1SCQA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetonecyanohydrin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
total genus 92
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1scqA00
5CH3A 1QO7A 1G42A 1ZICA 5FOQA 4BP9A 2HRQA 3IA2A 2XMGA 3WK5A 3FSGA 2AJDA 2XE4A 4QDUA 2Z5GA 1DWPA 4EY6A 4AN0A 1H23A 3X3HA 1N8SA 3ED1A 2XT0A 3A2LA 3O4GA 2XMDA 4W1QA 4NVRA 4CG2A 4GLBA 2WTNA 1UKAA 1MX1A 2VA9A 2R8BA 2XUDA 1QIEA 2CKMA 2RAUA 3H17A 2OQVA 4DMCA 2XMRA 1P0IA 4WFJA 2ES4A 3HI4A 5DTJA 1MNQA 3D2CA 6YASA 1W6RA 2BUCA 2QXUA 4E11A 1BN7A 4Y2VA 1JKMA 3O4HA 3UMJA 4M0EA 3WI7A 1EDBA 1QIFA 1XZFA 1AMNA 5CT5A 1ZI8A 2ROQA 2O2HA 2WUEA 3BE8A 3ESBA 4D9JA 1XZIA 1THGA 3L1HA 2QS9A 1EK2A 2RIPA 1UT6A 5ALFA 1B41A 3C6ZA 3W06A 3ESDA 3H2IA 4UFNA 1L7AA 3JW8A 4BATA 4YX9A 1TKRA 2OPHA 3WKBA 4WCVA 1LPMA 4B82A 5I9IA 1XZCA 5ALNA 4XWGA 1T2NA 3NUZA 2J3DA 3PFCA 1ZD3A 4EHBA 4B83A 1TK3A 2PUHA 4KEAA 4FWBA 5ALOA 1LPNA 5D6OA 2OGSA 5AKIA 1ZJ5A 2AJLI 1Q83A 4X85A 4U2FA 3DEAA 3G0BA 3H2KA 3WL6A 2IIVA 5T4FA 2FX5A 3WIOA 2YYSA 3MUNA 4IH4A 4ZI5A 2BJHA 2ACKA 3UUEA 1XRMA 4Y2QA 1UOOA 2X5XA 1QJ4A 3M81A 1H22A 5HKAA 2BFNA 3M82A 1AC5A 5DWDA 5K5EA 2ZYHA 1WB4A 1HPLA 1XRPA 1GXSA 4ARBA 3G7NA 5FUMA 5CT8A 3KDAA 1AX9A 2D5LA 3ZV7A 1NU8A 4H18A 1XQWA 3VJKA 4MEBA 4QDZA 4U2CA 3VVLA 1XKTA 4C88A 3AJAA 5EIHA 5FP0A 1WPRA 3WKAA 1EA5A 1ZOIA 2I03A 1QFMA 4Y2TA 1UK8A 1C4XA 5IVHA 1UOQA 4J03A 2WU4A 3U1TA 3IBTA 4J3JA 3HXKA 2G5TA 5A62A 1X2BA 2WILA 4WDRA 1MX5A 5ALHA 2ECFA 3STTA 1VZ3A 3W9UA 4H7KA 1VA5A 2WUFA 3AILA 4I3FA 1ZGBA 2XI4A 2BGNA 1W75A 4X71A 4V2IA 3G0CA 1USWA 2HDWA 3SX4A 3CCCA 1PFQA 4X93A 4CFSA 2XMCA 1U8EA 3WL5A 5K3FB 3PE6A 1UKCA 3DYVA 4P9NA 3QYJA 3IULA 2V9ZA 2X8BA 1GQSA 1VZ2A 4UHHA 2WHQA 2QZPA 1EVEA 1E66A 4KACA 3MGAA 5DNVA 3WL7A 3WJ2A 1K8QA 3PDCA 5AI4A 5JD5A 1R3DA 4WDQA 2HU8A 5ALKA 4OU4A 3WA6A 3KSRA 1ODSA 3KD2A 1YAHA 2H9YA 2J4CA 3W04A 1RWQA 4HXGA 1QIGA 1EH5A 3BJMA 3V1MA 3R3VA 4UBIA 1KEZA 3DYIA 3R40A 4UBKA 5JAHA 1JMYA 3K2IA 3WWPA 4XX1A 4I19A 2RHTA 3KOOA 1R9NA 3B3QA 1XZJA 1ETHA 4Q82A 3LP5A 3W2TA 1ZJ4A 2WIFA 3WKEA 5AHXA 1HKHA 3P2MA 3VJLA 5HKBA 1XFDA 2GBCA 1HBJA 1QIDA 2WFLA 2C0PA 2BUAA 3A2MA 1ZD4A 4ZRDA 4RGYA 7YASA 5AKLA 3WK9A 3F96A 3O95A 1MTZA 1GPNA 2C58A 3AZPA 3QMWA 5CH5A 5SYNA 4BAGA 3OTQA 1DX6A 5AH0A 3ZLVA 2QRUA 2Y6UA 1YCDA 2JGJA 4L3WA 4BDTA 2XUFA 3FBWA 2EEPA 2ZJ7A 3HACA 3G02A 1Q84A 1R88A 4HZGA 5LZ8A 5AICA 4DNFA 3GELA 2VATA 4J7AA 1MX9A 1TQHA 2CZQA 1BROA 4KE9A 1THTA 3IVMA 5ALUA 4QLOA 2LIPA 4S0XA 2PUJA 1YS1X 3R3XA 2IITA 4YPVA 5JAUA 2VTVA 1LBTA 1LPSA 4AZ3A 3N0TA 4Q05A 4ZGBA 4EY7A 3L1JA 3PI6A 1BCSA 2QVBA 3QPDA 2QXTA 4Y2YA 1Y7IA 5CT6A 3I6MA 3OOSA 4OPMA 4W1SA 3HJUA 3A2NA 4PSUA 4AN1A 4FNMA 1CQWA 2Y1KA 4DM7A 3D5EA 4W1PA 1MO2A 2WJ3A 4DNQA 3ZWQA 3QPAA 5KREA 1WM1A 2BAGA 2OXEA 1UXOA 4JEIA 2DQYA 2VJAA 4MQLA 3WZLA 1M33A 1CUZA 5CXUA 5BV7A 4X3CA 4C4XA 2XQJA 3EF3A 1SC9A 4FMPA 4BBZA 4PQEA 3ESAA 1J2EA 2XLCA 3M83A 3QBJA 4JNCA 4AMZA 3QITA 1UKBA 4FOLA 1CUYA 1CUAA 2ZSHA 4G4GA 5KBYA 2C4HA 1VE6A 4N5HX 5ALEA 5AKKA 4OB6A 2OCGA 5A7FA 4Y2JA 4BVLA 3TJMA 3O4JA 1MAHA 1TIBA 4BC0A 1BU8A 3STWA 4AZ0A 2ZJFA 1B6GA 5HK9A 5AI5A 5ALVA 5AK4A 1HLGA 1C7IA 3K6KA 4Q3KA 1Y7HA 2RONA 3PF8A 1W4LA 5HF9A 3DNMA 3EQ9A 5JADA 1G4HA 5AM4A 4X6YA 2AJ8A 1YSCA 5IVDA 4NS4A 1R50A 1Q0ZA 1VXRA 2XUOA 2QR5A 5LIPA 4BE4A 2QUAA 3PUHA 3F9CA 4B85A 1A8SA 4XIIA 5ALYA 3JWEA 1GKLA 3OM8A 4G4JA 2CEKA 5AJHA 3NGMA 5AI6A 3OPMA 2G5PA 1SOMA 3EQ8A 3WIBA 4X7BA 4HRYA 4KR0A 1J06A 3D2AA 3D2BA 1CUEA 1J07A 2O7RA 1WHSA 1CRLA 2WKWA 3S8YA 1P0MA 5AM5A 1MU0A 1W76A 1P0PA 3IUNA 2JGFA 5ALLA 1IZ8A 2GYVA 4FFWA 5CH8A 2ZJ6A 2QJWA 3RM3A 4ZV7A 1AKNA 2JIDA 5AKHA 3KWJA 3OG9A 3BJRA 4CIAA 1X2EA 1GQRA 1UZAA 4GW3A 3H1AA 1XKLA 2D0DA 2V97A 5ALGA 4UHDA 3WKCA 2PU5A 4KE8A 2PVSA 5AKXA 5E2IA 4CI9A 3G9ZA 4B84A 4BDSA 1O6GA 3H19A 5IH7A 4RNCA 5I7UA 1QIKA 4U2BA 2ZVDA 4DYHA 5EIEA 4BCBA 4CCYB 3TRDA 2XUPA 4QZVA 2VF2A 1TRHA 1P0QA 2PU7A 3D7RA 3OC0A 3WA7A 1AGYA 1QZ3A 5ALPA 2QKYA 3DKRA 4B7ZA 5BOVA 1PJAA 4EA6A 4AO8A 5HF6A 4GI1A 3QMMA 5EI5A 3C70A 3G9UA 1QONA 2ACEA 4EBBA 3H2JA 1MJ5A 2IX9A 1QO9A 4LIPD 5AO9A 2NW6A 1U65A 1E89A 2I3ZA 5AKGA 5AI8A 2GBFA 5EIAA 1AUOA 5HF5A 1MNAA 5IVIA 3I28A 4FBMA 4ETWA 2OCLA 3IIIA 3FLEA 5CBKA 1K63A 3FYUB 1E8DA 1YS2X 2CMFA 3V9AA 1WHTA 5E4YA 1FJ2A 3IUQA 4B9AA 1BRTA 4HS9A 3H2GA 1ORVA 4MWTA 2RGUA 3PICA 1ODCA 4IH9A 4LYEA 2HA2A 1L7QA 4O08A 2C5FA 1LPPA 4G8CA 1X70A 2OLEA 4Y2SA 4JYPA 1EK1A 2WFMA 3VVMA 4NZZA 1GKKA 5JD6A 1CUBA 2Z8ZA 3CCBA 2HA0A 4JH0A 4QWWA 3HABA 1IMJA 3HRHA 2PM8A 1QIMA 3FVRA 4A5SA 5CT4A 2YH2A 5KWIA 3ESCA 4H35A 4CG3A 5YASA 3STXA 3HEAA 5FV4A 2O2IA 4LHEA 2OGZA 2XMZA 4H7HA 1DINA 2HA7A 4X92A 2PSDA 4IQ4A 2HIHA 1T4MA 2JGIA 3I2IA 3O9MA 1XZGA 1QIJA 2OQIA 1Q0RA 1D07A 4LXHA 1XQYA 4DNOA 2DHDA 4FTWA 4X6UA 4WFKA 3VDXA 5C8ZA 2XQKA 4F60A 4GHWA 4BC1A 4OU5A 2W6CX 1JI3A 5JAOA 3I2KA 4UUQA 1YA8A 3FVTA 4J0DA 3TEJA 3CXUA 1XRRA 1JMKC 2PSJA 3QVMA 3AZOA 2DQZA 3B5EA 3FCXA 4UPDA 4B0PA 4B81A 2RI6A 1ODTC 4FFVA 1BN6A 1MPXA 2ZYRA 4UBMA 4QDTA 4W63A 3C87A 3EQ7A 4OB8A 5HQ3B 4CIBA 5HCUA 4JYMA 