1SCQA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetonecyanohydrin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 92
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1scqA00
1CUIA 3BJMA 3D0KA 4ROTA 2GBCA 5E4YA 4JUIA 3WK8A 3F98A 5EHQA 2Y2VA 5T4EA 2CMFA 1PV1A 3VISA 4EB0A 3QBJA 4AO8A 5AKLA 2CUTA 1JMYA 1BCRA 1VA5A 5CTAA 3BWXA 4NZZA 2QJWA 2DSNA 5YASA 4FKBA 4Y9SA 3JWEA 4QDOA 1NX9A 3TJMA 1A8QA 5HZGA 2O2IA 3WK4A 2BUAA 4Q34A 5JALA 4ZXFA 3KXPA 1QTIA 1YB7A 2AJDA 1BCSA 3YASA 4BCDA 2IIVA 3C8HA 5DTJA 3IULA 3H17A 3OPMA 3IURA 2WHRA 1HKHA 5I9IA 5DNUA 4J0GA 1EINA 1H23A 1JFRA 3EQ8A 2WUDA 2XT0A 2Z3WA 2FX5A 2RAUA 1H22A 3HABA 5HF5A 3STXA 4B85A 4UHFA 3G0BA 5A7HA 2V98A 3C6BA 4BB0A 5CRIA 3LS2A 2ACKA 4J0CA 2O2GA 2WU4A 2C7BA 2QUAA 3I2JA 2HA2A 4EY8A 4I4CA 3E4DA 2XMCA 3PFCA 2I3ZA 5JAPA 1LPNA 1QZ3A 1K4YA 2OAEA 4J0HA 2HFJA 1UKBA 3DKRA 3O95A 4ZV7A 4QNNA 2XLCA 4DIUA 1QOZA 1SCKA 1XRRA 5LZ7A 3G9ZA 5DTIA 1JJIA 4UBNA 1CUVA 1IVYA 1A8SA 3W9UA 3V9AA 5CXUA 4BVLA 2XQFA 1GQRA 3RKSA 2CKMA 4UBLA 4JEIA 1AKNA 4DSAA 2ZSHA 4HAIA 4J0KA 2V97A 3FVRA 3D59A 5KBYA 2OGTA 2C0PA 4P9NA 5EFZA 3W2TA 4MEAA 1UK8A 2JGIA 3I6MA 2CB9A 3DL7A 1G5FA 2GBFA 1H2XA 1EXWA 5HQ3B 4I19A 1Y7IA 1MN6A 5E4JA 3BE8A 4MQMA 5AK5A 4LHEA 3I28A 3CN7A 1C4XA 3DDUA 2WIJA 1CUUA 2RI6A 4EUSA 1O6GA 3EQ9A 4J0JA 2BFNA 2XUFA 1VE6A 5K3FB 3BXPA 4OYYA 4HXFB 5LYYA 2XUHA 2PSFA 5HCUA 1FFAA 1XZDA 3HI4A 5FPPA 1N5RA 1YS2X 4RE5A 3ZLVA 3G02A 5AK4A 1UXOA 4H7DA 4UFNA 1ORWA 3D2CA 1MU0A 3IIIA 2XMGA 1XZCA 3IUNA 4Q3KA 4DLNA 4HXGA 1X2BA 4FBMA 5AKYA 2JIDA 5D3KA 4W1QA 3G0GA 2QXTA 5DLPA 1FJ2A 4MYDA 4P93A 5IKXA 4UHDA 4B82A 4BVKA 1DWPA 4PV7A 1N8SA 2PX6A 1XLUA 1LBSA 2HDWA 2OCIA 5AI0A 3I2HA 5EHNA 4BZZA 4K6GA 3BF8A 3CN9A 3R3UA 4YK7A 3W9BA 3I1YA 2VAXA 1Z68A 5HK8A 3AIKA 4QDZA 3B3QA 3O4IA 1E8NA 2O2HA 3I1IA 2O7RA 5JD6A 3ICVA 4X90A 5EI5A 1RYYA 2XI4A 4X7BA 1L7QA 2VAVA 2WG0A 2XUDA 3RARA 1BEEA 3T4UA 1BN7A 4C6HA 4Q3OA 1F0PA 2BGNA 4P92A 4A16A 1QFMA 1IMJA 1AX9A 4W1RA 4X97A 3C6YA 1MX5A 4BC1A 3SX4A 1TCBA 3KWJA 1CUCA 2AJBA 1MJ5A 4DNFA 4FLEA 3OURA 3GZJA 2E3JA 4LKOA 3PUHA 1UZAA 4M0FA 1BE0A 3C45A 5CBKA 1XKTA 5F4ZA 1DU4A 1XZLA 2V9ZA 3E1GA 4X6XA 4OD0A 2CEKA 4DNOA 2WFLB 4AO6A 2ECFA 1ZOIA 1QTRA 4CIAA 1G66A 4DNQA 5A71A 4KR0A 3L1IA 2X5XA 4MQLA 3DLTA 5ALHA 3ZLUA 5FDFA 4WDQA 4K6HA 2B9VA 1VZ2A 5ALZA 4PW0A 4FFVA 3LLCA 5ALFA 2DQYA 5AJHA 2CBGA 2Z8XA 4IH9A 1T2NA 1MT3A 3WL5A 1SC9A 2D5LA 3ILSA 1GXSA 4LYEA 5JD4A 3KD2A 4MWSA 5DYTA 4WY5A 4ARAA 1CQZA 3E3AA 6YASA 2PSJA 1I6WA 3EF3A 2OXEA 5AKIA 1XZHA 1TK3A 4G9EA 4Z49A 2OQIA 3CXUA 4IH4A 3I2FA 2R11A 3U0VA 3RK4A 4KAAA 3FYUA 4BE4A 5ALTA 1XZFA 4HZGA 3FSGA 2WM2A 1P0QA 4K6KA 4OCZA 4KJXA 1QIIA 2W6CX 3FNBA 4H7JA 1CUFA 5AO9A 2YASA 1R4ZA 1VLQA 4UBOA 5AKJA 4FDMA 4U2EA 5JANA 5LZ9A 2PU5A 4BYMA 2LIPA 2XMBA 3F67A 4FOLA 5LZ4A 4PQEA 4BTLA 4EY4A 3OM8A 4X3CA 4IO0A 2OG1A 3X3HA 1QFSA 3QPAA 1JJFA 2XQJA 4ZRDA 5DWDA 4H7FA 1CUEA 5D7BA 1QIEA 2BKLA 4H77A 2BJHA 4GEGA 3AUKA 3FLBA 2JGJA 1JMKC 3WA6A 4BAZA 4Y2XA 5FXMA 1YAHA 5CW2A 2XQKA 1WPRA 1R3DA 2DR0A 4UBIA 4WFIA 4Y2RA 1BRTA 3F8SA 5A6VA 1XQVA 2WTMA 1N5MA 3PE6A 2OLEA 1YA4A 5AM0A 5HK9A 2ZVDA 1XZJA 4EY6A 4BBZA 5DYWA 4A5SA 4CCWA 1B6GA 4TPKA 2VEOA 2WJ6A 3AZQA 5AH0A 2WIKA 3N2ZB 2WJ4A 5C7YA 1ISPA 3NOXA 5T4FA 1DQYA 1R1DA 3R3WA 4WFJA 1CLEA 4U2BA 4L9AA 3GBSA 1HPLA 1HQDA 3ED1A 3UUEA 1LZLA 3V1NA 3V1LA 5K3CA 5AOCA 1XRMA 5HF6A 4G1FA 3QZUA 3PFBA 2C58A 1MX1A 4B84A 4G8CA 2Z5GA 4ZGBA 1VA4A 4QE3A 1ODSA 2AJLI 3HYSA 4JNCA 1D07A 1J07A 3D7RA 2WG1A 5ALGA 4GW3A 2XMDA 1EB9A 2DFPA 4J3JA 3WWOA 3ANTA 2JGKA 2WILA 5ALUA 3QH4A 3C70A 3R40A 4P08A 2YYSA 4YPVA 4GDMA 1TRHA 3I2GA 3R3ZA 3GELA 2OCKA 2Y6UA 1SFRA 3LP5A 1MO2A 3C87A 2XMRA 2XMZA 5JIBA 1AMNA 3SC2A 5JADA 3S2ZA 4AQDA 2Y1KA 1ZIXA 3ZLTA 3PF9A 5ALXA 3AJAA 5FV4A 3WZLA 3AIMA 4BRSA 2BUBA 4HS9A 2G63A 4XIIA 4DMCA 1S8OA 1K6EA 4JYMA 5K3BA 3I2IA 1IUOA 5ALWA 1R9MA 2QM0A 4KACA 1JU3A 5LZ5A 2WTNA 1ACJA 2UZ0A 5D6OA 3EQ7A 5HQ3A 1MTZA 3DNMA 1G4HA 4CCYB 1EI9A 2OCGA 2GBGA 4IH1A 4B0OA 1QGED 4Q1VA 1A7UA 3STVA 4OYLA 5K3FA 3L1JA 1USWA 4RE6A 1ZI8A 2BAGA 2QUBA 3WMRA 1C7IA 4KE9A 2BUCA 1IZ7A 3WL8A 4BDSA 2AJCA 2ZJ6A 5CT6A 4LIPD 4WJLA 1E8DA 1EA5A 1N1MA 1THGA 3G7NA 4H7EA 3VJKA 4E15A 1VKHA 4X91A 1YCDA 4PNZA 5AHXA 4CG3A 3FCXA 3FCYA 3HJUA 2XMQA 1H2ZA 3G0CA 1NU8A 2VJCA 1U4NA 3GUUA 1E89A 3V1MA 5ALJA 5EIHA 3W05A 5ALSA 4OU5A 3WK9A 5DYYA 2VJBA 5LKAA 1CUGA 5AOAA 4BAGA 2H7CA 1BN6A 3AZPA 3HLKA 4FHZA 5FP0A 1KEZA 3C5VA 2HA4A 3OC0A 5JYCA 5BWCA 1LZKA 2HA3A 2QRUA 2HA6A 2QKYA 2NW6A 2QVBA 1TIBA 4KAFA 3O4JA 4W1SA 4JH0A 1XLWA 4AX4A 4Y2JA 3STTA 1QIJA 4YASA 1MNAA 2XDWA 1QIKA 4AMZA 4FMPA 2PU7A 1ZD2P 2HA0A 3O9VA 3R41A 5CH5A 1AC5A 2OPHA 4DMHA 4C4XA 4Y2YA 1R50A 4FNGA 2GZRA 4ITVA 4N5IX 1MPXA 4MEBA 4NS4A 5DNVA 3WL7A 4DMFA 3ZV7A 5C81A 3LIIA 3EIOA 4H0CA 2ZYSA 2V96A 3FLAA 2HFKA 3G9UA 4QDTA 3PUIA 2WFLA 5H3HA 4NMWA 5ALNA 2HU8A 3WA7A 2YH2A 1U8EA 5EIAA 1CUDA 5D3ZA 4ETWA 2J3DA 3WYDA 3WI7A 2XB6A 1SCQA 2WFMA 1QIHA 3ZPXA 3DCNA 4BDTA 1RP1A 4X71A 3ESAA 2H7YA 4AZ3A 5ISMA 5JARA 3U1TA 1HL7A 3DS8A 3TEJA 4G4IA 1UK9A 