3V34A

Crystal structure of mcpip1 conserved domain with magnesium ion in the catalytic center
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
157
Chain Sequence
b'DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
publication title Structural study of MCPIP1 N-terminal conserved domain reveals a PIN-like RNase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 157
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v34A00
5H9VA 4G26A 3V33A 3V32A 5FT9A 5DIZA 5H9WA 4G25A 4G23A 3V34A 4G24A
chains in the Genus database with same CATH superfamily
1RHMA 4BV8A 1KTVA 1NBEA 4UUBA 3TLKA 3SMVA 4YCDA 5DHAA 3OE4A 2ATXA 4C4YA 2JAOA 4UJ5A 2C7PA 3LBHA 4LVNA 1I5RA 1WQ4A 4TSFA 4AYTA 4D0NA 4URXR 5IJ0A 4E2WA 4NG4A 1KRHA 4LJKA 4P92A 4C1BA 2GM4A 3I05A 3EQ8A 2IBMA 4DG8A 3MWEB 1UDWA 3RQIA 3E9MA 4OQXA 5DHQA 2VT3A 1Y98A 4N9WA 3OLQA 1J0EA 2GPBA 1UAGA 3QWAA 3D0OA 4LDAA 5C7OO 5IDWA 3VU9B 3NWJA 5JNVA 1L9KA 1K08A 1WKVA 4OSPA 2B3DA 5IPFA 4FCCA 1T13A 1TJ5A 1NLUA 1FBTA 4K9OA 3RSGA 1KMQA 1YJ8A 2VK1A 3DLTA 2X5JO 3G2MA 2JGMA 3NGXA 4D9KA 1SXGA 1FXUA 1O8BA 3GH3A 3EY4A 2W6JD 5HE8A 1NTOA 3C3BA 1VI5A 3EG5A 3RI3A 4CLOB 4CR7A 2GZ3A 2RFLA 2IEBA 3OETA 3RC1A 4DR2B 3SCZA 1MQ9A 3KV1A 5BVHA 2KYRA 2C7QA 1BC5A 1NIPA 1KQPA 2A5LA 3BC1A 1N6KA 3GMTA 4LTMA 4ONEA 2ZTHA 1VPTA 2FQ1A 3HM9A 3EARA 2UZ1B 2I67A 1FP4B 5DEOA 3TLCA 2VPZA 1Q57A 2JFPA 2CHGA 5CTJA 3TDKA 4Y7DA 2RAFA 2RAUA 1XEWY 2C9CA 4MLPA 4NBRA 4QC2A 1HQYE 3VPXA 3AV3A 4I50F 3FOBA 4HSGA 4JJKA 5AOBA 1V1JA 3USZA 1QHIA 1LKZA 1XYGA 1Z75A 2PZEA 4TRNA 3R0ZA 4XB6B 4BB6A 1SCUB 5J40A 4NHEA 1GJRA 3BE8A 3W2IA 1LTHR 5FCDA 5IXJA 2I2BA 3D0QA 5ALUA 2ID4A 1F8XA 1TEHA 4OUDA 3ZDAA 5D5PA 5EWMA 5A02A 1E6LA 1PEYA 1WCIB 1MO2A 2UUOA 3OQPA 4RJ2A 1N3LA 1BCSA 4IMRA 3U80A 4UUMA 3W2FA 5J4YA 1GA4A 4YB8A 3TSOA 2UUAB 4HFMA 1A9XA 3L1VA 1WW8A 3I2GA 3I4LA 3M9LA 2DQSA 4PV7A 4KAXA 2FPKA 1ZLYA 3MEQA 1TO2E 3GK3A 1RWPA 3PKIA 4V1CA 3UUWA 4EUEA 2XIQA 2XMSA 1U2GC 1XT6A 1KKMA 2BKEA 3C6ZA 5CVCA 4JEUA 1DUVG 3VNQA 2Z5FA 1Q84A 3TEMA 3HB0A 1C2TA 2OZLB 4IKPA 2C4NA 5LB4A 4IHJF 1QIIA 2ZYAA 1JQ5A 5CNMA 2H29A 4EYGA 1Q1BA 1TLFA 5COBA 2JLVA 3RJ9A 3O2QB 3QK7A 1XROA 3JQQA 3U4QA 2ADOA 3VR0A 3D3KA 2O2DA 2FEMA 3U0BA 2R4UA 1GPUA 4HPWA 1P3Y1 4F2GA 4MYCA 2W83A 3WQBA 4UNRA 2FJ0A 3C3MA 3EPJA 1J90A 1TCVA 3HUEA 1Y37A 1SOUA 1HORA 5IUKC 3KOWA 1VTKA 1XU7A 4D81A 2AFRA 4R8SA 2HNBA 2JS7A 2QQEA 2FPSA 2W2TA 2GWHA 2HK7A 3OP1A 4OVKA 1WBJB 1Q1GA 5JAQA 2GRUA 5JZBA 2XCOA 3CN7A 3PT5A 5EIFA 3RSHA 1EVKA 3GUCA 3R24A 2PIDA 5A3RA 2ID7A 3AKDA 4RHCA 1GGJA 3G9QA 4C0WA 2PSEA 2YIMA 4KQWA 2YH2A 4D4LA 4GBJA 1D0SA 1ZJ4A 4M7WA 4A0SA 4G01B 4BNGA 1XA4A 5EZYB 1PEDA 1W1UA 2H4XA 1BX1A 4FFNA 2OV4A 2W48A 5EWLB 5I9TA 4DQ0A 2VOJA 5MN4A 4P1ZA 5KWSA 4EW3A 2FMIA 4DMFA 3FMFA 2H8KA 1U9IC 4PYKA 5AW3A 1E3DA 3RH0A 2J6IA 1WUYA 1JXOA 2IODA 2ZBUA 1QZXA 3N8HA 2H2IA 1B42A 3QHQA 2ORVA 1KQGA 1CUEA 3BZWA 1T43A 4FFLA 4DWJA 2BDTA 3A9UA 4I4CA 1VYVA 3E3LA 3O6VA 3FWPA 2V6JA 1G64A 4IDPA 4RQBA 4MQEB 1QYWA 4P7FA 4Z0NA 3PQ6A 1JEEA 4OMDA 4JI3B 3GEPA 4JP5A 3WY9A 4DCMA 2ZG6A 2HA4A 4D0SA 1NNI1 3B7WA 1P0CA 1RWQA 3BQ9A 3GJTA 3LTEA 3CO5A 2PG3A 1CJCA 1YCHA 2HIHA 3IILA 3WISA 3ESDA 3RWOA 3P8ZA 1IB0A 1YB2A 3U62A 5KNCA 1MD9A 2PGDA 2D6FA 3REOA 1I6MA 2NYRA 3AKZA 3GRAA 4IICA 1YR2A 5TEWA 2WG1A 3R20A 5F2KA 3RRYA 4KW7A 3T4UA 4CM9A 3OU7A 1E59A 3IPAA 3O4RA 3VTZA 1CUBA 2OCDA 2CKMA 1Z0JA 3R5XA 3G23A 1W4RA 1M8FA 2KSQA 5DWDA 4Z3DA 1N2EA 1JEYA 1HZZC 4IH9A 5JQGF 4RFSB 4NJMA 4RVCA 1AU9A 2O3RA 4LCJA 1XO1A 2E4YA 3HU1A 3THYB 3HVKA 1XFDA 2JH3A 3CV3A 3L7BA 2Q5JA 2V4ZA 3Q3EA 2P9QA 5HS4A 3L6CA 2RG7A 4OIFA 1YZNA 5LB2A 1DIAA 2YWBA 5HQ3A 4X71A 2NQ2C 2ZDGA 1KP3A 1SKYB 3LP6A 2IOFA 1HMPA 3UJCA 5KX5F 1ABBA 4G0VA 3IA2A 2BPOA 1JAIA 4I50B 2A57A 3DL0A 4LXXA 5KNCH 3UUGA 3N75A 3O8DA 1JDJA 4YACA 5T64A 3Q3HA 1CLUA 3CMCO 4YX9A 4RKQA 4F38A 3OD5A 3EF1A 5JWRA 3CX4A 1EQ2A 1N2CE 2NTNA 2ZS9A 4KQ1A 5IHXA 1QAMA 2BEVA 5B7GA 2I76A 2WSSA 1YVDA 4NCXA 1YBMA 3PIDA 2O06A 1FS4A 2R1VB 5CM9C 3RVPA 3EVFA 3T94A 3H11B 2QVCA 1Y5LA 2D5LA 2PD4A 3Q12A 5U1PA 1E99A 3TXXA 3VU0A 4F4FA 4BC1A 1KJIA 2G40A 2J9YB 4MP8A 4E32A 4DCCA 3CEPB 4MS4A 1PV1A 4EL5A 3AM1A 3ZWAA 3QP9A 5BT8A 2NMVA 3HFJA 4KXFB 3U4QB 1WLSA 3JD1A 4QBIA 1VB5A 1T1EA 4Y2QA 4JI7B 1MX9A 1VCOA 2R1TB 3GJXC 5C35A 2NNLD 3ETCA 4CQMB 3NAZA 5E9AA 3W06A 2QW1A 2ZRQA 5HKKA 2JLUA 3GOHA 2I87A 3PXCX 1YIDA 3GEDA 3UG6A 4HB4A 3V4ZA 4D80A 4R05A 1LLQA 3S2UA 4B7CA 1ACMA 5AFSA 2EFGA 2RGEA 1UPTA 1M0SA 1M1YA 1PEAA 1BVHA 1Z2DA 2Q29A 2GD2A 3ST7A 3E03A 1NIJA 3AFIA 3DEJA 4R4JA 4YQYA 3VSEA 4ZU6X 3A9VA 4TTAA 3MQ4A 1VSQA 3PWKA 2WK1A 1B2LA 4IJ6A 3PNBA 4LYAA 2W8BA 3YASA 4DR1B 5ESDA 2C2XA 1DOZA 1HR0B 1W9MA 1Y3CE 2G9UA 3I1IA 3AHJA 3LC7O 5A5EA 3W9BA 1EM6A 2G0AA 3GC6A 1UKCA 1XNJA 1ODSA 4KSYA 1VL6A 4ZVPA 3FVTA 3O84A 5DGHA 2A5JA 4XYBA 3OJFA 1RTTA 1CF4A 4PN3A 1ISFA 2GPNA 4GW3A 1N5IA 2ZTVA 1N75A 1XLUA 2PXXA 4HDOB 4KP7A 4QG3A 3IMEA 4FZ3A 3CCCA 4JFRA 4OYHA 2IV7A 1RQNA 3TZKA 2V97A 3S4YA 2QMEA 4X0EA 2JFHA 2Z08A 4ZPJA 3ZBQA 3DAPA 3GVPA 2V54A 4WINA 4EPXA 4BAGA 2JGRA 1QF9A 1XZJA 3JQFA 2P91A 3U4HA 