1SCQA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetonecyanohydrin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 92
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1scqA00
2EDCA 2VT6A 3AIMA 1XZLA 3GA7A 4KAJA 1UFOA 1TQHA 3DOHA 3G8YA 3R41A 4ZREA 3Q0TA 1CUWA 5HFNA 3FAKA 2E3JA 2WJ3A 3W9BA 2HFKA 2VF2A 5E2IA 4CFSA 2PBLA 2G63A 2EDAA 2X5XA 5AI9A 3FNBA 5AM4A 4AXBA 4H35A 4FLMA 2AJDA 4UHBA 2O2IA 5HFAA 3H2KA 3LIPA 3C87A 4PSUA 4OB7A 1W52X 3NGMA 2WFZA 3NOXA 2JEYA 1A7UA 2HU7A 1G5FA 4BATA 5JAPA 3EF3A 4JUIA 1CR6A 3R0VA 1QFSA 3I2HA 1MNQA 3K9BA 4Y2JA 4BC0A 4JEIA 3P2MA 1HPLA 2WHRA 2XQIA 4F21A 1JI3A 2PSDA 2FUKA 4WFJA 3SWWA 2VQ6A 1LPNA 5CT4A 4ZWNA 2RHTA 2C4HA 4Y2QA 2GZRA 1EB8A 2CZQA 5AI4A 1TAHA 4RNCA 1VOTA 3BJRA 1XZCA 1WM1A 3F98A 4UHCA 2YASA 1FFEA 3BDIA 3I2FA 1DINA 3I2JA 1BROA 5AIBA 3O9VA 3FVTA 4TPKA 2XUHA 2ZJFA 4G8DA 5ALYA 4Q34A 4DMFA 4LYDA 4H7FA 4V2IA 5FXMA 3STTA 1XZEA 3E0XA 3W9UA 1UK8A 4B81A 4P9NA 1J06A 2JIDA 5HKAA 5T4BA 4G5XA 3BIWA 4C87A 3F9CA 3ZLTA 3NWOA 3VDXA 4JYMA 1VKHA 3VJMA 5DWDA 2FX5A 3ZV7A 4J0HA 1CUIA 3Q8WA 1QLWA 1E8DA 2WKWA 2WG2A 4X94A 2QR5A 3UUEA 5CT9A 4C4YA 4UPDA 5AK3A 2IITA 5D3KA 2HA2A 3AINA 3N2ZB 1AURA 4H18A 4U2FA 3WA7A 5ALMA 3M82A 2WG0A 5JZBA 4KJXA 2BUBA 4GI1A 2BKLA 1UK6A 3E1GA 1CEXA 3UUFA 3MVEA 4ZV7A 1XRMA 3LCRA 5BV7A 1ZIXA 1UOOA 4CCYA 3JW8A 4MQLA 1VXRA 4QLAA 3QVMA 4QE3A 1K6EA 5JATA 3E4DA 2XMSA 1W75A 1USWA 5A7GA 3AJAA 3G0GA 1R4ZA 4OSEA 4QWWA 1CUGA 2VTVA 3FCXA 1E8NA 3FCYA 5YASA 1N5RA 3HC7A 1NU8A 2DCMA 3U1TA 3QPAA 4W1QA 4YX9A 2IX9A 4OYYA 4N5HX 3B5EA 2XUJA 1MNAA 3G0BA 3K6KA 5ESRA 2HHAA 1BEEA 2WHPB 4X7BA 5HQ3A 1MT3A 3F8SA 4E11A 1Y7IA 4ZRDA 1XFDA 4H7JA 4EY7A 3FSGD 2DR0A 3R3VA 2RAUA 4PO3X 3DQZA 4EY4A 4G4IA 5E4JA 4M0EA 1R50A 2EEPA 4GW3A 5BWBA 2PKYX 5JAOA 4FBLA 3DS8A 3A70A 4MEAA 3H0CA 3C8HA 3WWCA 2WTNA 4N8DA 1SCKA 2CKMA 4M0MA 1NX9A 5T4FA 2C5GA 4WCVA 5LKRA 2WILA 1CUZA 1JJFA 5FP0A 4FWBA 3T4UA 3DKKA 1THTA 2JF0A 3WL5A 2WIKA 1R3DA 3RM3A 2NW6A 2WFMA 1IUNA 4J3JA 1CUEA 3H2JA 3UMJA 4EY8A 1G4HA 1L7AA 3PUHA 4NS4A 3STXA 2XUDA 5EHXA 1F6WA 1FFCA 3C6YA 1MN6A 4IHAA 3I2GA 4BC1A 5AKEA 4FOLA 2D5LA 1WOMA 4B6GA 4EY6A 4MYDA 4U2GA 1ORVA 2DHCA 5JAHA 4LHEA 1ODCA 2OLEA 1EB9A 1H2WA 4B83A 3OPMA 3BF7A 4BAUA 1BN7A 1UOQA 3KOOA 3H19A 3I1IA 4GXNA 4OYLA 2WUFA 2JGJA 4P92A 4FLEA 4DLNA 3ICWA 3ICVA 3AFIA 3I6YA 5FDFA 5JYCA 4ZV9A 4KEAA 3TGLA 2XUQA 2JBWA 3R3UA 5ALGA 2QVBA 3LS2A 1XLWA 4N8EA 1ZD3A 3ZI7A 3DL7A 5AM0A 3WK8A 2QUAA 4HRYA 3SK0A 2Y2VA 1H22A 3FLBA 4IO0A 4MQMA 1ZD4A 3ESDA 1JKMA 3D4LA 4H7HA 5HF6A 3BE8A 3BL8A 2OCGA 5E4YA 1S8OA 3L1HA 1YS2X 4CCWA 2XE4A 4LKOA 2OPHA 3O95A 1GKLA 3VISA 1YS1X 1XRRA 3QZUA 2BGNA 2OGZA 3WKEA 4EZIA 5LZ5A 1CUCA 3OM8A 1PJAA 1VXOA 4X85A 1UXOA 1XZBA 1UT6A 5A7HA 4FHZA 5J3JA 5JZ9A 1SCIA 4H7DA 3H2GA 5EI5A 5A6VA 4Y2XA 2OAEA 2BUCA 2HA6A 5LZ2A 3KDAA 4NMWA 1A8UA 4QDXA 1ZIYA 2B61A 3DD5A 5HQ3B 1JJBA 2HA5A 1TCAA 3QH4A 3PFCA 4YK7A 2W6CX 4U2CA 1UK7A 4JYPA 5K3FB 4BAGA 3D2BA 3QITA 5CH8A 1EDBA 3PF9A 3C6BA 2QJWA 3LIIA 3FVRA 3H1AA 1ZGCA 2QUBA 2WFLB 5AOCA 2WQZA 4OB6A 1WB6A 5DNWA 1N1MA 5LZ4A 2WSLA 2I3ZA 1A8QA 1CUAA 5A62A 1CUYA 1EVQA 1XLVA 2I78A 4N8SA 1FFAA 5FPQA 5C7YA 2HA4A 3MUOA 3H2HA 2C58A 4G8CA 1YR2A 5I8PA 5ALPA 4DNOA 4AO6A 2VAVA 4BE4A 4W1PA 4H7IA 3G9TA 3K2IA 5JD6A 4KRXA 4DM7A 1YAJA 4PSCA 2FJ0A 1XZFA 3W06A 3ZLVA 1VA4A 1XZIA 3G9ZA 3IDAA 3OTQA 4XWGA 1IUPA 5D7BA 3HEAA 4Q3OA 5K3BA 3TEJA 4L0CA 5D3ZA 4MWSA 2VA9A 4JNCA 3ESBA 2WLSA 3GUUA 1ZGBA 5DTIA 1R9MA 5IVHA 5ALKA 4L9AA 3DYVA 4GDMA 2G5TA 4GEGA 2PUHA 2JGKA 3IUQA 4MJ3A 1CUJA 3FBWA 2GBGA 3DKRA 4FFWA 1TKRA 3HABA 4BVLA 1QFMA 4FNGA 3W04A 4HXFB 3DDUA 1M33A 2BCEA 1Q83A 1FJ2A 4UBOA 4G8BA 1C4XA 4NVRA 3ANSA 2ACEA 5CMLA 3VXKA 4UHEA 3IULA 3IUNA 1HBJA 4W1SA 4AN1A 3STUA 2XUFA 3DYIA 1BE0A 1T4MA 1K5PA 5LP1A 5ALOA 4B85A 1QIJA 4GBGA 2QZPA 1R9NA 4EA6A 4FBMA 3R40A 2J3QA 1A88A 1JU3A 3WIBA 2R8BA 3FYTA 1ZJ4A 1BCSA 1ODTC 3G0DA 2Y2UA 1C7IA 3O4IA 4OD0A 3D5EA 2C0PA 2J3DA 4WFIA 5T4EA 3WMRA 2Y6VA 2H7XA 4PF1A 4INZA 1XKLA 3HI4A 5CBKA 1GPNA 1ETHA 3H04A 4DMHA 4CIAA 2O2HA 4KAFA 4OPMA 3PFBA 1VA5A 4CG1A 3DL4A 1EHYA 4UHFA 2YXPX 2OCLA 3FSGA 1N8SA 1YCDA 5ALIA 2DFPA 5AOAA 3RLIA 2HADA 3JWEA 3FOBA 1QIHA 1EXWA 3C5WP 1B41A 4DSAA 4WJLA 5CW2A 4Q82A 5ALQA 4L72A 1ZD2P 4FTWA 3U0VA 1GPLA 5FV4A 2VEOA 4PNZA 5HK8A 1QONA 4X91A 4X6UA 5AI0A 4X00A 2OGTA 1J2EA 2XQJA 2XDWA 3H2IA 5ALJA 4F60A 7YASA 4Y9SA 4QDUA 5AM1A 3M3DA 5CH3A 5JALA 3WI7A 1P0MA 2Y1KA 1B6GA 4A5SA 1X2BA 4J0CA 1BCRA 2GYUA 4H77A 5DTJA 4H7EA 1XZDA 1QTRA 1H2YA 2PX6A 4WDRA 3V1KA 2CMFA 3CCBA 2CUTA 1DT5A 5BOVA 3V48A 2BJHA 5DYYA 4PV7A 2H7YA 3PDCA 1P0PA 3WWPA 4CG3A 3FYUA 3O4JA 3WL6A 4EB0A 3DOIA 1YA4A 5AK6A 1K8QA 3CN7A 3IUMA 2YH2A 4B9AA 3MUNA 5A7FA 2ACKA 5C81A 1P0QA 2W22A 5K3AA 2WFLA 3DEAA 1XZAA 4C89A 3CXUA 1U4NA 2CJPA 4S0XA 4B0PA 2ZJ6A 4X6YA 2YYSA 4UBMA 5K3FA 3R3YA 4UHHA 1XQXA 3QYJA 3OOSA 3A6ZA 4W9RA 4UFPA 5T4HA 4ZI5A 1DWQA 4P08A 1AGYA 4XJVA 2VT7A 4X93A 1YB7A 3G7NA 5H3HA 3M81A 2PSEA 2P8SA 3IVMA 1LPAB 1VJ5A 1DT3A 2WUEA 2PU5A 1VZ2A 4BRSA 2Z3WA 3QM1A 1EDDA 1CIJA 3EQ7A 3FLEA 