4GHWA 1AUOA 3SWWA 3GFFA 3B5EA 2HA5A 2ONCA 5EGNA 2PBLA 3I6YA 5ALPA 4KE8A 2ORYA 3CCCA 3R0VA 1K63A 5EHZA 2FJ0A 3E0XA 5K3AA 3QMWA 5CURA 3R3YA 4S0XA 1Y7HA 3KSRA 1P0PA 4BZWA 1F0NA 1XRPA 2XUGA 4WCVA 1AURA 2HL6A 3WKCA 4HTAA 5HKAA 1XRLA 1DX6A 3WL6A 3BIWA 4ZI5A 4DMKA 1CPYA 1T4MA 3ANSA 3WKBA 5CT9A 4G4JA 2DQZA 5FRDA 2AJ8A 2G5TA 1LPMA 5LIPA 4C89A 4UFPA 4QEKA 4E11A 3M3DA 2VA9A 2X8BA 5HKBA 4DNPA 3R3XA 2P8SA 1HDEA 1CIJA 4UHBA 3A70A 3I6ZA 4ARBA 4X00A 3H2HA 2QXUA 1XLVA 1LPBB 1K5PA 5JZBA 2K2QB 5HF9A 3DOIA 4UFOA 3MVEA 2WKWA 1GKLA 1UFOA 1O6FA 2O7VA 4Y2UA 3OOSA 2JBWA 5KWIA 5T4HA 4WFKA 3PI6A 1FSSA 3O9MA 3K2IA 1XZMA 3WJ1A 4BTVA 5AKGA 4NVRA 5A7GA 2PKYX 4RPCA 2QT9A 4H7HA 4B9AA 5IVHA 3H2IA 3WWEA 2RGUA 1CUAA 1HBJA 2WFZA 4HRXA 5FUMA 1B41A 3ESDA 3A2MA 3HACA 4DGQA 1WPXA 1MNQA 5KREA 5LZ8A 1AGYA 2XUQA 4KRXA 3D2BA 3HXKA 1X2EA 4D9JA 4QWMA 1ZJ5A 3BF7A 2C0QA 3DYIA 5A2GA 1YB6A 4BP9A 1AQLA 4QZVA 4F60A 4H7IA 3O4GA 4EY7A 1GPKA 3G9XA 4GWLA 1SCIA 2B4KA 5JASA 3F9CA 1CUXA 2VSQA 3HC7A 1R88A 4V2IA 4XJVA 1L7AA 1VJ5A 1W1IA 3IVMA 1CVLA 4DSZA 1W75A 1JKMA 5AIAA 1UKAA 2GZSA 3IA2A 1YASA 1LBTA 2J3QA 2IITA 4B6GA 5HFNA 3WWDA 2Y6VA 1Q0ZA 2OGZA 1TKRA 2JGEA 4G9GA 4IQ4A 3WZMA 1PJAA 1L7RA 3SK0A 1UK6A 2Q0XA 1FFBA 1XZGA 4BAUA 1Y37A 2WQZA 4L3WA 3H04A 5IVIA 1GQSA 2ROQA 4KAJA 1J1IA 2I78A 2FUKA 3G8YA 2EDCA 2HHAA 2WLSA 4QA9A 1A88A 2WIDA 3STWA 3DJYA 1VZ3A 5ALQA 1JJBA 4UHCA 3ZI7A 3FYTA 4MYSA 1ZD4A 2QTBA 4B81A 5AIBA 7YASA 2VATA 4J0DA 4ZWNA 1ZD3A 4AN1A 4UHHA 3LIPA 2X76A 5ALYA 2OQVA 1GGVA 5BOVA 4CCYA 1ZJ4A 2WUFA 1XZEA 3MUNA 1XROA 2XE4A 4TVKA 1QONA 1XQYA 4BC0A 4QLAA 3UMJA 3GA7A 4ZREA 3HEAA 2PUJA 1QO9A 5EIEA 3QYJA 3DYVA 2J4FA 1IUNA 2RHWA 5A62A 3G0DA 1QIGA 1THTA 1BS9A 1CEXA 2WIFA 5AKZA 5ALVA 3IB3A 2HM7A 2R8BA 3AFIA 1WOMA 3FLEA 1JI3A 1TQHA 4KYVA 3FWHA 5E2IA 1JT2A 1UKCA 2XUAA 4Y7DA 1XKLA 2HIHA 4UUQA 1MAAA 4LXIA 2WG2A 1W4LA 4EY5A 3A2LA 3JW8A 2B61A 3HZOA 1CQWA 5FLKA 3NUZA 4X94A 4CI9A 5JAHA 2ACEA 1WHSA 2OAGA 2AXEA 4U2FA 2XMSA 1G42A 4B7ZA 2HADA 1CUJA 4A23A 5JD5A 4C88A 1JU4A 1QIFA 5AM2A 2VJAA 5FOQA 1Q84A 5AKHA 2HA7A 3L1HA 3ZWQA 4FFWA 2PM8A 5A7FA 2GYWA 3WK7A 4AMYA 1HLGA 3AIOA 4K5QA 3PDCA 5AP9A 4GBGA 4Y2TA 4KE6A 2PSHA 3VJLA 5LP1A 3WKAA 1E5TA 3EBLA 4CIBA 1UOQA 1EDDA 1DT5A 1EK1A 3H0CA 1A8UA 3K6KA 3FVTA 4YX9A 1XZBA 4QWWA 1ZICA 3D5EA 4G8DA 3H2KA 2XQIA 4EBBA 5BWBA 1NU6A 5K5EA 4FLFA 4CG1A 4BCBA 1DTEA 4HVTA 3G9TA 3WQHA 1XRQA 1IUPA 2RIPA 3ICWA 4Y2SA 2WHPB 2BGRA 5SYMA 4J03A 5BV7A 1CUHA 2PUHA 1C7JA 1CV2A 1K8QA 3HSSA 2C5GA 1FFCA 3C5WP 2G4LA 4AO7A 1EVEA 3WIBA 2B20A 3NGMA 5I8PA 5LKRA 1GT6A 3PF8A 3QPDA 2C5FA 2JGFA 1P0IA 4M0MA 1VE7A 1AZWA 3OG9A 1X70A 4XX1A 4UPDA 5JZSA 3FYUC 4X6YA 2XLBA 3C6ZA 5AI8A 1DWQA 1QIMA 4F0JA 4KEAA 5C8ZA 3VVLA 3IDAA 3ESBA 4Q82A 1ZIYA 3KWFA 5IVDA 2XUOA 4AB1A 2XUKA 3OTQA 3LCRA 2WJ3A 4H35A 3QMMA 2IX9A 4QDXA 4DYHA 1DWOA 1WB5A 5K3DA 5AM3A 5AICA 1DX4A 1H2WA 5AM4A 1GPLA 3UUFA 2CZQA 3T52A 4Q05A 3KOOA 3BL8A 2VT6A 4XWGA 2XUPA 1KU0A 3HRHA 4AZ0A 3BDVA 4AXBA 4H18A 4BCCA 3NWOA 3WWCA 1EDBA 5KWJA 4XVCA 3A6ZA 5J3JA 3STUA 5ALOA 1QJ4A 2ZSIA 2QOEA 2OGSA 1OCEA 3RLIA 4BE9A 2ZYIA 4FBLA 3D2AA 1SOMA 2C4HA 4QLOA 4BRZA 1E66A 2PPLA 4TGLA 4W1PA 3RM3A 5C8XA 1ZD5A 5AM1A 4OPMA 3AINA 1LPOA 1RWQA 1P0MA 3WK5A 3BIXA 4KE7A 1VXOA 5ALKA 3TRDA 1OILA 4X6UA 5LZ2A 4OU4A 1H2YA 4WDRA 4BVJA 1MAHA 1VXRA 2J4CA 3WKDA 4G4GA 4Y2VA 3FOBA 4E14A 1W6RA 2G5PA 2ZJFA 2WIGA 2QMQA 2JGMA 4X95A 4J7AA 1ACLA 4PSUA 3AILA 1DINA 1KU6A 3TGLA 3JYHA 1CUSA 3WLAA 2ZYHA 5K3EA 1GZ7A 4PSCA 1XFDA 3FAKA 2PL5A 4OB8A 1GPNA 3H2GA 3QMVA 3D4LA 4B0PA 4M0EA 1J2EA 4E46A 4U2DA 5AOBA 1CUWA 3O4HA 5ALRA 1EVQA 5EHXA 2H9YA 1YAJA 1XQWA 4LYDA 4N8DA 1LPAB 4KRYA 5CXXA 4GLBA 5HF8A 3VXKA 1QE3A 5ALEA 3DD5A 5AI6A 4U2CA 1GKKA 2EEPA 3BDIA 4OB7A 3DKKA 2VTVA 1EDEA 3G0IA 5JAOA 4B83A 1LPSA 2VQ6A 5I7UA 3D3NA 4FLMA 5AI4A 1XZIA 5SYNA 2GBIA 3MGAA 4JYPA 4N8SA 1XRNA 3DL4A 1FFDA 4X93A 4GI1A 5AK6A 1CFJA 3IUJA 2Y2UA 5CH3A 3M82A 1IZ8A 1WHTA 4N8EA 2JEYA 3F97A 1ETHA 2WU3A 1E8MA 3VDXA 5AK3A 4PF1A 4IHAA 3WJ2A 1ZGCA 3H18A 1YS1X 3VJMA 1ZGBA 4UBJA 3KDAA 2XUJA 4Q3LA 4G5XA 4UHEA 5DNWA 3M83A 4L0CA 3P2MA 4X92A 5ALMA 1LGYA 5IH7A 3H1BA 1W76A 5JAUA 2HU5A 1QIDA 2PSDA 5ALLA 2JF0A 4H7KA 4FWBA 3H1AA 2ZYRA 4U2GA 5AKKA 1UOOA 2JEZA 5T4BA 2QZPA 1CRLA 2VJDA 4K2AA 4GECA 4EZIA 5DJ5A 2I03A 1CUYA 4X85A 2GYUA 3DOHA 1UT6A 1ORVA 2HRQA 4PSDA 4INZA 1TAHA 3Q0TA 3ESCA 3IUQA 4DM7A 3W06A 1U65A 1W52X 2I3DA 3MUOA 5LLSA 2HRRA 4WY8A 3AZOA 5C8VA 1F8UA 1EK2A 5IVKA 2GYVA 2RONA 3IUMA 2WHQA 3S8YA 1DT3A 5ALDA 4UBMA 1UWCA 4HXEB 3QITA 3DQZA 1E3QA 1WB6A 4EA6A 2DHEA 3WK6A 1F6WA 2XUIA 4OB6A 1ODTC 3C43A 4LXGA 4PO3X 2H1IA 2VT7A 2PSEA 1ZI9A 3O0DA 3A2NA 5CMLA 4UBKA 3STYA 2H7XA 4MXDA 4W9RA 2D0DA 1TCCA 2RHTA 1WB4A 4QDUA 2ES4A 1YR2A 1CR6A 1YA8A 1BROA 4W63A 3F96A 3FSGD 4FTWA 1U2EA 4C87A 1YSCA 2BCEA 4F21A 3CCBA 5AKXA 1QO7A 1LPPA 2PVSA 4J0IA 4MWTA 5HFAA 3WIOA 1WM1A 4L72A 2ZJ7A 1EX9A 3GROA 5CT4A 2WUGA 4B9EA 1FFEA 4O08A 4Y2QA 1WCYA 4B80A 5AI5A 3C8DA 3W04A 4C4YA 3R3VA 1TCAA 5E4TA 2WHPA 4AN0A 5FPQA 3Q8WA 4Y2PA 4BATA 4C01A 3B12A 2WSLA 4G8BA 1PFQA 5ESRA 1VOTA 3WKEA 5JATA 2DHDA 3QVMA 4EHBA 1M33A 2Z3ZA 1LLFA 5AKEA 1LNSA 2XQGA 2Z8ZA 4C4ZA 3IBTA 1ODCA 2WUEA 2OCLA 3N0TA 1ZI6A 1Q83A 3K9BA 3V48A 5JZ9A 1DQZA 3BJRA 1OXMA 2EDAA 3PICA 4F5ZA 2QR5A 4FNMA 4DTCA 3H19A 5AI9A 4OUKX 3VVMA 1CUZA 4LXHA 4HRYA 5CT8A 1CUBA 5CT5A 1MX9A 4N5HX 1UK7A 1R9NA 3DEAA 4OSEA 2JGLA 2DHCA 1XQXA 1XZKA 3M81A 4BP8A 3FYUB 2CJPA 4I3FA 3WYNA 1BEZA 1UOPA 4CFSA 2FJPA 3FBWA 2YXPX 1EB8A 5AM5A 1BU8A 1Q0RA 4GXNA 2VF2A 5CH8A 4RGYA 4MJ3A 1EHYA 3H2JA 1XZAA 3QM1A 3I2KA 2QJRA 2DCMA 3WWPA 5FKJA 2W22A 3C6XA 2HU7A 1QLWA 3VKFA 3QPCA 4RNCA 4CG2A 1J06A 4ZV9A 3V1KA 1EH5A 2QS9A 5ALIA
