1SCQA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetonecyanohydrin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 92
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1scqA00
2HU8A 3CN7A 2FJPA 1MNQA 2WIKA 1QIDA 3I28A 3CN9A 4DMCA 4UBKA 5KWIA 5H3HA 3WK9A 4IO0A 3MUOA 1XZMA 4UHBA 3WA6A 3V9AA 3WWDA 3IURA 5AM3A 3BWXA 2FUKA 2WM2A 3QMMA 2RIPA 1JU3A 5AJHA 5JADA 4OSEA 3G7NA 4EY7A 1EI9A 3V1NA 3BDIA 2BGNA 2WJ4A 1VZ3A 4DSAA 2HM7A 5BOVA 4H7FA 4B9AA 4FKBA 1H2YA 5KREA 2WFLA 2Z3ZA 1U65A 2XDWA 1T2NA 1K8QA 1VJ5A 3C6XA 5K3FB 4J3JA 4EUSA 2VJBA 1WB4A 5AKKA 2ZVDA 1BU8A 3DOIA 1WCYA 4X91A 4W9RA 2PVSA 3DD5A 1XLWA 3C8HA 4U2FA 1IZ8A 3QYJA 1UK6A 1KU6A 2EEPA 1OXMA 4WJLA 1QTIA 3H19A 3WL6A 4G4GA 2QOEA 4AXBA 4ZREA 4KAJA 1LLFA 1ZOIA 2Z8XA 1TKRA 3WK4A 1QIKA 2EDCA 3FSGA 4N8SA 4Q3OA 1JU4A 1UZAA 3MUNA 4UBJA 3D5EA 3WA7A 1IVYA 3TRDA 4BB0A 4BC0A 1E66A 4DMHA 4Q1VA 5EHXA 1AGYA 1LZKA 4IHAA 4X6UA 1XRRA 3LIPA 4B7ZA 3WLAA 1ZD5A 3C6BA 4BVLA 4PSUA 1R9NA 1RP1A 4EZIA 1XQWA 3FYUB 1TQHA 5ALTA 5T4FA 2YXPX 4ZV9A 3H2JA 2HU7A 3AZOA 2HIHA 2XUHA 2Z8ZA 2XLBA 3R3UA 4Q82A 1XZKA 4M0EA 5EIAA 4ZRDA 4FDMA 2LIPA 3DKRA 1GZ7A 2B61A 4QZVA 4UHEA 3WK7A 4BP9A 4UBIA 4YX9A 2Z5GA 5AI5A 3AFIA 4BDSA 3IBTA 5AICA 5D3ZA 1TK3A 1EVQA 3D2BA 2YYSA 4L3WA 2O2HA 2VT7A 1QIEA 4N8EA 1XRPA 2BJHA 1XZLA 2XUGA 1MT3A 2J3QA 2V97A 3HACA 1BEEA 4IH1A 1PFQA 2JF0A 5K3CA 5CBKA 2K2QB 1CUAA 1E8MA 3ESCA 1Q0ZA 1W75A 4W1RA 4BRZA 3VDXA 2CUTA 2OAGA 3QITA 4QDTA 5K3BA 1JT2A 3I2IA 1GQRA 3E4DA 1GT6A 4C4YA 3D0KA 1CUVA 4UBOA 4MWTA 4BP8A 1G4HA 4CCWA 4PO3X 3OC0A 1Y7IA 2V96A 5KWJA 2PSDA 2Z3WA 4LYEA 4FTWA 3FOBA 4U2CA 1DU4A 4ETWA 4OCZA 3AILA 3ESDA 3R41A 3FYUC 4C4ZA 5LZ9A 1W76A 3OPMA 5ALYA 3S8YA 3HSSA 1GPKA 4JNCA 2VA9A 3GBSA 1BN7A 2OQIA 4INZA 5CH8A 3STVA 1YAHA 2C4HA 2WIDA 2OAEA 5LZ2A 2VF2A 1K5PA 1Q0RA 1H23A 4DNQA 3CXUA 1R50A 3ANTA 4QDZA 2ROQA 3H2KA 4DGQA 1JJBA 4ZV7A 5HQ3A 2XUIA 1VZ2A 2JGMA 1A8QA 4EY5A 3HLKA 2D0DA 1GQSA 4TGLA 1FSSA 4DIUA 1EDEA 1EINA 3HI4A 4XIIA 4ITVA 1FFBA 4BZWA 5A62A 2WG1A 5AO9A 1QJ4A 1WPXA 1R1DA 4FLEA 2J4FA 4A16A 2C0PA 3ZLUA 4H7DA 4OB6A 4OB7A 5FUMA 1MX5A 5ALIA 4J0CA 4L0CA 2WKWA 1KU0A 5AKZA 3T52A 3I6MA 2QZPA 1J06A 2QJRA 2CBGA 3W2TA 1YAJA 5ALLA 5ALGA 1QIGA 5CRIA 1XLUA 1AMNA 1JMKC 1WB6A 1P0PA 3G02A 4AN0A 3WWPA 4C87A 1UWCA 1UK9A 1DINA 5DJ5A 1EDDA 1MJ5A 3BIWA 2CMFA 2WJ6A 1ZGBA 3STWA 5JATA 4U2DA 2BUAA 3AIOA 1TCCA 1BS9A 2ZYSA 1XZIA 2ECFA 3WIOA 5AKHA 1W1IA 4FBLA 3F9CA 2HFKA 4CI9A 4Y2JA 2GBFA 3H04A 3C45A 4K6HA 3VXKA 2G5PA 4X71A 5AI9A 1D07A 4FNMA 1VXRA 4XWGA 1F0NA 2OCLA 3R3YA 3BJMA 1YS1X 5FKJA 4K2AA 1LPAB 5LP1A 2WQZA 4W1QA 1XZFA 3VVLA 1LPMA 2FX5A 4W1SA 4KEAA 1HLGA 1LPPA 1A8SA 1JJIA 3IUNA 2V98A 3DCNA 3SC2A 2DQZA 1G66A 5ALEA 5C8VA 4KRXA 5ALRA 4Y2VA 1S8OA 1XRNA 3WQHA 1YB7A 5HF6A 2GYUA 1XQVA 3TJMA 1L7RA 3LP5A 4QE3A 3C70A 4P92A 4OD0A 2G5TA 3D4LA 5LZ4A 5AKGA 3WK6A 5HFAA 2ZJFA 4PW0A 2HDWA 3WKCA 4HRXA 3PDCA 5JALA 1QIMA 4LIPD 2R11A 1J1IA 1TCBA 1ODCA 1Q84A 2GZRA 2XMQA 3AJAA 1QGED 1H2XA 4E11A 1TIBA 5K3EA 4WY5A 2J3DA 3OM8A 5DLPA 2WHQA 5AH0A 4WDRA 3Q0TA 1SCIA 2WFMA 1DQYA 5JAUA 5IVKA 3H2HA 1J07A 3I2FA 2XQKA 4LXHA 3O4JA 5LKRA 3M82A 1XZEA 4RE5A 1XQXA 4DNPA 3NWOA 3PICA 3H18A 2R8BA 1RYYA 3U1TA 2RONA 2GBCA 5LKAA 4DNOA 1QTRA 3R3ZA 5E2IA 2XE4A 1K6EA 2PSHA 4XX1A 3PFBA 1QO7A 1QO9A 3N2ZB 5DTJA 5ALOA 4AO7A 4C4XA 5E4JA 3GELA 4FBMA 4ZI5A 1OCEA 4EY6A 2CB9A 2O7VA 4C88A 2XUKA 1XRMA 1X70A 1QZ3A 2VAXA 3DDUA 2I03A 2X76A 3LCRA 5AKIA 5ALHA 4BTLA 3A2NA 2RHTA 4NS4A 2QTBA 3L1IA 1QIJA 4F5ZA 3MVEA 1XZJA 4CG1A 1CUEA 1MU0A 1EB9A 1B41A 1MAHA 3ESBA 3NGMA 5CT6A 5AIBA 4XJVA 4IQ4A 1CUUA 2XUJA 3KXPA 4I3FA 3WYNA 4K6KA 4G8DA 1EDBA 4LXIA 5AI6A 2VSQA 5IVDA 3OG9A 4AX4A 3H1AA 5CURA 1NU6A 4HXGA 4J0JA 4UHDA 5HCUA 2HHAA 4GW3A 3WL5A 2C58A 4J03A 5ALNA 5C7YA 3WKEA 1QIHA 2WFZA 3WK8A 3G9UA 2HA2A 4UBNA 2X8BA 1AC5A 3I1YA 5AKXA 1UT6A 2HA7A 4YK7A 2I78A 3F97A 3WK5A 4OUKX 5DYTA 1MN6A 1ZD2P 4LHEA 5JANA 5I7UA 3NOXA 5CW2A 4GLBA 2OLEA 3NUZA 2XQJA 4UUQA 4BZZA 3H0CA 3YASA 4B6GA 1BCSA 4BC1A 2RI6A 2OGTA 4JUIA 5DNUA 3BJRA 2IX9A 1XZHA 2QMQA 4AMZA 2PU7A 1ZI9A 4U2GA 5LLSA 3RM3A 4FWBA 5SYNA 4AQDA 4X85A 4E15A 4X6YA 3K2IA 4H18A 5EIEA 4OU5A 2JGJA 3LS2A 4H77A 5FV4A 3ZPXA 3WKDA 1N5MA 2AJBA 2YASA 2RAUA 5K3FA 4FOLA 3EQ9A 4Z49A 2P8SA 5ALSA 2WUFA 4FNGA 4U2BA 5ALXA 1LGYA 2HA0A 3K9BA 5E4TA 3WIBA 5I8PA 1VKHA 1UOPA 4KACA 3WZLA 1CV2A 4JYMA 1XKTA 3PE6A 5DNVA 5A2GA 2DR0A 5AM1A 5AKLA 1GKLA 4X90A 1DWPA 2B9VA 2Y1KA 4I19A 4C01A 4P93A 5AOBA 3WL8A 1R88A 2I3DA 1CUJA 5JZ9A 1XRQA 3FAKA 5AP9A 1EX9A 5CTAA 5D3KA 2OCGA 4UHHA 3B5EA 1WM1A 1DT3A 2WIFA 3I2GA 1ODSA 1X2BA 1TRHA 3H1BA 1QFSA 1RWQA 2PSJA 3BL8A 1I6WA 4IH4A 4Y2XA 2ACEA 3A70A 2BCEA 5SYMA 1AQLA 3FYUA 3O4IA 4DYHA 3ZWQA 3IVMA 3HXKA 1A88A 1WHSA 3C6ZA 4WFKA 1DX4A 1H22A 2W6CX 4UBMA 2V9ZA 1JI3A 2G4LA 3FNBA 1CUSA 4KR0A 3DLTA 3UUFA 3G9TA 4ROTA 2O2IA 4HXFB 4BVJA 4H7IA 3A2MA 5HF8A 1YR2A 5FPPA 4A23A 1FFEA 4M0MA 3K6KA 2HA5A 3QZUA 3E0XA 3RKSA 1N8SA 2OGZA 4QA9A 3B3QA 3QPCA 4D9JA 2WTNA 4KAAA 4AO8A 4X95A 1GPNA 1TAHA 2ZJ6A 2JGLA 2RHWA 2HL6A 5JYCA 5BWCA 