3V34A

Crystal structure of mcpip1 conserved domain with magnesium ion in the catalytic center
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
157
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
publication title Structural study of MCPIP1 N-terminal conserved domain reveals a PIN-like RNase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 157
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v34A00
4G24A 5H9WA 3V34A 5DIZA 4G23A 3V32A 4G25A 5H9VA 3V33A 5FT9A 4G26A
chains in the Genus database with same CATH superfamily
1UFQA 1OTXA 1T2DA 2Z2ZA 2ONYA 2Z30A 1SG6A 1L5KA 2YWDA 3WBFA 5FORA 4OAPA 4PCAA 1PJTA 1AGNA 3KQWA 2IEZA 5CXUA 4JY7A 4HADA 3LQKA 1HFWA 1GNPA 3FNFA 4RANA 2P11A 1XXHE 1J7JA 4GEKA 5E3JA 1Z7WA 3O8OB 4YRGA 2EWVA 1SVOA 4HH4A 1WD7A 4UASA 3UJ9A 2E4YA 1QMGA 2FH5B 1Z0DA 2IUEA 3LT5A 4R8MA 5E8JA 3ZHUA 1Q7RA 2YWBA 4ER5A 3EWIA 1C3LA 1NURA 5CLLA 5HRAA 3OI7A 3GLFA 3FFXA 3G2HA 1V0JA 2V45A 1ZCZA 3MJVA 3OLZA 4BYMA 2HBQA 5A71A 3DAHA 3FOFC 1N5RA 3K1AB 3K9BA 4X60A 3WDLA 4FLEA 4FPXA 1ZKDA 4BQQA 1OAKA 4WY8A 4XEUA 5FBZA 2WRZA 3HC7A 4XLZA 3ZCSA 4F96A 2OHVA 2CLDX 3OETA 4Q39A 2ZS7A 2Q3HA 4RFSA 5F21A 3OY7A 3B7PA 2HSGA 3ER8A 1SVIA 2QRZA 4R9RA 3CCCA 2RHGB 3TCKA 5FWDA 4R71A 4ZHQF 5C5DA 1KI7A 1UT8A 3V4ZA 2HSEA 1EA5A 4QTUB 4DCJA 5CITA 1LSJA 3P96A 5AXCA 3PZBA 5WRFA 2C9ZA 3CH5A 1PZGA 2EL7A 2QL7A 3DNPA 4E7OA 2EJWA 2CUNA 4Y2VA 3U4QA 4AF8A 2XVZA 3GJ0A 2ZXFA 3VKWA 2FZWA 3JQ7B 4L72A 2YKGA 2Q0SA 1YVEI 4ALMA 3JX9A 2FY8A 4ER6A 3AKDA 2HHHB 5CYGA 3AUXA 2HF9A 2NU7B 5KX5A 1FYWA 3NTRA 1RKUA 3F74A 2H7VA 3T95A 2FEOA 3NVDA 4F8JA 4H60A 1JVNA 3T1VA 2NUPA 1DIOB 4KLCA 3VDRA 4MPPA 2BJWA 2JHCA 2JARA 1EFTA 3ESBA 3QXCA 3QRWA 4LJ4A 4GX1A 4F3TA 2R8OA 1REQA 4LSMA 3K0CC 1Z5ZA 2P3OA 4R4JA 2PLAA 3C8ZA 4IIHA 4MP6A 5K3FA 2PKRA 4IUYA 3WL5A 1UM8A 4KXYA 3DWFA 2CVHA 4CXMA 2F3QA 1E6WA 4W82A 1RPTA 1I0IA 2QLTA 1UANA 1EK2A 3KXIA 3OCCA 3Q6MA 3DHWC 4P31A 3ZK7A 2OHGA 2XMCA 1C9NA 4DJEC 2PR7A 3FPCA 2VPIA 4GBMA 4XTRA 3JQGA 2GN9A 2GRAA 2H1HA 1ZITA 3UJ7A 2NWQA 4OI2A 1GL7A 1W4LA 2GEVA 4OQNA 5AHWA 4ZT7A 4AMGA 2PX4A 5JDIA 5CM9C 2XWJI 4QHSA 4OBEA 2Q4BA 3OCWA 1DKMA 5FIUA 1U94A 3GV0A 1SC4A 3AZQA 2J41A 1SKYE 3M83A 1ID1A 4FR0A 1ZOOA 5FL7D 4BJ5A 5A06A 2OSBA 4UHCA 4EB6B 2QZSA 4BJHB 2DJ5A 4GXNA 2Q1SA 3VPHA 2BEVA 4Y6LA 1SU8A 4L0MA 1P31A 1DEKA 1KQPA 3Q88A 3B1ZA 3C1UA 1X7YB 3LX4A 1BH2A 2YXDA 4YJFA 5I9IA 2H31A 3GRKA 1Z2CA 2J09A 1YDEA 3Q7IA 4QNNA 2E4UA 3W2EA 3ZU4A 3IEIA 4X63A 3CKMA 2ZYGA 4DQDA 2ZYIA 3STTA 1WSDA 1XAHA 3ZCVA 3QELA 2ZTHA 4EL0A 1C29B 3E3MA 1RMYA 4EDHA 3IBSA 5EQJB 2D7CA 3RU7A 4Q7JB 4ARBA 4ARSA 5HDBB 4HMQA 2INGX 2HEIA 3C3PA 2HQSA 5EWMA 2V65A 3DUFB 3NVMB 4EUFA 2XGJA 4YJ2F 2O19A 3GBPA 3UMMA 2FMTA 1N6OA 1M6YA 4NEQA 3LP6A 4J3NA 2GEBA 1M2OB 3ENZA 1UWLA 2Q28A 3LRXA 1VMEA 1KYZA 3DQQA 1XVAA 3FVTA 3G0BA 2WJ3A 4LJ6A 4AJ1A 4DLPA 4BGEA 3QEKA 4FQ7A 5CT9A 3ND6A 3IUMA 1ANKA 1RXEA 5LZ5A 3GIWA 1Y8CA 2JHGA 3A3OA 4WNAB 3RLIA 1B0ZA 2B7LA 4QOHA 5IKMA 4MVCA 2F8SA 4LRYA 2JGDA 2CZCA 3UAVA 4S0ZA 4Y9TA 3ISTA 3HJTA 4TSKA 3LP8A 1ILEA 4G1EB 1UQRA 3IFSA 1DQSA 2FZCA 2XGOA 5JZBA 2J5KA 2I9KA 3C1OA 1Q0PA 3E6AA 1DARA 4XUGB 1TQ8A 3GRZA 4EMUA 4X5OA 3NTXA 6ABPA 2J9FA 1TIBA 1R00A 1S02A 3JWEA 4N7RA 3C0KA 1Y5MA 1Z6PA 3TQFA 1ACLA 4HXYA 1G21A 3K94A 2FRXA 4WBNB 3B1XA 1FVHA 1OROA 4YP6A 3CSUA 5EQTA 1LDBA 2PZJA 3I4FA 5HJ2A 4UPDA 1CQWA 1J99A 4HFJA 5DNWA 3RSHA 4LSZA 3ESYA 2Q6OA 4OTZA 4QWMA 1XTVA 2YY5A 4GI2A 4XFKA 4YLGA 3TYXA 4RETA 2PA3A 3Q8XB 4AMBA 5JYBA 2RKBA 2OKCA 1X77A 2QTRA 5FULA 4YLYA 3D4IA 4HGYA 1FJGB 3RT1A 3Q5GA 3UHOA 4Z9BA 2C29D 3WFJA 2Z2JA 5BXYA 4PX5A 1QJ4A 1RQPA 3LY7A 3FVRA 1EVEA 3A14A 5DCYA 4KQCA 2Q5FA 3L5KA 3QKRA 3E5NA 3EHDA 1Q7EA 3OM8A 5EKTA 1UIMA 4IGKA 2YXPX 3IJEB 5CX1A 4OBXA 4RKYA 3SXJA 5CVTA 4MYRA 1YQDA 1Z4JA 3G5MA 3C6XA 3JYOA 4GE3A 1PYOA 5ILGA 2OR3A 3HHPA 1TM2A 1X2EA 3Q41A 3NUQA 2E4AA 4RAOA 3ZQ6A 1M83A 5B3JA 3QXJA 1AQ6A 1EDDA 1YJQA 3IPLA 3RTEA 2HSZA 4Z0PA 5AVVA 5JBQA 1Z4LA 4CM4A 1L5HB 3AINA 2Q9AA 4KZPA 3OZ7A 1F2UA 2DPXA 3V3KA 4POOA 4J4HA 4PZYA 4BNDA 3NVKI 1DCFA 1QC5A 1V7QA 3R3VA 4HUQB 4OQPA 4OPMA 1V8ZA 4QFCA 1CEQA 1HLGA 1IZYA 2LZ0A 3IQZA 4QFDA 4AKGA 4UUOA 2JZNA 1R3DA 3DKIA 4S1TA 1YKSA 1TEHA 3FOZA 2AGVA 2E2WA 2JANA 5EJ4A 3H9QA 1WP9A 3D4LA 2P9HA 1W47A 1JHQA 2IEDA 4RVSA 3OJCA 2YS7A 1T3SA 1UQUA 2E7ZA 2HDOA 4KG7A 4QDUA 4IFEA 1XTUA 4B3RB 1IXSB 1T4CA 4CQMD 1RI2A 1OLXA 1YR1A 5FR2A 1ORRA 1P7CA 1I3KA 1TQHA 2GUWA 3TXXA 4B6EA 1P17A 3TLBA 821PA 3RC8A 3OIWA 3QTLA 4LWQA 5IJ0B 3HBMA 2H2WA 1LLUA 2H1FA 4X8OA 1UPAA 2WD9A 4KRYA 1CUWA 1TKCA 3QE0A 3ZNOA 1J09A 4B4UA 1UBGA 1M8JA 4KTVE 2IP2A 3K5HA 1JIKA 3USES 4BBAA 4BX9A 2HJRA 3W3AH 1LPSA 3WSTA 3B8EA 4HQKA 4EF6A 1YVDA 3GEMA 4I4TB 3BSWA 1KY4A 1R4NB 3JV7A 1Z38A 4WLVA 5IVPA 4ILEA 2XNKA 1YBHA 3HJBA 4XYGA 3JAKA 