chains in the Genus database with same CATH superfamily
3P9YA 4KPYA 3QQPA 1N7HA 4WGFA 1EFLA 2KLHA 2C96A 2NU8A 5JS8A 2KS6A 1M9NA 2AVDA 4P2BA 1PUJA 1J8YF 1XHFA 4XD2A 4DEVA 1ABBA 3OHMA 4BGVA 3WK8A 1Z63A 3HU1A 3QHAA 4JBHA 1MHPA 4N4AA 3ZNNA 4HDCA 2BMDA 4H1VA 1FFWA 5C1BA 2NTEA 3IXMA 1XMPA 2CMFA 4X1KA 4ZAXA 3TQRA 3VISA 3U7QB 1HE8B 3VSDA 4PZPA 1UQRA 5AKLA 3NEJA 4U7TB 5FTWA 3BD6A 1VA5A 2QN3A 2HCJB 2IPXA 2YHUA 5CTAA 1CY6A 3WNDA 4XQ9A 1Y1TA 2C4NA 4TTIA 4HMOA 3G3EA 1EUCB 1WPQA 4L8LA 1IN5A 4B4VA 3A1VA 4ZT2A 2DSNA 3AVPA 2HTEA 4URXR 4FKBA 1GPJA 1OOEA 2CGEA 3OFKA 4BWGA 1UC9A 1NXQA 2VJPA 1U1FA 5BRNA 3EXIA 4DE5A 1FSZA 3DEJA 3C3EA 2O2YA 3CJQA 1RWMA 4FFOA 1SXJD 4I99A 4O4LA 2BUAA 3GO4A 3AF5A 3O8CA 4EH1A 4I4TF 1EX1A 2B3DA 5AJXA 5B1DA 4O4IF 1JAIA 1RD4A 4QL3A 5DEOA 3PTAA 1QTIA 1YB7A 1Z6QA 3IOYA 1ZONA 2RGBA 2YWRA 1YHYA 1PZFA 4RADA 5HIMA 4KU4A 2C5AA 4YC7A 1S9DA 2JFWA 2CD7A 1T10A 5DGIA 4LBVA 4UE2A 3UKDA 4Y9UA 2FZVA 2SICE 3RTDA 1NBWB 2W43A 3OPMA 2IP4A 1SH7A 3HVIA 3IURA 1FXWA 4LRTB 1YRWA 2Q3EA 2MSCB 2QZ9A 3BBPA 5LQAA 4P54A 1PN3A 1OH5A 2W6MA 5EE3A 5LLDA 2W8BB 3K9LA 3R6LA 1EINA 4OM7A 5JI2E 4IJMA 1H23A 1KDRA 1R6DA 3FOWA 1OMOA 3F4BA 4TQAA 2XECA 1E2KA 2CVPA 4XX0B 5L3RA 4AY4A 2ZSFA 3JZFA 4MS4A 1QHEA 1P4JA 1EFDN 5BNZA 1VL2A 5JZOA 4YDSA 4DV2B 1D04A 2VDVE 1UUFA 4L76A 1VPTA 3KC2A 1O95D 2X1MA 1ECFA 3CWZA 2OGWA 3KYJB 5IUJC 4G63A 3JRXA 3SNKA 4ETIA 1W0KA 2X6QA 3NIFB 4AJ2A 3JCZA 5JH7F 2FSSA 3BSSA 1XCBA 5AMXA 3X2EA 6NULA 1OH8A 3PHIA 3QLUA 3TZ6A 3SBXA 2H7VA 1RQRA 2PKQO 1ZHFA 4P38A 2PJZA 2PZLA 4F12A 2FVXA 2HMTA 3L0BA 1EG2A 3H1TA 2DX7A 4ITUA 2Z2KA 4BB0A 4DM4A 5HHTA 2EGGA 3P45A 4GI7A 2ACKA 4OP1A 3UV3A 3GNTA 3OPYB 1HT2E 2FPIA 2F8MA 4Q03A 1B6RA 8ATCA 3I2JA 4F8JA 3SHOA 1BIFA 3KG2A 4YRFA 1YS9A 5GV7A 4I4CA 3VR3D 4QTXA 1XD8A 3ZG6A 5DHQA 1LSOA 1A4UA 3UOAB 1M6VA 4A15A 1UMCA 5KC8A 2IXBA 3KB1A 2B1QA 1LPNA 1GAWA 4A0RA 1U80A 3QXXA 4YBRA 2KPOA 4LF7B 3KFVA 3E5RA 2RGCA 2R00C 1T3SA 4M8SA 3WGMA 3AKYA 5FUVA 1Y9DA 3VU0A 2WPDA 3KUXA 4ZV7A 4N47A 4IRXA 4C0XA 2IT1A 3GP3A 2GVZC 4BL5A 4DIUA 1QOZA 3N3AC 1ESMA 3AY3A 4X8OA 4AUKA 4QBHA 1YIAA 4ID3A 3FMPB 5E6RA 5L9AA 4GE3A 2O3JA 2XXJA 1NIJA 4KNYA 2D8AA 5DTIA 3MUFA 2IVFA 4PFSA 2O3TA 5K2MA 3TAUA 5K20A 1F5NA 3HVUA 4RF5A 1XL0A 3RYIA 4CF5A 3FUXA 4LXTA 4HYTA 3FPEA 1X7XB 2Z43A 3LPAA 2XQFA 2BPOA 4Z9AA 1V7QA 1E1KA 4UBLA 4BFSA 4Q00A 1GCGA 1N9ZA 1SXJB 1U3UA 2WIBA 1RC8A 4IRUB 1RABA 2MSEB 3INRA 4Q02A 1ML4A 3S7TA 5AVRA 2CWDA 4DSAA 2ZTVA 3EXHA 4WPGA 5IAEA 2Z5LA 2GESA 2E4XA 3BXHA 1W88A 3FGPA 3INGA 1AA9A 2OGTA 1DC8A 1VQ1A 5EZSA 2HR1A 2C0PA 1V45E 2IX3A 3IDFA 2HF9A 4E5NA 3CWQA 1W8IA 1UK8A 4I3GA 4WK0B 4TYMA 2JGIA 3OZIA 2Y66A 2BMFA 3I6MA 1G2IA 1R00A 1VJ0A 1SXJE 4Q4DA 1N6IA 4MVWA 4EOGA 4PFJA 5KYUA 3I0NA 2QMHA 2QGNA 3BK2A 4LV6A 4HX2A 1Y6ZA 4COOA 2CC2A 2M98A 3MMNA 2HJRA 1KXZA 3EHEA 1U4OA 4B3JA 1JEQA 5KHOC 4RUKA 3AVUA 1SHZA 2IUTA 3BE8A 3L9XA 4MQMA 2ZCUA 3RU7A 5AK5A 3DMRA 2H4HA 1PFGA 3DOOA 3I28A 4ZC8A 2AZMA 3C5EA 4OHRA 4BUJA 5H9WA 1C4XA 5FFMA 3ETLA 5SY4A 3TL2A 1N92A 4OJKA 4HJXA 3T7DA 1E9FA 1OW3B 5EINA 2IY9A 3CV3A 1HRKA 2WU8A 3LZDA 1O6GA 3H4IA 1L7MA 1BE1A 3GLHB 3K0EA 4TN5A 2DMRA 2OB2A 3PKZA 3TTUA 2LCFA 3JYNA 1NXWA 1J97A 1OZGA 3IP8A 4QPJC 4CLXA 2F1RA 3N2GA 5B3JC 2X9NA 2BFNA 3EXG2 4MS1B 4YJKA 2JIRA 5K3FB 4QT0A 3VO9A 1A4XA 1E9DA 4AYTA 3I4FA 1YZLA 1Z8HA 2YWXA 2BGGA 2B8EA 4BASA 3CPEA 4HXFB 1R66A 3E1SA 3BBLA 1L4YA 4NBRA 3IKLA 1XZDA 2Y71A 3H2ZA 5FHQA 2IYZA 2NXNA 4F3KA 3ASYA 5A0VA 1V7CA 4EENA 1I1QB 2XE8A 3C7DB 4MV9A 3ZLVA 4CVNA 2Q5OA 1T36A 1O94D 5AK4A 3ER6A 4UFNA 3D3EA 1E6EA 1KF0A 1U6IA 2YJTD 1QHSA 3IIIA 1N2BA 4OI0A 3K4HA 1WZEA 4LWZA 3FB4A 4X65B 1R16A 3IUNA 4IZHA 1WKCA 3MTGA 4M54A 1SKMA 4JKOA 3Q3IA 4FBMA 4EKEA 2UYOA 1XKXA 2JD2A 5L3QB 3RBZA 6AT1A 3RUAA 4HDKA 3IMGA 4DTIA 1PL6A 1CDDA 2A94A 2JDID 4IBOA 3R0QA 3D8HA 3TBKA 2P9QA 2C9BA 5LL6P 3E22A 1V48A 2NTJA 1BXRA 4GL2A 2FLKA 3A0RB 1ZL0A 4MYDA 1LVHA 5IKXA 3ZGZA 4XD7D 3K0AB 5H59A 3AP1A 1DWPA 3C7TA 4L22A 4TYPA 5BUCA 1A9QA 3THYA 5ITZB 3GHHA 1YK0A 1XNQB 3ZGOA 5BSRA 3OX3A 3DFIA 3CUWA 1LBSA 1ZSYA 1ZZGA 2OCIA 2R96A 4BVAA 4LGVA 3SJCA 3I2HA 1EP9A 3OZDA 3B9PA 2FZCA 1KAHA 3BFKA 5DULA 1UMDB 2A0KA 3OKFA 2I8CA 3BF8A 2WWIA 3A4VA 4LOKA 3CN9A 1OKKA 1P9WA 4WVFA 2IEIA 5CB4F 3R3UA 1Q77A 1QCDA 2HWUA 2UVPB 4JSTA 3W9BA 4XM2A 1H42A 3I1YA 2VO1A 4BY9E 1Z68A 1ISSA 5B12A 4GU5A 4EFDA 1H8HA 1VLVA 3B3QA 1IEQA 3KK0A 3PPXA 1RE1A 2JH9A 4LCEA 5HILA 3ZXIA 