1X7DA 2XNKA 1NNEA 1RC8A 3BJEA 3ODGA 1NPYA 1P91A 1RWBA 2FUKA 2B6NA 3V8QA 1XKXA 1L2TA 5DIFA 1DAPA 3H18A 5G1OA 5ICSA 1KMCA 1OGYA 1J56A 2GAFA 3K1ZA 4BU1A 2ZWIA 4N40A 1C2YA 3OTIA 4EG3A 3EEBA 4O3MA 4MUGA 1N2CA 3ROTA 2CLIB 5ES3A 5F4ZA 5TLSA 2A59A 1EXNA 5FWDA 1X9HA 5CYFA 3RODA 2F3SA 4DT1A 4KPEC 1NYLA 1Y3BE 5K0SA 3JQPA 5KYNA 1EWRA 1XZIA 4IIBA 5DULA 3NVKI 1JILA 1FSZA 1EDZA 2ZGVA 4EJFA 3KYCB 2B5VA 3PKZA 3D8SA 3I8OA 1FQWA 1P4HA 1SQ6A 1HUQA 3PE3A 4YMLA 1P2VA 2QQ5A 4TT3D 1G4HA 1RMTA 4S0XA 3EUWA 1N3BA 1Q1EA 1XHLA 2QL7A 3L4SO 2VUHB 3O82A 4UMFA 5DE3A 2VXBA 4NYMR 3IQFA 2H2HA 2PL1A 1X38A 3DZBA 5HUJA 1H2YA 1JA9A 4BQFA 1H2ZA 1AK9A 3CEHA 1NW9B 3F97A 4L27A 1GLVA 2XDWA 3FNRA 4JT2A 1GDTA 1H93A 5JQGB 2FQWA 4RV5A 1N57A 3EVAA 3N07A 2Y0EA 5IANA 1C7RA 2OXRA 1TD9A 1MORA 3M4NA 4IXWA 1RI4A 3AUTA 3G0CA 2H0RA 3JQ8A 4ICIA 5TMBA 4BNYA 2PEYA 2FRVA 5T5QA 4DLVA 2Z4SA 2DBZA 5DWVA 1JQBA 1V5IA 3L7JA 2NIPA 4KO2S 3M49A 5AOCA 4DSAA 5KX5B 3VYVA 1ULHA 2YOHA 5AM0A 1KETA 2MR6A 2QDKA 4B4OA 1AO0A 2PMCA 3ET4A 3GFFA 1N33B 4JZYA 5FTWA 5KCMA 5FD8A 3HCPA 3BDVA 4BWYA 1RRPA 1FX1A 1RBYA 4CMHA 3CX6A 3NGMA 4KFTA 3IJRA 3M3PA 1CRZA 4UQPA 2VAVA 2GN0A 4B4DA 3F7TA 5DYWA 1FYVA 1D04A 4KIFA 3GQVA 3H5OA 5EIWA 4AWAA 4DL9A 3OQOA 4UAVA 3RUDA 4E51A 4PGGA 2ZE6A 4JVSB 1HA3A 3AY6A 4Q05A 1M34E 2FN7A 2WF7A 3CM0A 2HXGA 1E6CA 5JMOA 1RM4A 2IEDA 4C14A 1JU4A 3T0GA 4MXDA 2F3TA 4CTMA 2ZSHA 2DHRA 5ALTA 3SPXA 3AEUA 3BSYA 4P82A 1JFVA 1NUAA 3R3XA 3O47A 5FL3A 4UJ3A 5K8CA 4IUDS 3NC0C 4G0PA 4LRXA 1AO3A 3JQGA 4I8IA 5BNZA 2ES4A 1DBRA 1KC1A 1TAHA 1Z4QA 2ZSEA 4KE8A 5C8YA 3P26A 3B8EA 1LPAB 4FFWA 2QTAA 3HXOA 4ND1A 1J8VA 1J21A 2QS9A 5EVJA 4B6QA 2DYKA 5C4IA 2PY6A 4WY5A 2PFKA 4U7GA 3WA7A 3Q5DA 4R2IA 1OREA 2YVAA 3S1LA 2Z2IA 1P61B 1V3TA 1G6HA 2NU7B 2XE8A 3EC1A 3K32A 4GMDA 3A3OA 5DW0A 3SEZA 3ZVRA 3RU7A 4J7CA 3TDMA 4BEVA 3FOZA 4AJJA 3F6YA 5KNLA 3HBLA 1L8AA 3MFQA 2QGNA 3DDWA 3FPKA 3RDPA 4JCCA 3MF4A 1J2UA 4O4JA 4EA9A 2D7DA 3D3WA 4I4TA 1HG1A 2CE7A 1C4OA 4RUKA 4DZTA 2NADA 1J0BA 4KNVA 1CZNA 3C14C 1EVJA 2DQ4A 1TC2A 1TZKA 3DMGA 4ERXA 1IATA 4BLSA 1ECLA 3P52A 3VHQA 5A9TA 5HM8A 4EJ6A 5JUWA 4X66B 2ETVA 3ENVA 1ZGHA 4F4JA 2NZYA 5FBVB 1U3TA 3WLIA 2DPXA 1II8B 1NW3A 1S3SA 4IOJA 3S1SA 1NSFA 3EEYA 3H16A 3MGAA 3IV6A 2CXPA 1P0QA 2AQ8A 3VX3A 3PIRA 4YCLA 1RWNA 4RK4A 1G9SA 2K2WA 5F23A 1TL7C 3DVLA 2PRJA 3DZ8A 2FUEA 4FHCA 1T36B 4QODA 3HBJA 3LL4A 4YP9A 1FSPA 1R0KA 2NQTA 3GO4A 4ISBA 5MFZA 2Z5VA 3T1HB 4D9BA 4KQMA 3BICA 2H92A 1CU1A 1BMFA 1MB0A 2DBRA 2GEBA 2OO7A 3L0OA 4DQUA 2YQZA 2CMFA 4FINA 3BPSA 4V1CI 4E1VA 1RTKA 3F7OA 2EFDB 2W6IA 2GPTA 4YLEA 4KQXA 2VUUA 4PO1A 5AYVA 4MW4A 4E15A 4MX8A 1JG2A 3FBWA 3VDMA 1DAFA 5AXDA 1QH1A 4Z0PA 1BOFA 5LQNA 1K6XA 4YMSA 1N9KA 3PVCA 1NLFA 2IDZA 5IFKA 2ADFA 1BMTA 2HF7A 2PJDA 3T7EA 4B71A 5LQRA 3HCBA 2PM8A 1LPBB 3GQBA 2BGKA 2H3EA 1EFPA 5TGZA 3QE2A 2OXFA 3I04A 3TQTA 5CDFE 1YE8A 3ZIUA 4EKIA 1VPWA 2G17A 2YFKA 4BLQA 1DT3A 5EESA 1JPJA 2QTBA 2B1JA 4Y6LA 3P2JA 1WUIS 4BNNA 3U17A 3CVOA 2ZUFA 2ATCA 3KQMA 1ADFA 3P5BA 1XAHA 4RVSA 1FSSA 2YN2A 4YP1A 2QY9A 3GCZA 3AW8A 3NRBA 1Q11A 3R3UA 1GG5A 5T6MA 5IT5A 3KK0A 4D3XA 2G9RA 3U4IA 4DABA 3EGXA 4Y9RA 4C5CA 4KXMA 3QBJA 1DEHA 2XUZA 4MVCA 2JI7A 3ECAA 4XQ9A 5LOVA 1UJMA 4LRUA 2A35A 5JW6A 3VMMA 3RNOA 4AS1A 1T6XA 1V4NA 2NVOA 4ZQFA 5J1SB 2Y1DA 4G4JA 4JITA 4QWWA 3TZ6A 3F4LA 3WYGA 5ECDA 4BCCA 1TJ3A 1KWKA 5C7IO 3U4GA 1Z45A 3SR3A 3UAWA 1NVVR 1RCFA 3IAM6 4Y1GA 4PC7A 5K6AC 1RHJA 3DOIA 1NLYA 3U7EB 1ILEA 3ZGNA 5ALSA 1TTPB 4MEAA 4XWTA 2NU6B 4X44A 3AYZB 3UEOA 1E79D 2Q1UA 1AXEA 4B47A 3RU9A 1JAZA 3HDHA 1THZA 2JLSA 4C1NA 2O8EA 2WYUA 1QPGA 3QMWA 4LXTA 1B43A 1R5JA 2V03A 3K15A 3ZX4A 1GN9A 1GQRA 3C5VA 3VPBA 1G20A 4RPCA 1QIDA 4EVIA 1EP9A 1R00A 5EJ4A 3TOCA 1XNQB 2PKQP 3MILA 3LT4A 4N03A 1IOZA 4I6JA 3L1KA 4PPFA 3EC2A 4NFSA 4PE5B 4RACA 5IT0A 3TJZA 3MERA 4AJ9A 1H66A 1KK3A 3PGA1 4O2BA 1L1QA 2FHSA 4WLOA 1YIAA 2I1QA 3KU1A 3LCUA 3AF2A 4R7GA 1MV8A 2VJPA 5D5HA 3SAJA 2D2FA 3QELB 3R4VA 1XVAA 3IFSA 5BQXA 2Y9MB 1X1AA 3F5DA 1NBMA 4O4JB 3U5TA 2J3EA 2IDKA 2J7KA 2OHGA 2XYRA 1E5XA 1YL5A 3PHIA 2C5GA 4DDTA 1XMQB 1DC7A 3OWOA 1M1XB 4O2RA 2WQ6A 3U61B 1CYDA 1B6GA 3F8TA 3BBPA 4QVKA 3VHXB 3ZCRA 3EVCA 2C07A 5AT1A 5JC8A 2WVJA 1WBBA 3IE2A 1I2CA 1Q20A 2QHXA 3D2BA 4XWAA 1P5JA 2FFQA 2Y0BA 1GNVA 2O2ZA 3P2EA 5CP8A 4F3CA 1JPVA 1I30A 2V7TA 4L9WA 3L05A 1NX9A 5KYUB 1KY3A 2QT1A 2JBAB 2V6FA 1SH7A 3CZ5A 1DG1G 1JG3A 1G8JA 1IC6A 4NCBA 4YHHB 5EZ5A 4G0ZA 4QA9A 4TUYA 4J76A 3GJ6A 1CR0A 2KM1A 4RXUA 3WGQA 4UULA 3CH4B 4KQJA 1E62A 2FOLA 4UU8A 1NJ5A 5ELXA 4TL6A 4NKRA 1SZCA 4WA7A 3EZYA 2XB4A 3MWYW 4KBYA 5AM1A 5TMDA 3W5JA 5CBPA 1X74A 1XZCA 2G25A 2HRZA 1IZ8A 2OFPA 2Y1XA 3FB1A 1NVUQ 1EX6A 2G1AA 3QLUA 4MV4A 5D00A 2VJKA 1RZUA 1IQ0A 2P9BA 1SUAA 1ICEA 1S7GA 2FEXA 4QXMA 1DEXA 4NOMA 5AW5A 4DDUA 1BD3A 2DFDA 4YRSA 4B3XA 4RULA 1J5EB 1GQSA 1HE8B 2UYOA 4PICA 3SXUB 1MFPA 3M3HA 4PG8A 2OZVA 1AV7A 3LUJA 3FOAA 4UDXX 4M9XA 4D97A 3THOA 4ZOCA 2VPXA 4HG2A 1DOAA 3HO6A 4LBYA 1AIPA 3ZWKA 3O3NB 4D9JA 4I9HA 5JRZA 5ALWA 3B5IA 3A2LA 1J25A 1Y8RB 3FHLA 3OSZA 1AZSC 4QFMA 5MN6A 4AWXA 4NZPA 4ZXPA 3IBSA 1RPNA 