3DC7A

Crystal structure of the protein q88sr8 from lactobacillus plantarum. northeast structural genomics consortium target lpr109.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
213
structure length
213
Chain Sequence
HVSFKRPAWLGDSITANNGLATVHYHDILAADWDVERSDNLGISGSTIGSRYDAMAVRYQAIPEDADFIAVFGGVNDYGRDQPLGQYGDCDMTTFYGALMMLLTGLQTNWPTVPKLFISAIHIGSDFGGSFSAVTNGLGYRQSDYEAAIAQMTADYGVPHLSLYRDAGMTFAIPAQAAIYSVDTLHPNNAGHRVIARKLQSFLDSHFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein lp_3323
publication title Crystal structure of the protein Q88SR8 from Lactobacillus plantarum. Northeast Structural Genomics consortium target LpR109. (CASP Target)
rcsb
molecule tags Structural genomics, unknown function
total genus 62
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3dc7A00
2WABA 1VJGA 1JRLA 5BN1A 4Q9AA 1BWPA 1ES9A 4JJ6A 4JGGA 4JHLA 3DCIA 1J00A 1ZMBA 3P94A 4LHSA 4IYJA 5CD9A 4OAOA 4M8KA 4PPYA 1IVNA 3SKVA 1U8UA 5JD3A 3MILA 2HSJA 1Z8HA 1FXWA 1ESCA 2W9XA 3BZWA 3DT9A 4Q7QA 4TX1A 3KVNA 4K7JA 4I8IA 1FXWF 4RSHA 4JJ4A 1DEOA 3DC7A 4H08A 1WABA 3U37A 2VPTA 1ESEA 2Q0SA 4K3UA 1DEXA 5HOEA 3HP4A 4RW0A 4K40A 4K9SA 3W7VA 4S1PA 4HF7A 1VYHA 4DEVA 3SLRA 5A4AA 1K7CA 3DT6A 4HYQA 4OAPA 5B5SA 1BWQA 3C1UA 1PP4A 2O14A 4XVHA 1YZFA 1ESDA 2APJA 4NRDA 4JKOA 1BWRA 2Q0QA 2WAOA 2WAAA 3RJTA 1V2GA 3DT8A 3PT5A
chains in the Genus database with same CATH superfamily
3LRPA 3MT8A 2Z08A 1PNOA 5MN6A 4NYJQ 3AZPA 4L57A 2ZJAA 5TGZA 3OTIA 4D3DA 1B93A 1PJQA 3PWTA 3UHOA 1GT6A 3ZNPA 5C35A 1Q5PA 4AG6A 4BMVA 4GS5A 2Z2XA 2LTAA 1JP7A 2B8TA 4R05A 1R66A 3HPRA 3PJFA 4YJDA 1P44A 1DJQA 4KWCA 3QLUC 2H18A 2H3EA 2CD7A 4KX5A 4W7HA 4YJHB 3QWFA 3OZTA 1QYDA 2FPGB 2D0OB 2H16A 2XT0A 4S24A 1HE4A 5LOVA 5JCXA 1BOOA 1OI2A 4FCVA 1X15A 4WFJA 1V5EA 3CPHA 1AQJA 3WAJA 2RAFA 2CMGA 1YDMA 5G3YA 2WKPA 1GKYA 2Y0EA 1WLYA 2CV1A 2B69A 1U90A 3A1CA 3KKZA 4OAOA 2A7QA 4BMNA 4UARA 4TWBA 4P7JA 2VYNA 2DULA 2O7VA 2WF6A 1BCRA 3LUAA 5E2IA 4OI1A 3MMXA 3TIIA 2O8FA 2J08A 2JKVA 2VPZA 2ZYGA 3JAKB 4JP3A 5CEEA 1V16B 2H11A 2DQ4A 3NW9A 1G4AE 1XLVA 2CY0A 2ZUBA 2J3HA 1PJAA 2IQ5A 1SPXA 3MNFA 2XCTB 2UZIR 4Q02A 4MP3A 1W5BA 3WKBA 3SBOA 4C1NA 2WE8A 3LXRA 1KSHA 4C4AA 1K97A 2V45A 4A8PA 2IY9A 3PTLA 4UJ3A 1N2HA 3ZZUA 4B76A 1QF6A 1KQGA 2FN8A 3HVKA 3VYTB 2P0AA 3C6MA 4N39A 3HYCA 5AM0A 2QLNA 4UE3S 1NQWA 4CDMA 5J2TF 3G0OA 5TXGA 4CM9D 5EWLB 2TMGA 2B1QA 3DL2A 3GWZA 4N5HX 4S1OA 5IX8A 1DAMA 3ZDCA 5CDHA 2GH1A 4OMDA 5F1YA 3GPBA 4F9FA 4UUBA 2VTBA 3IBGA 5C34B 1YQDA 4N3NA 1TGYA 1WVMA 1PWHA 2Q9CA 2HY7A 2NVUA 1EBBA 1B0ZA 3BSFA 5IAEA 1M8KA 1X1SA 1BH6A 4V3BA 5DXFA 2ZT8A 5KYXB 5M04A 3PX3A 2UYOA 1CJVC 2C7GA 1U94A 1YR3A 2HSGA 3CCFA 1T5BA 3TNJA 4OATA 4ARCA 4DBZA 1PT8A 2X6QA 1XTKA 4US1R 2VQ6A 2GBPA 4AQDA 1GN9A 5MGBA 1QQ5A 2AYZA 4LZPA 2RC5A 4FS3A 3SMQA 3AI1A 1DLJA 2XJ9A 1OPRA 2JRLA 1AZTA 2Q4EA 4QULA 2G70A 1WXIA 3QA3E 1W2WB 4IIJB 4WKNA 4DCTA 3LQKA 3GMSA 3N2KB 4EELA 2CLSA 4KXQA 3IOCA 1EQUA 3A1TA 3FIJA 1L7NA 3A6FA 5D1NA 5FHQA 3SVTA 4QUKA 1E4OA 5TMPA 2GCOB 2I87A 1YS7A 2BHRA 4QATA 2VDVE 4MH0R 3ZNQA 2A9KA 3IKTA 4QGFA 5EIAA 2QGNA 1JE0A 4WGGA 1X8LA 2BMDA 4Q3EA 4XWOA 4KDCA 1Q44A 1F8GA 3O03A 2A1TR 4NCAA 3QUTA 5BR1A 3KZOA 3AK4A 4I9UA 3FFTA 1AA6A 5A7FA 1E3LA 2YKGA 2HA7A 5I7WA 4ZEMA 2GDJA 3ZV4A 2AF4C 2OP0A 1KVRA 1NBIA 1XQYA 2PGDA 3BRQA 5CMLA 3S1LA 4AWAA 5KU7A 1U1GA 1FW8A 2CDAA 2HD4A 3O9VA 1LPPA 3A6DA 4LEIA 5PGMA 3SZMA 3OMLA 5AJHA 5CFOA 4IMRA 2XUFA 5TPZD 3GRYA 3PDHA 1RHQA 3QU9A 3FSJX 4JGGA 3TDMA 4BYMA 1IZ8A 4H7HA 4WWHA 4G24A 1BDMA 5KVAA 2V7GA 2WIDA 3DVSX 2IU0A 4JSTA 3ADDA 2WU1A 3W7BA 1P0FA 3WV4A 2G25A 3ORFA 2I34A 4FR5A 2WIBA 3G9ZA 2V7QA 5KOHB 5IP5A 4CKEA 4KSCA 2B6HA 4G0MA 1C0PA 2GPBA 3ND9A 4ZQBA 3D8UA 4ZDJA 3HO1A 4XIFA 2E4XA 3BHNA 2LV8A 2H52A 3VSAA 1OY1A 1YVPA 1J09A 3N0XA 3PD0A 3EXEA 1A8UA 1P8AA 2AJDA 2BM0A 4XPZA 4CFSA 5EJ9A 4CU2A 4FT4A 1AMOA 2HK6A 2JGLA 2DP4E 4OJTA 4TMXA 3E3OA 2YW9A 3BIFA 5GAJA 4A0GA 4DJAA 1X7YB 3AF6A 4DHEA 3PEEA 4LSGA 1QGDA 1EUDA 2P0EA 4KAAA 2CYBA 2ZVDA 2VOEA 1IK4A 1W4AA 2E82A 4N0QA 1OV6A 2VBFA 3GJRA 1GZ4A 4ZPXA 4IY1A 1KFCB 5KJEA 4UW9A 4DVJA 1XD2A 1H4QA 1K4YA 2WJVA 1YUMA 3M6IA 1IONA 1AXEA 3IE0A 4UFNA 3AM3A 4ARVA 3TDKA 4EG1A 2FN3A 5ICGA 3IC5A 1DBIA 1LVHA 3J81A 3JQCA 4WACA 3TZKA 3ACDA 3DULA 1H69A 1WSWA 4DQVA 1G8FA 5ALPA 4EZEA 3UK2A 4Y6GB 5LA6B 4D8XA 5LIPA 1IPEA 3S0JA 4EHAA 1VG9B 2H7CA 2J3MA 1UMDA 1YU6A 2VBIA 5H81A 5J40A 5JTTA 4UVDA 4D0SA 3ZHXA 2DETA 1DAKA 1QF7A 1O8BA 3TAHA 4MDFA 4X65B 2FF5A 5ALVA 3UAZA 1Y3BE 5FL7D 3O4VA 2VA9A 2GZDA 3H9BA 4Q15A 5DRTA 1NMSA 2I03A 3EDOA 5ENVA 4GPIB 2B3TA 1QS0A 2FE4A 1FTYA 5HCNA 3DGFC 3DAGA 1WZIA 1UWKA 5CVCA 5IHXA 3KTOA 1XNHA 4C03A 1A2QA 1SKYE 2L19A 3PNOA 3THSA 1G8YA 5AM5A 2PY6A 4YJGA 4XASA 1T3HA 4B2YA 4OYHA 2XQKA 3R0XA 3AMVA 2YMQA 1CVRA 1NBWB 1Z36A 4MUJA 3A0RB 3FTCA 3NRJA 2IYRA 4IVNA 3E48A 4O02B 4IJMA 4RFLA 2QBYA 1UPUA 3JSAA 4Z5XA 4CF5A 4A16A 3VU9B 1SVUA 6AT1A 3T5BA 4HDRA 3CY6A 3ILVA 3KR0A 1LV7A 3U7QB 3G2PA 4KLRA 4B6JA 1R5NA 1TYAE 3RYIA 5C7OO 2XB2A 5JH7B 1ZM9A 3AHFA 1EQ2A 3UV7A 1MT3A 2EXXA 3DFUA 3Q7EA 3F8TA 4TXHA 2EW2A 2Q1WA 2DFNA 3RIYA 5FTMA 3EW9A 4LX0A 5IZ4A 