4DCMA 3S2UA 3OO0A 2BN4A 2OBBA 3DT8A 3OMWA 2VN8A 3RS3A 3U4DA 4DCPA 1K5HA 1MC8A 1RXWA 1ORHA 1D4OA 1QVVA 3FTDA 3ZI4A 4R5MA 4F84A 3WLMA 1E3JA 3ICVA 2GWHA 2AG5A 2VDMB 4TV8F 3PYLA 1DBPA 5FBVB 2UZ4A 2QMOA 1QPBA 1RYYA 5IDQA 2ZBDA 2PNJA 1L4MA 2XUDA 4BQQA 3UJBA 2BRUA 2N1BA 2G8LA 1NVMB 2CVFA 3T4UA 2E82A 2BM8A 3H6GA 3D31A 3OY7A 3QXCA 2F43B 1F0PA 1NJSA 1X80B 4PTLA 4F5WA 3KWMA 1IPHA 4L50A 3RVNA 1L9KA 5FORA 1U81A 4LRUA 4E22A 4F2HA 1SUWA 4MEJA 3GFPA 1B0PA 3HEMA 3UYKA 4CIDA 1QFXA 3CBGA 3TL3A 1XA0A 4W1RA 2G9VA 1GUDA 2Z2JA 1GL3A 3HDYA 5E6UB 4WT7A 5EHGA 4G25A 5TPWB 2ET6A 2IV7A 1QH1A 1RI4A 4BC1A 3ONNA 3SX4A 3R5HA 4F45A 5AVWA 1YR3A 3GOQA 4EJ0A 1G2PA 1KDOA 2PLFA 2REXB 4REQB 4JUFA 1CUCA 1IWOA 1AXRA 2AJBA 2QZSA 4OXYA 4N7MA 2AEMA 3QI7A 4F3RA 1E2NA 1E1CA 3GZJA 1P7WA 4HUJA 4JXKA 4LKOA 2JFVA 4NE9A 1KMHB 3QSYA 4IOKA 2VQ3A 4G6ZA 1WETA 2XWSA 1EJ2A 1FMCA 2HV9A 4G1BA 3U7GA 1NMZA 3V4RA 1NJ8A 5EP2A 3FR7A 1XKTA 2A9OA 4J4BA 1XEXA 1XZLA 3NCHA 1Z7GA 5BYKA 4OXNA 3QEOA 2PKQP 5F76A 2ZRIA 4GZLA 2Z6UA 4HZUB 5D5HA 2DUNA 3BFVA 5CK5A 4A8JC 3I61A 4AQ7A 4KFUA 4YQZA 2CEKA 4LMRA 1RAIA 1TKCA 2NVUA 1TYBE 2QRMA 4PQYA 1OBFO 2WFLB 2D4AA 3KCNA 3NWJA 1GL7A 4YAIA 2J48A 4I50A 3SIPA 1X77A 1HMPA 4B47A 4N1AA 4OGKA 4QHTA 4PC1A 3CH6A 1KFKB 3A36A 1IPEA 1VYHA 2CJWA 2QT0A 3DC2A 4AIRA 4BQFA 1FU8A 4CIAA 3GZNB 3JQ8B 5MFZA 4HEA1 5BYJA 4V24A 5A71A 2AZDA 4G1MB 1TZ2A 3DE2X 3QELA 1L5OA 3IIJA 1MEJA 3NBAA 4FFBA 2MHCA 4MQLA 4DLLA 2ODEA 4FHFA 1ODIA 3ZLUA 1I7PA 1E9AA 4BQOA 4M1WA 1VZ2A 2VDQB 3TNYA 4R9SA 4PW0A 2KJQA 3DFZA 4TS1A 3OCYA 3PFGA 3WJ7A 4FQ7A 4L0DA 2GJ4A 3B9RA 3NDPA 1T2NA 2I4NA 4TSFA 3R7WA 3WB0A 1P1KA 4EMSA 2NZWA 3LX6A 2VPXA 1R18A 3CNBA 3PPYA 4DYDA 1H9CA 4GYYA 2Z08A 1E9SA 5LD2C 2X2FA 2F90A 2NPIA 3RODA 3DOUA 4RFSA 5CP8A 1EHIA 3SX0A 2AC7A 1E58A 1QHYA 3A6HA 3OO1A 3ETEA 1SC6A 1BZYA 3HL0A 1MF7A 3ILSA 4MPPA 4DXDA 4KOEC 1XJ0A 3I34X 5HTKA 3R7AA 1SULA 4LYEA 1YT5A 3KD2A 1WV1A 1ZOOA 4J0QA 4NZPA 3ZI0A 1JDPA 5KDLA 1T35A 4WJZA 3EQ6A 3CLUC 4EG0A 3I04A 1NVVR 2EW1A 1JSZA 2P6NA 3FHOA 5D3QA 1QP8A 4U1RA 5EIOA 3RU9A 3W3ZB 1NVTA 3R5XA 3E3AA 3VNVA 4PLPA 4H6PA 2P41A 3T5DA 1PZMA 5JPIA 1G19A 1BE6A 1B76A 3QJGA 3RT9A 3UAZA 2CXUA 4WL0A 5CA0F 2O50A 1T9ZA 5AKIA 4N3NA 2PV0A 2G9ZA 2RK6A 4G5FA 3SQLA 5HJEA 4U39A 4YCNA 1PD0A 2EWWA 1P5RA 4HWSA 5FUMA 5IULC 2OKGA 3ANNA 3NONA 4YIHA 3B48A 1YKSA 3ZDQA 2ERYA 4BIMA 5KYXB 1XELA 2X0FA 4YUWA 4EHJA 1FRVA 2PQ6A 2B8NA 4KAAA 4NJMB 4BE4A 3GLVA 5IM4A 4IHJF 3TPFA 3KYIB 4LF6B 1KQ3A 2J41A 1B15A 1JHVA 4FFDA 1IJEA 1QRDA 1NPDA 2O1EA 2WM2A 3QFHA 3SF8B 3GIDA 2W6CX 4X9XA 2JLYA 1G6KA 5DXJA 4FINA 1QAQA 3KAKA 2HHJA 3B82A 4HS4A 1VLQA 1CERA 3R09A 2R3SA 3NHWA 1Z06A 1L3CA 4UBOA 4PVDA 2PIAA 1QP4A 3FPKA 1WR8A 5BSKA 4OHUA 5AKJA 4FDMA 3EFOA 5JANA 1RRPA 3EC2A 4XVHA 5LZ9A 5TLSA 1V8FA 2C20A 2V59A 4ZOLF 2YUIA 2PU5A 2LIPA 2XMBA 2KWIA 2BCGY 5CLLA 1MBZA 3FTQA 3ICPA 2PT5A 3ODPA 4M21A 3D54D 4PQEA 2J0VA 3R77A 3SLKA 4EY4A 3NRJA 4M76B 4IO0A 2OG1A 1QFSA 2HLDA 3I5YA 5LMNB 3T3HA 3M3PA 2IUSA 4EMUA 3FAZA 3I8SA 4TT8A 4DA6A 5JHGB 4IHQA 3GFOA 3LUHA 1C1XB 4ZRDA 4FCCA 1GY8A 2PGLA 2XNDA 5T8KA 5GONB 3L0OA 3VZDA 1HI9A 3DAGA 3TD6A 3FFWA 3WLTA 1VFNA 3N75A 4H7FA 4MLDA 5BPHA 1XRSB 1XI2A 2HC9A 3S2FA 2BKLA 1YB5A 4N01A 1M7GA 1DBIA 3PGMA 4BX0A 4GEGA 1KSGA 3KLNA 4UUOA 2P2SA 3AUKA 4BE7B 4MUMA 2PD3A 2IYWA 3L0ZA 3DZGA 3U7QA 4BN5A 1JMKC 3GJ4A 4HH3C 1VG1A 4BAZA 1I5EA 5FTKA 2UUPA 4Y2XA 4DCNA 4IXNA 5ANRB 1DEHA 3GRZA 3JARB 2OHGA 5DKFA 1REQB 4NE7A 2IH5A 1AB6A 1EUCA 2NSLA 3NUQA 4HNSA 1AE1A 3CLSD 4XGQA 3PRKE 1UXJA 2XGMA 5I8ZA 3DD1A 1DEKA 4FGUA 3NDIA 4GPEA 4NMMA 4WFIA 5FHRA 4EG7A 1O3YA 4YJ2B 3G1UA 2GN8A 5DGCA 2YZ7A 1U0SY 3PSHA 1N3BA 4PS0A 4DNXA 1Z74A 1VCMA 1ZQ9A 2ZYWX 3PE6A 4MAAA 2B0CA 1WS6A 3KUDA 2D5IA 2OLEA 5AM0A 3QVWA 3AV0B 4JS0A 3PJGA 2A67A 3AJ8A 5HK9A 5IFLA 5F78A 3ISJA 5IBCA 4AS1A 4X41A 2AVNA 2BY4A 2WK1A 3GAFA 3R4CA 2H5EA 5D6NA 4Z3DA 2FPPB 4H6WA 3MSXA 4A5SA 3GGPA 4CFYA 4JEMA 1B8UA 3BD8A 4TPKA 3VA7A 3ZD6A 2VEOA 1H05A 1CJUC 2NZYA 2WT8A 2C00A 4Y6RA 1YQWA 2BGTA 1P7CA 1IMOA 1FDIA 2WIKA 3PEEA 4NCHA 5WRFA 3RHZA 1IULA 3RW9A 3JQBA 2GPAA 1HNZB 4Y6OA 3P9QA 3V6MA 5C7YA 1YZYA 1ISPA 2W8BA 5T4FA 1JI0A 5KS2A 1T8TA 2LKCA 4XX0A 3P2IA 3ZXXA 3R3WA 4GR5A 2HXYA 1T9CA 2RARA 3KAPA 1JHAA 4U2BA 3TG2A 1J24A 1J1UA 2HNBA 4DEXA 1HQDA 2PL1A 2W2OA 3LJKA 1VL1A 2I6QA 5F52A 4UTRA 4JLSA 2JVKA 3V1LA 3UWKA 4BQRA 5CFOA 3HCWA 5AOCA 1G2QA 3BHIA 5HF6A 2XWJI 4CLOB 3L0YA 4KXVA 4OAOA 2BM1A 4EA8A 2R47A 4YAOA 4B84A 4OAQA 4NBUA 4H3KB 4HF7A 5T64A 3FOFC 3ZVLA 4RHFA 3KIPA 5TMPA 1O6BA 5LA6B 2JLZA 1N3IA 4RTJA 5IPFA 2CBZA 4PM4A 2B1GA 2I91A 4IMIB 3RASA 1YZVA 1ZCFA 3OPYA 4MUHA 5HIAA 4XB6B 1NATA 3KTFA 4D9HA 2D5BA 4M2LA 2FWNA 3OFSA 1QDLB 3DQPA 3KBOA 3WGUA 3MIIA 5H5JA 1UBGA 1XL1A 1W5SA 2YIDA 4C2AA 1ZGGA 5G0UA 5A3RA 4Z8YA 2TMDA 3SSOA 2JA1A 3OZUA 4GW3A 1XRJA 2VWHA 4XFKA 3DQQA 2XMDA 3KL4A 5JWRA 3FKJA 1RHJA 2VT3A 4XLLA 3VZSA 4B46A 3RBVA 4FNAA 3ANTA 4BUZA 3QH4A 2QROA 4F4DA 1EUYA 3C70A 4N0DA 4ZEMA 3K53A 1U4SA 3D64A 1KETA 1NWHA 5CIYA 2KLBA 2O6HA 3EDMA 2VDUE 3ZCPA 3T4XA 1TZCA 2HX1A 