1SCQA

K236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetonecyanohydrin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
b'AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHLLQLTKTKEIAEILQEVADTYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-acetone-cyanohydrin lyase
publication title Reaction mechanism of hydroxynitrile lyases of the alpha/beta-hydrolase superfamily: the three-dimensional structure of the transient enzyme-substrate complex certifies the crucial role of LYS236
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 92
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1scqA00
1DTEA 5ALFA 4I19A 3E1GA 2HU7A 4OYYA 3UUFA 2CJPA 1CUDA 1VZ3A 1E8NA 1ODCA 2XMRA 1DQZA 4LKOA 2WJ6A 2BGRA 3C6XA 3KD2A 4QDOA 4BDSA 5K5EA 1WCYA 1ZIYA 1QJ4A 4BZWA 1DWPA 5A6VA 2QMQA 5ALQA 3AINA 3WWOA 2QVBA 1XKLA 3JW8A 4LHEA 3AILA 4G4JA 4GBGA 5EIEA 3DYIA 1UKCA 4J0GA 1KU6A 4X71A 3W9UA 1XQYA 3FSGD 5LIPA 1ZI6A 2JEYA 2AJBA 4UHHA 2GYVA 3WWDA 2HA4A 1DU4A 4UHDA 4GECA 3IBTA 4C87A 1IZ7A 4NVRA 4ROTA 2OQVA 4BRSA 4NZZA 2O2IA 1XFDA 3WJ2A 1PV1A 1VOTA 3JWEA 3ZLTA 5I9IA 3LIIA 2JBWA 2I03A 1JU4A 4AO6A 1XLVA 1UOOA 3WWPA 1ZGBA 2XLCA 1LBSA 4X7BA 1J06A 4MEAA 3QPAA 4Y2JA 1UOPA 4QZVA 3I28A 4Y2PA 2CKMA 4X3CA 2EDAA 3H2HA 4GI1A 4Y2YA 1XZLA 2WIKA 1AMNA 1FJ2A 5AI6A 4GEGA 3M3DA 1XZFA 1LNSA 2QR5A 5JALA 5A71A 4QEKA 2LIPA 1T2NA 5AI9A 4Y2TA 1CUVA 4G8DA 2QT9A 3G0GA 3TRDA 3RM3A 3ICVA 5AK4A 3C5VA 2GYWA 2B9VA 2RGUA 3ZI7A 1EVEA 4HXEB 5AK3A 4Z49A 1ZI8A 1G42A 2WFZA 5LLSA 1JMKC 2BKLA 4AO8A 5EHXA 3NWOA 5E4YA 2OPHA 2QZPA 1WM1A 3HSSA 3I2IA 3QVMA 1U8EA 1UXOA 3EF3A 3AFIA 4U2FA 4V2IA 1XZDA 3A2MA 4P9NA 1QO7A 5JZBA 1JJBA 5A62A 3G9XA 2CEKA 1N5MA 3H04A 4FFWA 2DQZA 3E4DA 1ZJ5A 4B83A 2WIJA 5AM1A 2DSNA 4UFNA 5AJHA 4GW3A 3UMJA 1VLQA 2PBLA 1GGVA 4Y2UA 3U0VA 2WM2A 1XZBA 4QNNA 3H1BA 3QM1A 3Q0TA 4ARBA 4Q34A 3PUHA 1MAHA 3ESCA 5IVDA 5AKEA 5DTIA 4QDXA 4U2GA 4H7FA 2XQJA 3DEAA 3I2JA 3O95A 4WY5A 1QONA 3WL5A 1EB8A 4MWSA 4K6GA 4QDZA 4KE6A 1H23A 1QIHA 4B84A 3IB3A 1QOZA 1D07A 1XZHA 2WKWA 2XUGA 3DS8A 3MUOA 2WLSA 2C0QA 5K3EA 5EI5A 1A88A 4UBIA 2HA7A 3G0DA 4AN1A 2PSHA 4QE3A 4FNMA 2ORYA 3OPMA 1JFRA 1J1IA 1CUAA 4CG3A 3V1LA 2J4CA 2XQIA 1JT2A 5ALPA 3ZV7A 2HA0A 3R3ZA 4EZIA 4Q1VA 4BRZA 3W06A 1WPXA 1YASA 4UHFA 4UPDA 1F8UA 5HQ3B 4L0CA 1IUPA 3D4LA 3VVMA 3K2IA 2HU5A 3WIBA 4INZA 4U2CA 4KE7A 5HCUA 1G5FA 2OCIA 2GZRA 4W1PA 3LCRA 5LZ9A 5IVKA 3STTA 3WZMA 3GROA 4Y2RA 1A8UA 2O7VA 1CUHA 4PW0A 3CN7A 3Q8WA 1LZKA 1R9NA 1E8MA 3RK4A 2WFMA 2VT6A 3C87A 1CQZA 3DNMA 1K5PA 1YB7A 3D5EA 2WHRA 1AC5A 3WKAA 1NU6A 4PO3X 2XUFA 4Q82A 3I1YA 4EA6A 4A16A 3X3HA 2DCMA 4XWGA 4QDUA 2AJLI 1EHYA 5ALGA 5JD6A 3D7RA 1R50A 3H2KA 1USWA 4OB6A 4J7AA 4N8SA 5CH3A 2J4FA 5AKZA 3S8YA 3D2BA 3C5WP 1CUZA 5ALVA 4C89A 3WA6A 5KBYA 3BE8A 4ETWA 5DNWA 3WIOA 3FWHA 3A2NA 4K5QA 2HDWA 3JYHA 6YASA 2HA5A 3K6KA 5ALLA 1VXOA 2JIDA 2WFLB 5E4JA 3IUJA 1SCQA 1P0PA 5ALXA 1J2EA 3O9VA 1CPYA 4UBMA 5EFZA 1A8QA 1CVLA 4PSUA 4K6HA 1XRPA 3KSRA 5BWCA 2JF0A 4M0FA 3G0BA 1CUXA 1X2BA 4KAAA 5CT8A 3WK8A 3FYUC 5FP0A 3IDAA 4X00A 3RLIA 4UBJA 2ZYIA 3OG9A 3PFBA 4CFSA 5BWBA 4UUQA 2PUJA 2WHQA 5DJ5A 4H0CA 5FPQA 2VQ6A 5HQ3A 3O4JA 4Y7DA 2GBGA 3W9BA 2ACKA 2DQYA 4HTAA 1THGA 1WHTA 4KRXA 2XUKA 2VJAA 3QYJA 5JYCA 5LP1A 3PI6A 4X94A 3DKKA 1FFEA 4X97A 1TCCA 1AKNA 1DT5A 4GXNA 4XVCA 3SX4A 1KEZA 3DJYA 1W76A 4FDMA 1R3DA 1MN6A 4DMCA 5AOAA 3ESAA 4H7DA 5DTJA 4BVLA 4X6XA 1UKAA 4CI9A 1LPSA 3FLBA 2XT0A 1CUIA 5C8VA 4MXDA 4YX9A 2QXTA 4BBZA 5EHQA 4WFJA 4AN0A 2GBFA 1WPRA 1TCBA 1YA4A 4J0HA 1AGYA 2CUTA 3B12A 3VJMA 4IH9A 1ZIXA 5CW2A 4OB8A 5CURA 2H1IA 3FVTA 3N0TA 4CCYB 3C45A 4BP8A 1SFRA 3GFFA 1XZCA 1DWQA 2WU4A 4EY7A 2ZJ6A 4G5XA 4OYLA 3FSGA 5FV4A 2GBIA 1THTA 2BUAA 4UHBA 4DNQA 5CXXA 1BROA 3GUUA 2Z8ZA 2CZQA 4K6KA 2W6CX 3HABA 4AZ3A 4F21A 1M33A 3ANSA 1B6GA 3IULA 5FUMA 2BUBA 4ZI5A 3PF8A 4G8CA 3AUKA 1ZICA 2RONA 5CT9A 4CCWA 1CQWA 5ALNA 4ZV9A 4YPVA 1IVYA 3H1AA 2WSLA 2B4KA 2OCLA 4WDQA 2OXEA 1E3QA 5FRDA 3H18A 5LZ7A 1XLUA 1VA4A 2GBCA 3OC0A 5T4EA 2WIDA 1E89A 3H2JA 4WY8A 3PDCA 5JANA 2HRRA 2ZJ7A 3I1IA 1FFAA 1VE7A 2Z8XA 3SWWA 5AOBA 4OD0A 3M83A 1GPLA 1XRQA 2GZSA 5JD4A 3WQHA 4BE4A 2QTBA 1XRLA 3NGMA 2AJCA 1ETHA 2WUFA 5ALSA 1HQDA 2WILA 1AZWA 2EEPA 1EK2A 3GZJA 4AZ0A 1WOMA 2K2QB 1XLWA 3VISA 3GA7A 2HRQA 1Q0ZA 5CXUA 4UBKA 2BUCA 4IO0A 2XB6A 4IH4A 1YS1X 3FLEA 1C7JA 3TEJA 3G9UA 1UWCA 1X70A 4F60A 5DNUA 5EIAA 4UBOA 3U1TA 3RKSA 4AXBA 4QLAA 2XMSA 3ZLVA 1MO2A 1N5RA 4B81A 5JARA 4A23A 3D0KA 3IIIA 2QS9A 2WG1A 2QRUA 3B5EA 3G8YA 5ALDA 1EDDA 2QJWA 3I2HA 1ACJA 2CBGA 4U2BA 1CUCA 4BCBA 1A8SA 4BAZA 3RARA 7YASA 4C4XA 4MWTA 3DOIA 3K9BA 5DYTA 5A7FA 4X91A 4QDTA 1F0NA 3E0XA 2DHEA 3QITA 3ZWQA 4MJ3A 2XUJA 4P93A 1XZEA 1HBJA 3C43A 4P92A 5AKGA 1K4YA 1ZOIA 3R3XA 5JADA 1R4ZA 4P08A 2G63A 1EB9A 4DSZA 4JYMA 4XIIA 4W63A 4G9GA 1S8OA 1Q84A 1XZGA 2XMZA 3WYDA 4XX1A 2VJBA 2C58A 2I3DA 2PUHA 1GZ7A 2JGEA 5IH7A 2O7RA 2G5TA 3G02A 3LS2A 4ZWNA 4BATA 5DNVA 3W05A 4BTLA 2ONCA 4H7KA 3WK7A 4CIAA 3WK6A 5IVIA 4BAUA 1AQLA 5CT4A 1LLFA 3PE6A 3QMVA 4QWMA 4N8EA 4JUIA 2I78A 2C7BA 4F0JA 5IKXA 1ZD4A 3DQZA 1NU8A 2OAGA 4C6HA 