3CX6A 1DAGA 1M6EX 2O8BB 3R1IA 4NHOA 3C5HA 1JIUA 2QRGA 1GGNA 3RV3A 4HS4A 2JDIA 4MMZB 3RBVA 1DAPA 1FE8A 1JHPA 5GWXA 3IT1A 4J0FA 1CCWA 2PSFA 1PWYE 1ZA1A 4AWAA 3NANA 2II6A 1N25A 1O97D 3JD0A 4Q1VA 4GP7A 2XQJA 3FSEA 3T4PA 1EFDN 1G8KA 1DAMA 4H4DA 2EJVA 2VBFA 3PPYA 5IT0A 1K5GA 4QL3A 3L6BA 1YV9A 2I2DA 1DU4A 3UQYS 1QH1B 2IVFA 5DGIA 3WX0A 2RAVA 2OM6A 3EE6A 4HB4A 3X1DA 1JJAA 4OQZA 2CSXA 1E7QA 2A5FA 2PSHA 2PU5A 4P4SA 2L82A 4IQ8A 1JDBC 3RK1A 4AN1A 3BG5A 2JK1A 4GLFA 2AK3A 2B30A 4C4YA 2I78A 1E20A 4DDHA 3BFKA 3IOBA 3B1KA 4HMOA 3V8RA 2PVCA 4NOMA 2AQHA 4DQ0A 1DV2A 4BECA 2XSZA 2V5AA 2XT0A 4IMRA 1W9MA 1J8DA 2CY0A 1WWKA 3D6VA 5DSTA 4BNUA 4PU0A 3NH6A 3DTVB 3GVIA 1XI2A 3Q3IA 4Q9IA 2O20A 2IZ0A 2B3DA 3PHIA 4EG1A 3CE6A 4ZVTA 4F93B 4ZJPA 4CUZA 5L4SA 1B0PA 5LZ9A 5J43A 2JI7A 3AF1A 3VA7A 5BSRA 2HH9A 4FOPA 3CEPB 3SZGA 3K0FA 2H00A 2YZNA 3FNHA 1L4MA 4CEJB 2BHTA 3QPVA 4Q1CA 5E4FA 5AOCA 1PV4A 1BEEA 2CXXA 1XNJA 4QNMA 3P4XA 1Y6FA 3IIKA 4YALA 2TSYB 2Z1MA 4M0EA 4HVLA 4P7GA 1RADA 5IMBA 5CLGA 3FOAA 4QUIA 3JR3A 3EPJA 3KDPA 4AZ3B 3SM9A 2W2NA 2Y1OA 5BRJA 2YINC 1JLLB 4KR0A 3EIWA 3EWAA 1NMQA 4ZKDA 2CMFA 4I36A 1AE1A 2JLYA 2O05A 3A6KA 1JG7A 5FA5A 1RCTE 1NJ6A 3AHHA 4BNYA 4ZYUA 4YP7A 1VB5A 1KQNA 5JLAA 2PZBA 4F3CA 1Q83A 3DBRA 1CUDA 3DOOA 1N3LA 4BNGA 4QQ8A 4G89A 1SA0B 1ML4A 1MD9A 2ZWVA 3FKJA 2KI5A 4NQZA 4QLAA 2A9RA 4DPLA 4EO4A 5DO9A 1U5BA 2JHAA 3ANYB 4FCVA 5KNDH 3OMWA 1Z5OA 3VR6A 3T5GA 3QXSA 4KQWA 1PS8A 4OATA 1N2BA 5LPNA 1W36C 1QTNA 4QGFA 2ZZMA 4HRVA 1JECA 4MA4A 1MGPA 4RZIA 4WCFA 2QLMA 3GLGA 1U0HC 3I61A 2CLKB 4KGZA 2O2SA 3CB4A 5D2CA 5IKOA 4LWPA 1VB3A 2AX4A 2P5YA 3Q3VA 3RU3A 5ENDA 5CMLA 2CNDA 2M6RA 4PHTA 1V8BA 5SZHB 3E3OA 3W3ZB 2OESA 1LFDB 5KPDA 4OHOA 1IEXA 4PNPA 3S28A 2ZJ1A 5EJGA 4XI9A 2WF6A 1YUMA 4ZCRA 2EU8A 3BE6A 3KTAA 4RCZA 4FYKA 1E8MA 4ZVKA 1DAEA 1GG2A 2FW1A 4PGMA 1G5HA 1XQWA 2WYUA 1FSZA 1PZEA 1FFCA 3GAFA 5ALKA 3W5JA 4JP3A 3RJ5A 1TGYA 3MJHA 5FLYA 4A2PA 3IKMB 4A9AA 5CVUA 2R6FA 4JGGA 2Q9CA 5CB4A 5KYKA 4E1BA 1LNQA 1G5PA 1N5MA 3FMIA 5CDYA 1RLJA 2C7GA 2QJOA 2F62A 4M7WA 4R83A 4UM7A 2F9FA 3NTVA 4DR1B 5FBRB 1E79A 3H9CA 2ZTMA 2Y0PA 1SKQA 3QBEA 4F5YA 1SVSA 3PS9A 2NUAB 3DLBA 2GK6A 2IHZA 3CM0A 5IEBA 1F4PA 4EBBA 4CTMA 1X3SA 3EAQA 3KQPA 2FPIA 5IK2D 1R0ZA 2C42A 1VLLA 2R6JA 3SR0A 2XDQA 2W6NA 4HTFA 4GG1A 5EUCA 4PCLA 1R6UA 2VRNA 1JHVA 4MS1A 5LUBA 1PR2A 2ZSBA 4KFCA 2C5AA 1XQYA 3JVIA 2HQBA 4YP5A 1NUAA 1RRPA 4AICA 1VYTA 1O96A 4O08A 4RD6A 1YI0A 3L93A 5ALUA 4NX2A 5ECYA 4CMIA 4D74A 1ODFA 2W6ID 4RIGA 3NS7A 3VC7A 1V8PA 3CVXA 3ZBTA 4UAJA 4WZAE 3TQHA 4FJ1A 2ZYTX 3V1LA 3V4VB 1RHUA 2J4DA 3GQBA 5BN3B 3X0DA 4LFAB 2ASEA 5HRUA 4X8MA 2HD4A 3GN2A 1MFZA 1C7EA 2GYYA 3T1NA 1RU3A 4UEWA 3OVMA 3PXUA 3DKRA 2JFGA 2DFPA 1ZOPA 2ZGVA 1RQ2A 1RBMA 2QXYA 3NQ41 4P4UA 3ANSA 1JQBA 3CPEA 3JQAA 4L9RA 4RZHA 1EP9A 1Q0HA 1KBZA 4HNQA 4OVKA 2X3YA 4BO7A 1LDGA 1LK7A 3VZBA 4R8LA 4WFQA 2RDMA 3KCNA 2H1LA 3UHAA 3ZE7A 4E21A 2BVNA 1LI5A 1CIJA 5HMMA 3SCZA 2ORWA 4P3XA 5H82A 1CUUA 5CUQA 3KFXA 4GR9A 5BV7A 3DO5A 3NHLA 3NAQA 2E9SA 1E1DA 5EFOA 4RACA 1ZH2A 1ESZA 2JCXA 2P41A 3ACCA 1NATA 3PUKA 3MINB 5KAPA 2WVHA 5CA0B 2RK6A 1RBZA 2B34A 4MVJG 4DKXA 4TWZA 5KS2A 2W11A 1KL7A 3MAAC 4JB0A 4RJJA 3JRWA 3H8SA 1B1AA 3G23A 3IBFA 4YWJA 2VQ6A 3L40A 1DI0A 2H11A 4LHYA 2QN6A 2R25B 2FUKA 2DFLA 3PA6A 2FK8A 2W71A 1MEOA 3L7DA 4HSEA 4QNRA 4B46A 4E03A 1PX0A 3OE1A 1G7TA 2K87A 1PIWA 3OPYA 3IIIA 2H17A 2ZT6A 5AKXA 1QVZA 4X6UA 3E7FA 3EXEB 3LHFA 2RC5A 1SKBA 3IOEA 4M46A 4WFKA 5K9ZA 3RVLA 1TLLA 2VHZA 4G9BA 4UVGA 2XKKA 3OUUA 4B3GA 2O2XA 1TC1A 4M53A 1JFSA 3IB6A 3Q3EA 3AP3A 4U7PB 3O7MA 1YHNA 4D99A 2J59A 3OEHA 2AUTA 2EIXA 3Q7RA 4L4RA 5J3JA 3D9QX 5TMDA 4C88A 4AJKA 3DB2A 2IIBA 4B1FA 1I13A 1EWKA 2VUUA 2J0SA 2JPDA 4C3UA 1JV2B 2ZJYA 3UJCA 1GSIA 1PN3A 3DC7A 3LBYA 1ZZGA 3DR3A 3SG0A 3K9GA 3KLMX 3RC9A 4M7OA 2YHAA 4I1YA 4IHKA 4MYDA 5KOIA 1D07A 2HQOA 2YWCA 3KZVA 3JY6A 1MQ9A 5EZYF 4P5EA 3HSKA 3AFMA 1E5VA 5JV5A 2EDCA 3GGGA 1WEKA 1WO8A 4I9FA 4DY4A 5ALHA 3SFZA 4PYJA 3THWB 1EFVA 2ZI9A 1FDOA 3G6KA 1Q17A 3GFTA 3TZQA 4MYTA 2ESRA 2QPLA 2TECE 3NHBA 4KTTE 3AR3A 1SCKA 5KJ1A 5JY6A 3MJRA 5B7PA 4H7KA 3EGWA 4QT0A 3SHOA 4F1WA 1EG2A 3LQFA 1XA0A 4C0QC 4UM9D 3NBKA 4JOCA 1W7AA 4M1ZA 3K32A 4KHPB 1ISMA 4BVEA 1GZ7A 3N8HA 2G1JA 3E9QA 1CVIA 3KQSA 1Q95A 3NW9A 2FJ0A 3P2YA 1OBHA 4NRDA 2Z04A 3CRZA 4Z1OA 4ZZIA 3D7KA 1QO9A 3WGHA 4D9IA 1P1HA 5SY9A 4YS6A 3LI2A 3ZJVA 2FZEA 2IUYA 2CLOB 4Q1AA 4EGCB 3THXA 1IK4A 2WPDA 4QJIA 4XWAA 3H9GA 1AURA 2R7LA 4ZARA 4HK4A 1F20A 3AFNA 2OG1A 2YUIA 2GN6A 1Z0IA 3R2JA 2Y2VA 4KWHA 4V2IA 4X20A 3O9MA 5JQGB 2PGNA 2WSYB 1IAQA 1RYHA 1T3LA 1JDJA 3DZGA 3PI7A 3VR1A 2OZPA 4F7WA 1EP1B 1SBNE 4DIFA 1PR1A 2P0AA 3F96A 5KWVA 5L6MB 3AESB 4OLBA 3OJLA 1MABB 4NMXB 1AHPA 3UIEA 2OVFA 3CS3A 3QWHA 1NF8A 2WZCA 1F8FA 4MIEA 4D6YA 1BKSB 1C0EA 