3GELA 1Z6GA 1YXMA 4LRSB 5M3BA 4K3UA 2HEIA 2OCKA 2VHYA 3AEQB 2QW0X 4C2BA 5I7RA 1SFRA 1T91A 3LP5A 1FP6A 5G41A 4DRYA 2ZS7A 2XMRA 3LQFA 3QU2A 5KQSA 3AVOA 3K0SA 5FI0B 2QRLA 3HYTA 1PRYA 2EX0A 3PDHA 5TF4A 4Y1GA 5JNSA 1X7XA 4A4DA 1VJTA 3AGPA 5EQTA 5DVZA 1ANKA 4B3BA 2JC3A 4JXXA 3O47A 3K6RA 2BR5A 1SXJA 1I1NA 3TTYA 3OZAA 4E94A 3SJAA 1JHDA 3OZTA 4OLJA 2NQ2C 3WYAA 5FV4A 5CDUA 1UCFA 3QX7A 4BRSA 4C7KA 4E4RA 4YRJA 4YRNA 1MABB 4KBYA 4AP9A 1NOIA 3DMNA 4XIIA 1Q57A 5TMEA 2DPMA 2A0XA 2CMDA 2IIBA 2ZITA 2ZRNA 3PQ5A 2P3QA 1YGPA 1DKLA 1QX4A 2VNIA 2NO1A 3E03A 2BE7A 4HGQA 4D4JA 4IX9A 3CU5A 2DOKA 3I2IA 3ZGVA 4MGYR 4CNBA 1IUOA 2Y3IA 4GICA 4EKGA 1JIIA 2F1OA 1Q14A 4NMHA 2VDKB 3I73A 4YUXA 2E87A 3F90A 2AQKA 3G7UA 1JU3A 1QXSA 1NNI1 2FZ5A 1IVNA 2WD7A 2WIAA 4KR9A 2ZB2A 3TQSA 3RUHA 3EQ7A 2O48X 3PFIA 3HCAA 1SVWA 4D92A 1MXFA 1YC2A 3QW4B 4OATA 1Y5MA 1G4HA 2GVDC 3AEYA 2ODQA 3JQ6A 2NP7A 2VAPA 1YNSA 2W2PA 1O95A 3FKSA 3M4JA 2HSJA 3R5FA 3RVDA 4DC0A 1YCFA 4DV7B 4J1QA 2AG6A 1XE3A 2OCGA 4LOAA 4Q9LA 3CTPA 4IH1A 2F3RA 4WLOA 1ESEA 2PZFA 4AJHA 5HZKA 5H4GA 1AU9A 1EZ4A 2Y1OA 3GLHA 5AJWA 4LVUA 4WBXC 4AJ1A 5LWQA 1TIKA 3P20A 2Y77A 4HFMA 3STVA 4FHCA 5A5VA 1W34A 4EFLA 1M2GA 4P3NA 1K7CA 3DE6X 4MS1A 5K3FA 3TJZA 1USWA 2FZGA 4FGJA 1GSHA 3QJ5A 3EODA 2Q1SA 4TTQA 3HBFA 3RNOA 1X94A 3FTFA 5J23A 3KT3A 2PA3A 5CNIA 5IAKA 2QR3A 3PQ7A 3WMRA 3VDRA 1AGRA 1C9NA 2B35A 2G1AA 1Z36A 3M1YA 3OZBA 2AJCA 4PZLA 3U2QA 4EW2A 1UZUA 4G0ZA 4MCIA 1JR3D 1EPUA 2ZJ6A 3BERA 2R7MA 3UQZA 5JAZA 3QV1A 2VHJA 2CLOB 5CT6A 2QP9X 2YJZA 4LIPD 2WSSA 1E8DA 2ZE7A 3M5WA 3ZCTA 4CMJA 4WJLA 1JR6A 1RM3A 4BUCA 1C8VB 1WX1A 4D8VA 4GLJA 3UPUA 1VSVA 1XTVA 1EA5A 1TLFA 2IZZA 2HT6A 2ZXEA 2DCUA 1THGA 2R6AA 3G7NA 1YMVA 4RLFA 1K06A 4NICA 5ENZA 4E15A 4K40A 2IYEA 4RIHA 1P2TA 1QX3A 2EQAA 3TOSA 4PNZA 4LJAA 3I6IA 4U8GA 4MW4A 4DQKA 1J2TA 1PT6A 3RCBA 3CNLA 4CG3A 4EMBA 1PWEA 3JWHA 3UK1A 3PEWA 2AB0A 2QMUA 4INJA 3HUFA 4KSCA 4RZ3A 3T3MB 2XMQA 4PO1A 1GPBA 4JBXA 2IXFA 3HXTA 3K94A 3HJFA 5HQTA 2VJCA 3LBIA 4WW0A 2CMGA 2R7LA 5G4KB 1Q3TA 1R2QA 3QYAA 1YR8A 3PHJA 3GUUA 1FBNA 1SZPA 1E89A 3V1MA 1ZRMA 3DSRA 3K0AA 4QC2A 5ALJA 3RFCA 1EXVA 5ALSA 4TZTA 4JHLA 4CM8B 3H3XA 4OLFA 5ITZA 3F46A 2OOSA 3PNBA 1E7WA 3WK9A 1EIZA 4G0PA 4FP9A 1IN8A 1NY6A 4BZXA 3FJYA 3THRA 5CNMA 4DLYA 4ENQA 1EP3B 4ER6A 1UMDA 2D7CA 5CTJA 5TX7A 2FN7A 4MKHA 3M1LA 2BW0A 4FHZA 4PLGA 4R68A 4GL4A 4URWR 2V0CA 5LUBA 3RPEA 4NFSA 2UVPA 1TZMA 1OQAA 2R2AA 3CVXA 3EMDA 2UVQA 1E63A 2RH4A 1X14A 4R3NA 3C8MA 4RFVA 4FMDF 1SUDA 2C8VA 3RFUA 4EUKA 2RGYA 4U0JA 3B38A 1GL6A 5JYCA 4E09A 5BWCA 4MIEA 2HA3A 3KVOA 2QRUA 2VOEA 3LDUA 5A3QA 1RXIA 3M6LA 1B43A 2QKYA 4NIMA 1HV8A 1TIBA 3G68A 2HXGA 3AQ4A 3CNHA 4A26A 1D4ZA 1EFRD 4UCFA 1N8TA 1Q22A 4YV2A 1ENOA 3H2YA 4A1OA 3ZDEA 1O87A 2AWNA 2X0KA 1HNXB 1CP3A 3CLUD 4LDNA 1XNRB 1XLWA 4R1PA 4V39A 5DHRA 4Y6LA 2QD4A 5J63A 1OFVA 3EHDA 4EFMA 4F6RB 5JU6A 2FUNB 2LDBA 4NONA 4CTJA 3FDFA 4C4RA 1NUHA 2F43A 2Y1CA 3H75A 1X80A 3LGSA 4JQZA 5HDQA 4AX4A 4BS9A 4D5EA 3LW8A 5J4KA 1NJ6A 1QIJA 2JIZD 4NQZA 1LY1A 5AYVA 2LKDA 2CL7X 3WGIA 5J4VA 3LRPA 4QGGA 1K0UA 3JSXA 3O38A 5FPTA 4AMZA 3S0JA 5CR9A 4GVPA 1HOXA 2PU7A 1UBHS 1KQPA 1ZD2P 4NZNA 5FYDA 2Y1XA 3EEIA 5F51A 3K70C 3EUWA 4FYJA 5E6UA 2VYND 5TPWA 1AC5A 3BYZA 3E5NA 5KOHB 4L74A 1LF5A 4JI2B 2JZNA 5D1NA 3Q8MA 2XX3A 1K4KA 3IBCA 1ID1A 4G1EB 4M7OA 4X1IB 3EH1A 3WBFA 2HSWA 3NH9A 1R50A 3U7RA 4FNGA 4BX3A 1DAIA 4REQA 2ZATA 3VYVA 2FW7A 3HV0A 2QVYX 3CVWA 2QRPA 5JCOA 2OQRA 2XNSA 5DNVA 1A5TA 1KMHA 4QYTA 1XK6A 2HHCA 3K0CA 3CWCA 2PTHA 3FUWA 1L1FA 2HQRA 4WK6A 2Z4RA 1GYRA 1WY7A 3BB3A 4IM7A 1F7VA 1GO2A 2V96A 1GARA 4HQ0A 1BX3A 2QG4A 2ZAMA 1BCRB 2B1JA 2GMWA 4HZUA 4UVIA 1Z73A 4KGVA 3HCBA 2HIAA 2HFKA 2ZAOA 3SM9A 3EUFA 1D2RA 1CULC 4FHDA 4Y98A 2RHHA 1QH0A 2GVNA 1JG4A 3G9UA 3MOGA 5DBOA 3TLKA 3NFRA 3PUIA 2WFLA 4ETMA 4JZYA 2B5OA 1VPEA 1JR3E 4A8JB 2IKQA 3HZHA 1ONPA 1WMFA 1MIOA 4HUQB 4CM9D 5ALNA 1WTAA 3QLTA 4F92B 2QJTA 2YH2A 3H1GA 1L8QA 2OVBA 1S2DA 3HBAA 4KQ1A 2JDIA 1CUDA 5D3ZA 1GPYA 3MJTA 4WZ6A 3BZBA 5H0IA 3ZYZA 3EA5A 3GZNA 3JQ8A 2KYRA 4ETWA 1RW4A 1RR6A 4OVKA 1Y9EA 2EFJA 2ST1A 2NLOA 2R6R1 4IRMA 4NZ9A 4Q7JB 1HNWB 4KPUB 4XD7A 1OA0A 2JFZA 5ITVA 5IYZF 1A8HA 2XB6A 3GJ7A 1SCQA 1USGA 2WMNB 3J7TA 2PUEA 1SXGA 4RMGA 2WSYB 1DAOA 3SXJA 2W4IA 3DULA 3MXOA 3OE4A 4GOMD 4X71A 5TQ2B 3UUWA 3DDWA 4R0MA 3I5UA 4EO4A 2E0IA 1DIGA 1ECBA 4OXRA 4NYJQ 4CW7A 4NOJA 5JARA 3DS8A 1VL6A 3DDSA 5LDGA 1VIAA 4H0NA 4GX0A 3TEJA 5M7EA 3LQ1A 4Q7QA 1QB8A 1M66A 2UZIR 4M87A 5TDHA 2X3FA 1ZXBA 1GZ6A 1FEZA 3K1JA 3KZOA 4O4HF 1GTG1 2P40A 3CZRA 3TIIA 5BRAA 5LD2B 1D8AA 2HA5A 3SZRA 3ZGYA 3SE0A 4YUZA 1JLKA 2NXJA 2WJVA 2CYAA 1UKEA 3WGGA 4KE8A 4IEFB 1XB2A 3R44A 4IXDA 5DM1A 3ITNA 5EHZA 3A1SA 1CDEA 2FJ0A 1X3LA 4UXIA 1GDHA 1F60A 1RYNA 1SRRA 1Z6TA 3X1MA 2RHGB 1Y7HA 2PKCA 3X0DA 3ZH9B 1W4RA 1P0PA 5DLYA 4Q6BA 2DH6A 3ACDA 3LKZA 2QGFA 4DG5A 4TVSA 2AYZA 2PX5A 4XVUA 1TGVA 4XDZA 4DQDA 5JNVA 7MDHA 3RRJA 1WBDA 3LU1A 1M8FA 2QY9A 1YRQA 3FOAA 1U3GA 2W6JD 2WZBA 1GEEA 1GAEO 5HKAA 1TYZA 1YCHA 3W0LB 2QXYA 3B7GA 3VPFA 1U2DC 4V0NA 1TOAA 1ZEJA 