DU8A 2TMDA 1RQ2A 4JVLA 1ZM3A 4RTNA 1CZLA 1BA2A 3HSKA 3KEQA 3OZDA 3PYXA 1M2WA 1ZUIA 3W4IA 4XKJA 2RGCA 3W4KA 2PA3A 3EH1A 1EDOA 5F2OA 3D0KA 3O2SB 3S8YA 2WWYA 2H2DA 2I1WA 1RXIA 3BIWA 3DJYA 1KAMA 3OTQA 4P4SB 1TTPB 1U5AA 3GRUA 3ML1A 2D0DA 2EJUA 4L5BA 4HYYA 3LXXA 3OX3A 1GL9B 2PANA 4RD0A 2DWQA 3DHNA 1F3LA 3RSLA 5KKNB 2LPMA 3T54A 1PO7A 5KWIA 2NG1A 3KBOA 4LPSA 4G09A 1Q3TA 2RKBA 2R2AA 4AJPA 2W2PA 4J4BA 4JLAA 3OZEA 5TC4A 4YAOA 4D8VA 3Q6MA 4D8UA 5IEBA 2H9IA 2YZKA 2EATA 5ALLA 3WMFA 4E2FA 1S8NA 2P2CA 1I32A 3TSOA 1EU1A 1H1LA 2R8OA 3I9LA 4OCZA 5KEIA 5LLDA 1L4YA 2QSZA 4DM4A 4WK0B 4DNQA 4EMUA 3PGJA 3A9CA 2Q8QA 2JKZA 5F12A 2OYRA 1LRJA 1N9GB 1KYVA 1V2HE 2YIDA 4JLSA 5F1PA 5JPIA 4GGMX 2O8EA 5EJ5A 1TCVA 3NIBA 2WQ7A 2R00C 1JA9A 4ZYUA 3ER9A 4PNZA 2XNJA 1GZ6A 2ZITA 3HLYA 1YZNA 5AXBA 4EWLA 1IY2A 1WXQA 3B2NA 2W4QA 3F2IA 3DZJA 4KK4A 5D01A 2HOQA 1UPTA 3FMFA 4G4GA 4JI7B 3C45A 2AOWA 2G4LA 2I1LA 7YASA 1A8QA 2J0UB 3VC3A 5JNRA 1U28C 4OXIA 2X9QA 1JAZA 2QAGA 4HN4B 4MUAA 4GKVA 1GUAA 3LWNA 1PR3A 5G40A 1UODA 1M2NA 5F77A 4AJNA 3ZZ1A 3DAFA 3ZV4A 3HJBA 2MWMA 1HYBA 4MUGA 1H42A 1W73A 4QUEA 2QN6A 1FUUA 4OJTA 4B4UA 1F1BA 3E27A 2WFLA 3QNMA 4OYLA 1B16A 4MAMA 2ZJBA 4JJ6A 4KOAA 4QXRA 4MVCA 1DXHA 3EGVA 4LXGA 3GEPA 3SQXA 2GS9A 1VRCA 2FKAA 1HQKA 3ORQA 2QHXA 1KK1A 4HMPA 3U3JA 2GD2A 2VLIA 1C7RA 3O2QB 3B5EA 1F51E 3U0VA 2AN4A 4PPFA 4OSPA 2PZFA 4BNNA 2G88A 1GG5A 3G5LA 4IO1A 3WWEA 3JYLA 2ZRHA 1CWUA 3HWSA 3FTEA 3TNLA 3MNFA 3ULKA 3HDTA 3IKTA 2A33A 1YIDA 1YFJA 1XPUA 3BRSA 2Y2VA 1HTBA 1I2ZA 3OQPA 4FLFA 3D0QA 2JEYA 1VMIA 1LX6A 1FYFA 1I1OA 1HDIA 1MFPA 3KOWA 3QF4B 1NFFA 3EDMA 2ZRNA 4IJ6A 3QQPA 2G0AA 1GPBA 1NV9A 1RWOA 3GAAA 4GOOD 2JA1A 2AF3C 3AYZB 3D4OA 2IYPA 1YA4A 4Q12A 4MW0A 5CA1B 5IT0A 1AV7A 1J1UA 2XKBA 1L7NA 3DB2A 3FBWA 3R4VA 4QTXA 3T5DA 1W36D 2R86A 1UKCA 2V7GA 4NYIQ 3NLLA 3PNQA 