3P9YA

Crystal structure of the drosophila melanogaster ssu72-pctd complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
198
structure length
198
Chain Sequence
GSHMTDPSKLAVAVVDSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVNNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CG14216
publication title cis-Proline-mediated Ser(P)5 Dephosphorylation by the RNA Polymerase II C-terminal Domain Phosphatase Ssu72.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 63
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3p9yA01
1EFAA 5C5EA 1GUDA 2AYXA 3JVIA 1LJUA 3VNBA 4MRMA 4D6YA 4ZJPA 5KQLA 3DBIA 2X7XA 1LBIA 1USKA 3LKVA 3SG0A 1E2BA 5DTEA 1B00A 1EWTA 1NXVA 2A9PA 2FN9A 1QQAA 5EWJB 1Z2DA 5PNTA 4Z4FA 1HEYA 2PUAA 5HQJA 3NBMA 1S8NA 3KLNA 2MSWA 3KCNA 4RK6A 3T38A 5TE9A 3LUAA 2P4UA 2PUEA 3RH0A 2E4WA 3D02A 5KQGA 4PYRA 1ZN2A 4WT7A 2WJWA 1DZ3A 3G1WA 3KKEA 4MR8A 4EYOA 4W5QA 3CZCA 3H5WA 4RK1A 5CNJA 1SRRA 3EGCA 1M5UA 1ABFA 3Q7TA 1FFGA 3HDVA 3HV2A 1F51E 1JBEA 3H75A 3R0JA 4FE7A 4MS3A 4EYKA 4KPYA 2MYUA 1YMVA 3HS3A 5F64A 5KQMA 4NV3A 4RV5A 3P9YA 3H6GA 4JB2A 4YO7A 5C5CA 4UHKA 4Z9BA 3A3KA 4HNSA 4JA2A 1ZGGA 1JH9A 2L17A 1QP7A 2OQRA 2P9HA 3O21A 1ZVVA 2R25B 5IUJC 3DGFC 4YGXB 4KNYA 3M9WA 2WMYA 5CHYA 2NT4A 4JAVC 4DN6A 3Q7RA 1CEYA 4Z4GA 2AYZA 4G0XA 1A2OA 4MQFB 1JWLA 3QLUC 3NNDA 1Z17A 3FMVA 3M6MD 1H9CA 1Z2EA 2R48A 1K68A 2IDMA 4MLCA 3SQNA 4TLLB 5HSGA 4KRFA 1U04A 7ABPA 5TPZD 4W5TA 2WWVD 3MM4A 3RVPA 4P98A 3H5VA 2IPMA 4G0ZA 1XHFA 3HSYA 1JYEA 3CHYA 2IKSA 4L85A 2FMKA 4MAAA 4B09A 4F06A 1VPWA 2FEPA 2R4QA 1VLZA 2XDYA 3H1EA 1RZRD 1DBQA 3NNNA 4O1HA 2MSLA 3OMXA 2HPHA 1GUBA 1JDNA 4QICA 1P6UA 4XASA 3LTEA 4ZYLA 4W5NA 3UUGA 4RXUA 2FW0A 4CBVA 5KI6A 2VUIB 3RVOA 3RVLA 5FWXA 4RKQA 5JNVA 3QEKA 1TLFA 3OQNA 1DRJA 3QLVC 3HJFA 3JVDA 1JX6A 1W9HA 2FSPA 8ABPA 1DJMA 3O1IC 3EQ2A 1NXWA 5T3YA 4KQCA 2PL1A 3H5IA 5I4CA 1YK0A 2W42A 5B3JC 3OQMA 1QO0A 1BAPA 1W25A 5IEJA 3ILYA 2CHFA 3URMA 3RVMA 4DQDA 2JK1A 2A9OA 3E3MA 4RK5A 5DGCA 4ZMRA 4OLAA 3N6VA 4KVFA 4MS1B 4LX8A 1ISRA 1ZESA 4G0QA 3OLVA 1QQBA 3QLTA 4ZMSA 3BRQA 2IPNA 2V0NA 2PE5A 1DP4A 2PMCA 5IC5A 1D5WA 1DC7A 4RZSA 1EHCA 1KMIY 1QP0A 4PE5B 1XHEA 4N76A 1MB0A 4G0YA 1BDJA 1PHRA 3GBVA 5E3JA 3KHTA 1NXXA 1A0OA 2YHBA 3N0RA 1BDIA 2CD7A 1ABEA 1Z18A 2FQWA 3KG2A 4RY0A 3JY6A 4F3TA 4E7PA 1ZHHA 3HXMA 1GCAA 3GA5A 1NXPA 2WRZA 1EWKA 1ISSA 5CNMA 3CKMA 3QEMB 3BREA 3KYIB 2PUCA 1ZH2A 3N75A 3HZHA 1TM2A 4M88A 2R47A 3IP5A 1JYFA 2TMYA 4RXTA 5BQ3A 2O20A 3FGZA 2IOYA 1C0EA 4EVSA 5BRJA 1NXTA 2QVCA 2QU7A 3GRCA 5D2CA 4S04A 1RNLA 4IMJB 2ID7A 2JVKA 2J48A 1OXKB 2OENG 3IPAA 1P2FA 2HQRA 1J56A 3LUJA 3MYYA 3KSMA 2E4ZA 1M2EA 1RPJA 1Z16A 4EYQA 3F6PA 1M5TA 1U0SY 1AB5A 1XWWA 1YIOA 2PKXA 4MPTA 4P1ZA 4YLEA 4NICA 1FFWA 3E61A 1DCFA 4MR9A 1MB3A 2PUGA 4ETNA 5FBKA 2WB4A 4F12A 5IEBA 1YS6A 1L5YA 3CLKA 3H5TA 3M9XA 4MR7B 2E4YA 1DRKA 2FVYA 2BGGA 4MQFA 2QZJA 1D4ZA 4MR9B 2FTKE 5HM6A 2LBPA 1JFVA 2JRLA 3LUHA 5TPZA 4TLMB 1D1PA 1UDRA 5HKOA 3KJXA 2VK2A 4S05A 1L5ZA 3I09A 3O74A 3C3KA 1F4VA 1PNRA 3IP9A 3NHZA 4Z4HA 1D1QA 2MYNA 4HNQA 3RVSA 4G97A 5TPWB 4MS4B 4NQRA 1RZRA 4WWHA 4L4UA 2RDMA 2QV0A 3KLOA 3W9SA 5TQJA 1YVUA 4PEVA 3CZ5A 1FFSA 3JPYA 5T7BA 3Q9SA 3TO5A 4KMRA 4RSMA 2FMFA 4H60A 2M98A 4Q6BA 4DADA 3DZDA 3EJWA 3GT7A 3LMKA 2PUFA 4FE4A 5FWYB 5IX8A 1DG9A 5FBHA 1ZAYA 3O2SB 5KQPA 4G0MA 3B2NA 4N0PA 3SY8A 4IRXA 4LDZA 1IIBA 1QNLA 4W5OA 3CG4A 3KYJB 1E6KA 1CYEA 2FKAA 4W5RA 1NTRA 5GOTA 3EDCA 4WUTA 4KFCA 3I5AA 1Y1LA 5ABPA 4O1IA 3QK7A 1EAYA 3LKBA 4D74A 1QP4A 4MS1A 4EY3A 4N47A 3JS5A 2NZUG 6ABPA 1TJYA 3OM1A 1C4WA 1USGA 1BDHA 5DCLA 4RWEA 5DLEA 4MQEB 1DC8A 3K4HA 4YRZA 4ETIA 3H5OA 3JTEA 3OO1A 3UKJA 4Q6WA 3Q15C 4QPJC 3H1GA 5EWLA 2YHAA 4IGAA 2PUBA 4GNRA 3UK0A 1TMYA 1Z13A 3H5LA 3HUTA 3MF4A 3IP6A 2HJ9A 2HSGA 5KC8A 4QYWA 1JDPA 1URPA 4MYRA 3HCWA 1LBHA 2QSJA 4OG2A 2FLKA 2RGYA 5EWLB 2ZWMA 2WY2D 3FFTA 5CNIA 4G0OA 2FN8A 4IILA 1P8AA 1CHNA 4KQ9A 3QEMA 1GLGA 3VNAA 5TQ0B 2IPLA 3C3WA 4YP9A 3F73A 4Z4EA 2GKGA 5TQ2A 2MSKA 3H1FA 3HEBA 3TB6A 2L19A 3TX6A 2GWRA 5JNWA 1OXBB 2VYCA 3C6QA 4O5AA 3O1JC 3LUGA 2MYTA 3BILA 4N41A 2CWDA 1DBWA 2F8SA 3N8IA 1PUXA 3G85A 4NCAA 4RKRA 2JVJA 4LZLA 5TQ2B 1SXHA 2E4UA 3OLZA 1VKRA 4LE2A 2QR3A 4N0QA 3NHMA 3OM0A 1JF8A 3QELB 4KREA 3EULA 2B1JA 3N0WA 3CS3A 5ED4A 2FQYA 1I3CA 1JLKA 5IULC 3A0UA 3HVRA 2PUDA 3JPWA 5JNSA 3MIZA 1YK1A 1TVMA 2JBAB 4YWHA 3OLWA 4ZPJA 5EWMB 4OLBA 3LUCA 1VRVA 4MR7A 1MAVA 1NATA 3LOPA 4Z9AA 3ROTA 3Q7SA 2IPAB 2HQBA 4F8JA 4XXHA 2KYRA 1ZITA 3CU5A 1U8TA 3TD9A 3I45A 3SAJA 1PEAA 4JP1A 1RXEA 1USIA 3HO1A 4QYMA 1FSPA 4MRMB 1APBA 1KRXA 1K66A 2RJNA 2HQOA 3IDOA 3FDFA 3RVNA 1D2AA 5TPWA 4MS4A 3RVKA 2Q5CA 1A04A 4Z99A 2M1ZA 5KC9A 5JNUA 2LIVA 2A9QA 4KK3A 1BVHA 4KK4A 4WXEA 4WZZA 3ILHA 2PLNA 1MIHA 1NXSA 1T34A 3C3MA 3LUKA 1ZGZA 2N9UA 4OBBA 2FMIA 1BA2A 3QLUA 3OMWA 4Q7EA 4FB4A 4NCBA 3HM9A 3F6CA 2E4XA 1SXGA 3O2JA 3N0XA 1JHZA 4XARA 1Z25A 3RVQA 3GL9A 4YV7A 1R8JA 3CFYA 2L2QA 2ID9A 3IP7A 4LE1A 2LUOA 2FEKA 3K9CA 1JL3A 4MR8B 4RK0A 4HYEA 2LP4Y 4XLTA 4RS3A 3DLHA 1ZY2A 5FWYA 5JS1A 1DCMA 4EYGA 3LUFA 4MS3B 3NNSA 2H3HA 2WJAA 2DRIA 