5JE8A 2G07A 1GM5A 1U2QA 2IWRA 1VL2A 4V1CB 2BFFA 1MO4A 5A02A 3EG5A 5A5VA 1OA0A 4EPXA 3RKRA 4ZD6A 3R6TA 4FCTA 3EDOA 1N9KA 4MKGA 2ONJA 1RWVA 3G9UA 4IIJA 4AAYA 3DZHA 4ZQGA 1BU5A 1F6BA 3LQRA 5IWAB 3I4LA 4RF5A 4Z2YA 3SC6A 1VHQA 1HE3A 3LK7A 2CZQA 3OLQA 4YUZA 1YR9A 1U2GC 3ESZA 3HUFA 4KV7A 1HYEA 5AI6A 3RTGA 1S2LA 2Z5GA 1IHPA 1OT3A 3A4LA 2BSQA 3HV2A 3VU8A 3NOVA 5P21A 5DT2A 3EWNA 2DHDA 1F8YA 1ICEA 3NKVA 3TCNA 3QFCA 3VO8A 4Z7JA 4DR6B 1NZDA 2OO3A 4PLVA 1E2NA 1KAHA 1DRUA 3GMSA 4FIDA 4X8LA 2WWRA 4ENWA 1YI1A 4FFSA 4CL2A 1VGQA 3K09C 3QW2A 3CLUC 3R8XA 3LSYA 3RU9A 2PT7A 3JW8A 1CRLA 3UG6A 4O4IA 1L4EA 3FTNA 5CFRA 3QVXA 1IN4A 3CLTD 4BVFA 4GHWA 4FFNA 3B1WA 1FJHA 4FWBA 4NZOA 1ZLXA 1WA5A 2BPOA 4LDNA 2QD4A 4H31A 2CNWD 1AZWA 2YN4A 3V5NA 4AF6A 3EVZA 2VTVA 3DM5A 3WDSA 3EIOA 4V0KA 2C31A 4RQAA 1YDMA 4M98A 5LQAA 3IUSA 1XCPA 3PWSA 3FYDA 2HBRA 4AJ4A 4B7UA 1DG3A 1F5NA 4BN0A 1QZ3A 5BV1A 4E94A 1N8KA 1E3DA 3C4VA 2WIKA 2I2FA 2W2TA 2EL9A 1IWOA 2GFQA 1EXNA 2WU8A 3JQCA 8MHTA 3LE8A 5SYAA 4HWKA 4W8GA 4EHJA 2YN2A 1L3CA 1LRLA 4ZALA 1A9XB 1NVUQ 1EUZA 3FYUC 1PE0A 2XUOA 2JA1A 4FIZA 4K0RA 1M8PA 5A7FA 1I2DA 4G0VA 3JARB 4HGPA 3K8QA 2DHQA 1AZSC 2QRLA 1EHIA 3EVGA 3NTUA 4KAXA 4N9QA 5I9BA 2NU9B 3T9AA 1KXZA 3I9JA 2ZANA 2V9CA 4RM3A 1GCIA 2BBOA 3I28A 3LQ4A 1OH5A 3KJQA 3ECSA 1R6TA 5FWYB 4J1QA 4C0XA 5CW2A 5AQEA 4M1TA 3V1MA 5LQRA 3A6ZA 4C4PA 2OO5C 5HQJA 1FDUA 2Z9BA 4JENA 2PQ0A 4EJ0A 3ZXYA 2AOTA 1C0PA 4BFSA 2Q7DA 3WRXC 3ZUGA 1T0JB 1XWFA 4YCSA 1FP7A 421PA 4O2LA 1WCWA 1E63A 4JFAA 3FJOA 2Y6UA 1OT5A 2QG4A 2QUBA 4RESA 1MTZA 5DLPA 1Y98A 1Z06A 2VH2A 2ID9A 3WGMA 3ENKA 4KWEA 1G0NA 5AKHA 5EKDA 4YRBA 1QFJA 3BILA 3AFGA 5AICA 4M0PA 3EPHA 2P27A 4TWRA 4BBZA 4H4CA 5KOJB 2VWPA 4I8XA 5ENVA 2P3SA 3L1IA 2C98A 4P81A 3DE6X 10MHA 4BO5A 3IAEA 2FR1A 4NE9A 1E1RD 4WZAA 3B7WA 2IU3A 1KBOA 1XGKA 2PX5A 1M2VB 2AC2A 4MV8A 3QKSB 1P0PA 4R2HA 4B2PA 4CIBA 2DFDA 2DKFA 1T0IA 1PWZA 1TEXA 2BMWA 3VC3A 4EHKA 4Z4FA 1DL5A 3M81A 5DK6A 4D9JA 3MQFA 5GQSA 5EXPA 2V7QA 4GT1A 3Q5DA 3WWEA 5I7WA 1Z13A 2LKDA 1JEOA 1W5FA 2BMVA 1GV1A 1MQ8B 2J1LA 3GOQA 3KJNA 4Q1DA 2APJA 1EFCA 1LSSA 3CUTA 2CUTA 3ICVA 4I5EA 4N1AA 4ZCLA 5K0LA 3C24A 1OXVA 4R40A 4FGKA 3NHUA 1PSDA 3MPOA 1Q1EA 4JC4A 4BY9E 1TO2E 2VNHA 4QJ4A 4MGEA 2H4JA 2G88A 2P2CA 1UBOS 1AH2A 4ZT3A 3BQ9A 3D43A 3FAKA 4F3KA 3F7OA 4G4SO 2CFIA 3BQMB 4YJ3B 1E4OA 1BMFD 2R66A 4J3FA 4EG3A 1MT0A 5JAHA 1SVUA 4XSVA 1ZUWA 3RGGA 5C5EA 4BLOA 2DU8A 3AK4A 3BBPA 1ZCFA 3HE3A 2R44A 1X9GA 3IODA 4OF4A 4CCWA 5ABPA 5KINB 4J16A 3PFFA 4DV7B 2OFFA 4NJEA 1DZIA 4OH7A 4WD3A 4KP7A 5FAXA 4MPRA 2Y0EA 4EA8A 5JYDA 1UFOA 1Y7LA 3C3XA 5G53C 3LFTA 3HZRA 3TR5A 2QTBA 4QPPA 4BP1A 5AOAA 1KI2A 1GCOA 1MX1A 2AVDA 3IVCA 2EX1A 2X5OA 4NDAA 4U8HA 2VJLA 2IEYA 3DGEC 4IWNA 1RKXA 4X00A 2ZBFA 3P52A 1ZVKA 3PXXA 3H1FA 3I6YA 4WEOA 5K0NA 1WMSA 3IDFA 2N42A 2PYDA 1B93A 2J7KA 3ZD8A 3DVLA 1W29A 4YRQA 2H59A 1OLSA 2AYYA 1NN5A 3C3BA 3HA5A 2OG2A 3D8RA 1U4NA 3H9UA 2H8GA 1DKLA 4DCMA 4RDXA 4CQNA 3WIUA 3IPAA 5EVCA 1Z39A 2QG6A 2JJ1D 3ETHA 1QQTA 1U0NA 4Q93A 3B5JA 1J0DA 2VWQA 3BXHA 3OKFA 2XZPA 3BA6A 4J2HA 1M0SA 2BHSA 1X7DA 1Y1TA 4I7EA 1YMVA 3Q7TA 4M60A 5IPFA 4D43A 1KAEA 2JZOA 2V3WA 3EGDB 2CDAA 3SQDA 1PG0A 1RPAA 2JKVA 3O3MB 2W2OA 2CNLA 4TTIA 5GY7A 3QSYA 3VKGA 2NM0A 4LMPA 1B8NA 2AYXA 3O5AA 4TWJA 5TE9A 1Z56C 4HLDA 1VHJA 3AF0A 4PHFA 5BYJA 5HTOA 1YMQA 2LDXA 4I9NA 2O7QA 1YHYA 5B1SA 3AQ4A 4LG1A 3EXFA 2I03A 5IASA 2Q46A 2YRFA 4O2AA 1RLTA 1ZJWA 3OEED 4DMLA 2XUGA 1WPQA 4A27A 4KC0A 3CIFA 4FEGA 1SQFA 1R6BX 2GJAA 2YR0A 2EBFX 3PD1A 5CDFE 1LS1A 4UTOA 5EWLA 4FGJA 5DBIA 4GPEA 1EGAA 2O5RA 3W79A 5IKEA 3L8GA 4RC9A 3AKZA 3RS2A 4Q34A 2OQ2A 1SUSA 1ZNZA 2HZBA 3PWTA 4AJPA 1XNHA 3FCCA 2VHTA 5C31A 5BVHB 4YUVA 2BGWA 1D2CA 5CYOA 5D01A 3OBBA 2JFXA 1RXVA 2VF5X 4IG9A 3BGWA 2DF8A 4YMLA 4DR4B 2Q9UA 3V7YA 1DBRA 1YOVB 1G8SA 2Y93A 4FFBA 4ZCSA 3GJ5A 2CC2A 5FNZA 3DMYA 3G8YA 3ONNA 4MRRA 1PSWA 4K8RB 2X1VA 4MV7A 3U1BA 1RHQA 1SCBA 4L73A 5F2KA 1E3WB 1CY8A 1U98A 1NAHA 2WKRA 4BMOB 2UVDA 3CIOA 1IB0A 4OBWA 4ECEA 2XE4A 3I0ZA 3CWZA 5LYJF 1ZEMA 1NC1A 4IF6A 1B4DA 3DAGA 4G37A 3CLRC 4ETNA 3LWZA 4AQ7A 3NP9A 4Q4AA 2MIIA 3H2HA 1E6CA 5F2OA 3ZY4A 3X2FA 1PD0A 2AOVA 4QX6A 3MF4A 2UAGA 1P29A 5LLDA 4ZYLA 4Q66C 1GSAA 5AR1A 3RTDA 4AKHA 3VJLA 5CG1A 4R41A 1W0CA 4DW8A 3PHBE 1LPOA 6NULA 4J76A 4ZPJA 3U4AA 4CIVA 2FP4A 3KQTA 1SQSA 1UAGA 2XF8A 3E4DA 2ODNA 3SI7A 3ORRA 4BO3A 3QNWA 5BMVA 1XAGA 1P3JA 4G1FA 4KLZA 2P1ZA 1V3TA 3EXHA 1JEDA 1Y3AA 2UUPA 4QULA 3P9XA 5FWNA 1QDEA 5ALSA 2CV2A 4QWWA 1ZK1A 4UXHA 1NQTA 4QBGB 5CJPA 3EQ6A 1A7JA 1QX4A 3DBVO 3PCTA 3HK2A 2A33A 2VSXA 1CEEA 4X24A 1N33B 4N48A 1M1NA 1IZZA 4WXHA 3DDWA 1OTYA 3GT0A 3OQIB 1WHSB 4TYNA 3IP8A 3QVKA 4RH1A 1GOTA 1DELA 3HCRA 4XPIA 5DWVA 2C1XA 1QE3A 4QDXA 4YAWA 2OZLA 1UC9A 3H16A 3GEHA 4URYR 1GYQA 5AUQA 4GOND 3HBNA 4URFA 