2H1FA 4FT2A 1CVLA 3P0EA 4CDMA 4G41A 4EO7A 4FR2A 5EC8A 5F7OA 1G42A 1TA9A 3LBNA 3PUKA 4J4HA 1U81A 3STHA 3GFOA 4ENQA 5HKAA 2GZSA 1KI7A 1P6UA 3DE6X 3BOSA 3DAGA 4R16A 1OSNA 3BIFA 5DFAA 1BQ4A 5LYJA 1TT7A 1FDRA 1XWWA 1YMUA 3PC7A 5IEJA 4IIFA 3SE0A 2AMFA 4KHPB 3LC2O 4HX5A 5JLJA 3EIHA 3UOWA 2BHRA 2QTAA 1QSGA 1UOQA 3NWBA 5DCWA 4LNAA 4B6SA 5JRDS 4MMXB 3QVKA 4YT8A 3I8XA 3HPRA 4NCBA 1I4WA 1QHSA 4TV8F 1W35A 1F0YA 1VGQA 1SBIA 3UBMA 3WK6A 2R96A 5D86A 4A5SA 1ZAKA 1PNOA 3DLHA 1DIGA 1RKUA 4HLQB 4BNIA 5J4VA 3RV4A 2BGJA 3EF1A 3WQSB 2WYHA 3ONVA 2C7GA 1FMLA 1RABA 4P35A 1A9SA 4C21A 3NWEA 2GCOB 3ZY5A 1XPOA 2Y1CA 4YJ2F 1B00A 3H2IA 1F5SA 1KYQA 1KYTA 1FK8A 1MZPA 5A03A 1T3GA 2P4HX 3RU9A 5REQA 1EIWA 3TLAA 3CSDA 4UCWA 1YZFA 2YYSA 3DR3A 6REQB 3IMKA 1JGTA 4ZRDA 5J3JA 3WYAA 1E8NA 2JLUA 1KTVA 3CW9A 1FMCA 3UTCA 5C7IO 5I7WA 2IW3A 4W1RA 5KCZA 1F9EA 2A4MA 1YB1A 1WB9A 2A88A 2WWHA 4PX2A 4NECA 4AULA 1ILEA 3SHFA 2YICA 3R7AA 4ZWNA 3KWLA 1P0CA 4AB1A 9ABPA 4OLFA 1DB3A 2GKGA 4PHGA 1XMPA 2VF7A 3EPPA 1XKLA 5AM1A 1UBUS 1MJGM 1XEWY 3DDUA 3SC2A 5JNTA 4QUAA 3UXHA 5EJ6A 2IXBA 1CCWA 2XMZA 2H1VA 1OFUX 2HA2A 3SBXA 3CEJA 4WCVA 4XCQA 1TCCA 1UPCA 1CQIB 3VX4A 1YK0A 4JIGA 1MO2A 1UH5A 2UZ0A 2JBAB 3QX7A 3BB3A 1RWXA 1MJNA 3KELA 5EMHA 1J2EA 4M9UA 1U94A 4MGKR 3ZLTA 4ZJUA 1QLWA 2CDCA 1HDXA 2EDAA 4A23A 1M5UA 1N3BA 3AB3A 4WGGA 4DHEA 1M72A 4HDAA 4LF4B 2JFPA 4ZEMA 1JFVA 1T0IA 3C3XA 3E7PA 3NRBA 2X3YA 5L7YA 3ZVLA 1WLSA 4M0KA 1G8GA 2Y4NA 2LCQA 1Z35A 1QX3A 1KEUA 4NE9A 4CMGA 4CL0A 3ZW9A 1XLWA 4Q3CA 4LISA 2IHYA 3KXLA 2UVPB 3EA0A 1DMSA 5JDCC 3A4IA 4XD7D 3KCNA 3W5JA 5FI5A 3IUJA 5LQKA 1PVVA 4C1BA 4E7OA 3OE7D 1VFPA 4XM1A 4EKEA 3ENKA 1ZC4A 2ZXFA 2HGZA 3PNVA 3T7KA 3JU3A 4JQZA 4G23A 2WB4A 5DF1A 1HX7A 2RH4A 1CYDA 4IGEA 3RVNA 3C98A 3FYDA 4DJDC 1ID8A 2ANBA 1E2DA 1H6CA 1QO9A 3WNBA 2Y0DA 3PUIA 4W5OA 