4WI1A 3C1OA 3RHSA 4QUIA 3RH0A 3JQEA 2QSJA 3BIWA 3AMVA 4KWHA 4YWJA 4EA9A 3ANSA 5JVDB 1ZY2A 5KYXA 4NJMA 2B78A 2HCRA 1FJHA 2ORIA 3BXZA 3NEPX 3DL2A 4JLDA 3P9XA 1IZYA 1N7JA 1ZVMA 2DQZA 2RAPA 5IUNC 4DR2B 4PGMA 4NK5A 3P2JA 1Y1QA 4PAOA 4GI3A 4LC0A 1LPMA 2IYYA 5EMNA 1CQIB 4D42A 1K8RA 2REBA 4QEKA 1A3CA 5HS6A 3X1JA 3SF8A 4MJ7A 4UFPA 2HEGA 3VR5A 5KNCA 3M3DA 3Q9NA 5GM1A 1PJ4A 2P11A 3SSNA 3U1VA 2C4VA 2FP3A 1FLVA 4QRIA 5KVCA 1NDHA 4EJFA 1HDGO 4YQYA 3F7NA 2Z9BA 1Z15A 2I8AA 1ZRNA 2IYTA 2QJFA 2ZB4A 2FEOA 3CNNA 3MMZA 3D3JA 1WDMA 2P79A 4J2TA 4YJGB 2LCQA 1HDEA 1ZIDA 1RQ7A 5KJFA 3I6ZA 4M46A 4IV5A 5IKOA 4A10A 4YT8A 5JMTA 1JHQA 1B73A 2KB0A 2G0AA 2X4LA 3GJ8A 2AXNA 1H1DA 1TO2E 4MV8A 5K0CA 4ZANA 3DH0A 3EXAA 1EAYA 4KYTA 3GFRA 2QXUA 1Z33A 3OE1A 3T1YB 1OC4A 2IS4A 1JYFA 4ZVVA 3ZBUA 5ICCA 2BKUA 3F1KA 3IQDB 3ZJ4A 3FDZB 4FJ1A 3U16A 2VJLA 3L04A 2WYHA 3GJSA 1UPTA 4DDMA 1UPBA 4PQGA 4D9NA 1F4VA 1C1XA 2P65A 3O0TA 4XFDA 4ZVOA 3OKCA 4BEWA 4P0QB 3N53A 5GONA 1H2BA 1IDN1 1HLDA 1BA3A 1UFOA 2FQ1A 3UWSA 5M5BA 4OIMA 1Q1EA 1GNRA 1Z6YA 1NXVA 2YDYA 1U8ZA 2H52A 3WNBA 4EYGA 1NJ2A 2WHXA 4PFKA 4DRZA 2VL7A 3UKJA 5JZMA 2CLIB 1HFKA 4UNNA 3PI6A 3EVGA 3UMGA 3O9MA 3FROA 1CKEA 1XQ1A 2R5FA 4Q3AA 4Q3NA 4TLAA 1GIAA 2W2KA 1XZMA 2QENA 2IWRA 3V80A 4NK4A 3Q2KA 3WJ1A 4BTVA 4P7KA 3JR3A 2PKYX 3NW9A 2IEYA 1OXSC 1TU0A 4GWKA 1IL0A 2QT9A 3JARA 1REQA 3HLTA 3H2IA 3TTVA 1E3LA 1VRWA 2RGUA 4ID9A 2WFZA 1OUMA 1XJQA 1T1IA 4KXQA 2LPMA 5E2AA 3C85A 1M34E 3HQ4O 2ZJ3A 3GARA 1W49A 4RPGA 1ZDMA 3F6PA 1B41A 4C0JA 4YJ2A 4WA7A 3K92A 5H70A 5LC1A 1TM4E 3V33A 5JNUA 3A2MA 4V0KA 4F3NA 1H5UA 3ETHA 4KWCA 4IXTA 1MNQA 5KREA 2JARA 2HGZA 2JCVA 2BFCB 5B57C 5JPCA 1WXDA 3M89A 1AGYA 1R0SA 5FB3A 3ZY6A 2FPPA 4RWZA 3VR2D 2P67A 1H4TA 1NT2A 3ORYA 5C51B 1H8ED 3EGWA 2QM7A 3EUAA 5AXDA 3ZJVA 1NNUA 1YBHA 1AQ6A 4FMBB 2VXOA 1MC4A 1PZHA 2BL4A 3M1IA 4RY0A 3UT5B 3VH3A 5TARA 4D9JA 1AQIA 1CF4A 5LM3A 1U1EA 1DAEA 4BQSA 1P4HA 1AZLA 1YB6A 3MHTA 2Z98A 3P9ZA 2BC9A 4HNAB 4RPIA 3ES9A 2QL6A 3KQHA 1VLHA 4NMXB 3SLGA 4CMGA 4EJSC 1L4UA 1E9CA 3EIXA 5IZCA 1SKAA 1UBSB 1MG0A 4YUVA 3T5PA 2QTAA 4ZT7A 5EXTA 2JIOA 3O4GA 1BMDA 3U7IA 2OA0A 1I2CA 2R6FA 5TXGA 2AT1A 4KH0A 1KC3A 4GWLA 4KRFA 4WOPA 1O97C 3WGYA 3VH1A 2PWYA 3F9CA 3O5AA 1CUXA 2VSQA 4IJWA 4D3ZA 4CLOA 1OWOA 1Z4MA 3U7JA 2ZJ2A 4XE5A 2FW8A 4EHIA 3VDNB 2PGAA 3SU8A 1YF3A 3RK1A 4MUFA 4X60A 3TBFA 4NCKA 5LA6A 3UTCA 2J3IA 1X15A 1GKIA 1L7AA 2YHAA 2FWMX 1J56A 3CT4A 3JVVA 3OX2A 1FP2A 1W2HA 4I81A 3WQRA 1W1UA 4XARA 3IVMA 8MHTA 1PNRA 4MSUA 1W93A 4ECAA 1ZO8A 3VAAA 5DI3B 1BMQA 3ZHOA 1U6JA 5AIAA 5DLQC 4IQ0A 1JZTA 1UKAA 1I01A 1V39A 4BFUA 1RVV1 4D56A 2D74A 2GZSA 4EYKA 4ARIA 2D2XA 1HT0A 1T5TA 3MJRA 2R97A 4JGGA 3ZY5A 3FFAA 3QBEA 1GR0A 2DUJA 2W2QA 2XTAA 3KSMA 4TLLB 4FW9A 1PI3A 1PGOA 5HFNA 3T1NA 2ZREA 2FOIA 3DMTC 3DHEA 2X1HA 3BRSA 4YT2A 1GVHA 4J7CA 1FTSA 3EPLA 2R751 2Y6VA 4R16A 3ROQA 2R00A 1VYUA 1PSDA 4DNFA 2JGEA 1M2OB 3EIEA 4DR7B 1R0RE 3U80A 5AFSA 2YJ5A 3WZMA 1JE1A 3AEQA 2GRUA 2Q0XA 3BAZA 5GY7A 3SF0A 2HB6A 4NI5A 3V8QA 4DM3A 4TWAA 1LDNA 4GR9A 1AS2A 2BTEA 4BEVA 2B1IA 4PPFA 2J7PD 2O4CA 3AYXB 5HG0A 2WQZA 4D25A 1X42A 2A5GA 5BUSA 5I7HA 1KAQA 4C43A 4L3WA 1Q50A 1V41E 2GEFA 3D0RA 1H6CA 1FJGB 4GC5A 1RZVA 2YWHA 2EZ4A 1E6MA 1GNSA 1LU9A 2NO5A 3OSUA 4FU0A 1G4AE 1K9VF 2PUVA 2FZEA 3WP1B 3RI3A 1GYPA 2BCJQ 4N7BA 4B87A 3FLMA 3JWGA 3M4YA 1AKVA 2FG6C 5B4UA 3ZNQA 1WMDA 1MABA 2UZAA 3ASUA 1A88A 2V45A 3CONA 2HWKA 3QV2A 3STWA 3CPJB 4BBAA 3W8EA 2E5LB 3LLMA 3S5JA 4F85A 1IK6A 1VZ3A 5ALQA 2RMKA 3DB2A 1X87A 1G64A 2F3UA 4QXQA 4U7PB 3TH5A 2OO7A 3V3KA 1AQJA 1XPRA 2ENUA 3AUAA 3JQCA 4IIGA 4BV2A 3IOEA 1WP9A 4LS3A 1Y82A 3ZI7A 221PA 3I23A 3V8RA 4B81A 2YOGA 3KSUA 2IBSA 1JHPA 4UEKA 2WFAA 4J0DA 1NT4A 3IPCA 5DX1A 1ZD3A 4DBLC 3CKLA 4O4LF 3RTCA 3WRXC 4DSUA 1XDDA 1BMFA 4JJ6A 3KAJA 4M1KA 2PVPA 3U0BA 3MJEA 1NQVA 2C3UA 3I5AA 2E2WA 1CZUA 4NOLA 1T2DA 3DG9A 4FGZA 5FWNA 1W36C 2PFSA 1JR4A 1X38A 1Y3DE 3MCAA 3ANYB 1ZJ4A 3LSYA 4ME6A 4LBZA 1V3TA 1XZEA 3MIZA 4U3JB 3WFZA 4YROA 3KETA 4WLVA 1XROA 3G8DA 2JFHA 5REQB 1EJBA 3I45A 4TVKA 4C03A 1IBKB 1XQYA 4BX9A 1HETA 4JODA 1RC1A 3C24A 5BN3B 3QIAA 1FXWF 3OD1A 4E3ZA 2C59A 2ZYUX 2X0DA 3PJEA 4ZREA 3OZSA 5JXJA 1QNFA 2IHKA 1BGXT 3LPLA 3FPFA 1JG1A 2KBEA 3N2LA 1YB4A 4OTZA 1WD7A 3HY6A 2R6CA 2PUJA 3O94A 5B3JA 4MDYA 2ATVA 3BQ9A 4BVGA 4EG1A 4EAQA 2VK1A 2H2WA 2AFHE 3PC7A 2CN1A 5E95A 4LJ4A 4DJ5X 4CL8A 1G5IA 4KG7A 3WS7A 3A6PC 5ER9A 3DV2A 5A62A 1QVZA 2XRFA 2C4TA 3G0DA 5ECGC 4JFAA 3Q6IA 4GPTA 1WCWA 2Q07A 2QN2A 4RZUA 3ZTWA 1BS9A 4RBNA 1TLTA 4OHZA 5ULLA 3BAFA 3H7IA 4JOCA 3A7EA 4RVOA 5AKZA 3WBJA 2BEKA 2PZEA 3AFIA 3HGMA 4GI5A 1WOMA 1GAQA 3RQSA 1H0SA 5F7ZA 4LZLA 1XXHB 1FFHA 5HYVA 4MMYB 4KYVA 1XDBA 3PGJA 1YVEI 4HDAA 5F2NA 2GZDA 2GTIA 3L7KA 5HOEA 2JI7A 1G8SA 1DDIA 2HIHA 3CH7A 1C50A 3V2IA 4UUMA 4UUQA 3OCWA 3ZJ5A 5G4KA 3CZMA 4JI6B 5DTEA 1I7LA 1ZP6A 1W4LA 1HDYA 2FRXA 2R9VA 1P45A 3P52A 3A2LA 3SOZA 4RENA 4S24A 4QNMA 1XXHE 4CM8A 4ENPA 1FMFA 1UP4A 3LL4A 4DPMA 2ZI7A 1XAGA 2OCDA 1Z2DA 4URZR 1BDJA 4G56A 3BL5A 3IVRA 3OPXA 2H4FA 1K9SA 4AMUA 2YCLA 5IDXA 