4G4SP 5JISA 5HJ2A 2QUIA 1NMQA 4LZPA 4Y2PA 3K8OE 1FFGA 3BGIA 2FEPA 1GTG1 1FXWA 1WHSA 4V2UA 2HFJA 2PKRA 2R86A 2WB4A 3GZTB 3O73A 3P0IA 4IJ5A 5CVTA 3T95A 4KFRA 1YA6A 2LGJA 3RIGA 4C9BA 3PQ5A 4XVHA 1YQXA 1Y48E 3SLKA 5HUHA 2AI2A 1ECCA 2RSLA 3FMPB 3P0FA 2I6FA 3N0RA 2AFHB 4I55F 3ABZA 2GSWA 4M3NA 3RFFA 5HGXA 5IZCA 5JSKA 2BT4A 3BFKA 1CNFA 3WIOA 3QEOA 5D85A 3I23A 1H42A 4I4IA 4EIWA 1V6CA 2PMWB 3EG9B 1NG1A 3F71A 4TKMA 5JD5A 3ZQJA 4CPDA 4JN6B 2Q5LA 1LWOA 2ASEA 3O7WA 4URFA 3FRHA 3K0SA 1E9DA 2G82A 4GG1A 2FEKA 2VP4A 4LXGA 1FJ2A 2BRUA 2FWRA 3IAXA 2Q7XA 1G8AA 3GN2A 4PRLA 5EMNA 4EQZA 3CG4A 4ZOBA 1JLSA 2Z5GA 3SKYA 4JBXA 4A2WA 1WD7A 5E6SB 4BC0A 1J0DA 2C3PA 3WLNA 2EFHB 2IZ6A 3GUZA 1QLHA 3QE0A 4YT5A 3Q0EA 3K4QA 1ZMBA 5CYPA 2H9IA 1F3LA 3A1UA 5LMUB 1I3OA 1JRLA 1YQUA 4ECEA 1N0HA 3BAZA 1QX3A 4WXYB 4JKOA 1YJXA 4BB0A 1WP4A 4EP1A 4JEMA 4G0NA 1VJ0A 3C7DB 3ILVA 4RK5A 1OWLA 4MTLA 3L7CA 4Z4EA 2BHLA 3FPLA 3IB6A 3Q0IA 1LVUA 4UBJA 3K4PA 4POOA 2AN1A 4GOMD 2EV9A 3KCQA 2HPVA 4IPTA 4LRQA 3KQYA 1DAHA 1I5EA 4Y30A 5GONF 4DDWA 3GDHA 2A58A 4MIYA 4R81A 2RBGA 2QBYB 3HXTA 5CB8A 4BNWA 4M49A 1R8SA 1FDIA 1U2QA 2JCSA 4YNBA 1Q7TA 1OB5A 4RHTA 3I5YA 4IX9A 1WX1A 1ZX1A 3T61A 4F6RB 1IVNA 1ZRNA 5DEIA 5DNDA 3SYTA 3I5XA 1IXZA 2JLWA 3QFRA 2I2XB 1CX9B 2RK3A 2YXNA 2CJWB 1YZGA 1BH2A 3HG7A 3ZXUB 2LPMA 3N86A 4Q03A 2GZSA 3PR1A 1NFFA 4UEWA 4MW6A 1EWKA 2R4QA 4G41A 3UMVA 3WKBA 1LLUA 3T9EA 3UXMA 5KYXB 1P29A 3L02A 2ZI4A 3PTLA 3OIGA 1E92A 1K7SN 2CXOA 2I6QA 1L5QA 3OH8A 1IK4A 2YBDA 4KQGA 2FPIA 4X1OA 4Z9AA 4D6XA 1ACJA 5FUBA 2VHQA 2FPXA 4Q5IA 3H2JA 5BPFA 1O6ZA 2C2OA 1QH8B 2N1BA 1WLYA 1YQGA 3RSZA 3VNSA 5REQB 4YUXA 5K9ZA 4JB3A 4N8EA 5T8KC 4AMVA 4JJ8A 1IHDA 2REOA 4KAAA 4BO8A 5KYYB 1FUYB 1YB4A 3NCTA 5ALJA 4HN2A 5G0SA 1EGMB 5JS8A 1NWHA 8ATCA 4N0DA 4X54A 3QIAA 1YRHA 2RBKA 4E2FA 4RSMA 1GPBA 1JWBB 1P9NA 1SAYA 2XPCA 2IY7A 3FCSB 4B3RB 1Q1AA 4RLHA 4Q4JB 5JAIA 1SCJA 3CWQA 1NXVA 1WW2A 1BDHA 4WERA 1NTRA 3KD3A 4S2UA 3GJ0A 1K4YA 2VJMA 3I83A 4C08A 2HJHA 3KLOA 3NBQA 4CRWB 5I6DA 1VPEA 3GVIA 5FHRA 3VXKA 5C18A 1E7QA 2HLPA 4ND5A 3WAGA 4M9CA 3DXYA 3KEOA 3O7MA 4RTLA 1P2FA 6LDHA 2UYYA 3RANA 2HQSA 4WZ6A 2Q3FA 1OASA 3J7TA 3OIYA 5FXMA 3TMYA 3IVCA 4AI6A 3CEMA 4IHAA 4BV9A 4RW0A 2BEUA 1PFGA 1RXEA 4DLRA 5BR1A 3PJEA 5MF6A 1B6TA 1Q0UA 4HTFA 4UBIA 5EJ8A 4EGAA 1E7MA 2P7IA 5CLGA 4CDRA 5T67A 3B52X 1AA6A 3KKOA 4WK6A 3OZFA 1EK2A 2UVDA 1ISHA 1X87A 5H83A 1GA1A 2BAGA 2H16A 1V5GA 5D1NA 2O5EA 3CT4A 4LDZA 1FDWA 2OBBA 3I39X 1XMVA 4QRHA 5F5XA 2JGLA 5H80A 3EGEA 1V3VA 1UP4A 3HB5X 1I7LA 1KS2A 1ODFA 5LMCA 3TG8A 4S04A 1B0UA 5FL7A 2ZVPX 4UU0A 3B2EA 4CM7A 3KTAB 2ZRJA 3GHHA 3PC8A 3PZRA 3SX2A 5H02A 2F2TA 3Q40A 2JCVA 2JC3A 3ZHZA 5FOWA 1MPTA 5KJ6A 1M0TA 3AB7A 5KJCA 1FFSA 3DDNA 4I55B 1RKXA 3P9ZA 2J45A 2C94A 2BMEA 5IABA 3N70A 3NWPA 1ZC3A 5IF9A 1I2BA 5M3BA 3WGUA 1XEWX 1Y1TA 1UQRA 3ESYA 3H86A 3I9MA 3KPYA 4CUZA 4GT1A 1W4AA 2QUHA 2EX1A 1QIFA 1CUXA 1DFGA 4BUCA 2NZJA 3PUKA 4DRZA 2GKOA 4I4NA 4LTDA 4NPCA 3FD8A 3A36A 4U7PB 4DDHA 4YYZA 1RRFA 4BNZA 2CHUA 3NIBA 4BKRA 2HSEA 3ENKA 1I8TA 4RQTA 4QBHA 2OQRA 3EHDA 5ALYA 3OQBA 1RD4A 2HYDA 2W0SA 2DPLA 1EJBA 4H59A 4CODB 1H4QA 4FW9A 1K3UB 4LGMA 4YAWA 3OQIB 2BW0A 5HIAA 1R6TA 1QLJA 2M6RA 3COPA 1GA6A 3F74A 5F73A 4D42A 5JJKA 2R11A 3RYHA 3MT0A 4LY0A 4CIVA 1FUIA 1GZ6A 4MRRA 1USUA 3O74A 2FJUA 2H4ZA 4FSXA 1A5ZA 1Z6QA 2CLEB 2D54A 4I5IA 1O6GA 3TD6A 2ZPUA 4CHGA 1IFXA 2FKNA 2JZNA 2PWBA 3PI6A 4JL5A 4CLXA 3K1AA 3M81A 4REMA 1CUSA 2XJ4A 1S1CA 4EJSA 2OFFA 2EEZA 4QOSA 3C3YA 4FNGA 4HUQB 3HVIA 5JY6A 3R7SA 2CV2A 4CGYA 2VSOA 1TU0A 1Q0ZA 3EFOB 3QOXA 1XVTA 3VBEA 2NO7A 3P19A 4JSYA 4BVLA 2QX4A 4D6YA 4QX6A 1CY0A 2O1EA 4XX1A 2V3WA 1N2GA 4TLLB 1CCWA 4F7DA 3F67A 3QUQA 1AZLA 4IXMA 3QF7A 4MUMA 1K7XB 1Q3KA 1ZD9A 2ZUVA 5BRAA 2QAGC 2W9XA 1F0YA 2HF2A 3DV2A 2CDCA 4KQIA 4RF4A 3RFUA 2O1XA 3SD7A 1GGNA 1IZ7A 3SNHA 1MAUA 1NBIA 2GPSA 2IH2A 2HOQA 2JIZA 2NO6A 2ZJ3A 5IHPA 2IXFA 4E33A 5J2TA 4UM5A 1ZN8A 3AEKB 3OHSX 1ANKA 1XLWA 4AZ3A 1W52X 1GLNA 2F4NA 1WXXA 2ODBA 1TCBA 3VZPA 1A7UA 3DTVA 4H7JA 3SR0A 1W5BA 1NU6A 3BMCB 2F90A 2JGNA 3DEHA 4DQLA 1UMDA 4X7RA 1Z12A 2CBZA 2FEOA 1KDTA 3NO4A 1H4SA 2VDKB 1YV9A 2NZXA 2FY8A 4HJXA 4HTFB 1IOWA 1ODKA 3SQNA 5U4XA 4Q3LA 5C3MA 1FB5A 3VKFA 5TX7A 3HU3A 4V38A 3OQHA 3CT6A 1U9ZA 1Y81A 5I7FA 2ENUA 3IQXA 5EZQA 3ZLUA 4C7OB 2C9YA 2J5KA 3EVTA 3MJSA 2DMRA 4RTOA 2YV4A 1R7RA 2GHTA 4LK2A 3SSMA 3QITA 3VH3A 1GL6A 4W5TA 3IXQA 2P5YA 5T7BA 3HKCA 5HZGA 3MMNA 1XAGA 4HX9A 1P77A 4US2R 1C3OA 5TPWA 2PBRA 1E58A 2V7XA 3VDXA 3AJDA 3NDRA 2KLBA 1X1TA 3P2KA 1HDRA 1L5RA 1P7VA 1PDWA 3PC2A 3QJYA 3IPYA 2HKIA 3KB6A 4KYTA 4X1IB 4XJSA 4LX8A 4CQMD 1E8NA 1HYGA 4JBGA 2IU6A 2AMJA 2B3TA 1Z6AA 3SVLA 1KFJB 3WK6A 1O6CA 5DBGA 4MV7A 2CLKB 3JALB 2GH1A 4JGGA 4PXSA 5KQRA 1W85A 4B40A 1XCGB 1HEIA 5J5CA 1DVRA 2W2OA 1ZEJA 3SG0A 2WJ3A 1K63A 2E48A 1RJWA 1HI9A 1EH5A 2QIOA 4F97A 2VYCA 3S8EA 1U8AA 2H2GA 2MYPA 3EWSA 1NHWA 3HV0A 2QM8A 3QVTA 1E4VA 3N2KA 3D3EA 1H5UA 5I5EA 2H1CA 2YQ4A 2PEZA 1DRWA 5ICCA 3BIXA 3INYA 2W37A 3HV2A 4MH0R 4LC0A 2W6OA 4G81A 4UFPA 2DAPA 4ZT4A 4JUCA 5IWCA 4K3VA 1EEXB 2P1RA 1EG7A 