5JMPA 4JC5A 1B0ZA 3LHSA 3FX2A 2V6JA 1MORA 1EAYA 1KQPA 1UBGA 4IR7A 1MABA 2QW8A 2X1LA 2ZS8A 3OE1A 3ZDRA 2PT6A 4AU1A 2E5LB 1SGWA 3GMIA 4TS4A 5SYAA 3TIXB 1XZLA 3GGGA 3G1TA 4DCUA 2WB2A 2FAXA 2WDPA 3H7AA 4GRAA 1O9HA 2PZLA 4G81A 4IV5A 3SZ3A 3PQ4A 4F4HA 2YY6A 2H4XA 2CFOA 3CBGA 1X2BA 4FU0A 1ZGHA 5EXPA 3ZDZB 4XGIA 4EPVA 2NNWB 4LDNA 4ON9A 4DV0B 1BD3A 1T8PA 1JR3E 1FOEB 2HSEA 2YZNA 3BRWA 3WKDA 3IV7A 1XMIA 2H06A 4KVZA 4XWKA 4BLVA 1O95A 2G5CA 3BWMA 3K1AB 4PZPA 2GVNA 4RFSA 1YONA 2ORIA 3GC6A 1R2QA 4A92A 1M2VB 4BL5A 3LPMA 2WWFA 3QMWA 4C0BA 1KPIA 1K7XB 3AZPA 1S9HA 2JHAA 2YVUA 2C57A 1NQUA 4IIJA 1G18A 1NMSA 3P2YA 5D2CA 3TWOA 4ND4A 1ESMA 1IHOA 2XIJA 2EZ9A 1Q50A 4E08A 1N5JA 1DV2A 2VRCD 4CN8A 4YV7A 3BJIC 1H2HA 2CCJA 2XMCA 1WVGA 3A25A 3EG9A 3HA3A 4KQMA 5H02A 3VU1A 5JOQA 4B3MB 1L5LA 3VI4B 1QYVA 1YF3A 4LMAA 1N1MA 4UM5A 3SMQA 1E1MA 1ZX1A 3HP4A 2BM8A 4EF5A 4GX1A 1MMFB 4OXRA 4CMEA 5AJUA 3NMUF 3T38A 4IDAA 2PMBA 4B2PA 2Z8YA 4O3FA 4OIMA 3TEFA 3IDQA 3KQUA 4DE5A 2BTEA 2BHTA 3PNOA 5KMGA 4QGHA 3HDJA 2ZJZA 1F0KA 1R8SA 2IT1A 3JV7A 1N4DA 2OK7A 4Q4HB 3H11A 2Q3EA 4BNUA 4R2MA 2LDXA 1LBSA 3SHTA 3WGIA 2X3FA 1CUBA 1VA4A 2PS1A 3GRZA 1QZXA 3A26A 3LYUA 3LSTA 2IQ5A 5F51A 3OX4A 4HWPA 3ZZ0A 4QZVA 3KQOA 1G41A 2PUAA 3RC9A 4RDCA 1YR2A 3K8QA 1IPEA 1Z0IA 4M1ZA 1V11B 3EY4A 3SBDA 4UKDA 1OJ7A 1VPTA 3A9RA 4MR9A 1KXZA 2J4DA 2I6XA 2OVBA 1BWSA 3OLQA 1B8PA 5LP6B 1GKLA 2E85A 3I30X 4Q7EA 2FSUA 5FRDA 2WZCA 1RJGA 3ZE1B 4HVCA 2VUSA 3H9QA 4WLOA 4BNJA 2E3JA 2OV1A 1E2KA 1QVAA 3G3EA 2PRKA 4MR8B 5CPBA 3KU4A 6AT1A 3D6HA 5AXCA 1KWGA 1FDSA 4UVDA 1UBFA 1GGNA 5G0TA 4HQNA 2EQBA 4BTLA 3O4JA 1HSZA 2XGJA 4LWQA 3NPMA 4B7AA 2XT6A 1T24A 1WE2A 2P0AA 3FAZA 1CS0B 2YXDA 4IIUA 3GK3A 3MA0A 1UZAA 4F3NA 5EZSA 1RRVA 3HJCA 2FR1A 1A8SA 1TCUA 2J4FA 3DFMA 5BYKA 1EFLA 4XSVA 3ZTYA 2W8BA 3I12A 2XZLA 1XZJA 3CJTA 