4CG1A 4HXFB 1UOQA 4DMKA 3PF9A 1YAJA 2HL6A 5AK6A 4OUKX 2D0DA 4MEBA 2HA2A 1BS9A 2DFPA 1QZ3A 3OM8A 3WL6A 4N8DA 4LXIA 3G0IA 4WDRA 3KDAA 4GHWA 4B80A 1ACLA 2FJPA 1EINA 1XQXA 2QKYA 3F67A 1FFDA 3BL8A 4PF1A 2QOEA 4W1RA 4EY6A 5AI0A 2XDWA 4PSDA 2WHPB 2DHCA 1N1MA 2ZVDA 1CUBA 1CUGA 5JASA 4LXHA 5AH0A 3HZOA 3V1KA 1YA8A 5JATA 3F9CA 3A70A 4DNFA 1CUFA 2JGJA 4Y2XA 3WKDA 3VXKA 3NUZA 4DMFA 3ESBA 2PVSA 5CBKA 2J3QA 1P0IA 4ZRDA 4UFOA 4X93A 1UT6A 1L7QA 1ODTC 3FCYA 4G4GA 4AMYA 2IIVA 4HXGA 4OCZA 4L72A 4TPKA 3F8SA 3WLAA 3L1IA 4FKBA 2QM0A 2B20A 2OGTA 3VDXA 3FCXA 1FFCA 1BEEA 1N8SA 1XROA 3FLAA 3T52A 2Z3WA 4EY8A 4KEAA 1EI9A 2XUQA 1LBTA 1OILA 3CCBA 4B82A 1ZJ4A 5AKKA 1QIKA 4UFPA 3BF8A 5ALYA 5T4HA 4J3JA 3C6BA 3G9TA 2V96A 4DYHA 5LZ5A 4JNCA 5HFAA 4J0IA 2RI6A 1QIIA 1MNQA 5FDFA 5FPPA 5IVHA 5J3JA 2PSDA 4N5HX 5AP9A 3FOBA 2HA6A 2XUIA 1DT3A 2NW6A 5LZ4A 4B9EA 3WKEA 3BDVA 5ALTA 4FHZA 1I6WA 1AUOA 1B41A 1J07A 2XMCA 3HC7A 5JAHA 4B6GA 1VZ2A 2X76A 3UUEA 2VJDA 2YXPX 1KU0A 1WB5A 1P0MA 3VKFA 3O4IA 3IUNA 4B0PA 2G4LA 3IURA 4G8BA 2OGZA 3NOXA 4C01A 3O4GA 3BIXA 3T4UA 1QIFA 1CLEA 4QA9A 1SC9A 4AO7A 1XQWA 4BE9A 1W75A 4J0KA 1IUOA 5AKIA 4DNOA 4FLEA 2Z3ZA 3F98A 4FWBA 4HZGA 2XMGA 4MYDA 4Y9SA 4EB0A 3AIOA 1SOMA 5HF5A 3MGAA 3EQ7A 2W22A 5ALWA 3R3UA 3H17A 1ZD2P 4J03A 2PL5A 3MVEA 4BCDA 5HF6A 5AOCA 3QPCA 4WJLA 1QIMA 2OG1A 2XUHA 1W6RA 4OSEA 4B9AA 1XZKA 4H35A 1MX9A 3HLKA 4ZV7A 1CFJA 1P0QA 1LPBB 4H7HA 3STUA 1QFSA 1QIJA 4X6UA 5BOVA 1LPOA 2PPLA 1RWQA 1GPKA 1IUNA 5BV7A 2YASA 4ZREA 4E15A 1QFMA 5CT5A 4HRXA 2B61A 1GXSA 4X95A 1BEZA 5DWDA 4DM7A 1RYYA 2JGMA 1R1DA 4H77A 1ZD3A 4WCVA 1GPNA 3DCNA 3DD5A 4BYMA 1WHSA 4DTCA 4FOLA 1BRTA 2V97A 3CXUA 2WJ4A 3C6ZA 3ANTA 4CG2A 4KRYA 3MUNA 2H7CA 4H18A 1ZI9A 4BZZA 4KACA 4KE8A 5AIBA 4G1FA 2OAEA 2WIGA 3FAKA 1F0PA 4IQ4A 4LIPD 1XRRA 4KYVA 3W04A 5H3HA 1QTRA 3IA2A 2WUGA 3C8DA 4KE9A 2R11A 2BCEA 3G0CA 4ZXFA 1W52X 2HM7A 3AZQA 1Z68A 1T4MA 4RGYA 3WKCA 2WFLA 5ALJA 3M82A 3HACA 2HIHA 5SYNA 2PU5A 1Y7HA 2ECFA 3A6ZA 2XMQA 1XZIA 2BFNA 3I6YA 3AZPA 2BJHA 3H0CA 3STWA 2CB9A 1TRHA 1H2YA 1XZAA 5KWIA 1PJAA 1O6FA 4U2DA 1EVQA 5ISMA 5C8ZA 5LZ8A 3L1HA 2PSJA 3VJLA 2EDCA 2FUKA 2WTMA 2OGSA 2IITA 1CRLA 3M81A 3WI7A 2XLBA 4Q3LA 2RHTA 3V9AA 4B0OA 5ALEA 1A7UA 3STYA 4K2AA 3DKRA 4BVJA 5LZ2A 3R0VA 1YB6A 1MU0A 2VTVA 3WA7A 5LKAA 4I3FA 5I7UA 1YCDA 3HJUA 4EBBA 3I6ZA 4DGQA 3R3WA 1SCKA 2X8BA 2ROQA 3FNBA 2ZYRA 2C4HA 1MNAA 3R41A 2XUOA 3OTQA 2H7XA 3C8HA 4AMZA 4L3WA 2WUDA 3FVRA 5C7YA 1WB4A 4N5IX 2HU8A 4W1QA 3AIMA 5AM4A 1UZAA 4GDMA 4X92A 3QH4A 1GT6A 1VJ5A 1Q83A 3AZOA 5DYWA 4O08A 1DX6A 2ZJFA 1C4XA 3BF7A 3WL7A 1AX9A 1R9MA 2XQFA 4PQEA 2VT7A 4H7EA 4UBNA 1MT3A 3WL8A 3WWCA 3ICWA 5I8PA 2WJ3A 4GWLA 3KOOA 4CCYA 1BN7A 5AI8A 5JAOA 1EK1A 1GKKA 3V1NA 3AIKA 2E3JA 4HAIA 5AHXA 1CV2A 1UK8A 1EXWA 2BGNA 3WKBA 2OLEA 3G7NA 1SCIA 2Y1KA 4DIUA 4ITVA 4PV7A 1G66A 1CUUA 2WTNA 4QLOA 2Y2VA 3BJRA 3LIPA 4DLNA 1CUYA 1HPLA 3BXPA 3OOSA 2OCGA 3FBWA 2O2HA 4WFIA 5ALZA 1XZMA 5SYMA 2PU7A 1R88A 3PICA 1K63A 4BAGA 1U2EA 4W9RA 4BVKA 3KWJA 1EH5A 1GKLA 4JH0A 4C4YA 5K3BA 1UFOA 4E46A 3D2AA 2JEZA 5FOQA 1MJ5A 4EY4A 2GYUA 5K3DA 4U2EA 3I2FA 3I6MA 3FYUB 3G9ZA 1WB6A 4BB0A 3KWFA 1H2XA 2QJRA 4FTWA 2ZYSA 4J0CA 1H2ZA 1JMYA 4X85A 5D7BA 4NMWA 3L1JA 1JJFA 1DWOA 4RE5A 5JIBA 2I3ZA 5HF9A 3WJ1A 2VJCA 1QTIA 5FKJA 4EHBA 4Y2SA 1OXMA 5ALRA 1CUWA 1LPMA 1H2WA 2OQIA 3DL7A 3DYVA 1ISPA 2G5PA 2WQZA 2FX5A 2QUAA 1JI3A 4OPMA 2XUPA 3ZLUA 4X6YA 4RE6A 2VAVA 4BP9A 1QIGA 4PSCA 5KREA 1QIEA 1EDBA 2DHDA 1HDEA 4FFVA 3HYSA 1W1IA 2UZ0A 3R3YA 4DMHA 4AQDA 3OURA 3GELA 5F4ZA 1U4NA 2C5FA 4Q05A 2PKYX 3N2ZB 4BCCA 4TVKA 1TAHA 2AJDA 1YSCA 4NS4A 5K3FB 4FNGA 5JZSA 2PSFA 2CMFA 1TCAA 1CUJA 1YAHA 2JGKA 5HKAA 3R3VA 2H7YA 1VA5A 2XMDA 1ORWA 2VATA 3KXPA 1L7RA 2WG2A 1XZJA 3STVA 1EX9A 1LPNA 1ORVA 5EIHA 1MAAA 1K8QA 3GBSA 5JAPA 1E5TA 3VVLA 3BDIA 5EHZA 5DLPA 5HKBA 3EQ8A 1GQRA 1DQYA 1JKMA 1JJIA 2HFJA 5AIAA 1EDEA 1G4HA 5JD5A 4FLMA 3R40A 1BN6A 3FYUA 4C4ZA 4ARAA 4BC0A 5HFNA 4XJVA 4B85A 1QGED 5AI5A 4H7JA 5D3KA 2V98A 2Y6UA 2XMBA 3QMMA 1RP1A 5AM3A 3HI4A 3HXKA 2XI4A 4Q3KA 1Q0RA 2VAXA 3I2KA 3O4HA 3D2CA 2X5XA 1FSSA 2RIPA 4H7IA 3AJAA 1VE6A 1K6EA 5A7HA 1E8DA 4FBLA 5LKRA 2AXEA 3BWXA 1AURA 3VJKA 3EQ9A 4LYEA 1JU3A 4JYPA 3DOHA 2RAUA 3D59A 4DNPA 1UK6A 1BCSA 4KAJA 3HEAA 3CCCA 1BU8A 3IVMA 1QE3A 4QWWA 4IH1A 4A5SA 5ALMA 4EY5A 5JZ9A 3SK0A 3WK4A 2IX9A 5AKYA 2Q0XA 2J3DA 1X2EA 1FFBA 1DX4A 4F5ZA 3S2ZA 5AKHA 4UHEA 4MYSA 1YR2A 5AK5A 2PSEA 5K3FA 1LGYA 3BJMA 2Z5GA 1CUEA 1UKBA 5AKLA 4W1SA 5CH8A 3DDUA 2WG0A 2Y2UA 3BIWA 2RHWA 1HLGA 4OU5A 2P8SA 1UK7A 3PFCA 2C0PA 4J0DA 2WHPA 4WFKA 2BAGA 5CRIA 1MPXA 3I2GA 4G9EA 3IUMA 4LYDA 3O9MA 2HHAA 2WU3A 3WK5A 1XKTA 1ZD5A 5HK9A 2O2GA 1CIJA 3QZUA 1VKHA 2XUAA 1TK3A 5AM0A 4CIBA 2ACEA 2QUBA 1O6GA 1LPPA 4UHCA 3FYTA 4BTVA 3D3NA 5AI4A 5ESRA 5DYYA 2XUDA 1LZLA 3C70A 2YH2A 2D5LA 5K3CA 4JEIA 4RPCA 1XRMA 3C6YA 4BC1A 3EIOA 4FBMA 2XQKA 4AX4A 4MQLA 3F96A 5D6OA 5CH5A 4KAFA 1QO9A 3H2GA 3IUQA 2ZSIA 5D3ZA 4LXGA 5E4TA 3WMRA 5AM2A 4HRYA 4BDTA 3YASA 5AICA 2ZSHA 5CMLA 2YYSA 4YK7A 1F6WA 1TKRA 4IHAA 4YASA 2JGIA 5HK8A 5FLKA 3H2IA 1LPAB 3V1MA 1W4LA 3CN9A 1BE0A 5EGNA 