2Q7XA 1GQ2A 4ZVUA 3ZOKA 4BO9A 3D8SA 1RCUA 3A05A 3HE3A 4LHZA 2BZ1A 1PJ8A 1FUUA 1Z0IA 2Q6KA 3M33A 4U2FA 4XM0A 4XUEA 3UHPA 3AR4A 1GLVA 1Z39A 2WZDA 3HXPA 3GUYA 2XMSA 2WWXA 4UCWA 4YRSA 1PGPA 4YT5A 4AG6A 1CUJA 1X7ZB 3BICA 4WXMA 4A23A 4HK4A 3PIRA 1K6IA 3KJEA 4KFSA 4B45A 3A2KA 3AR3A 1QIFA 4W6QA 4RMIA 1TF7A 5KNBA 4WJKB 2VJAA 3LUCA 3TLYA 1S4QA 3UXHA 3HHPA 4YYZA 2A86A 4E1AA 1PBTA 3K30A 5DZSA 3DB1A 3WNCA 4AZSA 4DJTA 5GZ3A 5L53A 2Y4OA 2CYBA 1IOWA 2VH1A 4INOA 1OV4A 4JKYA 2QQFA 4R1UA 3M6VA 3WK7A 4GX2A 4XPIB 5IEBA 4CNQA 4F6RA 3PNPA 3HYCA 4PX2A 2DM6A 2MSNA 1H1TA 1HQKA 2JI6A 2J6IA 1CETA 4BLPA 5AP9A 2YQ5A 3KD3A 4Y2TA 4ZVSA 2BI8A 3UWPA 3PRYA 4HNTA 4IDQA 4HWTA 1ECLA 4KX3A 1WVGA 3UAGA 1SIOA 3KSAC 5KOHA 2I7VA 1G291 1COWA 4B3HA 3KU1A 3R1IA 4X1IA 1SO8A 1UOQA 4KMMA 1BYIA 2I33A 1NNLA 4Z99A 4LI3X 5DM0A 4N0MA 1DT5A 1CX9B 4QKQA 2IOFA 3ORHA 3UT6A 2QTGA 1FJXA 4HJRA 1YRHA 4M7WA 2G70A 2Y67A 1NNEA 4EW3A 3K6KA 3I9V6 1JR3A 2VSXA 4MV7A 2N75A 3O73A 4PX5A 2HW8A 1C1HA 1NRWA 3DP7A 4I1YA 3M4ZA 4WE3A 2XA9A 1HR0B 1P2BA 3FWZA 5IH3A 2WWHA 4U7FA 3R9XB 1EBFA 4NECA 1ZICA 4WESB 1F5SA 3ND6A 3EFBA 2XQIA 4ZC1A 5DI9A 1Z6AA 4C5AA 3D3WB 1PWXA 3B89A 3KJHA 16PKA 5K5EA 2CXRA 3SC6A 4FLFA 4YP9A 3IFSA 5F3DA 2G7MC 1N3LA 1R5JA 5IBQA 4BFXA 3F3YA 4A8JA 2ATIA 3V4SA 1IUPA 1NGSA 1ZUIA 4HUQA 1SCDA 3M70A 4NFYA 1QF6A 1N1EA 3DEHA 3UJ7A 5CX4A 1LBEA 3K6JA 3V7WA 1P9NA 2F9LA 3CF4G 4B4OA 2R5WA 4BOYA 1WSBA 3FJOA 4J03A 3VHRA 5BV7A 5IXSA 4V03A 3LCVB 3THWB 4DUGD 1M6NA 4KPUA 3SDZA 3ZIDA 4B3IA 4B5KA 1IBRA 1SHTX 4RHXA 3TNJA 4C0BA 1XJWA 1YR7A 1E2FA 1FYVA 2AGVA 4DWOA 1FFCA 1QLHA 3C5WP 3M6FA 3FMOB 5AWFC 4DLZA 2V3WA 5TQ2A 1VPVA 2Q4EA 4MHSA 3GL9A 2GX6A 2B20A 4UKDA 5AKKA 5IJ9B 3R0IA 5A1JA 4LXQA 1K5DA 2YKGA 4FOPA 1HDIA 2A33A 5LKRA 1JAZA 3PEYA 3VHLB 4XLZA 5HMLA 4LYHA 1GT6A 5J5VA 3BXGA 1FMJA 4JJIA 3BGIA 4EYSA 1T5LA 1LF0A 3OMLA 3HR4A 3PB3A 3PHCA 4M36A 1UPFA 1KJZA 5EA2A 1P1RA 4N48A 4O33A 3BXXA 3VR4D 2JGFA 4NHEA 2GD6A 1ODKA 4FE7A 1MG5A 1M2HA 3PA8A 2P9YA 1YC5A 1MB0A 3QNWA 1VE7A 1EFRA 2A9RA 3IVGA 1T3LA 1X70A 4OBWA 2HZ7A 2XD4A 3PDJA 2VYCA 1ZUHA 2EJUA 3VSAA 1J0AA 2JHPA 3AX6A 4K28A 2ZR8A 3JQAD 4ZRNA 3PWSA 4JZKA 3ZE8A 5IJXA 3K32A 1PS8A 1JA0A 1Q16A 1UJ5A 1U0JA 1Z0JA 2ECQA 4FCTA 1MDBA 2XZDA 2XLBA 3AUYA 4L5CA 3DE0X 3QVGB 4EL5A 2BLNA 1ICEA 4KIFA 5CLQA 1UBRS 4F93B 2PLRA 1DWQA 1J4AA 1QIMA 2WAOA 4AS3A 2NZXA 3HA3A 4FOSA 3BG5A 3EJWA 3G89A 4F0JA 4RZXA 3OJFA 1LBIA 2O54A 4S2UA 4IIXA 4NE2A 1F9EA 3A4LA 4ZVMA 1ZW1A 2ZJAA 3ESBA 3RRYA 2WMOB 4HR7A 3X43A 1QZTA 1ZIYA 4WHMA 2QTLA 3MTAA 3P0RA 4JSRA 2O2XA 5JVDA 5I6DA 3DT9A 2E21A 2A9JA 3NVMB 4RA9B 4CHTA 4BV9A 4GYWA 2PZGA 4B6QA 3PCRB 1Y3IA 3G82C 4PRLA 1JECA 1FRNA 4IDDA 4PX3A 1CQIA 2C84A 5I7EA 2WJ3A 4Q4LA 2WA1A 4HNGA 1Z22A 3QMMA 3VPBA 5IM5A 3HDGA 1USIA 3GEMA 3ZWDA 1C8LA 3UAOA 1ZXXA 1DWOA 3AW9A 1WB5A 4NV0A 4P34A 1WNFA 2FMHA 4QPNA 4BLSA 4W6ZA 1DX4A 1T0JB 5EMJA 3TQFA 3RS9A 4YJGA 4WXYB 2R8PA 1J8FA 3HXOA 4R31A 3T3GA 1GPLA 2CZQA 4OHMA 5JFGA 4QICA 2FQXA 4QBTA 1N5LA 4L1KA 5HMMA 2O52A 5L6MB 1K89A 1CRQA 4NCJA 5J4YA 2FMKA 3BL8A 3LUGA 3ORFA 4KMSA 2GXSA 3FTPA 3GV0A 3KR0A 3RRFA 2XUPA 4GMGA 3KJFA 4Q93A 4XWGA 4LTMA 2OBLA 1OREA 3Q6MA 4R1OA 5BNWA 3RAJA 3WLLA 1C9MA 3GJQA 2D1QA 2I7XA 4D45A 4R3WA 4CKCA 2C5SA 3LCJA 2ZWMA 1HFWA 2PL3A 4LJ5A 4CMAA 1QRSA 1U2QA 3FDZA 2IPMA 3LF1A 3DOCA 3Q1LA 1EDBA 4AJ4A 3C3CA 2GXQA 3ZXSA 2JG3A 3C3XA 2GEKA 1W47A 4E88A 4XRGA 2ILVA 3L8YA 4OMDA 4MITA 2ZTSA 1TYAE 1X1EA 1PJTA 1OX6A 1KHHA 4LC1A 3GFVA 4I50F 2AS0A 2EKLA 3A1NA 3L49A 5G0TA 3EAQA 4GS5A 4JBWA 1P1CA 2CXXA 4PN7A 4JOBA 1ZAKA 4FBLA 5K3SA 3RSGA 3WQSB 2WV7A 4MICA 4XQGA 4TTJA 4ARCA 4H6XA 2C4HA 4PBSA 1GA6A 4QLOA 3IT1A 1GUZA 2BKEA 1NSTA 1YJQA 1E66A 1SZJG 2FZWA 3DZIA 4TGLA 4L28A 3OEED 9MHTA 2YN0A 1CZLA 4KMRA 3RROA 3N7TA 3IA7A 3RT1A 3L9WA 4UM9D 1NG9A 3AU8A 4P5DA 2GI4A 4OFWA 3PNOA 1LPOA 2JFGA 2ZUWA 2P4UA 3BS4A 4NBNA 2N3ZA 3CRW1 5IWCA 1P0MA 5BSMA 2H2DA 4XVRA 1FP4B 4QM6A 2CKDA 1N8NA 3IUYA 4OEHA 4WZAB 1BS2A 1AS3A 3NPMA 4Z4GA 1H2YA 4ZJPA 1XTBA 4G3XA 5DNEA 3CT6A 4MWEA 4WDRA 3V7FA 2WM3A 4BVJA 3U19A 1I2ZA 1VXRA 2BT4A 2YX1A 2Y93A 2E49A 1P74A 1FS4A 1K7EB 2IF2A 3HCPA 2BFCA 3K5HA 3M4NA 1GQYA 1VLZA 3TDNA 3WKDA 4JP5A 3RVBA 2C9DA 2W6JA 1S1CA 4ALNA 1GDDA 3WXBA 4PR3A 2G5PA 1M2FA 3TQIA 1U7HA 2KW5A 2Q45A 1FYDA 4WZAE 2IC5A 2ZE8A 1U0HC 4X61A 4A91A 5C4IA 4ZHQB 5LU9A 2I6XA 1PBNA 2PA0A 2B2NA 4M8IA 3USZA 3DUFB 2ATEA 3L8CA 4K6MA 3U17A 3H3JA 3UT5A 1KJQA 4Q0MA 2VYFA 1G21B 1MJGA 1DINA 1I24A 1KU6A 3Q5EA 4CIVA 3K9HA 3O26A 2F8TA 1M6EX 3WLAA 3C39A 4HNAA 2XCQA 4QOFA 4L6IA 3FXAA 2P1RA 1UKYA 3OOEA 3FAKA 4Z8XA 1ORTA 5EQDA 2QAJA 2DC1A 2FPGB 2NTNA 2VTEA 3BXEA 3MPOA 5I9MA 3WP0A 3H0KA 4EJSB 2PMBA 1XJCA 4ZCSA 3UZUA 2CE7A 4ARZB 2JGRA 1KH3A 2YY6A 3CNEA 3PIIA 1EGHA 3S2IA 4FZ5A 5I9NA 1BWSA 1BQ3A 1I2BA 1I0IA 1J2EA 1ORDA 5U9CA 4P1ZA 5IM4F 4DQVA 1QB7A 1D7AA 3C48A 3LMKA 1WUYA 2QQ0A 2Q5JA 4ZQIA 3HCEA 2PHZA 3NWBA 3O4HA 1W85B 3HKCB 2FA9A 5KYGA 1UXGA 4JL8A 3V8VA 3VTZA 5JAIA 1NV8A 2B30A 2HMYB 2W9XA 1F8FA 2EEZA 1CJVC 3ZCUA 4JJ7A 1P61B 4XJTA 4MW2A 4A0QA 5AUPB 1YAJA 