5K5EA 4D4LA 5AUNB 1ISIA 2HA3A 3GT4A 1EB9A 4G2TA 4KVAA 4MI1A 3LO8A 5IHPA 1KZ9A 2ZRDA 3JQFC 1PEDA 4XAQA 1RMQA 1JIQA 5GVRA 3SE7A 2WIAA 1L3BA 5LP6F 2QP9X 3KKPA 5F7ZA 3HO1A 1U1CA 4TUYF 4D1YA 5A6SB 2QTLA 1WY5A 4ZK2A 3QX8A 4WKPA 4U7GA 3V4OA 4P3KA 5AM0A 4BZXA 2BR4A 2REBA 3A1FA 1EVYA 1PJBA 4CQMA 3SSNA 1XZFA 1P2BA 3RFUA 2V7GA 2OB1A 4J91A 1CQZA 1MC4A 5BQFA 3DGFC 2C3YA 4F21A 3LWBA 5HBRA 5ADWA 4NDZA 1JB1A 4DFDA 5HF6A 1P2SA 3AB8A 3QITA 3GRYA 4R2MA 2Q49A 2WJVA 4R2KA 2ZYSA 4OJKA 4EI2A 4ZQHA 3BD9A 4Y2TA 3U4HA 1NLMA 4JT9A 4MRMB 4O4JB 2LGJA 3RG2A 4YV1A 1L5YA 1OQAA 3NDRA 1PJZA 4H08A 3GJXC 3WISA 4P93A 5B7NA 1V45E 3MS4A 1QB7A 3GHHA 4UUBA 3IHLA 1HOTA 1K4KA 4M1YA 4YLEA 3HJHA 2BGGA 3U9SA 2GFHA 2V0NA 4EAAA 3QF4A 4XDYA 4C78A 3VR6H 2ZG6A 1E5QA 4PAOA 3WHIA 5ELXA 4MKIA 3D4OA 4EMTA 5C8DA 5IFKA 2X6QA 4O2BB 3CHYA 1QR2A 2JLUA 2N3ZA 4FHEA 1KAOA 5BT9A 3T7EA 2CE7A 1W88B 2QVCA 3WAJA 4W5HA 2R68A 4LX0A 1VTKA 4RVFA 5T8KC 4URWR 4IIUA 5U4QA 4PBTA 1P1KA 3M6FA 3C7CB 4KPUA 1JRLA 1FS4A 3QBDA 4GPD1 4RWEA 2IH5A 1RJEA 3N2EA 4J0CA 1VKHA 2GHQA 4KLRA 5AHRA 4XQ0A 1UBEA 2I65A 1N1DA 1EBUA 1YMUA 1XRQA 3M3HA 4WERA 2X7XA 1I4EB 3U7QA 1KGDA 1QIGA 5JZOA 4US0R 2A0YA 3U60B 1UMKA 2W0SA 3HDTA 5LWHA 1PGQA 1ENYA 3IAUA 3KVVA 1KYXA 4GMFA 5DK4A 4B4WA 3ZNNA 2V5UA 3D1VA 5SYNA 4L50A 4RGVA 4DSTA 1EX6A 1PKXA 2FPLA 4IDHA 5JO9A 3RC1A 3ETGA 1BXRB 1O6ZA 3W8NA 3K8ZA 1QHNA 4LVCA 4NYMR 1C4KA 2I22A 5H9VA 4EZBA 1BN6A 3ELDA 1P8JA 1UOOA 1DO0A 2CDNA 4W5TA 1BIFA 4PE5B 3SXPA 1U0OC 5CDHA 3CPHA 4JJ8A 1DKOA 5HM6A 1OIXA 2QN1A 2JLWA 5BWLA 5C9ZA 1N7JA 5SZIA 2UYHA 1I7DA 1FFHA 3Q9SA 4F9FA 1IHYA 2QX6A 1DQRA 2VIIA 4FI3C 4Q12A 3SNKA 4B76A 2Z5FA 2WHYA 2PRYA 4UHKA 2OHIA 4AKIA 1TKBA 2XITA 3QOWA 3FTCA 1JFVA 4MV1A 3DLTA 3KT3A 4KE9A 4QGAA 3SJBA 4GM0A 3T06B 1NRXA 3OZSA 1M72A 1U8AA 3KHTA 1Z2EA 4QU8A 3S1AA 1XIVA 2FRDA 1A5AB 4M4SA 3SOPA 4A2CA 5HS4A 1N2OA 2QJRA 5K0EA 5KWJA 2BFCA 1ORIA 3ESAA 5CBPB 5I7SA 5JANA 2VDJA 2R6DA 4CLXA 3QIVA 1IE3A 4NH0A 2GN0A 3RUIA 3PRHA 3EC7A 4L51A 1IC6A 1LK5A 4B73A 5C18A 2I54A 2O8EA 2QTWB 2ZRKA 2H8KA 3W77A 1JIXA 5LCXA 3CUEF 3MJEA 5FA6A 1G3UA 4OA8A 4IXDA 1BOOA 2Q5LA 4V0RA 3RF7A 4HAYA 1NMSA 1UZAA 1ZFNA 4IVPA 2WE8A 1VKRA 3QTBA 4JBNA 1QOPB 1U02A 1N7HA 4LYDA 4HDKB 4EMBA 2XRFA 3WAGA 2OTCA 3AEUB 2Y71A 1DJPA 2FCAA 1EWYA 3GFQA 3SJCA 4BLRA 2NOAA 3TRIA 1IWPB 3BDIA 3I1YA 4IUCS 3D7SA 1IG3A 3K8YA 4ARAA 4URHA 3HVJA 5FADA 1Z8DA 2VJMB 1BDMA 2BGJA 3WJAA 4D57A 4BPRA 1GRVA 4IXTA 1L8XA 1U8XX 1IHUA 2E37A 4HD8A 3DH0A 4I19A 2A5YB 2UZ1B 2WSSA 1ZH4A 3NFYA 2IYLD 4H77A 3QLTA 4JI4B 5TPWA 1SVLA 2OORC 5FTNA 5AW4A 2VJKA 2PUTA 2CL0X 2FSHA 2AJDA 1XU9A 5CDFA 3BIWA 1UPFA 3W4KA 3D7NA 4OI1A 3K3PA 3RS8A 3SYNA 4Q3KA 3ZDCA 2HA2A 5T57A 3PUXA 1KYWA 5CXXA 3ZGNA 2B1GA 1JHOA 2R1ZA 4FW9A 4EPTA 4GKKB 1CQJB 1UAYA 3OTGA 4TMVA 3EH1A 2HBZA 1U7ZA 1ZI9A 4ES6A 1M6VB 3OE5A 3G5LA 3QF7A 5E0OA 4LQCA 2XW6A 2H65A 4DRXB 3OA0A 3UM9A 3HGTA 1X7HA 5TB5A 4GDFA 1CZRA 1KFKB 4LRWA 2KBFA 4A36A 4V1CI 4PYLA 5B6JA 3JQ8A 2G40A 2GF9A 2VDKB 3GVHA 3ZJYA 3H05A 5ESDA 1MBZA 4EYEA 2EX0A 2I99A 5IK2A 1WCXA 4Z53A 2BEUA 3S5UA 1YDWA 3GU3A 4E15A 3DPIA 4TMKA 3UK1A 5E1MA 1C2TA 2IPAB 2OGTA 4IZIA 2XNDD 4M89A 1W1UA 3SHVA 2G4CA 4FZVA 1GNVA 3U5ZB 4P82A 1DTWA 4PEVA 4RZUA 2HIHA 2RIPA 4XZ3A 1F8XA 1VSVA 3ORQA 4IVNA 3WXBA 1SB8A 3RSQA 4WLUA 1GADO 5KYVA 3QHPA 1EHYA 3B6IA 4BNJA 1CXZA 2QU7A 4DVGA 2W6IA 4J2OA 3HMKA 4FKBA 2WHEA 2ZZNA 1SOVA 1BD4A 2V8BA 3K8OE 3KSDO 4QPNA 1E5TA 1C50A 1XNRB 4HRYA 1J56A 3TLZA 2PE5A 4O6VA 2VT2A 1WQ4A 3VV2A 4N0MA 1GQYA 1WXWA 1PLJA 2XUPA 2YBEA 4LF6B 1U63A 4GL2A 3V1UA 3RHZA 3OCZA 5JSFA 1NRIA 1JPNA 2HN9A 2NADA 2C8LA 2CE2X 2ZTUA 4V3CA 5BO5A 1IBKB 1E4EA 1JBQA 2KPOA 3R0JA 1RXYA 4G25A 5ADVA 1UOQA 4EYKA 2ORVA 1JGTA 3NPAA 1KSJA 3RO7A 4B34A 4IJMA 3M8KA 2CCKA 5CD9A 2JIPA 2FW9A 3CSSA 4GZ3A 4AULA 4ESOA 3UKJA 1VFPA 2BLNA 2BW0A 2PPLA 1EESA 3PPXA 1A0OA 2WF7A 1TRKA 2GKGA 4EQ6A 4PHCA 1VDZA 3RNOA 3AO0B 3ZE2B 5CM8B 4CCYA 3L9XA 1S9DA 3I9NA 3WKDA 2YWGA 1FPQA 2H5LA 2J3IA 3T61A 3JPWA 4GI3A 1BYIA 3AYXB 2XOXA 3LWNA 3SR3A 1VP3A 1Y1KE 3O4GA 4ZMBA 1VL5A 1MQSA 1SXJE 3ZC3A 1TW3A 4XX0A 5IZ4A 3HEMA 1WCIA 5FUMA 3WLNA 2NTYC 5JDCA 2E5FA 3GLTA 4IYJA 3EH2A 4MW2A 5K3AA 2OUKA 5JECA 2IP4A 4A6XA 2GK4A 4JC8A 3TKAA 5JXJA 2D4HA 5ILOA 4MDFA 3KD2A 1T3GA 2F1IA 4ABTA 4OHRA 5KMGB 1ZGCA 4B81A 4DIUA 4FLFA 5FUQA 3JQ6A 1QTQA 4DMFA 3H4TA 1LLCA 2Q8QA 4GM4A 4YDRA 1YS2X 2PXCA 3EBOA 4W5WA 2ZTLA 4BNVA 5JEEA 4W4TA 3AJ8A 4MWOA 1DJQA 3B1FA 3NNDA 3RSGA 4DV5B 1G8YA 2ZP1A 4C21A 2JLBA 1QRSA 4AKTA 4F4CA 3S1LA 3JSXA 4Q15A 5E6UB 3MM4A 4LXTA 3A11A 1PL7A 4CLDA 5JMOA 4BFUA 4CDNA 2WB2A 3KD3A 5BOSA 1K8QA 1LZLA 1WUYA 2WZDA 3BK7A 3PU6A 5EHGA 2GBLC 1EDEA 2OV2A 1A7KA 4JHXA 4OOEA 3W8RA 4OQ4A 2BI7A 3AW9A 3A32A 5JJ5A 1TGVA 2IBMA 3DZBA 3I9LA 4LGYA 3TE7A 1CRQA 4PG4A 4KQMA 4B87A 2DRIA 5HEKA 