1UZAA 3PI6A 3WL7A 5EHQA 4I4CA 2XQKA 2RGUA 1LPMA 2X76A 2OCIA 4QZVA 2ZYIA 2WHQA 3WK6A 2AJ8A 2Y6UA 4BVKA 2BUAA 3WZMA 5A71A 4P93A 4K6GA 1TCBA 4FMPA 2XMDA 1QIKA 1WHTA 4AMYA 4BYMA 2BFNA 4U2BA 4AO8A 3WK4A 5LZ8A 1XZJA 1QOZA 2C0QA 1HDEA 4A23A 3LLCA 5AJHA 1TIBA 2XMZA 4WDQA 3HRHA 1UKCA 4DMKA 2QKYA 3DNMA 3M83A 1Q84A 3OURA 2C7BA 5AM3A 1YB6A 4Y2TA 1LZLA 4W63A 1CUBA 2PUJA 1EX9A 4XVCA 5D6OA 4IQ4A 1W6RA 3WKCA 4E15A 4EY5A 2XUGA 4Y2VA 1W4LA 3R3XA 2XI4A 3D3NA 3ZWQA 1CUUA 2ZYSA 3HSSA 1KU0A 4AO7A 3OC0A 3F97A 3VJKA 3F67A 4IH9A 2O7VA 2B4KA 4BZWA 1MJ5A 2OQVA 1CVLA 3S8YA 5JD4A 1QIMA 3RARA 3L1JA 4X71A 3S2ZA 1W1IA 5KWIA 3I2KA 1LBTA 5IVIA 5FKJA 4UBKA 1GGVA 2PSJA 3TJMA 1WB4A 3BWXA 5F4ZA 2JEZA 1EK1A 2UZ0A 2QXUA 4WY8A 1U2EA 5A2GA 3SX4A 1JMKC 3GELA 2OGSA 1E5TA 2H7CA 2V96A 4WY5A 5AIAA 1HLGA 1CUVA 4DTCA 1BS9A 5AM5A 3X3HA 1CFJA 2GZSA 3QMWA 3DLTA 5DJ5A 4BRZA 1XRNA 4HXEB 2LIPA 2PL5A 2ORYA 4GWLA 3STVA 3WZLA 2V98A 4J0JA 1FSSA 4YASA 4LXGA 1ORWA 2ZVDA 3WIOA 3F96A 2XT0A 4OU4A 1XQVA 4X90A 3G9UA 3WL8A 1AC5A 1DX4A 6YASA 2QRUA 4PSDA 4X97A 4XIIA 3WWOA 3GFFA 5SYNA 3ZLUA 2WU3A 1CV2A 1MU0A 1GXSA 5AICA 3G0IA 3ILSA 4Q05A 4AQDA 2RI6A 5IVKA 5CTAA 3C5VA 2XUAA 1AKNA 5JD5A 5K3EA 1IMJA 3I6MA 3CCCA 4HVTA 3D2CA 5AI6A 5EGNA 4AMZA 1OILA 3V1NA 3ED1A 1MPXA 2XB6A 3I28A 4YPVA 1DWOA 2Z8XA 1AUOA 4GLBA 5AKKA 5HF8A 5CURA 4OB8A 1HL7A 1RWQA 1K63A 4J7AA 3EIOA 4H0CA 1T2NA 2WJ4A 3QPDA 5CXUA 3VVMA 3HACA 1H2XA 3D59A 4DNFA 3OG9A 1CRLA 1CLEA 1DWPA 1GZ7A 1PFQA 3HZOA 1SOMA 3BJMA 4JH0A 1MAHA 5ALXA 4B82A 1YASA 4CCYB 5IH7A 4ROTA 1E66A 1J07A 5AKGA 3VVLA 1LPPA 1VE7A 4Q3LA 3BXPA 1Y7HA 1Q0ZA 1GQSA 1HKHA 2WIFA 5JADA 3IURA 2XLBA 4BCBA 3H17A 1TRHA 5ALZA 3QBJA 1R1DA 4QDZA 5ISMA 4UBIA 3IA2A 2XMQA 5AK5A 4LIPD 4FFVA 3WA6A 4K6KA 4PQEA 3WYNA 1XROA 2GYWA 3I1YA 1OCEA 4GHWA 5K3DA 1CQWA 1UKBA 3V1MA 3PUIA 4WFKA 4UUQA 4BCDA 1WHSA 4ARBA 4E14A 3PICA 3TRDA 4OUKX 3BIXA 4TGLA 1A8SA 5BWCA 3EBLA 3FYUC 4U2EA 4U2DA 5FOQA 1JJIA 2HA3A 5ALEA 4KACA 5EIHA 4CG2A 5AI5A 3FLAA 5K3CA 3WJ2A 2HRQA 4B7ZA 4X3CA 4BP8A 2CB9A 4KE8A 3WWDA 2ES4A 2JGLA 3O4HA 4BBZA 1QIEA 2GBFA 2HA7A 3WK7A 3D7RA 1LPSA 3BDVA 2H1IA 3B12A 3NUZA 2BAGA 4K5QA 2X8BA 1EVEA 2QTBA 1MO2A 2VSQA 2VJBA 4QEKA 4ETWA 4DGQA 2XUKA 2VJAA 2QT9A 1JT2A 1EDEA 2WUGA 3C8DA 4N5IX 2GBCA 2G4LA 2XMCA 5CT5A 3IIIA 4K6HA 4QA9A 1EK2A 3AZQA 4BB0A 1ZD5A 2V97A 3T52A 1XKTA 1RP1A 2XUIA 3RK4A 4Y2YA 4CI9A 3BF8A 4UBJA 5JANA 5IVDA 2DHDA 3EQ9A 4KAAA 3HXKA 1WCYA 4QLOA 4UFNA 1QE3A 5EIAA 2ZSIA 4HTAA 1U65A 2Q0XA 3ESAA 4Y2SA 2ZJ7A 3DCNA 4KE9A 5ALRA 2AXEA 4LXHA 5DNVA 2QOEA 1U8EA 1BN6A 3C43A 5I9IA 1QTIA 1G42A 4UFOA 1EA5A 5AM2A 4FDMA 3CN9A 3AILA 4B80A 2QM0A 4DNQA 1ODSA 1H2ZA 2AJBA 1P0IA 4C4ZA 5CH5A 3GBSA 4BAZA 2XUPA 5AI8A 4MYSA 2I3DA 4BCCA 3AUKA 3RKSA 3YASA 3GZJA 1MAAA 1CUSA 2XMRA 5AP9A 5AKXA 2QMQA 1ACJA 4ITVA 4BDTA 1UK9A 4G9EA 1QIIA 3MGAA 2PU7A 1F8UA 2H9YA 1ISPA 2XMBA 3V1LA 2XQGA 3AZPA 3W05A 5CT6A 4RGYA 2ZYRA 2DQYA 3SC2A 2WIDA 4IH4A 4BP9A 5FLKA 3VKFA 5EIEA 1XRPA 3WQHA 4HS9A 3KWJA 3D2AA 1ZOIA 1QZ3A 3KXPA 5DYTA 2WHPA 1ZJ5A 4FKBA 4RE5A 4B0OA 1UKAA 3IBTA 1XQWA 2DSNA 4C01A 3QPCA 4MWTA 3KD2A 1XZMA 1IVYA 4BVJA 1CUHA 1QO9A 4NZZA 2HM7A 4Q3KA 4E46A 2JGEA 2GYVA 4EHBA 5C8VA 1CUFA 1ZI9A 3G02A 3JYHA 1JU4A 1YSCA 1AMNA 4Y2PA 2OG1A 2PSFA 4DMCA 3DJYA 5HCUA 3H18A 4AZ3A 5AOBA 4X95A 3WLAA 2QXTA 1BEZA 1XRLA 4ARAA 1TK3A 4X6XA 2J4CA 4AB1A 2RIPA 5DYWA 4C4XA 1THGA 2WG1A 1E8MA 1JFRA 1MX5A 4FLFA 4BDSA 1AZWA 4D9JA 4B84A 3C6ZA 1LPBB 2Z3ZA 4EUSA 1EH5A 2WTMA 5AKLA 4M0FA 2D0DA 3STYA 2VJDA 3I6ZA 3HJUA 4QDTA 1QJ4A 1YA8A 4C6HA 1IZ8A 2VATA 1DQYA 3O9MA 4H7KA 3HLKA 1MTZA 1CQZA 5ALUA 5ALDA 1D07A 3ANTA 3KWFA 1QIGA 3WKAA 2WIJA 2B20A 3STWA 5FRDA 5KWJA 1BU8A 5LIPA 1H23A 1G66A 1KEZA 2AJLI 3AZOA 1CUDA 4BTLA 4RPCA 5AKJA 4MEBA 4A16A 3VJLA 5ALSA 5HKBA 5JAUA 4G4JA 1L7QA 5SYMA 5CT8A 1GT6A 1F0PA 1WPRA 2WU4A 1MX9A 2HL6A 1E3QA 2B9VA 4AZ0A 2JGFA 5KREA 4HRXA 2QS9A 5JASA 5HK9A 3PE6A 2WM2A 1XZGA 1PV1A 3WK5A 4MXDA 1GKKA 2Z8ZA 1EI9A 5AKZA 1UWCA 1BRTA 2FJPA 5DNUA 4QDOA 4Z49A 1WB5A 4F0JA 5K5EA 4L3WA 4EBBA 4F5ZA 1LGYA 1VZ3A 4J0IA 4CIBA 3AIKA 5IKXA 1XRQA 4ZGBA 4PW0A 1WPXA 5EHNA 1NU6A 4DIUA 3WYDA 5ALWA 4OCZA 1KU6A 4J0GA 5LZ7A 1Q0RA 3HYSA 1L7RA 1MX1A 4OU5A 5CRIA 2PVSA 5AHXA 5JZSA 1YAHA 4HAIA 2WIGA 3QMMA 5ALNA 5LYYA 4O08A 1GPKA 2ZYHA 1R88A 3C45A 1XQYA 2WUDA 2HA0A 4ZXFA 2ROQA 3WJ1A 1FFBA 3L1IA 2AJCA 1QGED 2RONA 1J1IA 1DQZA 5EFZA 1JMYA 1SC9A 3PF8A 2I03A 5LLSA 4B9EA 1X70A 1DU4A 4DNPA 2OQIA 3WWEA 3C70A 3R3ZA 1SFRA 2O7RA 4I3FA 3WK9A 3G9XA 2PSHA 3ZPXA 4IH1A 5C8XA 4J03A 1AQLA 4Q1VA 5FUMA 2RHWA 3QMVA 3A2NA 4HXGA 1Z68A 5AH0A 5FPPA 5ALVA 2O2GA 2VAXA 3G0CA 2K2QB 4GECA 3LP5A 2XQFA 4J0KA 2ONCA 1LPOA 4Y2UA 4LYEA 1SCQA 4UHDA 4G9GA 3IB3A 2CBGA 2IIVA 4KRYA 1VE6A 4AX4A 3R3WA 4QWMA 3W2TA 1HQDA 4BZZA 2DQZA 2OXEA 3WKDA 5HZGA 4AN0A 4G4GA 3FWHA 2BGRA 1I6WA 1GQRA 2C5FA 1XLUA 1QIDA 2HFJA 2HRRA 1EINA 2QJRA 1VLQA 3ESCA 4J0DA 4KR0A 2HIHA 3C6XA 3O0DA 1Y37A 2HU8A 4Y7DA 2XLCA 5AKIA 1TCCA 1C7JA 5HF5A 1ZI6A 2DHEA 2Z5GA 3WKBA 1DX6A 3D0KA 4KYVA 3GROA 4KE6A 5AKHA 2OCKA 1ACLA 5JARA 5ALTA 4W1RA 2XMGA 5ALHA 1LNSA 5DLPA 4TVKA 4G1FA 1RYYA 4UBLA 1IUOA 5ALLA 1ZI8A 1OXMA 2HU5A 2PM8A 5I7UA 3E3AA 3KSRA 3EQ8A 2JGIA 1E89A 2V9ZA 4I19A 4RE6A 1CUXA 1O6FA 4HZGA 5AKYA 1UOPA 2J4FA 5AK4A 4X92A 5HF9A 2ECFA 4FNMA 5C8ZA 1XZHA 4KE7A 5EHZA 2XUOA 5KBYA 4K2AA 5ALFA 3V9AA 1ZICA 1X2EA 2ZSHA 1LZKA 3H1BA 1CPYA 2R11A 2GBIA 2PPLA 5CXXA 5LZ9A 4Y2RA 4DYHA 2JGMA 5JIBA 5LKAA 3N0TA 4BE9A 2OAGA 3A2LA 4DSZA 2CEKA 1XZKA 3AIOA 4C88A 4LXIA 1DTEA 5AO9A 1QO7A 1N5MA 3A2MA 3FYUB 3B3QA 1K4YA 1LBSA 1W76A 3O4GA 1IZ7A 4XX1A 5E4TA 2WJ6A 1FFDA 1AX9A 2G5PA 1F0NA 1O6GA 2VJCA 4BTVA 2HDWA 4UBNA 4QNNA 1LLFA 3IUJA 3I2IA 1QIFA