2A0WA 2ONYA 1RI2A 4RJTA 2VL7A 1D7OA 5KYWA 3C3KA 3IUSA 3ND8A 4IS2A 1GG2A 3HMKA 1V4VA 2HF7A 1G6HA 1M8FA 3L43A 4EAAA 2QROA 3ABSB 4PPFA 5LIRA 3RAJA 2OE2A 3WLNA 3PRKE 3EULA 4NBVA 4R2MA 2DT8A 1W5SA 3SLKA 1ODJA 3KVOA 5C7YA 2D00A 2VP9A 3M1YA 3C41J 2JLZA 1S8AA 3EQ9A 4FD2A 4BLUA 4HFNA 1V5FA 1NF3A 3R2JA 1JIKA 3WLSA 3AZOA 1PFVA 6GPBA 4MWTA 5GGXA 2ZDHA 4X7RA 1SM4A 4WNIA 2F3RA 2JAUA 5LFAA 2CVFA 1AS2A 1I4EB 1IMJA 2PS0A 3PJGA 1U0JA 3DMTC 2VG8A 4Q9IA 5LP6C 3WL4A 4IDAA 1IDOA 2QTAA 3ZYCA 1X7ZA 4MRMA 4CM8A 3X1ZA 3S1SA 3MINA 3KPVA 4IFEA 2BKUA 4Y1EA 1IQ0A 4E6EA 5KTMA 3E1SA 1D09A 1C30A 5KHOC 2IUFA 3UJBA 1B8UA 2B83A 2FFAA 3AM5A 3PFHA 3FCOA 1E6CA 1OB5A 2X2PA 3LP6A 4JYCA 3URKA 4AMBA 4BBZA 1ZH0A 5FEMA 4MQFB 2FJPA 3EB9A 2O3TA 1QK4A 1KU6A 3UENA 2HXYA 1Q16A 5GVSA 2ZJZA 1UL1X 3CNOA 3M34A 4MCIA 4RTQA 2KW5A 1N2IA 5KPJA 4F96A 2GARA 4YAOA 2VZ8A 3RYHB 5E3HA 5AJWA 1ZHFA 1U8AA 2G5CA 4F4FA 1NXQA 2QRHA 1VJ0A 3LUKA 1XHFA 3SVLA 2YBDA 1WU8A 3NBUA 2BTOA 2C1EA 4B46A 1NF9A 4BP3A 3G0GA 3RS3A 2JC3A 4CIYA 3NAQA 3N6VA 2AMLA 2IXDA 1MOQA 3DC7A 3DLCA 3FROA 4KLZA 1ADFA 1DHTA 4IDBA 1UZMA 2MYUA 3NU1A 3PNSA 2G8LA 2L2QA 4UBNA 1INLA 5E9AA 4YK7A 3ZC3A 3BPSA 3AEXA 3PGA1 5EA2A 1HQDA 2DCMA 2JFVA 2L0XA 4NAHA 1DWQA 3WE7A 4EG6A 1ZL0A 3GFQA 4F11A 5F21A 5KX5A 2YFQA 4I9GA 4PIPA 2PZFA 1OYVA 2QPLA 3V1MA 4XKJA 3CV3A 4DYHA 4EEXA 1HDXA 4LQCA 1DC6A 5FR2A 4QD3A 5AD1A 5A0TA 4FMCB 1KKLA 1XMPA 3IR5A 4OI4A 5DWQA 3FHLA 4PLWA 3HDVA 1KEKA 4IGAA 2JA2A 2VEOA 2KB0A 3AIOA 3DJFA 3GRPA 3B6MA 3PTAA 4R2KA 3AR9A 2Z5FA 2XADA 1WSBA 2WJ4A 1SOUA 2W6IA 2QW0X 2X19A 3QU2A 1PEYA 2JG3A 4HDMA 1TT5A 4L8FA 3S44A 3U13A 3UWDA 1XNQB 2BHNA 4DT1A 1DX6A 2A9PA 1GGFA 1R2QA 3EF0A 1QG0A 4BUZA 3AJ9A 5DYIA 4AMGA 1KAOA 1QO9A 2YHIA 1OZ0A 1X3LA 1X86B 4RORA 3UKOA 1S0UA 4PSKA 3DT8A 4DCSA 4OLFA 4EUFA 1TU3A 2M98A 3RFUA 4MUYA 8MHTA 1WEKA 3DEAA 2A9QA 2V3VA 1OBVA 5AUOB 3OSZA 1X39A 2V6IA 1HFJA 4ZOLF 4ZOAA 2REBA 1AJEA 4BB0A 1QV6A 1E4EB 1TUEA 5JCJA 2A8YA 2EYQA 4YWJA 1DKUA 1LW7A 3D9QX 3WLAA 2VPXA 3D1JA 5CJPA 2ACVA 3QOFA 4G4GA 3T9BA 4JBLA 3EDQA 1WM1A 2W37A 3C5WP 3SYMA 2DFKB 5JY6A 1GTMA 5LQDA 3R5XA 1L5HA 1DRUA 3B3AA 3H9CA 1I7DA 3L7YA 3TVYA 2DHEA 3GJ7A 3O84A 1DWUA 3ZLBA 3NBYC 2PYZA 2R1UA 3K72B 4A2WA 4TVSA 1RWKA 3BM5A 1XNRB 3D8TA 5F7ZA 1W52X 3V2HA 5L6MB 3KTAA 3EF3A 5K3SA 1JH9A 5IC5A 1EJ2A 2JASA 2GZHA 4KH0A 4WJLA 5I5EA 3ZQ6A 3CCBA 3NUZA 2GZSA 4GBED 2WJJA 4J7CA 3N87A 3LK7A 2P7IA 2FLKA 1ULBA 5DEOA 4RHUA 1ISRA 1VKZA 1XVUA 4MLPA 4D5EA 1IY1A 2B37A 1L4FA 4X64B 3HXPA 2J3LA 1N7JA 3FCUB 5DTMA 1F2TB 3V6MA 4LJYA 1T29A 2D1RA 5BSVA 3R8FA 4AUNA 1D6JA 2HA4A 5IH7A 5JNTA 1MH1A 2NV0A 3M81A 3UF0A 4C4ZA 3VYRB 1HL7A 4Y2PA 5CCDA 3AFOA 2IQIA 1Y5NA 4M6WB 4FDLA 2NSDA 4MIKA 4EO7A 5JYBA 2WICA 2PLWA 3F9IA 4HWTA 1R12A 3FI9A 2AT1A 3EGOA 2CHVA 3B7GA 4CG2A 2F3TA 3O8CA 2Q9UA 1EXMA 3F49S 1ZUIA 3H5LA 4JUAA 2REXB 1K7XB 4TVBA 4Q1EA 1F51E 3HYRA 4DVGA 5BOSA 2PUGA 1PZEA 2VXCA 4IHKA 5LZ9A 3W5BA 4YT8A 1BX3A 1EVJA 2C4NA 4ZEVA 5IDWA 2I6SA 1ZD5A 1P62B 4Q3OA 4KPFC 2CNOA 2JI9A 3CZQA 1O03A 2C3PA 2Y9PB 3CEPB 1HMPA 3Q41A 1PS0A 2QR3A 4G1EB 4K40A 3EF1A 1EFHA 1FDSA 5BSHA 1NVDA 1Z28A 1T0IA 4IILA 3CQ9A 3N9IA 5EJGA 2XW6A 4DEVA 4YYZA 2BGJA 3PPIA 3HH8A 5FBWB 3ZG6A 1RRKA 4YS6A 3W8RA 5DKFA 2JGKA 2A0FA 3X2FA 1ZVMA 2QMOA 3O38A 5DM1A 4CM7A 2JLXA 5JALA 3EZGA 4QTUB 4Z51A 4R8VA 2PKQP 5HK8A 1CD5A 1PFUA 3FGZA 3W9UA 2VHZA 4KMOA 2N0SA 3E8XA 1ZG3A 4BU0A 4UM8B 4G0QA 3GNQA 5HUHA 2C2OA 5CJJA 3BOSA 1J49A 4RJJA 5AJUA 1P77A 2RGGA 3ZD6A 2QRJA 2EGGA 2EP7A 4QAQA 4DV1B 5JATA 4IQGA 1PNRA 1KO4A 1EDDA 1G42A 1KRHA 4LC0A 4N8DA 1D4ZA 5D84A 3SP1A 2R7KA 3AEQB 4I5GA 1R6BX 3C1OA 3MT7A 5EPOA 3TTVA 1RQGA 1Z2CA 3ZN2A 4CV1A 4N54A 3V4FA 5M3BA 2Q21A 4DM7A 2IUTA 3D6TB 1YE3A 3QLVC 1NYLA 3KR9A 1DIHA 3TN7A 1QHFA 2MSNA 4DMHA 1IQPA 2FDCA 3S2GA 3G85A 3BSYA 5K5EA 5KOJA 2RKWA 4LOAA 1WXEA 4O6VA 3R9KA 2C0PA 3IAXA 5KQPA 4ZYWA 2YDXA 4N47A 3UAOA 5FLYA 1CUWA 4C0BA 3E7WA 1A96A 2FSHA 2YWHA 3GMTA 3PQ7A 4RV5A 4JP5A 1SU6A 2O3RA 1H93A 1RXVA 5EHNA 1Z33A 4IV8A 2FPKA 4BJ1A 2VNAA 4GRAA 2WFLB 4CCWA 3KYDA 3EY9A 3GAZA 3WNCA 3O3OB 1RRVA 2PQ2A 3ORHA 4PGGA 2QTLA 5EPUA 4B3GA 4GFDA 3M6WA 2C7VA 5BT8A 2F3SA 3GEEA 3RWBA 3ZDYB 4S1TA 2I4TA 3LBFA 4DILA 3R7SA 2GYVA 1TQ2A 4LRWA 1ZO8A 1CF9A 3IV6A 4G9BA 2Q50A 4C01A 5BSKA 3ZU3A 3WZ2A 4MHTA 1W1WA 3UOWA 4PHCA 3C3DA 1DV2A 2CXRA 1L4YA 2JJYA 2RHOA 4KE7A 3SHWA 1ZMXA 2GBLC 3BMOB 4NMHA 3WGHA 121PA 1JHPA 1ZOPA 2NVWA 3P27A 3L0BA 3I5XA 4PC1A 4FYWA 1KO7A 4JITA 4OQPA 3KVNA 4LK2A 5DISB 1U7OA 1Y6ZA 5BSWA 2LCFA 3HYSA 1QUFA 1KZYC 2BJWA 3Q3JB 4UBJA 1IHPA 4LWPA 4BN5A 5LR6A 4QUDA 1UR5A 3I5MA 4J94A 4NYMR 5AKZA 5D00A 1S1MA 1KDZA 3RGWS 4C0AC 2X6RA 3CT6A 1P1IA 3II6X 4DJTA 4ZJPA 4QXQA 4L8WB 2GCNA 3ELBA 1SUCA 2ZWPA 1Y0BA 2XDWA 2ZBFA 3PUXA 4TV8F 3VNAA 3BEOA 3F6PA 3BB1A 1WXXA 5J4VA 1G3MA 3L0YA 5IJ0A 4IIYA 2BFCA 2H5IA 1TCVA 1RP1A 2PXCA 2QVYX 3RUHA 1KQFA 4JFRA 4PZZA 2PXAA 4HQ0A 1R8YA 4XFDA 1V39A 3AF0A 3KCNA 7REQB 1HQYE 1NU6A 5K3FA 2HWUA 4OIFA 2H9AA 3QVMA 4M38A 1HPLA 3KT8A 4O8ZA 1IY2A 3N8HA 4PLFA 4RABA 2M6LA 5JIBA 1K8YB 1QX3A 1SIBE 2JH3A 3ZX5A 2I6UA 4BWVA 3WAGA 3DBOB 1WWKA 2WSMA 3L93A 3IE1A 1J8FA 1MO2A 4KV7A 5HJ2A 4OEHA 