4OD0A 4X91A 3GZJA 3ILSA 3I2FA 5EHNA 5ALIA 4IHAA 4BZZA 3RLIA 2VT6A 5HQ3A 4M0MA 3RK4A 1HDEA 1ZIXA 3GA7A 4K6KA 4KE7A 4LKOA 3QPCA 1AZWA 5HF8A 1SCKA 3JYHA 1XZDA 1YR2A 1QOZA 2G4LA 1DQZA 2XMQA 1O6FA 4BVJA 2WHRA 1YB6A 1QGED 4BB0A 2HU5A 4LYDA 3V1KA 1FFBA 1ORWA 1BEEA 1CVLA 3Q8WA 1EB9A 2JF0A 4U2GA 2GBGA 5C7YA 4HAIA 4HRXA 4DGQA 2JEZA 3DOHA 1F0PA 5ISMA 3G0GA 3ICWA 4CCYA 2QTBA 1AQLA 2XMBA 3LLCA 1K4YA 3H2HA 3AIKA 5H3HA 5DYYA 4DSAA 4UFPA 3A70A 3KWFA 2Y2UA 4Q34A 2OCIA 2WG2A 3FLBA 3BL8A 4WY5A 3QH4A 1MAAA 4LXGA 5I8PA 3C5WP 2DHCA 1AURA 1QLWA 3C8HA 3WLAA 3MVEA 1CUHA 1GZ7A 2ZSIA 1ZGCA 5LP1A 1ISPA 1DU4A 1UFOA 3HZOA 2WG1A 4E15A 1EINA 1CUGA 3G9TA 3UUFA 1IUPA 5FRDA 3BXPA 4BCCA 2ZYSA 3WWEA 1OCEA 4PF1A 4PW0A 4B9EA 1N5MA 1XZMA 5HZGA 1QIHA 2YXPX 1GT6A 4W9RA 2CJPA 3K9BA 3C43A 4BP8A 2YASA 5CURA 3STYA 4P92A 4WJLA 4RE5A 5C8XA 1JU4A 5A7HA 1FFAA 1DTEA 4BRSA 4BAZA 4KRXA 5SYMA 4KYVA 2O2GA 4WY8A 2HA3A 5JASA 1EI9A 1TAHA 2R11A 2CUTA 5CRIA 1LNSA 4N8EA 3GBSA 3ZI7A 3QMVA 3FYUC 2AJBA 1BCRA 3E1GA 2AJCA 3DLTA 4FBLA 4KAJA 2W22A 3C6YA 4FLMA 4Y2UA 3EIOA 2Z3WA 3R0VA 1MT3A 3V1LA 4HVTA 2WJ6A 3RARA 4OUKX 4TVKA 3WWOA 2OG1A 5EGNA 1XZKA 5DTIA 1CFJA 4MJ3A 5LZ4A 1BEZA 3YASA 3WZMA 1OXMA 5T4EA 3DCNA 3KXPA 5K3CA 3CN7A 4ROTA 1FFDA 4BVKA 4B0OA 4RPCA 1R9MA 5DYTA 3BWXA 1XZEA 2WG0A 5K3DA 4Y7DA 4C4YA 5AM3A 1E8NA 2Y6VA 4K5QA 3E4DA 5AOBA 2UZ0A 5DNUA 1ZI6A 5T4BA 3IB3A 4FDMA 2OAGA 3SWWA 4EZIA 4DLNA 4QDXA 1DQYA 4UHEA 2PX6A 1FSSA 3WK7A 2HA6A 2GBIA 1C7JA 4GBGA 1NX9A 1F8UA 3BDIA 1EB8A 1R4ZA 3ICVA 2VJCA 1E5TA 4GECA 3T4UA 1QTRA 5A7GA 3FAKA 2P8SA 2WU3A 4KRYA 2PBLA 5F4ZA 1XZBA 4U2EA 4KAFA 4BYMA 1CUCA 1HL7A 5AOAA 5AKYA 5FXMA 3W05A 3STUA 2EDCA 3TGLA 4H7IA 5A71A 5FPPA 5D3ZA 2C0QA 4B80A 5K3EA 2HFJA 1EVQA 1A7UA 5ALMA 5C8VA 2B4KA 2VAXA 5LKAA 2WIDA 4UHFA 3ANSA 3R3ZA 2VQ6A 4GWLA 1G66A 2AXEA 2GYUA 3B12A 2JGLA 3VXKA 3F97A 1CUWA 3WWDA 2V98A 1F0NA 4G5XA 4N8SA 3C6XA 5AKJA 4AO7A 3FCYA 4X95A 3Q0TA 3WWCA 1VE7A 3HYSA 4C6HA 1E3QA 4QA9A 1CEXA 1H2XA 1CLEA 2BCEA 2H7CA 3IUMA 4J0GA 3BF8A 2WFZA 1UOPA 2JBWA 1ACLA 3A6ZA 5ALQA 2XQIA 2VJBA 5ESRA 4ZXFA 5CXXA 1IUOA 2H1IA 1I6WA 1YA4A 4KAAA 4H7EA 3GFFA 4BTLA 2PSFA 3O9VA 2RHWA 2VAVA 3WK8A 4EY5A 3EBLA 4N8DA 3LCRA 2PKYX 1W1IA 5FKJA 1LBSA 1FFCA 3DKKA 1EDDA 1A8QA 4OYLA 1CUSA 4H7DA 4C87A 3R3UA 5JIBA 1XQVA 1XLWA 5LKRA 4OB7A 2DR0A 1CUUA 4A16A 2EDAA 3AZQA 3C5VA 1IVYA 3AUKA 4Y9SA 1XZLA 5ALSA 4PO3X 5HFAA 4F5ZA 4AX4A 2HA5A 4DTCA 1GPKA 4QLAA 2WJ4A 5LZ9A 1JU3A 1XRNA 4G9EA 3GUUA 1ZD5A 3SK0A 4K2AA 4EY4A 4J0CA 2WFLB 5ALWA 2HM7A 3LS2A 4KE6A 2VT7A 1QTIA 4ZWNA 3WKDA 1N1MA 3D3NA 4BTVA 2GYWA 1EHYA 2XUIA 3U0VA 5EHQA 1WOMA 2B9VA 1XROA 1EXWA 5T4HA 3S2ZA 2HADA 4Q3OA 5CMLA 5KWJA 1U2EA 1WB5A 5DYWA 2PL5A 4FLEA 4ARAA 2H7YA 2WM2A 4HXFB 5LLSA 2WIGA 4INZA 4AB1A 1QE3A 1UK9A 4UBNA 3VISA 3C45A 3D0KA 4UFOA 4DIUA 4L72A 5JZ9A 1L7RA 3RKSA 3FYUA 1ZD2P 1SCIA 5FLKA 4J0JA 2HL6A 2WTMA 4BAUA 4G4IA 1XZAA 2O7VA 2PSHA 5JZBA 3FSGD 2B20A 3WYNA 4BRZA 1XQXA 4G9GA 3AIMA 4L0CA 4X90A 4WFIA 5CTAA 3IURA 3ZPXA 2XQFA 3C8DA 1CUDA 4PV7A 1JFRA 3F67A 3I2JA 3DJYA 1GPLA 2HRRA 1H2ZA 4XVCA 4MWSA 1LZKA 5LYYA 3BF7A 4OCZA 3BIWA 4K6GA 5EHXA 1J1IA 1VXOA 1LGYA 1NU6A 5AKEA 3T52A 5AK3A 5AP9A 5IKXA 4TGLA 3V1NA 4NMWA 5ALJA 5FDFA 4E14A 2XLBA 2OCKA 3WYDA 4EB0A 4EY8A 3DDUA 3LIPA 2V96A 1S8OA 3FLAA 2PPLA 4Q1VA 4H7JA 1R1DA 2XB6A 3I6ZA 2JGEA 1QFSA 5DLPA 5DNWA 1ZI9A 1W52X 3VJMA 2QUBA 2FUKA 5DJ5A 4I4CA 1CR6A 3CN9A 2K2QB 2C7BA 4B6GA 4DMFA 2GZRA 2JEYA 3FYTA 4MQMA 1IZ7A 4HXEB 4HTAA 4Y2RA 4TPKA 5ALTA 3G9XA 5ALRA 3R3YA 3M3DA 5AOCA 5D7BA 4MYDA 4W1RA 3AINA 1DT3A 5JATA 2XUJA 3L1IA 4OYYA 1RP1A 3O4IA 2XUAA 4M0FA 5E4JA 3O0DA 2ZYIA 5LZ2A 3DD5A 4FHZA 1LLFA 2H7XA 3G0IA 2XMSA 3WMRA 1CUIA 4UBLA 3IDAA 3STVA 2WIKA 1XRLA 3H04A 3I6YA 4X00A 5D3KA 4BZWA 2JGKA 1ACJA 5K3BA 1YASA 4PSCA 2VJDA 2JGMA 4J0HA 4G1FA 3ZLUA 1CUFA 2HHAA 4G8DA 4YK7A 5IVKA 4OSEA 4C01A 3H0CA 1TCCA 2WUDA 5AI0A 1U4NA 1SCQA 3BDVA 2I78A 4DMKA 3WK6A 4EUSA 2XQGA 5AM1A 4QWMA 3QZUA 4GEGA 3HC7A 3AIOA 1XZHA 1JJFA 4DSZA 1BE0A 1VA4A 4CCWA 1Z68A 4ITVA 5FPQA 4DMHA 5JARA 3GROA 2QM0A 3SC2A 2VEOA 2XUGA 1N5RA 4E46A 4X6XA 5JYCA 2E3JA 4DNPA 1F6WA 2Q0XA 4AQDA 4ZREA 2WIJA 1JT2A 2G63A 4FNGA 5AIAA 4RE6A 4J0IA 1DX4A 3MUOA 1CQZA 3E0XA 5EHZA 5J3JA 3I1YA 1H2WA 1LZLA 4FKBA 1WCYA 2OGTA 3N2ZB 4A23A 4N5IX 3WJ1A 1RYYA 5CT9A 4ZV9A 2WSLA 1CUJA 3I2GA 1GGVA 1KU6A 2ORYA 2CBGA 5JAPA 1EDEA 3HLKA 1XRQA 2Z8XA 5AIBA 2DCMA 1JJIA 1K6EA 4PNZA 1DWOA 1G5FA 5AM0A 5LZ5A 2XDWA 5ALDA 2XUHA 2VSQA 5LZ7A 2GZSA 4IH1A 3WQHA 4PSDA 1TCAA 5ALZA 5HFNA 2OAEA 4G8BA 2I3DA 3WK4A 3FNBA 3NOXA 2HFKA 1CV2A 4H0CA 1CUXA 3DQZA 4K6HA 4UBOA 4XJVA 4X97A 1PV1A 3D59A 3V48A 5C81A 1IUNA 3DL7A 3R41A 2X76A 5JANA 3G8YA 3C6BA 3G0DA 3IUJA 3W9BA 4GXNA 4QNNA 3PF9A 2PSEA 3QM1A 1SFRA 2C5GA 4UHCA 5JALA 1VJ5A 4H77A 1A8UA 5E4TA 2DSNA 4Y2XA 3PUIA 5A2GA 1ZIYA 2J4FA 3D4LA 4F21A 3I1IA 4UHBA 4AXBA 3FOBA 3F8SA 1YB7A 4KJXA 1QIIA 1UK6A 1CUVA 5HK8A 4QE3A 5K3FA 5A6VA 2ONCA 4LXIA 3H18A 5JD4A 4AO6A 3AFIA 4IO0A 3ZLTA 4F0JA 1CIJA 5ALXA 1DT5A 2B61A 2HA4A 3NWOA 1KU0A 2WUGA 5CW2A 2WLSA 3F98A 1VOTA 4Y2PA 1FFEA 1UWCA 3E3AA 4C4ZA 1E8MA 3DOIA 2DHEA 4BE9A 1WB6A 2Y2VA 5AKZA 2XUQA 3PFBA 4H7FA 2BUBA 1XLUA 2Z3ZA 3BIXA 2QMQA 5AM2A 5K3AA 1OILA 2QJRA 3ANTA 2HU7A 3OURA 2CB9A 3DS8A 4MYSA 1WPXA 4FLFA 1EX9A 1VKHA 4J0KA 4YASA 4AMYA 5EFZA 5JZSA 5BWCA 2WHPB 1BS9A 1LPOA 4L9AA 1TCBA 3WL8A 4UBJA 4QEKA 1HQDA 2QOEA 3R3WA 2QT9A 2BGRA 4P08A 1K5PA 4MEAA 3HSSA 5AK5A 2WQZA 4C89A 4JUIA 4U2DA 4X94A 4CG1A 3I2HA 1XLVA 1DWQA 1LPAB 5AK6A 1A88A 1H2YA 1JJBA 3LIIA 4P93A 3VKFA 4BCDA 1YAJA 2BKLA 1UK7A 2FJ0A 1Y37A 1MN6A 4Z49A 2WHPA 3H1BA 4Q3LA 4MXDA 1CPYA 1LPBB 2XUKA 2FJPA 3DL4A 2DFPA 4GDMA 2J3QA 4QDOA 5AI9A 5BWBA 3FWHA 1VLQA