chains in the Genus database with same CATH superfamily
2Q1SA 3U31A 2V7GA 2YQ5A 3B7PA 4OMFG 3ID6C 1UFOA 1K3FA 1OGIA 2QVCA 2O0MA 3DOHA 4KKVA 4WN9B 3R41A 2G9ZA 2I5PO 4ZALA 1D04A 3AF1A 5BW4A 3FR7A 2HV9A 4QL3A 3FDXA 1AS2A 1JQJC 2RK4A 1EUCB 5HFNA 4M1OA 1MR3F 5TE9A 2WJ3A 2IDMA 1K89A 2W6IA 3L7IA 1SHZA 3Q8LA 2CDCA 1QQTA 4JOBA 3HKCB 2FSUA 1IHXA 1T25A 2PBLA 2A4KA 2ZEJA 1TKCA 4CKCA 3RREA 2HLHA 3M0EA 5AVZA 2G63A 1A2OA 2X5XA 2REQB 4ZO8A 1QORA 2K4MA 1OJLA 3EA4A 1PS0A 1XQ1A 1I2AA 5IC4A 3VNSA 5CX1A 1VHWA 3BIFA 1N2BA 3U48A 3R6WA 4MVJP 4Y2GA 1QCCA 1C8VB 4AXBA 3UV6A 4C0QC 3II6X 5EEGA 5IJ0B 4MA0A 1N9KA 1Y9DA 2V9CA 1XK6A 2WF9A 3GZNA 4UU7A 1T2AA 1OI7A 5DBOA 1TE2A 1AKQA 4H1HA 5FL7A 2DFKB 4RKEA 4FWTA 1PD1A 2WVJA 4EGFA 3S27A 3ORSA 4AJ1A 4UHBA 1EFRA 4HLUC 3BD7A 4L76A 4RPIA 5J1SB 4IXWA 3H2KA 1XJQA 3F2IA 4S1TA 5GJBA 2SICE 3C87A 3D3JA 3DF9A 3T34A 4D3FA 1YRHA 2QN6A 1VL8A 1GUDA 1VSUA 2BI7A 2XA2A 2F8MA 4PSUA 5EP4A 2LV8A 2IT1A 3UTCA 2QYSA 2RHMA 1U1CA 4L2IB 2E4WA 4A0RA 3NGMA 3K2QA 3C3DA 1KTVA 3EF0A 2L0XA 1U9YA 3NOXA 3A1NA 1HI9A 1KJ9A 3L5OA 4MR8A 4OOFA 4BFLA 1ZD9A 3AP3A 1Q0HA 4KN5A 1ZINA 5DK6A 1J0XO 1CR6A 1E2FA 1HZZA 1XFAA 1YR9A 2J5RA 1MOQA 1VJGA 3E9NA 2EJWA 4P7BA 5DHRA 3WLMA 5JMOA 4D8VA 4Y2JA 4Y1GA 4CM3A 2GA9A 4QBHA 1TFUA 1GWNA 3L84A 2JZOA 3N59A 3ZY5A 3P2MA 2VDPB 1HPLA 5BN5B 3ER9A 1SCJA 1J00A 4FKZA 1JI3A 3V4LA 5LA6F 2W8BB 4LA4A 3GD5A 4M1WA 1OXKB 4HS4A 4EITA 1ISRA 3TLBA 1WUJS 1EQUA 4EHFA 3TAUA 2XOKD 2WK1A 3GK3A 2GAJA 1TVMA 1SELA 3T3DA 2C4HA 3CE9A 4Y2QA 2CV0A 1SRQA 4PX5A 3QWBA 4WCFB 1D1QA 3CLUC 3VAAA 1GFZA 2JL1A 3ITKA 4LYJA 2Q9CA 3IVCA 4KQHA 4F3YA 1V43A 2DXIA 1C5KA 2IFTA 1G4UR 1LX6A 1QHXA 1Y4SA 2QG4A 3MRVA 3OX2A 3AEYA 5AI4A 5BSTA 4PXYA 2P2GA 3HL4A 4FHDA 4AKTA 5ICEA 1PVVA 2ONZA 3JSXA 2BF4A 3I61A 5D84A 3R9KA 1YJXA 5L95A 4J94A 3NC4A 3BERA 2ZPAA 1KETA 1OV6A 4XAQA 3TMYA 5KHLB 1FTNA 2PWBA 1ZNYA 1Z4PX 3QELA 4ZO9A 3MRTA 4E5UA 4A2QA 4IJMA 4BNHA 2PUBA 1N2JA 3W2FA 4FYMA 5AIBA 3O9VA 4OQZA 3WHPA 5IZ4A 1I0ZA 2DYKA 1CVRA 4MUBA 1ST3A 3EGEA 4RXUA 4LNHA 4F8YA 3QVKA 1XZQA 2B78A 2O1WA 2C4UA 3IS3A 4FE4A 1HUQA 2B25A 3A7DA 4LYDA 4NULA 4UVDA 3PRHA 5CUQA 1DAHA 1MVLA 4N3BA 4YRQA 3AF4A 4F9EA 4B3MB 2OWEA 4DF3A 2ZUUA 5K0JA 3ZOZA 3R7DA 3PGA1 2K2WA 3RW9A 5CHEA 4OHRA 2LCFA 4RHFA 3UN1A 2Y1EA 4AG3A 5FA8A 1G60A 2Y92A 1UK8A 2D1QA 5KPJA 2IVFA 3DP7A 2YMPA 3VR5A 3P94A 1PFYA 5JW6A 5SZHB 3RUIA 4CXMA 4QASA 4D9IA 4L85A 1I1HA 1YTLA 3TVDA 1KC3A 1R0CA 1SKAA 4G5XA 3UXEA 2C95A 3EJ6A 1ZWLA 3PNLA 5A1TA 3A6PC 2IF0A 3BIWA 3K9QO 4DA8A 2O2ZA 2FR0A 5TT1A 3WGYA 5CITA 3IRUA 4UW9A 2H4FA 1RAAA 4D4IA 3KWMA 4UMFA 2HK9A 5G4LA 4E1VA 3CKYA 4F91B 4MZDA 2X8LA 4U7WA 4XGQA 2FX5A 2GCNA 3VO9A 3K0CA 3ZV7A 2GPTA 3MWDA 4QELA 4KXQA 4E1AA 4FC7A 1ZBDA 3IDFA 2QX6A 4IDOA 1GR1A 1E8DA 4X94A 2WG2A 4BN0A 5EIXA 1ZNWA 3FI9A 4P83A 5EJIA 3HBLA 3DDHA 5FJJA 2OMEA 3VNAA 1NF8A 3CINA 4IDGA 5D3KA 1OAKA 1T2DA 1RWOA 2R62A 5FHQA 3UCFA 1CS0A 2PKQP 1I8TA 3KJNA 5JJBA 1QU2A 2HA2A 1MJNA 1JV2B 1OLSA 2P6OA 1AURA 3N2ZB 4MVJG 4PHGA 1JQAA 3WX0A 4AZSA 4Z1OA 5BNIA 3WA7A 1EXDA 4OAQA 4MS4B 4G97A 2AKAB 5FTJA 1OGYA 3UPDA 1XMPA 3GDWA 2FW7A 1GZUA 1RJ9B 2FQ1A 4KJXA 4OI1A 4BMVA 1KYTA 4YRJA 1GU1A 2RHOA 3AEQA 4P58A 5CCBA 3QP9A 4N6NA 3PUKA 4AS1A 2XMPA 2BUBA 3DFKA 4GC5A 5L4SA 1LXCA 3DVSX 4IQGA 2Z4TA 1X0VA 1UK6A 2C29D 4DLSA 1CEXA 3WLKX 2CKDA 1YFKA 5TX7A 3GEHA 1GAQA 3KU1A 3LQRA 3DEIA 4ZMSA 4DLTA 1V16A 3MVEA 3I05A 3RV3A 4L5JA 5BOSA 3WB0A 1WCIB 1YK0A 4IWNA 1YUBA 3CUUA 4K6MA 1G63A 1ZIXA 3GOHA 1JHVA 3C3XA 3DZ8A 4WEQA 2OBFA 3OQOA 1PQUA 4NMHA 4CCYA 5JXGA 4DV3B 4MQLA 1YQEA 4A7PA 2Q3MA 1PE0A 3RUCA 2ZLBA 3JALA 4FSXA 4LRYA 4WECA 4FEGA 4JLWA 4QLAA 1GVHA 1GZVA 3LDFA 3NTXA 3EIEA 3PL1A 2ZS8A 4PZ9A 4Z0HO 1IH8A 3TPZA 1DQPA 4TKVA 4Z2AA 3OU7A 4ZTUB 1KJJA 2C2KA 4TXNA 5JATA 3FDZB 4TSFA 1N1DA 4K81B 3BOSA 1P5JA 2ZIEA 1F7UA 1UM8A 4GM0A 5CPFA 3SGLA 3BE5A 3PNOA 3RUFA 2B1GA 3OFJA 1Z13A 1K9VF 2BEUB 2VT3A 3AHIA 3LA8A 1GTVA 1EXMA 3CR8A 1JHPA 3D4OA 1C3EA 1UQUA 1Y7TA 3Q88A 4NZNA 2OHIA 4OA5A 5DM60 5KNDD 3PC7A 1VDMA 1Z6TA 2NT3A 5JCJA 1AA9A 4RZHA 1YR1A 2RDMA 3QVUA 1YNOA 2FSVA 1SUCA 4OOEA 4L4XA 4O4LB 4AZ3B 4MGEA 2AMJA 1IQRA 1SHKA 2AW5A 2AC2A 4PRYA 5ARDA 4YJHB 1L7DA 1HLFA 3NT2A 3TL6A 3ZTWA 4CIVA 3V7YA 5L3SB 2DG2A 5L7TA 4JVSB 3JAWB 3GAMA 1K86A 3TIVA 1TTQB 2VXOA 1E7YA 1UIMA 3D3QA 4QFDA 3D1LA 4MINA 2IZ7A 4I1UA 1CVIA 1KVTA 2FR1A 2JJ8A 3FCXA 1YKGA 4D3YA 3BIJA 2G0NA 4RVFA 1YBVA 3N5KA 4B40A 5HMLA 