4UFPA 4BTVA 3C8DA 2PUHA 3M3DA 1E8DA 3R3WA 5AHXA 4DMFA 2XUOA 4HXEB 4BDTA 5DYYA 4AMYA 3EF3A 2XUAA 4HVTA 2O2GA 1XZBA 5F4ZA 5CH5A 4GXNA 3G9ZA 1FFAA 4UFOA 1AUOA 1IZ7A 3IUJA 1LPBB 4MXDA 3PUHA 3FYTA 4EBBA 5A71A 2VQ6A 3EQ8A 1AZWA 3AZPA 3DL4A 3SK0A 3JWEA 3F67A 1MX1A 1BCRA 4J7AA 3GZJA 2VEOA 4PSDA 4B80A 1MO2A 5AIAA 4X92A 5FRDA 1E89A 4UBLA 4EHBA 2OCKA 4BCDA 4CG3A 3G9XA 3FLAA 2BUBA 4KRYA 3D59A 4H7HA 3ICWA 2D5LA 3WJ1A 4B83A 1P0MA 1IUPA 4CIBA 3RK4A 1LPOA 3HEAA 1CR6A 4ARAA 1O6FA 3STUA 3V1MA 2WUEA 1SC9A 2B4KA 4PQEA 1QFMA 4H7EA 2ES4A 1DX6A 4MEBA 4X93A 5HQ3B 2DFPA 1AKNA 5EIHA 5AM0A 2WG2A 4X6XA 3FBWA 4F21A 1N5RA 3ZLTA 1DT5A 1DTEA 5CMLA 1W6RA 2HU5A 5HZGA 4CFSA 2WHPB 3BF8A 4FLFA 4PNZA 1CLEA 3GROA 4OB8A 5HK8A 4DNFA 2DHCA 5IKXA 1IUOA 3VVMA 2XMGA 3DYVA 2XMCA 1H2ZA 5HKAA 4J0HA 3AIMA 4YPVA 1F8UA 4BYMA 1Y37A 3TEJA 1HBJA 5T4EA 3DS8A 3L1JA 4BAGA 1LPNA 4AZ0A 3FCXA 5ALVA 4KE6A 2AJLI 5JAPA 1ZD3A 3EBLA 5D7BA 4KYVA 2BAGA 1BRTA 1UKAA 1SFRA 5A6VA 2OCIA 4V2IA 3WZMA 2GYVA 4MQMA 2ONCA 3R40A 3U0VA 4MWSA 2QUBA 3VJMA 2CKMA 5FP0A 4JEIA 5ALKA 2VJCA 1ZI6A 3AUKA 3FVRA 2PSFA 3KWFA 2DSNA 3V48A 4RNCA 1J2EA 4PSCA 3JW8A 1CUFA 2WIGA 4DTCA 1A8UA 3O0DA 1ETHA 5JIBA 4DMKA 2JEYA 5BWBA 1BEZA 1HDEA 4AN1A 1UFOA 2QS9A 3G0CA 1QONA 2HRRA 2PBLA 5C81A 4G4IA 1CUCA 2HADA 4P9NA 1FJ2A 1E3QA 4G5XA 5JD4A 4GHWA 4QWWA 1YA8A 1SCKA 2VJDA 2Y2UA 1PV1A 3W06A 2Y2VA 3UMJA 4CCYB 5JD6A 5JD5A 2JGEA 4G8BA 3HYSA 2NW6A 4WCVA 3QBJA 2CZQA 3T4UA 5CT8A 2BFNA 1LBSA 1R9MA 4QDUA 3IB3A 5HF5A 3V1LA 2E3JA 5ISMA 4OYLA 5AK6A 2WIJA 1CUDA 3KOOA 5LIPA 1CIJA 1CPYA 5FPQA 4NZZA 4ZWNA 2ACKA 2XMDA 2XQGA 1XZAA 3D2CA 3QMVA 5C8XA 1HPLA 2OXEA 3O4GA 2H7YA 4B81A 2GYWA 2WJ3A 4BCBA 4WY8A 5EHQA 3O4HA 4PF1A 2ZYRA 1DQZA 2C0QA 3W04A 5FLKA 4PV7A 1E8NA 5ALZA 5HF9A 3WWOA 1XZCA 3BIXA 2FJ0A 4DLNA 6YASA 3JYHA 3E1GA 4RE6A 2PM8A 3QPAA 3G0DA 1ACJA 3FCYA 3EIOA 1ZIYA 1C7IA 2HA6A 2I3ZA 1Y7HA 4UFNA 2JGIA 3A2LA 4J0KA 3STXA 1M33A 5A7FA 3QH4A 4HS9A 4M0FA 4BATA 5JARA 1ORVA 1ODTC 4KE7A 3IUMA 2XLCA 4B0PA 1CUXA 3KD2A 5AKEA 2VT6A 4L72A 1O6GA 1MAAA 1VOTA 1USWA 1C7JA 5FXMA 2WU3A 3P2MA 2XQFA 5J3JA 2HA4A 4K5QA 3HABA 4KAFA 3DNMA 3HZOA 3WKBA 5AK5A 1N1MA 1MNAA 4Q34A 5E4YA 4QNNA 1ISPA 2C5FA 3G8YA 4ZXFA 5CH3A 3M83A 4ZGBA 3STYA 3I2JA 3QMWA 5A7HA 1G42A 1U2EA 3VKFA 1XLVA 4MJ3A 4N5HX 2H7CA 3BXPA 3G0GA 5CT5A 1EK1A 5IVIA 3TGLA 5T4BA 2X5XA 3R3VA 2QXTA 3GUUA 5DWDA 1P0QA 1QIFA 4QLAA 2HRQA 1MTZA 2PU5A 4KE8A 1XQYA 5FDFA 4JYPA 1UK7A 1VXOA 1CUGA 3PI6A 1UKBA 3WJ2A 1W4LA 2JGFA 5ALJA 5CT9A 7YASA 3Q8WA 4AB1A 2W22A 5EGNA 1EK2A 2JEZA 3DQZA 1ZJ4A 3ANSA 4I4CA 3CCBA 3GA7A 2C7BA 3DJYA 5HK9A 4FFWA 2WILA 5JZBA 5AM4A 5I9IA 3C5VA 5AK3A 4WFIA 1EXWA 1A7UA 1CUYA 3KDAA 3IULA 4EA6A 4W1PA 4MQLA 2C5GA 4Y2QA 4Y2PA 2Y6VA 2JGKA 3IUQA 2QKYA 5LZ7A 3I1IA 1W52X 2Q0XA 4RPCA 4FMPA 2XB6A 3D7RA 2PL5A 1GXSA 2AXEA 4X97A 1YB6A 2DQYA 3EQ7A 3HC7A 1ORWA 4G1FA 1LBTA 2WFLB 3O95A 1LNSA 4QLOA 3STTA 1R4ZA 4X94A 1EH5A 4C6HA 1UKCA 1HKHA 3V1KA 2OG1A 5ALUA 1SOMA 2QRUA 1THTA 1EB8A 3B12A 4AO6A 3F96A 1ACLA 3RARA 4WDQA 2BUCA 3ESAA 1CUZA 3QVMA 4HTAA 1XKLA 1FFDA 5KBYA 2XUDA 1JJFA 2WLSA 1ZD4A 5EHZA 4TVKA 4G9EA 4B84A 1ZGCA 2CJPA 3L1HA 4GEGA 4LXGA 1F6WA 4GDMA 3IA2A 1YSCA 2HFJA 2AJCA 5JZSA 1BN6A 3ICVA 1VLQA 2UZ0A 2H7XA 5AK4A 4BCCA 3UUEA 3M81A 3MGAA 5JAOA 1KEZA 4L9AA 1VE6A 2OGSA 4UHFA 3C43A 4E46A 5C8ZA 3OTQA 4QEKA 2ZYIA 4A5SA 4B9EA 5AOAA 3WYDA 1JFRA 4GBGA 1R3DA 5JAHA 1MPXA 5AM2A 2AJDA 2RGUA 2PKYX 3PFCA 2WU4A 5JASA 2QM0A 2WTMA 2CEKA 2JBWA 2AJ8A 1CUBA 4QDOA 3IIIA 1T4MA 3LIIA 2GZSA 4O08A 2ORYA 1CUWA 3FLEA 2XUFA 3I2KA 1VE7A 1WB5A 4Q05A 4NVRA 5LZ5A 1EVEA 3F8SA 4QDXA 2PSEA 4ARBA 3OURA 5K3DA 3QPDA 4GECA 2XMRA 4H35A 2DCMA 2ZSIA 1PJAA 4GWLA 5ALPA 4J0GA 4H0CA 4OPMA 2PUJA 3PF8A 1FFCA 5DTIA 5HKBA 1IMJA 1U8EA 5EFZA 1H2WA 4EB0A 3ED1A 3O9MA 5CXXA 2ZYHA 5BV7A 4Y2RA 5ALWA 2B20A 1HL7A 4EY4A 1XFDA 4BBZA 3A6ZA 1C4XA 2XMBA 4MEAA 4TPKA 3C5WP 2IITA 4Y2TA 4H7JA 1VA5A 5K5EA 5DYWA 4CIAA 5AKYA 5AI4A 1CEXA 1UXOA 1JMYA 2J4CA 4BE9A 2VATA 4JH0A 2WHPA 3FSGD 4X3CA 1SCQA 1AURA 1GGVA 5CXUA 1CRLA 1CQZA 1ZI8A 1CQWA 1XROA 2XQIA 3R0VA 3W9UA 4N5IX 5ALQA 1TCAA 2VTVA 5AI0A 1GKKA 2XUPA 1HQDA 1THGA 2OQVA 5IH7A 2PPLA 2QXUA 1U4NA 3VJKA 3VJLA 1ZIXA 2YH2A 1JKMA 3LLCA 1YCDA 3AZQA 2QT9A 4HRYA 5LYYA 1IUNA 1EHYA 3KSRA 1CUIA 1XZDA 5AI8A 1BROA 3E3AA 3S2ZA 4J0IA 1QOZA 2GBIA 1X2EA 2GBGA 4OU4A 4G8CA 4AZ3A 2WUDA 4FFVA 3I6ZA 1MX9A 4FHZA 4QWMA 4BE4A 5LZ8A 3SWWA 2DHDA 3WWCA 4IH9A 3D3NA 3H2GA 4B85A 4Y2UA 1YA4A 2BKLA 2H1IA 3BF7A 4HZGA 1Q83A 4F60A 2XUQA 4BRSA 3FWHA 2H9YA 4XVCA 1WPRA 2BGRA 2XMZA 4MYDA 4MYSA 1WHTA 4E14A 2O7RA 3HRHA 4GI1A 4RGYA 4B82A 3BE8A 2XT0A 3BDVA 1L7AA 1K63A 2WG0A 2QR5A 3F98A 4KE9A 4LYDA 1DWOA 2QJWA 4BAZA 2ZSHA 1AX9A 4CCYA 3RLIA 5YASA 4DM7A 5EI5A 3N0TA 2EDAA 4Y2YA 3SX4A 1CVLA 4KJXA 4Q3LA 4F0JA 4C89A 2Y6UA 1WOMA 3X3HA 4Q3KA 3ZLVA 3HJUA 1YS2X 3IDAA 1UK8A 1QE3A 1F0PA 2G63A 4EY8A 5FOQA 1OILA 1L7QA 1LPSA 4NMWA 1QIIA 1EA5A 5ALDA 1BE0A 3OOSA 5ALFA 3WWEA 2XI4A 5ALMA 2WUGA 3W9BA 3DYIA 5A7GA 3DEAA 3WI7A 3FLBA 5EHNA 5AOCA 4BAUA 3DL7A 4G4JA 1XZGA 3R3XA 2DHEA 4YASA 1DWQA 4K6GA 4OYYA 1ZJ5A 5IVHA 2VJAA 1XRLA 4H7KA 1GPLA 3AIKA 3W05A 2IIVA 2JIDA 1Z68A 3PUIA 4Y9SA 5T4HA 4HAIA 1K4YA 1QLWA 2XMSA 2PX6A 1CFJA 2VAVA 4WFJA 3CCCA 1G5FA 2QVBA 4FLMA 5HFNA 4X7BA 5DNWA 3WMRA 4UPDA 1NU8A 3DKKA 3G0IA 4U2EA 4UHCA 1YASA 2WHRA 3DOHA 5D6OA 2HA3A 3ILSA 1VA4A 1ZICA 4Y7DA 5AKJA 3C6YA 4X00A 2WSLA 3I6YA 1B6GA 5AM5A 4P08A 3H17A 4W63A 3G0BA 1UOOA 4S0XA 4CG2A 5CT4A 5ESRA 3VISA 3ZV7A 3FVTA 1P0IA 4B0OA 3WKAA 3GFFA 5K3AA 3WL7A 3ZI7A 4Y2SA 1CUHA 3AINA 3QM1A 3C87A 4DSZA 3O9VA 4G9GA 3D2AA 4N8DA 1LZLA 4BVKA 2QUAA 3I2HA 4J0DA 3KWJA 2OPHA 1NX9A 4LKOA 1UOQA 3PF9A 2ZJ7A 1E5TA 3H2IA