1ODIA 2FPPB 4FR2A 5FF9A 3ABQB 4AJHA 4MR9B 4BTEA 2NTJA 3C39A 4V0RA 2XT0A 3Q15C 4WTOA 2XOXA 4WASA 1AUXA 1JLLB 2JHGA 2OUIA 4BL5A 1GWNA 3AESA 1NF9A 2WHRA 3LBIA 5J47A 2G28A 1LGYA 3SP1A 3Q7QA 4ND3A 1B6RA 1NNUA 1LRKA 4YI5A 2WJAA 1HT3A 1H4VB 3E8XA 2NXJA 1R66A 4PSAA 5JPIA 3UIEA 3HNPA 3GLHB 4D92A 3KQNA 2V3CC 1DT5A 4N65A 2RGRA 3LPCA 2A1TS 2C61A 1LCIA 2BCJQ 4FNOA 3LM8A 4G1UC 4DJAA 4B3HA 2YZKA 3OCZA 3FPBA 1ZBDA 5KNCD 3JAKB 1HQCA 1SC4A 2JJQA 4NS4A 4PX9A 5JNWA 2ANCA 1XTJA 4CM9D 2E4WA 3SIXA 5EIXA 1Z2OX 1DZIA 3GT7A 4KXLA 3UAVA 1Q19A 2BV3A 2PUJA 2ZR9A 2X0EA 1T2AA 4F4CA 3QTTA 3RIHA 4DA0A 4B17A 3PFCA 2HBRA 3F6SA 1TA9A 1K3FA 2XLCA 3EK2A 5FAKA 3OVMA 5HTKA 1E6WA 4I1SA 5BSUA 3DQPA 3LI2A 4AUNA 4RDCA 4ALJA 4KREA 3ICOA 1V96A 2WWRA 4DNQA 4IV0A 1SQGA 2B5WA 3B9QA 4DC0A 1NFRA 1VLHA 4LNHA 4DM3A 1KO5A 5LFAA 2PKQO 3BGDA 4MI9A 1DINA 1OU0A 1T8PA 1XGKA 2FETA 3BAFA 4J1TC 4TTVA 3T9DA 3ZCPA 3F2IA 4YLYA 1QV6A 1EE2A 2NUTB 3G0IA 4EB8A 5BMOA 1P1FA 4A36A 1P19A 3JYLA 3NTRA 4N39A 3A14A 1U8TA 4PCVA 4Q1EA 1ULBA 2J5QA 4PFJA 1BE8A 1A72A 1GG9A 2GK4A 3MGGA 4WFIA 1GGVA 4MYSA 3E0XA 4CEHB 2IP2A 4F7WA 1CLEA 5C7LO 5JNSA 3RVSA 1J9GA 1NUTA 1RFLA 3GDOA 2H1VA 3LT1A 4II7A 3T5GA 1SUPA 1JHUA 1EXWA 5DV9A 3I2JA 3VYUB 1T26A 2YW9A 4ZRDA 4F91B 2CUZA 3TR6A 3CZMA 3EXHA 4BLUA 1ZM9A 2ODQA 4KKXB 3JYPA 4R1UA 5H70A 4BDTA 4Y2SA 1KPHA 4M88A 4W1SA 1REQA 4PAWA 5GMOA 4DY4A 2P1DA 1HFWA 3FZYA 1CRWG 1GNPA 3IKVA 3DZKA 2PS1A 3LP5A 4RXTA 1XRNA 3HB9A 1IUKA 2IHYA 4I1YA 4OAPA 4HK4A 3X44A 2MU1A 4CMIA 4MROA 3BT7A 1OIVA 4UDOA 4V0ME 4O1IA 5KMGB 3FTQA 1SKQA 4BLVA 2VDWB 1NVTA 2ZJ7A 2YDYA 2ZI7A 3FH0A 4S24A 4BJ6A 5IJWA 1F9AA 3KZMA 3MMSA 3D8TA 4FFDA 3IH5A 5C5CA 5J23A 1IULA 5JZ9A 3QX9A 4WW0A 1W76A 1DC6A 3VH4A 4AG3A 4MYHA 5KSWB 1B0AA 1N8SA 3PF8A 2AXQA 4P4NA 2WVHA 3HYRA 3L7MA 1JHAA 2ZP1A 2E49A 4YMIA 3KPVA 2FGJA 2UZ3A 4ETMA 4LFCB 1WS6A 1U7HA 3SEFA 3WGNA 4I1PA 1W0JA 4J0DA 5JD6A 1QMGA 1Q22A 4Q4AA 1H1LA 4UU7A 4YAKA 1GARA 2R8ZA 5HIMA 3ZKAA 4KQ6A 3X1XA 4RX1A 4ENQA 1X92A 4OL0A 4DE5A 2LD4A 3AIIA 4M1YA 1YS2X 1UF9A 4R1PA 3WFJA 4BGEA 4W7IA 5K8LA 5B3JA 4GLJA 5LKAA 2H06A 5AUPB 2Y4NA 1GZ3A 2BTQB 1GCUA 2W2XA 4JUFA 4KQKA 5AR1A 3K0FA 5A06A 5EUQB 2VXYA 2RHGB 4LXHA 4NTZA 1TO6A 3CBGA 4W9RA 4L7VA 1U2RA 5JANA 3EUEA 1TCAA 2X22A 4L5YA 4N01A 1CIVA 2VPTA 1V25A 5JCJA 5FJJA 2M32A 3E5HA 4G4SO 1NN0A 1K0FA 2GKSA 3W7AA 2B9VA 4G97A 3PDIB 4L9RA 4NIMA 5KTNA 1W44A 1KQOA 1WEKA 4PBTA 1FSGA 4DJDC 4FFMA 1H8EA 4MINA 5TGDA 1RM0A 5NLLA 1GQQA 1GPKA 3EVZA 2Q3DA 3BTUA 3S6JA 4BZWA 2SNIE 3MA0A 5A4MS 3BK2A 1DRKA 5IZ4A 4GQBA 2YDXA 3RKUA 2C7GA 3ONWA 1GUDA 4LJ7A 4QSHA 1IHUA 1PHPA 4PLYA 4ITRC 1R4MA 2UU9B 4L16A 1G41A 3BX1A 2YFQA 3M7IA 3RW9A 1KOLA 1TLLA 4CIDA 2NUPA 1ML4A 1GCOA 3I42A 4ZI2A 1T10A 4FYXA 3LCCA 3T5BA 2G8LA 3B82A 1U1DA 2IEIA 5CK5A 2VHWA 3ACCA 3LY9A 3PGLA 4KNYA 4OU4A 4LDNA 3WICA 1XXHE 1ADJA 4FHEA 3OZBA 5FFMA 2PCLA 1GNRA 1PRYA 2C2GA 2FPGB 3CLRD 1XZDA 2BSXA 2QLTA 3AP3A 1ZOSA 2VJCA 3NC4A 4M4SA 4EA8A 2B30A 1KI8A 3T4EA 4ZFNA 3WLOA 2QSJA 4UQLA 1UT8A 1OAOC 1WCWA 4JOQA 1FP7A 4RORA 5HJ5A 4LEIA 3IUYA 2Z1DA 3JQ9A 4YGXB 1STOA 2BHNA 5I7AA 6Q21A 1YACA 3OIUA 3N2EA 2IYTA 4DLNA 4NLLA 5A9SA 3KXPA 4D9GA 3EXIB 2Z8YA 3FNIA 1MGOA 5JSZA 4URVR 1XDWA 2POQX 2EF0A 3ENNA 1XC7A 4V0MA 3WZ2A 1I7NA 1HC7A 3O03A 3BJZA 4DR7B 4JGBA 1KIAA 1U0LA 5A4KA 3DCIA 1ULAA 1JZSA 3Q9UA 4YS6A 4DIBA 1T8WA 1YJ5A 1IY2A 1U0OC 4C22A 4LV6A 1PYGA 4REQA 3KLNA 1OZHA 5AH0A 4GR5A 4BTVA 2V7UA 5KSOA 5H9WA 4DUZB 3AF0A 2Z0MA 4CFYA 3M6FA 5YASA 5DTJA 3R74A 1JHZA 2RH9B 4B81A 1I36A 4L6CA 4AKSA 1ECFA 1JKJB 1DP4A 1Q6YA 1WZCA 4N0MA 4M1MA 1Z3IX 2JIOA 2ORWA 3KJQA 3VISA 4X1KB 4FYWA 5L3SA 3OIWA 1TC1A 4QGAA 3QVMA 1W96A 3DHYA 1IDN1 3QLVA 1Y9AA 4ILKA 3H3FA 1JE1A 2WJYA 3QU2A 5ALZA 4HLCA 4TMWA 1MB3A 3AOEC 1E9CA 1AY0A 1GEEA 1SBZA 2F00A 3K31A 3NNDA 2JD0A 3NUQA 3KHUA 3AT1A 3AEQA 4PO3X 3T5CA 3OZSA 4MV5A 1UL1X 3VV3A 2GFIA 2JDIA 4HDMB 1L4YA 2EP7A 1OGIA 4Y3UA 5CLFA 4P36A 2GAIA 2VRNA 1Q2XA 3DF7A 4MRNA 3WMWA 5CR9A 3GAFA 4ZA2A 3TNFA 4KLNA 3ZV4A 4NZYA 1F8GA 1BXKA 4EITA 2I4TA 3CNQS 3VAZA 3K71B 4LWOA 3K2EA 3FTNA 1FUUA 1JYFA 5JLAA 1IEXA 3OEHD 1EFUA 4WLFA 2BFDA 1D4FA 4B80A 3LJKA 3VR2A 1JVSA 5D3MB 3T7CA 2NO0A 2WUVA 4IIUA 5IBQA 4B0OA 2ZJBA 3CR8A 2AN5A 4G5SA 4FJ2A 5AW9A 1J06A 1H1LB 2KX7A 3BS4A 5E0KB 4CLDA 4FBGA 5HPYB 5AIAA 1UH5A 3C3PA 5FTKA 1KEUA 1MXFA 1GEGA 5EOVA 1KEVA 3NATA 4EG8A 1QG6A 5IDXA 4F3KA 5GV7A 1KJWA 3KQUA 1SNYA 3QYPA 5PGMA 3V1MA 1U0TA 4BVGA 3FAZA 2WU0A 3CF2A 5EFZA 1QPBA 3F96A 2HQRA 2YY5A 4IWYA 1IEWA 3LS2A 4OA8A 4HGPA 5K0NA 3KKNA 2J87A 1T1JA 3SZLA 1T5SA 3DXXA 1Y5MA 4IXNA 4Q9LA 3WXBA 4BJ1A 4LF9B 4V0QA 2HDWA 4BQNA 2FW9A 4FWTA 3VJRA 1H22A 3HBNA 2ZAOA 1ZI9A 2UV8A 3ETDA 1NSTA 3LO5A 2Y68A 3OEEA 4R16A 3QEKA 3UXYA 1YRLA 3R76A 2DG2A 4JJEA 2E4ZA 1C1DB 1DRVA 3N6XA 1Z33A 1RQGA 3W6ZA 2M6SA 5AKLA 1XMOB 2AJBA 4JB2A 3DBLA 4C0QC 2L0XA 4CN8A 1SXQA 1NJ1A 4TOIA 4G2TA 1T5IA 4YV0A 2XUAA 3A1TA 3R3VA 1IE3A 4QBTA 3WGOA 2D1YA 4CXMA 1T2VA 2IPNA 4ER0A 4PEVA 4K9NA 3FUUA 3GFVA 3NOVA 1R4NB 2VC2B 1UMCB 3HGTA 4RZIA 2GFQA 1ISMA 2Y93A 2BYTA 1E2BA 2CCGA 2PD6A 3PHJA 1GPLA 3Q3VA 5C32A 