1BCRA 5ALOA 2VSQA 2PX6A 1QIDA 2FJ0A 1OCEA 4HVTA 4Q3OA 5CTAA 2WUEA 3W2TA 2VA9A 3WK9A 1YS2X 3ESDA 3ZPXA 1Y37A 3P2MA 5HZGA 2ES4A 1ODSA 4EUSA 5JAUA 5FXMA 2HFKA 4KR0A 5AKJA 4KJXA 4OB7A 3QPDA 2V9ZA 2QXUA 5A2GA 3O0DA 3B3QA 3WYNA 4L9AA 3ILSA 5E2IA 2ZYHA 5HF8A 4FMPA 2OCKA 1U65A 3TJMA 5ALKA 4M0EA 1IMJA 3V48A 5C8XA 2WIFA 2AJ8A 2HADA 2HA3A 2Y6VA 4I4CA 5A7GA 5K3AA 2XE4A 4Y2VA 1HL7A 4PNZA 5ALIA 4TGLA 4UBLA 2JGFA 2VF2A 5AM5A 3H19A 1NX9A 3QBJA 5YASA 3E3AA 3WWEA 3ED1A 3F97A 2JGLA 3DLTA 1GQSA 4RNCA 4AB1A 1ZGCA 4FLFA 5ALHA 2DR0A 5EHNA 4ZGBA 1C7IA 1TIBA 4E14A 5LYYA 1TQHA 4GLBA 5AKXA 3DL4A 1VXRA 3HRHA 4G4IA 5CT6A 1E66A 4C88A 5KWJA 5T4BA 1IZ8A 4HS9A 3LP5A 4OU4A 1UK9A 3STXA 5ALUA 5AO9A 1DINA 4MQMA 4E11A 4J0JA 4M0MA 2PM8A 1MTZA 1XQVA 3SC2A 1XRNA 4X90A 3EBLA 2R8BA 1HKHA 1PFQA 1EA5A 2C5GA 1L7AA 3A2LA 3PUIA 3TGLA 4S0XA 4D9JA 1CR6A 1MX1A 4B7ZA 5T4FA 4DSAA 1CUSA 1H22A 1MX5A 3QMWA 2H9YA 3WZLA 1CEXA 3LLCA 1Y7IA 5C81A 2VEOA 2XQGA 4Y2QA 1QLWA
chains in the Genus database with same CATH superfamily
1WS6A 4LYYA 2WJHA 1M1UA 4HZUB 3INRA 3VNSA 1DTEA 3QEOA 1TVMA 3M4ZA 4KB5A 3PXBA 4HGOA 3JSAA 1Z28A 3ORRA 3ADKA 4X20B 1IWOA 1TUEA 2CJPA 4IMIB 5DBEX 1ZEMA 4JCOA 3ZY5A 1E8NA 3VH3A 1TF2A 2WVJA 4KDFA 3SR0A 4LZNA 1LH0A 4X45A 4NSNA 4TTPA 3V4ZA 2CV1A 3ZWBA 4X3PA 3LOPA 4BDSA 5K5EA 4DB2A 1WCYA 3EOZA 1G6KA 2WT8A 1RHUA 2ZTLA 2EFEB 3CZPA 1QE5A 3OPYB 4M49A 3W3ZB 1JAXA 3IQHX 4BO6A 2XNKA 3WQQA 1J33A 3WB2A 4ZC1A 2PGLA 3KWMA 3KJHA 4J1NA 1FS4A 4BZWA 1T10A 4QXOA 4JR0A 4MO2A 5FA5A 2QMQA 2A86A 4UOQA 1MB2A 2FGKA 1ZOPA 2R6AA 2ZQ5A 3P27A 2QQFA 3AR4A 5CHEA 4FHCA 2B4RO 1GQOA 2JFBA 4B79A 3U7GA 5JYDA 4ZU1X 3EY4A 1NOIA 1I01A 2GK3A 4LHEA 4C0HA 2QTCA 4PN3A 2QLBA 3RT1A 4I3GA 3X2FA 1JHUA 3ACBA 5GONB 2QX6A 2GH1A 2XAAA 5GPBA 4GBGA 1KU6A 1HLPA 1ZN8A 3LUHA 3I1JA 3ZTYA 1XQYA 2AR7A 4WADA 3MS2A 2EQAA 1V8ZA 3KDPA 2Y1GA 1XE3A 3NT5A 3Q7EA 4HP8A 3T3DA 2YWDA 1J2JA 3QLJA 2Z9CA 4AJIA 3SLGA 5F78A 1JR3D 1PJSA 3EGWA 1NSFA 1SBQA 3VU9B 3RSSA 1IZ7A 3MLBA 1TCUA 2O2CA 2X86A 1CEQA 2CNKA 4YRBA 4O5OA 1VOTA 5I3ZA 4OY3A 5I9IA 1JEYA 1U80A 3KTFA 4PRKA 3C5HA 2I2CA 2E6UX 4WEQA 1NPDA 1SVKA 1M2HA 2A4KA 2JVJA 1FYXA 3C1OA 4BEJA 4BV2A 3KETA 3OTHA 2I03A 1GADO 3ZWCA 4PPYA 1NN1A 3ASYA 3D8BA 3P4UA 1PI3A 1JU4A 3WHIA 3IODA 3WWPA 1YHZA 4RY0A 2XLCA 4WJKB 1TLFA 4FOSA 2ZB2A 4ND2A 4GGOA 3LAWA 2VI5A 3NX4A 3V3TA 2GAOA 3JWIA 3MGKA 1F2VA 1DMSA 1J06A 1U8FO 2XNHA 4PX5A 3K0EA 1RAAA 4BQEA 3LFUA 2DBVO 5IFKA 3VOAA 1AUQA 1GARA 4LW8A 4MEAA 3PJRA 1NY5A 1ESEA 4MQFA 3F3YA 1UOPA 4QZVA 2P0YA 4ZT5A 1JBKA 3I28A 4Y2PA 3T5DA 3M5DA 2ZUVA 2OFFA 4XLZA 2ICAA 3UAGA 1ZUNA 3MMNA 1F3LA 2X14A 4D44A 5BRNA 4K1XA 4DFDA 1VE3A 2VDLB 3T7AA 3WGZA 3H2HA 3O21A 1DRUA 1MTOA 1NUUA 2GF0A 4FCTA 4KQJA 4GI1A 4TTQA 3DQPA 5EJIA 2WIKA 5FLEX 1AMNA 1A04A 1GSIA 1W85B 3USCS 3ZZ1A 4EJ0A 3JS5A 2DZDA 2XOEA 4TKZA 5BN1A 1DKMA 1Z8DA 2UUPA 4YRPA 1P4SA 2SECE 3S3TA 2LIPA 2X0KA 4JEMA 2ZPTX 1AU9A 1G8FA 1V4VA 5AI9A 3ROEA 3CF4A 5LYJA 3WVNA 3R9XB 2MYPA 2MYUA 3GI1A 3E3MA 4I0WB 4JMLA 3TRDA 3UCXA 2SNIE 1P74A 2ZROA 2YXLA 4OOEA 1G6Q1 1YU6A 4GGPA 3H65A 2GPAA 5HMMA 1FBTA 2D7JA 4RVSA 4BMDA 4FB5A 1COWA 1TAGA 4FD3A 4QXQA 3LQQA 5JC1A 4FSHA 4JP1A 3L7YA 4PYOA 5H02A 4D45A 2YJNA 3GIWA 3ZYZA 5AK3A 2BZGA 2FPIB 5KSOA 1C7ZA 3GGOA 1H4QA 4WASA 2JAXA 5KSPA 4Z49A 3GD7A 4KWIA 3OE7D 1O08A 1QYWA 4M6WB 5FPHA 1PSWA 5H1YA 3NBZC 2BKLA 1Y34E 1J8MF 5E1BA 3FMGA 8ATCA 3DG9A 1ZLYA 2FWAA 4C5BA 2OPHA 2QZPA 3MTIA 1PSZA 3HSSA 4LDNA 4RPKA 1EFLA 2BFCB 4R2IA 1NKTA 1OJ7A 2I9PA 2HCRA 3BAZA 3ZDZB 1ZGJA 4YP5A 3O94A 4V2IA 1KOGA 2LRHA 1W9MA 2X58A 3HLTA 2P9FA 1B74A 3I53A 4M83A 4LBZA 4P9NA 3VU1A 4TRRA 4EKEA 5A62A 3EGCA 1RCTE 4IDQA 1D5CA 2PKQO 3G9XA 4MZDA 2C2ZA 5SZJA 1GKYA 1GSOA 2PYDA 2RGEA 4BV3A 1BE8A 4NBRA 1JDSA 1WUHS 3UT6A 1M73E 4Z4FA 2EWVA 4Y1RA 2RK3A 1ZJ5A 2A6PA 3BL6A 4IUDS 1U11A 2WIJA 4P5PA 2EGUA 2IXAA 1PBNA 4ALNA 2BHSA 4ZRMA 2DSNA 2P9TA 2PX2A 1FEZA 3KOUA 4LHZA 4I14A 2QYOA 5IEBA 1GPUA 1L1EA 1NQXA 1ZGHA 2NYVA 2VNHA 2ZSUA 5E1MA 1TM2A 3RF7A 3UWDA 4OXNA 5FUQA 1OWMA 4ZVRA 4Z86A 2WM2A 4EFKA 1T4CB 3S7TA 3CKYA 4JYBA 1DOHA 4RXMA 3HDHA 5CU7A 4ZJPA 3MTQA 3IQDB 2IF2A 5H3LA 1VB3A 2ONYA 4Q34A 3ZH2A 4MIYA 3CTMA 2G09A 3FOAA 5K7SA 3VO2A 5IVDA 2BBSA 3BHNA 2PBRA 1Z4LA 3BXFA 5AKEA 1XEFA 5LU8A 1ABFA 1BHSA 2XSZD 5DTIA 4HEJA 1KE2A 4U2GA 1J56A 1PJCA 1GGEA 4NXMB 5C7IO 2M9MA 3OPQA 3OTIA 3OX2A 4RVFA 4TWBA 4WTOA 4RSMA 3L18A 5DOVA 3I2JA 2O8DA 3O95A 2W2PA 4P5EA 1RABA 3L8FA 4MUYA 3K05A 4DCOA 4LJRA 2BELA 3QVGB 5KNLA 1FRNA 1EB8A 2J3LA 3QV2A 4MWSA 1MC4A 2Q41A 3NJRA 4RY8A 3X43A 4JBHA 4K6GA 4JBGA 5D86A 3V2HA 2FZVA 1C7FA 1PLLA 3IDQA 1XMOB 5TF0A 1Z6TA 4D6XA 4DUGA 2FW7A 3SJUA 4C9BA 3B1VA 4NRDA 2P4EA 1CE8A 3F1KA 3MTJA 4HGYA 2H57A 3WMWA 4B31A 1XZHA 4MV7A 2XUGA 2HO5A 1Q19A 2NZUG 5BV0A 1G5HA 2BR3A 1ZHOA 1ZSYA 4IQGA 3MUOA 2ONZA 4R8LA 3WFZA 2FR1A 3DDOA 4HFMA 5IZCA 2C0QA 2XZLA 1A88A 3LY7A 3WIVA 5GVSA 5CBPB 4O4IA 1A8PA 2E4AA 1XPJA 4MI6A 1RRKA 4F1WA 3E35A 5AJWA 2FFHA 2IGTA 1AVTA 1B8NA 2IQ5A 4AN1A 2EF1A 2G9NA 2P40A 1NMXA 2GPBA 3HU2A 3WLHA 1F5NA 1Y3DE 2CLEB 2I62A 4HNUA 3OPMA 5J40A 2WYOA 5IUJC 4FMDF 5K09A 2EX1A 2C2YA 2W0SA 