chains in the Genus database with same CATH superfamily
3F8WA 2IYOA 3P9PA 3GDHA 3T1TA 2HU8A 1LQ2A 3VH2A 5GONF 2XDQA 3HDYA 4D3DA 2FPPB 2IF2A 3QIAA 1NW9B 2N1BA 4NECA 4XDHA 2QD2A 4L07A 5F35A 2WT9A 2ZREA 3VZRA 3WLFA 4PTZA 2F48A 2Q4OA 5EE0A 1DWUA 2XB2A 2R8YA 1WEKA 2EV9A 3TEFA 1U7UA 1VHJA 1G6Q1 1NKSA 1NVXQ 1WMBA 2PRYA 3HM2A 4L7QA 4UBKA 5C18A 3KTAB 2XNJA 3RRJA 1XZMA 1T9GS 5FI0B 2O54A 3DMDA 3OZ7A 1T1JA 4KQWA 1KI6B 3V9AA 5JSKA 2PGAA 1DKRA 3NKLA 2Q29A 4DC9A 5K2OA 4JC8A 4D5EA 4QJ3A 1FP2A 2WYOA 3GI1A 2JIZA 3MWDB 4B4DA 4N9WA 1FQJA 1ZIPA 3MIZA 5J23A 1A5TA 3SPXA 1JIUA 3GRZA 3QMMA 2PJZA 4Z9AA 1MJHA 1L3IA 3M4NA 3ZNPA 1L9KA 2OLKA 3FJOA 4U9UA 5IF9A 2EJWA 1BMDA 1ZNZA 3GD7A 1WBJB 3AR5A 2A67A 3G7NA 5AHRA 1FLDA 3EFBA 1E3TA 3R3HA 3Q8LA 3QVSA 2FA9A 2V54A 3DVSX 4HH4A 1XALA 1ZJJA 1PEDA 1OXKB 1RQ2A 1SPXA 3WICA 3ZWCA 2O5VA 4B76A 3MWGA 4CLOA 4PC3A 1GQ2A 1XVVA 2EGGA 3TR5A 2EJBA 3PK0A 2ODWA 3PP8A 5CVEA 1WSBA 3V7WA 4LDPA 3Q3IA 4W99A 3DTNA 1DZ3A 2HCFA 4KGXA 3K9QO 3FHOA 1ZRSA 3K3PA 2J1LA 3GP5A 3HN7A 4DPKA 3RVBA 1NI5A 4M21A 3U44A 3FVQA 3HGTA 1O08A 3GH1A 4FKBA 4O3MA 3TXYA 3CW8X 3WE7A 2PLRA 1SVWA 1ISJA 1B76A 2IXBA 2FK8A 2L0XA 2P2NA 1WXIA 2HIGA 2PKEA 2XDWA 4I5DA 5COBA 3ST7A 3N39C 1ZUIA 3GUHA 3EGWA 2ZIXA 4KFCA 1IQ0A 1P1BA 1LK0A 3GPCA 1O8CA 3R8CA 2JLBA 3LW7A 3OSZA 4HDAA 2Z2IA 2Z2ZA 1OVMA 3C6XA 3HRIA 3B8EA 4J3JA 4C4PA 4R2WA 3TNDA 1D2EA 2IDKA 4OHWA 1IRXA 2BGLA 3RRMA 3B6IA 1I51A 4LHWA 2NUAA 3GIWA 4N7MA 4LWZA 1G4UR 2X6RA 3P9KA 5J5VA 2C8KA 1U3UA 3PQ4A 5C1BA 2C83A 1RC1A 1C9MA 2YCLA 2YCBA 1VYTA 3AESB 3FNGA 1P7VA 4N18A 5FTNA 1M0EA 3CC8A 4W9RA 1LX6A 3E27A 3TRIA 5KAMA 3AP3A 3K6SA 3RVDA 4B3CA 4CMJA 3DD5A 1SRQA 4INJA 1BVHA 2ZM6B 3IO3A 1XLWA 3RFVA 4LOIA 2OD9A 3EBOA 4U2FA 1DX9A 4YJ3A 4R0MA 4NJOA 1S2IA 4X1KB 2BFEB 4N7JA 5F1KA 3A9SA 3I8XA 2AQKA 4RH0A 4ME6A 3HXQA 4R9UC 1C1DA 3L9WA 1LLUA 2AHOA 1VYUA 3H19A 4KQHA 2P3LA 4RVSA 2I4IA 3TXXA 1ZU4A 2QOEA 4O4LF 3E9CA 4AXBA 3TNJA 1ITZA 4OYRA 5C2JB 1TKRA 2ZBPA 4N8SA 1V2HE 5K6TA 3W5CA 1YI1A 2Q2NA 4C78A 3LP8A 1OFVA 1QKKA 1PT6A 3G8DA 2L18A 2WMOB 1UZAA 3MUNA 3OECA 2PQ0A 4M0DA 1Y1TA 2VYCA 4LQLA 5CLGA 4D8XA 2A9KA 3TRDA 4BMSA 3QEJA 5AHXA 3KTDA 4V0RA 5I8WA 4FCVA 3ISJA 4LJYA 3GVPA 4CU5A 1MRZA 2ZUBA 2EX4A 1H1LA 3GNTA 4BC0A 4K87A 2P79A 4UEQA 1J7JA 1Y4UA 3EXAA 1FDIA 4NNOA 2KE5A 3R7SA 3F49S 3OZEA 1DTSA 4YP5A 1XRRA 2II6A 3E1SA 3K94A 3LIPA 3Q2OA 3IERA 4FDTA 1XYGA 1TPZA 3WGZA 4BUCA 1ZD5A 2WSIA 1IIBA 4FCWA 1O95C 4BVLA 3GRVA 2Q3BA 2IJGX 4UUAA 3DTVA 1ORIA 1Z2NX 2ZJ8A 4D97A 2LVBA 3KQPA 1Q19A 1R12A 4W6QA 5CLHA 4I14A 2HIHA 3FUXA 3WY9A 3JZIA 3CT6A 4J43A 4NU0A 1C9EA 2IYVA 4P4UA 4Q82A 4Y6PA 3RVSA 4TL7A 2W83A 5D6NA 4US0R 1SHJA 3OUTA 3DE0X 3L0PA 3PTLA 1W88A 3WRXC 4HNQA 1RBQA 1TUIA 4M2LA 3S68A 1HE4A 2X0JA 4N0DA 5F2OA 3DKRA 5DTQA 1W7AA 1IBMB 1P31A 3H7AA 1X92A 5A9TA 4HL6A 4E5PA 3QLJA 4JC4A 3WK7A 1EQ2A 2CHGA 3EAQA 4MQBA 2IVZA 4ZOLF 4GWGA 5ARDA 4YAKA 3IAFA 2QG6A 3GN2A 3MCVA 4F93B 1Z38A 4IUYA 5G40A 3SQNA 2QVCA 3IMKA 1KA9H 5C4GB 2DHQA 3WOVA 2IPXA 3PHHA 4KXYA 4RVFA 4B32A 3SS9X 5BN1A 1W0JA 2OBXA 2RHRA 2VT7A 3ECCA 3L6CA 2MR6A 2VHEA 4LXYA 4N8EA 4EX7A 1WDLA 1R3UA 1SVSA 2VQSA 1JSRA 1TFRA 2BJHA 3CF2A 4HTFA 4DV0B 5BORA 1XZLA 1QRSA 2QLTA 3ETHA 3CVWA 3IOCA 3HI6A 2IZZA 1B43A 3BFVA 5REQB 3MWKA 1QRAA 3HACA 1FYDA 3OE7A 3CX8A 1OVGA 3VTFA 2FOIA 2E4XA 3K05A 4LI0A 5K3CA 2BF4A 1C7RA 2DTEA 3TQSA 1XZ8A 1DV1A 4O4IA 4ZVOA 1BYUA 5DOVA 3FKSA 1BWQA 4W5HA 2FVYA 1Q0ZA 4ZRMA 2OSVA 2WR8A 4XWAA 3U4AA 3NLLA 4BWYA 1UWVA 1R8SA 4JY7A 2B34A 3J81k 4BRZA 1O95D 3ZHQA 2CUTA 1ZFNA 2B82A 3CQ9A 4RK7A 2CFIA 2PJRA 3N2IA 3IAM1 1QV9A 2WSBA 4PRYA 4RIFA 5ICSA 4YAOA 2R4QA 5CDSA 1D1SA 4LVUA 4HGQA 4MGEA 3I2IA 4MUJA 3OPYB 2XA1A 1QE5A 1SQFA 4L5AA 1ZN7A 5SYAA 2AOUB 3RJMA 1RDFA 4AJEA 1DGQA 1CUVA 1FVHA 3PA6A 4JEMA 4TMZA 1IPFA 1PRYA 1TK2A 1WKVA 3L1UA 5BPFA 2VZ9A 4NYMQ 1U6IA 1I6KA 5TQ0B 3HVJA 1WEHA 1PU2A 3TTYA 1SURA 5GOTA 4CCWA 3C2QA 5T6MA 3QP9A 3U4CA 3W9SA 3JQAA 3MCUA 4WEOA 4WJZA 4AURA 4YT5A 4G01B 4E08A 4JSYA 1T3SA 2PG3A 2QX9A 1OW3B 1KFKB 4LYEA 1HYHA 3QLVA 2F8LA 1KEUA 4KWTA 1OE0A 4MI3A 1CJKC 5F1PA 1YIOA 2HYIC 2OESA 2ZEJA 3DDSA 3G9QA 5B7NA 3QUAA 1SVMA 2OB1A 1AQIA 1FK8A 1U28C 2O0JA 4OP3A 5IJ0A 3PQCA 3TSZA 1VBMA 1WPQA 3I0NA 1FTGA 1FSFA 2ZRPA 1E1DA 3FYUC 5CLLA 3O2SB 4ISCA 1C7FA 2XQVA 1KHTA 2DC1A 4Q24A 2EKDA 2FSUA 3V2UA 4C4ZA 3CLKA 1W76A 2QX6A 3OPMA 5ALYA 2C4KA 2OMEA 3DEJA 1ESCA 1N2EA 2LUOA 3JQPA 5CM8B 1XNQB 4UOZA 