1JKIA 3B60A 4UCQA 3IT2A 3JYOA 4GZMA 3RPEA 5JZ9A 1E6KA 3AF1A 3PXUA 3NVAA 3KQVA 3ZHUA 2I7CA 1MQ9A 9LDBA 1UJ4A 3Q3CA 4FPXA 3QU4A 1YB4A 3EYWA 4NNJA 1FYFA 2Z8ZA 1XZQA 3A9CA 4QM6A 4TUYB 3L0DA 1PFQA 1U2SA 2W2MA 2ZU6A 3LWNA 4L8LA 1F1JA 2GVNA 2QXYA 3WA6A 4DSTA 3JSXA 2V5VA 4MEBA 3G5LA 1AKEA 3LQ1A 4MKXA 5DGXA 1CZLA 2JFYA 4AJ2A 3VDMA 3BXPA 1TO6A 1WPRA 3M3DA 1HETA 1DIBA 1MOSA 1WXQA 2I8AA 2CJXA 2C4HA 1V26A 2QRGA 4XR9A 3ES9A 5JVDA 1SELA 2VDUE 4WBNA 3M3HA 4PCAA 2H7YA 2PKWA 3BORA 3GLRA 3NONA 5LC1A 5KSZA 3H3FA 2H4XA 2QUAA 1XF1A 3WICA 2OFOA 3BDIA 4AJNA 1XJ0A 1XVLA 4L4ZA 4PCVA 1NR7A 2GJ4A 3UIEA 2RAPA 1W9HA 2FF7A 3I9FA 2DR2A 4UVEA 1IBMB 1Y8RA 1PWEA 4HH0A 1PD1A 1UBEA 3G5AA 4ZVUA 3AR3A 4AUEA 4FJ1A 3PFWO 4FYHA 4IDQA 1DRJA 3FB1A 2BMJA 1QQ6A 3DZKA 1ATIA 4RNCA 1ODIA 2W00A 1MV5A 2ZB8A 3TIFA 1RRMA 3UMCA 2FDXA 2WK1A 1YONA 1QVWA 2BKEA 4MROA 4O4LA 1CZOA 4Y1FA 3VUFA 2NO6A 2GZ1A 4EIWA 3IP1A 4KQFA 3MILA 1U2DA 3HCBA 4FZ5A 4L85A 3PQEA 2EARA 1TT7A 2J33A 2QQ0A 2RFLA 4V24A 5DP1A 5DRYA 2R2GA 2HYDA 3IQHX 3IMKA 3OFJA 5JI2E 5FKJA 1GPLA 2OCKA 3GLSA 3QKUA 4QYTA 2C7RA 5ITSA 3O3MB 3DAPA 3P2MA 5AMXA 5LU8A 1G5RA 4ENUA 3GNLA 2BKLA 3LXXA 2VBCA 5DHPA 3A4MA 1U8FO 1ZOIA 2EBHX 1RM4A 3NVKI 2AEMA 1COWA 4B4DA 1OH5A 2BGUA 4IBOA 4QHSA 2ASEA 5KNBA 3HU3A 4RVCA 4XYBA 1UOOA 3MBIA 2Y4OA 2G80A 2QD5A 1LNZA 2XPCA 4DLKA 1GG5A 1SKAA 3CUYA 1VKHA 3CZPA 1TC1A 5C8YB 1Z6YA 3LDGA 1WEHA 1NJ1A 1S1CA 2HLDA 4RY8A 4LYEA 4YNBA 1LS1A 2PAFA 2OGWA 2HHCA 4J4TA 1C8LA 5LWQA 4JVOA 4Z8XA 5DN9A 3AXSA 2NZ2A 4PSDA 3S1AA 2EL9A 2X2OA 3K4PA 1TKRA 3LM8A 2JB9A 2ZKIA 4FYMA 1RJFA 2GJKA 5DHFA 3LHSA 3LBHA 3E8MA 2PZKA 3FSGD 5DNDA 3ER6A 3NIDB 3SHOA 3I6MA 4J3JA 4C0LA 2HWYA 1CR2A 2BFWA 4FK8A 2XCSB 2EW8A 4DC9A 3L6CA 4YO7A 1QK3A 4DJDC 4RK7A 5FPTA 3TFWA 1U0OC 2Q1TA 1L5OA 3AQ4A 3KFXA 3NIFB 4KBFA 4Q3CA 1IZ9A 4KIGA 4JYMA 3TQCA 4CL0A 3GBPA 3FPEA 3N7UA 4NBLA 4F86A 2QAJA 2VK8A 3O4GA 3ZGZA 2ZJBA 3OU2A 4BN0A 3DOEA 1JVNA 3SMVA 3K4QA 1HDYA 1CXZA 4F3YA 1NMYA 1S2OA 1K5GA 3DLTA 1E9EA 3RS8A 4REQA 2ZCVA 4JKOA 1J56A 3U40A 3H9QA 4G2TA 2WUFA 3QUBA 5H0IA 3THWA 2X2FA 5IARA 5A4DA 4UHCA 3HQ4O 5KQRA 3U44B 1B6GA 3ZW7A 2B0JA 4PO9A 3RS2A 2IEZA 4G8DA 5BP7A 3TOSA 5TQ0A 1ICIA 2HDWA 5TJHA 4HLQB 4HUQB 4N3AA 3TOXA 2XYPA 4AIIA 2HTEA 2CBGA 3QTTA 4HMQA 3BERA 2MIIA 4UBKA 1IATA 1HURA 2RHLA 3QEJA 4MI6A 2G40A 2OXEA 4GMGA 5LQAA 3UBTA 1QIMA 5JFTA 4MVJG 1WHSA 2FZ5A 3EASA 2QTFA 2I66A 2RGUA 3F47A 4QPJC 2J45A 2OK8A 3I9JA 4MQ5A 2RI0A 2XUPA 4LZWA 4MV8A 1USWA 4GI3A 1IEXA 2YWRA 4WCFA 1SHZA 5KVQA 5I47A 5K8LA 2ZETA 2H1CA 1YQQA 1RADA 2WFZA 3FOZA 2H17A 2JGAA 5IWCA 2AK3A 4ALKA 1Q84A 4L3WA 2HPHA 2RGWA 3L8ZA 4PNPA 1QHXA 4KO2S 3T52A 3NJ4A 1PK9A 1RJ9A 3G82C 1Z29A 1U0FA 3E84A 2PX6A 2RB4A 1ZOOA 1KA9H 3GG2A 1J0BA 3L6BA 4DWVA 3ZCXA 4DXDA 3HJUA 4FQ7A 4QRDA 4RQAA 4OO3A 4DWWA 1XTIA 3WQRA 1P2GA 2XV1A 2GX6A 1FXWA 1T15A 1FNSA 3HO6A 5CLJA 1Y5IA 1XXLA 3PEFA 1IG0A 2IH4A 4YGYA 1YZVA 3ZI7A 3AF2A 3A9SA 4MVJF 3NASA 3T3IA 4R7TA 4DBVO 3NTXA 4CF7A 1E60A 3H04A 1EH5A 1I6MA 3E8SA 4E5SA 3HLYA 3Q3IA 4CMBA 1Y3IA 4EGFA 3K15A 3MB5A 1P5ZB 4WZBB 5M7EA 3V7FA 1F8YA 2P2GA 3KWMA 5IVIA 1TKCA 2RGNC 3CU5A 4COKA 1C3JA 2FP4B 4LRUA 3PQ5A 4ZU6X 5A4MS 1LPOA 2NTJA 4BMSA 3SS7X 1YB6A 3JARA 4Y6SA 5P8WA 1GCAA 4ASUD 2YH2A 1OKKD 3W04A 4TN5A 3DKVA 4G1VA 1P5RA 1VSQA 3ZX4A 3QBJA 2X8BA 3F6RA 3GFFA 4PZPA 4BWGA 1GNSA 2JK1A 4I2VA 3UTDA 3X1JA 1N25A 2O2HA 4LZZA 1PWXA 3QI2A 1ODLA 1WS6A 2Y1WA 3DTVA 3QWAA 4K2AA 1VE6A 3B1YA 5FUWA 1UWCA 1XTRA 2I62A 3SNKA 1MJNA 1P5JA 4UUPA 1CQIB 5AW2A 3GLQA 1MO4A 2WP0A 1J97A 2PL1A 2XTZA 2NUTB 4P9NA 4BO1A 3DQQA 4Z3DA 4DR3B 5I01A 2BM1A 3WGMA 2J07A 3PNKA 1O5IA 3FPKA 16PKA 1W88A 421PA 1GGVA 4BAZA 3WGVA 4UUNA 1ZR2A 1JNXX 3V42A 1PNVA 4P7GA 1FVHA 1NF2A 4OLJA 2K4MA 2O05A 2C2WA 3K0EA 5B1EA 1Y7HA 1KS2A 3KR2A 1EM8A 3QMVA 3ZU6A 1XEXB 4IXTA 1I9GA 2D8MA 3UKDA 3WLFA 4N40A 1E7YA 2W8ZA 5GONF 2DY0A 4EVIA 3AFHA 4MPTA 3K0AB 4HLNA 4EBBA 2RARA 1LW6E 1STOA 1XRRA 4RETA 1E3WB 3AY0A 4YRRA 4MW9A 5FNVA 2FZVA 3AEUB 1DG3A 1I1OA 2O2GA 1ADJA 4IHJF 4DSUA 1QHIA 2AEEA 4PS0A 2DR3A 1W4BA 1UWVA 4Q24A 3T12A 1SFRA 3VGPA 4MLDA 1DC7A 4S04A 1MIOB 2JIZA 1OXBB 2DG2A 1RSZA 3HCDA 3NETA 4IV0A 5D5HA 1H6DA 4DRXA 2WSSA 4PZDA 1K6EA 4Y6QA 3MUFA 3RVBA 4MA5A 5IRCD 4X20B 1V48A 4HRVA 4HDNA 1HRDA 1PU2A 2AXEA 4OU4A 4FKZA 4KO8A 4QVIA 5E8RA 2GWRA 2FJ0A 2LKDA 2OUKA 4C43A 2VP6A 4X1IA 1XRQA 2PV0A 5TSDA 4MRVA 1X42A 5BR7A 4X8LA 1N6HA 2QE7D 5DZSA 2XUHA 1WPQA 5DPMA 4PO3X 1RQRA 4MYDA 3NR2A 4NOLA 2KHZA 2C2MA 3AUUA 2RG7A 1L7QA 4OSPA 2QL6A 1PK7A 2IZ7A 4GBMA 4TTTS 3WSWA 3THWB 2VUIB 3VZDA 3IHLA 3W3AH 2I3GA 4I1IA 1CV2A 2VC2B 5JXIA 1NURA 4EY6A 1RMQA 4GLBA 4Q1AA 1KDTA 1ZS9A 1WP9A 3QK7A 2VH1A 2ID7A 2VDKB 4P5DA 1XPRA 4UEOA 2XVXA 3CTPA 2PMEA 3U4CA 1YH3A 4E5NA 1GU7A 1GSOA 2ZIEA 4YRPA 4DV3B 2W48A 2RE8A 3INTA 3IRVA 2P3OA 3TLZA 3VAYA 2FE1A 1XMIA 3CEJA 1PL8A 3C24A 4I8IA 5K0SA 1GYPA 2PSHA 2X15A 4OXRA 2CC2A 7AT1A 1R4AA 3JATB 4QHTA 2J7PA 4WA7A 4ZT3A 3R7BA 4GWKA 4PGAA 4B8ZA 3V1KA 5ALOA 4LF8B 2ST1A 2JAQA 2YV3A 3RF6A 4IFTA 4J0IA 5U4XA 4MOWA 4Q1CA 3SIPA 3OE7A 4MZXA 2V97A 3U62A 3HKDB 2JANA 2YIMA 1GM5A 1CY2A 2KBFA 4Q3AA 1FFBA 1W29A 5HF8A 2OHHA 2O8NA 