4RENA 1YJQA 2VQEB 4FGWA 4CG3A 1QYXA 2PGDA 1AXGA 1UQTA 4MRNA 5J2TF 1BVRA 1TO2E 2X6QA 3DZGA 4LDZA 3OFKA 4Q1VA 3TH5A 1YJAA 3V5NA 5IT0A 1WPXA 1GITA 1YASA 2H08A 4HGZA 4PQGA 4UHFA 1IIBA 3IMFA 4FEYA 2PXHA 3N8HA 1DAPA 4L0CA 4QRHA 1IUPA 2KS6A 4IHJA 4RTLA 3PNKA 1B73A 2BMJA 4NBWA 4C0WA 5K6RA 3WIBA 3EDOA 1JL3A 3ANXA 3AY0A 3IDFA 4NS1A 4PTZA 7ABPA 4MCJA 5L3VA 4PO1A 5A4FS 5BR7A 5LJLA 1WHTB 1KP2A 1PT7A 2QX8A 4HLNA 4MA4A 5A3QA 4YJKA 5CNMA 3WS7A 1F06A 1FPMA 3G6WA 1LQUA 1FUKA 4JODA 1R64A 2Y4NA 6ADHA 3MJDA 4PFJA 2VPYA 4FJ0A 4P36A 4W1PA 3LCRA 4DBVO 2OZVA 3DC2A 3EDCA 1A7JA 2H16A 4LX0A 4ZVPA 1R6XA 3EQZA 4UAGA 3VUFA 2J3EA 2R7LA 5LN1A 1HDGO 1CUHA 2QN8A 4MH0R 2J7KA 4I8DA 1MXHA 5LMZA 1YRAA 3Q72A 1I4OA 2IKSA 2RHDA 1NG9A 3GLGE 1DEHA 1TZ2A 2OZLA 1BXKA 3EUEA 2R97A 3AV3A 3IVRA 5G1PA 2NV2B 1ZA2A 1R9NA 1GU1A 1HF3A 2W98A 4QUEA 2NZWA 4U39A 1ADYA 2Q3MA 5DPMA 1OYOA 1O8BA 1T43A 3IT3A 4QLBA 1GQYA 3K94A 1NVGA 1K5PA 1UT5A 2I2AA 1BXGB 1YB7A 2AG8A 2NV6A 1OOEA 3V4FA 5ENZA 3CM0A 4DWJA 4F86A 1E2NA 3GN2A 1NVBA 2FEOA 1BMFD 2GJ4A 2OM2A 1PGOA 5EJGA 3WO0A 1AC5A 2O2XA 4NENA 4GKJB 1NU6A 3ITEA 4ZYYA 4KFSA 1WR8A 2Z04A 1LK0A 2DPGA 4ZQHA 2UXCB 3FNEA 2ZBPA 4XB1A 2DFDA 3KYCB 3FHOA 3HBFA 4YONB 3B13B 1JEOA 3ND7A 4G85A 4BL5A 4CMGA 2EKZA 2GGSA 4XWGA 3W6NA 4DLUA 4GMHA 4M9UA 4J4TA 4ID9A 3FB4A 5TGTA 1ZMRA 3FJYA 3I34X 1HZZA 3REGA 4FWTA 2WMDA 5L51A 2QLTA 3K1AA 3T4XA 4EGQA 2W11A 3LW8A 3H2KA 4FZ3A 4U7PB 3G5LA 2F48A 1ZHHA 3OZVA 4MW9A 4OB6A 3VO1A 2IX3A 1EYZA 4ZHQA 1SKMA 1K3TA 4Y6PA 2HUPA 1R6AA 3KTDA 5K0EA 1QP8A 2WIAA 4J1QA 3EEIA 5AKZA 2J4FA 2XTJA 3NIGB 3D2BA 4LOKA 3GG2A 3AYXB 5ELLA 1ZEJA 2UUCB 1H6DA 4DGSA 4KK4A 1V5EA 1EKXA 1N2EA 5EQJB 1NVKA 5KYXA 1H66A 1R0KA 3B6IA 3NRBA 4ZI7F 1EG2A 4JDPA 1OMOA 5DNWA 4EENA 4DG5A 5IK2D 2EGGA 3G7SA 1RTTA 5EYPA 5AW1A 3EB9A 1T24A 1X1QA 2ZB7A 3OU2A 5JCJA 1CQIB 3NZEA 2NVUB 2GEVA 3MYYA 3OKCA 3K6KA 1PNVA 2B35A 4ZJYA 1IN5A 5ALLA 4OA5A 1TTTA 2JIDA 1QH0A 1OWNA 3IUJA 1SCQA 1F48A 1UM9A 1P0PA 2OKGA 3LW7A 3PJFA 2OGUA 2C5SA 3Q0IA 4G4SP 1IYZA 1GA4A 3GZNB 1HDCA 5BV8A 2VJKA 4YMLA 4TVOA 1ZVJA 3PC6A 1K6MA 4KOAA 1CJUC 1DAIA 1A8QA 2KX7A 4PSUA 4F3YA 3RUIA 5KWSA 2BFAA 5DWVA 3PFHA 4GP9A 1SRRA 3O03A 2PS3A 5BWCA 3L04A 3CF0A 1XDBA 1AKMA 2G0NA 3F9IA 1LJLA 1NNSA 1ESMA 5H68A 3SQLA 3UXEA 5J4VA 1PV4A 2V58A 1IBRA 5E2BA 4DLPA 2NMVA 4Z9XA 3OO0A 1LQTA 4EMUA 2JJMA 1UJMA 2EX0A 3NFYA 2JFHA 3ZU2A 1S3FA 3EDMA 1TA4A 1E61A 1NURA 5AW2A 1M0SA 3CPEA 4YWJA 5LD2B 5DI3A 4MGHA 4KX3A 3RJTA 3MT9A 3IDAA 2X9LA 2ZEJA 4TQAA 4ZKDA 4LQCA 4DIKA 4MRMA 2PX8A 4KXUA 2ZYIA 1HURA 1TYZA 3V1YA 2PUJA 3G89A 5DJ5A 2W4QA 4MQ4A 3HFGA 1UJNA 2PL9A 4H60A 4NDZA 4Y0NA 5FPQA 3UHAA 4CUZA 2VQ6A 4AMGA 1E9AA 4LDPA 1ULHA 3HB5X 4F2GA 4D0LB 2ZUBA 5JAQA 3G8AA 5DP1A 4CI0B 1RAHA 2CUKA 4OQ4A 2ODNA 1WULS 1XTVA 2BGWA 1YHNA 3H7IA 2XUKA 5FULA 5JYCA 1DIGA 2BEUA 2W2VA 4JVMA 2CVFA 3GDHA 1UINA 3HM2A 4X94A 3I9V6 1UP4A 1WA5A 5EUCA 4HFNA 2Q5EA 1F4PA 1J0EA 3IPXA 1S2LA 1M10A 1XWIA 1U8AA 4RANA 4JXJA 4RZIA 3QUSA 1NN3A 1NPYA 3ZXYA 5C2JB 2ZJYA 2J30A 4EBFA 1S8NA 4D9IA 5IZ4A 1QOQB 1RRFA 2VSYA 4RFVA 4OHWA 1M1XB 4FKZA 1MRZA 3EAGA 1R3DA 3OUTA 1XD9A 2ST1A 3R23A 3FWZA 4EPYA 3GT0A 3AXSA 3ENZA 4HH0A 3RU3A 4DMCA 5BR8B 1SHZA 1Z0DA 3OLCX 4NYIQ 3DVQX 4G63A 3H3JA 2QD2A 3ORYA 4LJ7A 5DTJA 3CGGA 2JIQA 2PV0A 3FTNA 3G1UA 4FFBA 4V0SA 2YNMC 3TINA 4BVHA 3ESXA 4BVLA 4IVQA 1DEOA 3GVXA 2C4VA 1BZYA 4BUZA 4MRSA 4CI9A 4Z51A 4D3ZA 1JV2B 2UZ3A 2XT0A 1W94A 5HS6A 2Q5FA 4QTUB 2JW5A 1C0EA 1NP7A 5CDGA 1M76A 3GRFA 4K0KB 2ZT5A 4S35A 1IM5A 4HRAA 3HB4X 2DYKA 2YXNA 4ND5A 3VVCA 4DV1B 2C7QA 1QVRA 1U3FA 3H4IA 2PLNA 4WFJA 5AHWA 5CYOA 4BU1A 5AVWA 2MR6A 4GXRA 3EQ2A 3RFUA 1OLSA 1TX4B 3D4PA 1RWXA 1P33A 2Q4DA 1MZVA 1HX7A 1X1DA 2MSLA 1R7RA 1Q0TA 1YA4A 1RHJA 1AGYA 3C8UA 3H5RA 1G4AE 2LKDA 1S8FA 2HF2A 4J0HA 2CUTA 1K2WA 1TQ2A 1LC3A 3FFAA 2ZS9A 1D3AA 3VJMA 4IH9A 4DF3A 1RI4A 2WJYA 4XR9A 3S4YA 4RVGA 1WJGA 3IXMA 3A7DA 4L4UA 1EVKA 1AN0A 4N1AA 1XRSB 1MHTA 5JH7F 2PUFA 2UYCA 5L7WA 2I4MA 1FP4B 1S2NA 3BMCB 3EFHA 1HDYA 1Q12A 3L8MA 3Q3IA 2VRBA 3HB0A 4BMYA 3V33A 1TM1E 3BL5A 5BVHB 2AYZA 2CMDA 5EG5A 2Q3JA 2WOOA 3O8RA 1DWQA 3GEPA 3IQIX 2P1ZA 1X1SA 3O3NB 4FW8A 3R7FA 4P0QB 4CWAA 1MDBA 1QHHB 2IDJA 2ZJ6A 4GIBA 1H2FA 3OOYA 4UE3S 1AMUA 1J5XA 4OYLA 1XCJA 3B8EA 1Z3IX 3AVXA 3E61A 2GTPA 3OM9A 1Y6GA 3IJRA 3P9IA 3R0XA 4P3OA 3V97A 2AFIE 1I8TA 1N9GA 3DM9B 1U1DA 4OHFA 1XA4A 2BUAA 1DIRA 1MQ8B 3SY8A 5I3CA 4UHBA 5CXXA 3A1SA 3TSZA 3WDMA 1E5VA 1EZ4A 4LNAA 1JR3A 2I8CA 1SCUB 5KDLA 1IONA 3W79A 4RJKA 4P7GA 5BN3A 2FMXA 2IZ1A 2O7SA 2ZQYA 3E9MA 3EIWA 2FR8A 5DIFA 3OOWA 2IP1A 2DETA 3SYNA 4ZDWA 4OXXA 1VJ0A 2GVZC 2AN4A 1WV0A 4JP5A 4K6KA 3AL0C 3RRXA 4O5AA 2CYAA 3ANSA 4ES6A 2QVLA 1ZONA 3LT2A 4ZI5A 2ET6A 4OFWA 1W44A 1Z0AA 4G8CA 5CT9A 2F1IA 2RONA 4UHKA 3ZCVA 5KMGA 1SBCA 3D6AA 4ZV9A 1U0FA 1CNFA 1A97A 4WCFC 3AB7A 4R16A 3I0NA 4WV3A 4CRWB 2WSLA 2JLXA 3TTSA 2B4KA 2GCOA 1PDOA 2P9QA 2G9UA 3NOQA 2CMHA 2J1LA 4MINA 1E3QA 3JQ8A 3H18A 3F8WA 4I6EA 2QRVB 3T3HA 1DI0A 4JJ6A 3PHIA 3ZWWA 1T29A 3FNGA 4A0FA 2CJWB 1B1CA 3AOEC 3LO8A 1YQWA 3BFJA 4TWIA 1NFFA 4K9KA 4M8LA 4ZPJA 2BRUC 3KPUA 2WIDA 1E89A 3SIXA 