2VA9A 4XSHA 5BXQC 2AK2A 3ZCRA 3SIXA 1RNLA 1TD9A 3T5DA 2QUZA 3NBQA 1VL1A 5CH8A 3NBXX 1YAHA 3STVA 5I48A 2WIDA 4R1NA 2YJ4A 1LI7A 2VXYA 5AW6A 1IN4A 5K8JB 1GILA 1Q0RA 1ZCFA 2C2ZA 4MQUA 4O5AA 4QT4A 4MIKA 2OBFA 3D0QA 2WMDA 4PNPA 3OOWA 5EE5B 1HNZB 5B3LA 4EMUA 1IJKA 4LEIA 5EUCA 1C5KA 1K0FA 2QYOA 1RMQA 2VHTA 2VJLA 3CXUA 3DE3X 3OLQA 1C0IA 2YYAA 1U5CA 3VR3D 2O8EA 3ZNQA 3DMNA 2ROQA 5T3UA 3KL4A 4N65A 3VHXA 4PFSA 5KJFA 4DGQA 1JJBA 2CCGA 3A6LA 4ZV7A 5HQ3A 3VV2A 3V4OA 2XUIA 1VZ2A 3L49A 1QANA 3SR0A 4EY5A 1X7ZA 2V55B 4RVUA 4M1TA 4Q21A 3VR1A 3AB7A 1FSSA 3ZDZB 4QGSA 4DIUA 5CVJA 4XKJA 5KKCA 1BIFA 3C74A 3DBIA 5KQSA 4CKWB 2HB6A 1VC2A 2X9LA 5BYJA 1X7WA 1O96A 4CXMA 3ASZA 3BMCB 4J16C 1FJXA 2PRIA 3WGKA 3FPCA 3R77A 4GPEA 1ST3A 1Y9DA 2GEDA 5AO9A 1CBUA 4ENUA 1LBIA 4FLEA 3CWCA 4YUVA 4QFDA 3MOIA 1GDTA 4B74A 4MUGA 3NDBB 3ZLUA 1YDEA 4OB6A 3L6UA 4OB7A 2OWEA 1TMOA 5K6AA 3KAJA 4PYOA 3ITKA 4M88A 4O0MA 5ALIA 4EA9A 3FWPA 4LZZA 4MPRA 5KYXB 4XPIA 3CMMA 1BC5A 3HWRA 4F8JA 2PH3A 5K7SA 3RO7A 2PGDA 4IDFA 1SMKA 2IOYA 4ZYLA 3L7YA 5C52B 1UWKA 1AKEA 1NTRA 1A5SB 3HVKA 3PQFA 2ZI3A 3AKEA 4NARA 3FETA 3NWBA 3AHJA 1RXUA 5I7SA 4AKIA 2BBWA 2COKA 1Z4PX 3SXPA 4TROA 1J06A 4QYMA 4MHOA 1N1DA 3EZ9A 4U9HS 2Z56A 3LTNC 5ALLA 1AHNA 2AH5A 2ZI5A 3FVWA 5GVRA 4E2WA 4YV0A 4KPUB 1NV9A 1W59A 2BZSA 2FWBA 2GWRA 2RHCA 4C87A 4DSOA 4RHFA 1UWCA 1UK9A 1DEKA 1B8VA 1DINA 1F5SA 2WNHA 3GFTA 1QFYA 3EK2A 5LN1A 2HRDA 5G1NA 5JNRA 1FYXA 2X4GA 3LXRA 3AVXA 2CMFA 3SAJA 3UAYA 1FF9A 4PPGA 3E58A 4CHTA 6LDHA 1Y48E 3HUTA 3FI0A 4NBWA 3STWA 1GTL1 1X1EA 5A2QA 2Z8YM 3PDHA 4GR4A 4U2DA 4D9BA 2BUAA 1D04A 1B1CA 5LSAA 1TCCA 3KCQA 2HK8A 3FHJA 4H3VA 2ECFA 3WIOA 1C3JA 3C15C 3DLAA 1VLZA 1XHLA 2YZGA 3HB7A 4BMCA 5BNIA 3KL2A 3TUJC 4DLBA 3PA8A 4Q7QA 2HAEA 1Y8CA 3AERA 3VPXA 1PS8A 2PL3A 1YOVA 1VJ0A 1XNGA 2C8LA 2RAFA 3N7UA 4P84A 4REQB 2GBFA 1YJAA 1ORRA 3MILA 1LLQA 3PB3A 3IKLA 4RVOA 1OX4A 3LCMA 5GZ1A 4NE9A 2HJRA 3H04A 2GM5A 1B2RA 4B43A 2OO5A 3C7AA 1IRIA 4GPBA 3HB4X 5FR2A 2I3GA 1GO2A 4UVGA 5JS8A 2EJCA 2VYND 5AI9A 3OHPA 1L7EA 3QY0A 1NURA 3MCZA 3DH0A 1FFYA 1Z7WA 3IKVA 1Y4DE 1J90A 1G2OA 1T3LA 3GJ5A 4AZ3B 3FR8A 2O3QA 1E3JA 3KT0A 1JI0A 3OM0A 2OB2A 2CCKA 2GRAA 2PZAA 3EGXA 3M33A 4O4JB 3SFVA 3ZC3A 2R00C 2O52A 3NO4A 1NZJA 1Z7BA 1W87A 1XZFA 2QRVA 3COSA 3ADCA 2XCRB 1U8UA 2P11A 4X0EA 1QFXA 3RLFA 1XEAA 1UEXC 2P3OA 4OHPA 1GTSA 1QKJA 3B3JA 1I6LA 2P3SA 3B38A 3IEUA 3PBKA 1M7GA 5DM4A 1E1CA 1LC0A 2EGUA 4S0ZA 4YT4A 1HLGA 1Y3CE 2G1KA 4YROA 1QU3A 3H4TA 4Z86A 5FYDA 4EK9A 5FNVA 1Z2CA 2NO4A 4RXUA 1OIXA 1TT5B 2R751 1E9AA 2DQZA 4KIFA 2BR4A 1ZG3A 1R0CA 1TZKA 2MOKA 2Q4RA 5ALEA 5EJ9A 1JG3A 1N6LA 5CB4B 1CQXA 2VPZA 4BU0A 5C8VA 3HADA 3RSOA 5ALRA 1XAHA 3ZXSA 3W5DA 1S8OA 1U1CA 3UFBA 1JHQA 1YB7A 3RW9A 2YWXA 3D7LA 5L7WA 4LY6A 4RV4A 3P26A 4FZJA 4Q4AA 1ZKMA 3DT9A 4WA8A 1KEEA 1JEOA 1L7RA 1T8TA 4E6EA 3NHYA 5CD1A 3DMRA 4B8ZA 4W5OA 2R6R1 3W5IA 3C70A 5DHFA 1E2QA 1S2GA 4CMKA 5FQNA 4D4GA 4FZRA 1H1TA 4N1AA 2IRWA 1NJ6A 4OD0A 2JLUA 3G8AA 2XNKA 3PHCA 1ZLXA 1Z37A 1KRWA 2UVPA 1RYNA 2HV9A 3GT3A 5AKGA 3X1DA 5IKMA 1JQEA 2BFBB 4D80A 5KMGB 3GJ6A 4AUMA 2VHUA 4KSCA 3MS2A 3CT4A 3ND7A 1PL6A 3PDCA 5KSOA 3QWFA 1DQSA 2A5YB 2UVDA 2R11A 4JMLA 3UB4A 4E21A 5HZHA 1J1IA 5KO2A 3IT0A 1X38A 4TWBA 1ODCA 2ADOA 3PGLA 3R5JA 3P5BA 1ILEA 4HC4A 4XJXA 3LLMA 4KVAA 1UJBA 1NVTA 4QSMA 1JDZA 1ZNXA 2B3TA 4I81A 3LHSA 3QJ5A 2XMQA 1L4UA 3RUFA 4MKXA 2XPCA 3W6ZA 2HDNB 4EB6B 1H2XA 2FUG1 3HH8A 4C06A 3GGDA 4E11A 3N7AA 4ZICA 3WBFA 4S1PA 3R9IA 1DKUA 5BSWA 3G1WA 4Z4FA 4ISBA 3WIUA 3DE6X 2DY1A 4TLLB 5IU6A 4OQPA 1Y5IA 2QZ4A 3ONFA 2W2MA 4YRZA 3C24A 1W34A 5BYBA 2XWBF 1KF0A 2WHQA 3H3JA 4OFZA 2BFWA 4QD3A 2WLTA 1J6UA 3QKTA 3ZHRA 4BKOA 5EZYF 4PN7A 4WDRA 1J39A 3EIUA 2NZUG 1DQYA 2P9BA 1T5TA 5A05A 4F4CA 3GLKA 1Y3IA 3FNFA 3PI7A 3UT5B 2VKQA 5ICGA 3K73O 3QVJA 4QVKA 1RSZA 2H6EA 1P18A 3WYAA 1G7RA 1U0EA 1D4AA 5LKRA 1E3DA 1RWKA 3PFKA 1JNYA 4AF6A 2PGNA 4M0PA 4OH7A 1XZEA 1REQB 2RHOA 4NH4A 4F1JA 4RGVA 5KX5A 3OQPA 4R7ZA 5J47A 2KBFA 2C92A 2PCJA 1O54A 4K9OA 1DAGA 2WWYA 1HH4A 3DLIA 1AVTA 3DP9A 3JQBC 4TLAA 1EU1A 3IDFA 4C0LA 5EHIA 1YRBA 1HSOA 4UARA 4EITA 2F4VB 5CLJA 1UAYA 3NWOA 3R9KA 2PX5A 3FPEA 2R7KA 4NC9A 4MVJP 3F2IA 3AR8A 2XYRA 3FDIA 3PQ6A 2PRSA 2VNAA 3JSAA 1B42A 3DPIA 2H51A 3I30X 3NCTA 3NAMA 3PD1A 1LDNA 3Q6NA 4V0SA 4W6ZA 2R8BA 4EA8A 3CB2A 1X7YB 4JL5A 2OECA 3MC1A 2PMKA 4KU4A 4LBYA 4PYKA 4WLFA 3V8NA 3ZV4A 1L1RA 4PZDA 5JNSA 2R44A 5CEJA 2QORA 4G0PA 2RONA 5G53C 3KPWA 2A4MA 3IO5A 1Y6JA 3OKFA 1TAUA 1T36A 3AIIA 4MPPA 1N0IA 3UPUA 2A5GA 4HQFA 1IUKA 4OI2A 2ECQA 2YJGA 5FBQB 3GBVA 4EKNB 5TIIA 2VP4A 3V4RA 3ICEA 5K3SA 3GARA 4OQNA 1IH8A 1V48A 4YMSA 4UKDA 4H9GA 3BULA 5DASA 2IYSA 4XX1A 3V2GA 3THYA 2WA2A 3MELA 2WAAA 3OIFA 1CJSA 3M2PA 4PHGA 3MJTA 4FSDA 2PMFA 2PT7A 4RXTA 4WVLA 1H5QA 3N2ZB 3G6WA 3DVAB 4AO7A 1Y7LA 1QRUA 4B40A 3TLGB 3X1JA 3SZRA 3DFUA 1P1CA 2H9AA 4G1EB 1GGMA 1QTNA 2EFGA 4EG5A 1ODLA 4KZPA 3ELYA 3PC7A 5JVDB 5B30A 1E0DA 1ECPA 2B36A 4N5NA 1TZ2A 5LOVA 2VAMA 4WXEA 3V32A 3IELA 5HRCA 1P1IA 4C88A 3BYZA 2XUKA 1Z25A 1GEGA 3LGAA 3PZBA 4Z0PA 