3OM1A 2OHOA 4NV3A 1JNYA 3BA1A 4V02A 3WIBA 2YXPX 4M76B 5KSPA 1GTZA 5HGXA 5AK6A 3ZHYA 4L7QA 1JE1A 3ZHTA 3AVUA 4ZCTA 2PS9A 4Q21A 1DQSA 1IBRA 1KERA 3R24A 4A0QA 3DHVA 2VUSA 721PA 1OLUB 5LBUA 5EMHA 4FHEA 4URFA 5ALXA 1G5FA 5CBKA 3JQAA 2IW3A 3T35A 1W4CA 4KE6A 4G89A 1JLLB 2NZXA 3OZXA 3Q98A 3RI3A 2O23A 2Y1LA 5SY9A 3CF6R 4UNQA 4IINA 3NI2A 4GI2A 1C1XB 1U7ZA 3MTBA 4MK4A 4Y2VA 4OAPA 5GM1A 5AHWA 1KO5A 1YGPA 1UJ6A 4LXYA 4IIJF 2YVLA 2ZYRA 4FB5A 5ISMA 4EGSA 3NNNA 4PZUA 4EK9A 1XZJA 2C59A 3ECSA 4E30A 2VUTA 2DF8A 3RK0A 2BRUC 1DU4A 4FEAA 3DDUA 3G89A 3RG8A 3I09A 2J0UA 3C3CA 3HUTA 1NKTA 4GPEA 3FTEA 3AL2A 4Q9NA 4YRTA 2P2DA 5F9MA 5ITZA 1LPBB 3VU1A 1G55A 4GGPA 1UZUA 3MTQA 1JAIA 1ZQ9A 4HNAB 4TWAA 5FH9A 4JJ8A 3H05A 1KP3A 4OGLA 4R4JA 4RJ2A 3KJXA 4IRUB 4ZIRB 4FFNA 1DFGA 2Q6LA 4GSYA 1EG2A 1PIWA 2IYXA 4YMSA 5DCWA 4ZT7A 4WY8A 4ZICA 2FXIA 2Q62A 1MU0A 3GFRA 1N5DA 3JQPA 4M9XA 3LX6A 1T9KA 4RVGA 3P0HA 3K1AA 5BNFA 3RVSA 5HIAA 2WR8A 3KSMA 3WWPA 3L1IA 2H48A 2X13A 1OUMA 2PAAA 2YS6A 3TXYA 1XMOB 2NIPA 4BBPA 1FYVA 3GDFA 3BWDD 1BX0A 3H1GA 4A6DA 1Z6ZA 4R2WA 1BD4A 2YFKA 4GF5A 3SJAA 5BUQA 5K3OA 3U6KA 2GFHA 4W5OA 3B9BA 2IH2A 4Y2HA 1THMA 4FNOA 3TUIC 4B73A 4G4SP 3GJQA 1EBUA 3H18A 3DHYA 3IGFA 5CNJA 4J8PA 2J9FB 4N01A 1MXHA 4IWXA 1Q17A 2GERA 3EC1A 5ENZA 2R1TA 1GDHA 3SF0A 5C52B 1QG4A 2J0QA 2XZDA 4KZKA 5A4IS 2R7LA 4NU8X 2JFPA 3KEGA 1QH1A 1Z4JA 4WH0A 4C1BA 1Q1AA 3SSMA 3TCNA 1FDRA 1CK4A 2PL3A 4GR9A 4R01A 1P9LA 5EGNA 3MF4A 5SZIA 1VL1A 2PL9A 3KEOA 4G5GA 4J0GA 3ZHVA 5JSQA 4BNHA 1E62A 3HR4A 4C0HA 1GPMA 4CEJB 2HJVA 4LVCA 3WL3A 2H4HA 2B92A 4GT1A 5JYEA 2ZWAA 1NUSA 3IMGA 5EAIA 5JMWA 1MX1A 1TTQB 3LNTA 2PKEA 5DNYB 5CB4A 1KPIA 4U6QA 1D2CA 1FX0A 3LQ2A 3GA7A 4MJ3A 4E4YA 2B4QA 3DM5A 5JV5A 1SXJE 1ADCA 1DTWB 2IVZA 4JU9A 5LA6F 3K3PA 2I91A 2QMZA 4OP1A 1CX9B 3KYIB 1LI4A 2CVZA 1M33A 4IDEA 4OOEA 1IUNA 1UKCA 3B3FA 4B31A 2NNWB 4CI0B 1WB4A 3SJCA 5C5DA 2P9HA 3GRFA 3SR4A 4Z7OB 2NO5A 4UATA 2PT5A 2BSQA 1ZGJA 4DQKA 2ZSKA 3DXXA 5K8CA 1Z75A 4WESB 4DB2A 1NBOA 2ZB2A 4BQEA 1V6CA 4EUKA 5CFRA 4W5RA 5H3HA 4YRMA 4U7GA 2WVAA 2CJYA 5H9VA 1TM4E 1Z37A 2PZBA 5EJ7A 2QP3A 2RAVA 5HJ5A 2ZXUA 1LDEA 3QY9A 4S1PA 3PPWA 1N8KA 3BKXA 1TIKA 1CY8A 2F1HA 2BI8A 2IP4A 2QLTA 3BB3A 3ONVA 4H1HA 4WBSA 4M36A 4D92A 2PCLA 4X95A 1Z5NA 2VPIA 3P71T 3C2QA 4HJXA 5F5NA 1IE3A 2OC9A 2Z5VA 3PXXA 3L7DA 4MUNA 3VNRA 5JBNA 3RT1A 4U7WA 2VBGA 5JNUA 2QXUA 3BK2A 3W5DA 4ZYTA 3ZDXB 4B81A 4ZRDA 1I0LA 1O87A 1VBKA 1ZD8A 2IF2A 5JH7F 4M86A 1PQPA 2ZJ8A 1G41A 1H6AA 1C1DA 2Z58A 5KYTA 3ZEAA 3WDMA 2CVOA 1VP3A 1D6SA 4AS3A 2EF0A 2CVQA 5A5EA 5FUMA 1P0IA 3F6BX 4R9SA 2QL5A 2HYIC 1NUUA 1KARA 1CB7A 5MN4A 1CZUA 3A28A 1FNMA 3MCZA 1ZM4A 3EQ2A 3R6LA 2X3YA 1U7TA 5TF0A 1AGYA 3W6NA 3LUBA 4KV9A 4MV6A 5G0VA 1ZESA 2G1UA 1CRWG 4P2GA 3FBGA 4KX3A 3ANTA 4HVAA 4Z0TA 4NE7A 3G79A 1CDOA 1BWPA 1V7PC 3F9CA 3TSAA 1Z4KA 3VNUA 4YQZA 5ERXA 4GP6A 3OEWA 1D1PA 4PE5B 1SOWA 4QLAA 5A4JA 4F9TA 3SIXA 2ZWVA 1W34A 3WJ2A 3DE5X 4EYOA 1KOJA 4UVHA 3GLFB 1TQDA 3E4DA 3PPXA 4UZFA 4A5OA 1UH5A 4XIJA 3PDIA 1V9SA 3V1UA 4QT4A 1NWCA 1DADA 2DBVO 4KDFA 1MA3A 4WDQA 2PBZA 4XW2A 3JASB 4H16A 4O4IA 5ELLA 2ZUSA 3DA8A 3NANA 4OFXA 1PR4A 4HWGA 1G291 2X2EA 2VRNA 3KLBA 3EXG1 1CRQA 3CX7A 4UEQA 3DVAA 4UDYX 4DM3A 1AZWA 1Z88A 1U8UA 2R87A 2I9KA 1XTTA 2WLSA 5J43A 4FCWA 4MJLA 1O96A 5ALGA 1R37A 1K7FB 3UEOA 4J2TA 3RIXA 1ACMA 2BH9A 4IDPA 5ARCA 1R0BA 3G7UA 3KV1A 1FFXA 1LJ8A 1SVOA 2X8AA 3GGDA 5E3JA 1H5NA 2R1VA 1LRKA 3MWDB 1DIGA 3O4HA 1W2HA 3V2UA 4A4DA 3SF8B 4AKEA 1NE2A 3T7SA 3GF4A 3L7NA 4WKPA 4P81A 3M7IA 4BXOA 5CEFA 3H2IA 2PQ0A 2A3RA 2EKQA 2D13A 4L4RA 4UMFA 3DBRA 1OX6A 2UUPA 2VF4X 4UHDA 5DLDA 3SR3A 621PA 5E6RB 3IQEA 4FGKA 3GDHA 3DDWA 4LQ4A 4KR7A 3MN1A 3NT2A 3E3NA 4L73A 4R16A 2HFJA 3Q0IA 4H2DA 1SQ6A 3A1VA 1Y7PA 3H5NA 4L6CA 4ZQHA 5J59A 4XVRA 3G17A 5ER9A 1QF9A 2OCYC 1N2CE 1WA5A 5AR1A 4BNKA 4KITB 1EFAA 4RLSA 1TD1A 2VYND 4EJMA 3I64A 2P5UA 1T26A 5EL0A 5AI9A 3L9XA 3PUHA 5KTSA 5IFKA 5L3SA 2Q5OA 1P4RA 1ZVKA 2BAGA 2GXUA 5ELMA 4EFDA 1NVBA 2HK8A 4XE5A 5ESRA 4JJKA 3ZV5A 4B4VA 4XPIB 5BRNA 4UU1A 4EKEA 4DAOA 3HXMA 2J4CA 1IN4A 3I0MA 4JKIA 2DX7A 5FT9A 1DWPA 1G7CA 1WDKA 2QW8A 4JYBA 3I9MA 1N3IA 1QV7A 1YOVA 1HBJA 1YAHA 3EC7A 1G98A 2NXWA 4U8HA 2WEKA 2H1HA 2X23A 4YJFB 4NMMA 5B58T 1DCTA 2XKAA 3BN3A 1QGUB 3SCZA 3C7CB 5J3JA 2BFEB 1QB8A 3KCQA 1U0HC 2FSPA 4C0KA 1DAGA 2AGVA 1YKGA 2ZE5A 5ALUA 3TLGA 1L3IA 2QE6A 3H86A 3ULKA 1CYEA 1EB8A 3L7JA 5B1HA 3GCZA 1VTKA 2RCYA 3A8TA 4BMCA 5JW6A 3GAAA 1I80A 2FSUA 4L02A 1Y80A 3EVTA 3H2BA 4MA0A 3OZWA 1QHSA 1VMIA 4OSOA 4ZI7A 3CO5A 5L95A 2DUWA 4AS1A 4TTJA 3MAAC 1OC4A 1Z0JA 3RTCA 5L4NA 4DY6A 4UM9B 2PV7A 1UDCA 1ORTA 4OUKX 2XMCA 4HI0E 3GLHB 1GNPA 4QNMA 2QD1A 5AHRA 4XGRA 1A5ZA 4XUGB 3EXIB 3Q7SA 1DJPA 3OX4A 5ALIA 3IQDB 1BXKA 1KVUA 1LLQA 1WNTA 1GZVA 5ALZA 3RD5A 5BSFA 4JMLA 3ZWXA 1T2VA 3CNQS 4NMLA 2HHHB 4MEJA 3LT0A 5E1MA 3Q1LA 4F5WA 4YO8A 1VIAA 2AA3A 1RLUA 5K20A 2QQ5A 4I8XA 4WK0B 2FW7A 4J7UA 2I1VB 3BTSA 3C1TA 4XCQA 4ZVTA 3VKVA 1Q1BA 3UUWA 4IJ6A 1T10A 1GFIA 1VA4A 2QTMA 5C0OE 1P7PA 3RK1A 2PJRA 3ECAA 4YDRA 4PC6A 1AK9A 2D59A 5DXAA 4ED9A 5CD9A 5AOCA 5JVDF 1MZVA 2VLIA 2MSDB 5HP4A 1B6RA 4M8KA 1VKJA 2C31A 