2E3JA 5JBNA 3TZQA 1RQLA 3MS2A 3CRNA 1KMHB 3F2VA 4YR7A 3D6JA 2OEPA 1YHYA 1KYXA 3DBRB 4D4JA 1TU3A 1G21E 3CE6A 4JUIA 4M6WA 4WXEA 1Z63A 1F7VA 2AR7A 2GLUA 1HYBA 4QFCA 5IH3A 5BSEA 3NHJA 3RK0A 4KVZA 4K9KA 1EGVB 4H7PA 3U7RA 3BGVA 4BQSA 4CM8B 1CBUA 4WN9A 3BJRA 1BMFD 1BMQA 3E8MA 4F21A 3CVVA 2BUCA 1TKCA 3C85A 4LYEA 1I7DA 1TZCA 3N2LA 3QFFA 3E81A 4F5WA 3G2KA 2R7AA 3G2JA 1OLOA 3GIWA 2P6NA 2FCRA 2PX4A 4RPLA 3NYIA 3RQSA 4GI3A 3WIVA 3RVBA 3EAQA 4ECAA 3F5MA 4GLLA 4Q21A 4BZPA 1HT0A 4WXMA 1FZQA 4IEEA 3NBYC 4DIUA 4NNJA 4X6UA 1GHTA 4CE6A 3PX2A 3MMPA 1NVVQ 2BH9A 3S1AB 3TVDA 1RAAA 1VJDA 3OOYA 4PHCA 4JS0A 2VDRB 1OXUA 4DRXB 3AIMA 1P9WA 1UKEA 1TF5A 3JPYA 3PUJA 3NETA 3BH7A 4MV8A 3FB4A 7REQA 1IAQA 1WMBA 2P4UA 2NSJA 3NWOA 1B16A 2XYQA 1AGNA 1TM7E 2IS6A 4WOPA 4K88A 3AETB 3AEQB 3JVDA 3LZ6A 4G67A 4LKOA 4I1RA 4MVJG 5H81A 1THMA 5KOJA 3VDQA 4BGDA 3GUUA 2Z2JA 4D0GA 1SUCA 2OBMA 5BNIA 1VBFA 3ZWCA 2QKYA 1O3YA 1EFCA 1PNOA 1KI4A 2DPHA 3BERA 4FS3A 4AJPA 4E88A 3AH8A 1UC9A 4HNTA 1F14A 3BTOA 1NJFA 1NVGA 3DMPA 3E27A 1R1DA 4PM4A 5ETJA 4W8GA 4OI1A 3R3ZA 1N0WA 3IPLA 4YMVA 1Q44A 1IY0A 5KTYA 2XITA 4H17A 5EY5B 4Z3KA 2MHCA 4EJ2A 4RDHA 4OP1A 4HB2A 1LEHA 1DI0A 1L7QA 2GTPA 3B78A 4FXPA 5MN5A 1QS0A 3Q6IA 4OMFG 4QJ4A 4EKDA 3NBKA 3EGVA 3MJTA 1QGUB 4GZ3A 4R3WA 5SZIA 2C9MA 4CF6A 3G88A 3GRKA 4MUYA 4DMRA 4B46A 4BP8A 1GPYA 2JFNA 4Q82A 4AT1A 3MOSA 1ZGAA 3FPCA 5KPJA 3ROFA 4O5OA 2R7MA 2HR1A 3AYXB 3Q72A 5CGQB 1YKGA 3GYGA 4IXTA 2VATA 2QLLA 1OTXA 3I9KA 3U9SA 4XVQA 4HBGA 3OWXA 1Y33E 1JQDA 1X14A 5AVOA 3HJUA 4ZJZA 1EB9A 4R8MA 2FN9A 2FLKA 1QTRA 2H59A 2VQSA 4YRQA 4DC1A 5KNBA 2C1EA 4ALIA 3WXMA 4EJMA 1OV6A 5CFPA 1E4OA 1J6UA 1AOXA 1G55A 3HR8A 4L73A 4N18A 4QYWA 1W5EA 3KUDA 3KOXA 1ZRSA 4UTNA 2GZDA 3U16A 3CKYA 4G1MB 1QRRA 3FCOA 2BVNA 2C5AA 1UZAA 1U1GA 1YFJA 1NXPA 1NBMD 4WEQA 1L5YA 2ILTA 5B1YA 1ZDMA 5J4KA 1ZUNB 4KXUA 3L8CA 3IRVA 1VL8A 2Z57A 1ISGA 1EMDA 1XMSA 3CNLA 1C29B 1DBPA 1I2ZA 2GLTA 1HDGO 3IODA 4TQUS 3W5DA 1GO2A 1Y1SA 4N54A 4W9MC 2LE0A 2F17A 1OZFA 2EAUA 4KGZA 4E08A 2OXIA 4JH0A 1PJ3A 3K92A 4WNAA 4DXDA 1PL0A 4I99A 4LBWA 4AF7A 3P20A 2F4VB 1JLMA 2XCSB 1SK8A 2H3HA 2RHDA 1KYQA 4A8PA 4LC9A 2O8CB 5FDFA 2Z9BA 4XPIA 4KKVA 5EINA 4JLBA 4A8HA 4YPOA 1IBMB 4R8LA 4RZ3A 1FUEA 3V00A 3U2QA 5IKXA 4L5AA 5K7SA 1OAAA 4GF5A 1YFKA 1JN0A 1GGEA 2VHTA 3NTQA 4OQPA 1A4UA 3DYBA 3PEEA 1UJ4A 2X9NA 4NENB 3GEHA 3PPIA 2FSGA 3L8FA 4QOJA 3UAZA 2TECE 3I9NA 4DDKA 1PBNA 4ZVSA 3AP1A 3H42B 2ZIAA 4MQFB 1HF3A 3V97A 3BEDA 1A2KC 3K20A 2G83A 5LQJA 1BHO1 1LJUA 1PWZA 2VWHA 4G9EA 4Y6RA 5L7WA 1KYYA 4RPHA 1PQUA 2WF9A 3C16C 2B82A 4IF6A 2PU5A 5HSGA 3TGLA 1I3KA 2WIDA 3HWSA 3M1IA 1U4SA 3P94A 4ZHQB 2ONKA 3U7HB 3M6MD 4CIWA 3IHTA 1ARZA 3STUA 2I7DA 2MTBA 2HPHA 4F4DA 3E23A 2EGGA 3DQZA 4FKZA 1JKFA 1KK2A 1UDBA 2CDBA 3KV3O 3L0CA 3ELDA 3E4DA 5H5JA 3U44A 4K8RB 1D5CA 3C43A 3VDRA 4ED9A 1OLSA 2W2KB 2FWJA 3P9QA 3PQ7A 4RO0A 5D1HA 4H2DA 4BNFA 2OGZA 3E1KA 1CQIB 2IE8A 5KJEA 3UB2A 1RPAA 2DBVO 3VPCA 3OFSA 1DIOB 4HQ6A 4JLUA 2SKEA 3D7RA 5FFNA 5LZ5A 3BVPA 3ONNA 3GFRA 4TWJA 1OT3A 5F5LA 5ULLA 3GUYA 3IMGA 2AUMA 2CXRA 3KX2A 2UYQA 3N6RA 1UJ2A 2YJTD 2FTKE 2QL6A 3IUJA 3ESQA 3EZXA 5FUVA 4HRXA 4Q7KA 2D74A 3EZ6A 3H0CA 5MGBA 7MDHA 1A8UA 2XBUA 2PNFA 3AI7A 1LQUA 4AULA 5CX1A 3CZ9A 4G0QA 1BU8A 3K6SA 2BTOA 2DTEA 3NFYA 3GJ5A 2ZCJA 2PBFA 3QKSB 1PG5A 3UK1A 2SKCA 2WUWE 5F1OA 1O96A 5LU8A 4JEIA 5DOZA 5E1OA 4ZAWA 2C4TA 1FVFA 1Z6YA 2UZ4A 3KTDA 2Z2XA 5ERGB 2QG4A 3A6EA 5TQJA 3WKEA 1HEYA 1V3UA 2PZLA 4S1TA 2RHOA 3LGXA 1XQVA 4C3VA 2QRJA 3L6BA 2A9JA 1EWYA 2H5IA 2NUAA 5SYMA 3TI9A 3DMFA 3F1KA 3GL9A 1JVBA 4GMHA 3NT4A 5CT6A 1NDUA 1TIPA 1NE7A 5KWEA 4OEHA 2LCFA 4J9UE 1WCYA 5GVRA 1KBQA 4QNMA 4EY3A 2O50A 1LY1A 4KR0A 4UUOA 3PT9A 4PONA 4WE3A 5J5VA 4PSVA 4B0PA 4BE4A 1HLDA 2GZMA 2O7RA 2QYOA 3G7SA 4TLDA 4Z86A 3RUAA 4WSOA 5BSHA 4DLWA 4CKWA 4RJJA 4AC9A 1JEAA 1JG1A 2EQAA 4L4UA 5DB4A 5C1BA 4UVDA 3M5PA 2H63A 4KGDA 1F8YA 2VAPA 3WYDA 1T9GS 4WCVA 3QFSA 3A6KA 1XEXB 1WSWA 3UFXA 3V8BA 1DEAA 1Y3IA 5E2BA 3A6ZA 3KPUA 3AEZA 4PZLA 3VYRB 3NKLA 1LI7A 2UVPA 3I34X 1I2AA 2A0XA 2X6QA 2QRMA 3INGA 1H0RA 2PPVA 2VF5X 3FWZA 3L7KA 4YJ3F 4N82A 1D9XA 5AKEA 4J0KA 2LWIA 3O3CA 5ALHA 1WU7A 5K3BA 1JSRA 3ROKA 3ZBUA 5AM3A 2WI8A 2BHSA 1NA5A 1R4ZA 1UJ6A 4FPXA 4ZODA 2LDXA 3HPRA 4BCDA 3OFND 2ICAA 3EDOA 3LUPA 1KZHA 4OHWA 2EBWA 2FN8A 1Z74A 4UBOA 4EA6A 2O05A 2OM6A 2I4IA 4Q93A 2Q1WA 3HZZA 4ZDJA 1SPBS 4QDUA 5A0FA 3SXJA 2ZQZA 1F51E 1T9GR 1YS9A 4XPIB 3WMEA 2ZYIA 4C01A 1N3IA 2P9EA 3EOAI 3GD7A 1KO8A 3IUNA 3VAYA 4DIMA 4ZOEA 2ID8A 4W9NC 3AUUA 4ZVUA 5I8PA 3SM3A 1XDZA 2CLCX 4LSGA 3MS7A 1MENA 3SDBA 3IURA 8LDHA 4CHTA 1Q92A 1IWPB 3MJHA 1QV9A 4XFDA 4E5YA 2QAIA 3II6X 3OO1A 1UPUA 4ZD6A 5KOYA 5J63A 3M6IA 2GEJA 3CWZA 3SEAA 2OHIA 3C7TA 3PCXA 4JASB 4CLRB 3KUKA 4IRUB 5BQ3A 2V0GA 2CNLA 3OT1A 4RD2A 5BO5A 3IP9A 1H9AA 1OC2A 3FPAA 2P8JA 4H16A 4MKIA 5CIQA 3TS1A 1LNSA 3V2IA 1UWCA 3BHNA 4GR9A 1SCIA 3FKSD 3O8OA 5E1MA 5TQ2B 1Q0LA 2M6LA 4A92A 4WBNA 3RUIA 2XUHA 1FL9A 2DFKB 4JWTA 3TAXA 4MUXA 4LF4B 2RHRA 3JAWA 2A84A 4Q3OA 1YS1X 4ZANA 1NVKA 1USIA 2Q1YA 4HNGA 3LYUA 1KL7A 2PD3A 1XLTC 1F2UB 1ZPDA 