3TL3A 2IA5A 4OF4A 2OHJA 1Y4ZA 2VWHA 1WXGA 2WJVA 3NX4A 1YULA 3DO6A 4G85A 2WT4A 4LHZA 4W5WA 1I4DD 4GRDA 4BTLA 3PXEA 4LZNA 5AXDA 1ULBA 1J21A 3B53X 4FE3A 2X1MA 1S2LA 3RFXA 1XZPA 1QIJA 3LBIA 3SE7A 3VU3A 2CNWD 2OA0A 1QFJA 3DV2A 3TMYA 4CG1A 4KJZA 5E6RB 3RF6A 1A9ZA 2UYGA 4MB2A 2XCTB 1UWLA 2RFLA 1Q92A 1W30A 3JQDA 3OJFA 4JN6B 1EB9A 4QQKA 3JQ9A 4EI7A 2JVKA 1B41A 4QPZA 5CT6A 3NGMA 4RA9A 3UXMA 4NRDA 3AI1A 3WGQA 4LI3X 5CNJA 5H4GA 3OX2A 1HDRA 2OAP1 2F17A 3J7TA 4I3FA 2JI6A 2WKQA 3KKLA 5L3RA 3B78A 3MRXA 1ZJYA 3WYNA 1U81A 3KLPX 2JFXA 4PZZA 4W7SA 1IMOA 1EDBA 1K5DA 1T29A 1A77A 2Q0HA 3B20A 4Q3EA 2FZ4A 3IJEB 1SR8A 2DECA 3LQQA 4BQOA 1VLVA 5AVZA 1S9DA 5DLYA 2DUNA 4GC5A 1H2BA 4KR9A 1HDCA 1FP4B 4LJ6A 5DB4A 4Z4HA 4UHDA 3L7OA 3NHWA 3MGGA 2AFIE 4MEJA 2YBDA 3OZRA 1Q0SA 4LYJA 3UUWA 4A6DA 3WL5A 4FYXA 3W5SA 5C7YA 1QIHA 4Z4CA 1I30A 2EFCB 5CLFA 3G9UA 4LV5B 4CT5A 1P8JA 2ORWA 2PT5A 2R4UA 3KJQA 1G20A 4UBNA 5ABPA 3VBEA 2QPAA 4Q39A 3GD5A 4BJHB 2BVNA 1B8PA 3FY4A 4HGOA 1R4AA 1JHZA 4TMKA 2ZDGA 4HGRA 2ZYTX 3ETNA 3ROEA 1UT6A 3LJKA 3QSYA 3E7WA 4R68A 1ODJA 4YRNA 2QQEA 3T1OA 2HA7A 4LYFA 1MQ8B 2I7CA 3WLTA 4NZPA 4R2HA 2I78A 4YK7A 1M1UA 5E1MA 3WQQA 4C7XA 5FAKA 5KU1A 4QPCA 1ZJWA 2XXAB 2GVZC 4H7PA 5LOVF 4YLEA 2JJ8A 4Z4IA 1BXGB 3SJZA 1IHOA 3IAXA 1VYHA 3M70A 3NIFB 3QU4A 2QMZA 4GLBA 4JLAA 1XRJA 2C54A 5JCJA 2G1PA 3LUHA 3PGA1 4HLUA 4UAJA 4D9CA 1ZIOA 4HAXA 4UUQA 1MB3A 1U1IA 4CM4B 3UJ7A 4OGFA 4BZZA 3H9JA 5H3LA 1RHQA 4YUYA 4XSGA 1MVOA 2ZXEA 2C3MA 2XDQB 3KHKA 4WY2A 3BVPA 3LA8A 4ZPXA 2OGTA 1USVA 4JVMA 5JNWA 4KR2A 3VDRA 3ZGZA 1N33B 2YJ6A 1FRFS 3JD4A 3HCBA 4AIIA 3LO5A 1TVEA 1XZHA 2ODAA 2I9PA 1A9TA 5E7QA 4F5DA 2AWOA 4Q15A 3WDSA 2INGX 4O2RA 4ZJUA 1RCUA 5LLSA 3RM3A 3A4IA 3I01A 3WGYA 1ZMXA 1EFVB 1RXYA 1SXIA 3KQWA 1EG2A 1P77A 3K2IA 4XGNA 3I05A 1T0HB 2IL1A 4LZOA 3IUEA 3LS2A 5CPFA 3T1NA 4XQCA 3O2QB 2REOA 2DZDA 2A3RA 2Z83A 3CH5A 3ZPXA 3WKDA 1HRKA 4BPBA 4WXMA 4REOA 2B94A 1EK6A 1VL2A 3U4QB 1SCDA 2IHYA 1JP7A 5GV7A 5DM70 3LCCA 3AEUB 2AE2A 5K3FA 4ZYYA 4FOLA 1E0JA 4FYPA 3URKA 3X1KA 3LQRA 3LI2A 3EQ9A 3O8QA 4CQLA 4ERXA 1ATIA 5BVHA 5ALSA 2QU7A 1OWOA 2JAOA 2YUTA 4FNGA 1WQ4A 4CLOB 5ALXA 3ZZMA 4MW7A 2IEGA 1VCIA 3ZDXB 1F4LA 1LGYA 4ZANA 4LXQA 5E4TA 2W71A 2AW3A 1TFUA 1UOPA 4KACA 4ND7A 1TLLA 4NFYA 2PWZA 3WZLA 4DB2A 1YZVA 1M1NA 4LJ4A 4KYTA 1VP3A 2W2KB 5K4AA 3PLNA 4OIMA 5M3BA 2JLWA 3P20A 3PE6A 4CV3A 3VR3A 3DFZA 4OY3A 5AM1A 3T5TA 2ZS8A 5H59A 3R0JA 1XDUA 1N0WA 4QOFA 1DDOA 3L5KA 2H2AA 3NIBA 4G0OA 3PTAA 1PGJA 4HR7A 3T1QA 1W9HA 1DWPA 3FH0A 4WK6A 4I19A 3ZI4A 4LF8B 3SC6A 3U19A 5CFZA 2ZIXB 4I5GA 1ZGHA 2PX4A 2FDCA 1QG2A 1SBHA 4RTOA 1CUJA 3MMZA 5HKKD 1OWNA 2PYZA 1ORTA 1MBZA 3DL0A 4JGGA 3VOAA 2Q46A 4LHVA 4KDFA 3C5CA 5JZ9A 2IYZA 3FAKA 3JZAA 4D44A 3IUBA 1OAAA 4PXSA 1EX9A 521PA 3DR3A 5TVGA 4YP6A 4DMRA 2P2LA 2NUAB 3LK6A 1ULUA 1G2PA 3S29A 4KWEA 4A0GA 1LSSA 2WIFA 2ZRCA 3SYRA 1ODSA 3K6SB 3W5JA 1P74A 1RYFA 1ENZA 1T5OA 4FIZA 1IB0A 2A58A 4YRBA 4DDVA 5J4HA 3GFOA 3KEOA 4YJ3B 4KGZA 4Y2XA 1V4BA 4DCPA 4CKZA 2HEGA 1QSGA 2R6AA 4L02A 5SZJA 2JBAB 2OGUA 1YS7A 3BFPA 4OP2A 4RJLA 2HJGA 2JCXA 3D9QX 1IM2A 2VZ0A 4PIMA 5SYMA 4G9BA 4Z7JA 5IDQA 3FYUA 3P2JA 4ZDIA 1B23P 4JL8A 4E4TA 2MYNA 5HBGA 1VCNA 1NUHA 1R0YA 4HFNA 3V4LA 4IOKA 3A1DA 3IR7A 3R6LA 4FUTA 2GXQA 1W5SA 4ALJA 1WHSA 1P4RA 2ATIA 1QORA 3C6ZA 2B30A 1KKUA 4TL9A 3T9AA 2ZSKA 3VR0A 5BYKA 1IXYA 1LY1A 1ICEA 2ANCA 5FOTA 3FBGA 2C04A 3F74A 3K0CA 1EM8B 2AZXA 2N46A 3L0IB 2W6JD 3IP8A 2RGAA 2FFHA 3NKFA 1ZOOA 4MWGA 1P2FA 2V9ZA 1JI3A 1I2AA 2G4LA 2I6UA 3QXJA 5GP1A 1CUSA 3PKIA 4WD3A 5TS2A 3FXAA 5HJ5A 3DLTA 2EFHB 4KK4A 3PLAE 2VNIA 5H7XA 5GZ3A 3K0HA 1G2QA 1H1LB 3PUXA 3QW4B 1XMXA 4NATA 1Z8DA 1Y63A 4BVJA 4QL3A 2VQEB 4FZ5A 4BMPB 4PFKA 3OTGA 3WB1A 1YZKA 2IOQA 5AW8A 4GGPA 4I7EA 2EZ9A 1NRJB 3BMOA 2GJ4A 3T6KA 1N6NA 2UYYA 2ZE6A 3K6KA 1GAEO 3QBTA 3QZUA 4MIOA 3GJQA 3AF3A 4MV4A 3REFA 3SLGA 2AFHB 5CYFA 1N0VC 1TA4A 3K72B 3MAGA 4GYYA 3Q7QA 5FWDA 5AUNB 3W1EA 4D81A 5B1SA 5AESA 3MJHA 1F38A 4URYR 4X95A 1RFLA 2I3AA 3D7NA 4J16A 1GPNA 1TAHA 3CF4G 2IBMA 5CDTA 2ZE8A 2JGLA 3HJAA 1D4OA 3OFVA 3IAS1 1VJ1A 1W5BA 1KFJB 2CL6X 1OH7A 1MABA 4PPQA 4YJFB 1XRSB 2VYNA 4Q4LA 1L2TA 3NAQA 2BY4A 2NGRA 4XIFA 5CGZA 3I5MA 3T54A 1NI4A 5HRAA 5JYDA 1SJ9A 4OLAA 4ZARA 3KB6A 5KU7A 5J5CA 2XB4A 1F51E 2B8EA 2PUHA 1X1CA 4QOGA 3SHOA 2RBGA 4EUFA 1B6RA 4XWYA 2SCUA 2NQTA 3ADBA 3CONA 3MN1A 2HIMA 2NO7A 2NUTA 3VNUA 3SKYA 5JXIA 5COAA 2ORVA 4M7OA 5C37A 4HXEB 5FTMA 3M1AA 2PZFA 1I7NA 4K9SA 2OV2A 1YDMA 1SXJA 1Y1LA 2JGDB 3FG9A 3NPMA 3PENA 2B3DA 4HDSB 4RF4A 3VKVA 4QEZA 3PHJA 1T5DX 2F1HA 4OLHA 2YXDA 2W11A 1GYQA 4GX1A 1FA9A 1WU7A 3OQ6A 4EM6A 3S44A 3S2IA 3Q2IA 2NTEA 1I36A 3WRVA 3EC1A 4UOEA 4GOKA 4WZBE 3KQUA 1XZNA 1G8PA 2OHXA 3I8OA 3AONB 2XKBA 4GXNA 3QPWA 4MITA 4UEJA 2F43B 4JC0A 4UC0A 2JI8A 4ALMA 2ZIAA 3K71B 3K1AB 4O4IB 4Q3DA 5A0TA 3T95A 5JSYA 1NOIA 1P1HA 2OBBA 3NBYC 5A1JA 2FGKA 1K66A 2C2OA 2HPVA 4RY0A 4KPYA 3KJGA 1VHDA 3D8RA 3TVTA 3FYTA 5GOZA 3ZGLA 4R1SA 3FWZA 3O1JC 4IUBS 3G7UA 5HJ2A 3U9SA 1K2VN 4B3RB 4WBXC 2ILVA 4WAUA 5CA1B 2PXAA 4KR7A 2VQ6A 3VSDA 