chains in the Genus database with same CATH superfamily
2GCOB 3UXEA 2J5XA 6AT1A 3JQAA 2F62A 3UPDA 1GAEO 1ZICA 4OKSA 5FBZA 1FK8A 1FYFA 4ZU6X 5FV7A 4Q1BA 1XU9A 2PUVA 3WSVA 2EHJA 1YONA 4YP9A 4QUAA 4A27A 1UH5A 3Q11A 1M2HA 1NJ8A 1P6XA 2Q1UA 4OOEA 5AJXA 5SICE 2AJDA 2XE4A 4XEHA 4YMWA 5GGYA 2Q1WA 3T7EA 2QVCA 2Z5GA 1DWPA 4OA8A 4ZC8A 3KSAC 3AH8A 1OIWA 3SYLA 3ZGXA 1SQSA 2QVXX 3OJLA 4I08A 4B6RA 5FNZA 2I6GA 3INRA 1N8SA 1OX6A 3EB9A 3IXQA 3ED1A 1I2AA 3QV1A 3OWHA 3KKMA 3CVWA 1BWQA 1EGHA 2FDXA 2XT0A 3A2LA 3UJPA 4BNWA 4D3XA 3LYUA 2XMDA 4P4SB 3KT0A 1PTJA 4PQYA 1C80A 3OEHA 5ARCA 5FOSA 2BPOA 4MIYA 3IUEA 4QVIA 1H0RA 3AMVA 2X42A 3OCYA 5KAPA 5DH9A 4KDRA 5DBHX 1Y9AA 2WTNA 3LZ6A 1A97A 2VTKA 3PNMA 4I1OA 4NULA 3TIIA 4ZGWA 2WYOA 1AXGA 4JA2A 3QBTA 4RXTA 4AKEA 3AF3A 4A10A 1A9SA 1RFGE 2C2MA 2FN3A 4NTZA 4KGVA 3ME5A 1N9GA 1XZQA 2D13A 2XMRA 4OYHA 4DMCA 1K6JA 8AT1A 3A7EA 1UFQA 4M9CA 5HUHA 4KTTE 2ES4A 2GJ8A 2RGYA 3OM9A 3HI4A 5I8ZA 4PZYA 2KLHA 1P77A 3ZZ0A 6YASA 2BUCA 2CLLB 3GN2A 1BN7A 4ND7A 3UMJA 3O4HA 1SZDA 2EW1A 4L7QA 4M0EA 3HB1A 4M60A 3FM9A 1WKBA 4MQFB 3U60B 4KRFA 3JRNA 3P32A 3L5KA 3GL9A 3VUEA 1HURA 1XTTA 5LYJA 1SA0B 1L4KA 1LFDB 2WUEA 3BE8A 2Q5QA 5H59A 3QOYA 1WX1A 3TQCA 3DHVA 1TCVA 5BN3A 1UFVA 4RD4A 5ELXA 4XX0A 1R5OA 4H1UA 5DYNA 1IM5A 1AK1A 2EC5A 2EU8A 2JLSA 2WT8A 3MSCA 5GJBA 1V8BA 4HMQA 1THGA 1XDZA 2WWXA 5BV0A 3UZUA 4LJLA 3FJYA 2QS9A 1Y6FA 1FSFA 4K3UA 1AZSC 1IHXA 4ZHQB 3C6ZA 1D5WA 2QTVA 1L6IA 1IPFA 3EVGA 1GGNA 1QHNA 3QWAA 2GF0A 4XUEA 5T41A 2J07A 2C9BA 2QM3A 1R7RA 4C88A 2GJSA 2YCBA 1N0VC 4BATA 3RU3A 1GKYA 4JP2A 1PR2A 3D5TA 4KQCA 4G2TA 3TNJA 3KJQA 3W1VA 4MYRA 4EYQA 1FLAA 3K73O 3CH6A 5AMXA 1M5TA 2DVMA 3JPWA 4IXDA 3VFDA 3NYQA 5ESXA 1E62A 1U0SY 1XZCA 1XAHA 1KE1A 4B82A 1NF3A 5CITA 4XWGA 1IVSA 1L2TA 1QYXA 4H1HA 4NBSA 2DJIA 1CDZA 2RBKA 1MVLA 3B1KA 3K32A 5FI5A 3URMA 3HKCA 3VR3A 1XHFA 1JFVA 2PVCA 4JGGA 4PVCA 2H2WA 1DRKA 2IIPA 2O07A 3PCXA 4JFAA 4RAOA 4XGRA 3HJRA 4EHBA 5A4MS 9ABPA 4GOKA 2QAGB 3B52X 4RFLA 1AB5A 1AH2A 3FNEA 3E9QA 1OW3B 4X8MA 1RTKA 4LWZA 1S1CA 3K92A 1QVAA 1JDUA 2JVIA 3QVJA 1LPNA 5ALOA 5D6OA 3V7NA 4JYZA 4TV8F 1FPQA 1NYTA 1XEWX 2GPBA 4CDMA 1KWKA 2ZUTA 4F2HA 1DPFA 3VKGA 3EF0A 3RFFA 4PBTA 3OC6A 3NVDA 1Q83A 2JAHA 3SIWA 2GEUA 2O8DA 2EZTA 3LQ2A 4EJSA 3A4YA 3KSBC 3DL0A 1Z39A 4J0EA 3ND9A 1TA4A 5HZKA 5JYDA 3EF1A 4L6AA 3KZMA 2IYPA 5JCOA 4BB6A 1Q1GA 4BP3A 3FDXA 4DJDC 5E1BA 2AYYA 1DBQA 2FPLA 5LD2C 3H2KA 1DIHA 1CQIA 1PR9A 1R5BA 2AN5A 1VPTA 2YHAA 3O8LA 2QRMA 2IIVA 3NHBA 4H6PA 4HEHA 5JG7A 3KU1A 1P2BA 1UBFA 2VOEA 6GPBA 2IEYA 2Q4TA 4MQ5A 1I7DA 4KKXB 1U9IA 4ER3A 3HL0A 1O94C 2GDZA 1H0KA 4W9NA 4ZI5A 4WQMA 4QYSA 2O8DB 3JYLA 1CB0A 4U6QA 5F73A 4B31A 3KAKA 2GH1A 4NZMA 5D3MA 1GNTA 1GITA 1PJ2A 1I9GA 4MGEA 3LT5A 1X80B 1SXJA 4LEIA 3EFEA 3ZXXA 1MXFA 2H5EA 3A1FA 4LPSA 4ATNA 3EXFB 1SJ9A 1VPDA 1KMCA 2FDRA 2W9XA 3M81A 3U9SA 2IS6A 4GPD1 2GASA 2IFTA 4I55B 1PNRA 2ZYHA 5E0OA 2XGJA 1HPLA 3WYFA 3VPFA 2MJLA 2WM3A 4A0SA 1TVCA 4WKPA 2A5JA 3ZWKA 4CYMA 5FUMA 2FU5C 1I5RA 3DE0X 3KDAA 5CYOA 3U81A 4Z7JA 2J0UB 3TLAA 2C0CA 2H4ZA 2KPOA 4DARA 2I65A 1UPCA 1XXHE 4QDZA 4U2CA 2C3YA 1CVIA 3O2QB 4C5CA 1NM5C 5KQSA 3FVVA 3UQYS 4XCVA 3V55A 1XLTA 1B8OA 1PR1A 5CX1B 3WKAA 5KQLA 3WL4A 5BT9A 3QGMA 1TF2A 5JH7A 1ZOIA 2OZPA 4V0SA 3ET4A 2CB0A 2D2EA 2PKWA 2ZI6A 4FYMA 5B3JA 2VJMB 2YUIA 2MT9A 3GAMA 3BT7A 2D3WA 3LUPA 2NU6A 1PGPA 4KMMA 3DLBA 5IVHA 3K1ZA 4MP8A 4O02B 3UJ3X 3IBTA 1X3LA 3QVVA 4RQTA 3QVSA 2QD5A 1T4CB 1YS7A 1ZX1A 1R0WA 3OTWA 2WI8A 2EWMA 1WSAA 3OEEA 5EZ6B 4LRYA 1VL0A 1E2PA 2AE1A 1J25A 3L7DA 3UWSA 4I5GA 5EP1A 1JHOA 3VU3A 3RG8A 3STTA 3LUCA 3EXG2 5FWYA 5TQ0A 3O38A 4WKOA 3AILA 3MB8A 1E3EA 3KPJA 1FP4B 1ZGBA 2XI4A 2PFKA 2O7SA 4R69A 4REQB 2BEWB 2BGNA 3ZGOA 3OKCA 5F64A 4EZBA 2HCJB 1OLXA 2RGEA 1L7EA 3S2IA 1NVTA 2H1FA 2Y0PA 3CCCA 1RVDA 2FHPA 4X93A 1H1DA 5G40A 3RUPA 4KI0A 5KNLA 3K0HA 4JI4B 2REOA 3V8PA 5A4FS 3DYVA 1T0IA 3E22A 3JRXA 5AW3A 5BSEA 2B5WA 1IQ0A 1AHPA 1RLIA 3QYJA 5IKOA 3TWOA 3IULA 4FFNA 5GWXA 1E7YA 3USCS 4CXMA 4W8GA 2P9TA 2YZNA 1NBOA 1J90A 1PFVA 4A2WA 4RH1A 4CV0A 5LDHA 3OQMA 1F7VA 2E4XA 2LRHA 4Q1AA 5IYZA 2QZPA 3ZJUA 4EFNA 1LC0A 2PD3A 2GM4A 4JASB 1EVEA 3QUTA 4Q39A 4Z9FA 5EMJA 4EGAA 3Q2OA 5IMSA 3Q3EA 1EXDA 1O3YA 1CEQA 3N05A 3RFVA 3FTNA 1LK5A 1K8ZB 1X7XA 2VYQA 3PDHA 4QXPA 4WOPA 4Z51A 1Z6YA 5IKPA 1UAGA 3OBIA 4UATA 4C0KA 4OQZA 2J1LA 4E4TA 3UGTA 3H2ZA 5D51S 2IBMA 3QKRB 4JJKA 4LHXA 5FUBA 1ADYA 