3UMSA 4EW1A 2DJ5A 2VXCA 1PG5A 5YASA 1U3WA 4Z86A 3SEFA 1N5RA 3MJVA 4G01B 3VNBA 3HC7A 5I48A 4EVSA 2WWRA 1U04A 2HDHA 5HTKA 1JSCA 1HEYA 1J2UA 2BBTA 1ENZA 1RADA 3QPAA 2DH5A 1RXYA 1ADBA 1UDAA 3O90A 2R85A 3EFHA 4AJHA 2I9PA 2IX9A 3D43A 2CBZA 3OIYA 4LEIA 3P0HA 4XTRA 4BP3A 1UJ6A 2ZM5A 3RCBA 1V26A 4DWJA 3VVCA 4GFDA 1XTTA 1ZFNA 3HMKA 1T9CA 3K6KA 1RM5A 1J09A 3JD3A 4FFDA 4PFKA 4Y2HA 1B3RA 1MG5A 1XTZA 3LC2O 3SSNA 4A91A 3I0ZA 3AUFA 4FSDA 4S1OA 1FX0B 3MS7A 1LTHR 4F6CA 4Q03A 4UNPA 2DM6A 5HQ3A 4UNRA 4NJEB 1B6SA 5KX5B 2X6QA 1WBBA 3W5CA 3F8SA 3R20A 2YWCA 2GXAA 3WP0A 3K0CC 1Y7IA 3TINA 3SM9A 4IFTA 1EFKA 1SIUA 2E9SA 5KNDA 3JRXA 3QI2A 2UYYA 4PO3X 1M74A 3OOYA 3T54A 3FTFA 2AN1A 4UUNA 1RZRA 2Y05A 1AKMA 1DV1A 2E48A 2R48A 4PHTA 2P7HA 3T9AA 4KWCA 5FPTA 4M87A 1JTVA 2EV9A 1GR0A 3ORHA 1J70A 4MJXA 3NDJA 4HEA6 4FBLA 1SGWA 2GBPA 1W4CA 4IOLA 4DCSA 4CMGA 2Q50A 1GYRA 2C8JA 2Q2WA 1ECGA 4ND7A 3FOEC 1KP3A 1TJ4A 2TRSB 2H1LA 5J4YA 2O2CA 5JSZA 1YRWA 2A5YB 3H6HA 4CG0A 1J4AA 1FVOA 1U80A 1L4HA 2GNPA 4U5QA 1UDCA 2JLQA 1FX1A 3HEMA 4UTNA 2VSYA 1U7TA 3EFEA 4P36A 1RJDA 4UEWA 3C3YA 2AFHA 3UTDA 3KZ1E 4QSMA 1SQFA 4RFVA 4D9GA 2PX0A 1ETUA 4WCVA 2WILA 1E3WA 1X1CA 1ZJ6A 3ER6A 2KWIA 1KF0A 2I2CA 3HRIA 4XM2A 3UATA 3TE7A 1WEKA 1U31A 1UBGA 4JY7A 4FXPA 5H1YA 2IU6A 4H1UA 1RMTA 5LJLA 2RH8A 3BGOS 4KDRA 4BQIA 4EG7A 2XTAA 3RM3A 1U0RA 1TECE 2NW6A 1NQVA 4XVQA 1XTVA 3OC6A 5F1KA 3DE4X 2COKA 2ZWPA 3DE5X 3FGNA 3GLUA 4J3JA 4LZJA 4QGSA 1FF9A 3GEDA 2AI3A 1CUEA 4B4WA 4D92A 3JV7A 1JAXA 3H2JA 3KPWA 3SMVA 1DS6A 3UMJA 5C8YB 2ZRBA 3FYDA 3R7WB 4DG5A 2CVHA 1M7GA 2P1RA 2E18A 2P62A 2XZLA 2IUYA 3QLVC 3STXA 1MVNA 2F3QA 3ENNA 4FZJA 1L2TA 3DTVB 1T0IA 2QQ5A 4GI2A 1P1FA 1FFCA 2HXSA 3C6YA 5IDYA 2RJ3A 1C1XB 1L5OA 3OTIA 3Q41A 4U1RA 3KQQA 5J4KA 5J2TA 1W1WA 3N76A 1U7PA 3QFRA 1UC8A 3LU1A 4HH3C 1K7EB 4JI1B 2IS1A 4G0OA 4KPYA 1QNFA 2G04A 3C3PA 4BC1A 1GLGA 4Q9IA 4Q15A 4FOLA 4A6PA 4PS1A 5JDCC 3VH3A 4B6GA 3VA7A 4TWRA 5K6RA 3X0DA 1I2BA 2WF5A 2YFKA 4EY6A 1ORVA 2IXGA 2PGLA 4RMNA 2M9MA 1TX4B 4JJIA 4LHEA 5ER6A 1WSBA 2EQAA 3HVJA 3R7FA 5HZHA 1EB9A 4OIMA 4N5MA 3IELA 4CMIB 1VCMA 3UWSA 3OPMA 2WT8A 1E2LA 1OX4B 3BMCB 5DGTA 3LRXA 1BN7A 1SQ6A 4KV9A 4JKIA 4RDCA 1PK7A 3LT5A 3H19A 4X1OA 1UP7A 3DO8A 2TMYA 5BSFA 5IZCA 3EEOA 4TYYA 2B0JA 2WUFA 2JKVA 5F2KA 2IXBA 1OX4A 2W5UA 1E64A 1MG0A 1TM5E 3GYGA 1N78A 4ANFA 3RJTA 1TIKA 3I64A 1JA9A 2I6UA 5FDFA 5JYCA 3RC8A 1ONBA 3MERA 1F4LA 4AP5A 3GX1A 2XB4A 4AF7A 1E58A 1XCGB 5IG2A 4ZP1A 2I33A 4BNZA 5ALGA 1N1EA 1MT0A 1SVIA 3L8CA 1RM3A 2C2WA 2XB8A 3ESYA 1ONNA 4K9KA 4MUKA 4NZYA 421PA 5A3JA 1ZD3A 2JAHA 3AM4A 3U4DA 1AZTA 3KQSA 3EODA 2CLEB 2GLXA 1M6VB 4BEWA 1C1XA 2BISA 5J2TB 1DAMA 4IQ8A 1A72A 1U28C 3AHJA 4R9UC 3H2BA 3ZHXA 5A6SB 2AW3A 1KYYA 2ZBQA 4GZ5A 3VDQA 4WK0B 3KOZA 2OHJA 3HI6A 2B4YA 2I99A 4QUGA 1AG9A 4JLDA 2AH5A 2WD8A 3ESDA 4L74A 1PBNA 5C8YA 4FN5A 2UUPA 3VPDA 1BXRB 3BE8A 1Z56C 3J7TA 2R6GA 3AERA 1ZMRA 3SIRA 5BMOA 2GZ3A 2AKEA 4RIIA 4GLJA 2ILTA 1NI3A 1O4VA 3JQPA 1ZN2A 1TOAA 2O59A 1YIDA 3B48A 5LYJF 2C8KA 2P77A 3FROA 5LNK6 1O4WA 4RD2A 1S8OA 3L1HA 3M6VA 1URPA 4MGYR 2XE4A 4CCWA 3QWFA 5K6AC 3NBKA 1D2RA 2IWRA 1WDMA 4V1CB 1UIRA 2BI4A 1KWGA 3LDGA 1Q57A 2IXAA 3VISA 2AR9A 2XNJA 1UBHS 4IWYA 2QQGA 4L5AA 1XAGA 2OOKA 4G5RA 8GPBA 1YS1X 3L43A 3FPSA 5FEMA 3UQZA 4DRXB 2QTWB 2H4HA 3L8DA 1FYXA 4EZIA 2Z6VA 3HXOA 1XXHA 2JLXA 4OBEA 3H5WA 2G1JA 4L8LA 1S96A 4D74A 4I1SA 4B87A 1T3LA 3PUWA 5BP7A 2J3JA 2ZJYA 3E7DA 4IRUB 4X7RA 3B1WA 1WU8A 2V6BA 3R0IA 5KTRA 3K5HA 4J7UA 1I6MA 3NOQA 4Q93A 3PPXA 1R9GA 1RRKA 4BJ5A 4FCVA 1BWPA 1UBSB 1PJBA 2GNOA 3A1UA 3FZYA 5HM8A 3IVRA 1GAEO 4OATA 5D7NA 5A7HA 4BX8A 1T9BA 1ZVMA 1DKNA 4FHZA 3HCAA 3QY9A 2APJA 2QAJA 4V0LA 4B4OA 4F4FA 3NDRA 3JPYA 2CLKB 2D2VA 2WUVA 3H9JA 4Z7OB 3TLGA 1RI2A 1ZEMA 2DFNA 2C9OA 3T99A 4GI7A 1YC2A 3ROXA 4KGXA 4QODA 5F7ZA 4CHGA 4V0OA 1GTG1 3OT1B 5BVHB 2BUCA 4NP6A 3IQEA 4NU8X 5LZ2A 4B79A 1V6SA 4BZQA 1YJ8A 3LKVA 1AD2A 1UBNA 4QDXA 5F35A 2D0PB 4YLEA 5HQ3B 4ZOLF 2NYRA 4YRMA 2RGGA 1I32A 1A9TA 2P2ZA 1Q6YA 2VR1A 1T15A 3PG5A 2ANBA 1U11A 1T8PA 4G6ZA 3QH4A 3IB6A 3CX6A 5EOVA 2C9ZA 1GFIA 4PZUA 2P90A 3I01A 1UMKA 1M1YB 4KLZA 4OQEA 4JYPA 5A5VA 2PN1A 2W2OA 1YCGA 4X66B 3D2BA 3QEMA 3ILVA 1S9DA 1LEHA 5JO0A 5CH8A 1C3VA 5LUBA 5FFFA 4HDKB 1EDBA 3QW2A 1V4BA 3CW2A 1E7WA 1FNNA 4S12A 4WJZA 1P0CA 2OAP1 4D9KA 2A35A 1P39A 1VFNA 3AI7A 2ZVPX 1XVTA 4O4JA 1OBVA 3SFZA 4OTZA 4BBPA 1RJGA 4EG4A 4YV7A 1KOGA 2XWQA 2OXTA 2QUBA 4WE3A 2SCUA 2VPPA 2WQZA 3U9LA 1FOEB 4Z4CA 1U1GA 5JAMA 2FN7A 1WB6A 3U2QA 1JR3D 1G6OA 1PLKA 3ZH2A 3RSSA 3R8CA 3TCNA 1V3VA 1FQKA 3JU3A 5EP2A 4L95C 3TCXB 2JG3A 2GXQA 1BGXT 2WJYA 4C0LA 9LDTA 3NKLA 1OREA 3ECSA 1M0WA 2VPZA 2WU1A 4H2DA 4DIMA 2FPPA 1CUAA 1N57A 2HCFA 2GO7A 3CZQA 5ETJA 4RDXA 3LUKA 2ZWOA 1Z4JA 4WZAB 1U7HA 5FOVA 4EG1A 4N8SA 5FPQA 2E6UX 2XVXA 2HA4A 2OP1A 4I5EA 3H2HA 2C4MA 2YWBA 5E8JA 3U26A 5CFQA 2NLOA 2PZGA 5LBTA 3OZBA 1DHTA 1MXHA 1Q3KA 2FETA 2X9VA 3AHEA 4FFMA 4QXAA 1GV0A 4WZBA 3S2EA 1TZKA 1C9DB 1KFJB 3EXG2 3ZQ6A 1KI7A 3OUTA 3ZU3A 3ND5A 4F6RB 5CBPB 2EX4A 1M8GA 3N53A 3OLVA 3IUYA 