1V5GA 3OAAA 3JWEA 3FZYA 4NPHA 4NR0A 3F67A 1NW5A 4FC7A 3ZCUA 1U98A 3GZJA 1HDIA 3H8WA 3K9WA 3JX9A 4B80A 2BYTA 2FCRA 1MO2A 3DZ8A 5AIAA 1ESZA 1V37A 1J24A 1UQRA 3N07A 1TEHA 4M8SA 4PZ9A 1R15A 1KOJA 2Q4EA 4FZVA 4XQ9A 5FRDA 2I6TA 3TTTA 4YV7A 4ZODA 3NMUF 3M6IA 1GT91 1YFJA 4C7OB 2QNBA 4YAJA 1JHPA 2DUMA 4EJ2A 4DUZB 5ELLA 4RMIA 2AG8A 2FR0A 2WWXA 3NBKA 1JHMA 1CJBA 2VN8A 5H68A 3TJRA 5E0OA 3MXOA 3C7KA 1I10A 4JT2A 3M5PA 4M55A 3NT2A 2DFDA 4NU5A 1GA4A 1NSYA 2H5IA 1MQAA 1JG2A 1O5OA 2IDJA 4KRYA 4MYCA 5BW4A 3H5NA 1JKJB 3ETLA 4BEBA 1GITA 2AS0A 1A7KA 2O6LA 2Q6KA 3FUVA 4RD2A 4YRAA 3KUUA 2LXNA 4M22A 3THRA 3U80A 2IP2A 2OZKA 5E3HA 1R8XA 3AYXB 5B1EA 3JZMA 1XJQA 4BLSA 1XPRA 1Z13A 1UIMA 3Q40A 4NOJA 3OZCA 1O6CA 2FPUA 1OC4A 1IN5A 1FDWA 2WAMA 1LV8A 1X77A 2ZAIA 5IJAA 1DJQA 2PLWA 3L4BA 3TS1A 3ZCQA 1KAOA 3HEAA 5AHWA 5IXYA 3EARA 4ND6A 1I13A 3Q11A 4MDEA 1SD5A 4RPKA 5DO9A 3D8NA 4RORA 4F6LA 5TT0A 1V11A 5CP8A 1BWPA 5FI1B 4UZEA 3NM4A 4AUNA 3T9EA 1N2SA 2B4KA 1DBVO 4YMVA 4ZVUA 1NSFA 2WSMA 3I04M 3ELBA 4MR8A 3LKDA 2VVTA 4D9GA 1I3LA 3C3WA 4NMMA 5IN5A 2CV2A 1CZKA 3NYQA 2OSBA 3PDWA 1Z5OA 1RJEA 4X93A 1M2FA 5HQ3B 4B3DA 1YQWA 3DHWC 4HWRA 4C7VA 2RHBA 3CG4A 3DM5A 1JU9A 4NMLA 4OREX 1CRZA 3IP7A 2WG2A 4TV9B 1PQ4A 2F3SA 1N2OA 2ZRGA 4GOJA 4LRYA 2J9FA 1TJ5A 4KYIB 221PA 5ITVA 1E96A 3R5KA 1PAUA 1K6JA 1YGPA 2N1MA 3HNPA 1HFWA 1ZOSA 4FGWA 4BQSA 3OBBA 4OATA 1YZFA 3DOEA 1X7WB 4JDUA 2HSJA 4MWDA 4UPVA 5EJAA 4FLFA 4PNZA 5CX1B 3OQBA 4R6XA 1WSWA 3A3YA 1VL6A 1ILWA 1FVOA 2GBPA 3DTTA 1L1QA 3GROA 3KEFA 3L02A 3MF4A 3GJZA 3O3NB 1L5QA 4HB2A 4IS2A 4N5DA 4KREA 3UGQA 5HPYB 4YFYA 4DBLC 4IV5A 2PS0A 5DHSA 4LZPA 5JQGF 1CR2A 1TMKA 4RKYA 1M10A 2DERA 2GASA 4HZUA 2YV1A 4B09A 3L43A 1N6IA 3WX0A 1DAEA 1IZZA 3OCVA 3VVMA 1DBRA 2XMGA 3DYVA 3CB4A 1UM9B 3UK0A 3TR6A 3JALA 5HKAA 4AC9A 4BNFA 3WGVA 5L4SA 3ZWYA 4RTQA 4FN4A 3P0EA 3TEJA 1KIMA 5HM6A 4AY5A 5T4EA 2YTZA 1U8AA 2ZSBA 2AYXA 4O1IA 1SZCA 4DCGA 2CNNA 3D6AA 2XTAA 4J76A 3E9YA 3L0DA 3TPCA 2PX0A 1RWPA 5LA6A 1V8FA 1MJNA 4FU0A 4I6EA 2X5OA 3CZAA 1JLRA 2TYSB 4G41A 4KG7A 1WULS 4FYIA 3WHPA 4EYQA 1JWBB 1AK9A 4QTXA 2BAGA 4M98A 1BRTA 1BKSB 2WV9A 2Z30A 2WZQA 4H6WA 4JQSA 1UKAA 3B3FA 4KXMA 3VC7A 1PJQA 1KDRA 2CNWA 2ZI6A 2GETA 1QZZA 2ZCUA 3LFUA 4V2IA 4OI1A 1E92A 3LZCA 4R8LA 5CD9A 2KS6A 2Z6QA 3P0FA 4DV3B 2V7VA 3P27A 2O2SA 1CWUA 2H8GA 3N3BC 1LNZA 1Q0LA 3BBPA 4R1LA 1MH9A 4ZHSA 4RULA 3COVA 2NVOA 3ER6A 3GZNA 3QKRA 1UDCA 5BWLA 1SU7A 4KMRA 4O25A 1IULA 3O47A 3G17A 2CKMA 4GNKA 2R7MA 5F5NA 1G21E 1VE3A 3RIHA 2XTZA 2DT8A 1H0HA 3WGIA 1NXQA 4EKGA 4IAOA 3NYIA 1RWNA 1OXBB 1OX4B 1T5BA 4JEIA 4P8RA 4E07A 3LY8A 1V7QA 4Y6SA 1WB9A 4JT8A 2EWVA 3AGQA 1F17A 2PSFA 1LJ8A 2QTHA 3GQBA 2Q3DA 4RNCA 1V8DA 4MH0R 4CDGA 1JDUA 4IG9A 1Z5NA 3OP1A 2DUJA 1S96A 4DUPA 4YCSA 4LC0A 1J2EA 1VLJA 1SG0A 1H6AA 4PSCA 3RUIA 4DWWA 2CXQA 4AYTA 4EJSC 4ES6A 1CUFA 4RTSA 3HUFA 2WIGA 1I5RA 2FWIA 1QYWA 3GPLA 1L7XA 3CLRC 4FUQA 5J59A 2R8ZA 4PAMA 3UH1A 4RVHA 3W0LB 4EYSA 3ND9A 2QRVB 3K1JA 2BEVB 1TM7E 5FB3A 1Z28A 1Z2EA 2Y66A 4TV8F 2IFTA 4KWCA 1RLJA 1A9QA 4IHJA 1QHIA 3EAFA 5A0VA 5EPEA 3HR4A 4TLEA 5ENDA 2OFFA 4TVSA 1PTJC 3MINA 3VO1A 3PPVA 2VSXA 3MRVA 1L7NA 2QJOA 4XGQA 1M0SA 1RKXA 4BQQA 1R7RA 3PZRA 2G9VA 1IOZA 1DNPA 2ZYGA 4LYHA 1IOLA 1CUCA 3DB1A 4UXJA 3EVBA 4PLZA 1E3QA 1AK2A 2OL4A 1GSOA 4FYKA 4QWWA 3ZCSA 1YA8A 1SCKA 2Q50A 2VJDA 3L9XA 3PWZA 4Q7JB 1VMDA 2EZUA 5TDHA 3MGKA 4DFDA 4ECEA 2R65A 4EGFA 1C1HA 3NONA 5LFAA 1QZXA 3UMJA 5JD6A 4CUZA 2R7NA 4G8BA 1P2TA 3WDLA 3TFWA 3HYSA 1X8JA 2NU9A 2NW6A 3I9FA 1N9GA 3N58A 3PUJA 3BN3A 2VBIA 4OMCA 5DP2A 1KSGA 4QSHA 2CZQA 1LFAA 4LJ7A 1ZVVA 2BFNA 2F55A 2XTJA 3TQHA 4AAYA 1D8AA 1DUSA 1GFWA 3I42A 1E63A 3KX2A 4P2GA 2UUAB 1GADO 4D8UA 3SKVA 2E3JA 2UVPB 3U62A 4NH0A 5AK6A 5IFLA 2GEFA 4ZT5A 3F4BA 3CGGA 1CUDA 2PFSA 3IB6A 1Z0FA 1V3UA 1X3LA 3GLVA 1YK1A 3KVOA 4GMFA 4GMGA 1PT9A 2RG7A 3KOOA 1JXQA 4O2BF 4YB8A 5DYNA 4B6OA 1HG0A 3OJWA 4P38A 2P3QA 5DN9A 4AG3A 5EUMA 5TQJA 4AZSA 2NZYA 1K7SN 1TM1E 4LBVA 2EGHA 4IJWA 2ACKA 2L69A 3QOXA 4XGRA 4TYQA 5H0IA 4NBRA 1J8QA 5MN6A 3L93A 2PWYA 3LZ6A 1Y9ZA 4KH0A 3L92A 4CEJA 1MORA 2DWCA 2VDRB 3E82A 2H2FA 3L7IA 4G1MB 1BOFA 1KI1A 4LTNA 1Z4JA 1JECA 4FT4A 2F1RA 3QMVA 2X3UA 5JSQA 3RV4A 3CLRD 1OLSA 2GN1A 4DIOA 3Q7IA 5HUHA 2J5QA 5B4VA 4D92A 2GYWA 1XQ1A 4IHJF 3AQ4A 3GLRA 3PC8C 1T6NA 1FTWA 4Y98A 4IIJF 1XOIA 5LU9A 3TE6A 4G5QA 4IM7A 4PF1A 1CYEA 1T5LA 1WQ1R 5I3ZA 5FLKA 3CE6A 3E2PA 1E1KA 3D4NA 3PTZA 4LN1A 3KXDA 1P3DA 3W8NA 5KNDD 4IDCA 3AUUA 4CQMD 5HKKA 1X9GA 1HE2A 1JALA 3ESXA 1XZCA 4WK2B 4LFBB 2O2XA 4CMIB 3AEQA 5A5FA 4IF4A 4AZWA 4HAVA 5AVVA 1Z26A 1TMGE 4JBNA 4AFNA 3IAHA 3MS7A 1RM5A 1E2JA 1B8NA 4RE6A 5E7IA 1US8B 2FE4A 2Y8EA 2YQ4A 3HJFA 3EG9A 2QVYX 2IBSA 2YOGA 4OFXA 4CN9A 5DPMA 3K92A 3ZDQA 1I1QB 3LK7A 1N8NA 3MJSA 1EDZA 4YAFA 3UK2A 4C22A 1C4KA 4JVOA 5JR3A 3GVXA 5GTDA 2X58A 3DP7A 3FMOB 4ALNA 1XJCA 2CFSA 1A3CA 4I6GA 1RLIA 2GESA 3MHTA 3SYMA 2P5UA 1SG6A 2VK2A 1WBBA 2YHUA 3VTKA 1Y3HA 1RRVA 1MB2A 1RI2A 1WG8A 1ORVA 1ODTC 2ECKA 2R96A 2Z1NA 3IUMA 2QENA 4HUQB 3Q9SA 4TVOA 4B2PA 3DPUA 3LY5A 4PX9A 1PJ8A 