1O9GA 1YS7A 3G2LA 5BORA 5KX5F 4Y1EA 2ZIGA 4JQCA 4MQ5A 3W4IA 2PZKA 3QYJA 4N7BA 4CV0A 1CR0A 4ER3A 2YYZA 4O0LA 4Z86A 3AX6A 4Z9YA 3RJ9A 4BFXA 4QFBA 2ETXA 1ZMRA 5L3QB 4HDRB 4E2XA 4M7RA 4RS4A 3HBJA 5H70A 4GYKA 1E66A 4I3FA 4U7HA 5TPZD 3B3GA 1CF9A 1QO7A 3MCVA 5EXSA 1RMTA 3E3AA 4F11A 5FUYA 4BEJA 3CEHA 3OPQA 1F0YA 2PEZA 3DZCA 3R7WB 3NPMA 5I48A 1FQKA 3HDHA 1RWQA 3ZXSA 1G3RA 2G70A 3LF2A 1DAHA 4G6ZA 4JOBA 4D4HA 2GAOA 4N5IX 1MRSA 2HNBA 3EULA 1UR5A 4V3BA 1W2HA 2AE1A 3D6UA 3T35A 2LVBA 1GT91 2GZSA 4P3YA 3WB0A 1HMPA 4TM7A 2XB2A 4XIYA 4KI0A 1CRPA 3QFSA 3KJGA 1K63A 4C04A 2YRWA 1PDVA 2PUJA 2EAUA 4E30A 1PYDA 1XDSA 1FNCA 4TYPA 3S6JA 3A2MA 5GJVC 4KACA 4OGKA 4M1OA 2BZ1A 1YJCA 1RRGA 3HZHA 3I34X 2AF4C 2QAGB 1R0KA 1Y9ZA 4J90A 5B1IA 1HQCA 5I7RA 1RWXA 2GN8A 4GU5A 4P4NA 5FTJA 3TIXB 3UWPA 2DB3A 1YIAA 1VPDA 1XCLA 1BDBA 1OYVA 2JLCA 1XN1A 4L9AA 4R8KA 5L6LB 1E32A 1P4JA 1WDTA 4E7PA 3HCOA 2Q5JA 3DTVD 2QRKA 2O2YA 3UMFA 4C0HA 3QEBZ 1NVBA 4FMCF 3RSOA 1TAGA 1XRPA 4D96A 3TQIA 4C2UA 2HJGA 3EASA 1KDVA 2WWIA 4H7HA 1F0PA 4KIGA 4DJTA 1IFXA 2NSYA 1T0PA 3GXOA 3DR5A 4U02A 3SY8A 4ARVA 1QP7A 4OJTA 2C5GA 2DHCA 3MXOA 4PYKA 3QPAA 3WL3A 3FDXA 2C54A 3V1YA 5JAOA 3ZI7A 1CE8B 3X1MA 2PBZA 1UDBA 3NZEA 3H2YA 2YJ6A 1LGYA 2CUZA 1SU4A 4YWHA 3BL5A 4DTCA 1BEZA 1CNFA 5HCNA 2OGUA 2Y4OA 4ZGGA 1EWTA 4R1TA 2ERYA 3T4UA 5B2EA 2D2XA 3Q1KA 1JA1A 2HW8A 4P0TA 2GVDC 1JKIA 5KYXB 2H7CA 1I5EA 1YFJA 4ZO6A 3CG0A 1KO5A 4XKJA 5L4LA 2WM8A 1R0WA 1KRHA 3HN2A 2X2PA 4MV6A 5IDYA 1M0TA 3ZBQA 1PQ4A 5HZHA 2BTQA 2C2WA 2MDTA 3LIIA 2QVGA 4JN6B 4I3GA 3AI7A 4X91A 2JC3A 5JSKA 5EHQA 1SFRA 3KRTA 3ST7A 4AKSA 2D7DA 1P5JA 5LMUB 3WGTA 1X14A 1ZOLA 1NT4A 4HSGA 2H1VA 4XR4A 1DADA 3KL4A 2XOEA 3PHLA 1KEKA 1ECJA 5JSQA 4IEFB 2FSIA 1N9ZA 2GPAA 4GH5A 3UMSA 4B6GA 4DGQA 3M6LA 2Q5EA 3P5SA 4F1JA 3EPKA 5JWOA 1N6RA 3DTTA 2Z2XA 1OSNA 3B85A 3RVRA 1QVWA 5FKJA 1TLFA 1MX9A 3HJGA 2C2MA 1N3YA 4FK8A 1PR3A 2I3GA 2JIBA 3E81A 4KMOA 2REXB 3I6BA 3JWJA 3FDFA 3AIOA 4OFBA 5DM60 5TXGA 1LUAA 3SJAA 3KLOA 4ITRC 5J9FA 4ZRDA 3IBYA 4MWTA 3UJPA 3UY4A 3VPXA 3KUCA 3E48A 1X0VA 4AROA 3WLIA 1LH0A 3KYBA 4GWLA 2QNRA 1Z0AA 4ZT6A 1JKMA 2QE7A 2REOA 5JR3A 4Z2AA 3FRJA 1Z4IA 3KOUA 4DB2A 3NRJA 4QGHA 4YRPA 3KBOA 1KDOA 1G18A 1DJLA 2P35A 2OMEA 4XD7D 1WOYA 4KV9A 1C1HA 1XLUA 4C0JA 1ZN2A 1W5SA 4HZUB 1VRCA 3L0PA 2GXUA 1K7CA 5LZ2A 2VNIA 2CUKA 4JXXA 4WASA 2EJCA 1GGHA 3GXBA 4KIFA 1JWLA 1T1SA 4XPZA 1LJ8A 4W5NA 1AUVA 3L6OO 4ME6A 4BTLA 1HZZC 3CNLA 2NNLD 2KYRA 2YNMD 5EQDA 4DA7A 5TDHA 3VYUB 4E2ZA 1IBLB 3Q98A 5ALNA 3FCSB 2A2ZA 2B2NA 2VF8A 2IE0A 4G65A 5EINA 1M1ZA 3H87A 4PGHA 5GADl 1JF8A 3K15A 3P5BA 2BGLA 2V7VA 4LNHA 3WGNA 4F97A 2JCSA 1KYYA 6LDHA 2P2DA 2V0CA 1E0AA 1L1RA 4BNHA 1FMCA 3B6JA 3RUFA 1VHTA 4HLQB 5IM4A 3O2QB 3NTQA 4KGDA 3SEFA 3AEKA 3NKLA 4FE3A 2DTXA 4LJ7A 3ZZNA 2D7JA 1RAAA 4UZFA 2MOKA 1PQPA 2XUJA 4ZOLF 1UP4A 2ISSD 3CVWA 1IM2A 1JU3A 1MP0A 1N78A 4JELA 1OOEA 5K3BA 1BROA 1ZJJA 1GKIA 2RJNA 2RKWA 1ZNQO 1KJ8A 3I72A 3I0NA 3NUZA 3O2JA 2OCGA 4QYIB 3PNVA 4DOMA 2JA2A 2JJ2D 5FPYA 1CX9B 3C4QA 1J8FA 4FMDF 3UFXB 2XYQA 4HMPA 5DHTA 3U81A 3VKUA 2VSQA 1BMFA 3RK4A 2NZWA 1NVKA 4L7VA 2VOJA 3LS2A 1A98A 1BWPA 2WQZA 3MG9A 2W6MA 4FWIB 3DMGA 5JD3A 3WNVA 4ZYZA 3WL8A 1SXJA 2IIPA 4DV1B 4MOWA 5LKRA 3H17A 4INPA 2PRZA 2PDAA 3JYQA 1OBOA 2FPUA 4MVJF 3U4IA 1QV9A 5A0TA 4C7JA 3GPCA 2R1TA 4NKRA 1GTG1 4L4YA 3ILYA 1YRLA 3QWAA 2DWUA 2WR8A 5D6NA 3AJDA 3MAGA 4BO6A 4JUIA 3SSMA 5TJHA 3DAFA 4MQEB 3FTQA 4JNKA 2YXLA 3GDHA 1D9ZA 1YZKA 2UDPA 3MCUA 3HH8A 4NBWA 3U4GA 2CLSA 3RS4A 3ZXIA 1ZMTA 4PC1A 2JD0A 4NIMA 3M1LA 4LGMA 2OCDA 1A95A 4EJMA 3D6HA 3AH8A 3VGPA 1AT1A 4B3XA 1RABA 1NZJA 4LRTB 4DLAA 4E88A 3T1YB 1ODKA 5C80A 5IBPA 2D6FA 2E1RA 1BYUA 3A1DA 3BWMA 3LPMA 3ROKA 3HA3A 3TLJA 3WFZA 3EMVA 3OFJA 4BX8A 4NNOA 2C99A 3QKWA 2P4SA 4I3HA 3SF0A 4WKNA 1ZONA 5L3VA 3RVOA 3IUPA 3OZAA 3R7BA 3UC5A 3V6LA 5ITZA 2PUEA 4QICA 4BBPA 1T5HX 1WXXA 2RAFA 3HVKA 5EI5A 1B6TA 2H16A 3JZIA 2FA9A 4BBJA 3DPUA 4EENA 1MG0A 4I5IA 1MT3A 5L3RA 2AFHE 3D8NA 3HUTA 5KDLA 2G0AA 2FW6A 4FYXA 4MULA 2ZVDA 3GG2A 3ZWBA 2L42A 1JLSA 1RYEA 4E2WA 5BUQA 1EM8A 3AEYA 1SKMA 1OREA 5ALEA 1X7WA 2OKGA 3NM6B 4DXAA 4Y0AA 3EVTA 5FPSA 2W2QA 2CVOA 2HB6A 3U7RA 4IP0A 2Z9DA 1NV9A 3QVSA 1J6UA 3JD4A 1XL0A 4QXPA 1F2DA 2NV6A 2C0CA 3EZ6A 3FFTA 2EBWA 3IP6A 4FNOA 5J4LA 1TQDA 1JJIA 3DLHA 4C87A 1ONPA 4O8CA 3CF4G 4EY6A 4M0UA 1FX0B 4BE9A 1SVWA 1VE3A 4QO7A 1DWQA 2ZT5A 1ZP6A 2W2VA 1WXGA 6CHYA 2HJHA 2O2GA 3L07A 4OYYA 4WESB 3OX1A 2QSJA 2WLSA 3VNAA 4YUAA 1TMYA 3HA2A 4EARA 5HWSA 5IEJA 3WA7A 4DR7B 3BT7A 1PU2A 4TSFD 1HI9A 2YL2A 2ID4A 5F35A 4YONB 4B74A 1PZHA 1R0SA 3EOZA 1H3FA 4EYQA 3FLEA 2XTNA 2WF8A 2QLFA 1H6AA 3GRCA 3IUJA 1M9NA 2K2WA 2V54A 3ANTA 3PC8A 3QQ5A 1HE8B 4ALNA 3SDBA 4DRYA 1M2GA 3CW2A 3OZTA 3U3XA 2PLNA 5JAIA 4TZ6A 2OSVA 3F2VA 3TJZA 1YR6A 4HDNB 