3OLYA 1JFSA 1KRWA 1PEYA 2QVGA 1RXIA 4OATA 2IYNA 3QX9A 5IBQA 3OQOA 3CTPA 3HUUA 1SD5A 4E7OA 1YTUA 5IUKC 2E4VA 1M2FA 4N03A 2L18A 9ABPA 3FFXA 2FMHA 2GX6A 3L6UA 4XAQA 3KS9A 4IF4A 3RVJA 4H3HB 3D8UA 3QLVA 3BBLA 1LJLA 3LUDA 4MQEA 3A10A 4RK4A 4UHJA 2JVIA 4LDAA 4EUKA 5BRAA 3RQIA 4ETMA 5JS2A 3BRSA 1DBPA 4YS6A 5B3JA 4Z4IA 3IPCA 2QXYA 4RK7A 3Q41A 4F11A 3O75A 4D6XA 1Z15A 1JFTA 3GWGA 5JNTA 4GPAA 4MLDA 1WETA 3N53A 2GI4A 2ZAYA 3EODA 4PZ0A 4G0PA 4HNRA 4JB0A 4EVRA 4YCSA 1QPZA 2H0AA 1KGSA 2PJUA 1LK0A 2RJOA 1MVOA 1GCGA 1ZDMA 3FFWA 3GV0A 3O1HB 3HK2A 5TQ0A 1DCKA 1E6LA 3MA0A 2JB9A 3H6HA 2GBPA 3KTOA 3MQ4A 1E6MA 5FWXB 4Z4CA 1Z26A 3GBPA 3L49A 6CHYA 1EWVA 2FQXA 2JCGA 5GQSA 3MMNA 3T6KA 3LFTA 1Z12A 1P6QA 5DKFA 4Z0NA 1YS7A 2FLWA 4Y9TA 3EQZA 2NUBA 2LPMA 2A9RA 2CHEA 3HDGA 4KV7A 4LE0A 4JOQA 1QO0D 4WXMA 5CNKA 3SM9A 5IUNC 5JNRA 3DGEC 1NY5A 3DLBA 3T8YA 3A0RB 4OTZA 3CNBA 3QELA 2I6FA 4TMYA 2PL9A 5BR1A 4RDCA 3I42A 4RU1A 3F7NA 4RY9A 3QX8A 1QMPA 1U2PA 5KWSA 2FEWB 2NT3A 4PICA 3SNKA 4EVQA 3C97A 1ZH4A 4YR7A 2JBAA 3CRNA 4RXMA 1YMUA 3GYBA 3T95A 4H3KB 2MYPA 4G86A 4XFKA 5EWMA 1SXIA 3CG0A 2PAFA 4ML3A 4RY8A 3TMYA 2NZVG 3O2QB 2F8TA 3EAFA 4TN5A 3OLXA 3RVRA 4EGSA 2FXIA 1U2QA 1PNTA 3ROFA 2VUHB 4KZKA 4JASB 1QKKA 4MGEA 4IMIB 1NXOA 1FQWA 3S99A 3OO0A 5EWJA 1AB6A 4LRQA 2QW1A 2B4AA
chains in the Genus database with same CATH superfamily
1RQRA 2O8BA 1RAGA 1RTKA 1YL5A 2CGEA 2XTAA 4YAJA 1ODCA 3S0JA 3VNBA 4A73A 4ZJPA 2FR8C 2EIXA 1LBIA 2E0IA 4PBSA 4ZI5A 4JLJA 1IHDA 3M5PA 2QDXA 5I9MA 1QQAA 2OM2A 5EWJB 1M1UA 5BSEA 1HFKA 3O8DA 4Z4FA 1H94A 2C4WA 2PUAA 2IEZA 3NBMA 4FS8A 4EOGA 2GT1A 4MXDA 3BWYA 5IYZB 3Q0TA 3GLVA 4BWGA 1G1MA 1O6BA 1K2VN 1SQ0A 1TCUA 3AJ8A 3CRQA 2A2ZA 1PR2A 3QH4A 3SX4A 3BH0A 3IB3A 3GEHA 4RUKA 2G5GX 2VAMA 2XCTB 1WA5A 4D98A 2C2YA 4NXMB 1N2IA 2R7MA 2VQDA 1E9VA 1EP9A 3EN0A 3LO8A 3LDFA 4ZODA 4RHXA 1D6SA 4TV9A 4XVCA 1T1JA 3HDVA 3R8XA 5DULA 2PZAA 3T1NA 4C0SA 3OLQA 1U2SA 1BFUA 2Q1YA 2FUKA 5C5CA 3D4PA 4KAXA 2CC2A 1X42A 2V6IA 4DR5B 3AY7A 4MQUA 4CT4B 2LV8A 3T1YB 3A3KA 1YE8A 5ITWA 2BONA 5ES3A 1C4XA 2ZI3A 3O21A 1ZU4A 1B74A 1NJ5A 4WL0A 1F3LA 2GF0A 4TKMA 4TL8A 3TZEA 5G0UA 2ZQ5A 3L92A 4MGIR 3HL4A 1QGZA 2XTZA 4GLBA 4JIGA 1R0KA 4Z4QA 2HN9A 3GEPA 3HU5A 2WU3A 5JJCA 1BJRE 5T41A 2YUIA 5AJHA 5GOZA 1BJKA 4QIHA 1II8B 3EXIA 5KVQA 1MJFA 5HIAA 1E1LA 3MWFA 2UYQA 4R4JA 4TLLB 4EENA 4ZOQI 2VSYA 5ILQA 1KMHA 3BERA 3L1JA 2DKFA 1OOEA 4ZHQF 5A0VA 5LU8A 3PLRA 1SN7A 2G17A 2XNDA 3CE9A 1PG5A 4G0ZA 3KEOA 2IDKA 4BX9A 2DWPA 1E60A 1O0CA 4YDSA 1EP3B 3TN7A 2XR1A 4Q21A 4YH1A 2ZB7A 3B3JA 3IHKA 1HL7A 4JODA 4CM8A 1Q92A 1FP6A 1VYHA 2BFFA 3QUTA 3BL8A 3RT7A 4N4AA 1U1GA 3A4MA 3NEPX 2B37A 3TBHA 1JDNA 1U7DA 1HL3A 1IH8A 3OQJA 4CL3A 1XF1A 3L7YA 3GN2A 1UBKS 1LWNA 4BBPA 4FFBA 1I36A 3MQFA 3W5HA 3A27A 2F48A 3M83A 3DP7A 4CIVA 4FN4A 4OHOA 3B1WA 2QD1A 3QLVC 5DHSA 3ICCA 1DV2A 1UBFA 2ZIGA 3ADPA 3RS3A 3PSHA 2BSXA 4CDNA 4DPLA 4PYQA 1NXWA 3S2UA 2QJWA 5K3BA 1PV4A 5IM4F 3AETA 4YI3A 3KWJA 5EESA 3EXFB 2CK3A 3PDUA 3REQB 4KTVE 3UK1A 3PFKA 4WXYB 1W2WB 2H51A 4OHCA 2JFXA 1W2GA 2AI2A 5JCZA 1ORTA 4ZT6A 4FW9A 4UZEA 4N3GA 1JPJA 4ENSA 4OHZA 1YUMA 5J2TA 3WWYA 4OFBA 2Y2VA 4LX8A 1L8XA 4N7RA 3VVCA 3JV7A 3PX2A 1CQIA 3SZOA 4PC7A 2G9QA 4F5EA 3OUZA 4E2FA 3UJ8A 2ZM5A 4UOZA 2DHCA 3LLVA 1YJAA 5K0BA 3H9QA 4FDAA 5AXDA 1M0EA 3LYUA 3B9PA 5A3VA 3ZN2A 2G5CA 3F5FA 4CT0A 3ANSA 3V2HA 5LB2A 1QP0A 4A23A 1Y0BA 4NLLA 5CFNA 2QRUA 2FEMA 4TWIA 4JL6A 3FJYA 2J6CA 3MWDB 2WIBA 4D96A 3WAGA 1N34B 2YJ3A 1PTJC 1OI7A 3N0TA 2LKCA 4HX9A 2K2QB 2XXAA 1JFRA 4EITA 4RELA 2G63A 2X9LA 3OJCA 2HF8A 3HP7A 2V0CA 4X1KA 3TS1A 5E0OA 1I80A 3QEMB 3MYRA 2B21A 5JH7B 1H9BA 1X1QA 1XKXA 3RV3A 4U7DA 3NWEA 1TM2A 2PGOA 3SJZA 3IJEB 4EX6A 2V6GA 1OB2A 1VBMA 5BYBA 4O2BF 5DXJA 5FPYA 1T9KA 1GN8A 1FFAA 1Q6ZA 1K88A 3D5TA 4I36A 4CN8A 3F6EX 4Z7QB 3NH6A 4XH9B 3ZXYA 1U2GC 4GOOD 2X6TA 4V38A 3UKDA 4QXAA 1QGED 1Z0UA 4RPLA 1ZFNA 4IQFA 4PN7A 1GLVA 2IUSA 4KXYA 5AKJA 1HZZA 4C4ZA 3UHPA 2XD9A 1QGDA 3EYAA 4YRIA 1U0BB 1ULUA 3D6TB 4XIGS 1NRXA 3LC2O 3LUJA 3P5BA 1Q0ZA 4YCLA 4TTVA 2Y4NA 3H0KA 1VKNA 3BB4A 5DVZA 1G9TA 1E1DA 2G4VA 1H6AA 2HRQA 5HOQA 4YAOA 2PKXA 3KJGA 4YLEA 2GN6A 2M2IA 3BHJA 4QATA 1Z68A 4D81A 3PU6A 3FYCA 4EHHA 3DW3X 3AVQA 1LQ2A 1B6TA 1U3FA 1X7XA 5FNVB 3RGGA 1MR3F 2IX9A 4K0KB 1L5YA 1N25A 2C5SA 1J2TA 2AD5A 4WKPA 5D5QA 2G72A 2NU7B 4DIMA 3AI7A 3LDHA 1GILA 2P9ZA 5KNCH 2O2YA 2Q5HA 4XYBA 4QJ3A 1RQNA 2XYRA 4F60A 1XNQB 2HT1A 5DRTA 1KEKA 1U7UA 1PZNA 2ONKA 2PQ6A 1YVRA 1XVTA 2DAPA 1GGVA 3PGVA 1M2OA 3I6ZA 3P0HA 1TRKA 3C85A 1D7OA 1WKVA 4G01B 4X64B 5HKAA 4WN9A 3GGDA 1G60A 2QV7A 5KSWB 1QAOA 1X86B 2V9CA 4PLCA 4X9XA 1JAYA 1ESEA 3DMRA 1H22A 1TF2A 3BH6A 3E9NA 3HCPA 3E2IA 3FYSA 4MITA 1TEHA 3HYCA 4J2HA 4RZXA 1CFZA 1Z6YA 3A37A 4A0HA 2IXFA 3VH4A 4RQBA 4DC1A 3FAKA 4JJGA 3L7CA 3ABQB 1BKYA 1DDGA 1IHOA 1J4AA 2IWHA 4NBRA 3H19A 1U7XA 3QVMA 2R1TA 3RSGA 1KH2A 1VCMA 2XZOA 4ER3A 3C3DA 3VJKA 2DWQA 4DVGA 1N78A 4KJZA 1YVUA 3VOTA 5CEEA 1QPBA 5KYXB 2C5GA 1PUIA 3R5JA 4HWSA 4J2OA 5G02A 1KJZA 4DQLA 2UXCB 4IVQA 1SCIA 1QHYA 1RCUA 3IB6A 1IJEA 1MC8A 1VKHA 1JECA 4HGOA 1U8ZA 4KXQA 4RJ2A 1JHYA 