2IVFA 2X5KO 2PSFA 1RAAA 1Y1TA 1HV8A 3C3CA 5KYXA 1CRWG 2MDTA 4I9UA 2DLCX 2VHXA 4HNTA 2BDEA 3L1KA 4PX9A 4L72A 3TL6A 4B33A 4CIAA 1V9SA 3JVUA 5ERGB 3OZVA 4CFZA 3JZIA 2V7WA 3T5CA 4INOA 4BX0A 1A82A 4ZHSA 1V7CA 4YUXA 3L0BA 3K20A 2XDAA 3B9BA 3OE4A 1V8FA 1UQRA 4OSOA 3UWSA 1YUNA 2YRFA 1GPWB 4H1UA 4C5AA 1I9CA 4BQRA 3AR8A 2WTAA 1WXWA 5AI5A 3QPCA 4WNIA 3UJHA 2QORA 4CLEA 1UZUA 2AI2A 2R8PA 4F45A 4FX5A 3EXG2 2VFAA 2BMAA 4N41A 3G8BA 3UOAB 5ILOA 3LUJA 1XD2B 5HIAA 2HMTA 3R3JA 1QK3A 3PHBE 2X0IA 2YHUA 1U4SA 3UK7A 2C42A 1O54A 5FTNA 2ZPUA 3UW3A 4AX8A 4B45A 1Q0TA 4L85A 3PXBA 5UKDA 1CETA 3UV7A 6CHYA 2DBZA 4XVCA 3V55A 2PXXA 1AM4D 4DV7B 1DJPA 2TMGA 3A6DA 3LUPA 1U6KA 4EJ2A 4LBWA 5H3LA 3VC2A 1L7QA 1UM8A 2E4WA 4CKEB 3U4QB 1I7DA 1J2RA 3A4YA 5KSWB 5CA0A 5C32A 1DWQA 3R23A 5TPWB 1QYWA 4R41A 1JJBA 1JVBA 1P5JA 1SC3A 1NQ5A 1XQ1A 4JFRA 4XJVA 5JAQA 4PGAA 2WHRA 4BLOA 4YO7A 3C4QA 2PT7A 4FFDA 2VSFA 4KH1A 1G20A 2G5PA 4KMSA 5DGDA 3V1YA 4AKTA 4D4LA 3GLRA 2BN4A 2B98A 2RARA 1D6JA 4YA6A 2IZ0A 1G8KA 3TTWA 5DTRA 3W79A 3Q3GE 4HFJA 2BJVA 2FU5C 3N70A 2RI1A 3B1YA 2B20A 3L0YA 1HGXA 1KYWA 4G1FA 1BE6A 2VSXA 3IP9A 5DASA 1OLXA 4U39A 4B6EA 2HMYB 5I4KA 3B7WA 3NTXA 3M33A 1H94A 2WAOA 4B9EA 1N8NA 4QDOA 2F00A 3LLUA 1GU1A 1H2FA 2VK8A 3PI6A 4CU2A 2BFCA 4J0QA 5G0SA 3P9SA 2HJSA 1M1YA 2W48A 1EFTA 3WMGA 3UWKA 2W98A 4N1AA 3O4GA 3UJ3X 1GQRA 2C78A 1FYDA 3B1ZA 1WXEA 3I4LA 2EBHX 2BMJA 5FXMA 1UM9B 3HKBA 3NWOA 4XEHA 4JQCA 2WTBA 1ZWKA 1XCGB 3WMRA 1FPMA 4LG1A 1ZJ6A 5B6PA 4GSLA 2BSQA 4GPZA 3HYNA 5B7QA 1U1CA 2R11A 3E53A 2PKCA 4ZJYA 3TGWA 3TIVA 2NU9A 2VDPB 3ICVA 4AZ0B 2H1SA 2QVZX 1MB9A 1QHHB 2DLDA 3GYBA 3P26A 3UUWA 5AD1A 4DIEA 2Z1MA 1JAHA 1RLOA 5E1MA 4EPWA 3IXLA 3IBYA 4PYJA 4CMIB 3RIYA 1C3VA 3I2GA 1IN1A 1K63A 5HQJA 1EFUA 4RVNA 3ZV3A 1M1UA 3Q41A 1Z74A 2ORVA 3SVZA 5LMUB 1HDOA 1FTWA 3BWYA 3U3ZA 5B2FA 