2ZJ1A 5K09A 4AZ3B 2YY7A 4JYZA 4PTZA 1DDOA 4PFQA 3JQFC 1BXGB 2NPFA 4QWMA 5FPYA 1Y6RA 4BVGA 3SBEA 4UBMA 3KZNA 4YXWD 3TAXA 5LXTA 4V0OA 2HSJA 2ZBDA 1Z0IA 3TR0A 5CBPB 2O2YA 4WN9A 1YF3A 1H23A 1RW4A 3UGJA 4FFBB 4HHEA 4NEQA 4C5AA 1N36B 3P9QA 3H0EA 4S35A 4CQMA 2HKIA 4E94A 4HBGA 4POOA 2DRIA 1KR5A 4EX6A 4D8TA 2GRUA 4KQXA 2HJ9A 1NQOA 3OMXA 4UJ5A 3EMDA 2C5AA 2HA2A 2IDMA 4M83A 4LGYA 3C4JA 3B70A 3HBLA 4QUGA 4TPKA 1JIVA 3EA4A 4LMRA 1FY2A 4HPJB 2CLMB 3EZ9A 3STHA 1SNYA 1F2UA 4FLMA 2PKRA 4ZCSA 3VHRA 3LOUA 4H59A 1VKNA 4TRMA 3RTEA 3FGNA 4Q9JA 1TCUA 2VQDA 2C8LA 2V7QD 2PX3A 4DY4A 1P9RA 1EJ6A 3DLAA 1P9OA 3CX6A 3LCCA 4CDNA 4PYQA 3OPYA 4DMLA 1UDBA 3LRTA 2CCGA 1ZGHA 4JJEA 2E4AA 2QI9F 3AU9A 3FAZA 2Q5JA 7MHTA 4OQXA 2VJMB 1R4NA 4FINA 1L5GB 1O58A 3TRJA 1V8OA 3K0SA 5F3WB 4R1SA 4WERA 4AN0A 3H6HA 4MV3A 2XWBF 1NVAA 3I9V6 1AK1A 4L8GA 1NUTA 1SCAA 1KPHA 1LA2A 3EQ6A 3JVUA 5EQJB 5I3CA 2YIJA 1AZSC 3NBZC 2ODWA 2J31A 3BE6A 3OT5A 4NIMA 5DO9A 1FUUA 2MINA 2X14A 3KNZA 4PWYA 5AW4A 5SICE 2Q3EA 4H4DA 5AVKA 3FI0A 1DBRA 4KYVA 3ODPA 2QMEA 2WI8A 4GX5A 4JGBA 1YZQA 3ZIAA 1JG3A 2VK4A 3KAKA 4NZZA 2AOTA 2X4LA 4Q34A 1OX4B 3WGGA 4G5HA 1IOVA 4L9WA 4BB6A 5H5JA 3FMGA 1Z2NX 3H8JA 1NW5A 2FN9A 3LGXA 1Y4SA 4GQAA 4JLBA 3PUJA 5K3AA 1HQKA 4C2TA 1FYXA 3SS8A 4ND1A 1JIXA 1I6LA 4C87A 1QOQB 2D54A 5DM2A 4UXHA 3NNDA 5F2KA 3RVRA 5A3RA 4TMVA 4NHOA 4TMKA 5FBKA 3QBVA 1XTBA 4H3KB 1P7CA 4YALA 2HM7A 3A6HA 1OXXK 2B4YA 4D9HA 4LMAA 5AP9A 4O29A 2LRHA 3F8WA 5KTRA 3IVMA 4NATA 2NMVA 3VNBA 1DXHA 2CT8A 2BP7B 1GZHB 1K08A 1EFKA 5K6AA 1F5SA 1RS0A 1Z7BA 2FP3A 1Z0UA 1XMXA 3NHLA 1KJ8A 2HEGA 3Q88A 4IJWA 2HQRA 4MW2A 3ZV3A 1R16A 1EPUA 4UNNA 5AFSA 2X1LA 3HNPA 4MQ6A 1B7GO 4TL6A 4V39A 5TQ2B 2WQ7A 4QG7A 5BN4B 4HZUA 1GLNA 1M1NB 3BK7A 4OHWA 4MW6A 3VZRA 1LNSA 4LNUB 3MAGA 4KR6A 1WX1A 3B7WA 1S3FA 4OCZA 3K9FC 4TRRA 4KUEA 4U4AA 4ZZ3A 1WMBA 2GM5A 3PC8C 2VJBA 3MERA 5CIYA 1Z82A 2C0QA 3C5VA 1D0SA 3ME5A 2QTCA 5ILQA 1QKKA 3SDBA 4OH1A 2IF0A 2ZEJA 2H2AA 3WB1A 1FRZA 1GAJA 5LMCA 2CXQA 2WHYA 1A0OA 4D41A 3EXHB 1Z5OA 2CXOA 1ZC4A 1U3FA 2NSHA 3K16A 3K96A 3KXLA 4IIHA 3CVVA 2XHZA 2Q3BA 3BFXA 4RYLA 1EK2A 4R2JA 3WGYA 2CE2X 2G7ZA 4Y2YA 1EP9A 5JZOA 3ABIA 5L4LA 4DIDA 3EIFA 2FUG1 1MB4A 1J25A 3QVJA 4UULA 3O92A 4Y8VA 3VV2A 4DM4A 3G0CA 3VKHA 5KEIA 1LUAA 1GYRA 3IUBA 4TV9B 1W6UA 1CBUA 3O3CA 2NXNA 2QOEA 3MTDA 3IL2A 3ZZ1A 2Y27A 3ONWA 5SZJA 3VRHA 4AP9A 4W5JA 3WP1B 1U4NA 4H35A 1CP2A 1IWOA 3M70A 4KFTA 2OORC 3W06A 1UXKA 1GQSA 2A5DA 2HL6A 5F1PA 2JBAB 1YJBA 3CEMA 1AH2A 4TYNA 1FLVA 1MFZA 3RNOA 2I0FA 3DR5A 3V7YA 1WDTA 4L72A 1ZUNA 4FYXA 2J9GA 4Q1BA 3W5IA 3WGOA 5KC8A 3C3PA 4DV0B 1TKAA 1U5AA 4ZOBA 4ARIA 1A27A 4DSNA 1BQEA 2QRPA 1H1LA 3S28A 2AOWA 1G8KA 3DW1X 4WOBA 1XTJA 2FRDA 1E3SA 4P2BA 1SVIA 4P80A 4GOOD 2AJLI 4LTNA 4WASA 3RRFA 2NU6B 5EJEA 4UHBA 2O8EB 4A1FA 2ZLBA 4Y98A 1XYVA 4M4SA 1XELA 3CA8A 1GU0A 3IXMA 1F6DA 3HRKA 1I94B 2ZIZA 2QVCA 1YI1A 3W9BA 4CLRB 5HVNA 4BNZA 1LC3A 1TJYA 1E9DA 3KBOA 4JT2A 4PS1A 4YP6A 4D98A 3T1HB 1RYNA 1YC5A 5DHSA 2ZULA 1AQ6A 4LJRA 3K2EA 5KYKA 3ORSA 3P2JA 2GHQA 2OKCA 2C3OA 4GLLA 3LH5A 4ZAFA 1DBSA 1K6MA 1SVSA 4TWJA 1PT7A 2APJA 4DLNA 4TUYF 2FFHA 1GZ5A 4HEQA 5D3MA 3AERA 3L77A 3ROFA 3HCNA 1SQSA 1N6KA 2VWPA 3ENWA 4G1MB 4MR8B 5B57C 3WIVA 2PJUA 1ZXLA 3E22B 1JHXA 4TS9A 2E6KA 3PZBA 3CW9A 2VNKA 4FX2A 3CF4G 4XDZA 3BCHA 4DAEA 2GOYA 1N2JA 3K09A 4N12A 5TQVA 1HEUA 1UF9A 5BVHA 3TFOA 3FYUC 1HZZA 3VR0A 4FGLA 4OQMA 1U0RA 2B20A 3MYRA 4JFAA 1FDOA 1U7UA 1Z5VA 1APBA 3QPWA 4S05A 4MGYR 1C7EA 1OFGA 1U8EA 2GAJA 1VJRA 2HNKA 3N70A 3U7EB 4C4PA 2DHQA 3WXMA 2ZCJA 3WRXA 1UP6A 2MOKA 1F48A 3U1TA 3X2SA 4FB4A 1B43A 3E5MA 1J9EA 2A0YA 3GCWA 1CCWA 3HKBB 2QVBA 1P1JA 5ALDA 1UDAA 2GNAA 1RPNA 4ZC1A 3U1VA 3I2YX 5CVUA 4EHKA 4YMTA 4TMZA 2HIGA 1IPHA 1ZH2A 3PA6A 3LD9A 3TRKA 4OI0A 3DUWA 3PYMA 2WWFA 3OQIB 3WWZA 1KXJA 1BAPA 1GPDG 2IS4A 1RKQA 3NAGA 5IT0A 4LYJA 3ILXA 3M4JA 1FA9A 4CODB 3KE9A 5JAIA 3EIQA 2JF0A 2NUBA 3AT1A 2JFQA 3JVEA 3P2IA 4PY2A 4CDRA 4QFBA 3TLEA 3WBKA 4D4MA 4J4BA 4RC9A 4Y6PA 3VMMA 4JQYA 3RT7A 2ZRFA 5NLLA 2PO7A 2Q29A 3COSA 3BFVA 4F5DA 2JI8A 4QGAA 1DELA 3KB8A 2O1XA 2ECKA 5HWSA 5AI4A 1L4BA 2EWMA 4K7JA 3O1JC 1FVXA 1XHLA 1FDWA 1NYQA 2ID9A 2XOXA 2ZANA 3ID6C 1TJPB 3IIIA 3MOSA 4K26A 5IT5A 4RPCA 4FS8A 1RI5A 4ZQGA 1F6BA 1W46A 5MDHA 1JYSA 2YWGA 1M2VB 3EHDA 1QANA 3EIOA 3QF4B 2DHCA 4P4NA 5DMXA 3D8BA 1I3LA 1EZZA 1MC1A 2A78A 3GMIA 4YAJA 2QKYA 4EHHA 5JAOA 1WMEA 1CWUA 1CQJA 1TQ8A 4PZLA 5C8YF 1FJHA 4ZJYA 4JVSB 5DW3A 1JQ3A 2PRIA 1TZKA 2W7TA 3IMCA 5IAGA 3F67A 3X2EA 1Z0DA 4AY3A 2AG0A 2NUPA 1THTA 1TA0A 2IXGA 2WUWE 3OFND 4GBJA 4J90A 3RRXA 3K6JA 1D8TA 5FQNA 3WP0A 1CJUC 3VR6A 2IUYA 1UPBA 3EDYA 2D5LA 1P2SA 1CS4C 1QH8B 4GLOA 5LZ7A 4E46A 4EI2A 4CTMA 3TLCA 5M34A 2EBWA 4GYYA 3UMBA 4RW0A 1T9DA 2Q1XA 2YWDA 4U9IS 1FDIA 1L4MA 4CLOB 1YTUA 4QASA 1NW6A 3IQGX 3M6LA 4CM5A 1UMCB 2LVBA 4TT8A 3SC4A 3JAWA 3SWWA 3QUCA 4GRDA 4M1QA 2XMDA 4BPRA 3N6RA 3ZOZA 3ZIUA 4ZI2A 3KQKA 2FWIA 3LZ6A 5DNWA 3ZNNA 5CDGA 2G5GX 4A92A 4C0SA 1LLDA 3E9NA 2QG4A 1TF5A 4I1OA 3ESQA 3OX2A 5TE9A 4NPAA 1TZBA 2HUPA 1ENOA 2ZJOA 4P82A 1CW2B 3G7NA 5AUNB 1FSSA 1Z8FA 2B8WA 2BMFA 3ENNA 3PHIA 4FR2A 5KVSA 2E37A 1M1YE 