3DZDA 1SCAA 2J6HA 3PNYA 4IUBS 3UIEA 2OZPA 4EFLA 2PUFA 5AI5A 2JIRA 4POOA 2DY1A 2ZANA 1T5BA 2IC5A 5DBIA 3BICA 2PUTA 2I2XB 2IYAA 3P0RA 3P9NA 4FHEA 4EJSB 4ZCMA 1Z74A 2FETA 4PG6A 3IEKA 1ATZA 2VF7A 3OQBA 1DIRA 1ZBQA 5BT8A 3WDMA 4LDPA 5GV8A 2EFHB 4BN4A 4YGYA 2QX6A 4PQFA 5JR3A 4KQHA 1JSXA 1W4AA 3BIXA 5CB0A 2WB2A 4R1MA 1WZ2A 2FSHA 3WWOA 3I62A 4LDJA 3AYZB 1CXZA 4QRDA 1RS0A 1FXSA 1TLTA 2WG1A 3NBYC 3W4JA 4I1VA 3FMFA 3ENQA 3ZD8A 2FF5A 5AW6A 2J67A 4L27A 5DCLA 3T7TA 2NYRA 4WK4B 1BMFD 1E9BA 5FUBA 1DC8A 4B3DA 5CA1B 3LUPA 5EZ6B 1NT2A 1UKBA 3OPYB 3P96A 2OQ2A 3OO1A 5CT6A 4HVAA 5LUAA 1RYMA 2PGIA 3QVVA 1ULZA 4UEKA 2ZJ8A 1KHTA 4H18A 4D5EA 5F3WB 2IEYA 2VRCA 2ZRAA 1ECFA 2QRKA 3F3YA 2PJRA 3LY9A 4FUTA 5ERXA 4Q9HA 4RLQA 3UJHA 4C3VA 3U17A 3THSA 1C3LA 1OZAA 5DYNA 4PYMA 1QIHA 1DQZA 1DTEA 2W98A 1XDSA 4REQB 2KM1A 4BB6A 2GF9A 4LV8B 3UG6A 4ZN6A 4KNVA 1C9NA 2O1EA 1YNSA 5BW5A 3QEAZ 2XTNA 2VWHA 5C8XA 3RG2A 3TTWA 5JO9A 4GQAA 1RLJA 2JI7A 4V2UA 4II7A 3DL2A 2J5RA 1R18A 2GO1A 2FEAA 3KSUA 4IRUB 3CUTA 2VYNA 2ZKIA 3O8OA 4Y9RA 5FUVA 1WD5A 3GLSA 3T5CA 1KJ8A 5LXTA 1Q21A 4O4IF 4R2KA 3I2IA 4JVOA 2MYTA 2EWVA 3PDIA 3ND8A 3L46A 4URHA 1W4BA 1E2QA 3PVSA 1D04A 1CUXA 2BFBA 3FYUC 1VKRA 3V4FA 2VP4A 1A8UA 3HP1A 3HVUA 4H16A 4KAFA 5B7QA 3OM0A 3QELB 2NUTB 6Q21A 3ZTWA 5C8YF 3CS3A 5IJWA 4NPCA 1N5RA 5IC5A 4EMTA 1CJMA 2ZSDA 3NWOA 1QTIA 2XYPA 3QW4B 4L02A 4P81A 4AUEA 5EXSA 3LC7O 1OYWA 4GU5A 4MMZB 2XBUA 1VB3A 2K4MA 2QOEA 5J4LA 2G3YA 3DKIA 3DYBA 3OJLA 4QOJA 1LX6A 1PP4A 3LUCA 2EZUA 3O47A 2G7ZA 4JOSA 3SFTA 3VR1A 2RAFA 3VR2A 1NATA 1HV8A 5DV9A 1N8NA 1A82A 1TYBE 1P9NA 2IPAB 1K5HA 3BTSA 4XVRA 3YASA 1RWVA 3ZWQA 3CU5A 4FLEA 5SY6A 3CLRC 1U5CA 1F6BA 4PZUA 1MAUA 3HB1A 4FX2A 5D6NA 5KX5A 3QHAA 3Q3JB 3SAJA 2JLQA 3CCFA 4UAGA 4YCJA 3WRXC 4MIEA 4EVIA 2B6HA 1USIA 3G2NA 1IZ9A 4TUYF 2ZRGA 1ZRNA 3TWOA 1U5BA 1T0JB 4ZVRA 1PT5A 1UXHA 3E3OA 3PQDA 2WF6A 1M2VA 4Q48A 1A04A 5E1OA 4K1LA 5JNUA 4S1TA 1V0JA 4C6TB 1L7NA 2VHVA 1YBVA 3GLKA 4JLAA 1RHJA 1ZMRA 2WNHA 4IVRA 4MEBA 4WASA 1WSAA 3KZXA 3LBNA 1B8UA 3FDZA 1SKUA 4ZV4A 3VA7A 2H16A 2QTRA 3G0IA 1JHZA 3JATA 1CEQA 2AE2A 3JQFC 3OPMA 3Q11A 2DVMA 2L2QA 3AR8A 1W85A 4FE3A 1NN0A 4N7JA 1NV8A 3W77A 4FDTA 5ECGC 5LMZA 2LP4Y 4RO0A 4MCHA 4UEWA 2F43B 2EZ8A 3TIGA 4M0KA 2ZYIA 3HACA 4WK6A 3VC3A 3X1XA 4DR4B 3FRHA 4INAA 4TRNA 1CQZA 1D4FA 2AKYA 3PQ3A 4EB8A 4R1UA 2O7NA 2XMCA 4PN3A 2RGDA 5T4EA 1G6KA 5C7IO 4NONA 2W4QA 3D8TA 1EGAA 3KVOA 2JHAA 4FDUA 3Q7PA 3M3PA 5HF5A 4KODA 1HETA 1BD3A 2O05A 3AR2A 5EP4A 3AF3A 2QQEA 4RSRA 4LXHA 2XITA 3R3WA 4WEOA 5ANRB 4ZT5A 1PRYA 4B6QA 2GZSA 4ER0A 1CUUA 2B61A 3WO0A 1E3WA 4PAWA 5DI3A 2UXBB 1PGNA 4KLRA 2Z4RA 4Y6LA 5FXMA 5HK9A 5K20A 3AVUA 5GV7A 1AK1A 4KWEA 3EXIB 4DGQA 1F9AA 4KN9S 4U2CA 3UXMA 4BNMA 4FIDA 4C7OA 4JR1A 4RK4A 2PMFA 4UHJA 1KMHB 3BRSA 4HDAA 3K9WA 3KQPA 2JLVA 3G8AA 4RNCA 4Z4IA 1VXRA 3I9LA 3K0FA 5IAGA 3TZCA 1G7TA 3RQSA 4JI5B 3CH5A 3IEUA 3M3DA 3HDJA 1AH2A 3ND5A 2QZ9A 3ILXA 3BD6A 1R66A 3ORRA 4CM8B 4JB0A 4Y2VA 3DNPA 4WN3A 4YCSA 2BKEA 1N8SA 2VDQB 2BFFB 4RQUA 4HVTA 3OF5A 1QPZA 2CBXA 2GHIA 2WTEA 3A58B 1G8MA 5EHQA 1GCIA 4BTLA 1VM6A 1I4EB 2PL3A 3KB8A 3RK4A 3LF2A 5JJKA 1XFDA 1DCKA 4G36A 1C4KA 4FFLA 1XROA 4C7BA 3QLEA 1ZZEA 4Z4CA 1CHDA 5SYMA 5EE5B 4CKXA 2D1QA 4OQQA 1L5MA 2AEFA 1ZBDA 3WB0A 3ZHOA 2ZWAA 1GPKA 3PFBA 3AETB 4EKIA 5HIIA 1JE1A 1CRQA 1EZZA 5I5GA 3MPOA 3OKPA 5JCJD 4PF1A 2I22A 4BS9A 2OECA 2IEGA 1QE5A 5HS4A 2CUKA 1RQ2A 2AGVA 4C2TA 2EWWA 1SVLA 1QHHA 1XTIA 3FCSB 5ALIA 5J2TB 3GLRA 4Q4HA 1W36C 3L0YA 3NATA 1JIQA 1C0LA 1VXOA 2SBTA 2WA1A 3HJBA 1CQIB 3I42A 3K4QA 4YTEA 3RNLA 1KJ9A 3B8HA 3CLTC 1ADJA 3ET5A 4XR9A 5ALSA 3UWSA 4CCSA 1IM5A 1ZUD1 1SUEA 3KZCA 5AI9A 5LMCA 4YECA 1JDBB 1GRQA 3RBXA 2X0KA 2Q6IA 1IWOA 2R8OA 2X8WA 4JJEA 4LXUA 2GDJA 2J5BA 1OROA 2A4MA 1TM1E 4KPUA 1FSZA 1VL6A 2GJAA 3NUZA 5EXTA 3UT6A 2R62A 1QZXA 5B3KA 1S01A 5EZYF 3CA8A 4ZD6A 3PC8C 2Y9MB 1NXOA 4U7FA 3JYPA 3W34A 1Y80A 2UUCB 3X43A 4ZDJA 2YV2A 1OR8A 3EUAA 4RPIA 2RIPA 3LVRE 4URXR 5JI2E 2XXAB 3R8FA 4DB2A 1JXMA 1LJUA 2ZROA 4U1RA 4ALNA 3DXYA 4X1KB 1NXVA 2NADA 4ZYXA 4JCOA 4D4IA 4F2PA 1FDRA 5ICMA 1SB8A 4KOAA 3BF8A 3LD9A 1T8RA 2CVHA 1EJBA 3EGOA 2GEJA 1HE2A 5T57A 1H6CA 2D0OB 3KVVA 1XDBA 3L4BA 4P0PB 2Q1TA 5EJFA 1YA6A 2BTEA 1L7RA 4J0EA 1NWHA 2QZSA 4HP8A 1M6YA 1U3DA 1W59A 4JYBA 4WFIA 2NXNA 1HLFA 3D81A 2O7RA 2QBYB 3NRJA 4MR8A 4MI6A 5TGZA 1OASA 3EGCA 3VX4A 2I1WA 2O23A 3U9LA 1X2EA 2GBLA 2X4IA 3N8GA 1F51E 4EYKA 1Z5PA 1CEXA 3N8HA 1BVYF 4B48A 3UGTA 1R1DA 4JB2A 1FDTA 1W49A 3LP5A 2WT9A 3A14A 1B42A 1NDUA 1XDDA 2W2LD 1GV0A 3LS2A 4KN8A 2EZTA 4BO1A 5CYGA 4CETA 5DHTA 1P5ZB 2P9HA 5I6DA 1G3RA 1R6DA 1KDYA 4NH0A 9LDBA 4RTPA 2Q9BA 1X7XB 5JTTA 5AWFC 5JJIA 2X42A 3LZ6A 4UDXX 2Q7OE 1Y33E 3BTUA 2OWEA 1VFPA 4A0RA 3GFTA 2I4RA 4L3OA 5BOVA 4DPMA 2J9RA 3TRDA 5A4AA 4BKQA 4ZIRA 5CK4A 5BO5A 4EKEA 4A10A 5EA2A 1GDDA 2IS4A 1M2OB 3F1KA 4FFOA 3OWOA 2BOVA 3V8NA 3EVDA 3H2GA 4A1FA 4JEHA 2J45A 2VSXA 3O3MB 1R15A 2VJMA 2XA9A 2VPZA 2YKGA 3TPZA 3N07A 3R5SA 4BVAA 3QIVA 4EYEA 1KKUA 1XLWA 4KQXA 2FMKA 2P1ZA 3KBBA 3L7MA 5FI0B 1JYSA 3ZDXB 5EC8A 2R1TB 4DAEA 3WR5A 1JIXA 4FCWA 1ZM2A 3DMTC 