2FNAA 2M1ZA 1WNFA 4RKRA 3HNPA 4ZEVA 1MENA 4URWR 3UFBA 3H1FA 4NU6A 4FEYA 3EZ2A 1V6SA 1H0SA 4GM0A 2PUFA 4B3SB 3KSRA 1LQ2A 2N42A 3KZOA 1KI6B 1NBHA 1QAQA 3SF8B 2JASA 4C7BA 2HV8A 2QN6A 1KIAA 1QGYA 3DB2A 3DMFA 3EA4A 2HH9A 3JARB 1JXAA 2JKYA 4U5XA 1RWQA 1AHIA 3B1FA 1KVQA 3AEXA 1U3GA 1VPLA 3NU1A 4J7XA 4OQQA 5BNWA 1TYAE 4NOJA 3R7NA 3V1MA 1DAGA 2FA9A 2JD1A 4Z2AA 3THYA 4D8TA 2OD2A 3S1LA 4UBKA 4DLXA 5IJZA 5JAHA 3DZKA 4A9AA 5CDFE 1IBMB 2DPLA 4ZQHA 5CNJA 1P4JA 2C9DA 3D6MA 4DV2B 3JX9A 4XX1A 5KU7A 4Q5IA 3L6EA 4ZZIA 3CLTC 1SMKA 2IRWA 4D80A 1N3IA 2WJJA 3B3QA 1NP3A 2HWKA 1Y81A 2JFNA 5IC6A 3TSYA 1YVPA 1SHKA 3QU4A 4TTQA 1E6MA 5D86A 3SG0A 3FTQA 1QH8B 1WXQA 3VZRA 1VCNA 4ZKDA 2NZ8A 2TRSB 1Y6ZA 1Q77A 4MWGA 3RUDA 1V4BA 4LDRA 4EEZA 2QZJA 1P3JA 2GBCA 1XWFA 4JLAA 3K96A 2BUAA 1L1EA 3QLVC 1QYDA 1ZD4A 4LW8A 4ZRDA 1N7HA 2W5UA 4RGYA 5BYBA 1CJBA 1II8A 2KSQA 2OO7A 2PZAA 2RK6A 3KB2A 3OOJA 3KB6A 1KKUA 2Q2QA 1H9CA 3D6FA 3GNLA 2Y1GA 2LE0A 5IBRA 1DTSA 1BFUA 4EHLA 3HJCA 1II9A 1PEAA 1T6BY 1LDBA 2JI7A 2QRPA 5KINB 2FZVA 3ANNA 5I8WA 1WO8A 1RJ9B 2GUWA 3G2MA 2AX3A 1KZ9A 1MTZA 3BWBA 3HYCA 3IOBA 1GPNA 3OOWA 3ZGVA 3AZPA 2OSBA 3C98A 4TVBA 5CH5A 1SA0A 2PBZA 2W90A 3UAXA 2QSYA 4DM4A 1D2EA 2H29A 1SC3A 4H6XA 4ZGGA 1DX6A 2JHAA 4PG5A 2PIDA 4XTRA 4PYRA 1J1UA 3QEAZ 5EAIA 1U3TA 1DZ3A 3TUZC 3WV5A 1MGPA 4KMSA 2HK8A 2Y6UA 2IEZA 4LCJA 4YECA 1VSTA 1P7YA 4P34A 4PIPA 3H1GA 4IFIA 4QGAA 4CQMD 1E9BA 3JQGA 1ZGZA 2XUFA 4PLYA 3TQHA 3NDBB 2ZI3A 4OO3A 5A05A 2BFEB 3GLFB 4WLVA 4YCAA 3ZNPA 4DY6A 1R88A 1UM9B 1N2GA 3I9OA 4G0OA 4FJ0A 1JV2B 4KLRA 4OJQA 4YRRA 3ZU2A 4L8YA 2MSDB 2JLAA 3GHHA 3ODPA 4B6QA 1U6KA 2PBFA 4MLDA 1PKEA 3MG9A 3BMNB 2QROA 4PU0A 5LZ8A 5JY6A 2XVYA 1NUUA 4JI2B 1WW8A 4C6TB 5DEIA 4ZRNA 4DNFA 3ETJA 5GVSA 4EZEA 2VATA 4HWSA 4NNPA 4D9MA 2CLKB 3UY4A 1Y33E 1FDVA 4NZPA 1CF2O 1FLDA 1KAEA 1BC5A 2Y0BA 2E49A 4H60A 2PT5A 4EPWA 5KOJB 2P35A 2XGMA 4WOBA 4EFLA 4L7VA 1G21A 1RQLA 1Q3TA 1GU0A 2QAJA 1BROA 1SUCA 1NV9A 1SCNE 4MQBA 5AXBA 4GPEA 3FOEC 1X39A 2WKPA 1IDOA 2D7DA 1Y5RA 3LG2A 3TTXA 5CK5A 3FZEA 2JJMA 4Z9AA 2H65A 4H6WA 1YDFA 2VJMA 2PZMA 4QYIB 3IVMA 5EE1A 3OZCA 2F3RA 3SXPA 5IT0A 1HNXB 1QE0A 3UF0A 1RWNA 3RHSA 4XRRA 3LQ4A 1UKVY 1UBSB 3A6EA 1LBTA 3ABOB 1BWPA 2W6PA 1LPSA 4JK3A 3CNHA 3N0TA 4TX1A 1XSEA 4AZ3A 3N7AA 3GMTA 4RTLA 3SS9X 2VP0A 1FFXA 2FQWA 2JFFA 5TSDA 3VOBA 2JFXA 4EAAA 3BJIC 1JIQA 3LRXA 4NZNA 3P27A 1J0EA 1RAFA 3LA8A 1EQ2A 2C29D 3WADA 3PI6A 2FRDC 2ZIUB 1KYZA 2FPMA 4GMKA 3RTDA 2QVBA 1FIUA 1LLUA 1QYWA 2QXTA 3UXHA 1NNI1 3MQ2A 1V71A 2C5HA 3ZXUB 2PGLA 1I5EA 4CT5A 4RSGA 1NI4A 2B6NA 4BEVA 2BEVA 3HJUA 1MA3A 1QFZA 2AWNA 4NBLA 3ONDA 4IY1A 3Q98A 4PSUA 2IPMA 1M34E 4R8LA 3S5JA 5JRDS 2BGMA 4TWJA 5L3ZA 2DYKA 4URUR 2IEBA 3C8UA 2GM5A 3VDNB 2I6UA 1ND5A 3OIDA 1K0FA 4W1PA 5F1OA 1KJWA 1NW7A 2INGX 2WJ3A 1GR0A 2YY6A 3ZWQA 5IAOA 3B38A 4QSHA 3QPAA 5IPFA 5KREA 2JJ8A 3OQVA 2ODAA 2X7HA 2M2IA 2JAXA 3I04A 4FFPA 5BMVA 1IK4A 2PZJA 4HAYA 4FK8A 2LCIA 1ZOOA 2ABWA 2HPZA 2FSPA 4YCDA 3HKCB 4QYXA 2QZ9A 4MYCA 3IDZA 1E3SA 1VGRA 2MTBA 2R6HA 1XDSA 3KD3A 4FEAA 1I3MA 5DNEA 3M70A 3GNQA 3K0KA 4A1OA 1ZOSA 4H4CA 1MX3A 2Y05A 1VCMA 1FDOA 4Z9YA 1DC3A 3ASVA 4FMBB 2Z8YM 4KIJA 4W9MC 3JZIA 4IYJA 5BV7A 3U7GA 3WMXA 1ZGJA 2VRNA 3DLHA 4H6VA 2VQEB 1QDUA 3PI7A 4RX1A 3W2GA 5FOUA 1SC9A 4FMPA 2FRVA 4X54A 3R8XA 3GLUA 1XCLA 2YHIA 3CPJB 3F4BA 4G5HA 5A3QA 1SHLA 2XLCA 2CDBA 3I9LA 5J1SB 2HQSA 3M83A 2FE1A 3DDSA 4GVPA 1PVOA 2Q9BA 3OZ7A 2WYUA 4WASA 2GN8A 4G4GA 1XK6A 1U8CB 4OP3A 2VNSA 4PXAA 4F9GA 1SUWA 3DTVB 2MWMA 3CG0A 1HRKA 3NTLA 2C4HA 4I1UA 2GN0A 2XYHA 3GK3A 1YH3A 3HADA 2VSOA 3OOEA 1XEWY 2JIQA 4HX2A 4MQ6A 4ZDWA 2OCXA 4H7PA 1OTYA 2QNIA 1DAFA 2C2WA 1SUEA 2ZB3A 5C52B 1OPXA 4TT8A 2VK8A 2Y8EA 3KKQA 1P5ZB 3PQEA 4RESA 4Y2JA 5H68A 4AVYA 3TJMA 2CDRA 4RV9A 1R4NB 5AVQA 3DE6X 1H4SA 3GJRA 1A4IA 1TIBA 2PWBA 2VS1A 3RWMB 4FZRA 3DTVA 1UM8A 1J23A 2H2FA 4NCNA 5DNAA 4WK6A 1JLHA 1M0TA 2PEZA 2VRWA 5INTA 1XDUA 2NNLD 2ZJFA 1U2ZA 2IYLD 2V0NA 1B6GA 4NMHA 5ALVA 4K6MA 4CIVA 1WHTB 2Z56A 3K6KA 3GDHA 5LBUA 1C7QA 1KARA 3GRKA 2A9KA 5F5XA 3KJEA 1WMSA 4I99A 1G6Q1 3V7FA 1J2YA 5A4KA 4JKIA 3O1JC 3EG9A 5KX5B 1KC3A 3R5XA 1G4HA 4PC7A 2ALJA 2W2LD 1LCIA 4IJMA 4F7DA 3CU5A 4S24A 4TTAA 5JH7B 1TFUA 1DHRA 4EL5A 3RVPA 2XBLA 2BCJQ 2GM3A 2HJRA 2R1TA 2VN8A 4IDAA 1N9KA 4II3A 4TQAA 3QPWA 3EN0A 1WL8A 2CNDA 3HBMA 1CZHA 1CY0A 3ND7A 1R50A 1SUSA 2G04A 4FPXA 4WERA 5I5GA 1M75A 1N2EA 4IFBA 3IIMA 1BJTA 2ZIXA 2XUOA 3MCAA 3QUSA 2F43B 1UP7A 4KHZA 3SSAA 5EXPA 1OUMA 3UAOA 1PU2A 1Z16A 3CLRC 4LDPA 4CM3A 1U2GA 2H2IA 1XQ1A 3K8OE 2FZLA 1DKPA 4BNDA 2P90A 4S2EA 3T61A 3PC8A 5AQ1A 1A8SA 3AESB 3DMHA 3UT5B 4D0LB 1RPTA 5CCXA 2XWBF 3OM8A 4JBYA 4IBOA 5JWRA 5FWYB 4IR7A 1YNOA 1Q7RA 5AJHA 1K8XB 3LC0A 5AI6A 1HQCA 4KQGA 2WB4A 5E6RB 3EQ8A 3AY0A 2LTAA 1RC0A 2EW2A 4HRYA 4X7BA 1I6KA 1QLJA 2F8SA 4CTKA 4O3FA 3KR0A 1PNVA 3S5UA 1J06A 3THWB 3PITA 3HXTA 4TTTS 3T7KA 4IXTA 4RPHA 3D2BA 1D6SA 2HXYA 3BMXA 1JFFA 1Z2DA 1WDKA 3M6VA 4LE1A 4RM3A 2O48X 1OAOC 3K16A 4TLEA 2A1UA 5B12A 2O7RA 2XNHA 3QHPA 4YUWA 2FWJA 1ZC3A 2ZT6A 1W581 2YR0A 3QELB 1YKSA 