3F5SA 2X2FA 1GNVA 4J7UA 3U3MA 1LBHA 1P5HA 1Z7BA 2AG1A 4N3BA 1P2SA 3PDCA 4WY8A 3OETA 3SBXA 4DLTA 3H6KA 5JNSA 2ZZMA 3GGDA 4WOJA 2HSWA 3SX0A 1FFAA 4GT1A 5HZKA 4NJEB 4DRXB 1AB6A 4CKWB 2Z8XA 1ZJ6A 4XQ0A 4JHXA 4CGZA 5JS6A 1CXZA 1XEXA 4RHCA 4BY9E 1GPLA 2LXNA 3FFXA 2ZDQA 1T1SA 1NDQA 2FN9A 1X1TA 3OE5A 2JNWA 2BVNA 4GVXA 1ZVQA 2GZSA 4JN6B 4K40A 4ZI3A 5JD4A 2PT6A 3AI1A 3OQ6A 4NESA 1Z6YA 1GA6A 3U3XA 3PFKA 4MA5A 3SZUA 4ASUD 1LTHR 3DDNA 2B21A 2Y1EA 3TZQA 2WUFA 2VZLA 2ZYGA 4QO7A 4D8YA 4B2IA 2K7FA 5ALSA 2WP8J 4QEZA 3P0IA 2WTXA 1F2DA 1ZITA 2PYIA 1DC7A 1EE2A 1EK2A 4KQ2A 3SAJA 5KYNA 4G0WA 1KDZA 1YQ9A 5JJIA 4L51A 3MOIA 4BNLA 5ULLA 5LP6F 4GM4A 4DCJA 1WOMA 4LHWA 2JIMA 4NEGA 1XLWA 2PRKA 2KJQA 3ETDA 3SE7A 3HDVA 1L5MA 2YQZA 4G5HA 2Q5JA 1Q0ZA 4OBEA 4ER6A 3OE7A 3WJAA 1QM5A 5CXUA 2PUDA 1ZWLA 4PLFA 4R0NA 4NG4A 3ZDEA 4IDCA 4F85A 5EXPA 2C07A 3RJ9A 1YS1X 1JDTA 1PL7A 2R79A 2F90A 4A91A 1TT5B 3C5EA 1V3UA 1GTJ1 3R6TA 3EBOA 5DGHA 2J5BA 3G9UA 2CWDA 1OV6A 1GUAA 4RBNA 2Y9MB 2VAPA 3SR4A 4YRSA 4YUZA 3OZRA 4INPA 4N7BA 2OECA 3MSCA 4IIFA 3L7DA 4F60A 4DT1A 2LCQA 1FQKA 3HN6A 4EI9A 1BS1A 4YV2A 4IXWA 1M8FA 5CK5A 4RABA 5KQMA 1FIUA 1SBIA 3I9JA 4I5EA 2EW8A 4UBOA 3HJRA 3AR7A 4HPXB 4ARCA 1H2EA 4F5WA 1MB4A 3HCNA 4PSKA 3U7HB 3BA1A 4S2UA 2ZATA 3RKSA 5KYUB 1RXVA 4MQUA 2NU8B 3MNFA 1QH8B 3PZBA 4ZCPA 3GPLA 4E03A 2Y1FA 1EWKA 3EPPA 1S2GA 5TQVA 1M7BA 1O2DA 3UJDA 3WYCA 2Q5QA 4FE3A 2QMYA 4OHPA 5C18A 3KHUA 4I4LA 5K0JA 2V0GA 3ST7A 4A23A 2ZETA 4UM9B 1JKXA 2RGCA 2V7GA 1X7ZA 3IIIA 5FBWB 4CIXA 2BGGA 2WG1A 2BL4A 4CM4B 1Q95A 4M9RA 1ID1A 3CX6A 4LXYA 1TADA 1FMTA 1TK9A 1XTZA 4O4HB 2I67A 3KZNA 1FUUA 2H52A 3AERA 3FKQA 2VA8A 4FQ5A 4HDSB 2QJWA 3ZHOA 5KC8A 2FA9A 4MKFA 2BFWA 3Q7QA 4YUAA 3K6SB 4RPGA 1LX7A 1IK6A 5IWAB 3BMOA 1AIPA 2I99A 5CLGA 3HK2A 1VKOA 1I5OA 2I4IA 2HEGA 4JJ7A 4U2BA 3V8PA 2DPHA 1E2JA 2XSZA 3KXDA 4XOUA 2FWRA 2RHMA 1A8SA 1I0IA 3AONB 1U0NA 3BMNB 3KG2A 3FFBA 4GUAA 3GJSA 4ONEA 1TVEA 1UL1X 1B23P 2DJIA 1HSZA 1Z74A 4RDIA 1IHXA 4XX0B 4OHVA 1RI2A 3K9BA 2E4VA 1NUHA 1YOVB 4LKRA 5E6UB 3UBTA 1MENA 5DYTA 3UGQA 3AP2A 1C4KA 3LCCA 3VX4A 5EKDA 4XH9B 3ZE7A 3LVRE 4WLFA 1QCYA 3CYFA 4EG3A 5JSZB 1DVRA 2O8BB 4FM9A 2DHEA 5BSTA 3TQIA 3GLFA 4D4GA 3PHCA 5KCMA 1I4TD 1Q7RA 1O96B 3BPSA 2ZTHA 2P35A 2YOHA 5DK6A 2CL6X 5C5EA 2XUJA 1XZEA 2W4MA 4L9RA 1S0UA 1RI1A 2PX0A 5TR9A 5EEGA 3FNFA 4U5XA 5DH9A 3O8NA 5HM6A 5FNZA 9MHTA 4LJ8A 5BSVA 4I50F 2RHGB 3BN3A 2C2XA 2GASA 4HDRA 4MQBA 1Y7LA 5BSEA 2NYUA 3ZVLA 3R3XA 2J6IA 1Q7TA 4RYLA 2HHJA 1Y98A 4AK9A 2PANA 2G63A 1U0SY 2C5EA 4KQIA 4AZVA 3KB1A 4YUYA 3QFTA 4GOXA 2IVZA 4XIIA 1RQXA 3KPYA 4BNDA 1GVNB 1EJ2A 1GZ6A 2J85A 1XZGA 2FHPA 4NOMA 1KC3A 3TDNA 1NVXQ 1JVSA 4QX6A 4PSAA 2GPNA 2RKOA 4B43A 2H1RA 1L3IA 3P2KA 3P4XA 4HUQB 2B25A 2WTUA 2CCKA 5E3HA 2YHIA 2CNDA 3MQ4A 4I9FA 2WHYA 1XQ1A 1ZN7A 2PUHA 3BREA 4FUTA 4COKA 4D57A 8ADHA 1P19A 3VU8A 2QLLA 3TBKA 2DFVA 2O7RA 3E27A 3TW8A 1JH8A 1FVOA 4YT4A 5IH7A 4C2UA 2ZOSA 4LBYA 5B1DA 2VQ3A 2Q7DA 4Q37A 3RYFB 1YV9A 4MHTA 4BATA 3GJZA 4PZPA 1RQLA 2WPDD 1U8TA 3ZE6A 1NV9A 4XUDA 4FNOA 2ATVA 2ONCA 2JHFA 5FO0A 5IAAA 1X9HA 3BUSA 3WK7A 5C37A 4B8WA 3EA5A 3MBKA 1GNQA 2P9BA 3Q88A 5C31A 1OV4A 1K6XA 3WK6A 4BAUA 1N1GA 2GQ0A 2H1WA 2IEBA 4MWZA 4OQMA 3H7AA 5J4HA 4N8EA 4M1TA 1U94A 3N5KA 1KJZA 3EFBA 4D3FA 3FWPA 1XSEA 1IH8A 5ED0A 2OYRA 2I78A 4GPAA 4DWOA 4F0JA 3H1GA 4ED9A 1KYQA 3EDYA 1CR1A 1TM5E 4PG7A 4Y2HA 2GM9A 2XW6A 1JKJA 1HG1A 1XYVA 3AHCA 4O6VA 3TXAA 1EFRD 3EIEA 1EX1A 1J5PA 1VJ1A 4MP8A 1Q0PA 4HXFB 3OT1A 2XNCA 1W8DA 2Y1LA 3QF7A 3UHPA 4DA7A 3PF9A 2XH8A 3B48A 1Z83A 1N5OX 5F5XA 5KX5A 4Q9HA 2HL6A 4RFLA 4GSKA 1OKKD 3LVBA 3TCKA 2EW1A 3SLKA 1SCAA 1QFJA 1UMBA 3IAS6 2OV1A 2EU8A 2J0UA 1RZRD 2D0DA 1HO3A 1BS9A 4W5OA 3S44A 4C7OA 2FFQA 1YQQA 1YHYA 5HM8A 1QZ3A 3LPNA 4GKVA 1NKVA 3FHCB 4GSLA 1H93A 4OMFG 4F91B 1JG6A 2ZR9A 2AD1A 4HAWA 5HUJA 3CBGA 2AEFA 4N8DA 2OEPA 4LXIA 5JZOA 3TTXA 1YZQA 3CZ5A 2WA2A 1NF8A 3G0IA 3H8VA 3EHDA 4GH5A 4G89A 1XZ8A 2IHJA 3VR4A 5EY5B 4ARUA 1CBUA 4ZQGA 1EUDB 1ZDMA 2XF8A 1DAEA 2Q6VA 4KZKA 5JG7A 3RRJA 1OBCA 2DBYA 4B80A 1ACLA 1QHIA 4CL8A 4DLKA 3ZGZA 2FJPA 3F6YA 3M1LA 3UMGA 1EM8A 4EFDA 2F43B 2QKYA 3MELA 3D6VA 2I4LA 3JYQA 2QQGA 1E7SA 1FFDA 3UQYS 1G3MA 4AY6A 4K9LA 2VRNA 4JI2B 3MWGA 4Q7KA 4OK3A 1YFLA 4YB8A 1WZCA 1FNCA 1J99A 2CNNA 5ABPA 5TGZA 1O94D 1Y6QA 2QVGA 2QOEA 1WD7A 3HDGA 1TL7C 4KXQA 3SC4A 2QORA 4EEKA 4EY6A 1MEJA 4F4IA 1OFTA 3D0QA 1V26A 4LGVA 4BNGA 3K9QO 4FYYA 4IJKA 5I4BA 1NVFA 3NBYC 2G4CA 5CJ2A 1NMSA 1GGNA 4OL9A 1SXHA 3ZNPA 3AI3A 4MUKA 4CDNA 3SS9X 5KC9A 3QY9A 3KQKA 4KX5A 5GWXA 2O3UA 2YJ6A 3E22B 1CUBA 1JHAA 3M89A 1MFPA 2AMFA 3BTUA 4PZZA 4ZYTA 2D7CA 5BOSB 4D3SA 2I1WA 2WWHA 5HA5A 3VBEA 3TSAA 2UZAA 3IUBA 2D74A 4AYXA 3VJRA 2IEGA 2C7RA 4J16A 4JBXA 2VH1A 2XCSB 3HVJA 2XWPA 2ZIEA 3R2JA 3HZOA 1RLOA 4GX0A 1L4GA 2NM0A 4M37A 5KAMA 4GBJA 4REMA 4EKGA 4F7DA 4PQFA 3SHOA 4MVXA 4CUKA 4TMYA 3QBEA 5K8UA 3KKLA 1TGVA 1JH9A 2FJUA 3HMQA 1Y8QA 3E8XA 3X1ZA 4J1TA 3BJZA 2E55A 2FWIA 3GAFA 1JHDA 3MLEA 5G0TA 2IPNA 4YJHA 3CURA 3BH6A 3Q87B 1CNMA 1D4FA 3LC1O 3QG5A 4CIVA 3L5KA 3PFWO 4RJTA 3QXJA 4L1KA 4Y1GA 3RS2A 3UMCA 4WKCA 4X93A 1A27A 