4L6IA 3C6ZA 1P4SA 4HV4A 3DAYA 4ZYXA 1E2GA 2NYAA 5EEGA 3LCRA 4UJ3A 2PKWA 5JCXA 5AOVA 2MSEB 2H4YA 2VUHB 4HDMA 5AVKA 4J9VA 2CHFA 2FLVA 3MT0A 1QYDA 1U3DA 1YRHA 1ZJYA 4REQA 1N4AA 4DNQA 3W6UA 4FOOA 3C3DA 4FS8A 4G23A 3RIEA 4MS4B 5I7AA 1AS3A 1X70A 1IU9A 1A72A 1VLVA 2D5CA 3BTVA 5HIJA 4IX9A 1Q6ZA 1YQGA 2HK6A 3LY5A 1W1IA 2BEWB 5D7NA 4FC6A 1EFKA 2EKDA 3NO4A 1E9EA 5AJVB 3R7NA 3ZYCA 2JGEA 4BQEA 3SVTA 4DABA 2V7EA 4F71A 3FWHA 3PL5A 4M1MA 3FKQA 2ATXA 3EGCA 2G9VA 3EGVA 5FPHA 1YJ5A 2PS3A 1Y3HA 2BCGY 1D2NA 1GPAA 2HMVA 4G1VA 4BCCA 3AC0A 4O4HB 4D9CA 1N0IA 3STUA 1PNQA 5AMXA 5I8WA 5J63A 1L4LA 2DR2A 2DFKB 1RZUA 4K9RA 5KJCA 4LWZA 2RH4A 3KLBA 1I2ZA 2HF2A 1JQKA 1QXSA 4G1CA 5IAKA 4D9FA 1VIAA 4OYLA 3KSMA 2CDRA 1HNNA 3DHVA 3R9KA 1NWHA 1R6XA 1LZKA 3IO5A 2GFIA 2ZAGA 3TW4A 4C1NA 4EGSA 5LWQA 3L04A 4NJOA 4I1SA 2ZJAA 5JXHA 3GLRA 2BIFA 4DQLA 1JEQA 1MORA 4P0QB 3GFOA 3O8NA 1A82A 1QF6A 1YIOA 4NOLA 2Q3FA 3QOYA 2R00C 4PRZA 3IX7A 3VPFA 1ZCJA 3D3WA 1F3LA 4BKMA 4GDMA 4IZ6A 4CU2A 4FBMA 3V8MA 2ZIEA 3DBOB 1JR4A 3CZMA 4BV3A 4EKDA 3GLFB 4OHYA 1CJVC 1R9NA 2AN9A 3FCXA 4NMLA 3SZ3A 3TAUA 1U8UA 3OC0A 2CL5A 2I9PA 1DQYA 1N5OX 2ODPA 2XUAA 4M54A 2OA0A 1DKQA 1VGRA 4UUNA 5TQJA 4YIHA 1D0VA 3NT2A 1SOUA 4N0DA 4BE4A 4C07A 1NFQA 2PUDA 5B64A 1VSQA 3H18A 3AOGA 1KR2A 3TOZA 3G7UA 1UBMS 3DMRA 2BFWA 2IZ5A 2CLCX 4QOIA 3SFTA 2CVQA 2VH1A 3IOYA 2IOYA 3B13B 3IPCA 4N39A 4RA9A 4XCVA 2XQVA 1C7ZA 3E53A 3FFBA 5LOVA 3CWQA 3C15C 2ZKIA 5B4VA 2OM2A 1SUFA 3G5AA 2ECFA 2HRZA 3LLCA 2W8BA 3DE1X 3OLWA 4MGZR 4DT1A 4RTRA 2WKSA 4AF7A 3F1KA 3G0GA 5B57C 1K0FA 1LX6A 2G25A 1Y7IA 4XQCA 1PG5A 3C8UA 3MWYW 1M8GA 3UXYA 4RTSA 4A10A 1SM4A 2BISA 1X8JA 4OQFA 4KUEA 2D5BA 2WZQA 5AM3A 4KWCA 1NR7A 2VRCD 1O5IA 1PR0A 4Y2PA 5TARA 1EMDA 1YB2A 3PLRA 7REQB 2NUPB 1H5QA 5ECDA 3NCTA 1U4OA 1F8UA 4FZJA 5BW5A 5C5CA 1REQB 2C0PA 2IVZA 8ABPA 3BTUA 3L6UA 1UMDB 2CXOA 2I4TA 5K3FB 1N5DA 2HPZA 1U7TA 4PLFA 3KEMA 3SBEA 4LF4B 5FLEX 4HGOA 4M0KA 4AYWA 3HGQA 2WICA 1KAQA 3K0CA 5TSDA 2O14A 1NM5C 1Q0QA 2PMBA 4L8LA 5B4UA 1RIIA 1X86B 3W5AA 4FDTA 4K7JA 3DV2A 3ODPA 4FGUA 3DEYX 5I9TA 5BSGA 1K97A 4PPGA 1ZSNA 2H0QA 5K0ZA 1S6YA 3JQGB 5GV8A 4AJLA 1B73A 2MSDB 1Y3FE 2P75A 4Q7MB 5E6RA 3HXQA 4PYRA 2HWWA 3K2BA 4OX9B 1O6BA 2LPMA 1WMEA 1RAIA 2I0FA 1YQTA 1F4VA 3GNLA 3NT4A 2DSTA 1QNLA 2VAVA 2P40A 2BEVB 4PIVA 1PGPA 3AGPA 3R5HA 1AUPA 5DKFA 1PJCA 1CJKC 3I9V6 1YNOA 3W9YA 1PJRA 2A7XA 2XKJE 4TL9A 4YJFB 4YV2A 4D3SA 2J08A 3O8OA 2O23A 4UHBA 4WOKA 4CTKA 4YASA 1AV6A 8ADHA 4YRFA 1S1CA 2ZU0C 3B70A 1HQDA 3P9YA 5LP6B 2BGNA 4KX3A 1ZR2A 4NL4H 4J1TC 4XM1A 1UT6A 4WOJA 3D2LA 5AI5A 3VC2A 2MSNA 4ZJUA 4FJ2A 2CXPA 2IHUA 4ESHA 2Z4SA 1KZ4A 4XYLA 3L8CA 3LXXA 3K1AA 3UKDA 3DOEA 3MVEA 1D2MA 1U0EA 2FR8A 2PXAA 4AJHA 5A1TA 4DJ5X 2FMIA 1EM6A 2IXGA 4R2WA 1A1VA 2QXTA 3O4VA 3KOWA 2XT9A 2FCRA 4UCFA 3HM9A 2QTHA 1ZESA 4TS4A 2LUOA 3LT4A 1HXHA 4WN9A 4K9MA 3HY6A 3VUFA 5AXAA 4DDWA 1R4MB 1FDSA 5FOVA 2QMOA 2FPPB 4HQNA 4V0SA 5LU8A 3STHA 1J49A 4LHZA 1CQIB 4D8VA 5KVAA 2ONKA 2VK4A 2NVWA 4QQFA 2HUPA 2Q2NA 3HDQA 1LSOA 1J39A 3NHSA 1B2LA 1GQOA 3LLVA 1XZCA 3OPMA 4MEBA 1QOQB 3N8NA 2BFEA 4Y1GA 1SN7A 2IXBA 1K5HA 1LVUA 3L18A 2MCFA 1XMIA 2NU7A 3B3AA 1T0HB 3F3MA 4OIMA 2WUDA 3UGTA 2O8VA 1BE8A 5I51A 4N01A 2PO7A 3FXAA 1RJDA 2WHXA 1OBFO 2AFHA 2J9FB 4BNZA 5I7FA 3SC2B 5ETJA 2CLHB 2IU6A 1JLMA 3IMFA 3IVAA 4HS9A 4LW8A 5HBGA 4A0GA 1NLUA 1E2UA 2AR0A 3FNRA 5G02A 1JQ5A 1UMBA 3CGWA 1E0DA 1TJNA 1JHUA 1G7CA 4RQUA 3R5JA 4W7HA 3EZ2A 3EGXA 2IU4A 4QSHA 1XT6A 3C8DA 2BGUA 4V03A 4ND8A 4PHGA 1KK2A 4PANA 2ZR0A 4YI3A 5FJJA 1PWEA 1II8A 5HQTA 4BAZA 4L76A 2EFCB 2I3BA 4B6PA 1E3TA 3U61B 1I2MA 3NRBA 1ESNA 1T6ZA 1MIHA 1WE2A 4KBGA 1VCIA 1P2UA 1VBMA 5I4IA 4QC2A 3V8QA 3QKRB 1LPNA 2I7CA 2YVKA 4E5VA 3GRVA 1GPWB 2X7JA 5TF4A 2A0KA 3H9JA 5E4TA 3JPYA 5CX1B 1P4GA 1J0XO 3FMOB 2V58A 1GVNB 3H84A 3NASA 1FTSA 3TMKA 4IO0A 5AWFC 3LBNA 1R8QA 4A7PA 4ASUD 4R1LA 1ZKMA 4FDVA 1ORHA 3VKVA 2ECPA 2OWDA 2A1TR 1QYWA 1Z37A 4EB6A 3O9ZA 4U8GA 4DLNA 2XADA 1XKQA 2GAIA 5HM8A 3ZDDA 1NR1A 3UMCA 3GT7A 5DZSA 1MEJA 4INAA 4CEHA 1X7YA 2QUKA 4GM1A 3P71T 2EGHA 2D0PB 2O2CA 1N6LA 2GESA 2ZRHA 3E5HA 3GH3A 3ELBA 4MWZA 2ZIZA 4L78A 1LNZA 3H97A 5DULA 1IAVA 1A4XA 1F2UB 2HA0A 3IJRA 4NS1A 5HK8A 4B83A 1E58A 4BNDB 1QC5B 3LWDA 3ICWA 2C3OA 3ZHYA 1QLHA 2PLFA 3LCVB 3R0QA 3DP7A 3PR3A 4JCOA 3K9HA 4D2IA 2IYSA 5IDQA 3X1XA 4UW9A 3LRPA 3AY6A 3GCGA 1O87A 1EEXB 4A73A 2XB6A 3N3AC 1NXOA 1PR9A 3OOEA 5IUNC 5AK3A 1UXOA 3BMCB 3HL0A 4B7ZA 1VI6A 1RS0A 4DDVA 3MLEA 4ZI7F 5EJAA 2ZBRA 4EB0A 1IVYA 3FSRA 3HYSA 3KKKA 4YXWA 4BNNA 3E27A 1Z25A 4H15A 3GGPA 2EQ5A 4G5YA 4YJ2B 5F2EA 4U63A 4BHTA 2ZUEA 3KZKA 4BX3A 3P19A 5EGSA 5F5NA 4U00A 4ALKA 3EZYA 3OT1B 5E7JA 1NE7A 4MINA 4ZEXA 4WNCA 3GFPA 3NP7A 3NDIA 1FFYA 2XH8A 4N6OA 4H1WA 4MRVA 1RJFA 2HA6A 2XRYA 5CP8A 1QMPA 4ZCPA 3JAKB 4A15A 3VVBA 