2RH9B 1G2QA 3NAMA 4JBNA 3PRKE 4G0VA 2DCUA 3PIIA 2CXTA 2Z6VA 4MW9A 1CQPA 3NVMB 1W76A 3S1AA 4INPA 1L7BA 3PUWA 2CUKA 4QECA 2JGFA 5DTMA 2ERYA 5ALLA 1IZ8A 4FFWA 1U9YA 3ZK9A 1K3FA 4YQEA 1OYWA 2ZAIA 5C51B 3AUXA 3F47A 4ZD6A 1F14A 2XT9A 5E2BA 2ZU0C 1KMNA 4UCQA 3FFTA 2QJWA 4WW0A 4NHOA 2FZ4A 1SGWA 3CSSA 3LXMA 2BSXA 2DPMA 2MSCB 2EWWA 3N59A 4UM9B 3ADPA 4OQYA 1NR5A 3QWHA 1RMYA 2EVWX 2UXDB 1M8FA 3KWJA 2COKA 4R6XA 4QXRA 2BMDA 1EKXA 4BVEA 2BL4A 4R8RA 4OAQA 3T3NA 2FF7A 3UT0A 4CIAA 4AICA 3ZD6A 1R6XA 1U0JA 2I1LA 4DIMA 1XPJA 2M1XA 1H2HA 1I8TA 1ODFA 3COYA 3DLPX 3JQCA 3LUGA 2E4UA 3T9BA 4CKCA 3NP9A 3QFFA 5HFJA 3ILHA 2AXQA 4UUBA 5DKFA 3M9XA 3WKCA 4GM4A 5C31A 4IDQA 2PVSA 1SG0A 4HK4A 1JB9A 2XNDD 1INLA 2YQ5A 4QHTA 3OLXA 3BRWD 3EH2A 3G9ZA 4CI9A 1C8VB 1R0CA 4BDSA 5IH7A 4RNCA 4HWRA 2G17A 4Q3CA 4U2BA 4PG6A 3VSCA 4RTQA 1E98A 2VZ0A 4HMPA 4Q3EA 1WCV1 1K68A 2AA3A 5JS6A 2ZG6A 4JLJA 2ZVDA 1R0SA 4RSRA 3RWBA 1IE3A 1A9XB 3BBPA 3UMBA 2YWBA 2V6BA 5K1ZA 4DA4A 2IHTA 1QAMA 4FWIB 1PX2A 4JJ4A 1TT5B 1VGVA 3RR2A 4HVCA 8MHTA 4QPPA 3FG9A 2X19A 4KREA 2EF0A 1NXWA 4NZYA 2DWOA 1GHTA 2EZUA 5CPBA 1FF9A 4LWQA 3VHRA 4WFQA 4AFNA 5J4KA 1Y5NA 2QTAA 1MDBA 3FN4A 3OC0A 4W7HA 4B17A 1N34B 5CLFA 2D0OB 1X15A 2VSYA 2YJGA 4Q47A 4KZKA 2O1SA 2Z1MA 3RIYA 4E3ZA 4B7ZA 5LQNA 3ILYA 2G3YA 4K46A 1J0XO 1XN1A 3TNFA 1JAYA 5T8KC 3TXXA 4JVNA 5JT1A 1CY2A 3D3WA 4ZQGA 5DX1A 2YC2C 3O75A 4A2CA 1YZHA 4ZVMA 3M6FA 1RHUA 3H2JA 3V3KA 3GH3A 3JZDA 4LIPD 5EMNA 3NM4A 5JJ5A 2NW6A 1DBWA 3HR7A 1ONPA 4J1TC 2ZSUA 4EJ6A 3U4DA 1TUBB 3LNCA 5AKGA 4B4KA 3HDYA 4GKJB 2AG6A 1PGOA 2EBWA 5KYNA 3ACDA 4CM9A 1ZXBA 5AJTA 2VSFA 3DT9A 1JDNA 5JVDB 5EIAA 3JQ7B 4JL6A 4BV8A 4IL5A 4IIFA 5J1TB 5B37A 1TEXA 2XOEA 5HS4A 4BKMA 1NI4B 4EYKA 4C04A 3CVOA 1YRQA 2KE5A 2YZKA 3P5BA 1RRVA 2J32A 4FBMA 4XQ0A 2I6TA 3ITDA 5F1PA 4RLFA 3UPUA 4KXYA 3MCUA 3OFJA 5GM1A 3VR5A 1AIPA 1K63A 1FDSA 3QXXA 4Y67A 1D0VA 4EG5A 2WNSA 1QCCA 1HG0A 2IP4A 1IY9A 3BERA 2CMFA 3HI6A 1SBHA 3HVIA 3V9AA 2GBLA 4JOCA 1WZNA 3IAS1 5BPFA 4IRMA 1BRTA 5CYGA 1ONSA 5B6PA 5ER9A 4UAUA 3L6UA 5JSUA 5G0TA 2RHCA 4BMOB 1OY1A 2NUPA 1H8HD 4R83A 4WESA 4I6GA 3A1TA 5CNKA 3CTPA 5JH7F 2HA2A 3BGVA 2Q4EA 4Q1CA 3ZGLA 3N7UA 1YQ9A 2PX0A 2DSTA 4O08A 3EQ6A 2AW5A 1AKTA 2C5FA 2HHLA 3AUYA 1HMYA 3HA3A 3PVCA 4G8CA 2CF5A 4KUEA 3X1ZA 1P9RA 2Q8PA 1OAAA 4HQ0A 4YJFA 1KSHA 1E18A 4OX9B 1SC6A 2YWCA 3UA3A 2XAUA 5HGXA 3LO8A 3IE2A 3PA8A 1U7PA 4IM7A 1LSSA 2WT9A 1EEXB 4J16C 1DJLA 1HO3A 1RCFA 1GKKA 3EA0A 2IZ7A 2RHDA 3KBOA 2WAXA 4NZZA 4EK9A 1CUBA 1JDBB 1CY1A 2FRDA 2HA0A 2V3WA 2WC1A 3AI1A 3MNFA 1ZGGA 4PLZA 1JR4A 3HRHA 4QWWA 3TLXA 4IUYA 5T64A 4JUBA 5B4UA 1ZIDA 2PX8A 4TWRA 2OV3A 2P4HX 1PP4A 3EXFA 3RVNA 4ZI7F 2PUEA 1L1QA 1PL7A 2I6XA 4A5SA 2X6RA 1P81A 1WQ1R 5CT4A 3ESCA 1DFHA 3L0IB 3LBNA 1QRTA 4CZ2A 1KQGA 4KO8A 4JL5A 4PHFA 1USVA 4DJJA 1BXZA 1P18A 5AHKA 2FW1A 2O54A 1VE5A 2FLVA 1HY3A 1BMDA 2OGZA 1R8SA 4CMIB 2XPCA 5ITZB 3NZEA 4HS4A 3LCCA 4OHXA 3TAXA 4AK9A 3PQCA 4WLEA 1FC0A 1X8XA 5CM2Z 3TG2A 3E15A 2HA7A 4OL0A 2MIIA 2VJNA 5TJ9A 1F51E 1EHCA 4NENA 1NHGA 1XP8A 4NQZA 1WZEA 1BXRA 5TVKA 3MWLA 2PSDA 1RJFA 1WW2A 3MD9A 3I2IA 6Q21A 3PFFA 1RM3A 3KX2A 1QK3A 1QIJA 3CLUD 4C4RA 2HMUA 2YBDA 3Q1LA 4LOHA 4BEWA 4I8DA 4KP7A 1M66A 3WGOA 3ER6A 3K9LA 3QUAA 4E1BA 5CFZA 4KL8S 3CEAA 1EE9A 2W43A 2HSGA 2NU6B 4LXHA 1G1AA 3N0RA 4QDKA 4E94A 3OZGA 3GVPA 4ZTZB 4WN9A 1Q2XA 2GNAA 3PD7A 3LOQA 2OY0A 1SXIA 2ZJAA 1GAWA 1LDMA 2J41A 2UZIR 4L9WA 4LZLA 4R3WA 5DYIA 5HMLA 4HWGA 4X6UA 1AQJA 2HNAA 3BE4A 3OKFA 3DKVA 3VDXA 3EBPA 3RBAA 4MSUA 2XQKA 3JQBC 4F7WA 4J7UA 1CK4A 3CQ9A 4F5YA 3U4GA 1JH8A 5HP4A 4IIDA 1V16B 1W35A 1JI3A 5JAOA 3RIHA 1NR1A 3QX3A 2X4LA 2Z04A 1F20A 1ZN9A 4NMMA 2XJ4A 3KQQA 4XGQA 2ODNA 4YIHA 4E5DA 5BN5A 4J0DA 5FTLA 2XGOA 3C7AA 3GG2A 1IWPB 4NOMA 1N0IA 1KMHA 1X7ZB 2XIQA 4XYLA 4OM7A 4CKZA 2IKSA 1EBBA 4CIDA 1JQDA 1W85B 1X1BA 2IPXA 5AYVA 3QVMA 3VOAA 1SM4A 2VJOA 3AZOA 1ZRHA 1AZTA 1E1LA 2L69A 2ONKA 4G0ZA 4IUBS 4O5AA 4UPDA 4DV3B 4E03A 4N0PA 1V5FA 4S1NA 3AF4A 4B0PA 2BFCB 1PD0A 1WPQA 2FW6A 3ECSA 4LHVA 5KYXA 4HLUA 1YFJA 4O4IA 5IDXA 3A31A 3EVZA 4YRAA 1W5TA 2Q7XA 2YWGA 1XTPA 1KMHB 1X7ZA 2PJDA 1JG4A 1VMDA 2A58A 3GP5A 3OLCX 1EM8A 5CLIA 4EARA 1JQ3A 2CXQA 4M0CA 1GPUA 1UR5A 1NE7A 2IHZA 1RI4A 2OORC 2Q2OA 4EW2A 3K0BA 1FP7A 1QTQA 2BFEA 5CW1A 3IV9A 2AG0A 2J7KA 1T5BA 2OBFA 5KVAA 3DE5X 5HCUA 2ZJOA 4CODB 2PRZA 2OCBA 1LC3A 2JJ2D 4DCPA 4LXXA 1PRYA 2Y71A 1VL5A 3F7TA 3GZJA 3LE8A 1XEFA 4J6FA 4X91A 1PJLA 4BS9A 3LQRA 5EIWA 3TAUA 5M7EA 2VHXA 4IGKA 5EHNA 2RCNA 5KYYB 3V7UA 3A06A 2CNLA 3PXXA 3C48A 2FZ5A 4BZZA 5KOJA 1U0FA 1IYZA 1PJQA 3G59A 2VT6A 5E9JA 3H84A 1A0OA 4ZCSA 1QP8A 1RKQA 4PY2A 3G49A 3HVKA 1PSDA 3OF5A 2UYYA 3DCJA 1AF7A 2DFNA 3JCZA 5FUQA 1ZJWA 3VPCA 8OHMA 4Z53A 2CMKA 1SCKA 1Y4AE 3PHIA 4EGSA 1AE1A 1E0SA 1WVIA 3A7DA 1QOZA 1TUBA 3G0HA 2UXCB 7MHTA 4EELA 3GEDA 1ECFA 4WPGA 4MI9A 1C9JA 1DQZA 1D1PA 4IIHA 2HD4A 2ZIXB 2IU0A 4XM2A 4DMLA 4IIGA 4X20B 3K94A 4MIKA 3EVFA 2BP7A 2PTGA 4EHAA 4BB0A 5A4JA 1L8XA 1UBNA 1O6CA 1TUIA 3C3DA 2YWHA 3CGGA 3W1EA 2DHRA 2C84A 3CX3A 4AIIA 1Z2NX 3BA6A 1NA5A 1OWLA 