2AI2A 2FY8A 1H65A 3KR0A 3H9CA 4QG7A 2OZEA 4B40A 1Y9ZA 3K72B 5SZKB 1T9AA 4F2DA 2V6BA 5EESA 1E96A 2XXAA 4PAQA 3W8DA 2IIVA 2ZRLA 4HXGA 4L72A 1A2KC 1RP7A 1XVUA 1I9CA 3BIJA 3PQ2A 2A0XA 3NIFB 2P9JA 3F8SA 3PGJA 4HV4A 2WM8A 3UV7A 2H9AA 1RQ7A 2ERYA 3D3JA 4TV9A 3EWSA 3HYLA 4U8HA 1M2OA 2QM0A 4RA6B 1GTG1 5MGNA 2QG9A 3ETJA 5FTKA 4MS3B 2XD9A 1E62A 1IHOA 3FCXA 3QHAA 5K2MA 1ZK2A 4RJLA 3KB2A 4KN9S 3U37A 2Z3WA 4EY8A 1JXMA 1XTKA 1EI9A 3EUAA 1JEDA 5L9AA 4N40A 2QN9A 4WUVA 3DE7X 4CUJA 2OQ2A 3FETA 4Z4HA 3KQUA 1TC2A 3COZA 1B6RA 3ACDA 5AKKA 4PTLA 1VGQA 1H0HA 4DLAA 2QLJA 3UHFA 3OJCA 4AKIA 1SC1A 4AP5A 1A8IA 4J3JA 3A05A 3DTYA 9LDTA 2VP5A 2V96A 3AVOA 3G9TA 5BYJA 5EOVA 2XOKD 1PW5A 3V7UA 1PR2A 5LZ5A 1S9HA 5HFAA 5HJ5A 4NCBA 2A14A 1VKJA 2QPTA 1M1NB 1S7CA 2C61A 3TQRA 1E0SA 3HYRA 5MGBA 4CZ2A 2IUYA 1Y1LA 2R3SA 4EHAA 5HQJA 2EJTA 3CCFA 1SC6A 3HP4A 5AP9A 3GLIE 2H2DA 2HA6A 2O0JA 4Q4JB 2FPOA 2EATA 2QNIA 4AYTA 1E6WA 2IHKA 2E85A 2H8GA 2WJPA 5B1EA 2Y77A 4JXKA 3IS3A 1J0AA 4DPKA 4DWVA 4CEJB 4YRQA 3WKEA 2PGJA 4ENRA 1SIOA 2AI1A 3UT5B 3WAGA 2Y66A 1U9CA 4Q48A 2HF7A 3J81A 4FHZA 1SCJA 3BOSA 1X42A 2REQA 3H2BA 2WVGA 1V4BA 2I4NA 2FZ5A 4LDAA 5EKTA 4B75A 3ILYA 3KZMA 1GG5A 3H8SA 1JQJC 1LK5A 1YUNA 3ZOKA 4FYHA 1NBMD 1JX6A 3B1FA 1RRPA 3BGIA 4RMGA 4L0MA 5FA6A 3WV4A 5JAHA 3H1EA 3UUEA 1JWAB 1U0LA 4R2JA 2VJDA 3FBGA 3KJQA 3P94A 1O6BA 3O4IA 4B0PA 2RJOA 4F8JA 5HCNA 2WJIA 3HYTA 3C8ZA 2G4LA 2AN3A 4JUBA 2PQMA 3IMEA 5CM2Z 2O50A 3ETHA 3MM4A 2D2EA 3SZLA 4EOGA 5FTNA 4NHOA 2GD2A 2A5FA 2WE8A 1ZZGA 4YHBA 1WBDA 2KLHA 1BVUA 3B8HA 4TKUA 4FHGA 3NP9A 4C01A 3P45A 1RBMA 4BNHA 2CLIB 3J7TA 4B35A 2WTEA 1GWNA 1PUJA 4ABTA 3W2HA 3OQIB 1JR2A 5HUQA 4IG4A 3M6FA 1QLJA 3IP6A 4IKPA 3VO9A 1K4KA 3NTUA 2IODA 3VR4H 2IHTA 4H59A 1RYBA 1ZSVA 5T8KA 3LYAA 1TA0A 2MSDB 3J80A 2WICA 2PZGA 1K7FB 5K0FA 1FP6A 2E1PA 3HA3A 2W7TA 1IUOA 3PDIB 4A0HA 1BOOA 2P68A 1M74A 2XXBA 4MWCA 3T1VA 4BO5A 4DNOA 5IHPA 4PPFA 1G5TA 1C3OB 1X13A 3LRTA 1THZA 2W43A 4PPGA 1U1GA 2YUIA 2VVTA 1ZW6A 4GPEA 3EAQA 3TSOA 3K0SA 4K6OA 3F71A 4HZGA 4HWRA 1OXTA 4I66A 2PK3A 4RQBA 2RI1A 3CF4G 4NCXA 1TMOA 4Y9SA 4OXKA 4KGDA 1SOMA 4Y6LA 1OLXA 1MABA 2B6HA 2D2XA 4TYPA 5A5EA 3BWMA 4US2R 3N58A 4EG6A 2UVQA 4RORA 1FLVA 2ZUUA 5ALWA 2Q62A 3TOCA 1ZD1A 2CDNA 1P4JA 2BY4A 3F5QA 3H17A 5DSZA 3RRBA 1TZMA 3N86A 5LOVA 4KGXA 1PJLA 1YR9A 3DB2A 1Z4NA 2OZKA 3FNHA 1CY2A 1LC0A 3ADPA 4TOIA 4ZO9A 3SSNA 4AIIA 4YRAA 3THYB 3AVPA 3Q4GA 3ZGXA 5TF4A 4G4SO 2OG1A 4TRNA 3P20A 1KO4A 1ZK4A 3RQSA 4OSEA 4RK5A 3T54A 4Y0AA 1ABBA 4F6RB 4OG2A 3VNRA 1ZNYA 3IDOA 2WSMA 3QLTA 2FOIA 4JC5A 4B1FA 1US8B 4TQ9A 3T06B 2EOAA 1XZKA 5K0GA 4DV6B 5JAIA 3TI9A 2WT4A 5FX2A 2AC7A 3KT0A 2EG5A 3HLKA 4GD3Q 1PFGA 3AY7A 2E5FA 1P0QA 1LPBB 1OZHA 2IYVA 5A9TA 3MJRA 4KQHA 4ASUA 4X6UA 3ESQA 2CKDA 2X3YA 5BOVA 1M6VA 3FVWA 3A1CA 3IAUA 4LOAA 2J45A 4MAMA 1V5GA 4QJ5A 5CB0A 3TCXB 1DQRA 1S1MA 1I3KA 3PNVA 4IG9A 4JQZA 2XR1A 2R4TA 4U6NA 4FFMA 5T67A 3W7VA 1AUVA 2CE2X 1L4UA 4HRXA 5CT5A 4PBTA 3SIRA 2ZP1A 3PYMA 4ENSA 4XRGA 2REOA 1QVAA 4GBED 2ODQA 2QYTA 1KP3A 3CFYA 3V6MA 4IVNA 1X77A 5LDDC 1U8CB 4IOLA 2JL1A 1BEZA 1UBNA 2QRPA 5KTRA 4FYIA 4IWNA 3LC7O 1ZD8A 1K7CA 4NP6A 1RWBA 1IDOA 2H1SA 3Q40A 2PLWA 3B1WA 3KCNA 2R2GA 1C1DA 4DY6A 3DCNA 5H8WA 3EIUA 1L7PA 1ZRMA 3DD5A 3U49A 1KH1A 1H69A 3IXLA 1ZXBA 2BPOA 4FOLA 5BNWA 3PHBE 2V97A 3LNCA 2CVOA 2WJ4A 4TM7A 4X1KB 3PBKA 4PIPA 3WGTA 1ZRSA 1FOEB 3QVWA 5B6JA 3QY0A 1X8LA 1L5KA 1LI4A 1CW2B 5JXIA 1SBNE 2E4ZA 4H3HB 5E4FA 5AXAA 1KY4A 4CF6A 2ETVA 2H7CA 4RPLA 5DHQA 4BZZA 3E0QA 4DHWA 5CITA 1KK1A 4RD1A 3T3OA 1VRVA 1C30B 2I6SA 1M8GA 4NABA 3TLJA 4HLUA 2ZJ8A 3VRHA 2IZ6A 1XRRA 2HMYB 3GL9A 3D4OA 3PX3A 5IXJA 3ZWXA 4KYVA 5TARA 3PUJA 3W04A 1QQTA 5H3HA 3EFOA 2VUTA 1SUBA 2QRKA 1D04A 4J49A 1PL8A 1RE0A 1U2GA 2TMDA 2O59A 3ICOA 1KTIA 3ZE2B 2I66A 2R11A 4UUNA 3WYAA 4EA9A 4R0MA 3WE7A 1W581 3EUWA 2R5NA 3G0CA 1G20A 3B53X 5G0VA 1C1YA 4FXPA 4MRRA 3HCWA 1OTHA 1WP4A 2Q5OA 4OF4A 3AEKA 2HJGA 2WJZB 2XOXA 2OK8A 1FW6A 4MMZB 2P90A 3LLSA 4S0ZA 1CRQA 3TLEA 3BRQA 5G0WA 1JQ3A 1XWWA 2WFLA 4Z9BA 1I2CA 5ALJA 2H0QA 3AUTA 3HACA 3ZD9A 1BX1A 1U0EA 2KW5A 3DE6X 5SYNA 3EH2A 1UBSB 1PUXA 4NOKA 1O97C 4DQXA 3PEFA 1E3WA 3ZCUA 3TLGB 2ZXUA 3PX2A 2V8OA 3HXOA 2XMQA 5KVCA 1MVLA 5JRDS 1UCFA 3E18A 3IIEA 4P7FA 4GMKA 1YQXA 3UK0A 3H0CA 3GFSA 4C4PA 1SQFA 3O38A 4R7TA 2AMJA 1PG0A 2GZ3A 1QSGA 3M5WA 4FEGA 1I2BA 2VPQA 4DLSA 4K6MA 5KWIA 1HY3A 5EWJB 5FUBA 1AKQA 2XXJA 3IP1A 3K53A 3K8OE 4G25A 3ZXSA 4U2DA 4R5HA 2G25A 5IJWA 2C2MA 2X5KO 4GDFA 4XCVA 1OI3A 3I76A 1GUZA 1KFEB 1QAQA 5CX1A 3VJLA 1P4AA 3L0ZA 2XD4A 2C2OA 5KVVA 1DWUA 1OZGA 1GZ4A 1H3NA 2BJVA 2WTMA 3GRVA 4C14A 4G0YA 3H9JA 4K6CA 3REQB 1SULA 4M9CA 4ZAWA 4ZZ0A 1CRLA 5CFZA 1A9XA 2O5CA 2R5WA 1O4WA 2WE7A 4AZTA 3H11B 1SOAA 2XAUA 2CNWD 2VPXA 3WI7A 1WO8A 5GIOE 2OV3A 2Q6OA 2O06A 1NJ5A 2XIQA 3DZ8A 2XLBA 2O6LA 2RHTA 2ZULA 4RZXA 1T8SA 3D2LA 3RS5A 4B0OA 4BLVA 4V0KA 4MAFA 3D3WA 2JFFA 3CRW1 4I4TB 1DQNA 1FSGA 4J6EA 4QGAA 3UG7A 3VNUA 4HMOA 4EJSA 4J4BA 3OTGA 3ZY6A 2JJQA 3G5AA 4ETMA 2F8MA 5EJ5A 3PQ4A 1YB6A 1MU0A 2VTVA 2RKBA 4N3NA 4WNAB 5CW1A 3KQPA 1NBAA 1ML3A 5FYDA 5IM5A 5GJCA 4WESA 2G1JA 5I7UA 