3KEGA 3LUCA 1M76A 1CZOA 3OCYA 4DCSA 1VJCA 3FNEA 4JDUA 2FFRA 3H1AA 4K6OA 1KJIA 3Q2OA 5I4KA 1VBFA 5BQPA 2HQRA 3G6WA 2H2AA 4JLVA 5IP5A 4LZLA 1UXJA 3B9QA 4IDNA 4OAOA 2W93A 3FFAA 4DV0B 4B71A 2I6GA 1XXHB 1K9SA 3P7MA 2OV4A 3H8WA 2FWRA 2B20A 1T6YA 4HB2A 3KFLA 4BZZA 4PFSA 1P9WA 5EIOA 2X3UA 4AXBA 1QHIA 3LYLA 2XGMA 1K98A 4D80A 1QKIA 1ADYA 2QI9F 2ADFA 1GL9B 3CVUA 4OKNA 1BW9B 5JNTA 4PTLA 3E3LA 1AGRA 3LW8A 5CDUA 1OA1A 1HT1E 1VLMA 2HSWA 4P4SB 4F4FA 2HJ9A 4I5DA 4RGYA 2W8ZA 4F8YA 3R9IA 5CLIA 5HKKA 3TM4A 1J24A 2X9QA 1X92A 3CNEA 1ETUA 3KEQA 5DBEX 1LC3A 4J0JA 3QGMA 1GZ3A 2OQRA 3EMDA 3AGQA 4M38A 2XA1A 3UUFA 3ZIUA 2SNIE 1I1QB 4PC2A 3ZY6A 2FSVA 5G3ZA 3W8EA 4BKPA 1JG6A 1YS4A 4FHFA 5B3AA 1NW5A 4D46A 3QJGA 1CNMA 4Y6QA 5BRNA 4IIVA 1CJMA 3TVYA 3VDQA 4DM3A 4BWGA 5BR1A 3L1KA 1H4TA 1Y5LA 1ONOA 1C9MA 2BDUA 1PEYA 1OLOA 2FPXA 1U2TA 2IDKA 2AJCA 1T9AA 1UZUA 1ORWA 1U8FO 2ZPAA 3BTSA 3S2IA 1P2VA 2YMPA 4Q4LA 4BMCA 3BWEA 4ENTA 2ZU6A 3FZNA 3A6DA 1K4YA 3HJCA 1MVNA 4R7ZA 5DEIA 4RKFA 3SLGA 6YASA 2FG5A 3PEWA 3DULA 3I6QA 4ISBA 4RTPA 1NIPA 1A2OA 2PMWB 4PX3A 3EZ7A 4B48A 2WJ4A 2ZJ2A 4BGIA 4KITB 4MPTA 4YRKA 4I55A 4MW9A 4ZI2A 1YUNA 3ZDBA 5LIPA 4J7CA 1TTHA 1YBFA 3VKHA 3I83A 3IOCA 4R1MA 1JIJA 1EVKA 3P0EA 2RGRA 3KVYA 5JS1A 1HDYA 5BURA 4J75A 3V1TC 4AQYB 3L5OA 1JHZA 3DBRB 2C7QA 1YR2A 1QZXA 3KU1A 1OU4A 1XE3A 1YQEA 4I4TA 1R4NA 1SC1A 2DY0A 2QYOA 2QN9A 4PX2A 2QUIA 4RLQA 5C1IA 4BFZA 5EPEA 4YQFA 5KQSA 3WSWA 2O8BA 2E6UX 2C82A 2VO1A 5KTMA 1J20A 1CBUA 1TMOA 2WIGA 2GH1A 2QY6A 1WETA 1Z5UA 3FMPB 3Q0EA 3ZNQA 1SKYB 4DB4A 4J4BA 2JFUA 4D3XA 1QFZA 2GEFA 4CIAA 4PNZA 1XZIA 5KEIA 4WZZA 2VQDA 3SZMA 1ZW1A 1FMLA 3WQQA 4BTEA 3NR2A 1FSPA 3PG5A 3LKDA 2P6PA 5CHEA 2E55A 2XQFA 3QEJA 4WCFB 3WBKA 1YSCA 2DQKA 3GEBA 3Q6NA 3ADOA 3ZZTA 4MKZA 1EP2B 4QXMA 4KXLA 4JI2B 3B9BA 1AOXA 4AUKA 2X9NA 4ABYA 4HZGA 4RIIA 5AVSA 2IYOA 4IOJA 1JMYA 4LBZA 2HV9A 1PFKA 1G41A 1GZ5A 1Q3KA 4H7FA 2XCLA 1P4RA 3KTAB 1MDFA 1XMJA 1ZM2A 1RQGA 5INTA 2BFOA 1KEPA 1PBTA 2HPVA 5AOBA 5B2ZA 2WMYA 4GLOA 4K6GA 2IS4A 4P4LA 5DNVA 3JALB 2QIOA 5CB4B 4DA6A 2O7SA 5C1DA 3J80A 3D4PA 1J23A 1PZFA 2QF7A 4JL8A 1CD5A 1YA8A 4MCIA 3E15A 4UNIA 2QM0A 3OZEA 3HL4A 4EF4A 3F6EX 3WQHA 5JRJA 3K4QA 4QEKA 4OKSA 4D79A 3T7JA 5GVSA 5HKBA 4CEJA 2FSSA 2FPIB 2G5GX 3FOWA 3OZRA 4F9GA 1QQ7A 1OX4B 1QGDA 4HTFB 1BA3A 3OP1A 3NG1A 3I53A 3OZFA 3KZCA 4MLDA 4N8DA 4OUDB 4QUKA 5EE5B 5LQSA 5AQ1A 3RQSA 5EHXA 2PV0A 1ZIYA 3IVXA 3DD1A 3WYCA 1BWSA 1JE1A 4X8HA 4AZ3A 2BI8A 2YC2C 3CH4B 1O96B 3SBOA 1JLLA 1H6BA 1ZW6A 1DIHA 4CMIB 4WY5A 1MQAA 3QVTA 1KIAA 5F9MA 1JHDA 1V5WA 2VDLB 3CNBA 3GA7A 3OPXA 3MA0A 4TVBA 521PA 4RV5A 4BGUA 2DXIA 2XODA 2BM9A 2BFDB 5AW9A 3TSWA 2WY2D 4F06A 1C9YA 1JFRA 2QL5A 2XD4A 4XWGA 2VJCA 3WZLA 3CTPA 2AIRA 3S4YA 3IURA 5FLXA 1XU4A 2D74A 2AC7A 1IM8A 2VOEA 4ED9A 1N2SA 1HG0A 3W2TA 2LIVA 3UT6A 3AILA 5DGHA 1O8CA 2VSYA 3URKA 2CFTA 2QHXA 1PBNA 1VLHA 3HKBB 4J0DA 3C98A 5ITSA 3NXKA 1KI4A 1JDPA 1STOA 3B1YA 3CWCA 1W2WB 3IV6A 3BZBA 2P9BA 1PLKA 3T12A 3HNPA 3BVPA 1T8WA 4S0XA 4MVJP 4A8TA 3PQEA 3BIFA 1AKEA 5ITVA 2YX1A 1G55A 1XPOA 4TKUB 4X90A 3KXLA 3KKEA 2I6SA 1V43A 3OT5A 3TLXA 1W25A 4KE7A 4M9SA 3QA3E 1CQXA 1KSHA 4L57A 3E1KA 4UZEA 5E9WA 5ALDA 5KC9A 3PFKA 4TXJA 5IH7A 4B40A 4ZJZA 4YY3B 1LWOA 1OFHA 4HJRA 1IN5A 3EBPA 3HU1A 3DMTC 3KYDB 3IP7A 4OK6A 4XD7A 5J2UF 3W2GA 4MSUA 3ROTA 3NGMA 1E0SA 1RZVA 4RK6A 2OPBA 4GEGA 2BD0A 4LE1A 4MUHA 4TKMA 4UFOA 4XYMA 5FLKA 4KAAA 2WYVA 4TXLA 2ECKA 2DSNA 2QM7A 2WAOA 1YB5A 1V4NA 1TC2A 2RGEA 4IJWA 4RMJA 5TX7A 3OPYB 3WDMA 3WIBA 3DDCA 5FQOA 1HL3A 2JAWA 5H81A 1SEVA 1NVTA 2PD3A 4R6WA 1ML3A 2RARA 2V3VA 3L7BA 4PC6A 1YL7A 3MBIA 1T9CA 4TT3D 5EKSA 4YRMA 3GRPA 1GZ4A 4NV0A 2QORA 3SZOA 5LDGA 2HMSA 3M2TA 1GQQA 2NUAA 5HR5A 1WQ1R 3MQ4A 3TZCA 1R50A 5LP1A 2V1UA 2PXXA 1GDDA 3C43A 3N2IA 3OU2A 4JOSA 4PBRA 5GGYA 2LW7A 1KK0A 3C3MA 4LHEA 1UKBA 1VPVA 2BM0A 5DXAA 2ECQA 2HF7A 3ESXA 5H83A 5A9TA 3TH5A 1T2AA 1M1YE 2CFSA 4A8JC 3H5TA 3MEQA 4L1KA 1OE0A 1E94E 3RR2A 4DVJA 3ZBUA 1A9SA 2A59A 4FDAA 1PVVA 4KXNA 1W4ZA 4C6SA 1Q1QA 2EGGA 1Z4KA 3D8TA 3L0OA 1EFVB 3KJHA 3F78A 4I6JA 5EN4A 1SMKA 3K0AA 5GGXA 4YRJA 2XMDA 1RHRA 5CU7A 3RF6A 1L7EA 3DZDA 5CTJA 2BBWA 1U28C 2GPJA 2WFLB 4W8OA 1N1EA 3ROGA 2WDPA 4JX9A 3K71B 4MR7B 3K70B 4BP3A 3ZD6A 3PR1A 1AVTA 3RC7A 1F9EA 4PVDA 3OQNA 2AFIE 1AZTA 1OGJA 3L0IB 1NG9A 3AV3A 4AG6A 3ETNA 2B4QA 1J1ZA 1EWVA 2KLHA 4DLRA 3GB9A 4E2FA 5JH7F 2OV6A 2G3YA 4OB6A 4NBLA 3TF5A 4LY9A 2J6CA 3THXB 4U2FA 4BJ6A 1NXQA 1RAEA 3O38A 2ACWA 3DBIA 2QYTA 3DD5A 2P4HX 4Y98A 1NNSA 1NBMD 3P2JA 1AKWA 2J0QA 3IMCA 3L0YA 5LBUA 2M6LA 2X22A 3N6RA 5E7QA 4KPEC 3QX3A 4FFDA 2E5WA 2O0MA 1RLOA 2OXFA 2NP6A 3I5YA 4U7JA 2OCBA 2QTTA 4Z4IA 4R5HA 2DFTA 2X14A 2RE8A 3VBEA 4GPBA 5K7SA 1MV8A 3AXTA 4Z3OA 2MYTA 1A8QA 2PZLA 4PV7A 5EGNA 3DM9B 1U1EA 2ATCA 2BFFB 5ESWA 2MYPA 