4Q15A 3EH1A 1SO8A 4A2WA 4K2HA 4AD8A 3PD0A 3L04A 4P4SA 4ZYLA 1II0A 2VOJA 1ZD3A 3JSXA 2FUG1 3TLXA 3RSZA 4LBVA 3VAZA 5JNVA 1R9JA 4ZRDA 3TKYA 5DN9A 2Y99A 2OBLA 1WXWA 3BGOS 1PLKA 3U9SA 3WC4A 2ERXA 5JRJA 1AM4D 3O1IC 3EQ2A 3ENNA 1IZ7A 3GUVA 5DE3A 2I99A 3TAHA 2WV9A 5A9SB 3H5IA 3O9VA 4QOEA 2W42A 3ZIUA 2EKBA 4Q7LA 3NYWA 5B55A 1JR4A 3K2QA 5EHZA 4PZLA 2WA2A 4CMIA 1SCDA 3UW3A 1KY5A 3D6MA 4UD6A 2GVDC 2HJWA 2NVBA 3C1UA 4H7PA 1SOMA 1ZUHA 3IKVA 1MU0A 4ARVA 1QU2A 1Q1BA 3KE9A 2IA5A 4EPVA 2X5KO 3DUWA 1KP9A 2DWUA 4FI3F 1Q1AA 1UP6A 3OX1A 3H9UA 4FFPA 5CVVA 5CVJA 2C54A 1HXHA 3ASUA 3MJ4A 2IUTA 3WAKA 2PE5A 2BH9A 3E5NA 1HT2E 3CLHA 3H8JA 3MD9A 4YA6A 3RYIB 3I5XA 1H2YA 3OQ1A 1Z45A 1WPXA 3KL4A 3X1WA 5I4KA 2YRFA 4TX1A 4KP7A 3IL2A 1XHEA 3PQ6A 1FVHA 1M9NA 3AR7A 3W9BA 3W2FA 2Z6UA 5TX7A 3NCHA 1J0AA 4ZZ1A 1P1BA 4WLUA 2NTVA 3U7GA 3NV7A 3MCAA 2H2HA 2GM9A 2R8XA 1OZFA 5J1TB 2B8EA 4CMHA 3HXMA 1GCAA 1UXGA 3BD7A 4GPBA 4MAFA 4DG9A 3O4FA 4NS4A 3UK7A 3TKAA 4CRWB 1LVGA 5CPFA 3VR4D 1EH5A 5D3MB 2G8NA 4II2A 2QI9F 4BNKA 3N75A 4EUHA 1MH1A 5BSKA 3DB2A 3PEUA 4UNNA 1Z0DA 1Y6RA 3R7BA 3BK2A 4MHSA 3O8OB 4QPPA 3RAEC 5LXTB 1YZNA 4GWLA 4A8PA 5EIXA 4IV5A 1JDUA 1DS6A 3PDIB 5CITA 3SJAA 1T2VA 3CLSD 3CW9A 4BQQA 1WTAA 3TL6A 4MI3A 2CXHA 4J0QA 2A5LA 1ZAKA 2BFBB 3NC1C 3IEMA 1A7KA 1V26A 2N0SA 2RH4A 2X14A 2W7TA 3IQIX 3AFOA 2NO9A 3SQMA 4D45A 1Q0LA 5I8WA 2E1PA 2E89A 5LD2B 1AQUA 1E9EA 3PPWA 2OA0A 3Q98A 4MV3A 5CR9A 1MNQA 5HE8A 3CF6R 1SUCA 3MBKA 3N2EA 2FPKA 5IH3A 1LDYA 3I5UA 3ASYA 3RRNA 5DM60 2GZ3A 4NICA 1JB9A 1L7VC 1U8FO 3MWEB 3NI2A 2X0NA 5LZ9A 3I9NA 3PXXA 1Z6QA 1R0RE 1RI4A 2H07A 1IOLA 1X15A 2XYQA 4N8SA 5K1ZA 3QA3E 1D2NA 4GVLA 1KEEA 2EW1A 2IBMA 3TFWA 1FDIA 3AL2A 3EDMA 2DG2A 2XGJA 4YJGA 1DQPA 3FWKA 1IPFA 3RUFA 1TL7C 1UJ4A 2C77A 2JLRA 2QUKA 2WUFA 1T1RA 5KTTA 4Q66C 3WDLA 5JARA 3KJXA 1FQKA 3OHSX 5I3ZA 5KX5B 1EZ1A 2IPXA 3C7TA 4BAUA 3IHTA 4QASA 2WSMA 4R84A 4XPZA 1WMDA 1U5BB 2ZU6A 1OBOA 4HDSA 3QBVA 1E2HA 3K94A 3RVSA 1YR1A 4GMKA 1EDDA 3KC2A 1M2VB 3W4IA 4BMZA 4XM2A 4YWJA 3RYCA 1GGHA 4WWHA 2JLYA 2NSDA 3BXGA 2G04A 4TXJA 2PGXA 3EIQA 4PO9A 1W4RA 1HE4A 1KOJA 3V00A 2D1RA 3ORFA 3T34A 1MA3A 3FUTA 1SZCA 3JPYA 1PLJA 2O5VA 3FDZB 4DIKA 3JATB 5AK6A 1GYPA 1R5OA 2DKNA 1WHSA 2H63A 4Q03A 3T15A 3GJYA 3IPLA 3TXXA 2M98A 3KJNA 4EL0A 4QPDA 4Z7JA 5BN4B 1C1DA 3QXHA 4FE4A 4FXPA 4MVYA 3ITDA 5KQPA 3T3DA 2XEXA 4IZHA 3TDMA 3JARB 2MSNA 3KYJB 4FYJA 2Q1SA 5LQAA 1FL9A 4YRSA 2OAP1 4IIEA 1UFRA 4MCAA 4PAQA 1UPTA 3T1HB 1PS9A 4JNCA 2NXWA 4OPMA 1Y1LA 4CIWA 1LPSA 4BP1A 1SXJC 1V8OA 4WJKB 4X3OA 4B2PA 1Q2UA 4JI6B 1JEEA 3OOWA 1E3WB 5DI3B 1SUDA 3TTXA 3I34X 1XMOB 1SC1A 2GDZA 4M0MA 3B6MA 3WIBA 3NWPA 1ADYA 4CE6A 1RYHA 1ZKMA 3JQBA 3QW2A 4C7OB 4YRZA 4P3XA 3HGTA 4N9QA 1GZUA 2ZSEA 4JCCA 5JEDA 1E4YA 2RH9B 4Q05A 1JAIA 1L8QA 3EWAA 1OXVA 3K0FB 3LNCA 3UK0A 5C1BA 1X7DA 3IDFA 5BW6B 1XDGA 4FGZA 2G0NA 4CFYA 5KYWA 1F12A 4HTFB 1EFVA 2OV8A 1TA4A 1E96A 3TLMA 4C05A 5EMLA 2WP0A 1LPOA 4LRYA 2KBEA 4OI0A 3O4VA 1LKZA 3TR0A 5IYZA 4RA9A 2GN4A 1Z39A 4J4BA 2KSQA 3EZ2A 1U1DA 3TVDA 4ZHQA 1E1YA 5EKXA 4TTSA 1C8LA 4ATNA 1UKEA 2YX1A 1EBUA 2IPLA 2WJ4A 2XRYA 3E27A 1YRYE 3EEBA 4LFAB 1RXWA 2NUPA 4B6GA 1K9VF 1LDNA 1KJWA 1AKQA 3HMKA 3I4CA 1E7MA 2MSKA 3H1FA 4PWYA 1ZWKA 5IJAA 5LA6F 1OYOA 3MTJA 1E1RD 3H16A 5A71A 4AKEA 2VH2A 3C6QA 3FOBA 3ZWCA 4RMIA 2W6PA 4HF7A 1P60A 2Q46A 2QL9A 3B78A 2QMUA 4LBYA 4KQWA 2WM9B 2WWGA 2GA8A 4MNTA 1EMDA 4A6EA 2C2ZA 3OTOB 2F8SA 4GBMA 2I54A 4L28A 3FMGA 5TQ2B 2RGGA 4RV4A 4GXTA 4AF7A 4E4TA 2CDCA 3OE7D 3GGCA 5GIPE 2OGSA 1QHHB 3DO5A 3EULA 1WIWA 4AT1A 1LSUA 2ALJA 4G0VA 4Q4HB 5IVKA 5ED4A 3FNIA 2AXNA 4V0KA 1SCQA 3FDIA 3N39C 5IM4A 3HVRA 3VOSA 3GRZA 3QTLA 4OHVA 4BN0A 3ZDCA 5A4JA 3DVRX 1G8GA 3ESYA 1M5RA 3VBCA 1FW6A 1ENOA 3COZA 1C7EA 1MOQA 3EG9A 1CY1A 1ZI9A 3OSZA 3GXBA 4NNJA 4LF9B 5K3OA 2ZFUA 4KPUB 1ZD4A 2K7FA 5SYNA 1KE1A 1SB9A 3SKXA 4FYIA 5B1YA 1LD3A 3CNLA 3RJZA 5AVXA 4UPVA 5F3DA 1I2BA 2R6GA 1EP2B 1PEAA 1BNCA 5JCOA 1DWPA 3JQ7B 1NE2A 1T13A 4BY9E 4D9FA 2ZZNA 1P6XA 3Q9NA 2A7QA 4W63A 1PUJA 1V5FA 4TROA 3QU4A 2LIVA 2F4VB 3L8ZA 4PCUA 3GRRA 1FTYA 1DAMA 1WQ4A 2O2JA 3A4IA 3K9QO 4TOIA 4EG6A 2PR2A 1J9EA 6NULA 1QZ3A 1EJ2A 3A28A 3FSGD 3G89A 3H2ZA 4PHGA 4CKCA 2FH5B 1HRKA 1SXGA 4XARA 1U28C 3N0XA 4LXQA 4IZ6A 4DG8A 2C4HA 3I8XA 4MR8B 4P7BA 3TZKA 4H35A 4QARA 1CP2A 1ESDA 3NJ4A 4TQGA 4E5KA 5I4BA 3QY0A 4NV1A 1JG3A 2NO1A 1FJHA 4YQYA 1RC0A 5FBQB 4TSRA 4KMMA 1E79D 1PVOA 2QUJA 1NF3A 3PBKA 4O2BA 4L4YA 4RH1A 4I46A 2WUVA 3U3DA 4EI2A 4JFAA 3VISA 1JSCA 4WH0A 2FE4A 3HUUA 1QIGA 1W19A 2UUAB 5TV2A 4RH0A 4FYPA 3DD1A 4KXVA 2GVZC 4JKOA 1EVKA 5LQUA 1YCGA 4NBKA 4G23A 4BUCA 4K9NA 3KS9A 4UE6A 4IF4A 5E7IA 3HDQA 1QRAA 4ZIRB 2RK3A 2R7LA 4R98A 4WADA 2B5OA 2D6FA 3SBXA 2AJ8A 5AJYA 5F33A 3GJ3A 1FA9A 2DULA 4ROSA 4F4HA 2VJMB 3Q0IA 3HP4A 4YS6A 3FHLA 3TSAA 1S7GA 3CV3A 1UWLA 4QYIA 1S2LA 5JAZA 3AIIA 2UZIR 2C1ZA 4GPAA 3WNZA 3HJCA 3R3VA 4MRVA 3RSHA 2ZUSA 3S7ZA 3SF8A 3UAVA 5ICFA 4CKBB 4JLNA 2RG1A 1ZMXA 2BTOA 2Q2WA 3B53X 4RTOA 4QLOA 1DINA 2HLNA 6YASA 3U4QB 2B8JA 1YJCA 3V97A 2PO5A 2BYTA 4Q1AA 3RIEA 5H4GA 4P4SB 2DBQA 1ISMA 3BMNB 1GM5A 1KXZA 3AESA 