5DI3A 3MT8A 2QX4A 2QVGA 2VNKA 1K4MA 4P35A 4HAZA 4Q1BA 3TUJC 4BV3A 5AVXA 4W5TA 3RUCA 3H11B 3IP3A 4MHOA 1YQGA 3QFSA 3OP4A 5AVOA 4Q24A 3UJ6A 4II2A 4FGSA 621PA 1PD1A 2WNHA 4I1PA 4N8DA 3DMDA 5EMKA 3NHKA 3RVQA 2HGSA 4J3NA 3DCIA 3WTBA 2V1UA 1Q0HA 3HDTA 3JAWB 3DCJA 3IEKA 2IE8A 5CXXA 1S7CA 4GKVA 5HF8A 4YCMA 1PVOA 1BWQA 1QE3A 2EF0A 1QO0A 3GJRA 3ZDZB 4JP2A 3DXYA 4YP5A 1M2OA 3GG9A 5AI6A 3ZV6A 4KZPA 4A8HA 2IPNA 4YLYA 5CD9A 2EEPA 3T3PB 4WIAA 2COUA 4JV5B 3OLWA 2CYCA 4JBIA 3V1UA 4RHYA 2QPLA 5EWLA 2VHVA 4JYBA 5JAOA 1A8IA 4W7HA 3S1AB 4B83A 3UATA 4BO2A 5KTNA 3E48A 4NL4H 3LH5A 3I0MA 4UM9B 1RAHA 1N4AA 5KNDD 4BEJA 4NBWA 4U6SA 3GPLA 4MW5A 5AI4A 2P9ZA 4G5HA 5JT1A 8AT1A 3O8RA 4ZXPA 5SYNA 4YAEA 1QHNA 2RKOA 2DWOA 4B73A 2W90A 3RUEA 4IF6A 5MDHA 3J81A 4N8SA 3KQYA 2D8MA 2D4HA 5JNTA 1TF5A 1XRNA 3DL4A 1CY4A 3TXYA 5K6TA 4D6PA 2V74B 4N6OA 5A3VA 4ENTA 1FFDA 3E9MA 1Z5GA 2DT8A 2Z8YM 4MDHA 5KTYA 4X93A 5H81A 2WQ6A 4QEDA 4G24A 5BV1A 1NTOA 5CG1A 1NIPA 5P8WA 3VYUB 2QI9C 3A1WA 3GT0A 4FZ3A 1L5NA 3S40A 3COSA 2FN9A 3BMNB 3M82A 4C4TA 3VR2A 4AIIA 3HVJA 4PC3A 5K0ZA 1T15A 4G5GA 4ZGGA 2ZWIA 1H8EA 3AOEC 3AXSA 1GPWB 3HFRA 2H1WA 2GN9A 4O2LA 3ASZA 4D98A 2YZ2A 1B0UA 2P0YA 1E8MA 1NQXA 4ICIA 1PWHA 4JUAA 4XB2A 3GFQA 5EUMA 3SJZA 1HEIA 1VBKA 1T2FA 3VDXA 4R1NA 3LRTA 2JLWA 2KI5A 4FGKA 1J21A 3AKEA 4C7JA 2EYQA 1H2HA 3CGGA 1ZGBA 1AN9A 2J5BA 3EIFA 1P44A 1GQFA 1XMSA 2WF9A 2AI1A 2XUJA 2NO4A 3T6KA 4MTLA 4U3JA 4AP6A 1WSWA 2DTXA 2C9MA 1JAHA 2Q3CA 2RC6A 2H65A 3NATA 4HADA 4JC5A 5REQA 3ZWCA 5DNWA 1W36B 1C29B 4KYIB 1TW2A 3OWOA 5ALMA 5DU2A 1LGYA 3VPDA 5LFAA 2XCLA 5BN3A 3IUBA 5CVDA 1CB7A 1H0HA 4FI3F 3ZHCA 1QIDA 2Z2IA 4HD8A 4DBLE 3D7NA 4DHWA 1I5OA 2OWEA 4MPDA 4DWVA 5IF3A 2JF0A 3LUAA 1A9YA 4HGOA 4RHUA 4LRYA 1M1ZA 2NVBA 1EVKA 2FEKA 5EJMA 1WQ3A 4RH0A 5T4BA 2IFTA 2RGNA 3T4PA 1QCCA 4XAQA 2VJDA 1MGOA 2WYOA 3PEVA 2O6LA 4K2AA 4PYQA 1J1ZA 4X8HA 2WJWA 2X8LA 4IEEA 1H94A 1AV7A 4QQFA 3PDWA 1L7PA 2YFQA 2DY0A 1QKIA 1K8YB 4JASB 3NKVA 3PNMA 2DJ5A 4UAJA 4F46A 2GYUA 5EJGA 5DIZA 4W5OA 2VJNA 1CC1S 2SNIE 1W6UA 1ORVA 1KI3A 2B99A 2A7XA 4V0ME 3T3EA 1ZOSA 4OBEA 4PSDA 4QGHA 1TAHA 2AJTA 4LXXA 2ZS8A 5IMSA 1XXHA 1AHPA 1CT9A 2JA2A 1OGJA 3DGEC 3OCVA 1NE2A 4YAJA 4B6PA 2ZPAA 3VYWA 1U65A 4BWVA 1AKTA 1G41A 5ETJA 1O08A 3MQ2A 4ERNA 1F0YA 2WMYA 4G2NA 3PPWA 4M1ZA 5GGXA 2IYAA 4WY8A 2OECA 4I8XA 5C8VA 2BKAA 1F8UA 2ZSAA 4RLQA 4E6EA 2Q4DA 3L7CA 2Q6LA 3I9V1 2IS6A 3H1FA 4B7AA 3D4OA 3L1KA 4BNLA 2MSWA 3NYIA 2FZ4A 1NUQA 3ZZNA 2BJWA 1DT3A 3ELBA 1H5NA 2FMFA 3FHCB 1V9LA 3TS1A 1J9EA 1YNOA 3F5MA 4KHZA 3CUTA 4ZOEA 3HBNA 4D3FA 4D4HA 3X1YA 4HXEB 1SKQA 2QVXX 3C0KA 3KOUA 3DQZA 3L8MA 3Q41A 1Z5VA 1F14A 5AK0A 3SEAA 3SMVA 1VG8A 1KDYA 5A4MS 1I32A 1P29A 1RKXA 3A9WA 3VC2A 2X9GA 1MQAA 1GZVA 8ABPA 2PGNA 1X7ZA 3PBKA 1KY2A 5LWHA 2UZ3A 4B4KA 5JQGB 4EYQA 3GLIE 1T5HX 721PA 3RVJA 4LX0A 4PO3X 4IYJA 1E9RA 1WZUA 4DAOA 3ZUGA 4F04A 3HB4X 1QGOA 2B3TA 3HB0A 5JOQA 1PNOA 3E3LA 1ZMXA 5FUBA 3TPZA 2VXBA 2VDPB 3HLYA 2LXNA 3O0DA 4KRGA 3STYA 4B48A 5KYNA 5DCWA 2YV3A 4XPIA 1KGSA 1E4YA 4W9RA 4BNTA 2BGJA 4DKXA 4Z5XA 2NAPA 2QRJA 1V25A 2VHUA 3RQIA 1Z08A 4EDHA 3Q72A 3A25A 1FW6A 1MX3A 2JBAB 1DWUA 2PGDA 3KVVA 2RBEA 1J0CA 2ZIFA 3HV2A 2B8WA 5EWJB 3THSA 3ZHBA 4L4RA 4KI7A 4NMLA 1M2NA 5FLEX 4D97A 2I1LA 1U1IA 1ZPDA 4BLQA 3FTEA 2JKVA 1NYQA 4OHVA 2DWPA 4TTTS 1YSCA 2BCEA 4J49A 4F21A 2R44A 4DQXA 3QG5A 4LJSA 4MRRA 5AVTA 4WCDA 3ZU5A 5GPBA 2QM8A 4YVFA 3VH2A 4DV4B 1JBQA 3RAFC 3LXXA 4TWZA 4IAOA 2V58A 5F2OA 2GYYA 2NT4A 1QZXA 4DV1B 4KP7A 4ZO4A 2YHIB 5CJPA 5ICFA 1YJ5A 1R6AA 2OV1A 6ABPA 3BJIC 1WD5A 2ADFA 1VI6A 1RQPA 5E7QA 3AY0A 4JUBA 5ELXA 1RXUA 2WUGA 2ZJYA 1E96A 4L8VA 5GP1A 4A6EA 4B9EA 3R9XA 1FFEA 4YHBA 1NSFA 4Y2QA 4WESA 1MVLA 3MERA 4BO3A 2LZ0A 1BC5A 2M1XA 2ZRAA 3C5CA 3H8VA 1Y3CE 2ZJ5A 3NHBA 4M4SA 3D3WA 4UNIA 3PQFA 2E37A 1GTJ1 1V96A 3DBRB 5AI5A 3AU9A 3IKVA 2WWFA 3P0IA 5BXQC 5HIKA 4OXXA 1L5FA 1UADA 3W04A 3PUXA 5F7JA 4OK5A 3BWYA 1HA3A 3LCCA 4NPAA 1KJ8A 2XVMA 3DFMA 5E4TA 2EGHA 3TIXB 3SR4A 4BATA 4DJEC 4KK3A 2DPYA 2VKTA 1DIHA 1F4LA 3THWA 2PXXA 3QU9A 2I3AA 1J9ZA 4HI0E 4ECEA 1B2LA 1FLNA 4CMIB 5JNRA 3KYBA 1L3IA 1K97A 2CSUA 2P9BA 3IJRA 4MB6A 2ZULA 2VWGA 4JHXA 2OFWA 1R4AA 3CNOA 4IKOA 3QVMA 4NABA 3WIDA 2GQ0A 5K03A 3G5AA 1NRIA 1BA2A 3GH3A 4H1TA 2Z8ZA 5IJ9A 2A5LA 3COWA 1PR2A 1E1RD 4RIIA 3D6UA 2WUEA 3K2EA 5GVSA 1LI5A 3UB3A 2Q8QA 3AG5A 3L7JA 5CAEB 3ROPA 5SICE 3TQTA 4F2DA 4QXMA 4JUDX 3H1EA 1QMPA 4QQNA 3V8PA 4J43A 1Q83A 5MHTA 4LK2A 4DA7A 5GTDA 2O8BB 1W46A 3T7JA 2JAQA 1H1LB 1ZA2A 3JXEA 4C3ZA 4F3CA 3K7EA 4R0NA 3WYEA 1UBCA 2J32A 2BFFB 1DQZA 3UK6A 1P5FA 1Z7WA 3UF0A 3VM6A 4ZYLA 3B7WA 4YV0A 2IV2X 3ZQ4A 4BFYA 4D8XA 4ZMSA 1KI6B 2JRLA 5C9ZA 2QR5A 4DR4B 1QE0A 1W48A 3NHFA 4MR7B 5HE9A 3ZGNA 3WDSA 1E79D 1T5OA 5AI9A 2OD9A 4RO0A 3IX7A 3KS9A 4IDGA 4KYUA 4HRYA 4FDAA 5LLTA 1O89A 2A0YA 2FWRA 1CUBA 1W96A 3UJCA 1GTMA 3VFDA 5CT5A 1X7WB 3N1UA 2Q9UA 5FJIA 1SKBA 4UM8B 4GPAA 4WLNA 3V2GA 2VNHA 3QVGA 4OSEA 2J0SA 3JD3A 2FSGA 1M0TA 3M81A 5JSUA 4UU7A 4TWBA 3JQRA 4QUJA 3TD2A 4J75A 2A35A 2BWJA 4I3FA 4R2MA 2J3KA 4MGKR 4MW6A 1X1TA