4EYEA 3DXYA 4B0PA 3O9ZA 3RFUA 3TSOA 4BKRA 1HOXA 2WWRA 5FBVB 2QT1A 2ZYVX 2VSNA 4JJ4A 4V0OA 1R27A 4O1MA 4OGKA 5GWXA 2IQIA 4NZMA 3SVLA 5AVQA 1XL0A 2IHBA 2QTZA 3KIPA 1NR5A 5AKEA 2A4KA 3U6KA 1N3IA 4XAQA 2VT6A 4EZEA 2J0UA 2WQ7A 4LYYA 1MAAA 4RJ2A 2BDTA 4N3GA 2PD6A 1ZISA 2XIJA 3FSJX 3NANA 1KZ1A 3MJRA 4C0KA 4QO8A 3CKMA 3E35A 2X13A 1D1PA 2JATA 1M5UA 2YOFA 4YRJA 1JMVA 4LJRA 1EUQA 1THMA 3PDIB 1OAOC 3MM4A 3ORFA 4K5QA 1Y7TA 3HZOA 4GGOA 3RYCA 3FMGA 2HRBA 5E4YA 2KSQA 2VR1A 3OE1A 3LAWA 4LHYA 1DRWA 4ZXFA 5CH3A 3M83A 4A7PA 3U44B 1FFXA 3DL2A 4DA4A 3STYA 1X1AA 3GMSA 3BGIA 2JFUA 3MJFA 4X8OA 1D2RA 1MB0A 2GXUA 2H0RA 3ZS9A 3RROA 4HWKA 2G1UA 2HKIA 4DLSA 3I9OA 1KOFA 3T4PA 1U6KA 1JEQA 1GNVA 4KVZA 1Z8NA 5K8IA 1FMCA 4L9SA 1XLVA 2FI1A 1XEXB 5EA2A 4N5HX 1ZH6A 3G79A 1E2EA 4I4NA 4LRQA 4E33A 5IVIA 4K9QA 3HJHA 2WBLC 2ZT7A 4GOLD 5J40A 1XMQB 3ZBTA 4I50A 2DKFA 3GNLA 1K4KA 3Q5GA 4Y18A 4MRVA 4I9HA 1C81A 2DQKA 3HDGA 5IASA 2QSUA 3QNWA 5J58A 4OHVA 2X2EA 3RS3A 1T25A 3G0HA 2IDZA 1RIFA 4M3NA 1S3IA 5DWDA 1P0QA 1T8WA 3LUKA 2C7OA 4BKMA 3QOFA 1CQIA 4Z4GA 5IAGA 1DC8A 1KDPA 5KIAA 3GOQA 4HH1A 3VZCA 2PS3A 4UJ5A 2HRQA 3TZKA 1JAHA 2OK8A 4P22A 5JXHA 2PU5A 1D1QA 1OJLA 3BORA 1XXHB 4FT2A 2JLAA 5G3ZA 1E59A 3X2EA 2J3KA 4BFZA 4YCMA 2HLNA 2HUNA 5HVNA 1D2HA 3UKOA 1VXOA 3OF3A 4NE7A 4Z4EA 3U4GA 1SQ0A 3PGVA 3EISA 1G5PA 2AKAB 1T9BA 3GNSA 5L3QA 4NBKA 2MTBA 3VX3A 1YC2A 1H4TA 1YL6A 3IOMA 1OIVA 2IIBA 2ZSFA 4MLZA 2R97A 3FWYA 1JE1A 1SO8A 4PGAA 5K0NA 1DJOA 3PVZA 2QTRA 3E8MA 5HX7A 2W22A 3W2FA 4DTIA 1XG5A 1LI5A 3ACDA 5IEBA 2YJNA 4LF7B 3EQ6A 1JDJA 5DGXA 4PTLA 1XD8A 3G85A 3KJZA 3SEFA 5K4HA 2IH4A 3LCJA 4Y67A 4GSKA 2VDOB 5EP1A 2NXCA 2E37A 4YYEA 4IV8A 3TVDA 4A8JA 2PZKA 1U7XA 2CLEB 2ODBA 4L2IB 5M5BA 1ABBA 4KGVA 3ZW8A 1MDFA 4QG7A 3TRHA 1Z12A 1BA3A 3PD7A 5DF1A 1HETA 5EIWA 1D6JA 2QP3A 1T6YA 2GI4A 3GRUA 3O4VA 3VFDA 1OQAA 5CA0A 3GA7A 1FMFA 1N2XA 2YWJA 3C3KA 3DJYA 4ZWNA 3B60A 3PEFA 1IJBA 1K6MA 4V2UA 3UK7A 2XGJA 4DUGA 2P35A 2JD0A 1NUSA 4YMLA 2Q5HA 2NUPA 1ZA2A 5GQSA 4NXMB 5KYTA 4EA6A 3D4BA 4O63O 3T3EA 4MQLA 4QREA 2ONZA 4I50F 2VT2A 1N3YA 4Y2PA 2JGKA 5LZ7A 1TXGA 1SKQA 2QL7A 1P2GA 1R0KA 4MIYA 1Y3BE 4HATA 5BV1A 2Q0XA 5IX8A 3AVWA 2ZJ1A 4RPCA 1WSAA 1G7TA 2OILA 1HRDA 3T3NA 1HXHA 2ZYDA 3D7RA 1GXSA 1HG1A 1ZEJA 1RJWA 3JARB 3KE9A 2FR8C 3VO8A 3HC7A 1JFTA 1ORWA 4HV4A 2XKKA 1RWMA 3KR9A 1Z5GA 4LMRA 2EBHX 2GUGA 3C8ZA 3OZTA 4RTRA 4QLOA 2HLPA 3STTA 1OTXA 4J0EA 4D8TA 3G5LA 3M6XA 1J22A 1WMEA 5HXAA 1EH5A 3ICCA 4C6HA 4QYIA 2EQ5A 3LUBA 5DH9A 1HKHA 3DEKA 3V1KA 2VJMB 2GFHA 3BSSA 1IC6A 5ALUA 3G88A 4U7WA 4ZEXA 2ZJBA 1SOMA 4D25A 2VRWA 4IIUA 2H3EA 1D9XA 3H97A 4L57A 3SJAA 3VZBA 2CXHA 2J9ZB 3GV0A 3MTQA 1BDBA 1PUXA 1V9CA 2Z9BA 3G2HA 3ROKA 1C8BA 3E7XA 3F3SA 4CKYA 4DCNA 3F96A 5HKLA 5CU7A 1N6HA 2M6RA 3UAWA 2J5KA 3K0FB 1ACLA 5K8LA 2O8BB 2YL2A 1P80A 2EOAA 2M1ZA 4WDQA 3HHEA 4HG2A 4B3HA 2R1TA 2Y1EA 5IAKA 3T06B 2ZVPX 3CRMA 1UZLA 2IHKA 1JBEA 4ZZIA 1C4OA 5CA0F 3ORRA 1NFFA 4CU2A 2HK7A 2DVMA 5A6SA 4LWQA 1FZTA 1S8FA 1U99A 3CR8A 3GX1A 4R69A 1TJ3A 4HS4A 5DGDA 4EY3A 1EFHA 3AHCA 4RA6A 3TTSA 2A9PA 2A1TR 4XZ3A 1AUPA 1QZTA 3IQWA 1QF7A 3GUZA 4XIYA 3UG6A 3EFOA 2QRGA 4TVKA 1W2WB 2C3UA 1XTVA 3SX2A 1JDSA 3QLUC 1SB8A 3LC7O 4FD3A 5ENVA 4DBVO 1ZMOA 4Q1AA 3ZUGA 4K40A 3EYAA 3UAGA 4E0BA 2BELA 3U7JA 1GUZA 2D06A 3HCCA 5AW5A 1M8JA 3G5TA 4PINA 1Z15A 3IP9A 3UENA 4MLPA 3FOWA 3QYAA 4IGIA 2GPWA 3GJRA 4XB1A 4ZEMA 4X54A 2HSZA 1ACMA 3U3XA 4O8CA 4FI3C 1ZJ6A 3IP3A 1UMCB 2H4ZA 1N7IA 3FCAA 4JVNA 4OXNA 4BO2A 2Q4TA 2UZ0A 3ASUA 1VGRA 2QTNA 1GQQA 3A1NA 1V6AA 3GLGA 2OFXA 3E5NA 2WKPA 3GA5A 4C6SA 1ZK2A 5EIXA 2AXPA 5IFKA 4H3SA 3M81A 4TTIA 5FPQA 3ONDA 1WBDA 1ODKA 5DHQA 1A76A 4ENTA 1DOZA 5JPDA 1X7XA 3N2EA 4MW4A 4YIKA 4GP6A 4TSFD 4NIMA 1SBCA 1ZK0A 4J1TC 4NHEA 4QXMA 2PIAA 4S2UA 1MQSA 1M72A 3L7LA 1L5KA 3AHEA 1LNQA 4QGFA 2FP3A 2WTXA 2QUJA 2PKXA 1A8HA 3QUBA 2VTBB 3UJ6A 1KH1A 5A02A 3RIGA 1UXIA 5KTNA 1G8KA 1ZC3A 2C2XA 4RMJA 3RRNA 2JZCA 3EUAA 5AMXA 4ZT6A 1JAXA 5B4UA 5JSFA 2HCTA 2UZ1A 1JFRA 3C7CB 3M9WA 3PV0A 4Y6OA 1E2PA 4AY6A 5DHRA 4Q00A 3E3MA 1X8KA 3WMWA 4Z1OA 2EU8A 2O3SA 4LGMA 4JD5A 2G72A 8AT1A 2QMOA 3QE9Y 1JR6A 2V7QA 1KXJA 4HWSA 1V8OA 5DU2A 2IBTA 5JTTA 5LXTA 4FOTA 2VNKA 3KSDO 3R7WB 1NVAA 3TSCA 4OJNA 2PEYA 4TYYA 4PCLA 3EJ6A 1YUNA 3T1HB 1GFSA 3KZ1E 2GAJA 4FOSA 3D3KA 1TEXA 2JEOA 2QM0A 2WTMA 4QGGA 5ADUS 1JIKA 2F3UA 3N74A 3WMGA 5AXBA 1G0OA 2PPVA 2Z04A 4BGVA 3T5AA 5HG0A 5CITA 5GGXA 4EH1A 3CSDA 2X77A 4A2QA 1JYSA 1T4MA 2ECOA 3R9XA 3CO5A 4QBGB 3UJ8A 4C20A 4O08A 2ORYA 1VBFA 5KYNA 1SZDA 3BE6A 2X9QA 1CERA 2SCUB 3OFND 4JELA 4JKOA 5EPUA 3RIEA 1E2IA 1T1IA 2XUFA 1JKIA 5IYZA 1E7RA 2E4AA 3NHUA 4MS1B 3GRAA 3N5CA 2NUTB 2J5RA 1Q6ZA 1D6MA 5ECGC 2AYZA 2GRUA 3PNMA 4FZ3A 4BY9E 1HFKA 1SXJB 3HBAA 4P3YA 3DVQX 4HX5A 5MGNA 2P2DA 1TJ4A 3ILVA 5BUCA 4FGUA 2YV4A 1HQYE 2VIIA 1E79D 3R5TA 1KRXA 4TLBA 3OLCX 1O7JA 5K3DA 1ZD1A 3LLUA 1S7CA 2HBRA 3KK0A 3MMPA 5AVRA 1RWVA 1L5YA 5F73A 2FZ5A 3P32A 4HAZA 4LJSA 3VDNB 2A7QA 5DI9A 4RTLA 3ZE6A 1XMPA 2X8WA 1N57A 4MQ6A 4MKHA 4RF5A 2ZSIA 3PUYA 5DW0A 5E3IA 5CVTA 3RT7A 