4PVCA 3ZZNA 3PEWA 5LKAA 1L8XA 4R1PA 3EVAA 4RXMA 4LRSB 4LRXA 1I2AA 3I39X 3PCTA 1L7DA 3HEBA 4NL4H 5F64A 4ENTA 1DMRA 1D0IA 4ZI7F 1FB5A 2Q0QA 2VP3A 3A4YA 3GIDA 3NKLA 5LVAA 3DPUA 4QOGA 2OHJA 1K3TA 1TVMA 1PFWA 5FOWA 4Z9FA 3EVCA 3WJ7A 1QGOA 2PN1A 3FXAA 2J5RA 4NOJA 4CEHB 3P9KA 2W8BA 3QYPA 4Q00A 5GGYA 5M2QA 5BQFA 2ODAA 4HLUC 4L74A 1P72A 4GSKA 4PZ0A 3NHBA 5F76A 3FM9A 5IC4A 1N6NA 4Z3KA 3WGTA 3QFSA 4BFSA 2BGGA 2G08A 3D0KA 5HKLA 2VJYA 4BNXA 2JAPA 2D7CA 1PSZA 2GUWA 2Q3HA 3DHNA 4RGYA 1HY3A 5C4MA 3T3NA 1BMFA 2P78A 1U0NA 2NQ8A 3RNLA 2ZYDA 2FQ1A 4I5FA 3PQ3A 4MKRA 4ONEA 2IITA 2CHQA 2HTFA 1O97D 4W1RA 2PZ8A 4ON9A 5FYQA 1G66A 5LDGA 3CNHA 4JGIA 4DDTA 1Y3DE 5JZVA 4YRKA 1V96A 4YVFA 2Q8QA 5DNUA 1WUHS 1ZN7A 3CS3A 3GLUA 4LKOA 4XSVA 2NSLA 4BY9E 1JU3A 2CLIB 2IHZA 2O7NA 2WU8A 2HMWA 3FKSA 3ZWNA 4ZHQB 3C3YA 4CKXA 4BKUA 1XSEA 1CQPA 4ZJZA 3KLNA 3O9MA 4YMGA 5U9CA 1HDOA 4K86A 1ZIPA 3PTZA 4EG0A 4FYKA 4TRJA 1QYVA 1W1UA 4V2UA 1MVLA 3R3WA 3TSOA 4BZWA 1BFDA 3ZKWA 4JBWA 3GUYA 5DGHA 1UXIA 4TXLA 1NRIA 2DQYA 1EAMA 1G4UR 1O97C 2G5PA 3DL0A 3H1BA 3JZAA 3NTQA 1JKJB 4RFSB 4BNDA 5LD2B 1PEDA 3K8ZA 4FC7A 3ZE2B 2PLAA 3AVPA 5JR3A 3THYA 2I9PA 4A8JA 1ECCA 3Q7QA 1N6OA 2F3QA 3MRSA 2WJHA 4GGOA 1XWIA 4FI3F 3NEAA 3L7LA 1QHGA 1BS9A 1N75A 3HRHA 4QTXA 2Y1OA 4R1OA 2BM9A 2XXAB 1XCLA 4JNCA 1MGPA 3AEYA 2AXQA 3CGGA 3H8WA 3QJGA 1KI4A 1SCUB 3N75A 4H77A 3GHYA 3RRBA 3SC2B 3U7FB 4E22A 2UUAB 1WKCA 1PDOA 5BO5A 1PDVA 3B78A 3ITKA 1KDYA 5JSZB 1KYIA 4LPKA 1SR8A 3TB4A 2Z1NA 3PD7A 4FX5A 5DTIA 4UPEA 5KDDA 1KMNA 4NU6A 1A1SA 1BN7A 2QRQA 4KLNA 2XXJA 3WTBA 3LC0A 3WK4A 2JLSA 3NBKA 3WG9A 3TAUA 5AXDA 4QPCA 3E9ZA 3GC6A 5CCEA 4Q5IA 3TG8A 1DMSA 2BF4A 1CR6A 1I4TD 1CG6A 2GN9A 4WZAA 5HZGA 1JDBB 3ZJUA 2FPSA 5JSKA 1T0UA 1XF9A 2PH3A 2Q5LA 2AX4A 2WSIA 4L08A 4B3JA 1IEVA 3BFKA 4BB9A 4JC0A 1FFYA 2FOLA 3I6IA 1K6JA 1NGSA 1W4LA 4ZT6A 3DWIA 2OBLA 2Q0HA 2YTZA 1JHQA 3H6KA 3PNMA 4LI3X 2R86A 4BBJA 3ABZA 3RAFC 3C6XA 2ZSJA 3S7TA 1BN6A 1IBSA 3L8HA 4LTDA 1QIHA 1N1GA 3LC1O 4HFRA 1MRNA 2X22A 1ZGAA 3RO7A 3F6SA 4RA6A 1LWOA 1G17A 4K6CA 4GPAA 4MW1A 3BIXA 1TFUA 2VT6A 4FZVA 5FV7A 4DKXA 1U8CB 5KTKA 3HCCA 2C7OA 2WBLC 3GFTA 3GIWA 3Q87B 3I23A 1ISGA 2QIOA 2WJZB 3AVQA 4WNAA 5JMPA 5C4GB 5MN5A 4F1KA 3U39A 4LFBB 2Y0CA 3MT0A 2WWVD 1YUBA 3HKEA 4EFLA 5JDIA 5B3JC 4YAGA 4P1ZA 1QRAA 2AN3A 4PRLA 4GECA 4JEMA 5EKTA 2P1DA 4KHPB 4Q9HA 5BUCA 1YZHA 3TR5A 3BC1A 2QNRA 3FZYA 4GPBA 1MW9X 2VF2A 2R6DA 1JWBB 4OLHA 3FZGA 1HOTA 1W25A 3X1XA 5KREA 5I45A 5KSOA 2D62A 2WUVA 3AHGA 2Q4OA 3NBQA 4W1PA 1E79A 4OBWA 4NZOA 4OUDA 3KB6A 1GLVA 3ZY4A 5BWLA 3ZE9A 3UVEA 1RXWA 4HT3B 4ND4A 4EHBA 4C7KA 2PEZA 4YCNA 5C1IA 2ZJ7A 4QUAA 2NVBA 4DABA 2Q5HA 3RLIA 1TK3A 3ZXUB 5KNDD 1KOFA 1SRQA 2HBZA 3GN2A 3G2JA 3PXCX 3ZE6A 4BLRA 3LA8A 2FEMA 5IK2D 1DIRA 1SWWA 4AZTA 1VGQA 1PN3A 1DLIA 2E89A 5CD1A 2FWMX 1LDBA 1CIVA 4BFWA 4D4KA 1X0VA 4CT4B 1CDEA 1MABA 1ZHOA 2J0SA 1E77A 1PJBA 2GAIA 2VRBA 3N2NA 1C7JA 1K75A 3OIFA 2YWFA 1ZI8A 5LB2A 4M60A 4UASA 3KEQA 3K1JA 5JNVA 2CWDA 1RHJA 1T6BY 1OA1A 3ZW9A 4BQFA 3ZLJA 4HPWA 4CM6A 3OPMA 4MPDA 1WMDA 4F7WA 3LHDA 1R0YA 3FNIA 3RRZA 4BO3A 2PRYA 3HADA 4EP1A 3L4KA 1GADO 1FVFA 4N5NA 4DUGD 4EGCB 1O9BA 4IGIA 4GO1A 1A1VA 3HB4X 1QYWA 1URPA 3TIGA 3IEKA 4LY0A 4CIBA 1UOPA 3AINA 1M5TA 4JL6A 3W5UA 5F35A 1W48A 1XGKA 2CZGA 2XWPA 3HJRA 4NC9A 2IIQA 2DPGA 2WSYB 1QZ3A 1ISPA 3F5MA 3C43A 4YY3B 3LTNC 1Z4NA 2Z3VA 1FBNA 4RM2A 4XM1A 4DB4A 3H97A 3JALB 3FCEA 4U7PB 2DWPA 1PW5A 1WTCA 5EFZA 3M6AA 1IHYA 4QPDA 1A9PA 2NXJA 1IWPB 5AOAA 3DL7A 2EOAA 1BMQA 4RGQA 3TPZA 1B2RA 1V1MA 1H6BA 5B1DA 3OZGA 3CYFA 2C2ZA 1IVSA 2OBYA 1LD3A 3KPJA 3N7AA 5FQOA 1VYVA 2GHTA 5KYUA 2GJAA 3I0ZA 1EE9A 4D7AA 5AKYA 5C7IO 2P9TA 2QK4A 2ZRAA 2QLJA 2YWEA 3AY3A 3ESRA 4RY0A 1Z16A 2HLHA 4C78A 5KTOA 1COWD 1KKUA 1U0LA 2AE2A 1PUJA 2IKQA 1IM8A 2IZZA 5KNBD 4MTCA 1N5LA 3BRWA 3T3GA 2QNBA 1USIA 2CEKA 2QAIA 3WMGA 4FDTA 3VR3A 1EFRA 3OT4A 3T9AA 2QTBA 4Y7CA 4LPSA 5LLSA 3V48A 2O8DA 2HLDD 2CD9A 4D4IA 1U2DC 3UT5B 1OW3B 2FPUA 1PVVA 1VJGA 4MGHA 3IKJA 4WRRA 4CLEA 4RH3A 3GPLA 4G0UA 2CYCA 1KAEA 3CNEA 4WKCA 5DASA 4R9UC 4F4UA 2Z3WA 4XARA 2O0JA 2XQJA 1XVVA 3CLKA 3DFIA 4PC3A 4XGNA 3WISA 3UTCA 4LYGA 1QUEA 2M32A 3IP6A 1NAHA 1X7GA 5FO1A 1X77A 4I4CA 3RUFA 5EC8A 3TW8A 3P5SA 4UTNA 3O82A 2MSCB 4OHRA 1Z5PA 3A6KA 1XO1A 3LT4A 3NFRA 3HB0A 3PVSA 3KDPA 3QBDA 1JR3D 1JLMA 2LIVA 3ABRB 4M55A 1ZK0A 4XPIA 3KZVA 1OWMA 3ZI0A 1JG6A 1E9FA 2ZITA 3EQ8A 4P38A 2NW6A 3P26A 1VE5A 1U3TA 2VK1A 3N1UA 4CKYA 3E7DA 4YCDA 1P74A 3UATA 2CL5A 4KPUB 5EHQA 1UJCA 3OWHA 2EP8A 1YQEA 4K28A 5G4KA 2XGSA 1U5BB 3NTVA 3UAYA 2IHTA 2QSZA 2QLFA 5CPBA 1OI4A 4W9NC 4FVTA 5A5VA 3ZHQA 3E03A 4KCGA 3R9IA 3JPWA 3JQ7A 1PJ4A 1ZSYA 2WVJA 3HB1A 3DQPA 4FILA 2WVGA 1Y1SA 5BVGB 2Q3CA 5J2TA 1WQ4A 2C4UA 3BE8A 1QPBA 3OZ7A 2FB9A 5B36A 1GR1A 1XU4A 1JG2A 5DT9A 2VJCA 3T3EA 4CYMA 3K53A 2OXTA 4GH5A 4HGPA 2Q7DA 3UK1A 3AOEC 3B2QA 3P2EA 3U3OA 3CKKA 3X3HA 2GTHA 5HHTA 5DSZA 2A9VA 3R7NA 4AF6A 2CNWA 3SZ3A 5IKXA 1CR1A 5EIXA 3ORQA 5JWRA 2BTEA 1AHPA 1N2XA 4MV4A 4WTOA 2G09A 1AS0A 1T8TA 4XRRA 1VA5A 2GN6A 5L3RA 2OESA 3HZOA 4C20A 2G1JA 1DAIA 2YUIA 3KVVA 4CT5A 3EX7C 3R0JA 5JRJA 4LQDA 4YRQA 2CKDA 1I1NA 3EA5A 