1ZINA 1BKDR 1RWMA 2IXTA 3OJFA 1KI2A 1T8WA 4RTOA 2LPMA 3D6HA 3ORHA 5G0SA 1NUAA 4D26A 4AI6A 4DGQA 1FYVA 2YUTA 4NDAA 5BY2A 1KJ8A 3QFHA 2FETA 4MB6A 4RDHA 2VJOA 3BXZA 3CMCO 4JI4B 1H0SA 1ZW1A 1PDWA 1V8BA 2WPDA 2X8BA 3RYHA 1CZKA 1U1FA 3U3KA 1W2GA 3R9IA 4PYNA 3TAXA 2XWBF 4XGKA 1DCMA 2C4HA 3MB5A 3ZI4A 4LI3X 1GAWA 3SVTA 1GUFA 1KK2A 3OTQA 4BGUA 3TQTA 1T3ZA 2WUDA 5LB4A 3MGBA 3M7IA 3OJEA 2BKEA 1WB4A 3QF4B 1EJ6A 4LC1A 4TMXA 3P7MA 5FA8A 1C41A 4YUVA 1JBEA 1V8OA 4DBLE 1JVBA 2WYUA 4DPMA 3I04M 3GY0A 1RXYA 2J6HA 3GFTA 1KZ6A 1XTJA 1NNEA 3FNIA 2C8VA 2UU9B 1UJCA 3ZNNA 4QU5A 4RHFA 1XTSA 4BNYA 3J81k 1ANKA 4NZMA 5G4LA 3V1TC 1VJ5A 1Q83A 2YY6A 4M8KA 2ZRFA 1EFRA 1Z5GA 1XEWY 4MMXB 1EP1B 1YU9A 3HKCA 3ZU3A 2EQ5A 2HLDD 4IQ0A 3RU2A 4O08A 1QORA 4I8IA 2WYVA 4ESEA 4HATA 1TM4E 4RPHA 4Z0TA 2N1BA 3F3SA 4NFLA 3DW3X 1BGWA 1DUSA 2A88A 1DTWA 1R9MA 2D0IA 3PVCA 4RFSA 2ZJ0A 2IZZA 2JFVA 3CTPA 3ZWDA 1RHMA 4EP1A 5C46F 2ENUA 3QEBZ 1OKKA 3ZOZA 4PQEA 3U56A 1BXRB 1QZTA 2M32A 3LTEA 4B7XA 1JEEA 1NOKA 4MS1B 4Z3KA 5CP8A 1EFHA 3DE0X 3GFGA 4GQBA 1RZRA 1MT3A 1NI4B 3T1OA 1U5AA 2QGZA 3EGVA 4H4DA 4WXHA 5DBHX 4YV1A 2MSCB 1X7WA 3WL8A 3ICWA 3OCUA 3W2EA 4EI8A 9ABPA 5I8PA 1E77A 4K9NA 4DABA 3LT5A 1EBFA 1TFUA 3CKKA 4GWLA 3KOOA 1CJVC 2OO5C 2GF9A 3JRWA 1U1IA 4E5PA 2W6JD 3ZD6A 3JQ7B 5JAOA 5LXTA 2G28A 1Y9JA 4CEHA 3PTLA 2E3JA 4QYXA 3BH7A 2C00A 5TVKA 1FDIA 1Z4QA 4PE5B 2DTEA 1A9YA 4RZQA 2P9HA 2OY0A 2P9ZA 4YJ2A 1EXWA 4MW1A 9GPBA 3QA3E 4PNEA 4I1UA 5BYAA 5H5JA 4G0QA 1AS3A 3K7EA 3AX6A 2NUTA 2EJWA 3DUFA 1R8SA 2ZVQX 3H4VA 3PV0A 3LWZA 1JF8A 4M21A 1P72A 4OKSA 1C9EA 2WAOA 4UAJA 5TQ0B 4S1OA 4BECA 5KPDA 4DIUA 1SXJD 4J75A 2DUWA 2IZ7A 3TOXA 3UXMA 2OFPA 4WZBA 1XP5A 1CUUA 3GCGA 3OA2A 2WAXA 1O94A 3QW2A 3RBAA 4J4HA 3RS7A 3DXZA 2EXXA 3TVYA 1MJGM 3EMKA 1Q7EA 2C95A 1L5RA 4EFNA 3T1TA 2KSQA 3TE6A 4YYZA 3R5JA 4O3MA 3BXPA 3A1FA 1N2ZA 2F9FA 4IUCS 3F5FA 2A1TS 4MV4A 3OJWA 4QFCA 1L8LA 4YA6A 1EFPB 3FBWA 4R3WA 4V0OA 5CM9C 2OXCA 1PE0A 1EK0A 1VHWA 4EB6A 5GZ3A 3TUZC 1E9RA 2FF5A 2R7AA 5EXXA 3PEYA 2RJNA 3EDRA 2EZ9A 2MSEB 3KOWA 3V2IA 1VLLA 3G5UA 3P5BA 1N8NA 5JPCA 4MUIA 3QFFA 2CLOB 4JS0A 3EGDA 5SYMA 3VC3A 4ZMSA 2BTEA 2PU7A 3OLWA 3N7AA 4IIJF 4RD6A 1R88A 3OH8A 3CZAA 4TMKA 2FB9A 4ZEMA 1O95C 3A0UA 2ATIA 3G2LA 1QB7A 1JR4A 1RLIA 1HEUA 4O3FA 2GCNA 4RX1A 1QUEA 1GR0A 2AKAB 1AHHA 1V4NA 2PIAA 3N2KA 4GU5A 5DCYA 3AFNA 4ZVOA 1SCBA 1W0JD 1JIUA 1SH7A 3JYNA 4FYPA 2WHEA 4DCVA 2R8PA 4O4IB 1GKLA 3QLUC 4NZOA 1KVSA 2FHSA 2POCA 5U9CA 4NPAA 5FTJA 2Z5VA 3DMDA 5LBTA 5FOQA 2EZTA 2FMKA 2HDOA 2RH4A 1G21E 2ZYAA 1E1LA 1RR6A 2JA2A 4EG7A 3PC8C 4O2AA 3N7TA 2XA1A 3ENKA 3P71T 4EY4A 3K5PA 4DCPA 4K9MA 5EIBC 3QKWA 4U2EA 4LF8B 1VMIA 5EGSA 3I6MA 2IYSA 3FYUB 3IIKA 3QVJA 3ZY2A 4DXAA 1QPGA 3C3WA 1WDLA 3ELWA 4HPJB 3S2GA 3U80A 3U3ZA 4ER0A 1YNOA 3HSYA 1M7GA 4XOIA 2BBOA 1ZCAA 2H9IA 1IBCA 3HKBB 1QBGA 1MAUA 1ZMOA 4R83A 4WCDA 3ZS9A 1T1GA 3A4MA 4IHJB 1Y82A 1K7YA 5CFQA 3BGVA 2FRDC 3K2EA 3VOBA 2WWWA 1GFZA 3TUIC 4KHZA 1OREA 1XMPA 3EYAA 4K28A 3JPWA 1AO3A 2HLNA 4OK5A 1YDFA 3GJXC 4ZN6A 5IBCA 4CU5A 2ZSKA 1MC1A 1R0CA 4H7PA 3SDZA 2IEYA 1N7IA 1XCMA 2EJUA 5HVNA 4YCJA 2JBAB 4OM8A 2YWHA 3NTXA 2UZIR 2AXPA 4HDQB 1A82A 5JIBA 3HB1A 3NHYA 5HF9A 3GDOA 3WJ1A 4S04A 3CR8A 3QPWA 1UJ5A 1N25A 2VJCA 1QTIA 4G0XA 5FO1A 3RS0A 5FKJA 5DNEA 3UTCA 1GLNA 4DCSA 1W4CA 1E1CB 3RT9A 3DR3A 1VG1A 4EHBA 2LDXA 3DAGA 4UDXX 3S2YA 3ZG6A 1MVOA 1T6NA 2QMOA 5C5CA 4B6FA 5J2UB 1AS2A 2OZLB 1VCOA 2EF0A 2GJ8A 5F73A 1DKPA 5F1OA 3PHJA 5AVRA 1DELA 1P6UA 4MZXA 3NXKA 3A6HA 1Z5OA 4G09A 3RB8A 3ZS8A 3G0HA 4BU0A 4IIVA 3FPBA 4OHBA 2XOKA 3CT4A 5THKA 3EVNA 4X6YA 3D02A 1H05A 1DKOA 5IDYA 3ZQ4A 4X64B 1EIWA 1FFGA 4CQNA 3QKSB 2B2NA 1W5AA 1A2QA 1QIEA 2J07A 2HNKA 2I29A 3GG9A 4U3JA 3RUAA 3A7EA 2FFBA 1K7XB 4WVFA 4URXR 2OKCA 3IQFA 1GPWB 4LZWA 5KPJA 2D6FA 5EZYA 2VFAA 5LU9A 1X86B 2QAIA 4M2LA 2G3YA 2OHIA 5DASA 3HCOA 4KQ6A 3LUPA 2QW1A 4AQDA 3OURA 3G6KA 5FWXA 2C9CA 1V41E 3GELA 5F4ZA 2DT5A 2C5FA 1EJ0A 2NU6A 3AR3A 3LWDA 3N2ZB 1ST2A 5ADWA 1G8AA 1TO6A 2ORIA 4LXXA 1GGMA 4BCCA 5IWCA 1FNSA 1P2VA 2GARA 3A1EA 1R00A 2X4GA 3AF5A 1MUUA 4K0RA 5L3ZA 7GPBA 3A4TA 5K3FB 2JPDA 1RM5A 1QCCA 2EVWX 4KIWA 4M1MA 4MVJD 2PSFA 2CMFA 1NBMA 4HDCA 1QKKA 1U9YA 2WWGA 1TU0A 3NJ8A 3RGWS 4RTRA 1IEVA 1FYEA 2ANBA 2HXGA 3PJEA 3T0GA 3KJFA 4CCAA 2Z6UA 2O48X 1SA0A 4LJYA 1Z47A 3VYTB 2BSAA 5K8TA 2NZYA 4EI2A 1N2XA 3EPJA 1C9MA 2C0CA 2QP4A 1ES9A 1VJTA 1HT3A 4X9XA 1G8PA 2O1XA 3DEHA 1H1LA 1EG7A 1TO1E 1NUQA 2D3TA 3LQFA 4IDOA 4IHQA 1BDIA 2DR3A 1L7RA 3NHJA 1NRIA 2C8KA 3L0OA 2H59A 3ODGA 4MPPA 3TIIA 5JTTA 4M53A 5AHKA 2Y99A 2G5CA 3Q7IA 4J94A 3STVA 1DEXA 1Z56C 3MMXA 1NN5A 1P1IA 2ZKLA 2ZTUA 1VLJA 2XE6A 5GV7A 2Z2YA 5B30A 3T9BA 5EIHA 2I6QA 3KAQA 5BUSA 2D06A 1K8QA 4KQGA 3GLGB 3MT8A 1RRCA 4UTZA 2FKAA 1PBTA 1KFCB 4L5BA 4R31A 4LMRA 5CLJA 5F1KA 4NOJA 1UM9B 4HGNA 3TVDA 3EXIB 5JAPA 1UPFA 3WHKA 2J5XA 1L5NA 3VSEA 1JKFA 2ORED 1OAOC 2GPWA 3FUCA 3L07A 2RK6A 3W90A 3Q41A 3OVMA 4R1LA 4BVAA 1A8HA 1LVGA 2O7QA 3GQVA 2EJCA 2PA3A 3DBHA 2YHAA 3PB3A 1G9SA 3FWNA 3G7UA 3R5FA 4RU1A 4BWYA 5DXAA 3L8EA 3DWGA 1GUDA 1PGPA 2A30A 5BVGA 4BE7B 2HIGA 4C78A 3PQ8A 2N75A 