2QTVB 1BQEA 3L7JA 3ROXA 4M6WA 3UTDA 3W8EA 2IOYA 1KBOA 3FI0A 1GTL1 4R54A 4I81A 5KIAA 2E6UX 2X8AA 2IV7A 2E18A 3H5NA 2Q5LA 1ZU4A 2J45A 3ZCUA 3A1WA 2ECOA 3VPGA 4MV0A 1ZNYA 4DGQA 4C5BA 1JNXX 1E9FA 3LPLA 4DWVA 4E5PA 1QG4A 1QGUA 2Z9CA 1F0PA 1H8ED 4RK6A 4XQ9A 3RUFA 5C35A 1UXKA 2MSWA 3N87A 3KEQA 4QQ8A 1LVUA 3O47A 4FE7A 1Z75A 1AN0A 3L7NA 5KCMA 4HEQA 1NW8A 1Q92A 4NCIA 4M0UA 5GMOA 1UL1X 4IX9A 3L0OA 2D59A 4KIGA 4RF4A 4CR8A 1F9EA 4DAOA 4F4JA 3RYTC 4DSAA 3ZNNA 2H5JA 2QL9A 3JSXA 3KWFA 4JDPA 5IJ0B 2XBMA 4ARSA 4K7JA 1Y9ZA 3EVEA 1Z8DA 5LJLA 2CK3D 3KPVA 4QARA 4MW2A 1N2ZA 1L5ZA 2AMVA 3FLBA 3P96A 4O2LA 4EKEA 5K9ZA 3BL8A 2HPAA 4WY5A 4EB8A 3NIGB 4Q16A 4CMCA 3QH4A 2QY6A 3ADKA 4PYLA 2UYHA 3KTOA 2J5KA 2ZQZA 5I8PA 3C5WP 4TL8A 2DHCA 3TX6A 3LRTA 2FG7C 4RMHA 2X1MA 2CC2A 2ECPA 1A9OA 2AFHA 2VUSA 3MVEA 4K9OA 1FFYA 3WRXC 4H3SA 2GXSA 4JT9A 3ZR4B 2IHNA 3KJGA 4D98A 1DU4A 2FZEA 1ADJA 1G7SA 4X1IA 5JMWA 2VTBB 3E9EA 3M2TA 4BB9A 4ZRMA 1G4AE 3D7SA 1IM2A 1HFJA 5E6SB 2I7CA 4OG2A 1EX6A 3NDJA 4UCFA 3O4RA 3L5OA 3MYRA 1NASA 4E15A 3J81A 5CFPA 1TM7E 3A1DA 2WDPA 3EXIB 3UK0A 4CF3A 5JPIA 1T9AA 5I3ZA 3G2NA 5TB5A 2IYYA 4ZZ0A 3ZN2A 1J8VA 2G1KA 3AERA 3NT4A 5BWNA 3F6CA 1ZD8A 1IUPA 1MOPA 4ICIA 3H97A 5FRDA 2GZ3A 3INYA 3T7CA 4BCCA 1GSIA 1XKXA 1NPTO 2ZSAA 2DBYA 3P9PA 1RQRA 4B9EA 2BISA 4ZVQA 2GEBA 2PX2A 4KN5A 3L8GA 2J0UA 1UT8A 5E3JA 1XZMA 3AP1A 3CLRD 4NARA 4KQJA 5HZGA 2QTHA 3EXIA 5ITSA 4MV7A 3NTOA 1E5DA 3OIYA 2YXPX 4W9RA 2IEDA 2PH1A 3F0TA 1JJVA 4CI0B 4TM8A 4EVRA 4LSGA 3TSCA 2Q3HA 4ZICA 3A6DA 3STYA 2OHOA 2ZTMA 4TYNA 3LKBA 3MMZA 4B7UA 9MHTA 4X62B 3UT6A 2BEJA 1QRDA 3UGJA 5C8XA 3HB5X 1GTZA 3DFZA 3NANA 1UZLA 1DTEA 2RI0A 3I05A 4LF8B 1HYEA 4AKGA 3IEPA 1QQ5A 1D09A 4MV9A 4RPJA 3C3XA 4NX2A 1M2WA 1R9GA 2Q2WA 5AFSA 2WWVD 4BIIA 3L77A 1V4NA 2PN1A 2O2GA 3N39C 3E7FA 4WY8A 3L82B 1L7NA 4I1IA 2YJNA 4PRZA 4S1TA 3RU2A 4KDEA 2XZLA 4I9NA 4Q00A 4E7OA 5B4VA 4BX0A 4EENA 5U4QA 5IF9A 4ZT3A 2BM9A 4ER5A 4P2GA 1APBA 1MVNA 3PQDA 2XKJE 2I0FA 2R11A 4XGIA 2CUTA 1QF7A 3KOWA 1DMSA 4B3CA 2REBA 5CRIA 1Z47A 2BGLA 3VV3A 5KTTA 2Q45A 3CWCA 4C06A 2XODA 2Y67A 3GGOA 5FAKA 4JLSA 5CVUA 2G88A 3QWIA 4GU5A 3LT4A 2VQFB 1Z2AA 3ENNA 3AQ4A 3CZQA 2FMHA 3GBSA 4IEFB 3QMVA 1D9ZA 1YQEA 1NKSA 3QX8A 5JSKA 3ZI7A 4A8HA 2AEFA 3ESXA 3IAM1 4DHEA 3UAGA 2AJBA 4CM4A 1G0OA 2YRWA 1BCRA 4N4AA 2ZREA 2J5QA 2XVZA 3DDZX 3PX3A 2AJCA 2NU8B 3CVXA 2P0YA 3OFKA 2GOYA 3NPAA 3DLTA 2QL5A 1UCFA 2AN3A 2RB4A 3L40A 4G84A 4GRIA 4FBLA 4NZOA 1PUXA 1Y42X 2JS7A 5F3DA 3RRYA 2W22A 3MD0A 3TLBA 1E4EB 4FLMA 3SDBA 4F45A 2O8VA 2SKCA 3K6SA 4FR0A 4BY9E 1OB2A 2Z3WA 3HA5A 1IJFA 2HJHA 3R0VA 3V1LA 5KTPA 2FWRA 4YCMA 2PJZA 1K1EA 4G67A 3ICQB 2G6BA 1H2AS 4JBIA 3ITKA 2IZ0A 1KFCB 3U17A 4P5PA 4J16A 3C3AA 4DQKA 4L27A 5JEEA 4KI7A 3DB1A 4TVKA 4Z1OA 3OZFA 4WUTA 4DQVA 1FQWA 1ZM3A 4E5SA 5A02A 1XZKA 1H4TA 4AYXA 2GEDA 4QX6A 1BEZA 3DXFA 3JQ6A 3OEYA 1CIVA 2ZDHA 5F98A 4BLUA 3C3KA 4LZOA 2LCQA 2BCGY 4AT1A 3RYIA 9ATCA 4MB2A 3ROMA 1P2SA 2W2MA 2GNPA 3DCNA 4GC9A 1QVWA 2RHGB 3NASA 2QIPA 2VT3A 3PXBA 5ILOA 4OY3A 4I7EA 1P5FA 1ZC4A 4GZMA 1XZEA 2H57A 4TMYA 1NQWA 2BJWA 3M4YA 4Y7DA 3ZCSA 5A04A 3VH2A 3EVTA 5CXQA 2AI2A 4K5QA 4WBSA 4JYCA 4M55A 3LY8A 2YMQA 4PAOA 2ID9A 4Y3UA 4WD3A 4WN3A 5DNUA 1B6RA 4ZVTA 1AGNA 1YGYA 1SAYA 1T6YA 1EVKA 1KQPA 4OP2A 3GA5A 1I3CA 3FUTA 5EQTA 1JYEA 2WMDA 2O2YA 3GUVA 3O2NA 4QVKA 5FTMA 2OAGA 3HBLA 3LXUX 1TM1E 4YRKA 1MRZA 3SQOA 2ZRBA 1SK8A 3HE3A 4BMSA 4YACA 3H0EA 2EGHA 2MU1A 3CKKA 2SCUA 1SD2A 4XWOA 1YQUA 3Q3GE 4P3NA 4QDXA 4HYQA 2ANCA 3PQ7A 4AM8A 4BNFA 3L7MA 4TS3A 2CXHA 3LPDA 5KX5A 3CE9A 4UHEA 2H51A 4ALIA 3GJ3A 4OKNA 2D3TA 4HGRA 1C3XA 5I48A 2HA6A 3UA4A 3A26A 4AIRA 1PFUA 1WB9A 5IRCD 1C4WA 2PYIA 3RAGA 2ZYUX 5JHGB 4Q48A 3UHJA 2GBIA 2JJYA 1JDTA 3RS2A 1ZL2A 4AS3A 3BDIA 3BD6A 1FX0A 2RGWA 3QF7A 2IHJA 3S3TA 5MN5A 5SY4A 1R4ZA 3KUCA 4Q4HB 4YCJA 1EAMA 4Q1DA 3ICVA 5DHQA 4D9GA 5C7LO 4BPBA 3D4BA 3NHWA 4OQNA 2RHOA 3AT1A 1N5DA 2BFAA 2OBYA 3A6FA 3NPMA 4GECA 4WAUA 4YAWA 1RRGA 4ENPA 3AVXA 2O8FB 2IYTA 1LD3A 2DTEA 5ULLA 3K70C 1DKUA 3FAKA 1VI6A 1UBEA 2B78A 3IC5A 2M6RA 3ZWOA 5K2OA 1EFKA 1XXLA 3D7MA 4FFRA 2BGGA 2VNHA 1XDBA 4KRYA 5DHSA 2ZUDA 4WZBA 5KPJA 1AQUA 2HBRA 2LVBA 3SGLA 1F7UA 3T0FA 3PTLA 1P1BA 4YP1A 3TRHA 3ELYA 3CWZA 4LVCA 1F17A 2WF6A 4LUCA 1PJBA 4AJKA 1I3KA 1NOIA 4BYMA 4HNAB 5DGXA 2UZAA 4MCIA 1E1RA 3L7IA 1GM5A 4C0BA 2YHBA 5JEDA 4G2NA 1E1QD 3A4NA 4RUKA 5EJEA 2OO5C 2IYFA 2WF9A 2E48A 2RKOA 4HQOA 2WE7A 3TGLA 3ZWWA 2RAPA 3GMSA 3TLCA 3TXYA 1ZJZA 3HTXA 1II0A 4OQEA 4ZOAA 1B1AA 4CLXA 1PZXA 4QFBA 1O89A 4NC9A 3AVQA 3PNQA 3AYZB 2Q3FA 4R9VA 3CHYA 4MKXA 2HFJA 1PI3A 4RDIA 5K3EA 5DGHA 1EVQA 1H94A 4YAEA 3RVJA 1H1LA 1B15A 3QMPA 4MUFA 4MS3A 4UHFA 1LQTA 4IS3A 4K6FA 2EG9A 2UYGA 1IOVA 3GP3A 2Q6KA 2ZIVB 4R2LA 1QVRA 3T3MB 5K0SA 2L42A 5FFFA 2AXEA 1GPYA 3PDWA 4QXAA 3EBOA 2PK3A 3CO0S 3T3HA 3ZQKA 4ZCMA 1MO3A 1CUWA 1XGKA 3IPXA 4GI7A 2GPAA 3HGTA 3TLYA 4MQFA 3U3DA 1F0NA 3OE4A 3PJFA 4INOA 1MUUA 1QFYA 2J31A 4TT3D 4N3GA 4TN1A 3TFQA 4AX8A 2QTFA 4DCOA 4UJ3A 3ROPA 4N76A 1TYEB 3NWBA 1Z4MA 4DSNA 2AI3A 5IH3A 3MXOA 4TKUA 3UWPA 