2OMKA 1XMXA 2D1YA 2G0TA 3GGOA 1LZKA 4F6CA 3EXEA 3P9IA 2FQXA 3U31A 3QE4A 1GQ2A 5HRCA 1Q12A 3IP3A 2GHTA 1T8PA 1YR9A 3SK0A 1GADO 3Q3GE 2PQ2A 3EQZA 1XRSB 2A9RA 4KU4A 2JPDA 4MPDA 3HC7A 5LIPA 3W5IA 3VZPA 2ZE5A 4IDHA 1U0HC 3TQQA 1HDOA 2FWRA 2COKA 3I2YX 4YXWD 1TUBB 4ZGGA 1YCHA 4URYR 1EA5A 3EVAA 2PL9A 5B53A 5FFMA 3VVLA 5COAA 4QT0A 2WAMA 4XGRA 4ZYYA 2PUHA 2JCYA 1U2PA 2C88A 4TYNA 4EPWA 2RK6A 3A1DA 3N3AC 2HO5A 3AUAA 4W7SA 4QREA 4KRGA 1JALA 2R8ZA 4MGKR 1VE9A 5J4HA 1IOZA 1VSQA 5IT9A 4TTAA 3GLFA 1FVXA 3O2QB 4LW8A 4U3JB 1CY0A 3OLXA 3RVRA 3FOZA 1HY3A 3D31A 1VMEA 3M4YA 3COVA 4I9UA 4JQZA 3S99A 2GEKA 4EDFA 2Z6QA 5I7RA 2XH8A 1NVKA 1YFKA 3GAMA 4AY6A 4ZVNA 5KNCD 3IALA 3RRZA 2AKAB 4JT2A 2A84A 3G49A 5DM0A 4NY1A 1TK2A 4H1HA 4EGAA 4OBWA 1NQXA 1NOJA 4RE5A 5ER6A 5PNTA 3R8CA 4UCQA 2TSYB 1JSZA 2B2XA 2FHPA 3G2IA 1M2GA 4WCDA 3W9YA 2GN2A 1P1JA 3D7LA 4Q1FA 3QOXA 4EARA 5BSGA 5AKYA 3C6BA 3SJBA 1ZN2A 4KPGA 1UWCA 3FJ1A 3F6RA 4A8TA 5CNJA 4S12A 3UMYA 1NP6A 3EVBA 3PC7A 1QUEA 3E15A 4FJ0A 1T9HA 3UHAA 1UPUA 3X2SA 3LA8A 3IILA 3ZE9A 1LW7A 3L41A 1ENZA 4D56A 5AI4A 5E4JA 3EZXA 3RTGA 3VGPA 2V8BA 3H9BA 1P29A 2A92A 2HJGA 1YU6A 2ZJ5A 2E37A 3BBPA 2B3TA 2HUNA 2JIDA 3L7JA 4R1NA 4Z1OA 4O4IA 2QG6A 4AJNA 4X1OA 4IJQA 4HEHA 4RZ2A 4F1KA 1DOHA 2J7PA 3O90A 4BKMA 4TRRA 3JAMA 4LHEA 2OHXA 2V3VA 5EIBC 4OIMA 1LBTA 2QM3A 1BC5A 3OZDA 4H6VA 5JWHA 3GLFE 1GSHA 3BCSA 1KEEB 2L0XA 2OAEA 3L7NA 4CL0A 2FX5A 1JN0A 1RLUA 2AYZA 3NBZC 1A2OA 1KPGA 2WYVA 1E6CA 2WSSD 3DAYA 3NNDA 4IJ5A 2REOA 4YJGB 4GOXA 4EEZA 3ADKA 3K9FC 2IU6A 2ILTA 1ADCA 3KHKA 5I7EA 4G56A 1XCOA 3L7LA 4EBFA 7ABPA 1HA3A 1TJ3A 2ZT8A 5IDYA 4JGBA 3NTLA 2GPAA 2XUGA 2QL6A 1K9SA 1PS0A 4DCVA 3IUSA 3AEKA 3CHYA 1GPWB 4KWIA 2XCLA 4ZEVA 5AKIA 4B4UA 2XB6A 2VP2A 1GTSA 4LZPA 2OCBA 1MCZA 1YZTA 2VTVA 3KEQA 1VLZA 3VYUB 5J5AA 1EVEA 1Y6GA 1Z0IA 3A2NA 3AFHA 5FPPA 1UZNA 1JZTA 4GZ3A 3GQVA 2V7QD 2O2EA 1CUFA 2LZ0A 3C16C 1ZSVA 4XCVA 1X7ZA 1L8AA 2ZQYA 3OHMA 4Z7NB 5HJ7A 2ZDQA 4PSVA 5GJWC 5C53B 3C5CA 4RXUA 3DZFA 1WHSB 4WDQA 5KI6A 3A9RA 2YHIA 5TC4A 1SIBE 2MMGA 5DW0A 1C1DB 4Y2JA 1L4LA 3PIRA 2AL7A 3UN1A 3ZEIA 3AU9A 2EX1A 2VTKA 4CU2A 1WF3A 1FNMA 2B7CA 3V55A 3BWEA 4QU0A 1YKFA 4C43A 2P6OA 2X9GA 4S1OA 1QO0A 5B4TA 2PH3A 2O1WA 1DX9A 3PXBA 1QG4A 3T4UA 2A0WA 5FPKA 3IHWA 3VBEA 3L0IB 3IEIA 3PT5A 1U3TA 2E82A 2WILA 2VZEA 4MUAA 3KHSA 3E3MA 4I08A 4F85A 3L5KA 1GAXA 1P39A 1ZINA 3QMPA 4J49A 2OFPA 1QJ4A 2ZSBA 3LLMA 1QF9A 2PKCA 2X7JA 4O0MA 1CV2A 3WL8A 4DSNA 4EWLA 7ADHA 2SCUA 1DBVO 4AP9A 2V0NA 3FUVA 3LPDA 1WABA 4GMFA 4MWZA 1FFBA 4F4CA 1U7PA 1WXHA 2DZDA 5G3YA 1N1DA 4HH0A 4PE5B 1CQJA 5K9ZA 4UVHA 2PMBA 1VJDA 3BXPA 4DZRA 1JPVA 1VBKA 2YV1A 5J58A 1ZRSA 2D62A 2IXGA 2XA1A 3NGMA 4QBFA 1QB8A 1EFVB 2J9ZB 5KYWB 3S2FA 1GOTA 4UHEA 1UQRA 2FQWA 3U7IA 4MW5A 4EATA 4RY0A 2X0DA 1LH0A 4DNXA 2ACVA 3ZCSA 3AY3A 1PJRA 4JXKA 1YB4A 1Z4KA 2O14A 4I14A 1DTSA 4Y1EA 4BBAA 3HNRA 1O87A 2ATEA 4AUKA 4ZHQB 3QE0A 5JYEA 1ZG3A 2GK6A 3LM8A 4ND1A 5IVDA 3K9HA 1UDBA 2NUPB 4IP0A 2H7YA 4IDCA 2X2EA 4RIHA 3T35A 4UUQA 4EJMA 1T8WA 2TMYA 2Y67A 4LKOA 5FORA 3L82B 5BQ3A 4ZCTA 5G4KA 3DO8A 2OV2A 5K6RA 4ENRA 3ETGA 3KAKA 5ITSA 5KS2A 2COUA 521PA 3TOSA 1XPOA 1OGIA 2XE8A 2WF9A 3I37X 1QP8A 3IPAA 4PX9A 2HQRA 2I80A 4POAA 3KB1A 1T1IA 2WQZA 4X7RA 4DA0A 4AN4A 4LJSA 2IYVA 3VR5A 3N6RA 5BWMA 5FFFA 1XWWA 5B57C 4RULA 2WQ6A 1XTZA 1MG0A 4K8OA 3BGWA 3MGBA 3ZI7A 4I1OA 1F9EA 3L07A 2P0YA 2ZGVA 3D2BA 3QYFA 1HT0A 1YAHA 3DM9B 3H5TA 3D64A 3H9EO 3BXZA 3UUWA 1VRWA 1PJQA 3EG9B 3OJ0A 4DA9A 1SVSA 1EXDA 4RD6A 2Q0XA 4X45A 3G1UA 1UBMS 2R751 5A1JA 2E18A 3MVEA 2ZRMA 3PL1A 1NVMB 3U09A 4C08A 2LBPA 4JXXA 3TFQA 2O0LA 2IOHA 4QA9A 2VDLB 4XGKA 5TPZA 4ENTA 5HKOA 2ZZMA 1WDMA 3CX4A 4LG1A 4IMRA 3QGMA 2W6NA 4EH1A 3FTFA 2ZR9A 4KFTA 1RFLA 4S0ZA 4QQNA 1J97A 1GVHA 1AGYA 4AFNA 2V4ZA 3B8EA 1KQGA 1LBQA 2GN8A 3D6UA 3HB4X 4PPGA 4XJVA 5LMNB 4M9SA 1E2MA 2NYUA 1JS1X 3DHWC 1AKVA 4I5IA 1Y89A 1BRMA 3U40A 4FXOA 2CLIB 1KOGA 1NW3A 5DYTA 1P61B 1GFWA 4BV8A 1CQPA 2B34A 1MPXA 2QYTA 5EEGA 4CKCB 4N1AA 4DVJA 3KSRA 3TO5A 1CJVC 3ZJ5A 4FZ5A 2SNIE 4IQGA 2UUBB 2FMXA 3OURA 2BLLA 3AL3A 3I2FA 4H60A 3W7AA 3TIFA 1I7NA 2C92A 4FBMA 3WL7A 1CY7A 4J4TA 4P4UA 4A2QA 5HZGA 1XRMA 4NEQA 1NRWA 4UBIA 5IABA 2CUNA 4UTZA 5AW9A 5JANA 1R0LA 2O4UX 5LP6B 1F2TA 4OLHA 3RFFA 3U56A 1YE5A 3CG4A 1HORA 3H7AA 3IV7A 3SYLA 3ZCVA 1GQQA 3I6BA 3QOYA 5A7FA 5LQDA 4WUVA 5DSZA 2ANBA 2PVPA 1T2AA 2QRNA 1CSEE 4B6PA 4HNUA 1XMSA 4KFCA 1ICIA 4BFZA 2YBDA 1LX7A 1OC2A 4S35A 4UE3S 3LKBA 1TGVA 4LHYA 5ADWA 4AMVA 1UJBA 1E2KA 1WAMA 1TJ5A 5CJJA 3RO7A 3ZXUB 3HFSA 3LV8A 3Q87B 5ALLA 4K0RA 3JQ9A 5LQMA 2YNMD 1HNXB 1AGXA 1E0AA 2C7BA 3CX6A 4BRWA 2V9ZA 4Q6WA 2OXCA 2D00A 3MS4A 4I4NA 4BWFB 1MT0A 5LPNA 4M8NE 4QYIB 3BORA 1TMYA 2QM0A 4JBHA 3L8HA 1RW4A 1G21B 3ZUPA 2HU8A 2NU6A 4KIUA 3QFHA 1JDPA 3C2QA 3NU1A 5ALMA 4A6PA 1YO6A 1S0UA 1CUYA 3AKEA 4OG2A 2X5XA 5EERA 5HFJA 3LX8A 4ZTBA 4Z6KA 2DFKB 5CCDA 1F5SA 3NHBA 5CNIA 4G0OA 3OFNA 2Y1OA 1QFXA 4FCVA 1I4DD 4H0NA 4KQ9A 3USZA 2FSSA 1YJQA 2HRDA 4MDYA 1A5SB 5GINE 4YP9A 5L3RA 2AX4A 3LSTA 2O7VA 4WX2B 1GCUA 3TRJA 4LUCA 3BF7A 2V7VA 3AGQA 1K7YA 4RNDB 3EXEB 2JGLA 1VPVA 