2ZRAA 4DCOA 2P78A 3RFTA 2VAVA 1TUBB 1TKAA 3G2JA 2UVPA 4BE4A 2PUGA 1K68A 2HF2A 4K28A 4BFZA 1O6BA 4WXYB 1NAHA 3ELBA 1ACMA 3JAMA 3E81A 3G9TA 1HGXA 4TKVB 3OFND 4U7GA 2B83A 4O4HF 4WXPA 5JD6A 1XEFA 1MZPA 1RLTA 2WOOA 2ZAMA 1IQUA 2VRCA 2X5NA 3QVTA 4QJBA 5LOVA 2DKFA 4AKIA 1BCRB 1E20A 1EP3B 2H1SA 3FNQA 3NTOA 4QJ4A 4R8SA 5M2QA 4UD6A 2CWWA 1XZFA 3JATA 3WLJA 3UJDA 4F6RA 4KXFB 2O7QA 1WW3A 4PRLA 3C4QA 4CODB 1I3LA 1RQRA 4GKJB 1E4OA 2B36A 4NTZA 4V24A 4XOUA 3VSEA 5BUCA 5LDHA 3WJ7A 4OQLA 2UUOA 4MI3A 2OZLB 1U8CB 3CZAA 4KX3A 4OV6B 2O2JA 3DO6A 4XWGA 1AJEA 1HO3A 3O38A 2IHKA 1PGNA 3L8ZA 4IJVA 3CWZA 3RS2A 3WRWA 1QF7A 3VHXB 1UL1X 4H9GA 5G4KB 5K3BA 4KYTA 3RK0A 5HIKA 3M33A 1RJ9A 3G9QA 4L0CA 4MWSA 5D3ZA 4URVR 5HVNA 4OSOA 1ZGZA 5DPMA 4MS4A 4D4JA 4JNCA 4L28A 9LDBA 3LG2A 1Y63A 3RBVA 2GEDA 2XT9A 3S5JA 4D3SA 4RTOA 1ZR2A 2YV3A 2CYAA 3GUUA 5HE9A 2JA2A 2QL6A 3H05A 2JIOA 1USIA 3K94A 2VFAA 5ALKA 5IT4A 2SCUB 3IKMB 1Z6PA 4KYIB 3U7JA 1DO8A 4E2XA 4L9AA 2OV1A 5DNAA 6Q21A 5HKKA 1J8VA 1U2SA 2UKDA 4NOJA 3ORQA 1C9MA 1K3TA 4MAFA 4P35A 2C31A 5TGZA 3UO8B 2ZREA 3G23A 2HHHB 3MWDB 4ER7A 3KCNA 1UUFA 1QMPA 3RHSA 3NBMA 3K53A 4HDKA 3TQCA 3TZBA 1X7GA 2WTBA 3IEUA 1EFVA 5LMNB 3ADBA 1QFYA 4JOCA 3FBWA 1IK4A 1XTJA 2GBGA 4DV6B 4M88A 2EGHA 1DADA 1KDRA 4M46A 5IEJA 3D3KA 3FLMA 2FXVA 2WPDA 4IVRA 5DNCA 6LDHA 1DXHA 5C1IA 3W04A 4QXPA 4YPOA 2NT4A 4NFYA 2BGUA 2BTQB 4GNKA 2M1ZA 3F6RA 2QPAA 3V55A 5FORA 5JLJA 1KIAA 2R3SA 3H2YA 3WRYA 4MP3A 4CL2A 1Q83A 2J48A 2XCUA 2O3TA 1CFZA 3H42B 1C4XA 4NVRA 3A27A 2WV9A 1R18A 2BE9A 4R6WA 1XJCA 4D4HA 4OQPA 3NXKA 5CMLA 4TMFA 4KLNA 3JXEA 1N9ZA 5AVVA 4U6SA 3ANXA 1XJ0A 1E1YA 3OPNA 2W6JA 3QEAZ 4IIYA 2Q3LA 4W1SA 4AN1A 5B6JA 2DKOA 3MWGA 3LQ1A 3WGIA 4AT1A 1WKBA 2XUFA 5TS2A 3V3KA 4NPAA 2JNWA 3DYIA 3PGLA 1RC0A 3TRFA 4DIEA 1FS5A 2LP4Y 4WBNA 3T5AA 2E37A 4EHAA 4ZEVA 1C30B 3IHKA 4AP9A 3I5MA 1KTIA 4D0LB 4A0GA 3OZTA 4I8XA 1ICIA 3HB4X 1U2GA 4J90A 3EYWA 4R81A 1R9NA 4ZOEA 3BC1A 3ZEAA 5MHTA 1OD6A 5KYUB 2CK3A 5EXPA 1WXFA 4EA6A 1DKQA 5LP6F 2ZWAA 4M76B 1ZM9A 1X42A 5D2CA 1A88A 1EGVB 3COVA 1Y1LA 3WIBA 5ES4B 3IUPA 3ZUGA 2E4YA 2R8BA 1N5KA 3FYTA 3ONFA 1ZXBA 3B3GA 2H1OA 1KDPA 3VSBA 1SPBS 3I37X 1ULBA 1C30A 1UBRS 1LLDA 1DJNA 1YR8A 3ZU2A 1RPZA 3MAAC 2MR6A 1A5AB 1ODTC 1N2IA 1NATA 2IEBA 3L6UA 4X8MA 1BFKA 1HDOA 2DBZA 1SZCA 1MQAA 2QPTA 4DPKA 1ZH2A 2C0PA 3GJ4A 4QXQA 3BXEA 3SYNA 3VOSA 4BMXA 3ZN2A 3DE3X 5DOZA 2Q6VA 5LQAA 1W36D 1KDVA 1E2PA 2H7XA 2P9FA 4LJLA 4TMVA 2C9BA 4HX2A 4I14A 1Y8CA 3A0UA 1XKLA 2JRLA 3C1OA 1ODLA 4M1TA 4PVDA 1V8DA 3L6CA 1GPNA 3RYCB 1O03A 3QBEA 3U17A 3CQ9A 1ZJWA 3UH1A 4NCHA 1G3IA 4B8YA 4M54A 3GPBA 4OPMA 3CM0A 4ZEXA 4MR8B 4YHBA 4HQLA 4JA0A 3MIIA 4OLHA 2AZXA 1LKZA 4Z3DA 2IIBA 3R0ZA 1VYHA 2M32A 1N3YA 3IILA 1II8A 1KOJA 4L2IA 4UHFA 4G24A 2Z04A 1L8LA 1PJ4A 2P11A 4OHWA 4NYJR 3WMEA 2ZETA 1UMDB 3RLIA 3Q9SA 1ESZA 2P40A 4O8CA 1WD5A 1QIHA 4KMSA 1QTNA 3AR2A 4J6EA 3EGCA 4M9UA 5D85A 5FBLB 1Z0IA 2GT1A 2G67A 3PFIA 2VHXA 4MW6A 3B3FA 3W77A 2QGNA 2YXLA 1GCAA 1UKYA 2JRCA 5ALQA 4RVUA 3CX7A 2FEPA 1MEEA 2D7DA 3FPJA 5DF1A 1AZSC 3CF4G 4C29A 2J0QA 1VG8A 2QRMA 4KUGA 2AC4A 3WMFA 2JCSA 4IFIA 2VEOA 4RD0A 1RXEA 3K09C 5ICSA 2J31A 1E32A 2FLWA 3R6LA 3EA5A 4LJ5A 2UZ1A 4NSNA 4X91A 1XTQA 1J24A 5JSYA 4KR3A 2O20A 4YAKA 1FL9A 3D2LA 4DKXA 4IP0A 4EATA 2FSHA 1GFWA 4PO9A 4ALIA 4XWOA 3R44A 2XQJA 1Z6ZA 2Q4DA 4CQNA 1WEHA 2DUWA 4CKCB 3H2IA 3OM9A 4LWOA 2VP2A 1Z7EA 3DTTA 5KTYA 3KTAB 1IHYA 2FAXA 2C5SA 4E12A 1V8OA 3MCTA 1WZEA 4U6NA 3UHAA 1K7CA 2OZLA 4K05A 4ZJUA 3MILA 4R2MA 3VYSB 1V48A 3LW8A 2QNBA 2XWPA 5SZJA 3E5HA 1BHQ1 3CZ5A 5CXQA 1IN1A 3QVXA 5HEKA 1B8OA 1MTOA 1B6GA 1B8NA 1N6NA 2BPOA 4H6XA 5F64A 2YXDA 4XYLA 4JHLA 2FCAA 4YYEA 1K5DA 3BL6A 3N28A 3N8HA 1HDRA 5AJWA 2J9GA 5E1DA 5GQSA 1DKOA 2GM4A 2ZATA 5JH7F 2PX6A 1V1MB 3V1KA 4A8HA 5K0TA 1JDBC 1C3XA 4NJMB 5KQMA 4Z3OA 1WAMA 4F7DA 3CCBA 4KXLA 2WE8A 3P2OA 3PITA 2Q45A 5EJ6A 3MQ2A 3A06A 3JQ9A 2PT5A 1E3WB 5DYYA 3RF7A 4PV7A 1SULA 2KQUA 4EJ0A 1FTGA 5B7GA 2L19A 3RRJA 3VNRA 3VUFA 2EEZA 1E18A 1C0KA 4A6XA 4EKYA 4IXTA 1NONA 3U4GA 1BJKA 4DCJA 2BN4A 4UM9D 5JD3A 5E6SA 1ISMA 1A98A 3WWPA 4F6LA 1NPTO 5JNLA 5JSZB 3FYUA 3H9BA 1QRAA 3O4JA 3WL6A 2P30A 4FZRA 2WMNB 3BE6A 1MDBA 3G59A 4GL4A 3MQFA 3PXXA 4EOGA 4RHCA 1F20A 1EVZA 4A6EA 3SFTA 1VJ0A 2YH2A 2L42A 1YZUA 4LMBA 3R8FA 2IBSA 2UXCB 2QTRA 1N6OA 3FIJA 1Q19A 2EIXA 3MUNA 5AUPB 2P6MA 3K1JA 3U7EB 4EYGA 4RTJA 1JBKA 1OVGA 3E5RA 4IGFA 3RVNA 2OHOA 2RH5A 2VCHA 1X8LA 2ZT8A 2D8MA 3O4VA 3PCXA 1L5VA 4OXKA 4BRUA 3FXAA 2BKUA 2D00A 3BCHA 4X41A 3UWMA 3SYRA 1U4NA 4GR5A 4O4JB 2IH5A 3EMDA 2I1QA 2QU8A 3CTPA 2HZ7A 2QVLA 2FWAA 3VC3A 3LGSA 1X7ZA 4PLWA 4EJSB 2NU6B 4XX0A 1DAIA 4IRXA 5DWVA 2PX5A 4F06A 3F71A 5K3FA 4UHHA 3H5TA 4B3CA 1JXQA 2HC9A 4I50A 2XDAA 3DMGA 5FUVA 1KFBB 1PEDA 3F6SA 3GA5A 2D2FA 5L6MB 3OQBA 1OC4A 5DI9A 3B9BA 2ILVA 4TYPA 3AUJB 3N8IA 1AK1A 2I6FA 3L46A 5K0NA 1PQ4A 4UFPA 1X7XB 4LHYA 4C76A 1R0KA 4KHPB 2H9AA 3ETEA 4HN9A 1AGYA 2V7QD 4ILKA 4ISBA 4IXDA 1UC9A 2D2XA 3RTDA 1ZCZA 5KAPA 3BN3A 1YR6A 2ZTHA 4CMHA 2ZXFA 1RW4A 3PQ2A 4LY0A 3KC2A 3LYLA 1PEYA 3K92A 