1JZSA 3K5WA 5MN5A 1L7VC 3TNYA 1TW2A 1UZNA 3TRKA 3UMVA 3GEHA 3DEHA 4CW7A 1L4MA 4YGXB 2YJZA 3B7WA 4OPMA 4MVJH 2PL9A 5LQUA 4NOMA 1MVLA 2X7XA 1NMYA 2BFMA 2CHUA 2ZAOA 3IPCA 4XB6B 1IIRA 3QY9A 1NF9A 2DF8A 2CLIB 2R2AA 2QTAA 4F1WA 3DUFB 4XQEA 3TFOA 2ZYUX 1BA2A 2FKNA 3N8IA 4PLFA 2XUZA 3SDBA 4DCJA 1TCVA 4KO2S 5BWOA 5I4KA 3C4QA 1RYHA 3EMDA 5FFFA 2RGNC 1FOEB 3SJ7A 4JI4B 3ZHVA 2PBRA 3L6RA 2FVXA 2X2PA 4Y2RA 2ASVA 1AKUA 2AC4A 1E0SA 2Y1WA 2Q7OE 1HL7A 1PL7A 3GFPA 3OT5A 2OZLA 2W2NA 4HB4A 3EXHC 1J9ZA 5EE1A 1OR8A 5FHQA 1L5LA 4OYHA 4BBZA 1VIYA 2JHCA 2XMBA 2NVWA 1C29B 1XK6A 1XTRA 3Q87B 4MEAA 4C6TA 4JQOA 4CF4A 1GY8A 1XELA 1QV6A 1YVEI 2NN3C 2VK4A 3C5WP 2VH1A 3BA6A 1SUSA 1X42A 4EJSA 3LT4A 3NV9A 4WERA 1ZJZA 2CLDX 2BFAA 1L1FA 4RTMA 3AFMA 3K70C 3NB0A 1VB5A 3N2NA 4D99A 4DCMA 2NNLD 5DGHA 1NP6A 1NVUQ 1NKTA 1PX0A 1R0RE 2H11A 4ND2A 5JYEA 2UXDB 1Z4IA 4DV2B 3FA2A 4AWAA 1YQUA 4IINA 3S0JA 4ESVA 4NYJQ 1KEPA 1PTJA 2BFFB 3MYRA 3DMHA 2VATA 4K9RA 5KNDA 1F2VA 4K6FA 4D0RA 2WHPA 3FSGD 4X3CA 3WVNA 1EFDN 1SCQA 1GGVA 3MTJA 4CQMA 3PNBA 5LYJB 1MZVA 2JHFA 4KX3A 1RADA 2J67A 4YFVA 4OQMA 1ESNA 5L4NA 3W9UA 3MW8A 2DWUA 1TCAA 1J2JA 2X22A 5EWJA 5B1HA 3SF8A 3IUPA 1UBUS 3TPZA 2VTVA 4L28A 4UE6A 2CMKA 1JHDA 4MR8B 1GKKA 4ZP1A 1USGA 3VO9A 3ZQ6A 5CDYA 3IKTA 2W2QA 5J1TB 3E61A 2CHEA 4IGKA 2VA8A 3UT0A 2O0MA 3ZWWA 3NHFA 4RIGA 1U2QA 4UMDA 3EUEA 4MJLA 4CLRA 1EVKA 1R66A 1YI8A 2V5AA 3QHPA 3DEIA 2FZGA 4PVCA 3VJLA 2H1FA 1UKEA 5EYPA 4X62B 3SQWA 1CETA 2PX2A 1T2CA 2YH2A 1NBIA 5DHUA 3QNMA 1MO6A 4MR7B 4PCVA 2J9FB 2GFIA 4DJJA 4RHXA 4ENWA 1YCDA 4HRYA 3GLTA 4K03A 1MLDA 5LYYA 3ZWPA 4DLYA 1OZAA 4IIDA 1U7WA 3OZIA 3RWOA 2HMYB 2EFEB 5I7EA 4UCFA 1EHYA 5JAMA 5KHAA 4NCXA 4NL4H 4TLDA 1GOTA 4O4HF 4OQZA 4HRAA 1XZDA 4DKXA 3EY4A 3KZVA 2H4YA 1FTNA 1J5XA 4Q1EA 1FQWA 1Q1EA 1X1TA 3EDMA 3N8KA 4DLXA 1Y42X 1Z33A 4EPXA 4BV8A 4TKVA 3NRCA 5IJZA 1ZH8A 4OQ4A 3SZGA 4F3NA 1FNSA 3I9LA 3IKMB 1QOZA 4UD2A 3W5VA 4JITA 2GBGA 3DBHB 4DLZA 4G0WA 4KR6A 4NHOA 2KW5A 3K70D 1U3FA 1NVDA 3LUJA 2FSVC 2EKLA 4AWBA 1Z4LA 1FNBA 1MX9A 4QWMA 4BE4A 2W58A 4U6SA 2WDZA 2WKRA 2Y1CA 3RSGA 1NFRA 1H3NA 2IXGA 3FMPB 3JALB 4D3FA 1K75A 1GARA 3AKCA 3IHWA 3PVCA 4PBRA 1ADYA 1WOYA 3WWCA 4C7JA 4H2DA 4DLVA 3GRFA 4BNJA 4B85A 3S81A 1L4LA 1DMSA 1MOQA 2H1IA 3BF7A 2A9OA 4FYWA 4I55A 4FEGA 2D2VA 3RHSA 2ZXFA 2H17A 3ZVLA 1F8YA 5LA6B 4HY3A 3N1UA 5HIMA 3L1VA 3P2EA 4EQZA 2WVJA 3C4JA 2PEZA 1SELA 4CDRA 1XTSA 5AQ1A 5C35A 2CDBA 1CTQA 1GRVA 1ZU5A 2BGRA 4RNDB 3NH6A 4ARVA 3B1VA 4DA8A 1ULAA 1DC3A 2ZU0C 2GEJA 3PHGA 4XH9B 4P2BA 4MYSA 1Y6ZA 2HJSA 3W8DA 1A5ZA 4RH3A 3T1VA 3GEEA 1F8GA 1MJGM 1U9JA 1HR0B 1K92A 2RKWA 3FOAA 5BPHA 4WEQA 1W46A 5I9MA 3HRHA 1KY2A 4RYDA 4KFUA 3DCIA 1DCMA 4LOKA 4P4GA 1NI3A 2CE7A 1UFQA 1MMFB 1PR0A 3Q98A 1JN0A 1N2CB 4BNLA 1T8YA 3A8TA 4EJ6A 2QR5A 2BW0A 1NJ2A 5CHYA 4MGZR 4QOHA 4GPTA 4QG3A 3W3AH 4YV2A 2OE2A 3TW6A 3FF1A 1KK3A 5A5DA 4LG1A 3VR4H 1F14A 1QJCA 1NW8A 5LCXA 4ZVKA 3QMPA 2X42A 5KJ1A 2DP4E 1GL7A 2D7DA 1BJRE 3GQBB 2RGXA 4BAZA 1NATA 1HM5A 4A10A 2ZSHA 3SDSA 2AKEA 3SC2B 3SD7A 1COZA 4JI1B 3W6OA 4YLYA 2CZCA 4P5DA 1YKFA 3SN6A 3VC3A 2NU6A 4EUHA 5JCOA 2PK3A 1ODIA 1A2KC 2K2WA 2RAPA 3I6IA 3COJA 5JCXA 5YASA 3VSEA 1B4DA 5EI5A 1CQJA 2IYNA 3CNLA 1EUCB 5ECYA 5KVCA 2GCEA 3N2LA 1WRBA 4Q3LA 1PT7A 4RLHA 1T8UA 4E5YA 4YECA 4X63A 1CS0A 3E23A 4IQFA 1OAOA 3EPJA 1NBOA 1XR3A 5IT4A 1DJNA 2Y6UA 3WBJA 1NMQA 1JKXA 4Q3KA 1JQ5A 1NE7A 3FDJA 3CF4A 2Q5LA 2WC1A 3FMFA 3M89A 4NK5A 1QYIA 4QUEA 4QQNA 3Q8MA 1BGXT 1AN0A 4C07A 2NZJA 3IDAA 4KXVA 1V1MA 3QGMA 4G0MA 2TSYB 2YJ3A 2B1IA 2EQBA 1H0KA 2BR3A 1UJNA 3AC0A 4NPAA 5FOQA 3A4YA 1JDNA 3C1TA 4F5EA 3DDZX 2IIQA 3MCTA 5JDCC 1QIIA 1EA5A 2AUTA 4HVLA 3VNQA 3D3QA 3EGOA 2IW1A 3NTVA 1SD2A 2J4DA 2QHXA 2YDYA 2JANA 1LF0A 1Y4AE 1OYYA 3NPAA 3OOSA 3R3SA 3MUEA 4HEJA 5AVSA 4P86A 5BSUA 2XI4A 1G16A 1NYRA 2IKSA 4GP9A 3O4RA 2DE0X 2QYTA 2B1RA 3LHFA 3O31A 3SFZA 1M76A 1U94A 3A9TA 2PFGA 1XTIA 3IEPA 3N70A 3IXLA 3AUXA 4JXJA 4KPFC 3WI7A 2FHPA 3FLBA 4MUXA 5J2TA 4PXAA 2ZIGA 2AFHE 3HQ4O 1XT6A 3K7EA 4JODA 3TLXA 4A2PA 4CVNA 3O4FA 4EPYA 3CX3A 4HX9A 3I04A 1NE2A 1CY1A 2NYAA 3DL7A 4LOJA 2DQSA 4IXWA 1XZGA 4V3CA 4F4HA 2EFYA 2OK7A 3RT9A 2PFKA 4FKMA 3R5XA 1ZN8A 3WLSA 1V9SA 4OHYA 3JASA 2DHEA 2DRIA 3NRJA 4QAQA 4CEJB 1S1MA 2G06A 2VYQA 4MUYA 5TF0A 3S40A 1DJPA 3M1YA 3VNVA 3AR6A 1NXSA 5BY2A 2X7HA 2BBTA 5DLDA 2VJNA 4F3YA 2ZUTA 1Z5ZA 4X45A 1XDSA 3U81A 3COPA 3NOVA 4UNQA 3HBLA 4ZJYA 1OLSB 1E61A 4IMIB 1TM2A 3T0GA 1PFGA 4LUCA 2IU6A 3QWIA 2J6CA 2UVQA 5GADl 2CDNA 1RMTA 2QLMA 4B3IA 5ES4B 1JAIA 4AY2A 1DFHA 4H7KA 2PGXA 4FFNA 4J8PA 4I8IA 3NEPX 2VQDA 3AIKA 3ET5A 3K0EA 4I4TF 3W05A 2IIVA 5B37A 3URMA 3PUIA 3SR3A 1T1EA 3BGDA 3EIEA 1T91A 1XVAA 2Z4SA 3MTAA 3BUSA 5U4QA 2AJTA 2GSDA 2JFGA 4HAIA 5J2UF 1B3RA 5EWLA 1DIGA 1QLWA 3CZ4A 2XAAA 1CFJA 1E4YA 5DHTA 1J9EA 1GNRA 1H69A 2I7XA 1YL7A 1JX6A 2WAOA 3UMFA 4WFJA 4UM9B 3GT7A 2Z09A 4QEDA 2PH7A 3NR2A 4FR2A 4X7BA 4NS1A 5DNWA 2XT9A 3UGTA 3DKKA 3MQFA 4H17A 1FTSA 1MRSA 4L0QA 1IVNA 1QHFA 3G0IA 3M1LA 4FEYA 4XIJA 4KOEC 3BC1A 4QYTA 3EG9B 4FGJA 5TPWA 2YW9A 2Q2WA 5HIJA