4RJKA 4EI9A 3OAAA 4CYMA 2NMVA 3E2PA 3T94A 3F2IA 3GJ7A 1ZIXA 1VMKA 2DUJA 3M2TA 4N41A 4TMXA 1J39A 1Z7WA 4HAVA 5IC4A 4EJ0A 1FYVA 2YVQA 3ZZTA 2ZTHA 1OX6A 3H11A 3LDAA 3B2EA 5A02A 1IUPA 3L7IA 3RODA 4N0QA 4W1PA 5DISB 4TYWA 1NBMD 1KDZA 4AZVA 3FHCB 1OLOA 1O3YA 1LK7A 4GI5A 1Z3CA 1YJXA 1BKSB 3HYLA 4CLOA 1TF5A 1B8VA 2I0FA 4C29A 3A0UA 1Y7HA 2NUAA 3N2YA 4C03A 5SY4A 2NNWB 1YK1A 1HDZA 1TJNA 3RLFA 1G9SA 3V8EA 2OBYA 2Q3EA 4O4JB 2ZBUA 3UH1A 1ML3A 2Z58A 3HCCA 1NYLA 3WLLA 2QTTA 3VHLB 1SIUA 3GLFB 4DEVA 1BWSA 2H2DA 2QLNA 1WUJS 4OP3A 5AXCA 1WOMA 2Y1DA 1U9IC 3QKSB 4C0BA 3G2PA 4YUZA 3I52A 1NX9A 3KR0A 3KJHA 1VKZA 3X44A 2EQ5A 2OAGA 2W4MA 2X5OA 1OHHA 2R79A 2IV2X 2OHOA 1ETHA 1O5IA 5F2EA 4HQRA 1FMLA 4ARZA 1MP0A 1LZLA 1QV7A 3H99A 3K9BA 5DCWA 2DU8A 2HEGA 3TE6A 5F7OA 1KI6A 1GNQA 2Q5CA 3KOMA 4O2RA 2KJQA 3ZE7A 4B0PA 3CRMA 4D4GA 3T4XA 1U0LA 4KK4A 1E3TA 4KVGA 3TLYA 3U16A 3O26A 4R9SA 2RD2A 2PLNA 1NLYA 1DJQA 3B3FA 2N9UA 5CUQA 1NUTA 2WM8A 1YHYA 3RVQA 2V7TA 3DS8A 4ETNA 3B38A 3K9CA 4RK0A 1LU9A 1JG1A 2FW6A 2W6JA 2QN3A 4G25A 4CEHA 2YY5A 3NNSA 5BN3A 1RLMA 2H3HA 1VYTA 4OGFA 4P58A 2XVMA 1U7TA 3ZE0B 8LDHA 5LN1A 5K45A 4UNIA 1U0OC 2P2ZA 3BHIA 3MJSA 2BEVB 1I6WA 4O4IB 1SBZA 2GN0A 4Y8VA 3BA1A 4MVJH 4TM8A 1EVJA 2I7XA 4X20A 1F2VA 3LL4A 4FMBB 2I76A 2FE1A 4KACA 4PTLA 3R7WA 5A0TA 2R44A 4FOPA 4HSEA 4MO2A 1QOZA 1G5PA 5F76A 4CG3A 4DA6A 3OTIA 3CUVA 4DV5B 1WCIA 3EA5A 4YRNA 2H8GA 3A2LA 4WPGA 2D7DA 2Y27A 4WNCA 1WUKS 1E6WA 1Y8QA 4MQLA 5C8YB 1EWYA 1WNFA 4G5SA 4TVOA 5CVCA 2HU5A 3RGWS 3RTEA 3ZH9B 4AWAA 2P62A 4P8RA 4EJSC 3U49A 4DMKA 3AG5A 3A10A 3PR3A 2JW5A 2CF6A 4XDZA 1NVUQ 1O03A 2GAAA 4D3DA 3Q1KA 3NJRA 3IPCA 5IBRA 3UJ6A 3W3ZB 1P7VA 4G8BA 2AKEA 1Z15A 3GVHA 1D5CA 1ORVA 2OCAA 5AKHA 1S8OA 3CBGA 3TCKA 3PGXA 3X1JA 5CEJA 2FUCA 2XCUA 1OBCA 4MV1A 5KPJA 3EPJA 4JI0B 4PG7A 1UBTS 2BEJA 3BGDA 1E9CA 3IBGA 3LY7A 4JHLA 4EGCB 5K0SA 4EO9A 3ZHVA 1XKTA 3I2JA 3I4LA 4G65A 3LHFA 4OJKA 1X7ZB 5L40A 1RQLA 5KQSA 3C70A 3OU7A 4IS3A 3PKJA 4LGMA 4NYMQ 1EFTA 5C81A 3PIIA 5GIOE 2ZIXB 2YHIB 1NBHA 2GBPA 2VL7A 3I2GA 4K9SA 3L49A 3KWMA 5B12A 4U8GA 4ZP1A 2DPYA 2JCGA 3SP1A 1Q0HA 1IUNA 1FK8A 3DZGA 4BO5A 1DBSA 1PYDA 1RI5A 1O8BA 1L5SA 2JATA 3CJQA 3FGNA 1P6QA 2PQ0A 3FYDA 3M8KA 5JSHA 3K6SB 3IDSA 3NHYA 2PH5A 1TM7E 4EY8A 4FMDB 3DL7A 4HYQA 3DGEC 1JP7A 5FT9A 1NF8A 1E18A 3LO5A 1DUVG 4MV9A 3SCZA 4UBKA 3U0VA 2AG8A 2I6FA 1XEAA 5LYJF 1KI8A 1AHHA 3E7PA 4LY6A 2DUNA 2WAAA 1E7RA 3L9XA 4GRIA 3TD2A 2QJTA 2Y1CA 2BDUA 3R1IA 2AW5A 2CMHA 3FTNA 1XN1A 3KOXA 3F7MA 1JNYA 4K05A 3RBZA 5ELXA 3Q5GA 2VDKB 3TNDA 3CCBA 4UOEA 2HMYB 3QP9A 1GKUB 3KXIA 1DC3A 4KEAA 1KQFA 1T4BA 4JGIA 5EFOA 3CSUA 4R2MA 4C0LA 1PBTA 4JP2A 4ON9A 4ML3A 4RY8A 4UVGA 3PDJA 3L40A 1EE2A 1DAOA 3OIYA 4B43A 1CQJB 3K6RA 4XIYA 5DHRA 1TM5E 3CXUA 3S40A 5I7VA 3ROFA 2NXCA 3M82A 2PJZA 3UOAB 1P4AA 4EUFA 3HCDA 3KJQA 4YJFB 5KIAA 2Q8PA 4CR6A 2UYCA 2F1KA 3DFMA 2G9NA 1CK4A 1ESZA 3UH0A 2X2PA 4BNGA 3U48A 3ZHBA 4MW6A 2X58A 4MW7A 1LTQA 4XYGA 3ZZ0A 5C5EA 5KZMB 1XTBA 1RYBA 4HAYA 5GJBA 2X7XA 1B23P 3INNA 5DTEA 3BDAA 5WRFA 3SJUA 2H4WA 4DZZA 3V7NA 3GH3A 1H0SA 2VDWA 1AXEA 1BYIA 1UPFA 4X8LA 4DJEC 5K7SA 3HTXA 3WMRA 5HWSA 3KR9A 1AX9A 2IOQA 1SBTA 4FHGA 3C3EA 1J42A 1NW4A 3L7OA 2NVOA 3ZIAD 2ZYHA 3E8MA 1C7ZA 3HI6A 4R31A 3ZV6A 4E30A 2JJ1D 4N8EA 1QZTA 5CU7A 1MZPA 2KWIA 2QZZA 1E98A 2WEKA 4N7MA 3RIHA 4RK1A 5C1OA 3VR3A 4L5AA 5JCXA 3GFSA 3SM3A 4D2IA 1OFVA 2YIMA 1JBEA 3E4DA 4GKVA 4K28A 4DCUA 4EIWA 4O2AF 3KVRA 1V8PA 2HWYA 2IYEA 2X2OA 4UXHA 3FPBA 3P9YA 4IZOA 1NA5A 3U81A 3UT5A 5IXSA 3H04A 3SYRA 1WXFA 2FDXA 2DFVA 5D5HA 2M6RA 2MU1A 3BJMA 4CODB 3KVYA 3NRCA 4M0PA 3CF0A 1NGSA 3OMLA 3PUJA 3H0EA 2P5TB 3D59A 3M4NA 2GNAA 5E4YA 3VPHA 2Z57A 2F00A 2HCBA 4Q82A 5K6TA 1XDUA 2YCBA 4JLPA 4UVDA 3UATA 3ZCRA 1RAFA 2B9EA 3G7NA 4QHSA 4GFDA 1K68A 4DQKA 2WD7B 3FOWA 4I5FA 2VR1A 2X9VA 3SQNA 3MRVA 1DKMA 4KRFA 1ECJA 3O8BA 3R5FA 2YQZA 4Q1CA 4HB0A 2F3QA 3N2ZB 2JI6A 3NLLA 2J9FB 4BFXA 4IHJF 4CIYA 3LHSA 4QUGA 5KWJA 2IKSA 3GYGA 2HDOA 1GSIA 4NBVA 4RD2A 3H2JA 3UAYA 3AUKA 3AINA 1Z0ZA 3AR9A 3DDOA 1YQ9A 4E12A 3Q3VA 1SMKA 1YT5A 2F7SA 2YDYA 4PFJA 5AM4A 5F7JA 3UMCA 2XOKD 1KSGA 2BGUA 1EJ0A 1W46A 3PKIA 5CFRA 1A1VA 2G07A 4NFHA 1J70A 1RDFA 4LQ4A 3NYQA 3GCGA 2NO7A 2CKMA 2FR0A 2IP4A 5J5VA 2DF8A 3ETEA 3K70C 4JBXA 3C5WP 2HZBA 4C78A 4MZDA 2DBZA 4OQDA 4PLGA 1TU4A 1G6OA 4MVJI 1DRJA 4KYTA 5C37A 4R0NA 1BVRA 2RK4A 1E5LA 2AUNA 2PL1A 3TK1A 2NWQA 1CDOA 1ODJA 1IN6A 2O2GA 3OU6A 1E2JA 2D5AA 2WIFA 3CMCO 3HU1A 5EGSA 1FYFA 1RM4A 1FUYB 4RY2A 1C80A 3ZHZA 5MFZA 3D9QX 1RKVA 3N70A 3TR6A 2HA0A 2YXEA 3GEGA 3AB7A 4FMCB 5C7OO 4RMHA 4C14A 1J8QA 3N6VA 4DMHA 5AIBA 2NV2B 3DZCA 4QDZA 1CETA 1J07A 1ZGBA 2P78A 4TWZA 2W4IA 1ZESA 4HGRA 5L6LB 3NBQA 3R74A 4B45A 3R20A 1JV2B 3E4CA 1UF9A 2VHXA 3ISJA 3QLTA 3WB2A 4D3FA 2W0MA 3NHPA 4OL9A 1A77A 1ZR4A 2AFRA 3IAUA 1MHTA 5KSPA 4E70A 1T9GR 5JASA 3T7IA 2O1SA 4YYZA 1ZPDA 2I55A 3BG5A 5IBPA 3D7MA 1Y1RA 4LJLA 4D9CA 1L1EA 3JQEA 2JJMA 1WXDA 1YA4A 3CZMA 2BM9A 1JIJA 1QCYA 1DC6A 2GPJA 2I4LA 3R41A 4MIKA 4MWCA 3ZGVA 5KNBA 1W5AA 3A4VA 2P79A 2ZBFA 2P68A 5BMOA 2ZJ7A 4LRTB 1ADBA 3VKFA 1TKRA 4N82A 5JI3E 1EWKA 