1TLFA 3H1GA 1NN3A 4XM1A 1RM0A 4FCCA 3BUSA 2G1PA 1M1YE 4R3NA 3UCXA 5BWLA 3WWZA 1XVIA 1KH1A 4JXKA 3PRJA 2ZKIA 5FTWA 4KFSA 4IKOA 4NS1A 5JHGB 1J90A 1JWBB 2GVDC 3KDSE 1NDHA 3OKPA 4DOMA 1LPAB 2WUEA 3HNRA 1BXZA 2PU5A 2PS1A 1VZ2A 3DPUA 2Y1LA 4Z9XA 4EABA 1YTUA 4PSVA 4KSYA 1K9SA 4DMGA 4MVJE 1EYZA 1XXHB 3UFBA 1Z16A 4GE0A 3MMXA 3USZA 4ETMA 3CURA 2BR5A 3AH8A 3FDJA 4RXMA 2CMGA 4K9OA 5EHQA 4I4CA 4EA9A 2XQKA 5A4MS 5BNZA 3S8EA 1LPMA 2PO5A 2XIQA 5ESXA 4ZHQF 5BY2A 2PMBA 5B4TA 1VRCA 4QUHA 3GLGA 2BGLA 5DN6A 1O3YA 1U2DC 2QWXA 2PK3A 1KJNA 1FMCA 2AJ8A 2KHZA 2Y6UA 3A4VA 3JQDA 3PQCA 4U39A 5DGCA 4XWWA 2NVWA 5EFOA 5LQRA 3FDZA 3N86A 3UWOA 3EDMA 4OFWA 2ORIA 4X9XA 2BUAA 3OTHA 3WZMA 3VRHA 5A71A 2G1UA 3RK1A 1FDIA 5BW5A 3U61B 4BXOB 2QY6A 2Q29A 2G76A 4CKZA 1U0HC 1KAQA 1LTQA 3L7LA 1D5WA 4JQOA 1M6EX 1VHLA 5CU7A 2TMKA 2NSHA 1Z5ZA 2Y99A 4ECEA 3EH2A 3VC2A 4BYMA 5JAPA 2QX7A 4M7OA 3WIUA 3DMNA 3GZ4A 5BOSB 1V16B 4W5QA 5A6SA 2BRUA 3DUFB 5BW6B 3RI3A 4AKEA 1QOZA 1LW7A 2WJIA 3GDOA 3C3AA 3C1UA 2BCJQ 4R16A 4NEHB 3ROTA 1II9A 2NU8A 4HDRB 3S28A 4RV9A 1H3EA 4YCNA 2VWPA 5AJHA 2RB5A 1TIBA 4WDQA 5IYZF 3T7JA 2QQEA 4L4ZA 2JCVA 3HRKA 3M34A 4RTSA 4CZ2A 4G0NA 3DNMA 3M83A 3N3BC 3ZY2A 3VKHA 2JAQA 2P3QA 4XYEA 1IY2A 4KWTA 4D96A 4DQVA 3LUCA 5AW5A 4U9IS 1MFPA 4Y2TA 4XARA 3UJ3X 1CUBA 2O6LA 2PUJA 3RC2A 1EX9A 2PZLA 1P29A 1R37A 4MWZA 2OYCA 4XVCA 5E9WA 4MCJA 2CHGA 2FPGA 3VR5D 3DLCA 2EG5A 2OB2A 2OSBA 1B76A 1LDEA 2J45A 2XUGA 4Z8YA 2OUKA 4F04A 3R3XA 4ZHQA 5CEJA 1JIQA 2XOXA 3B78A 3W4JA 5B3KA 1QVRA 2XY4A 3CRW1 3OU2A 5ITWA 2X0NA 3BMCA 4BEVA 1GQ2A 4TL9A 4CMIA 1T43A 2XCRB 4HUQA 3LCUA 4PPGA 3C8MA 4BLOA 3ORYA 4L8FA 4FS3A 4LHWA 3F97A 4J2TA 3QVLA 3F67A 2HF8A 2DTXA 3QU4A 4M55A 2WAMA 3LPNA 1L4KA 1JAYA 3CT6A 3EXHB 3FPLA 3JX9A 1YULA 4DA0A 3JQFC 1PZEA 1XKXA 4BGEA 1CLUA 3MJFA 3TQHA 1F1JA 3CGWA 1LBTA 1M2VA 3G8AA 3LLMA 2ZJOA 3ABIA 4MJLA 5FNVA 5IVIA 3UWPA 1II0A 4ALMA 5CCEA 2GN4A 5FKJA 4UBKA 2V7UA 5JUWA 2M6RA 2B7BA 3L0SA 2ETVA 2VOJA 1KYZA 2A9QA 4DL9A 4QBFA 1ZGHA 3BWMA 4UDOA 5F4ZA 2ZIGA 3OM0A 1EFAA 2QW8A 2HUPA 3OEHA 1FNDA 2PLWA 2AK2A 2AV6A 3RJ9A 4CIYA 1HOXA 2HKIA 4GX5A 5FULA 3SVZA 4X65B 2H7CA 3WP1B 1D1PA 4WESB 3X1JA 5B2FA 3TNDA 1I7DA 3HYCA 1F6DA 3IPAA 1JWAB 1FTWA 3KJFA 5FQNA 4JMLA 5KI6A 3VR2A 2JEOA 1CUVA 3ZBPA 3GFBA 1R0YA 3OZUA 4CQJA 2GPBA 3GLHE 4M6WB 1WMEA 3PVCA 5HIAA 2I22A 1PHRA 3H9UA 1VKNA 3QMWA 2ZUEA 3IEIA 5JECA 4EJ2A 1DRVA 1ESMA 5DJ5A 4CUZA 4WNYA 3RRXA 4IDBA 3R3SA 4XOIA 2V59A 4EHHA 1AHNA 5DXJA 1LSJA 1ZQ1A 4DV7B 3B9PA 3ZJYA 4CM4B 2PD3A 3EVEA 3G2IA 1R0SA 1OLUA 2C8VA 2PL5A 3E22A 4RJIA 3V46A 1A4UA 5ECWA 5DIZA 1I2DA 2ORYA 1JFSA 1NVVQ 3STVA 1GRCA 2F59A 1JVBA 4HWSA 1GZHB 2FOXA 2EKPA 3E9RA 4WNCA 4W6ZA 4EEKA 1ORWA 4G2TA 2A9PA 1QDLB 4MUAA 5TPZA 2NUAB 2QLBA 1HR0B 3I3OA 2I8LA 4LZZA 1KA9H 2W8BA 3FWPA 2XT0A 4MVXA 1RVV1 4B76A 3K2BA 1QYIA 1UBEA 1M2NA 1XQVA 4X90A 3F1KA 1RMQA 2Q9BA 2YZMA 3PUZA 5KYVA 3PD1A 3W6PA 2JI6A 5ICCA 2PZ8A 4Y1RB 3RYTC 4B6PA 6YASA 2H6EA 1UJ4A 2QRUA 3A32A 3DMDA 1AA6A 1U6JA 3HY3A 4MKZA 1E4YA 1EVLA 3ND7A 4TTTS 1RYMA 3ILYA 5ELXA 3GO4A 4XIIA 4I1PA 1NTOA 4PTYA 2JIBA 3KQLA 2ZRNA 1T10A 2HK7A 1P4JA 2Q0SA 2XITA 2DCUA 1KYVA 2W2PA 3PEEA 5JXIA 2QX9A 3CRVA 3BZBA 3RYFB 3DNPA 4ZI3A 3ZLUA 2VNIA 2AFVA 4A0QA 2AG6A 1PNTA 1ZYUA 4K9MA 3F5MA 2O2DA 4B32A 1W4ZA 1PTKA 3ESZA 4IEEA 3NOOA 4RMJA 5I45A 3CLVA 3NT4A 2PFKA 4H3SA 2QN8A 4BUJA 1USGA 2BMFA 3ILSA 1PU2A 4Y3UA 5B30A 4M0LA 4HEJA 3SMQA 4MCIA 4NG5A 3OOWA 1AKNA 4ZI2A 1Z47A 5EKDA 2Z1NA 3BRCA 4GOND 4UZFA 2ZE6A 2V6FA 3IDOA 4P7GA 1JSLA 3R6GA 3V4RA 1GUBA 2WDZA 1IMJA 1AK9A 1IDN1 4Q47A 4HTFB 2JFVA 4INPA 4HVTA 2PX8A 5EGNA 4AMZA 1FU8A 1BKDR 2ENUA 3ZCSA 2NADA 3TD6A 2FSSA 5MGNA 1VHTA 1Q7EA 2FGJA 1AUOA 2CNOA 2VUSA 3HEBA 3WDLA 1EQ2A 3VHXA 3L7NA 2C9MA 1YRAA 2Q7DA 3GCZA 1Y4UA 2VP5A 3CVYA 1ZCFA 3VPBA 2G6TA 2ESRA 4OQMA 3HCOA 3U7FB 3DMHA 4LQLA 4J2OA 4KGDA 4GI3A 4C4AA 5A5EA 5C7OO 5IK2D 3A36A 1MCZA 3TX6A 3HNPA 1JZQA 3EB9A 4JJZA 5TIIA 2X0JA 1KMQA 1V9CA 3SQOA 3TKLA 1FJXA 2PKRA 4P84A 3LX4A 2VEDA 3TZEA 4KKXB 1BOOA 4B3GA 3B82A 1V5FA 1UXIA 3HFGA 3QE3A 4CW7A 1EPUA 1KQGA 4IZHA 2F90A 1MD9A 3VVMA 3EXIB 2YICA 2PIDA 1OYWA 3AGPA 5FD8A 5EE1A 4DN6A 3L8MA 1BDIA 4DNFA 1HE5A 4KLAA 1YCFA 4AL4A 4MV9A 5JBIA 1CRLA 2BFAA 4NRDA 3V2GA 1DWPA 4FGZA 4NFLA 3VPSA 4OA8A 1NNI1 3MK31 5ALXA 5F7OA 4B82A 1MAHA 3A14A 4YLYA 5DYIA 4MVJA 2BGKA 4BO3A 4P4LA 4ZCRA 4KMOA 2PD4A 3ROMA 1GSAA 3SP1A 1HSOA 3NJRA 4ROTA 1I24A 1WCIA 1J07A 1POXA 4WZBB 1CQIB 2VDNB 1SCAA 3LK7A 1PX2A 2JATA 5IJXA 1AHIA 4G1UC 1I1QB 2G25A 2GHTA 1Y7HA 3BXPA 2IHVA 5EZYB 1VDZA 2Q1UA 4LV5B 2WIFA 4WOKA 3WBKA 1DCKA 3M6FA 1T5DX 2VAWA 2P0EA 1C7EA 3DCJA 2BSAA 2FPPB 1WXHA 1U0FA 1EFDN 1YJ5A 2FHSA 2Y66A 4I46A 1EWRA 4A82A 4BNXA 4AU1A 5ISMA 4C4RA 2X0DA 3RIXA 4B2PA 3IUEA 4TX1A 2XMQA 2EARA 4RPGA 2Q1TA 3BDAA 5B12A 3V4OA 4EB0A 2ET6A 2X7JA 1B42A 5F1PA 2DUNA 3L40A 3W78A 4FFVA 2A9KA 2PYZA 3GNTA 3QKIA 3HBFA 2NVUB 4YT4A 1IPEA 3UH0A 4C6RA 4JLMA 4KZPA 1TTPB 3NIFB 1S7GA 2GCOB 1XCOA 1Q3HA 3I1YA 4OQQA 5K3DA 3PXGA 2PYIA 2DY1A 1MW8X 3ICPA 5I9SA 3GJ8A 2ASEA 4DZTA 3NHKA 3K1TA 