1TZCA 3HFRA 2Q5QA 4UNSA 4Y9UA 4XA8A 2KMLA 4M22A 5LOVB 2EX0A 1T2NA 2GQ0A 2QN8A 2OQRA 1LBEA 1W1IA 2FU5C 4GI7A 5JSHA 1ODTC 4NAUA 1NN5A 4AT1A 1Y1KE 3KVYA 3CRZA 3JXEA 4EH1A 3I2FA 2FN7A 2Q0SA 1KYXA 4ZTBA 3GT4A 1DEXA 2O8FB 3LDHA 4PFSA 4Q01A 5KOYA 2EG9A 2A6PA 4ILKA 4ZQFA 1V8BA 4AYXA 1L6IA 3H16A 3IEIA 4ENPA 5I4KA 4S3MA 5IJ9A 2I76A 2BONA 4D9CA 1RPTA 3OCWA 1GQOA 3KZMA 4CUJA 2C5EA 1DKQA 4P4GA 1JJFA 4AO7A 4G0PA 1HO3A 5DGDA 5G02A 3GZNA 5FBRB 2HIMA 5B7PA 5BXQC 1F2VA 4WCFC 4F3TA 3R5JA 3L79A 1ZOSA 1I7SB 1CF2O 2Q1YA 2JCYA 2QRVA 2NQ2C 5A9SA 3FW1A 1UJ2A 4UDNA 3N0VA 4J9UE 5IFLA 1JFLA 2FEWB 2WHQA 2GCPA 2VHXA 4YFYA 1NHWA 2ONCA 4CLHA 3JWPA 3SDSA 2XGMA 3KJGA 3ZZ0A 3KSAC 4GKJB 5EIHA 1E2GA 3JY6A 2FW0A 1X8XA 3JD1A 1FNBA 3WKCA 4WJKB 1MCZA 3P9YA 2FXVA 4EHJA 5DI3B 5CAEA 4IIUA 5A2QA 1DPGA 1HKUA 4D80A 1U6IA 2JKZA 2JA1A 3MXOA 2BELA 1L4NA 2NO9A 3RF7A 2CBZA 4V0ME 3HBFA 5HYVA 4JROA 4B3IA 1G8SA 2NVUB 2FZEA 1HE1C 3GX1A 2OFWA 3S68A 3VUEA 2OMEA 2QUIA 5BMOA 3GOQA 3TNYA 3ANXA 3IUEA 4BEBA 3DEFA 4EA7A 3WIDA 1DJLA 1M6WA 1QTIA 4RK6A 5DE3A 3R0IA 2YMPA 4KN9S 4NLLA 4UQPA 4FOPA 6REQA 3BRSA 4B44A 5KKAA 2FX5A 2Z6UA 1WG8A 1J9GA 2VQ3A 3LY8A 4M49A 5JE8A 2W11A 2P30A 4L9SA 5DGTA 3H4VA 4BVLA 1XCBA 2UDPA 4G5SA 4YP5A 4R81A 1H4SA 2E6UX 3DAHA 4JL5A 2ATCA 3CNLA 3BDVA 3QPVA 2ZWIA 3R40A 3FTFA 2D1QA 2ATVA 1FEZA 2CL6X 3G3EA 4LW8A 5KJ6A 1JEEA 3NH9A 2W43A 2Y8EA 3EIEA 2SCUA 2QDKA 4NJEA 1B6SA 1XA0A 1D0VA 3OG9A 4L75A 3VOAA 4BLWA 3INNA 5LKRA 4B87A 3FTQA 3T7EA 5ED4A 3F96A 3VISA 2XIJA 3UG6A 3PI6A 2FR8C 2IA5A 3R41A 4RF4A 4ZREA 3W7AA 5U4QA 2AZTA 3U3MA 1ZISA 2QMHA 1E3TA 1V37A 2GSWA 1VXRA 5COAA 3T3OA 3LHIA 4C7MA 1M10A 3V80A 2IYZA 5TARA 3IJRA 3EZNA 5MGNA 4N1AA 2I6TA 4GNKA 2MMGA 1OAKA 2ZQYA 2E21A 4BJ5A 4BNLA 2D8AA 5A62A 1MC4A 1XJQA 5G4LA 1U3VA 2JGJA 1L1EA 2YHBA 4KGVA 5LJIA 2QYOA 3EZFA 3H1PA 4DGQA 3UUGA 3DE4X 2HA5A 2IOYA 4KO3S 4LDAA 2O6LA 3WGQA 2WWRA 1R4MB 2W2LA 4BRSA 2IXAA 4N3GA 3LT2A 3D7MA 3BMQA 4LG1A 3S7ZA 4BX9A 4WFQA 1IZ0A 1XDSA 3QOXA 4UBLA 5SZKB 2C9DA 4PCLA 3WGNA 4KTVE 4NV0A 1ZBDA 3EDMA 1H42A 1CEEA 1DOHA 3AP1A 4M9ZA 4OH7A 1O94D 1IAQA 1EP3B 2RONA 3EG9A 1KY4A 3I2HA 3NC1C 3PR1A 4ZOEA 1ZXBA 3EXEB 1KI6B 4HDKA 5ECYA 1I33A 3GARA 5HOEA 2TMKA 5K8TA 1A2OA 4P5EA 2VWGA 4PWZA 3UJPA 4B45A 4ER7A 2Z8XA 1UDWA 4BO5A 2OC4A 3HBNA 3MWEA 1EUDB 3B53X 3DKKA 3KAQA 2JCSA 4KAXA 4QICA 4WT7A 5KYVA 3REQA 3VJLA 2I65A 4B43A 1P1FA 1T3SA 1QE3A 1UMKA 2ET6A 3C8HA 2NNLD 3HZRA 3TL3A 1ZNWA 2WM3A 3HFJA 3MEQA 4KB5A 1TAHA 3VHXB 1KJIA 5H7XA 3KIPA 1D2AA 2OWDA 3RVKA 5JAQA 1JWLA 3PE6A 1JJBA 4FE4A 2VYVA 4F4HA 1ONSA 1EWQA 3SC2A 3CG4A 3VR4A 1IQUA 1Q12A 4PVDA 3SQLA 3H8SA 4B6FA 1XK7A 3MMPA 3G1UA 2ANBA 4MKHA 4BUJA 4DRZA 2WVHA 1O94C 2O14A 2RHRA 2Z09A 1ZJ5A 4QBGB 1KFJB 1C3OB 3QXHA 1V1RA 2JCBA 1JXMA 1KGSA 2RHBA 1IN5A 5HFAA 1RAFA 1UMDB 2HT6A 5ITWA 3K9NA 2RG1A 2XGJA 3AI3A 5LUAA 4HRAA 3WWDA 5JDCA 1JHDA 4KQKA 4F6LA 1JTVA 2F48A 1XZBA 2W93A 1QS0B 2FCAA 1EXDA 2DTDA 2WTUA 4IEFB 3RBAA 5LMZA 2JLYA 3CPEA 4G97A 3ZBUA 4NBKA 2IPXA 4F6CA 2FX2A 1PZGA 4QYIA 1CJMA 1ES9A 3Q6IA 1TAUA 3JQAD 2QPAA 1KHHA 5DYTA 2EIHA 2OK7A 2XF2A 1CKEA 4ND8A 1EG7A 2WJPA 1M1XB 2XA2A 1M6EX 1A8SA 5BURA 3HJBA 4HNTA 2PD4A 1XQ9A 2Z4SA 2QBYB 1CETA 3KYJB 4JDUA 4ZK6A 2PSSA 1J20A 2PU5A 2VAXA 1XXHA 3ESAA 4FMPA 4HAIA 4V03A 5E95A 1BQ3A 1RIIA 2JZOA 4HDRB 2ZRMA 4ZA2A 5HS4A 3E5RA 3QLUA 4D6XA 4X7PA 3T06B 3NHAA 5EQDA 2ZFUA 3VH4A 4BAUA 2DPXA 1FU4A 3QFHA 2VPPA 4YROA 1ZRHA 3JWHA 3QWBA 3SBDA 1HWYA 1VCIA 4AX4A 1N3LA 1T4MA 3ZY5A 2O19A 1AXGA 5DBFA 4ROSA 3T0FA 1B1AA 4QYSA 1XZLA 3RADC 1SHJA 2H1OA 3OEYA 4M0PA 3ZJ5A 2BKVA 3ELWA 2GBFA 1YQXA 5KYWB 4ZODA 4A8HA 1YULA 5EIWA 1ORVA 1TM5E 2BEVB 1E3JA 2P6PA 1KEPA 3I9V1 4B6EA 2ZYUX 4C3ZA 5CEJA 1JEJA 4EPXA 3EE6A 4TQ9A 4BKMA 4HGZA 5SY4A 3OQPA 3B2EA 1QZXA 1SBIA 1X74A 2H85A 2HRQA 2IZ0A 3DCNA 3NTLA 1ZCAA 1IVYA 3NPAA 4IXDA 1MC5A 2HXGA 1KPGA 1ONBA 1AURA 1ESZA 1R1DA 1U3GA 3S70A 1V0JA 1XALA 2HMVA 2B99A 3AUFA 1GVNB 2WWGA 2H65A 2ZAIA 4G2NA 4Z54A 2IV3A 1FMTA 3GQVA 3RHTA 4HGQA 4J7AA 2QTVA 2IW1A 3NORA 4J91A 4JLPA 2P9QA 2F1RA 3D64A 3AR7A 4KSYA 4PSUA 1BEZA 4MRMB 1JHUA 4PYOA 3IS3A 3MINB 2YRFA 3G8BA 1E8DA 2FPPA 4Q05A 5DM60 4DW8A 1CUFA 1GNTA 1DIOB 2QRKA 3KOWA 1ZLYA 2KLBA 1OBHA 2WWWA 2R7NA 3CF0A 1CU1A 1ISSA 1BS1A 1C30B 1GT91 3GN1A 3KU1A 4OKIA 4A15A 2R96A 2IYAA 3V7NA 1C9JA 1N5RA 4DR4B 1WL8A 3DE0X 2XA9A 4XM0A 4UTXA 3TS1A 5DTRA 4EG7A 3KSRA 2BUAA 2NTEA 4OMUA 5IN5A 1RZUA 3QNUA 3TZ6A 3L18A 1BO6A 1UOQA 3FA2A 3RU3A 1GPJA 3I12A 3PDCA 3GDWA 4W1QA 2AF3C 2CDNA 2WP8J 3K5HA 4FP9A 3UJ7A 4XWTA 2ORED 5THQA 2XCIA 3WRWA 4KDRA 4C4OA 1I7NA 2VF5X 5LQMA 4BX0A 4XYLA 4M0CA 2GO1A 1T2UA 2O1WA 3WL7A 4QXOA 2QENA 1DCFA 3GLGE 2ZRDA 3V7UA 2RHTA 1TRKA 2BZ0A 1SHTX 3FYCA 3IOEA 4ZOLA 1M2JA 5G0WA 1GFWA 1XZMA 3L49A 3KQHA 4E12A 3HE3A 1FE8A 4M9SA 4B40A 4TTRA 3B38A 1NUQA 3GMDA 4L22A 4YRIA 1TCBA 2OO3A 4E09A 5K05A 4E1AA 5DSXA 3AEZA 5DTJA 4ESOA 1TU0A 3CZMA 5KC9A 4WN3A 3RREA 3UC9A 1D2EA 3OM0A 5AJYA 5IKEA 3A9RA 1VJ5A 4XQ9A 2HCRA 2XGGA 4BKOA 4OQYA 1MMFB 3V8BA 4AWXA 2NSJA 3VPXA 1RBQA 1N7IA 5KX5B 1IH8A 2IYWA 5B7NA 2XMRA 1PW7A 3EOBI 2HJSA 3ABOB 3B9QA 3CNNA 2NACA 2PH1A 3PFNA 4FLEA 4JHLA 1N2BA 2HFKA 