3QVUA 4HAUA 2PLFA 2HBQA 4KPGA 4D99A 1NM5C 2HHHB 4QATA 1Z8NA 5GJWC 4K9QA 1KJYA 4QHTA 1KF0A 4HCJA 2F43B 1XX6A 1BW9A 1V8FA 2NTVA 3JQAA 1YC2A 4N0QA 4YN3A 3TPZA 3GRVA 3B48A 2CMGA 3TLMA 4R51A 3ZDQA 4IIJF 4NAUA 5I47A 4PSCA 2GX6A 3N8DA 4L78A 4NU0A 4OM8A 3OHPA 1EUCA 1MEOA 4QBGB 5JO0A 5LA6F 4EEXA 2E5FA 3B12A 2I55A 1XLVA 5AOAA 1GTL1 4J2OA 2P0EA 3IR6A 4NBLA 5ESWA 2FP3A 1TMOA 1K5PA 5ABPA 4V3CA 4N7RA 5BRJA 4EYOA 4OQ4A 5HW0A 1XNRB 3KELA 3G6WA 1G8MA 1VP9A 2HYIC 5B36A 4GZLA 1HE1C 4BWFB 4DLPA 4FDLA 3LUGA 1Q6ZA 2JBWA 2ZT8A 4CZ2A 6GPBA 1KEZA 1MOQA 2XKKA 2OHXA 5CT5A 1X8LA 3LHIA 4YCMA 1G2QA 4GMFA 2O8BA 1JEQB 4FFPA 1OV4A 2Z3ZA 1DTWB 1UC4B 1UKAA 2JCYA 3FTPA 3PYMA 3QKTA 2VZ9A 2REQB 5D3ZA 3ZUGA 3M9XA 2GCIA 4QPPA 1GAXA 1U28A 1ZW1A 3A1SA 3PUXA 3BRQA 4CTOA 5CHEA 1DARA 3RYIA 2GEDA 5CT9A 1VMAA 4YIHA 4AU1A 2CN1A 3MSXA 3B3GA 2Q8NA 2PX0A 3C24A 4IKEA 2JLXA 1P4RA 4HDRA 2A0YA 4M0CA 3GLFE 1BYUA 3HUUA 4ARZA 4CMBA 2IZ1A 3IERA 1CJUC 1PG2A 4M0MA 1T8TA 3KUUA 3V80A 3IAUA 4PQGA 3ZWDA 5C8YF 1WF6A 4UHEA 1GRNA 1GFSA 2VCEA 1C7ZA 3BWVA 4XUDA 4DY6A 3P2MA 3VYWA 1ESEA 4MOWA 3RBXA 4ACBA 1WMEA 2VZLA 4IYJA 5EN4A 4UCXA 4MICA 1DEKA 1NOJA 4ILEA 2EX4A 2W5UA 2F1JA 1W34A 4NE9A 4F45A 4QHYA 1W6RA 2KQUA 2AOTB 5BW8A 3WJ2A 1T1GA 2ECFA 3DFMA 3IDQA 1MX5A 3OM1A 1YHZA 1N36B 2RHMA 3UGTA 1GPNA 1VIMA 2IW3A 3SFVA 3UJDA 4BO0A 3P1JA 1UC5B 4I4TF 4E2XA 3GA5A 1Y1LA 5JOQA 3RAPR 4E1BA 2DCMA 2XKBA 1QX4A 2XQKA 3CNNA 4YJ3B 1C7JA 1Z0KA 4L9AA 2AXEA 3D4OA 5AW4A 1EB8A 1GRRA 2P69A 4XVRA 2XSZD 2YWXA 3SIWA 3DEKA 1GXSA 3EIHA 5TS2A 4MWSA 2H7XA 1C4WA 1HH4A 1Q5PA 2HHAA 2OBYA 4OHCA 1YDWA 4CU2A 4CV0A 2HI0A 3EWNA 5EHXA 1RCTE 1UFRA 1X80B 3QU7A 3HVJA 1N9GA 1PR2A 4ZCLA 1PR1A 1NATA 1DRJA 1NRWA 1H0KA 2ILVA 4CM4B 1C8BA 2ZIXB 1WRBA 2R6CA 1P9OA 3DEYX 1CQXA 4HV4A 2GD1O 1MB2A 4LQDA 2JLZA 4O3FA 2PL5A 4QJIA 1MXHA 1VA5A 1H6AA 1RYFA 3TSYA 5HKBA 4ZYVA 2I0FA 2Q5HA 3UAYA 4XVUA 3NEYA 5KI6A 3AJRA 1IN4A 1CRLA 3EQ2A 4L08A 2KWIA 2RBEA 4TLMB 4XXHA 3AI3A 1KR5A 3KLBA 2IUTA 3O0DA 5AHRA 3AL2A 2F1RA 1QG0A 3ZY2A 4RANA 3MG9A 3ND8A 4R7ZA 4P81A 3K2BA 3E4CA 2IT1A 2IU0A 3WSWA 5DHUA 2XT6A 2C3UA 5E1BA 3EHEA 2EVWX 4NZOA 1PJSA 1O95A 1VECA 4RPGA 4WQMA 4KGXA 2O8FA 5JQWA 1O7JA 1ISSA 1UQTA 3HI6A 3KUCA 1TEZA 4ZCRA 1V3QE 2HGZA 4GBED 2ZTLA 4OI0A 1KXZA 4RZXA 4DMCA 5FNVA 2F8MA 2GJ9A 3CLVA 2LRHA 3FF1A 1VXRA 3LHSA 5EP2A 3WLMA 4G23A 1ENYA 3AVOA 2QRVB 2OCIA 3KAQA 1BQ4A 3TKYA 1BDBA 3AONB 4J0IA 4ZO9A 4TL9A 3SBOA 1P1RA 3KAJA 1XXLA 1JHXA 1JQEA 4AS3A 3LPAA 1CVLA 1COWA 1ZLXA 3EQ6A 1F6BA 3V7UA 3T9AA 3R6WA 4QXQA 3HN6A 4RWEA 4QWMA 3H9EO 2Q46A 1JFTA 1PT9A 1T6YA 1T4CA 2CC2A 4E70A 1NZJA 2GCOB 4O5AA 5LOVF 1NNLA 3NPMA 2YRXA 4YRNA 4X20B 4BHTA 2A92A 5CRIA 2SCUA 4IIJB 1NZDA 4NICA 4ITUA 2EC5A 1J70A 1IDOA 1PNTA 2JCGA 2NTYC 1A7KA 1K9VF 3MWKA 1NF8A 4JJ6A 1N2XA 2CNBA 2WZBA 4X3OA 4NXMB 1Q14A 2BC9A 2MDTA 2OKCA 3JATB 3BFPA 2PT6A 3PFFA 4UE2A 1HQDA 3RYIB 4BQOA 1Q0QA 1A76A 1M33A 1IBKB 3VI3B 2XTNA 1TQ2A 4OLFA 3S27A 1VZ3A 3MXTA 4BMSA 5IULC 1MAAA 3AKYA 3COJA 3RS5A 4WV3A 4AZWA 1QNLA 2BP7A 5HRUA 1W49A 3CPEA 3OMLA 5ES4B 2AH5A 4N7BA 3OQNA 5BV7A 4EW6A 2WTEA 5SY6A 4PTLA 1FA9A 4QXPA 2BDUA 1D1QA 1ORWA 2B8JA 2JFYA 1ZD2P 1VB3A 2Y0PA 4NPAA 4O2BF 1R12A 3KM0A 4ZCPA 4F71A 2UYHA 3WDSA 1XALA 4YCJA 3RF6A 1M5RA 3SXPA 1UUFA 4L95C 4YR9A 4KDRA 4JJFA 4TTJA 3HFGA 9MHTA 2W0MA 1KI1A 1XJQA 4RD1A 2DWPA 2C5FA 4QXOA 3UOGA 4DQDA 5L4NA 5JBIA 1N6HA 1YKFA 5F77A 5LDHA 4E5NA 1LW6E 3QPDA 3SEQA 4G07A 2GZ2A 4O02B 5K3OA 5CD1A 4WECA 3A7DA 4B6EA 2IP4A 1VMIA 5ALPA 3E9RA 3ED5A 2G5CA 1RYBA 3ZU6A 1IZ0A 2VSQA 4M53A 5ICMA 1I6KA 2X2FA 1TW3A 2V58A 2A9RA 1EP2B 2CXXA 4KQFA 2GA8A 3SYLA 4MI1A 2BWJA 2NU9A 1QBGA 2ID9A 2G9NA 3WZMA 3NVMB 5JR3A 1P9LA 1SBHA 2AEMA 1J8DA 2FN4A 2P40A 4JLOA 1XIVA 3TE7A 2CWDA 2GTHA 3E5MA 3RTDA 2F3PA 1QG2A 1GSIA 4TUYF 1E20A 1VE1A 1UXJA 3ABIA 3MCAA 3JVUA 4KMMA 3NPAA 1YJAA 3ABSB 4O25A 4WRRA 1YE3A 1D2EA 2XQIA 3EFEA 1T24A 1TYAE 2HCFA 1NUPA 2P27A 3FDZA 4O2AA 1EUQA 2Z4RA 3LWNA 1AN9A 3VO1A 3DYVA 1YVEI 1ZI8A 4FX2A 4GVPA 2O1WA 3M33A 2G88A 4GBMA 1K89A 4HLUC 2FZGA 5DOVA 1FMJA 4LDJA 2RGBA 3EODA 1KSFX 1L7XA 4RTNA 3WX0A 2ZSBA 2C5HA 3LUCA 3HDGA 4HEHA 3PFHA 3UMCA 3TLZA 3B6EA 3DD5A 3O4VA 5F7JA 3JARA 1G9XA 3QVGA 3AOGA 3RVMA 5B1DA 4AUKA 1FNSA 2X2EA 2AFIE 5TT1A 2R7LA 3VR6H 1DNPA 3FCEA 3DPIA 4R8KA 3ENWA 2GCPA 1C9YA 1CZHA 3QYAA 5AJHA 2M6KA 3NHUA 2N3ZA 5EG5A 2GB4A 4AMZA 4BFLA 3D2LA 1E2FA 1YS6A 1KR2A 1Z0FA 1Z68A 2EBUA 4GVXA 5BQPA 3WGJA 6ABPA 2PA3A 4JQZA 4IWNA 3DP7A 3WWPA 1PP4A 2ZVJA 2GBPA 1KA9H 3K9FC 1M2OA 1JSZA 1DAMA 1P8JA 4FJ1A 3CPHA 1JSCA 2F9MA 2QZ9A 3CTPA 3HWRA 4KPUB 3WGGA 3CEAA 4YUVA 5BQFA 1UBLS 3ER6A 1EXVA 3M5DA 1M34B 1ZA1A 1THTA 2J09A 2VKQA 4U4AA 3S2EA 5DI3B 3WTCA 1QP8A 2GLXA 4J2HA 4BFCA 1OX4A 1PT5A 3RK4A 4BO7A 3KJNA 4OXYA 4GOLD 4Z49A 2ZJYA 4CFSA 2ACVA 1YQQA 4RMIA 2D0IA 3WL6A 5BW4A 2JLYA 1KO1A 4UBKA 1KI6B 5KYGA 1F0PA 3AI2A 4PNPA 3R7NA 2BFWA 3GW8A 3ROXA 2YXDA 1SR8A 4P0PB 1QHXA 4Z9XA 3TTTA 3A06A 5KWIA 5KYWA 1Q7BA 3MYYA 1QHEA 4AMUA 3N2GB 5SYNA 4BO2A 3A6HA 1UQUA 3DCNA 4LF8B 2HWKA 1JQ3A 1KYWA 3QEMB 1QQ6A 2OVBA 2VBCA 1OWPA 2BF7A 1W0JD 2HREA 