2HF8A 4WFKA 3PQ3A 1ZVVA 3M1YA 3QRWA 1KR2A 3FOEC 3NRJA 1GAEO 5KVVA 2M6RA 2NVWA 1Z33A 1DQNA 1ZU5A 2GYUA 5CX1A 2OQIA 2W70A 4Q34A 4EHAA 3ZLJA 3HUTA 1IOVA 2BGTA 2D1SA 2BEVB 4V3CA 3ZIAD 4DANA 4AY2A 2VXBA 3BJZA 1QOQB 3D8RA 3EGXB 1EDBA 1K4MA 3MT9A 1KFKB 2FPRA 4QVGA 5F5LA 2BR3A 3PEFA 3A37A 2ZE5A 3UAZA 1PJ4A 1B23P 1RRCA 3WRVA 3U4IA 3LCUA 4H6WA 3V4PB 3ZZUA 5JH7F 2GJAA 2O2SA 5DI3A 5MFPA 1LQUA 3EXIB 1O6BA 4F93B 4CHTA 3MWLA 4IGIA 1GTVA 4WQMA 4EHIA 1YVUA 2CXUA 2P9EA 3IBGA 3VR3A 4BNWA 4DLWA 2PN1A 2Z3VA 3JQ8B 4FCWA 5FYDA 1JLLA 3NJ4A 5FO1A 4LZWA 1E7WA 4F06A 3GRCA 4BMYA 4YAWA 5LPNA 3R44A 5D3MA 1XAJA 4AROA 4K0RA 1CHNA 4O25A 1KZ9A 2HA0A 2Y0CA 3G9XA 4PR0A 3SIPA 1QHNA 5A3SA 2HC9A 5IULC 1UR5A 3QEAZ 1H4TA 3KSRA 2UU9B 2QPOA 1E3EA 3LXMA 1ODFA 3NWJA 1YIAA 1K9VF 1TA4A 2IX9A 1EFDN 5J9FA 4G5FA 1K4YA 1UBLS 2HA5A 3ZU4A 2AQHA 4TLDA 4FHDA 3TW0A 3OQNA 3IAS1 4JA0A 4FGZA 2RE8A 4G5OA 3AESB 4J07A 1KBOA 4RF4A 3UMRA 4AUKA 4QEKA 4DLNA 3G17A 4OXQA 2ZB3A 3P9NA 5AOVA 1Z73A 2ZU0C 3OWHA 2Z6UA 1I10A 1UBTS 2VYCA 1BU8A 1GGKA 2MMGA 2VWQA 4QDJA 4ETIA 2O23A 4KLRA 9GPBA 2XDQB 3NDJA 5IMBA 2G63A 2V97A 1L4HA 1RXWA 3N8KA 1ACLA 3UAWA 4KQJA 3RSOA 4RQBA 4WZ6A 1M0EA 4JI8B 4MLPA 3A0RB 5CVCA 2YWHA 4EBBA 1N0UA 4EPXA 4U7TB 5DHTA 3RS2A 3Q6NA 1FS5A 2ZJOA 4W7SA 4Z0TA 3RF6A 1NX9A 5A1TA 2ZBUA 4BWGA 5CLLA 2B4KA 2VDMB 3WDMA 4C7KA 3ZCUA 2GFHA 1V71A 5EP2A 5K0NA 3GYGA 3PNSA 5G1PA 2F1IA 1GNRA 3OD5A 3ORYA 3AJ8A 4WXPA 3TR5A 4BO0A 4YRAA 3C1TA 1V26A 4TVOA 4QBGB 5CMLA 1KMQA 3OZFA 3NBUA 1RM3A 2EWMA 3AMVA 3DDWA 4O3MA 1G5TA 4MP6A 1MTOA 2DCUA 1MW9X 1LY1A 2IYZA 1FDUA 2GN9A 2WWTA 5EJAA 1G8HA 2J30A 4GSKA 1HT2E 4XUGB 4DMGA 1JT9A 4ER0A 4J6FA 4BO4A 2PFSA 2KX7A 1ZM2A 4L5YA 1QBKC 3BCUA 4CGYA 1CZUA 1SOVA 3L18A 4MV3A 4RZ2A 1M6NA 1ISRA 1Y9ZA 2D4AA 4NEGA 3L6EA 4U7GA 5BUQA 3PGKA 5DOVA 1EESA 2B7CA 4K9SA 5GWXA 