4HAOA 4X41A 1T4GA 3AI2A 4F1WA 3OT1B 4EL0A 5JHGB 1GRQA 5LYJB 1QNFA 2X76A 1XU9A 1YJXA 3ONDA 5E6UA 4OHZA 1DAFA 5AVSA 3I2IA 3M6UA 5JS2A 5IULC 3DWGA 1VB5A 5JANA 1TUGA 1ZNXA 3W5JA 3C97A 1Y3CE 4B3RB 4XJSA 1JJIA 2UZ1A 3FYTA 3M6XA 4LHZA 4O5AA 1R6XA 3G8AA 4FOOA 4HDMB 1PJ8A 1TT5B 3QW4B 5AW9A 3PQ6A 1OAAA 4DT1B 4P54A 1E1RA 4ZP1A 2C84A 4RS3A 2CJPA 1LRLA 3C8DA 2BFPA 5BWCA 2YHIB 2WNSA 3BS4A 2OHVA 3ZWAA 4V0RA 1HH4A 4IDCA 2PMKA 4AURA 5JAPA 4MMXB 2OOKA 3VR5D 3WK7A 3KOYA 4KXVA 2DU8A 2CSUA 3FLEA 4DTIA 4RPHA 3TE6A 3CW2A 4O5OA 4QDXA 4B6OA 5B6JA 4ZDIA 4D4JA 3DLBA 3GYBA 3QHPA 4UFOA 2ZIXA 4W5WA 1HTTA 3R76A 3VZPA 1SG9A 1YE5A 3IKMB 2DKOA 4QREA 4ZO4A 3GROA 1NI4A 2XMPA 3DMDA 1I3OA 5EVJA 3P5BA 5BORA 2I2WA 3O31A 3GDOA 3AETB 3D2BA 4KK4A 1AUOA 1L5HB 2ZRPA 3RBZA 2ZZMA 1WCIB 3V2IA 2WWYA 2RD2A 2QGFA 3ZDQA 1ZFNA 2F00A 1XJWA 4BFLA 4OHPA 4ARBA 5K0BA 4IIDA 2YQ4A 2C03A 2LZ0A 2PUTA 2JLRA 5CG1A 1E2MA 3MWFA 2W6JA 4JLMA 1G38A 3KTAB 1P2FA 3E5HA 1C0LA 3C3EA 1KHTA 4RD0A 5K3BA 2AUMA 1NE7A 1DAOA 3WX0A 2XYRA 3W8NA 1KSJA 1CE8B 1PYDA 4QU9A 1KBOA 1MT0A 1KMHA 3LU1A 3OSUA 3QKIA 3EEQA 3T9FA 4MXDA 1Q1GA 4BLPA 4ZK2A 1P80A 2MTBA 4HF7A 4RSRA 5LL6P 3LQYA 1UBSB 2PKXA 1P7WA 5C32A 4H7FA 1QOPB 4LY6A 4PC2A 4U63A 2EX4A 2N3ZA 3U9LA 1W9MA 4FMDF 5CVTA 5DHAA 3AESA 2J5KA 3KLPX 4GVPA 3B5IA 1YRAA 1C4WA 4IAOA 4RKWA 3EZ7A 3QVGA 1IZ7A 1OBCA 1M7HA 2XHEA 2WYOA 4IWYA 3WLRA 5JXJA 3DMPA 3BJZA 2ACKA 4PFJA 3PYLA 3V8NA 5KTNA 4XQCA 4MNTA 3EMVA 3GLFE 3B48A 4OHYA 4ZI3A 3LLUA 2I1LA 4X1YB 4E07A 2Z2JA 5K2OA 1PR9A 1GXSA 3BWMA 5LZ2A 2H51A 1I7PA 4CF4A 5BOSB 4BQOA 4EY8A 1NATA 1TLTA 1TZMA 2H07A 2WTEA 3FYSA 5CTJA 1MRZA 4BDSA 1Z7EA 2ZI6A 1LDMA 4BVJA 2UUCB 3G8YA 3AFGA 3FMIA 1KC1A 1BIFA 3AVXA 2SKDA 3SS9X 1M6VA 2H59A 2ZR9A 4JC8A 3RVPA 3WVNA 4EJ6A 1L7PA 5GIPE 5F33A 3R4CA 3B6ZA 3IJEB 2F17A 4XLLA 1E20A 3EIHA 1G7RA 4JBGA 5EG5A 1U6JA 1E4VA 1L1RA 3TXAA 3ETEA 4XSHA 4JJAA 1AKRA 1JMYA 1T3LA 1Y5MA 1EZ1A 2LCQA 4BQSA 1JXOA 1NC3A 1V25A 5AWFC 3NHPA 4N3CA 3PHJA 4OLBA 3EPPA 3EDRA 3LL4A 3MMZA 4ND3A 3T7JA 4TTSA 3A4LA 3MLBA 3INYA 3PHBE 3MG9A 3DZGA 1T9AA 3KXIA 3NTOA 2VNJA 3PXEA 2HB6A 1O9GA 5KKNB 4H7JA 1QAOA 4J0QA 3ESDA 4RS4A 3ROTA 5IG2A 1AHNA 2QU8A 2WYUA 3M33A 2B4RO 1A7UA 2I54A 3ADPA 3DZJA 4G0YA 4HAWA 5FWAA 5HRUA 3G5TA 1H8HA 2IEGA 4QWWA 4YP9A 4JJZA 3K4HA 5J1TB 2D2XA 5ALEA 3DMTA 4R0MA 1DARA 2P0YA 3M82A 3Q6MA 3ONEA 2RKBA 3QEKA 5C1PA 5LP6A 2IS6A 5TVKA 5FHRA 4UCFA 2DUJA 2A84A 3ZE0B 4KNWA 2CFOA 4H6WA 3VKUA 2IYUA 2JGRA 3VSCA 3LPNA 4LVOA 4BZQA 4M46A 4OQNA 1SOMA 2NU8B 3U4DA 5CB0A 1I5RA 2XH8A 4TKLA 5KJCA 4MB2A 5KOJB 2J46A 1ZWLA 1ZM2A 2B9EA 3F2IA 3A1DA 2Y1KA 3DDNA 3P9IA 2HNBA 3EBOA 4IQ8A 4GPZA 4ALJA 4IDHA 1G20E 2PJDA 4FE7A 4YRSA 3WIOA 1MENA 4CN9A 5GZ3A 1EWTA 4TV8A 3LWDA 3OOJA 3GLGA 1BWSA 2R8RA 2I4NA 1CHNA 1T2CA 1BFUA 2B5WA 2WD8A 1OXUA 1TAQA 4EW3A 1DBQA 1OD6A 3ZYZA 4KO4S 1VDZA 2R751 3AUJB 3A25A 1SWVA 3LF1A 2H2GA 2Z8YA 4OM8A 1E2PA 2WKSA 1Z17A 3G49A 1ESEA 1W19A 1W2GA 2HMYB 5P21A 2C9YA 1QM5A 1U28A 4IIEA 2PYDA 3A70A 3RHSA 3TMAA 4XM2A 4A73A 1GPBA 3DFZA 2WA1A 1ECFA 1XX6A 4PO1A 5HZKA 4Z8YA 1ZD9A 3GRUA 5JISA 2XT6A 2EQBA 1E2NA 3GLHE 5EZQA 4TL9A 1UM8A 2ZUVA 5D2CA 1ML4A 1ZXXA 2VCHA 3K70B 2JLQA 4TTVA 4HEJA 4GWLA 5DHTA 2DAPA 2BC9A 4Z1MA 4F2GA 3MTIA 3DZCA 5H8WA 2IHBA 5TVGA 2YRWA 1UP7A 1DC8A 2IOHA 4AO6A 2EX1A 4CQMD 2E5FA 1BWQA 1CEQA 4WUVA 4M7WA 1DE0A 4LDZA 1D3AA 4KQGA 4P86A 2KSQA 4N18A 1A69A 2DECA 5TS2A 3HI6A 1DJNA 1WD7A 2L42A 3NEJA 1WY5A 2W42A 1EESA 1NQ5A 2R00C 3CCCA 1QE0A 4YN3A 4I5DA 2BEKA 4Q7MB 3JRWA 2FWAA 2O7SA 4NBTA 4CF3A 1ACJA 1X1AA 2WHRA 3FPFA 5FWXA 2V3CC 4F9GA 2C3YA 3D3WB 4B34A 4X0EA 3ESXA 3PWSA 4YV1A 2R8OA 5KMGA 5EOVA 1CUJA 1DT3A 1VG8A 2XUAA 4FSXA 4M1KA 5T6MA 3EUWA 1NVVQ 1XVAA 3I4CA 3ZLTA 4BGIA 4NENB 5IJ0B 1GAEO 2BFCB 3U3XA 3HDYA 3DYVA 3G5UA 5JG7A 3UAVA 4DEXA 3LUPA 3O8OB 2A3NA 1VSBA 4NBUA 5I7SA 1Q14A 1YZNA 1S02A 1S8FA 4RAOA 4WVFA 2BH2A 1G8PA 2W0SA 1T2EA 5K3FB 4CV3A 1T5HX 2PGAA 2NGRA 4Y18A 4UUQA 5CDYA 3M9XA 4OKNA 1Q7TA 2CDRA 2PTGA 1ZMBA 2B98A 3KDSE 4I1VA 1U9JA 3ASYA 3Q7RA 1L8AA 4J7XA 5HJ7A 2IBMA 4RL4A 1WZNA 1RQ7A 2HGZA 1Y9AA 5T3UA 4RXTA 3WYNA 1F0KA 3BB4A 1S7CA 2WPNA 3BE5A 5JO0A 1UBRS 2GN1A 2H31A 2MR5A 1WB9A 3ZIAD 2RIPA 4CLDA 3U4MA 1ILWA 3EVFA 3KQQA 3LQ4A 3PG5A 4L3VA 1E2HA 1VXOA 1NDHA 4PPYA 4ZHQF 4HTFA 4S1NA 3K1TA 3H87A 2BTQA 2WNHA 4HY3A 3F6EX 3JCZA 1IRXA 3AFMA 4XIGS 4BEVA 1GPKA 2HCBA 3QFRA 3AVWA 4MDEA 4B3CA 4IPTA 2UVPA 4E2WA 2BBWA 2UZ3A 1VLLA 4H0NA 2NWQA 4ZZ2A 1PL0A 4R3UC 4I9NA 3L06A 3MLEA 3OZCA 5E7QA 4Q66C 3TJMA 2IELA 4NEHB 2IV2X 4IWNA 4KYIB 2OHXA 3N74A 3CINA 3IB6A 5IMBA 1PI3A 4I9HA 2R85A 5JVDB 1FX1A 1F12A 4CNQA 4F8EA 4WBNB 1VJDA 3KKPA 4NARA 3A10A 1M5UA 5CIWA 1UAYA 3TZHA 4F85A 1QYCA 1UBHS 4OJNA 2OAQ1 3KYCA 3I8SA 3CPSA 3C1AA 2C78A 3JYPA 3KKOA 2AX3A 3GFPA 2CLLB 5EEGA 2YYZA 3BULA 3GFBA 1M76A 1LBSA 3PHGA 2XMBA 1GGMA 4MS1A 1O4WA 1SC3A 2REQB 3I1JA 5JS6A 5TY0A 1WW3A 3FPLA 3OCJA 5IVDA 5AVTA 4Y6RA 4D8WA 2CF6A 2PUWA 2B6NA 3N76A 1T1GA 1XR3A 4WV3A 3RTDA 1FYWA 3ICPA 3L7CA 4UAVA 2CXXA 2XBUA 1ULAA 1BYIA 1JU9A 3MD0A 3PUYA 4O4LB 1BCSB 4J0FA 2P6RA 2A86A 5CJ2A 4MR9A 1F4LA 2G28A 4PAMA 1E9CA 4RH0A 5FWYB 1CZHA 4FGZA 4L07A