5EIEA 1BD4A 2W9XA 3TCXB 3CZQA 1D1SA 2CYCA 3K6JA 3RFXA 4BVKA 1UC9A 2H4YA 3JX9A 4XVUA 5HS6A 1S8FA 4ZK2A 3HWWA 3IMKA 4AX8A 5JLJA 4BO2A 4XSGA 1WS6A 1Z8NA 4JVSB 4K1XA 4G26A 4H31A 3ZU6A 2O20A 2O5CA 1U8YA 2IOYA 4BFTA 2XVXA 2NO4A 1OLXA 3TIVA 1M10A 1WUHS 2QVCA 2VWPA 3I92A 1XZGA 3JQAD 1A1SA 2WSIA 4J1TC 4UUPA 3V7YA 5FAKA 3AX6A 4QU8A 5ILOA 1K8QA 4XI9A 5ALEA 1ULHA 3H11B 3A31A 5FLKA 4NCXA 1GKLA 1NHWA 3EGIA 4RVGA 4BLQA 3U61B 3PEYA 3RJTA 4NE2A 4ID9A 2B4TO 4EGQA 3KXLA 1LQUA 3AHHA 2ACWA 3MOSA 7REQB 2IBSA 3EF0A 1L4UA 1AB5A 3QQ5A 4YRKA 4DSAA 2XBMA 3MIIA 4B73A 2H5JA 2NUAB 5E9AA 3IJPA 1F20A 2VSNA 5DOZA 1UMCA 1ZK0A 1ID1A 2R9VA 1E3MA 1XXHA 2NQTA 3C45A 4QQKA 3SZMA 4YDRA 2ENWA 1YZQA 2PNJA 1VHTA 1RACA 1NFQA 1DV1A 2ZTSA 4N6NA 2Z09A 3FCUB 4GZ6A 4I1YA 1XRRA 1TAGA 4B4OA 2B4QA 5FEUA 2ZXUA 4CI9A 1L7DA 1PKXA 2ZJAA 2GETA 1FY2A 3O31A 1E4EB 1G8YA 3PQFA 2H65A 2H85A 2BBSA 3P7MA 1VGQA 5GM1A 1DE0A 2ZEJA 2VHZA 3PXGA 2I7VA 5BSWA 4QSMA 1NQWA 2FFJA 3M5CA 1Z4NA 4GI3A 3RUCA 3KDPA 3A2MA 2NGRA 4ARZB 3L43A 5A04A 3LKDA 4LXXA 4LQLA 4M37A 4GKBA 5IJXA 2PT5A 1R4AA 1KI6B 2C20A 3EAGA 1FEZA 2ZUVA 4KRYA 2C3PA 4WXPA 3HKEB 3KLOA 4MOWA 3W9SA 3OTQA 5J47A 3LQ1A 5SZKB 1O95A 3AY6A 2QW0X 1GP2A 1IB6A 3I8SA 3RK1A 2BH2A 3O3NB 1FYEA 2Q6OA 3PCTA 1KGDA 2WG2A 4MX8A 2O8EA 4WNIA 1EG2A 1JIKA 2JJ8A 4RHYA 5ADVA 5KJ6A 1RVV1 4JLWA 3VH2A 5I9TA 4Y6GB 4LYGA 3ZNPA 5JYDA 1CS0A 3BE5A 3PCXA 4J0FA 1J1IA 1DG1G 4CEHB 1F8YA 1HPLA 1XA0A 2W83A 3F6YA 4PHFA 5BN3B 1NLFA 3TECE 2J4DA 1WMEA 2YZKA 1IIBA 1KZ9A 1KYTA 2RB5A 5G2OA 3RC2A 3AEYA 1CYEA 1PT6A 1YB2A 2IYLD 3S44A 5GOTA 2BZ1A 5E2BA 3U7QA 3WHIA 2BSAA 3DL4A 2QB5A 3R7WB 1XXHE 1M2WA 2ZULA 4TQ9A 2BGWA 2X3YA 1WCIB 4A16A 4JQYA 5DSTA 1T3LA 3F3MA 2O3RA 1JG7A 3BMOA 4IIVA 4NARA 1Y8QB 1KVTA 3CT4A 1LK5A 4CW7A 1VE7A 4AZSA 1UC5B 4C4RA 1TEZA 2Q5IA 4AJOA 4ZOLF 3DD5A 4AURA 3JTEA 1ES9A 5AVRA 2VQEB 1PSZA 1U8UA 4DCCA 3J7AC 1LQTA 4E6EA 2O0MA 2PFKA 2OXFA 3RB8A 2ZJ1A 1CZHA 2P2CA 4J75A 1TIPA 5GWXA 1J0DA 1NYTA 4H1TA 4DMFA 3B20A 1U8EA 1UPCA 1KY4A 1XKLA 4ITUA 4N6GA 3B2QA 2V55B 4FEEA 1YUNA 4MW4A 2RARA 1FS6A 1T91A 4WJZA 4AQDA 5EWLB 5T5QA 3B1VA 4BMPB 1LDBA 1WLYA 3VJMA 1AHIA 2W71A 2QDKA 4UDNA 1CHNA 2FRXA 5IHPA 2ZK7A 2PIAA 3CR7A 3R3SA 2Y77A 2GEBA 1PJ4A 3GO4A 4GECA 3G2KA 4P7KA 3WKAA 5CA0F 1OW3B 2YZGA 4MPRA 3O95A 4ODIA 9MHTA 3UHFA 1Z22A 3CEAA 1HFWA 4EQZA 3D6AA 2DC1A 3OZFA 2OPBA 2FWAA 2VPQA 4O5AA 4DLPA 3HABA 3KOUA 1GAJA 2XT6A 4J16C 3PQ4A 1ZONA 1XZEA 2V54A 2PEZA 4C0WA 4NZMA 1PG2A 3A36A 1OIXA 1KI3A 2DX7A 2GJ8A 3FUUA 3TLJA 1UDXA 1E5XA 2E4UA 2G1JA 2I1QA 1RR6A 1ARZA 3H4TA 2VNAA 3H5NA 3ITNA 2Z1MA 3I1YA 1T3GA 3WI7A 4ESVA 2PD4A 2ZRBA 4OQYA 1SC9A 2FZCA 4GGOA 3ZY3A 1C7IA 3GLQA 2GD2A 1EX1A 4Y3UA 1XD2A 3AHEA 4RKEA 2FYTA 3VHXA 4OP2A 4FLMA 4P33A 4WA8A 4F9FA 1S2NA 3W79A 4BX0A 3E70C 2PUDA 1Y9DA 3VNRA 4YAFA 3I32A 1Q15A 1Z8DA 4AVYA 1KYZA 2KHZA 3MS2A 1D8AA 4KHZA 5AW2A 3PZRA 3WLQA 2MSCB 3QYAA 5E9JA 2WINI 4ZV7A 3ZZNA 4MR7A 1SD1A 3V6LA 4D25A 1MAVA 2ZVDA 2BLNA 4GBGA 1M3SA 1MABA 5E3HA 4EHJA 5BR8B 4V0NA 2JF0A 2YJ4A 5LD2C 4LV5B 4R1TA 2C9DA 2NLOA 3TD9A 1M74A 2IYSA 2C9OA 5AVZA 4NECA 2JJQA 3OZIA 1H3FA 2BGJA 3G17A 3QM1A 1C3EA 3OESA 4M0CA 3K1AA 4I6EA 1G8AA 3EVEA 4EG3A 2H06A 1KDRA 4JEMA 3DLCA 3LG2A 4PZPA 4RZUA 4MS4A 5AKKA 5TPWA 3K8QA 4W82A 5P8WA 4BGUA 2VDWB 1YASA 3RU3A 1NBAA 2XLBA 4WECA 1VKOA 1O0SA 2BGLA 3RANA 4BFLA 3ILHA 1OWLA 1CIPA 2P4SA 3IVRA 4ND6A 2EGHA 4BP8A 1DL5A 3EIEA 4WJLA 1GGKA 3BFKA 2XXBA 3DWEX 3MMSA 1W1WA 4W1SA 2O0HA 3KTDA 1FDOA 5FI1B 2R6HA 1NVEA 5ESDA 4M9QA 2OXRA 2NYAA 4GP6A 5EIBD 4AUMA 3DLHA 3TRFA 2YZNA 2P3QA 2YMQA 1P4RA 2FDRA 1MV5A 2XX3A 1L4NA 1WRBA 4IIFA 3EA4A 2QXTA 3HUEA 4LBWA 4TRMA 1JHXA 3UT5B 4M1KA 3BC1A 2L69A 2ICAA 3ROEA 1TVCA 2HHJA 2II6A 1CUAA 4OATA 4P7FA 1LW6E 2CNBA 2H00A 2W2OA 3DLTA 4KVAA 1C29B 5HIKA 3NDIA 4NS1A 4BXOB 2ZUEA 2ZPTX 3FFXA 5F35A 1IN1A 1RAHA 3N87A 5JDIC 2ORVA 3FOAA 3TSOA 3CNQS 4DMUB 1H2RS 3X1MA 2O3JA 4KDRA 3UAOA 4ENPA 2Q0SA 5HKKD 3FAZA 5EPEA 3QLVA 4CQLA 1FYWA 4B1FA 3GWZA 4HNGA 1XMJA 3PI6A 4DJ5X 1EM8B 3AVPA 3GEEA 4K9RA 1RE1A 3N7AA 4R41A 2A0KA 1B8OA 3HR7A 4EMBA 4QE3A 4BRUA 4PAOA 2CYAA 4J91A 2DY0A 4YCBA 2EJTA 4JUIA 2C4NA 3GRKA 2GI4A 3HDYA 3VUFA 1PJ2A 1VG1A 3ICPA 4L07A 4DLKA 1KS9A 1ULTA 1FUIA 2VPWA 3AI3A 2A94A 4NDNE 4BMDA 4I1PA 3ZD7A 5LIRA 2H3EA 3BZWA 1P4GA 1W5FA 3IT1A 1MFPA 3URKA 4HXFB 1NMYA 1C7FA 4FK8A 1KNXA 4J03A 4L15A 1BQEA 2DP4E 4PC1A 1Y3DE 4M8SA 3HK2A 1T4DA 2BEWA 3LBFA 2AJBA 5F5LA 1U8AA 1XKQA 3DQQA 4MUXA 3WQBA 821PA 3AHIA 1TAHA 2VJCA 4WLOA 2IWRA 3MMNA 2NO0A 1V9CA 3AIOA 4HDCA 3GZTB 2P9TA 2FJPA 5CIWA 3T7DA 1FNSA 2P1DA 1GKIA 4ILEA 1YS7A 4OQZA 1FZTA 3DYIA 2C2HA 3OZ7A 4HGPA 1Q0UA 4L8YA 3TKLA 4J3NA 4DLAA 5MN4A 5JEEA 1H5QA 2CHEA 3EVTA 4KV7A 4JJZA 5D51S 1DJNA 3B5IA 1JR3D 5FBRB 1U6JA 3DOEA 2NZYA 4CM9A 2IY8A 3EW9A 4ZT2A 1MTZA 3PQ5A 5BWLA 5JZOA 2PY6A 3TBFA 1QVAA 4EY5A 3I53A 1H2AS 2HRCA 1ZCZA 5AICA 2OSBA 4BO7A 4OI1A 5KU1A 4RV9A 1ZD8A 1UK9A 3C97A 3RHFA 1WXQA 2JBAA 3CRNA 1CTQA 4MWBA 4RXMA 1RMTA 3G13A 3STYA 1HLPA 2IJGX 2OCGA 4H3KB 1N3IA 2BT4A 2V59A 5D3KA 2VA8A 1L0BA 1U2GA 2GRAA 3GDWA 4Z86A 2MSDB 1L8OA 1AKWA 4TN5A 5DCYA 