5LOVF 1OXXK 1XCPA 1X15A 4K8OA 1YRWA 4EG7A 3SYTA 4DAOA 2EC5A 3THYA 1LFAA 4OHOA 1UFRA 1X86B 1XXHE 4UZEA 4BQSA 4E5PA 1Z38A 4IQ4A 1NW7A 1WPRA 4LGCA 3Q9SA 3H5VA 9LDBA 4UTNA 3HFJA 1RHJA 2ORED 3AY6A 5I5GA 2NU7A 3VZPA 3HKEB 1FX0A 2QXTA 2DYKA 2EW1A 1GFZA 3DW1X 3ZWXA 2CGEA 3PNLA 5KYUB 1GPNA 2QLMA 3IO3A 1FP7A 1DJQA 5DGTA 2XB8A 4TT3D 2WJHA 1YL6A 5EUBA 3PSHA 3TOXA 3DVAB 4E6PA 2QWXA 4XDYA 2GN6A 1N4AA 4JOQA 5LXTA 3PG5A 4R05A 5BW6B 3RT7A 1JHXA 5FBKA 2HU7A 1E20A 5FOWA 4DQXA 1QKKA 3T5MA 1XQ6A 2R3SA 3GGDA 2JJMA 4FN5A 2F6RA 4IEIA 4F5YA 1FJXA 3MOGA 5LLSA 4B82A 3ENNA 5KX5B 2QPTA 3LGAA 1UQTA 4S1TA 4ZQFA 3ADDA 3K0FB 1HBJA 5IHPA 2XY4A 3MBIA 3M6VA 2J7PA 2XCSB 1O97D 5ECGC 3F4BA 1QIIA 1QFSA 1U2QA 4F96A 5I7SA 2ID7A 5CIYA 4ZV7A 3M0EA 2Q4EA 1S8AA 3QFTA 3V8MA 2X0NA 3W5AA 1QS0A 1SQGA 4GC9A 1Q7BA 3UM9A 5BW8A 2RDMA 2PYDA 2V7EA 3WIUA 3BXPA 1ZZGA 1YAJA 1AS0A 3GNTA 4OXXA 1SHTX 3DZKA 5E4FA 2O2XA 1CBUA 1NJFA 3CIOA 4QOJA 1U3VA 4UEOA 4V0NA 2JGNA 5G0UA 1L5NA 4AMUA 2DFVA 2CNKA 2VJQA 1MXFA 2X2PA 3JAKA 5KVQA 2EKZA 1ADBA 3GJ0A 4NBSA 4PINA 4Q47A 2E48A 1HYQA 1KU0A 4U9UA 1NXXA 5AVRA 1CUGA 2GEBA 4WOPA 2EWVA 5JSZA 3RK4A 2J6IA 5TQ0B 4WVFA 1VLMA 1WXDA 2G6BA 5CYPA 3W2TA 3WAKA 3T3HA 4CKWA 5T57A 4RVCA 2CBGA 1U7DA 3G5TA 4FFMA 4NU0A 2IP4A 5C18A 5IAOA 1WEKA 3KAQA 2VZLA 3Q9NA 3QU7A 4TRRA 4WK4B 4QYMA 3HFSA 4UHDA 3OZCA 3AI3A 3MILA 5FTJA 2VP3A 1B14A 3BTUA 1RKVA 5JCOC 3QVWA 3FLAA 1W36B 2OQRA 1I2MA 5IBQA 1KDYA 2IEDA 2ZI4A 4IS3A 5DM70 3L92A 1NUAA 4Q9NA 1JKJA 2DUMA 5DOZA 1ZSNA 5FTKA 3GJZA 1OX4B 2R8RA 4HPXB 4L8FA 2ZB2A 5ICFA 1MGOA 5A5VA 2NVUA 1KEEB 4PTZA 1G59A 3G82C 4B4KA 3TO5A 4JVSB 2OHVA 4I3GA 3U3XA 1OH8A 3UC5A 3VX3A 8AT1A 4FCCA 3GPCA 2BSAA 2C3MA 2WTNA 3RW9A 3FD8A 1M54A 3OVMA 3PQ7A 5DBHX 3EY9A 4PCUA 5EHGA 3RSZA 3T52A 2DSNA 1Y4UA 2R7KA 1GL3A 3P9RA 4MHSA 5TGZA 2I4NA 3OPNA 5FL3A 