3L07A 1TUEA 4PHHA 1YB1A 4XIYA 5K8JB 2IQ5A 4DMKA 2QK4A 4D9HA 1JL3A 1DWPA 3HN7A 1TTTA 3HDJA 2QUZA 1FFBA 4DLTA 3I6MA 3I5UA 5TVGA 2FWMX 2C31A 4GGMX 2FQQA 1S01A 4MDFA 1Z0IA 2GJKA 2HMAA 3LYAA 4EAAA 4N8SA 2OL4A 3DUFA 4MVWA 3WGVA 3AFGA 3M0EA 3T7AA 3QKRB 1RIIA 4HLQB 4B7UA 3WWEA 5LXTB 3IMFA 5B64A 121PA 1Q3HA 2OHHA 1A7JA 3CN9A 4QM6A 3QLUC 1OXKB 5IAJA 3CNOA 3RLIA 3THXA 3EQ7A 1NMEA 3S3TA 4ID3A 3A05A 4OMUA 3A4LA 5LZ7A 4BKOA 5D86A 5I8WA 4UMDA 2EQ5A 5A4IS 2A5GA 2QAJA 1E77A 2YHIA 4AZ0B 1VKHA 4YPFA 4DOMA 3IAAA 3OA2A 3PVSA 4MJLA 3ZWWA 4B44A 2COUA 4ZDIA 4PQEA 1PJCA 3KFXA 5AESA 3HDVA 3ZU3A 2W11A 2ZCVA 1CRQA 1XNGA 2QMHA 4N3CA 3VR3A 4IY1A 3KXIA 2I4MA 3RYFB 1GPH1 1NZFA 1DADA 4U1RA 1Z4MA 2OC9A 1NP6A 4B82A 3I6QA 2I34A 3RAEC 2GGSA 3MBKA 4XOIA 1E1LA 4TWAA 3MAAC 2XMZA 1G8PA 3Q1LA 5LBUA 2B36A 1PBTA 1S8NA 4L50A 4O4IF 4PHFA 1K66A 4RY9A 3N8IA 3G6KA 4LS3A 4NMXB 2RE8A 4FE3A 3SC6A 1KKLA 2CUNA 2G36A 3I1JA 4BNUA 4C4TA 2PUCA 3CKLA 4P4SB 3R8FA 3KT3A 3DEZA 1RKUA 3UMRA 5HMMA 5DM70 4QEZA 2O5VA 4DSTA 4ER5A 1Z0SA 5LLSA 3KC2A 3DE4X 3PNLA 5JS1A 4PZCA 3ZZNA 2ATEA 2OZPA 2QQ0A 4RCYA 3TQQA 3AY7A 4O63O 2DWOA 3WNVA 5IZCC 4P31A 3S44A 2RH8A 2R6AA 3LT5A 5C8VA 4BO9A 3J7AC 4PGFA 2EHJA 2HGSA 2X4GA 4GGPA 3LHFA 5BOVA 5AP9A 3ID6C 1VQ1A 1CJTC 3GMIA 3IUPA 3NZEA 5A6SA 1NW5A 1Z8FA 4ZRNA 3TPFA 4QIHA 4ZVKA 4P0QB 1UODA 1S1MA 2PYZA 3F7NA 4H4DA 2XTZA 1EU1A 3KE9A 3T1VA 2BGWA 1X42A 4BRUA 2I2AA 2JKYA 3BF7A 1E2DA 4TRRA 2EJWA 1F8UA 5EI5A 3VQTA 3PNVA 4CBVA 4G09A 4OHUA 5EMJA 3TRKA 4N5HX 5D2CA 3OQVA 5TEVA 3UUFA 1D6SA 2VQ6A 3AERB 4ZN6A 3E7DA 1PFUA 3HB4X 4UTPA 4RV9A 4JDPA 3QX8A 4K9MA 2YWFA 3T9BA 3Q5EA 1K2WA 4RK6A 2IHUA 2CDRA 4BNVA 2D5CA 1BN6A 1USWA 2HQBA 3I58A 1SU6A 4JQSA 2DWQA 2I4OA 1KI3A 2ZZKA 4Y2UA 1KOGA 4Y6SA 1FNCA 1LZKA 1SKAA 2FNAA 2C2KA 4Z7JA 1JJIA 4FIDA 5DM1A 2F6RA 4IFBA 4IJQA 5KTTA 4CF5A 5I5GA 1L8LA 3BRWD 1BS1A 2A9PA 1DAGA 3EC7A 1C30B 3FG9A 1FMLA 4FMDF 1I80A 4EF4A 3FDFA 3G2IA 1RQPA 2O57A 2XUQA 1O57A 3MRVA 3P0JA 1DG9A 1MF7A 4JK3A 2WJIA 4LKRA 4Q00A 4XRGA 4GX1A 4ZI7B 3ZHTA 3THWB 2C0CA 1JJVA 4HVLA 2EWMA 5J2UF 1ZC4A 4A7PA 4LWZA 3OZVA 3OESA 5F2NA 3BOSA 2XW6A 1A9OA 2Q99A 2OO5A 2YJ6A 4RQAA 4YONB 1SVIA 3T99A 2K7ZA 3REQA 3ZE1B 2C9ZA 3QE4A 3AUAA 4LZLA 3N3BC 2C0QA 2QU8A 4TKVB 2HA2A 1AQYA 4AZVA 3ZI4A 2WB2A 4LQCA 3L8YA 1BEEA 1RPZA 3HA5A 1RYYA 1JKMA 1HYEA 1KZ9A 5KS2A 2ZREA 3KKKA 5I3ZA 1SQFA 2DGDA 2MR5A 1R0RE 4NQZA 3A3PA 2XCRB 1J8MF 4MVJA 3ILHA 1P72A 2QGZA 3T1QA 1TVKB 5DM60 2I80A 3RHFA 1U0NA 2WT8A 4BWVA 2Q2OA 3S29A 1MHTA 2WINI 5FH9A 1PSDA 3H6GA 1WDTA 5FLKA 5I8ZA 1OH7A 1VYTA 2VXOA 3DT6A 4ZEXA 2PX6A 3VHRA 4TKLA 2ZRDA 3O9VA 4BJHB 3ZGZA 1V1MA 1P80A 2WSBA 2CXTA 2JGDA 5DNVA 5LC1A 1ST2A 3AVXA 4GQAA 5KWVA 5AK6A 3T8YA 1VGVA 1AUPA 4LJLA 2P4EA 2GJ8A 2XD9A 1TDJA 3Q10A 1E3WB 1QE5A 4XGNA 4HGRA 3U31A 3PGVA 5ECWA 3CUTA 1QZUA 1Z73A 2WZQA 4OGFA 4WKPA 1CR4A 5CJJA 3RNLA 1TZMA 3HABA 4ZAZA 3NI2A 4LYHA 4KN8A 4JI0B 3CRMA 3LF1A 3DAHA 4PFQA 4CV3A 3RKRA 4RF3A 3VVLA 4QZVA 3ER8A 2ZR0A 4HRAA 2PH3A 1FUKA 2QV7A 4MVJH 1HTBA 5LKRA 1G5TA 5DP2A 2YJ5A 1N5OX 2ZRCA 4G89A 5L4SA 2OCLA 3AK4A 1Z62A 5CPFA 4QG7A 3SHQA 4OK5A 3HACA 2F1KA 2NAFA 5CHYA 4A5OA 4K86A 1GM5A 3T3OA 4GMGA 5DF1A 4Y1RA 3I01A 1GUZA 3MLEA 2VYQA 4O4IB 4BX9A 4EVRA 5LP6B 1TQ4A 4V03A 3DWFA 4QVGA 2AVNA 1K8XB 2VJNA 3SF8B 3VDNB 5A6SB 1V5EA 2FOIA 1S2IA 2XYVA 3BB1A 3TH5A 4YUZA 4Z53A 3JD0A 1ZSNA 2FR1A 4OKNA 3TTUA 2X2OA 3PC8C 2H4JA 4IIEA 2WNIA 4UNPA 2Y2UA 3QSYA 3FLEA 1QO0D 3F6RA 3ICPA 1WV0A 4OHOA 1W25A 3ROEA 2A8YA 5BV0A 1K8ZB 5JBQA 1RIFA 4DRXA 1AB6A 2FCAA 3HB1A 3PWTA 3LX6A 3AR4A 3SBXA 4BTLA 3FKJA 3ZZMA 1KPGA 5FOQA 1J8QA 3SGLA 2IIVA 2YCLA 3ZE7A 1YVRA 2W6ZA 1BDIA 1GSOA 2G80A 2OHVA 2DHQA 2HL6A 1P33A 2DKNA 2CLFB 2BGLA 3V8MA 5D6NA 1G6OA 5KSPA 1OBHA 5CDGA 3EDMA 4XX0A 4FYHA 4P7BA 5KIAA 2VJOA 4IGKA 4AFNA 4JCOA 2FA9A 3K53A 2W93A 5TMEA 3TVTA 3O9MA 1WM1A 4HEA6 3BL8A 3MINB 2CD9A 1UBOS 1UBNA 3ZBPA 3WR5A 3B2NA 4MUJA 3G2OA 5A5VA 4Y2TA 3L43A 1UM9B 4KBFA 5AVZA 1N2OA 4DKXA 3TB4A 4BRZA 1ZJJA 2FUCA 2G4VA 3OLXA 3PGKA 4GKAA 4ZVVA 4M98A 3ZWVA 5AVRA 5I7HA 3ZHXA 3OTOB 521PA 1G0OA 1R0SA 2H1IA 3CH6A 3JQRA 4KRYA 4GM1A 1DB3A 1GNSA 3NCHA 1BD4A 4Q34A 4L8YA 4EUSA 3H1EA 1E5QA 4UM8B 1BRTA 4C88A 1HQKA 2XXBA 1CP2A 2JH9A 3MRSA 4WZBA 4EZEA 3AVTA 4BMCA 4EJSC 4R8RA 4FMDB 5B1SA 4R9NA 3AF3A 3GH1A 1QPZA 2GYVA 2PSSA 5C81A 3GGSA 2PJUA 5BUCA 3ILXA 2QTGA 2AEJA 3HSSA 1L4MA 2HBZA 1DBQA 2WG0A 1GNQA 4BNDB 1ZJWA 3USES 3NX4A 1P1JA 2AI3A 3AB8A 1V43A 1AKQA 4CMAA 3OT4A 4RD6A 3SZOA 2X8JA 3L7DA 3RVJA 3L8EA 4JNCA 4ZEWA 5J2UB 3W79A 3BN3A 3C3XA 3ZZ0A 1NXQA 4K5QA 3VOBA 2YMPA 3PFIA 4P58A 1IH8A 1EFVA 3HA3A 1C81A 3QVJA 1WHTA 2JFBA 4YJGB 2H07A 4B33A 5KJFA 3U6KA 4TLBA 3SQLA 4M86A 3D5TA 4CV2A 4WADA 1Y8ZA 4OXQA 2DPMA 2HMWA 4C3ZA 4OX9B 3HKEB 1JF8A 2LVBA 4PVCA 5CXQA 4XJTA 2AK3A 1EINA 3DVSX 1C9NA 1LQ2A 2H2AA 3OJEA 3X2FA 4ZT2A 1XZ8A 1W59A 1XQ1A 2B4RO 1C0KA 4WA8A 1USVA 2FWAA 3ZH9B 3A6FA 4JLJA 2D8MA 2RIPA 1WQ3A 5BMVF 4Q1VA 4M8SA 1YS4A 1OXSC 2FE4A 4N5MA 3FOWA 3IR5A 2I7CA 3KDSE 5C8ZA 5JAPA 1BCRA 3NHSA 1C7QA 1DL5A 1SA0A 3RUFA 3RD5A 2G08A 1W88A 4FQ5A 3V3TA 1K5DA 1MLDA 