3UANA 4RWZA 4ZT4A 3C6XA 5AKJA 1MV5A 2ANBA 4TZTA 4ZAVA 1PGNA 3AKCA 1GARA 4X95A 1DKMA 3HYSA 4XDHA 1FTGA 3KUXA 2KWIA 1GEEA 1HETA 2NMVA 3CX6A 2WE8A 2AFIB 2BWJA 5HUQA 2IBSA 4OHBA 3VUFA 1O6BA 4OVKA 5G4LA 1LW6E 2RGNA 2H7CA 3IUMA 4J0GA 4RY8A 3TEMA 4EUKA 3Q6MA 1THZA 1W0KA 1NQUA 3SQLA 2B94A 3VC3A 3WYEA 2RGRA 1LDYA 4A15A 2QSZA 3ZIDA 2YWFA 3WGGA 1QU2A 3PFKA 2O50A 5DGCA 2DWCA 4AJLA 3N0XA 5K8LA 1RYZA 4RK0A 1E96A 1IUOA 4DXHA 2H1IA 4LBZA 4QUIA 1ULSA 3FHLA 3N7TA 1UMDA 4FP9A 4JB2A 4K2HA 4LMRA 3GFFA 1HDCA 1U3UA 1KOFA 1XXHB 2PSFA 4G25A 2QNRA 4Z7NB 2DZDA 1MHPA 2RG1A 1KY3A 1F2VA 2O06A 2H08A 3O7WA 2RHWA 4Q9KA 3GF4A 2Y3IA 2VAVA 4IHQA 5J63A 3RJMA 1T5IA 4EJFA 2XJ9A 2Q9UA 3EBLA 3LGXA 1L7VC 5AWFC 4LE0A 4U6SA 1V6CA 1JKFA 4KQ1A 2PKYX 1JALA 1GZ3A 3WP0A 4EG6A 2IUSA 1FQJA 3OQPA 3SE7A 4KQHA 3CZMA 1DUSA 1QB8A 3OJWA 4UE6A 3MMPA 5IDWA 1ZQ1A 5LVAA 4M9QA 2BD0A 3FBGA 4HDNB 4UNQA 5FBWB 3LX8A 3Q9UA 2PKEA 1HNWB 3WHLA 1FNBA 5JIBA 1XQVA 5EMKA 5DM70 1YR8A 2OK8A 1FJGB 1G5TA 2R8PA 3GZNA 1RPAA 3MCWA 5ADWA 1TLTA 1PJZA 5IMBA 4IQ8A 4EKGA 1ONOA 3HGQA 1YTUA 5G1NA 4DR4B 4C0LA 1X8JA 5JBNA 1SG6A 1ZUNB 3OP4A 1SHTX 2PLRA 1ZVMA 1RLOA 5LUAA 1I7PA 1JWBB 3ZQ4A 1TA9A 4UULA 3DWIA 2EDAA 5FBKA 3GJ6A 1XTIA 2R5FA 2VPYA 4WA8A 1YJ5A 3TQSA 4ON9A 3RSQA 4YMUA 4P84A 2SNIE 3QVGB 3T7SA 5FH9A 3R20A 5JLJA 4PO3X 5I9SA 4TVSA 3OJCA 1J8QA 4QODA 2NVUA 4CTMA 4F1JA 1XXHA 2QI9F 4KVGA 5H70A 5HFAA 2DBQA 5EXDA 2GQ0A 2XE8A 1GCAA 4F5ZA 4IJ6A 4BFXA 1RWXA 2Z2YA 2QUJA 3OM1A 4DTCA 3T7RA 4TZ0A 3DGEC 4DV4B 2VNAA 4QLAA 3PKJA 4PPNA 3OUZA 5LZ9A 2VF8A 5AW7A 3AFMA 1JU3A 5EKDA 4FFBB 4CEIA 3HVUA 2EZ8A 4H4EA 4REOA 5ETJA 1TVMA 4BVBA 3PPWA 4QO7A 2P30A 1XPOA 4EY4A 3K5HA 2IHBA 2QE7D 2R00C 3ELWA 3BHNA 3GFOA 3IHLA 3KHUA 2WFLB 3BHJA 2HM7A 3LS2A 1UBJS 4GX5A 4QU9A 4EI7A 4XSVA 3IYLW 1W0CA 2QU8A 5DT2A 5KYKA 4BBPA 2VT7A 1SD1A 3FMPB 1SG9A 4R5HA 1QTIA 1EFPB 3MT7A 4ITRC 4ZWNA 3U7HB 4ZDJA 2QZ4A 4P35A 4C7KA 4RC9A 3SYKA 2QAGA 1N1MA 3GEPA 1WV1A 4Q4DA 2GYWA 3OQNA 1EHYA 3I1JA 2HOQA 3KVVA 3VGPA 1ZYUA 3U0VA 1UWLA 4Z8YA 2FG5A 3OPVA 5EHQA 5JI3E 3U5ZB 1V16A 3LT0A 1WOMA 3FCUB 3KQYA 2CLHB 1YBVA 1BGWA 3ONWA 1XVVA 1W29A 3H8VA 2XRFA 5EFOA 3IHKA 3B1JA 3BFJA 3PEVA 4UMVA 5REQB 3EPKA 3QVXA 2OFXA 5T4HA 1E2EA 4ZI2A 4LJ5A 2F90A 2QDKA 2JARA 1ZQ9A 3IAFA 1E6LA 4L02A 4LYGA 2DULA 3ZJ5A 2H54A 3MTDA 5TQ0B 1DX9A 1P75A 2JH8A 2I7DA 3I37X 3PNBA 2C2OA 4Q4LA 3TJZA 2IY7A 2PL5A 5FQOA 4DLYA 2GTIA 1DIOB 3FOAA 2WM2A 4OJMX 4U7DA 3EC7A 3M6AA 2QRQA 1CZKA 2GVNA 4F3NA 4FGUA 4R9UC 4U9UA 2ZR8A 4WCDA 4AB1A 2RHHA 1QE3A 3HUTA 4Y9DA 3OAAD 3KVOA 4IDCA 1UDWA 2GEVA 5IAKA 3UV6A 3VISA 3LT2A 5TF0A 3UJNA 1VBMA 4MV4A 2JHGA 2ZT8A 3K9CA 3KVYA 3D0KA 3E22B 3LLUA 3PUKA 2ZIWB 4XSGA 3RK1A 3WO0A 3ZI4A 5JSHA 3ZWCA 1FP6A 4IRXA 3F4LA 3FMGA 4ZK6A 3ANXA 3ZTTA 3R6WA 1ZD2P 3GJTA 1C3EA 2J9ZB 1SCIA 1TF7A 4DWWA 4Y98A 1DCMA 4J0JA 2HL6A 2X23A 3FJ1A 1L5HB 3GLGA 3GPCA 1FOEB 4G4IA 2BP7B 1EVZA 5DSTA 1XZAA 3GAFA 3TG8A 3C15C 1QP4A 2B8TA 4HTFA 4EHJA 1Z0UA 4YJ2F 3TZKA 5E1OA 2O7VA 4NCAA 2PSHA 1WWKA 4L28A 3R9XA 3A37A 1DXYA 4FGZA 4RD1A 3M6IA 3MWJA 4IAOA 4O2AB 1L4YA 2B20A 3WYNA 4GZ5A 2C61A 1FYWA 1P91A 4M7RA 5LQSA 2ZLBA 1PVDA 1ZO8A 2PMEA 5KS2A 4CQLB 5M2QA 1A9TA 1GUYA 3AIMA 2B5OA 3TM4A 3QV2A 4ENUA 1RBYA 2W11A 3GEBA 2NZUG 3RS8A 3IH5A 4YWJA 4N3CA 1JG7A 4ZEMA 3E7DA 4ER0A 2KS6A 4KFRA 5K0JA 2BMFA 3PNOA 1YFZA 5KNDA 4B3TB 3C8DA 3CF6R 3FCOA 4FXPA 2O57A 4NG5A 3OBBA 4ZJZA 2OFOA 2V03A 2ORVA 3GIWA 1E1MA 5KTRA 4FYYA 2Q0SA 1GRNA 3TKAA 4R2WA 2EFHB 2GHTA 3S8MA 4ZQBA 3AGPA 3RS7A 1CY7A 2YIVX 2R1TB 5CB8A 1JFTA 4QJ4A 2J67A 1VKJA 3M6WA 4OCZA 2IZ6A 5H3LA 4GZ6A 2H1LA 5EZQA 3WAGA 3HB9A 4TXMA 1NOKA 4UM8B 4YCBA 5BV8A 3SFZA 5JQGF 5EUCA 1LGYA 3HBFA 4Q66C 4AMVA 1DBSA 3ZE0B 1T5DX 3RC2A 4TWZA 2VJYA 2R8ZA 2VRCA 2GZMA 3UCFA 1E2HA 3SBDA 1U80A 1JA1A 4JVLA 1KVRA 4C7VA 2OG2A 1A5ZA 2ZJBA 5ALJA 1WEHA 2DC1A 2OAQ1 2VAMA 2XLBA 5ILQA 3A6GA 1QG2A 1ZW1A 4EY8A 3B78A 1YJXA 2BFDA 3T34A 1IOLA 1GUDA 3CUUA 2FMUA 3GJ5A 1S8OA 2R6DA 2VOJA 3LYAA 2QLFA 2NUAB 5K03A 4Q1VA 2XYQA 4CLEA 4IJUA 4D26A 1AV7A 1DOZA 3T0GA 4YAJA 3IQGX 1GZHB 2SCUB 1FMFA 2ATCA 2XB6A 3X1XA 3PGVA 4S2UA 1F0YA 1XDGA 3CGWA 4HGNA 5BQFA 1ATZA 5BUSA 5U1PA 4C22A 3R2JA 3QLEA 3BWDD 1XAGA 3HKDB 2Y27A 3PG5A 3ABIA 1YRBA 3GLTA 3ZNOA 1Y6JA 3GXBA 4BNTA 3MFYA 1VDMA 2IY9A 5DJ5A 4PLTA 3VNRA 4I4CA 3U13A 1G20B 1C41A 1K2WA 2LBPA 3LKVA 3T9DA 4E4RA 3ZHRA 2DE0X 3ZU3A 1BXGB 1CR6A 2ZWVA 3HXMA 4YDQA 2VHTA 2WPNA 1PS0A 3RSLA 2C7BA 1IU9A 3FAZA 4GPZA 4BMPB 4XUCA 1J0CA 1Z3IX 1B26A 2JEYA 4GMXA 1WMDA 3GARA 3FYTA 4MQMA 1IZ7A 5DCYA 4Y6LA 5HCNA 4EO4A 3GEHA 2R751 4Y2RA 2JFPA 2W2KB 1RYHA 3BXOA 5K0ZA 4YT2A 4P82A 2AQKA 4RHEA 3RKRA 3M3DA 4MUYA 3LA6A 3GLGB 3KYJB 4M6WB 3SZOA 4IMIB 4RL4A 2VDWB 2ONJA 5KHOC 1N8TA 4MRSA 4O8ZA 1I7SB 2ZB2A 1DDOA 1QP7A 4O0MA 1CR4A 2D1TA 1OXTA 3UBTA 1M2VB 4OAOA 2G6TA 2Z2XA 1Z0ZA 3K70D 5BOSB 1FTQA 3QFTA 1XWIA 1NZFA 2C2ZA 3O4IA 1X86B 2JAPA 5TR9A 4ZHQA 3GLIE 3ASUA 3B70A 4JB0A 4PGAA 1CQJB 2ZVPX 2HCTA 4FDTA 1X77A 4MLZA 2IYNA 3MWEB 1R6UA 3V2GA 4V3CA 3ADBA 4YUAA 2NUBA 4AY6A 3DD5A 1DAHA 4FCTA 1Z08A 4F3RA 3TRJA 