3OC0A 4MW2A 2ISCA 3R7SA 5JSYA 1WULS 1KH1A 3ZGNA 1GG9A 1VL1A 2XF2A 3HXLA 4R8RA 1ZGCA 4TPKA 3L8FA 5DIZA 4LI3X 4EUNA 4BNIA 5KCZA 1Y3AA 1NRJB 2Q29A 3IA2A 1RYZA 5CLHA 4HDMA 4MUKA 3QVWA 4HN4B 1SVKA 1B73A 3C7AA 5T3UA 2F3UA 5CVTA 2XKJE 1AU9A 2QROA 1FSGA 1OTYA 2XMSA 4CV3A 1T3SA 2ETXA 2HWWA 3HPRA 4EFDA 2TRSB 1U4OA 4KLAA 5JMTA 2HSDA 3VR6A 1DUIA 4ZVPA 3P2JA 3HSSA 5CXSA 5M5BA 1T3TA 4BTVA 4YAEA 2C9YA 1N3BA 1CFJA 2AUTA 1T3ZA 4I50F 1OLXB 2IU0A 1ZD2P 4WT7A 5LBUA 4CKEA 3EGXA 2G7MC 3G1WA 1I4TD 2G80A 3LT5A 4LOKA 4Q4AA 5F73A 4QWWA 1KYVA 2A57A 4P84A 1M5UA 2EKPA 1NJ6A 2DJ5A 3GT4A 3OFJA 4GX1A 5HF6A 5K03A 4PBTA 3G0BA 4BP9A 3HS3A 5F64A 4CCWA 2VUTA 2C8JA 2GXQA 5C4GB 1XVIA 3A1FA 4UTRA 2WQ7A 2CFCA 2VZ0A 1OAKA 4U7PB 1M0SA 4GRDA 2FEXA 3L4BC 1HFJA 1RWXA 2WLSA 3EQ7A 4GXQA 1ILEA 4KE8A 4Z54A 5CDYA 3Q3EA 1XXHB 1YR7A 1X3LA 2LIPA 2QXUA 2LE0A 3QI7A 2G08A 3QWAA 4CF5A 4I9NA 3BK1A 1IPEA 3QVKA 3Q7RA 4O5OA 4YHBA 4Z0PA 4IBOA 1O9HA 3ZWMA 2VC2B 4NE9A 3MTBA 1KQNA 4GVPA 1CEYA 5DM1A 2JC3A 4K9LA 4KMOA 1LPNA 1SCUA 3KJEA 4XB1A 3RU7A 5BY2A 2IDMA 1T5TA 3G82C 2OXIA 3ZU3A 4RZIA 4L72A 2QYSA 3UC9A 1U04A 5T64A 1E3QA 1XZBA 4M0DA 1FYXA 1QTNA 3MM4A 1TTTA 1VYVA 4RD1A 1KMQA 2WWIA 2VP0A 1XD8A 5ADUS 3RTDA 2CLDX 2BKLA 4TTPA 5DT9A 2RFLA 4NFLA 4DTCA 1IB0A 3NIWA 2X15A 4J7UA 1COWD 5GM2A 1A7UA 1U0EA 4O1HA 5YASA 4AG5A 3LL7A 4RFVA 5EJ6A 4MWGA 3CW8X 3EAQA 1DIAA 1FDUA 5ELMA 4M53A 4UMEA 3VTZA 2O8EB 5SZIA 4JQSA 2ISQA 4CIBA 1B0UA 2W6OA 2QMEA 4NYJR 2VUIB 5FOXA 3V8RA 1HR0B 3V33A 2D59A 5FWXA 1LSJA 1X1DA 1TLFA 5LNK1 1MO3A 1CS0B 3WGIA 3KPJA 1U7OA 3D7RA 1GU1A 2BCEA 2C99A 1C9KA 2LRHA 2Y92A 3LW8A 1W9HA 4KYVA 1SHTX 4N18A 1KFBB 4EGFA 1EFHA 2Z2JA 2W8BB 2ODEA 2VEOA 1P1HA 2I3DA 3R44A 3SX0A 2ZI7A 4WXHA 4DBLC 2BV3A 2HZ7A 3U7QB 5B6PA 4NZNA 3CVWA 5E9QA 1TLLA 4O33A 1RPZA 5E2IA 4ZC8A 2JK1A 4RK5A 4ZMRA 3C3XA 3HEMA 4EPTA 3BKXA 4Y98A 4KKXB 5L3ZA 1G5TA 4CF3A 1DC4A 4R9NA 2QNIA 4XQEA 2W2XA 4REOA 3FBWA 4HFJA 1CIJA 2VJOA 2YRWA 4IS2A 4IJUA 4ZZIA 3PSAA 5MDHA 1ISJA 4WLEA 1N5JA 4GO1A 4JJ6A 2C78A 1ZGJA 1H4TA 2IHJA 4Y67A 1ELOA 2B8WA 3GDHA 4PPNA 3Q3HA 4R6WA 4F9GA 4QTYA 1WU8A 4JENA 1YH3A 1FDVA 4R40A 3U13A 4EPRA 4XOIA 1U4SA 3EIHA 5JH7F 4WFKA 3QPUA 1YL7A 1ZEMA 2Q5EA 2A78A 1BDJA 1G2QA 1Z0SA 2BEKA 3C87A 3DB1A 3FYUA 3QVUA 4Y1RA 4A0GA 3LPNA 4B6OA 2JI9A 2YVAA 3CWQA 3OZVA 4HJRA 4EHBA 4FZ3A 2ZDGA 1ODIA 4G5QA 4BFUA 1JR2A 2HWKA 2WKSA 3R3UA 5DTQA 4QKQA 3TNLA 3JWJA 3RJ5A 3IPYA 3VU1A 1BJTA 1T2UA 1WX1A 3A3NA 3PYMA 4DIBA 4ENWA 1HC7A 2FW9A 4R0VA 2QPOA 4P22A 1G2PA 2XTMA 4LZAA 1RAIA 3TRIA 3UZUA 4R9VA 5KO2A 4K9DA 1EK1A 1CC1S 1JYFA 1XTQA 1ZW1A 4OMCA 4FOSA 5CGZA 1GT6A 1C0EA 3MRXA 3UAXA 4EVSA 4FU0A 4KE6A 1W44A 4LFBB 1FZQA 2QN1A 5E7QA 2QMZA 5F5NA 4RLSA 1P0FA 2J48A 3GP8A 3I5MA 2HNBA 4IUCS 2PMWB 4ZVQA 2WIGA 4DKJA 1HQYE 1SULA 2A33A 2PX4A 5GJVC 3SVLA 2W2KA 3NKFA 1CY2A 2IW1A 4DXHA 4EG8A 4AIRA 2GERA 2OGTA 1ZWLA 1GPBA 1XD2B 1J1ZA 4OFXA 3VHXB 3AR5A 4LGVA 4MYSA 5DLDA 1G1AA 1Z6TA 2WWHA 4FJ1A 4BJ5A 1MB3A 4LTDA 4AY2A 5TNXA 1MTOA 2BUBA 1R6VA 3OJWA 4G0NA 4DDWA 3LK6A 4C7JA 5AQEA 3JQFA 4MR7B 1YFLA 2DPGA 1X14A 4J76A 4A91A 5LYJA 1EIZA 3WK8A 3JWPA 2VF5X 4TTJA 1MABB 2QZJA 4ACBA 1CZKA 2GHRA 4KTTE 4LNUA 4HLNA 4M1WA 1CUVA 3SJCA 4B32A 1P4JA 5HM6A 1KDTA 3RUIA 3DWGA 3TEMA 4IH1A 1XAHA 2QMOA 4PHCA 5KYUA 3RHTA 2BI8A 1K2WA 1OX4A 1KO8A 3R0ZA 1DOZA 1UEXC 2BN4A 5J9FA 3RFTA 1SUAA 2NIPA 4CF6A 3ANNA 3DHVA 3IR6A 1LSSA 4J3FA 5TPWB 4MS4B 3P4XA 1NVWQ 1AE1A 1GY8A 2D4HA 1W47A 4G2TA 5LLSA 1N2ZA 1PDWA 1J00A 3D3WA 3MJVA 4XA8A 2W00A 5KAPA 1K4KA 2CFIA 2ZIVB 1MXFA 1J22A 2WTMA 4GBJA 3T54A 3I23A 4QPZA 4GQBA 3PQEA 2FG6C 3Q9SA 2XNCA 4JR2A 3BZUA 4YEDA 1UWKA 2L82A 2HHAA 2EL7A 2Q4TA 4PLPA 3ZJYA 2H2WA 1PFVA 4OM8A 4XWWA 4A3SA 5L4LA 2HKIA 3GQBA 3HCAA 4B2IA 3WWEA 4FOLA 4Z9FA 2I4MA 4YALA 1DEHA 2G0AA 5IU6A 1DJLA 2F17A 4M60A 2GZ1A 1XTPA 4JIMA 4UAUA 1P4HA 5JOQA 1VLHA 2PRJA 1QONA 4W5RA 4FIZA 2CJPA 4WUTA 4Q01A 4CMGA 1KU6A 1P1FA 4OGGA 4CWAA 1MJNA 2HPZA 2QPLA 2BI4A 1DXHA 3DOOA 2ATCA 4LYAA 3GJ8A 5CPBA 2QD2A 3OE4A 2IS6A 2F9MA 4RIFA 2YXNA 3JALB 4O2AA 4N47A 2AB0A 3GIDA 4NH4A 4Q3OA 4X8OA 3SEZA 1O2DA 3TGPA 1USGA 2GA9A 1BCRA 1WZNA 1NVBA 3DCNA 3HGMA 4QNRA 4CQLB 2GK7A 1P80A 1IC6A 1M6VA 2WKPA 3ZVRA 3OQIA 1GTMA 3FNGA 5CRIA 5IYZF 4UMDA 4B17A 2XEDA 3HCFA 3JCZA 4BEJA 4W5WA 2C0PA 3ZYZA 4WFQA 2RE8A 3HUTA 1RKBA 1V7CA 2ODAA 5KC8A 4YJDA 3LFHA 2PDAA 4RGVA 2AWNA 3K15A 2GJKA 4QQRA 3G68A 1WEHA 1BFDA 1KVRA 3OX2A 4I4IA 3WLAA 3ZLTA 2JAHA 1V3TA 3GJ6A 1LC3A 4IXNA 4CMJA 4JQCA 3EZNA 4D5GA 4ER7A 5TIIA 4P3NA 2X6QA 4DW8A 5LKRA 4R01A 1F0NA 4XB2A 1V11B 1TK9A 1UPBA 4QLAA 4HDNA 2IEAA 3DXXA 4ACAA 1QC5A 4IHJA 4XOUA 1UAGA 1Q7GA 2BEWB 2XSZA 3C24A 3KQYA 4M1SA 4S1PA 3CTMA 5D7NA 4A6DA 4C6SA 2P4HX 2Q6TA 3OPVA 2O6HA 4BX8A 4BEWA 2R86A 1XZCA 1RRFA 1AKUA 4D02A 3VAAA 3R9IA 1N6KA 3EZ9A 4LZOA 3PC8A 3VVMA 2XUQA 2IGTA 3GELA 3O94A 4W1QA 4ZJZA 4PYNA 1AMNA 1MC4A 4TMKA 4O08A 1JWAB 2PUJA 4PG5A 4ZDKA 1NC3A 2AC2A 2GAJA 1Y5MA 4KLNA 4Y6QA 1L4YA 1O96A 3NIGB 1JEJA 2Z5LA 1NNUA 5FWAA 2P0EA 3QF7A 1VSTA 1CJTC 1EB8A 3QV1A 4NEHB 1V7ZA 1KORA 2FPPA 3FMOB 1AUQA 1U11A 2FQYA 3C4JA 2WC1A 5T4HA 4FBLA 1RXVA