3ORRA 2B5VA 3OP4A 3DE1X 1ZL0A 4BCDA 1RD4A 1H8HD 3MRXA 3AW8A 1M1YA 2WW8A 4MNTA 2P67A 3TRDA 3HU5A 4ZCQA 2JFUA 1JLMA 3A4TA 2G09A 1IXZA 3T95A 5CAEA 1CF9A 3UICA 4ZXPA 1UJNA 4EGSA 2HOQA 5DWQA 2QR3A 3HWRA 1A8SA 3X2SA 5IWAB 3SEQA 1KI6A 2VDKB 2VF5X 1W2GA 3F3YA 4JOQA 4M8LA 2HR1A 4R68A 1D0SA 3OETA 3QOWA 1JAIA 3AV0B 1QM5A 3FYUC 3K4QA 2O5VA 4RZ3A 5BVHA 5IRCD 2X40A 4MPJA 2NYVA 4DB2A 1ONPA 1OV4A 2ZBPA 2W90A 4CDGA 3MD0A 4AS2A 1P7CA 2J0SA 3I12A 2B6NA 4EPRA 5B4UA 3G5MA 1TM1E 1Z39A 4DXAA 2H4ZA 4O2AF 3S0JA 5B3JC 1NJ2A 4JI3B 4P1ZA 3NHBA 4LTNA 1K08A 3OQPA 4P4GA 5K3CA 1SAYA 3DVRX 1O96A 2CB9A 4KE8A 4KW7A 4JIMA 2ES4A 3LUBA 2AOUB 3SE7A 3AW9A 3M7IA 1QWSA 4ZKEA 1GO2A 1Z5WA 3QELB 4ARZB 1B43A 1T4BA 3D3WA 4AWXA 4TT3A 4DIOA 1Q0QA 4PIVA 4OM8A 1J25A 5D1HA 2IYOA 4IDPA 4MV7A 4YY3B 3D7RA 4QAQA 4QPNA 3H87A 3QE2A 1DAPA 4DRXA 1P5ZB 2WF8A 1V3QE 1YQUA 1XQ9A 3NUZA 3PGJA 1JIJA 4LNUA 4BWGA 4HRAA 3ETCA 4KDCA 4M1EA 1BXGA 2QN1A 2W48A 2A57A 4K5QA 1GGJA 2B37A 1MB9A 1X74A 2OGUA 3I8OA 4L8YA 3NVMB 2A9VA 4YV0A 2PMDA 1REQA 1YA6A 4J3NA 1N6PA 3ZXXA 1U2ZA 1RAFA 5K8LA 2R87A 2AN3A 4REMA 2VJMB 2VJBA 3D8HA 4I55B 1FU4A 4DGQA 1IG0A 2XUKA 3D8UA 1DEOA 4DSUA 3EHEA 2D5AA 3WRVA 4J4BA 3P5SA 1D1TA 1VI5A 2QT9A 4A0SA 2HWKA 1IN4A 1PGPA 5BN3B 2FZCA 3BK1A 3FRJA 5EJEA 1ORRA 3SQXA 4M99A 5FL3A 2XMCA 5CT5A 5FBRB 2POCA 1AF4A 1BH2A 3N58A 1HF3A 5T41A 3AKCA 1M6VA 3Q8XB 4KIFA 1YFLA 5HBRA 3T3GA 4B2IA 1J9ZA 5C53B 3EEFA 4MW1A 4AW9A 5IF9A 4MRPA 1TB4A 1NDUA 4U3JB 3RFXA 1UJCA 1EK2A 4D43A 3AZQA 3CVWA 4BB0A 1SU7A 4HQ0A 1LC3A 1ZD5A 5FB3A 3DAOA 1AT1A 3HYRA 4UM7A 1BMFD 3OWOA 3G2OA 2IY8A 3GRCA 4C0JA 2WYWA 1DKRA 3RBXA 3UB3A 3U3MA 2QUZA 3INYA 4FYKA 4NCNA 1NAIA 4HMQA 2XUIA 1FP6A 4K1XA 3RU3A 3NM6B 3RK4A 3M5WA 1ADYA 1QV7A 1LBEA 3LHIA 2OD2A 5HKKD 4HNGA 2MSDB 3IDQA 2L17A 2NUBA 4MUEA 2FA9A 4UBJA 5JANA 2DHDA 1ABEA 1L9XA 4EWLA 2BJVA 4ITUA 5CYFA 3ZV6A 4PZZA 1E2JA 1XAIA 1WCYA 4QLOA 4YMSA 1W5BA 1ZVQA 2IRWA 5A06A 4RZQA 3WAGA 2BGJA 1F51E 2V5AA 5EIAA 4HTAA 1NQWA 2V7TA 5IX8A 1D6NA 1ULHA 3ETNA 2GKGA 2VQFB 4Q9NA 2W8ZA 5JZOA 3SC6A 1U4SA 2IY9A 2YJTD 4M7PA 2OXCA 4IDQA 3RIYA 1G1MA 2HNBA 2P41A 3A10A 1J0AA 2CLSA 1EE2A 1M83A 4FYWA 4CU5A 1GHTA 1WA5A 2XCQA 2R6ZA 3FCOA 3MT0A 4HC4A 3GD7A 2C3MA 2X6RA 3GJ7A 3H4VA 4GRAA 4X1IA 1PV4A 4FJ0A 4KPEC 5DK4A 1L9KA 2BR4A 2GAAA 3H8JA 1BQ3A 2HWUA 3M1AA 3KYJB 1MB4A 1QQ5A 1BN6A 3EDCA 4N12A 4YRTA 3Q3GE 5I9MA 1BS2A 5L9AA 4GOKA 3T06B 5I9IA 1NVWQ 3H86A 2GSDA 1TJPB 4IX1A 2JLSA 4MVWA 4P53A 4KOAA 4TUYB 4LC0A 4AVYA 3TNFA 4FDMA 3AR3A 3CN9A 4FOOA 2HMYB 1CJCA 3K0HA 1KEWA 2QA5A 2AJBA 4HGQA 2A9FA 5CH5A 4I36A 2C3PA 3SEZA 2C3UA 5AI8A 5K9ZA 3LCMA 3V4PB 3AUKA 1JXMA 4ER5A 2AOXA 2EERA 3GDGA 4WT7A 2G0AA 2FQXA 1GZ6A 2YYYA 3GZJA 3QXXA 5AP9A 4KR9A 3AU8A 1O94A 3GFQA 3LUJA 3EZYA 5SZKB 2O2SA 1OZHA 4Q1BA 4ZU6X 3QNUA 3S5UA 4DCUA 2AFHB 1KQFA 4UUAA 1UJMA 4JBWA 4M7RA 5JCPA 2H9YA 4L75A 1ISPA 1SBCA 4F93B 1Z29A 3GJYA 1KYIA 2IEYA 3VMMA 1K3UB 4YMHA 1Y7PA 4WLEA 5KU1A 2NTEA 1Z3IX 1IN6A 4JT9A 2WYUA 1AS3A 1TF7A 1DC8A 4WINA 4MARA 4B6QA 4DKJA 2EFYA 2PV0A 1CEEA 3UHJA 3K72B 2BEVA 4DV4B 1K0UA 2ZYRA 1QHHB 4PQYA 3F6YA 2FEOA 5COQA 5L53A 3QVGB 3K0FA 1NY5A 4EZBA 1TTHA 1MC1A 1T9GR 2O0HA 3GFGA 1M8FA 1F5SA 2XD4A 4BP9A 1M5RA 5FLKA 1ZESA 3AF2A 3JQ7B 2UV8A 2ZSBA 3RSZA 4G1BA 2NZYA 2JLVA 5IARA 3EXG1 1SUBA 3WVNA 3OA2A 1T5LA 2CJFA 2CCKA 2WIAA 3EZ9A 4NK5A 4Q6WA 1NNLA 3KWJA 2AMVA 4IL5A 1ZN7A 1Y9ZA 3D2AA 5DM2A 3FSEA 5DZSA 4Q18A 4FFOA 1ZOIA 3UUWA 1RXVA 4RQBA 4OIFA 1O08A 4K9RA 4HOYA 1XMSA 2J4DA 4ZICA 3QX3A 4XB2A 3ZJVA 2WZCA 1BDMA 1MIHA 1XVUA 3UFXA 1RRPA 1UKAA 1Z07A 3GCDA 3TPCA 4F5EA 2WINI 1YVEI 1ISJA 1NC1A 1SOVA 1A69A 2PUCA 3EZNA 4TROA 3NBZC 4WWHA 1PDOA 5CLHA 2PTHA 1DUIA 5AXAA 2VDLB 1Y3AA 4P22A 4RKFA 3KFLA 4EYQA 5DI3B 3EDYA 1I36A 1SCNE 4F2PA 1QO9A 4NZZA 3FFTA 5JBQA 2W42A 2GYVA 3L49A 4PZDA 1X3LA 3KR0A 1QKIA 1FQJA 3NVDA 4NU5A 4ZQCB 4CLHA 2WSBA 4ZVMA 4J1SA 4GVPA 4WZBE 3VPAA 4LMRA 3F4KA 1US8A 2X9NA 3G5UA 3ZGLA 4EUKA 1D6SA 5LXTA 4RTMA 3LQ2A 4RLFA 3SLGA 4UOEA 3COSA 2EF1A 1GV1A 4ZDWA 3H2ZA 4FYJA 1JDUA 1OYVA 4QDJA 4OHZA 4YXFA 4MSUA 4TKMA 2EJCA 3U0BA 4LDPA 3JAWA 5L4LA 4PC2A 2IYNA 4JLVA 4US2R 3HTXA 1M0EA 2GH1A 1ICEA 4MVYA 1I1OA 1P4RA 4G5OA 4ZOCA 4XDYA 1ZWKA 2GDZA 4U63A 4DMCA 3T41A 3TSZA 4KVZA 1W0KD 5AOBA 3ZKWA 4AZ3A 3KQUA 1IVSA 2O2EA 5IUJC 1LLQA 1IY1A 1CY8A 4JT4A 3RT1A 4EW6A 5IT5A 3FTDA 3WLAA 4JP1A 2J3EA 5CGQB 3DEFA 4LJYA 4ARAA 4I4LA 3A26A 4CKEB 3JWJA 2Q5QA 2IYEA 1LQ2A 4WACA 1U6KA 4X1YA 2ZJBA 3I42A 3RHFA 3TBFA 4PLTA 4AB1A 1GKYA 2G77B 2PJZA 1T26A 2C98A 3TTTA 3CC8A 3BMQA 4H6WA 1E8MA 2PX2A 3A1FA 3N2GB 4MYTA 2NYUA 1AN0A 1WMAA 3RG8A 3D64A 4V0NA 1FLVA 2HWXA 4FLFA 1YZKA 4MYHA 4BFUA 4B84A 2Y0CA 3C98A 3GRVA 1L5LA 1EUDB 2EW8A 2QTFA 1V45E 3PUYA 1PJCA 1U7XA 3OT5A 4MOWA 4QTZA 3ZWPA 1ST2A 4M0FA 2EP5A 4YRLA 1SPXA 3STYA 1WKVA 1OLOA 3KB8A 3I6ZA 1OPRA 2RB4A 1YA8A 3CNHA 3P0FA 1W8DA 1TLLA 2WHEA 3BK2A 1K8RA 3BSFA 3KUUA 4MX8A 5CA0A 1BDBA 1KS2A 2R7LA 3O9MA 1YZNA 3NAZA 4H7KA 4QUEA 5KKNB 3HLKA 1CT9A 4FHCA 5ALUA 2B94A 3W5DA 1R4MB 4XIGS 5ALDA 2CV1A 2OK8A 1DRUA 1YD7A 1PNVA 