1JVSA 2G08A 4Q9LA 2H7XA 1Y5MA 3P0RA 4AG6A 1Y5IA 2ZS7A 3EGDA 3W6NA 1MDFA 1CUIA 5K09A 1XX6A 5F52A 1LQUA 1N1GA 4M9ZA 2RKWA 5AOVA 3T5DA 1UJNA 2J08A 4UBLA 5CB0A 1SXQA 3IDAA 2I3AA 2WIKA 1EIWA 3F71A 4RACA 1P73A 2VCYA 5I7RA 3EZ9A 1J5PA 4FJ1A 4HB0A 3AG5A 3I6YA 2OMKA 1KJNA 4X00A 4E32A 5GIOE 1VLLA 3C3EA 3EZNA 3JD3A 3AFGA 4PZCA 4BZWA 2BE9A 2E4YA 1ZXLA 4MJXA 2B4YA 2Y1LA 1V5IA 1EUDA 1TRKA 3IODA 4MV3A 5K3BA 4LTMA 4RSHA 1EGQA 1PR0A 1YASA 3SI7A 1NP6A 4IZOA 3ZHOA 4Q7QA 3GEMA 1GLNA 3A58B 3EEFA 2JGMA 5TEWA 1I10A 2WJIA 4RKEA 1XTRA 3JY6A 4NABA 1COWA 4HBGA 4RD6A 1YOVB 3D3WB 3EZYA 5LWQA 2ZJ5A 3U1VA 1TKBA 3VJRA 2JH3A 1EMDA 1ONBA 4DDTA 2JVJA 4ZVRA 4IWYA 2A88A 4OSEA 4TM7A 3DL2A 1TCCA 4IGAA 1ES9A 2WUDA 4LYJA 4J3NA 1ZUHA 2ZYTX 1MAVA 1SCQA 2CLCX 2YNMC 3BDVA 3HFRA 3ICOA 3AM1A 4YGXB 4GDFA 5BRAA 1TMYA 1X0XA 4AL4A 2Z5FA 1M6WA 1U7TA 3A1CA 3O91A 4MUAA 5A4DA 2IXBA 1EP9A 3WK6A 3P9CA 3WX0A 4EUSA 4LZWA 4JFRA 2J7PD 3HY3A 1NF2A 4ZFNA 2QD4A 4Q18A 3OAAA 4EO9A 1WA5A 2H4HA 5B58T 4M0KA 1I5OA 2HCRA 4WCFC 1U7HA 1NI3A 2NADA 1BE0A 3A9RA 3NEYA 4GLFA 4DA8A 4DSZA 4ZZ3A 1EUYA 3WIVA 1NJ2A 3EH1A 4IHJB 2I8CA 3BGWA 2HBZA 4CKWB 4ESHA 3PRYA 2G8NA 1KS9A 4XVHA 4A6PA 3EPJA 1JI0A 2QM0A 3MLEA 2GA8A 5A3SA 3HZRA 2VEOA 4PPYA 3R7BA 1FP4A 3K5PA 4RH0A 4REQA 2OENG 1SQ5A 3G1UA 4MPDA 3U49A 2FPPA 4ZO9A 4E46A 3SKXA 1ZK3A 1QSGA 5LNK1 1I6LA 2X3UA 1GILA 4OAPA 2MMGA 5CFQA 2PKRA 3FYDA 5AUNB 3AG6A 3KKLA 1M1NA 5JNLA 4UZFA 1B2RA 1Z7YA 3DM9B 4MOWA 2CL0X 5CB4F 2FEMA 5EHGA 3N75A 3VVCA 1PZEA 3EK2A 4OI4A 2VF4X 4C0JA 2ZATA 1DTWA 1UZUA 3CW9A 2VYVD 2JLRA 4RA6B 1SXHA 3M1YA 3I9JA 1TM4E 2WSMA 5AIAA 2H0AA 4J0IA 1OYOA 1DBVO 2AKAB 4RHFA 5ECGC 2PDAA 4KPUB 3FX2A 4COKA 1K08A 2DUMA 3BG5A 4EFDA 5EHZA 3I1YA 1M1NB 4NCXA 1LZLA 1KF0A 4ZYWA 1VFNA 2K4MA 1WCYA 3KDSE 2OGTA 3N2ZB 5AJWA 4P83A 4A23A 4BNJA 4J4BA 4M38A 5TLSA 1P39A 3HUDA 4JJZA 1BGXT 5EJ7A 2IUEA 3MW8A 5CT9A 3RJTA 4XA8A 2BEKA 2D6FA 1PBTA 5F7XA 3QELA 3RC7A 2CBGA 3CONA 3D7KA 4FEGA 5GOZA 1S3SA 4CKWA 4F92B 1W7AA 1EDEA 1PF7E 2G28A 3LBFA 5ADHA 4C0AC 1FU7A 1IZ9A 5FLEX 1ZL0A 1LNZA 2Z83A 4BZPA 4Z8XA 4BWVA 2YXEA 3I9V6 3VH4A 1K6EA 4PNZA 3BIFA 5DBGA 4CLHA 1DWOA 2Y93A 5ERYA 1HE4A 3LVRE 2BI4A 4GQIA 5C4IA 2CNWA 3PWSA 1M1ZA 1M2KA 4D6XA 3HJBA 2Z9DA 3A0RB 3VR1A 4RV5A 3SXJA 2QUIA 4LHZA 1U3DA 4QBGB 1V5WA 1YGPA 4IWXA 1W47A 1XMSA 2JD2A 1KYQA 3P4UA 1DELA 1JIUA 2FFRA 3ISJA 2R5NA 4MWDA 2G7ZA 5FORA 2HX1A 4MKGA 4TV9F 1TCAA 3CH7A 2OAEA 3FBTA 5HFNA 3UVEA 3D8TA 3WE7A 1UP6A 2PLAA 2YVKA 2H1HA 1DL5A 4LA4A 1Q21A 4NJEA 2QLNA 3FNBA 3HXLA 3THRA 2N9UA 3ZVRA 4CF7A 2FGJA 5GTDA 1IIRA 2GJAA 2J3LA 2P9ZA 1ZOLA 3GJ7A 3NOXA 3WLRA 1Q57A 4RYLA 3A6HA 5K6RA 2WNHA 4H0CA 3G2HA 1UJBA 1RCUA 3FHCB 3DQZA 3WWYA 4P31A 4OJNA 2Z9BA 2IU4A 2ZRMA 3GJ0A 3THXB 4UBOA 4HVAA 1AA6A 1BEUB 2BM1A 2OXCA 2Z3VA 5G0SA 3ZY2A 2RGXA 4GGMX 1M1XB 3HFSA 4RJIA 1P7WA 1SHJA 2WTEA 3JTMA 4GUAA 1PV1A 4XLLA 3IMGA 5FB3A 4KR2A 4HQ6A 2NO5A 1RHKA 3AR4A 4A7PA 3WQQA 1OBOA 3P0JA 2FFQA 3A3KA 3DL7A 1OFIA 4UAGA 3OCCA 4YAOA 1E0KA 3SQDA 4KLNA 1BYIA 1NDQA 3K6RA 3U4CA 4G5YA 5J43A 4PC3A 3THXA 3PDUA 1ZGHA 5IK2D 2XYVA 3TZBA 3TTYA 3E4CA 1U99A 3MLAA 4F5WA 4LFBB 3W7VA 1O95C 3WGHA 3PNSA 4ME6A 3P2JA 1V4VA 4YEDA 1HE1C 4UTRA 2BTQB 3FOFC 1H3NA 1W88B 2X0DA 3EE6A 4YY3B 2C5GA 4X7RA 5JXHA 1L5HA 3ZHQA 4XFDA 2QMZA 3LUKA 1EFRD 2WAMA 4TZ6A 3GIDA 1OX4B 4HL6A 5E4TA 1NPDA 2I6QA 4FGSA 2CHVA 3KQTA 3Q7IA 1E3IA 4N0EA 1F4LA 4LNAA 1BE8A 4A0RA 4D46A 4DIBA 4N0MA 4FW9A 4C07A 5L3QB 5JR3A 3DGFC 3HN7A 3F90A 4NV3A 4YYEA 2J4FA 1ORDA 2VXOA 3O8DA 2Y76A 4JWKA 2GPTA 8ABPA 3I1IA 3WAKA 4O4JF 4P54A 4BNMA 4DKJA 3DE3X 4C0SA 2AMLA 4P7BA 4DR6B 2D2VA 3OIVA 1BQ3A 4NH4A 5L9AA 4G9BA 3F8SA 4NV1A 3LZDA 1VKOA 1VMKA 3AU8A 1Y3AA 1B0PA 3NNNA 1V0JA 1E69A 4LDQA 3P2EA 3UMFA 3GLQA 5EJFA 1T5TA 5TGZA 1S3GA 1YV9A 1M2FA 3WLEA 2Y0EA 3G88A 1XR3A 3NKVA 3SZ3A 4QE3A 2QRNA 2PUBA 3A3PA 5IN4A 1C5KA 3HN6A 3R0JA 4LXIA 4RF3A 1W5SA 4XZ3A 3GYBA 4NBVA 5TPZD 1PTJC 3DBRB 3ZLTA 2R48A 4N49A 5HOQA 4ML3A 1CIJA 2QQ5A 3PSAA 4UZSA 3RC1A 4EPTA 2WUGA 3BZWA 1KK3A 1HYHA 1JP7A 3FDZB 1N2CA 4KPFC 221PA 1P1IA 2V74B 3B53X 3RTAA 5F2NA 1A2QA 2C2HA 4BYGA 5TIIA 3F98A 4L07A 4HX9A 3IKTA 2NTEA 3JZAA 3MBIA 1VOTA 4YJKA 1MEOA 1OX4A 3RC8A 2X0NA 4WNAB 2DERA 1Y1PA 2N75A 2NPFA 2XEXA 3UW1A 2I29A 1SUIA 1WB6A 1Y3BE 3MGBA 4KQFA 3HR4A 1CJKC 4IHJA 2LKDA 3OWXA 2D5CA 4JU9A 1YB1A 3ZHVA 1XLUA 3BFXA 2HLDA 2Z3ZA 3BKWA 3NRJA 1OT5A 4QAQA 4YJFB 4EJSC 3BIXA 3R8CA 3VHQA 1KI9A 1QGOA 2VPTA 4GGPA 1YHZA 3HHEA 4RY9A 2ECKA 1GUAA 1OILA 1V9CA 3EULA 1NVBA 4JOSA 2HU7A 2HU2A 4GE3A 3A9CA 3GH1A 4EHFA 5CA1F 4S05A 2Y0CA 2FPPB 1XL0A 3CF4A 1A1VA 2J59A 1RBZA 1PL0A 4UTNA 1XCOA 2G7MC 4IO1A 4YI5A 1YI0A 2ZUBA 3L6CA 3I42A 1ECCA 2BEUB 3SX0A 4DT1A 1ZLXA 3WLSA 4FLFA 4D45A 1CEEA 3G5UA 2ODBA 1WIWA 2QAIA 5L4LA 4FFOA 2IGBA 1ONNA 3KM0A 2CJFA 4UEJA 4D4JA 1G20A 2QN3A 4YMVA 4E6PA 3HP1A 3P2KA 2HYDA 2ZIGA 4PGGA 1J7KA 1LPOA 4L9AA 5E9QA 1I51A 5TMDA 2GETA 2ZBPA 2QOEA 3DZIA 4Q1EA 1F12A 5DIFA 3RRMA 2DQSA 1BRMA 1S3IA 5T6BA 1F5NA 5K5EA 4JJ8A 4EWLA 3D5QA 4MVXA 3ROGA 1K5PA 1NLFA 3IPYA 5LL6P 1VFPA 1YQGA 3PEYA