2XGOA 1N77A 1EA7A 1QGOA 2HFJA 3JQPA 1RQGA 5DK4A 2J08A 2PD4A 5G1NA 4DM3A 1SUDA 3RABA 1T0PA 4WECA 5JD5A 5DEOA 2A8YA 4IDDA 3PYLA 5BMVB 4ZOLA 3R40A 4D8TA 1UBHS 5DI3B 3MGCA 1NF9A 1PWYE 2EIXA 2ZRBA 5HP4A 1Y9DA 2OLKA 3K9CA 4YYEA 4EDFA 3ICEA 2XWSA 6PFKA 4ZICA 4IV0A 1Z5WA 1ORRA 1F14A 3AR9A 1PJ8A 4YECA 2P3LA 4IIBA 3RSCA 1QLHA 5ITVA 3B36A 3QPVA 4GS5A 4HJRA 1P1CA 3CVJA 1JAZA 3P9CA 1UBJS 4JEUA 1FW8A 5CGZA 5HE9A 3GPIA 1Y48E 2DC1A 2IY9A 1TTQB 2IW1A 1AF4A 1II8B 1G5QA 3LUCA 4H7JA 4K9RA 2ACWA 4ZCQA 2V98A 2RB5A 1XN4A 3N8GA 4IIXA 4JY7A 5H9WA 3QMMA 1EQAA 2NXEA 1J8YF 3DMRA 3ER6A 5TMBA 4CM3A 4CNQA 5AM3A 4DCTA 3L82B 3WL4A 2FEMA 3CONA 3VZDA 4YMUA 1ZXLA 3N6VA 1S4MA 1P2BA 1J0BA 1HK7A 1IB6A 3L8ZA 3LHSA 3U4DA 1DO8A 5A6SA 3I2KA 1C1HA 1Y5NA 3GMDA 3ZCTA 4U6SA 4AIRA 1XV5A 2O2DA 4IWYA 2ZJ4A 3IIMA 3OBIA 3U4IA 5LP6C 3UC5A 5KB3A 3AJAA 2OOSA 1Q50A 5CX4A 1Z7GA 1A9PA 4A1OA 2A9RA 2I7VA 4N7JA 3ULKA 1AURA 3BB4A 3VJKA 1BCRB 3L8HA 3EQ9A 4CLDA 2O3RA 3QU5A 1GG8A 3R8CA 1G7CA 1TYEB 2YR0A 5JD3A 4HUTA 5JQWA 4EW6A 2WDZA 1Z82A 1NBEA 2CDRA 1JLLA 5TQ2A 6LDHA 1BDBA 3DOHA 2RAUA 3G79A 4BO1A 1XLTA 6GPBA 1YL5A 1BCSA 5EMKA 3CCCA 3N2EA 3JATA 4WNYA 1VCNA 3IVMA 3JD4A 4XWAA 2C7PA 3K09A 1QE3A 2CHQA 1HZJA 1ESCA 5ITZA 2RAPA 1SR8A 1CEYA 1KI9A 2GSWA 3R74A 3PPXA 3IILA 4B87A 5CCBA 4ARIA 4PFKA 4H1TA 4LNUA 4UVIA 4KFCA 3ZVRA 3O2SB 5KYWB 4U00A 3FA2A 2W6OA 2FZEA 3NH9A 2ZM6B 2COUA 2IYEA 3OQHA 4TQUS 2R00C 4IL5A 2HW8A 2HC9A 3DP9A 4B76A 1GP2A 5K0LA 5IYZA 2NSDA 4K7JA 2ZJ3A 3UANA 4F92B 4WZAB 1I3NA 1RHQA 5E2AA 4BLSA 1XNHA 4MRPA 5HRCA 3U6BA 5G4KA 1WX1A 1OXBB 2SICE 1OLSB 3CF2A 1N2JA 1NVVR 1MOSA 2BKXA 2QQ0A 2XRMA 4NJMA 4IJUA 1XTIA 1RAEA 1LGYA 1MOPA 1KFJB 5J59A 2G0TA 4EKIA 4FR2A 5LR6A 1U63A 1ZUWA 4YQFA 1J70A 2Y0DA 4LF7B 3LJKA 1F5SA 4V2UA 1XBTA 3JVEA 4W1SA 5JJBA 3LBFA 1EFAA 1YS9A 1SEVA 1Z75A 2Q1YA 1B0PA 1NA5A 2IKQA 2YOFA 3BIWA 4QASA 1UOEA 2IYQA 5EWLB 3QVLA 4GYJA 1IAVA 4B3FX 2X41A 2WSYB 2GCEA 4CM5A 4DQVA 1NQUA 2J3KA 1NJSA 1UK7A 4ZO7A 3GFBA 4P58A 3R0ZA 4RF4A 2LW7A 1QRAA 4WFKA 4WI1A 4DUPA 5FH9A 4FW9A 2C7OA 1LCIA 1MPXA 2PUVA 2GN1A 3I2GA 1T36B 3O3CA 1IHUA 4G9EA 2IH4A 4YXFA 3LDUA 5HE8A 2B5WA 4E2XA 2XGMA 1JI0A 1TEXA 3FPFA 3CLKA 4HEHA 2H5JA 3C3EA 2J9FA 1I7SB 3QJYA 5LMCA 4RLHA 2VNKA 1BGXT 3MLAA 1VIDA 2WI8A 2O7NA 1A76A 2R60A 1RWWA 4X24A 2CCGA 1NL3A 3NAZA 3K70B 1VL1A 3ICCA 4AECA 4DKJA 1N9GB 1M8JA 2R6DA 2XUAA 1NZFA 4K1LA 4ARSA 4KOEC 3ICQB 2VOJA 1UBLS 3CUEF 3AIIA 4RH0A 3GJRA 4TUYB 4J91A 5FBKA 4DL9A 1Q44A 5AM0A 2B94A 5EPUA 4JZYA 5ESDA 1NVDA 3U09A 4Q47A 4XM2A 2E82A 4XQEA 1DX9A 1O6GA 2O0KA 2R7KA 3EYWA 1LPPA 3KQWA 3MSXA 3FYTA 3MWFA 4H0FA 4ND4A 4UHCA 2NTEA 3X1WA 4BTVA 5CA1F 1Y5MA 5K4GA 3EPRA 1G8MA 3QFSA 3GAAA 5D3QA 4U8GA 2XUDA 3A6JA 1ESNA 1LZLA 1V5IA 1KI6A 4FGSA 2PUGA 4TLLB 1Q11A 3LBNA 121PA 4BNIA 1K7SN 2R66A 4FHEA 4GICA 5K3CA 5KMGB 2CNWA 3QEMA 4ZRNA 4RPCA 1XRMA 3PWSA 3TL3A 4EUNA 3H87A 1F7UA 4CCSA 4TVBA 1U8XX 4FBMA 5K0BA 4B6SA 3JQ8B 1L4LA 2GM3A 3R7BA 1X1AA 3GUZA 1HDZA 1FSZA 2NAPA 2CSUA 4MQLA 3CVOA 4LYAA 2VWGA 3ZGLA 5D6OA 3EVGA 5CH5A 3LOQA 3O93A 2VF8A 4LYHA 4KAFA 2H4XA 3WLTA 2UV8A 2BFFA 5LA6A 2I4RA 2GWHA 4ECAA 4MGKR 4R8RA 3ZVNA 3HWSA 1ZJZA 1M66A 2PO7A 4QJIA 3A11A 4R2KA 5KZMB 1YB1A 2W8BA 1M3SA 3JARB 3O2JA 4JCCA 1I94B 4QXAA 3GEDA 1RCUA 1XEXB 3N39C 4L5JA 2YYSA 4H08A 2ZI9A 4LVCA 4TLCA 4M60A 1TKRA 3WRYC 1JR3E 1EE9A 3ZGOA 2P9CA 2ZTVA 2JGIA 3CZ9A 1BJTA 3DM5A 1KO1A 5HK8A 4EKYA 3KEGA 3KR9A 3IOMA 4O2LA 1G6HA 2IY8A 4XRRA 4FINA 2O0LA 3ZK7A 3CN9A 4CM7A 4CLOA 2FWPA 5EGNA 5EIFA 4PAGA 2AFIB 4PEVA 3KV3O 3ZBUA 1IEWA 2ZAYA 2FJ0A 3E8SA 1DRVA 2A5DA 1AUXA 5CTAA 2IDKA 1OIVA 3W2TA 2HQSA 1YCFA 1NRJB 3WK9A 1XO1A 4LJ9A 5CLIA 1WXDA 5CB4A 3VX3A 3IKLA 1N0UA 3ZDBA 4BXOA 1YS2X 1Z8HA 5L6MB 5B53A 4EX7A 3A58B 3ESDA 2FVYA 5MHTA 4ZQCB 4C6RA 2E87A 1Y37A 2P11A 3KVYA 3WGUA 4BNVA 1HFKA 2ES4A 3B51X 4NPHA 4Q3DA 4RIEA 1EWQA 1IE3A 2V9PA 4IOJA 4DLVA 2M6LA 2Z4TA 4TN5A 2V4UA 2V7PA 1AA6A 1DDGA 3QNWA 3BMQA 2YY7A 1RHRA 4R1TA 4R8KA 4RO0A 4AX8A 4ZVUA 1QGZA 3WP0A 4OB7A 1T5SA 4A36A 4M0DA 3L0PA 3PWKA 3UAWA 5JFOA 4NAVA 5FBZA 5A2GA 1E2IA 3W6ZA 5BRJA 2AOUA 1JNYA 3O0DA 3B85A 3B3QA 4FWIB 3ETGA 2AGVA 3NC0C 2ZYHA 4LISA 3P9QA 1I5RA 4PRZA 3L5OA 5E2IA 3WBFA 3WRXC 2QUKA 4MVJI 4H0NA 1QRRA 5C7LO 1EMDA 3EXHA 2YWGA 4BQSA 2W6JA 1U9ZA 1U90A 2PH7A 3KKKA 2HLHA 4NMXB 4L2IB 1P81A 4FEAA 1YS6A 2XB8A 4CMBA 3V48A 2OBFA 3DO8A 1F1JA 1JEQB 5C8XA 4H1WA 1G2IA 2WIFA 5F3DA 1DGQA 2WF5A 2GTIA 3JZDA 3ZW9A 2R1VA 1ZWKA 2AJ8A 5IT5A 4ZALA 1IY9A 5BQ5A 1W36C 1GLGA 4G01B 4P2GA 4DVJA 5KNDH 5AW6A 2W2MA 3KUKA 4I4CA 4Q9AA 4TKVB 3ZNQA 3AERB 1WRBA 1SXJA 1UIMA 1QAMA 2P1DA 1V7CA 1PUIA 2VF2A 3F6SA 4Q6BA 4G5OA 3ZJ4A 1TKAA 2BI4A 2QSZA 1L5HB 2NPOA 1FUIA 4NJOA 4D9NA 3PXEA 1I51A 1V5WA 4TTAA 3DLPX 1KORA 2Z1NA 2GZ1A 3D0RA 3PWTA 3QBJA 4FDLA 2YVUA 1U5BB 4HNQA 1UC4B 3FTCA 1E63A 4W8GA 4YMVA 1Y6RA 3M8KA 1WZUA 1ZK3A 2GXQA 2ZR8A 5AJUA 3F97A 2IYPA 2BSXA 4IFEA 1H6BA 4D82A 1BGVA 3FMOB 3PTZA 4C2BA 1Q17A 3B2NA 1T6BY 4JDUA 4AB1A 2MYNA 3NHBA 3EIQA 3LXUX 5BSRA 5JCPA 3CZRA 2P3SA 1V16A 5ALHA 1ZUHA 5EHNA 3WAKA 1P1JA 4ZGBA 2CSXA 1TIBA 3GLFB 5DM70 4E14A 2PEZA 3ZBQA 2WU1A 2VNAA