2B9EA 4YJ2F 5A02A 2ZM6B 3E18A 1ZP6A 1QYWA 3TG8A 3VHRA 1QH0A 4CU2A 4P5EA 2P6NA 2YHIB 1NWHA 4GPD1 2E82A 2WIJA 5K05A 3A1SA 3GLHB 4H17A 5FRDA 5KWJA 1BU8A 2IDZA 221PA 5K7SA 1F2TA 1PG2A 2XYRA 2G08A 2SECE 3QLUC 5EMJA 3WSVA 5MN4A 3AZOA 1U5BA 1GDDA 2DLNA 4OLJA 2VJQA 1T6XA 4U2KA 3ZIAD 3NAQA 4D4KA 3Q87B 3MJCA 4FFLA 4PN7A 2IF2A 3P2YA 2A33A 3HDHA 4E5MA 1QV9A 2PT7A 3E7FA 5U4XA 4BO0A 2OZPA 4HNTA 1QHFA 3IEKA 3I62A 3Q3VA 5HKBA 2VZEA 5DHUA 5JAUA 1M67A 2C59A 2GPAA 1Z15A 4XW2A 4X8LA 1P9NA 4XKJA 1EWKA 3G0OA 3R4CA 5T6MA 5CT8A 4F12A 2NZWA 4ZI7F 5JYDA 4GD3Q 4J7CA 3KB6A 1NDQA 1GT6A 1M1XB 4BRWA 4BP1A 2FG5A 3CUSA 4YAJA 1N3BA 3CR7A 5E6UA 1JX6A 1N7GA 1H1LA 3OJFA 3OQ6A 3B52X 4TXJA 1GPWB 3UV3A 3VYRB 5KREA 1XV5A 4HRXA 4AIIA 2BP7B 3DB1A 1SNYA 4CKXA 3HVKA 5E7QA 5EIWA 3PEUA 5DW3A 2ZUTA 3UGQA 4F2GA 1S2IA 5HK9A 5JASA 3W5UA 1PV1A 1X8JA 2EIHA 3JVDA 4BNWA 3NIGB 2ZTSA 4U9UA 1FY2A 1WMSA 3FX2A 3AVPA 4A2PA 4MR7A 5AKZA 1BRTA 1V5GA 2B2CA 3FDFA 3U7QA 2CL0X 3AYXB 1OGJA 4EJMA 5FNVF 2FDCA 1XPUA 5DNUA 4O4IA 4IGEA 1Y6QA 1USKA 3KQYA 2A88A 4F0JA 1YJAA 1QVAA 1I4DD 2JLBA 1EK6A 2GS9A 1J0DA 2XKAA 1VIAA 3IAHA 5J2UB 3EMBA 3KZVA 3RVMA 1I7SB 2R6CA 4MZXA 1LGYA 4YI5A 1SUPA 3CBQA 2ZYGA 1QHIA 4RZSA 4X84A 4ZU1X 4BV2A 1HT1E 2BW0A 2FEAA 3BS4A 3FPBA 4O59O 3M4NA 4GF5A 4PW0A 4ZGBA 3OJ0A 4I1OA 4C7OB 1N6IA 5HDQA 4ZEMA 4XIFA 2X23A 2IX3A 3MS2A 1E2EA 4LWQA 4CF7A 3SC2B 4DIUA 3WYDA 2C2OA 2VP6A 3BGSA 3CZCA 1JQEA 3JASA 5ILGA 3ZQ4A 4I9GA 3FHJA 3PNQA 3PXCX 1KU6A 2B4AA 3FYSA 3IV7A 4EF5A 4DMLA 4PVCA 4DMUB 1V8PA 2Z4RA 3TLJA 2IZOA 3AFNA 3RYHA 1R6DA 4NMXB 4BMYA 4WBNF 5BN1A 3HVRA 5CRIA 2Z9DA 1VKJA 2AG1A 2QSZA 4BQEA 5ERXA 5JFGA 1JR3A 1IN7A 1CQPA 1PFGA 4KWEA 3T5MA 3J7AC 5LYYA 1RTKA 4C03A 2QZZA 4CETA 2GCIA 1GPKA 2ZYHA 3IDSA 3R09A 3EOBI 3LWNA 4XJXA 2ZDGA 4M49A 1FP4A 3ZYZA 1JTEA 2CMHA 2YHBA 4Q01A 3AM5A 3WJ1A 3UJBA 1FFBA 1HNNA 5FWYB 4IFEA 1DGQA 2BSXA 1XA4A 2R5FA 1CY1A 2IYSA 2O8NA 2ZJ3A 3EK2A 2GB4A 1IEQA 2DTDA 3I23A 3DF7A 4UAGA 1ZS9A 4LG1A 5KOYA 1MH9A 4BFCA 5FWXB 3AB3A 1W88B 2YN4A 4F5WA 5EFZA 2WLTA 1GNLA 1L7EA 3ICQB 3PDUA 1BNCA 2XEDA 4NF2A 1OLXA 1DBVO 3PEFA 1T9KA 5D6NA 1X70A 3R8XA 1DU4A 2LE0A 3USES 3WWEA 2V1XA 3R3ZA 1NVDA 4R8VA 3TI7A 4O1IA 3G2HA 4OMDA 4B3SB 3ESXA 3RS8A 1CJTC 4L51A 3B1XA 3EWNA 1U3UA 2YR0A 4YCSA 2MU1A 4PX3A 3VKGA 3WYEA 1NE7A 3QXJA 3JARB 2EJBA 4M0KA 4TV9A 2WB2A 1AQLA 4EMTA 1TD1A 3JQ6A 1JW9B 1UZMA 3MTIA 4JLJA 2ZZMA 2R47A 2ZYAA 1C0PA 1QPBA 4QVKA 3E53A 1VKOA 4CLDA 2EYUA 2P69A 4CMEC 3HGQA 4OQFA 5IC5A 1I4WA 4LVCA 3L02A 3GJZA 1UDXA 3Q40A 3B8HA 1TPZA 2Z57A 4RF5A 3DV2A 4X20A 4BVEA 1FLAA 4Z2YA 1Q1NA 2GZHA 2I91A 1WUTA 2B8TA 1G0NA 4OSPA 4RVDA 1SA0B 1ZW6A 1VGQA 1VKZA 4ARVA 1HY3A 2RK6A 4GECA 4BIIA 3LP5A 2XQFA 4FCTA 3AIIA 4EPYA 4CM8B 4HWRA 2PH1A 4RVGA 3CXRA 3USCS 1Z0AA 3CVOA 1A04A 2IU4A 1QH1B 2PEYA 4MQBA 2NU7A 2I54A 4QKQA 1W44A 3OA0A 1OMOA 4YFVA 4FCWA 3Q7RA 4LOAA 1QKKA 3EG5A 4DC1A 4FQ7A 4WN9A 2COUA 3IP3A 2XR1A 1JAHA 4M98A 3RROA 3W2TA 4QWMA 4H1TA 2W2KA 5TVGA 4X7PA 1X19A 2LVBA 4NNOA 1HQDA 2DQZA 4M9RA 4R8RA 3AF6A 4H0FA 1FUIA 4DREA 2EWWA 4EFKA 4JGGA 1JQBA 3ZXUB 1VPEA 2P4UA 2KS6A 3VFDA 3X43A 1CULC 2G9VA 3COYA 2PY6A 1JG3A 1Y5RA 4J1TC 3QEJA 1N5DA 1MEOA 2F9MA 4Y0VA 4LGMA 2ZYVX 2J5QA 3W3AA 3SQNA 4EO9A 4YDQA 5FWNA 1J42A 3WFIA 4DIDA 3GRAA 1MIOA 4QBTA 5HUHA 2HFJA 4A92A 1DBRA 3RS5A 3WAKA 4XWAA 1X94A 1KVQA 2XDQA 5EQFA 3OCVA 1PO7A 1GGEA 3ESCA 1SUDA 1WCV1 5P21A 1X1RA 1RS0A 4RVSA 4J0DA 4BFTA 5LQNA 3EQ6A 3JWHA 3C6XA 1F8YA 4CL0A 3UKDA 4C1BA 4ZAVA 2F9FA 4N5LA 1OFTA 2BEJA 1PT5A 1C7JA 1U8TA 3I1FA 1B26A 2AOWA 3I6QA 2I80A 3KM0A 3P97A 4GX2A 4XIYA 1NQXA 1TXGA 3W2IA 4A10A 1A1VA 4NATA 2FR8A 2A58A 2Y0EA 5HSGA 3SHQA 3WKBA 2JD1A 4L0QA 1VCNA 2AUTA 4G65A 1YI8A 2PJUA 4U7FA 1TT7A 5AVSA 1I3NA 3FCSB 2E87A 4KMRA 3FJ1A 3SOPA 4B5LA 1ISSA 1R4NB 3HXLA 1ZK1A 5C1BA 5IFLA 4ZN6A 4UPEA 1KOLA 4IVQA 1ACLA 5AR1A 4AROA 2BGGA 5ALTA 2QTTA 4M86A 2ZQYA 2WF7A 3AHGA 3BM5A 3MTJA 4MIOA 1T13A 1Y89A 2PXAA 3EZXA 2DX7A 3RHZA 2O7NA 5ALHA 5A3RA 4MIYA 3RNOA 4QUBA 2F3TA 1C9KA 3I9FA 3LHDA 3HLTA 4LBZA 4B09A 3FYHA 4OXRA 4UBLA 3DZIA 3BHIA 2H1HA 3LUAA 2Y93A 3C16C 4OKIA 2V7EA 1BE1A 1SC4A 1SUFA 1X0XA 2NQTA 1V1RA 1XTPA 1ZNZA 3FKQA 3GHYA 3JQ8A 4HAOA 5BVGA 2UYCA 3PX7A 3U62A 2V65A 4RE6A 2QT1A 4Y67A 4ZQFA 5BXQC 4KO4S 2ZXUA 2O8FB 1M2OA 4HNQA 2J4FA 2WMOB 4KBFA 2PWPA 3REFA 1H2AS 3AK4A 5AW2A 5B1HA 4X92A 4A0HA 4IXNA 1QG6A 3OZ7A 1WZCA 3B2QA 1LLCA 1QHGA 2Q2VA 1QC5B 1TDJA 1ZUNB 3MC1A 4O0LA 5EUCA 4BWVA 4FNMA 4YAOA 2CEAA 2F8TA 1DUSA 2ZAIA 1KXZA 4Q4JA 1P2SA 3QKWA 4MUIA 1R0XA 4DM4A 8OHMA 4LE0A 3BH0A 2IV2X 1KYXA 1FRNA 1WULS 3P1JA 4MR9A 5JV5A 1N8KA 1U02A 3KJIA 3SHOA 3SNKA 3CH7A 3SXUB 1SRRA 4BNFA 4UUOA 3IEVA 4Q4AA 1Q1ZA 2ZDHA 1X2EA 2HV8A 2R97A 3DEZA 3NHRA 3Q9UA 4JEUA 3UJ7A 1B7GO 1MP0A 1C2YA 4LFCB 1Y8QB 4HDMA 2C4KA 1WUKS 1KZ7B 4DMMA 1QVZA 2B1JA 3ROEA 3RIMA 4WASA 1FA9A 4CF6A 4LX0A 3PLNA 2PPLA 2VP0A 3K9LA 1HRDA 2V58A 2YW2A 5JSQA 3GRUA 2VC2B 2JGMA 2FPOA 3BMXA 1DB3A 4KZKA 2G6BA 3ZJTA 3UJAA 2XJ4A 4YR7A 5EUQB 1CJKC 1HWYA 2ZXEA 5IVHA 2XTNA 5IU6A 1L5SA 1KDTA 4JXJA 4QYSA 2EATA 2ZYUX