2FPSA 1X80B 3TN7A 4KV9A 4TYYA 2VHCA 1RR6A 1CW2B 1EJ2A 3K4HA 1EBFA 3OLZA 5DGHA 3UWPA 1JNXX 4BNDA 1CUVA 3ZWDA 4HLUC 1X7ZA 1NHGA 4IQFA 3CNEA 2DSTA 1ZLYA 4UM8B 3TVDA 3AFNA 5JBNA 2AUNA 4BS9A 1Z6ZA 3C1UA 1TVMA 4IVQA 3ZKWB 5HVNA 3HO8A 3DFIA 1QDLB 1XCJA 3C7DB 4WBNF 3S8EA 1SOAA 3RSSA 5TEVA 3ESDA 4RGVA 3LQ2A 2CVFA 2H0AA 1Z2AA 3EVBA 4N82A 5A0FA 5HCNA 1VL1A 3VC7A 4DY6A 2XZPA 4CV1A 3TI7A 4BB5A 3M6LA 1IATA 2GX6A 4S24A 3WBJA 2FUNB 1KVTA 2CMKA 2PXCA 1WUTA 1SUIA 1OBHA 2VJMB 3GCWA 3O7WA 4UBMA 4QPNA 2W2TA 1RPNA 5K4HA 3FLEA 2I3DA 5DXFA 1YI1A 4EPRA 2LR0A 3AR5A 3O91A 2XZOA 3HGTA 1F4LA 5HZMA 3AVWA 2GPWA 3DE3X 1DDOA 2H8GA 2BM0A 2R8ZA 1ZH2A 3BD8A 3NH6A 4IJMA 4J1SA 4YFYA 3DYIA 3QTLA 2AG1A 1PZFA 1K5DA 2V7QD 4IJVA 3U44A 1QR2A 2PMFA 3PGMA 4GP7A 4XYEA 2HV9A 3I1IA 2HADA 1N6NA 1Y37A 1NF8A 1SVUA 4IJKA 2X8JA 3FSGD 1PSZA 3QF7A 2Z5LA 4RS3A 4YAJA 5BXYA 4RMJA 4JS0A 3RBVA 4OLAA 4IDDA 1N2ZA 3LO8A 1H3EA 1YE8A 2QI9C 2XNKA 1G2OA 2B94A 3AEKB 3FIJA 3CKYA 5C81A 2GQ0A 3HB7A 3K9WA 4K8RB 1X6VA 2I6SA 4EQ6B 1TTHA 3P2OA 3NJRA 3E9CA 1IQRA 4D79A 2WG1A 3KG2A 1JT2A 1YH3A 3K15A 3QXSA 4OQLA 4XPIA 4ZOCA 4NAUA 4RWEA 5FWXB 3EXFA 3V1KA 2EFHB 3OSUA 4GPTA 4D92A 4MB0A 1XCMA 1L2TA 3H83A 3COWA 1N7GA 2CY0A 3FNFA 2ERCA 3OTWA 1P33A 4U2BA 5JT1A 1ULTA 4J3FA 1HT0A 4AP9A 4RTSA 3OLWA 4Q16A 4AWAA 4LFBB 1XVAA 5CK5A 3JZFA 3R6DA 1NUHA 4TV8B 3FJYA 2NTJA 1ECLA 3W5DA 5CU7A 4RY8A 4C4YA 4GXRA 1Z6XA 1SKMA 1BJTA 2HWKA 4MMZB 3QKUA 4O2BA 4Y7DA 2D0PB 1OUMA 3ORSA 5E1DA 2GN2A 3Q7TA 4M99A 1UQUA 2MINB 3G2OA 3UJAA 4B80A 4WLNA 4YJ2B 2Q2VA 2H5JA 4GKBA 1F7VA 3CSSA 1C1DB 1QM5A 2M6SA 4UATA 3TZ6A 2ZBGA 1PJLA 1UMDA 2O50A 3L9WA 4PIPA 1JH8A 2DLNA 4I4LA 3LC1O 4AUMA 1AQUA 3DBLA 1XWFA 1P74A 4MXDA 4M1WA 4Z4CA 5I4IA 4IOJA 3HDGA 4G9EA 4MQBA 4QG3A 2JCGA 4MVJA 4QVKA 5KB3A 1A5BB 3D31A 3ZXXA 4GG1A 5SZIA 3ZCTA 2A78A 3WBBA 4IJUA