2XNCA 4ENVA 4FUQA 2P35A 1GUAA 3NP9A 4HH0A 1A9RA 4M7PA 5FWXB 5IT9A 1JR3E 3PXBA 5CXSA 2YNMC 4G5YA 3SFZA 4MUNA 3CS3A 1D2HA 3C5CA 4B6SA 3ZHCA 4EFMA 1BVYF 1XQXA 3I9V1 5AW7A 3LX5A 3L4JA 2PUHA 4F8JA 4EUFA 4D9CA 4MW9A 4Y1RB 4Q9IA 3CQ9A 4BVHA 3Q2IA 3B51X 5LL6P 5THQA 3DEIA 4UVHA 5CBKA 2IXTA 3KJGA 2PFSA 3GEIA 4FYMA 3UQYS 3T7SA 3RU2A 2AW3A 2GFHA 2WA1A 5DDIP 2A78A 4LDRA 1EAYA 2MSKA 2P9CA 4Y8VA 4UTVA 3FDIA 2R5FA 3H2GA 5BXQC 5ADVA 3QF4B 2ZBDA 5JFGA 3R7WA 1PV4A 1I94B 4TWZA 5HF5A 2ZT6A 3A9WA 3ZJ5A 3PJGA 4AY3A 2OFWA 4MQ6A 2CFSA 2I2WA 4KMOA 1AQ6A 1FFXA 3BHIA 2DHDA 2W71A 2EWVA 4EELA 3BIOA 2CHFA 3BMNB 4JR0A 4OTZA 2V96A 4POAA 3MHPA 3FSRA 3K0HA 1X1QA 2V4UA 3ZBTA 3G0DA 4H1TA 5BN5B 2EP8A 3NOQA 3ZY5A 1UEIA 5A4FS 4GIBA 2P2NA 4UHJA 4Z1OA 1ACLA 1RCUA 5LR6A 1SBYA 1MBZA 2NACA 3OCXA 4L7QA 4NSNA 1XKQA 1CY4A 3LVFO 3UM9A 3VI4B 3WMGA 1ZN2A 2IPMA 3QBDA 1B73A 4BV3A 2WD7B 4TQAA 2OBLA 4JX9A 3THRA 4C6RA 2O8DB 3ORSA 2Q3BA 1YCDA 4KJZA 3A6JA 2FRDC 3D4NA 4XKJA 3SQOA 2BD0A 4R54A 5G41A 4E3WA 3WL7A 5GVSA 1PIWA 3EXG1 1YU9A 3HI4A 4PTZA 5FTMA 4LTNA 3ERCA 2H1LA 1JBQA 4RU1A 4W99A 3Q9NA 5JCXA 4GHWA 2HU8A 3PA8A 4ZVQA 1W8IA 2FPOA 3N0TA 3QUTA 4FU0A 5GM1A 5UKDA 3RC9A 3RC8A 2Q6OA 2XHZA 4EHAA 1RLUA 4LNUB 4HT3B 3OLWA 4U7WA 3WQRA 1BXRB 2BKLA 5LSAA 1GTMA 3C1TA 4QPJC 1W75A 2R44A 4LA4A 4LE2A 5EPEA 2RKBA 4BNKA 3G8DA 2UUBB 3H4IA 4IDHA 4C43A 1GGKA 1DKMA 2ECOA 4UZFA 4B45A 3K9WA 4FZ5A 2AZTA 2NU8A 4P3YA 1DV2A 2B2CA 2VH1A 4HDKA 1W5TA 2ZAMA 4K6MA 2IYEA 5BSRA 4YQEA 3WGHA 4NXNB 3VAAA 1WZEA 3C1UA 3KLMX 3R5JA 1NXXA 1UEJA 1S2LA 1T8RA 2G06A 3P5SA 4G4IA 4HR7A 4WVFA 3WFZA 3GN1A 2P5SA 2YTZA 5JSYA 4CEIA 4XFJA 3U3JA 1Z8HA 4DA7A 1J9EA 3MS4A 2HLDA 3RTGA 1UBEA 4BFYA 5JI3E 1QAOA 3STYA 3E1SA 1JNXX 3RSQA 4WDQA 5KSYA 3C3KA 2SHKA 4G8JA 1CK4A 5KC9A 2QTMA 4I0WB 3RC2A 2B69A 1T6ZA 3M6XA 3RVRA 4TZ6A 3H9CA 1HOTA 4OB8A 4ZOAA 1UJ5A 2C7OA 4S3MA 2P2GA 3VRHA 1FRFS 4BQIA 2NX2A 1L8XA 3IOBA 4KN9S 4LZZA 4A2QA 2DT5A 4WD3A 2JZOA 1DG3A 3MN1A 4KU4A 4ZMBA 2C2ZA 3IQZA 5B1IA 1UFKA 5BOSA 3WGIA 1CTQA 1WP9A 4QUDA 1U2DC 4AY6A 3EXHC 4UPEA 4LC1A 4EX7A 4EG5A 4YUAA 2P7HA 1IY9A 3GU3A 3CR7A 2IEZA 4K05A 2AYYA 1XFAA 2ZYSA 1L4EA 2JEYA 3I4FA 1YOVA 2XZOA 3L4BA 2WE7A 2X0FA 1H6CA 1Z6TA 5CJ2A 2JKVA 1QGOA 3CZ4A 4G4GA 3I6BA 2QR5A 4UATA 1UBFA 4Y9UA 5K0ZA 4EB3A 4C0SA 4JQCA 4K8OA 3NM5A 1KTIA 3ORRA 4EVQA 5L3QA 3V8EA 4F11A 1MO5A 5KWJA 3QKWA 1N2ZA 4DQVA 1GR0A 4KDCA 1H94A 1IQUA 2GEFA 3PCRB 2BM9A 4QQKA 5K4GA 3JW8A 4RJLA 1O94D 3MM4A 1LXCA 1MB4A 4HO1X 3R7WB 1OH8A 1YZUA 3OAAA 1RYDA 1B0ZA 1E4EB 1N6PA 3OPYB 1DWQA 3BFXA 3ZS8A 1JJAA 1ZNZA 3ASZA 2CLHB 3IEXA 3OIDA 4OOEA 4XUEA 3GJQA 2Q2VA 2G5GX 3Q5GA 4L5IA 2WVGA 3QY9A 1E32A 2GOYA 4I9GA 4R2MA 3SHOA 3IALA 2DFVA 4QNNA 1FFYA 1FNMA 3EIXA 4O4HF 2HRRA 1J1IA 1U8YA 1QVRA 2ZUCA 4ARIA 1WCV1 5B3JC 4KG7A 1CQJB 1QBKC 1MC4A 3IBGA 3TECE 5HFNA 2J41A 2QR3A 3F78A 2ZJOA 3H9BA 4ND8B 4M21A 3FHTA 2JCBA 4IVPA 4UBNA 5EAIA 1W8DA 1IOLA 2GZHA 4B79A 4ZV4A 1Z4KA 1RM3A 1G63A 4DIDA 3GLGE 2JGEA 1E3QA 2AOUB 4I1IA 4R1LA 3UMMA 5SZJA 4IUYA 3OX2A 3O8QA 3ZQKA 1QCYA 4P8RA 1P7YA 4EB6B 4M1TA 2YRWA 2XB2A 1W29A 4HRYA 4YROA 4OHYA 4PSUA 2D7CA 1LFDB 4K9RA 1SXJB 3K8YA 2A0FA 3L0YA 4TV8A 4C6TA 2LKDA 1WSAA 2IYXA 2Q8QA 4GPEA 4K6FA 4MDEA 1M72A 3D1VA 1T4BA 3FRJA 3NDIA 4BQEA 2J85A 2QM3A 3SYNA 4JUAA 3HMQA 4JMPA 3P0EA 3DBHA 1KVQA 4XCQA 4YCBA 4KQEA 4DTCA 4Z7QB 1V9SA 1Q7GA 1W87A 5IJ9A 1JXQA 3OOHA 4ME6A 3ND6A 1EFTA 4GX2A 1M6VB 2O14A 4AG6A 2QXYA 621PA 8GPBA 1Q83A 1P44A 3QENA 4QYIA 1E60A 3LWZA 1GGMA 4Q9NA 2X3YA 4AMBA 1WMAA 3TE6A 3UMYA 4HXYA 3KKMA 2RKWA 5CLQA 4E21A 5FUWA 2ASVA 2E37A 3L6RA 4DARA 1G5HA 5CCXA 1N25A 3GI1A 1GGFA 1KZGB 2JHPA 3ELUA 5DJ5A 3A25A 3BRCA 3JQ9C 4Q66C 2Q45A 2IHBA 3OF5A 4XAQA 1GZUA 1N8NA 4PRZA 2G04A 3PJDA 2QTWB 4C2AA 3BGWA 3QI2A 1YJQA 1NUHA 2Q5CA 5BWMA 5CB6A 2AIRA 1JHYA 3C87A 3LHDA 2HJ9A 1OYWA 4GPIB 5K3FA 4AQ7A 3H8WA 4PLCA 4CT5A 1VSVA 4M9SA 3KAPA 2J0EA 1D2CA 2Z83A 1JMKC 4BECA 1H2RS 2HADA 3LOQA 2QEQA 2XRZA 4J7XA 4CIXA 1TIBA 2CXHA 2FSPA 1DAOA 5EXEA 5BOSB 5JFOA 4Y0AA 2C04A 1L7VC 4ASUD 1SJ9A 3H2ZA 3K96A 5EZSA 3TOVA 2RK6A 5KVCA 1BWQA 1BOOA 3FVRA 2CXSA 2WRZA 3LDAA 1QFSA 2P9FA 1QRTA 4MCIA 5JMPA 1R50A 1WB4A 3KSDO 1TUBA 1JX6A 2G3YA 3MUFA 4PX3A 2CBXA 4UZSA 3LBFA 2WDPA 3G9ZA 4HQRA 3I62A 4CF7A 2YKGA 3DBOB 1MDBA 3O4FA 4HYYA 1GTVA 1YZ3A 4GRIA 3V4SA 3WG9A 3WBJA 4YQZA 2JJ2D 3JWJA 5ALDA 2C1ZA 1XZAA 2IELA 1TX4B 1U65A 4DC9A 3B36A 2W22A 3EMVA 4F85A 1Y5NA 4XW2A 1EK0A 3A26A 5KJ1A 3GLGA 4PG5A 1X8JA 4MW0A 2GPAA 2X3UA 1GKKA 2BFBA 1E9EA 3UH0A 3UJHA 4HFJA 3ACBA 4KVGA 4N6NA 1ADYA 1F06A 2I62A 4ZI7F 2VUTA 5CH5A 2C4HA 2XOKD 2YMQA 4M1EA 4N5LA 3ML1A 3T52A 5BN3A 1T8UA 1NR1A 1QF7A 4HDSB 4FSDA 1BKSB 4O59O 4MZDA 3NAMA 4K9SA 5KOHB 2TYSB 2BIFA 2V7WA 4HVCA 4ALMA 4DV5B 4PZ9A 4DJJA 2PCJA 3I1YA 4X24A 1C9DB 4GQIA 4WLVA 4G1BA 1FMFA 4S1PA 3TNJA 1PL7A 1ZKMA 1CY2A 2J3LA 1MVOA 2PAFA 4HYQA 2H31A 1QIHA 2IU4A 2O4UX 3RRFA 4C30A 3JASA 2FV8A 3R2JA 5JDCA 1UPBA 2QN8A 5IBPA 4MRMB 5ALIA 3NH9A 2O2YA 3F8WA 3HWX1 3NUZA 3FNQA 4Q4LA 5GZ6A 4CNQA 2DXIA 1RJ9B 2F8LA 5JLJA 1EJ6A 4X84A 5H0IA 2AQKA 3Q2OA 2FX5A 5HBRA 1N0IA 3V8V