1OWOA 3HWWA 2F64A 3P45A 1B15A 2YIJA 3M6VA 4GVXA 2G5CA 4ZT4A 1VYHA 3PGMA 3PUJA 3OTQA 2LV8A 4HFNA 4IIJB 4LTNA 3T5DA 3V34A 3ZQUA 3P0RA 2FN8A 1ODJA 2W70A 2CBZA 4DRZA 5T4BA 1H0SA 4Z9AA 1TCUA 2V96A 4QVKA 3F3YA 3N05A 3QLUC 4BO1A 1YC2A 4GOKA 3VOSA 3T1HB 1GSOA 5EJ8A 1A5SB 2QD1A 1BZYA 3TLAA 1GGJA 2IUSA 2FPKA 4TKUA 3FPBA 4H9GA 2ZDGA 4IDQA 4BB6A 2PKYX 4CMHA 2VP9A 5KJ6A 3CUSA 1U2GA 4NZ9A 2I66A 5F51A 3DKVA 4ZVVA 2XUDA 4LMBA 2YXNA 5JPIA 1YACA 2R7KA 2C4WA 2YJZA 1PJLA 3RIYA 1ZUHA 1AK9A 2CL7X 3BWYA 4NAHA 5CK4A 5K4AA 3UK2A 4C4OA 5L4NA 2DR3A 3GNTA 3BEDA 4D7AA 2FPRA 3F6PA 3CYFA 2QNIA 3UMYA 3THWA 1EVJA 4LRUA 1W6UA 1KQ3A 5NLLA 1FYVA 1V5EA 2G9QA 4AM8A 5JROA 3EY9A 3HY3A 3FYTA 3ZH2A 4CM8A 4B09A 1SD1A 5CLHA 4TSFA 3WA6A 4G5SA 1P72A 2FQXA 1N6PA 3C5EA 2YH2A 1DCKA 3W3AD 4IRXA 4L5JA 4PXYA 2COUA 1MENA 3FFWA 3QPDA 5EJ9A 4RD1A 1DO8A 1CLEA 4QU5A 4ANFA 1WF3A 1E7WA 2PX6A 4C89A 3GD5A 4ITUA 5B5SA 1TYEB 2GBCA 1DCMA 3TGLA 1K3TA 5T8KA 1JJVA 2Q3EA 1KJWA 1S8NA 4FOSA 1ZVJA 1XO1A 2NV2B 2EFGA 3WHPA 2ZRNA 4DCGA 4LEIA 2CV1A 5G41A 4I1PA 3PCRB 1NJSA 1JXQA 2P91A 3I30X 4FC7A 4A3SA 2ZIFA 5EE3A 1J21A 5DLDA 5HKAA 2C3MA 3FYUA 3PIDA 3P0IA 1VKZA 4OU5A 2B0CA 3SEZA 4Q5IA 2ES4A 4EQZA 2Q7OE 2W6CX 5C81A 3D59A 3CN7A 3TW0A 1J9GA 5H3CA 2D06A 2RG1A 4DYHA 1VE5A 3ZGLA 1CFJA 4OM7A 3BL8A 1BFUA 1Y8QA 2HXSA 3BXOA 1M66A 2OCAA 3NDPA 1YS9A 4WKGA 3ZWVA 1OXTA 1NTOA 1HDEA 1T1IA 2O1XA 4A0SA 4EHDA 3A25A 1DO2A 2YXBA 3MT8A 4G5RA 3TNLA 2FZKA 2NNWB 1IJBA 1W0KA 2OO5A 3L02A 3ZK8A 2NIPA 4OXIA 1GARA 5EJEA 5DGTA 3SF8B 1CUHA 2R6ZA 3GEIA 4OBBA 4AN4A 5EWJA 3TG2A 1Z0ZA 2Q3CA 2RGXA 3GGCA 3Q9NA 1IZ7A 4FOLA 4MHOA 4QJBA 2GM5A 5JIBA 2HL6A 1JPUA 4ZAZA 1TIPA 4LZNA 1GWNA 1LVGA 3ULKA 4BVJA 2PCJA 3RUPA 5K4GA 5IX8A 4K0KB 3S70A 4WZAB 1P9RA 3LQ2A 1OC2A 2WU0A 4R68A 4P84A 3TLMA 2QVZX 5T3UA 3TQOA 2ZETA 2AFVA 3CZ5A 3FDIA 4TZTA 3QY9A 1ODIA 4OSEA 2B2XA 1KO7A 1H2HA 1JTVA 3HWX1 5LZ4A 2VUTA 1AIPA 3LMKA 1KMCA 2FG7C 3AVQA 5CJJA 3OIVA 1CR4A 4OHUA 3UJDA 2ZBQA 3KP1A 2F8LA 4KO3S 4MW7A 1TZCA 1GN8A 4UM8B 3O83A 4X85A 4NF2A 2Q2VA 3G0DA 4PM4A 3VZRA 5TMEA 3LK6A 2YOHA 3BGOS 5G1PA 4GSYA 2WG1A 3DFMA 2CFCA 4P08A 4PPFA 3BXFA 3L0ZA 2Z57A 2RHDA 4XQGA 3G2NA 3ZYZA 5B3LA 3E7XA 1YB6A 2XR1A 3ONEA 4XGQA 2FUEA 4AY4A 1YB7A 4HL6A 4NR0A 4AMUA 1H94A 2ZR8A 4AS2A 3DDHA 1C7IA 4AZSA 4I50A 3A9TA 4I99A 3ANLA 3E0XA 1V4BA 1Y3DE 2SICE 4XIGS 5B6IA 1A4IA 1NYTA 3L4SO 4HVAA 4X7RA 3T9CA 3QU9A 4AJ2A 1NVDA 1I4TD 4GKAA 4RLFA 2PJDA 3I9KA 4KGVA 5FHQA 1HTBA 4E13A 4UU8A 3DLPX 4IS2A 4N3CA 3LDUA 4R0MA 3PL1A 4C2TA 1Q15A 1EE9A 1BHSA 4NJEB 5KNDD 5ES4B 3UJNA 2Y99A 3JARA 4GMDA 3N86A 4IQGA 3KPJA 1PJSA 1NG1A 2I71A 3GY0A 4OGGA 3VHRA 1Z7EA 4E12A 5FWYA 5DV9A 2F1JA 4JT2A 1LB1B 1A2KC 2WSIA 4JI1B 2JGKA 1ZK3A 2PM8A 1C8LA 1Q6YA 3BGDA 1NUHA 2WQ7A 1R5NA 2CN1A 2PZMA 5AK6A 3TTVA 2PUFA 3GMDA 2VYVD 1CUCA 4CV3A 5M5BA 1THMA 1W1WA 4ALIA 1M1YA 4CDMA 3ADCA 3HSSA 4C0AC 4G41A 4CFZA 4DEVA 4UZSA 4LGCA 3NWBA 3OLXA 1B8PA 3QG5A 2I3AA 3A28A 4ARZA 1UZMA 4JV5B 3NHRA 2Z4TA 5LC1A 1SU7A 2RHLA 5JCJD 2JK0A 4OQEA 4R2LA 1TRHA 3I12A 3OZDA 4OGLA 4QBFA 5JWRA 4NE7A 1TA0A 2A3NA 2B8TA 2C88A 2EF0A 2QLBA 5IMSA 1SCDA 2QX8A 4YO7A 2WFMA 4QARA 5DP2A 2QUHA 4RADA 1R0BA 1NNEA 2ADMA 3ML1A 4URVR 3QKSA 4WLEA 3QPWA 3TSZA 2PLWA 3LQQA 4PBSA 3S44A 4DJFC 3LHKA 1GDHA 1T24A 1ZHHA 3EBLA 4JI8B 1K8YB 1VCOA 4MLPA 1PNVA 2AFIA 2X1LA 2EIHA 3JQBA 2JVJA 3PE3A 3EXFB 4TV9A 4DARA 5EJ5A 4O2AB 2YFQA 3S81A 1UBNA 3TRHA 1R5BA 3SJUA 1KJQA 3AUYA 2ENWA 4B9EA 4YCDA 2GRJA 2VAPA 1QF9A 1I2BA 3TLEA 3H1BA 3P4YA 2BKVA 3PNBA 3FR8A 1OD6A 4MQUA 4QRIA 4P22A 5KWIA 1VRWA 4TQAA 5FR1A 1EXVA 3LXMA 1EIWA 3C5VA 4KQHA 5C32A 4YGXB 4OIFA 4BEWA 2WFZA 3UV7A 3U39A 3UXHA 3MJTA 2PGAA 4FN4A 1CLUA 2JHFA 1XRMA 2EEZA 3N58A 3RWMB 2IZOA 3DF7A 5AI0A 3TIVA 4EB3A 2JKYA 5DMHA 3ZR4B 2AJLI 3OIFA 3AF4A 2OBMA 2HIMA 5KKCA 3G5TA 3C3AA 1E9RA 1SOWA 2A0WA 4OQMA 3SIPA 4F6RA 3JR7A 3HBLA 2FE1A 4M1QA 4RKWA 3EG9A 5DYTA 5KVQA 1G8JA 2NT4A 2O8NA 5E1DA 1C7FA 1WVGA 4HG2A 4RDHA 2GI4A 4MB6A 3P9ZA 3ZHTA 2QD2A 3ZV7A 1L8AA 5ICCA 3ZKWA 2NAPA 4CKCB 4IDDA 3URMA 3EMBA 5F7OA 2LNDA 4RD0A 4QD3A 5AIAA 4IO1A 5FOWA 4MUJA 3M6UA 4Q4AB 4B79A 3H5RA 3P9PA 1M34E 1AHNA 3A9UA 4EK9A 3C6YA 1IPFA 3IAXA 1ZXLA 3ABQB 3IPRA 1DDIA 1SVKA 1GTRA 2VPPA 2WD8A 2G9NA 3UFBA 1ZQ9A 3RREA 5IUJC 2VQEB 4GZLA 4QIHA 1TZKA 1H4SA 3THOA 1RACA 2FP4B 3EY4A 3WNQA 1H4QA 2V3CC 5ALWA 4MEJA 5BMVB 2PKQP 5ALZA 1AZLA 4X7PA 3A9VA 3GEEA 1T8RA 5DYWA 2JBHA 3BZWA 2GPWA 1IJKA 3EXHB 2OO7A 2X8AA 4GWKA 2C5BA 5L7YA 2RHCA 1KOJA 4QDOA 2Y1FA 3MIZA 3I92A 1IHDA 3N8IA 3DMNA 1M5TA 4BLSA 2O1WA 2PNFA 5DT9A 3K2IA 4AY5A 3W5UA 2VK1A 2UXDB 1MFPA 3Q2KA 4IMIB 4PC7A 4YMUA 5ARDA 2GCNA 3E84A 1Z5PA 1M1NB 1GNLA 1VE6A 3K05A 2A1TS 3TD2A 3ZJ4A 5DNYB 5L3ZA 1W34A 1E1CA 2HU5A 4E1AA 2RKOA 2CMDA 1GT6A 4R9NA 3JU3A 1W9HA 4XPIB 5HZMA 1OXBB 3IHWA 2OZLB 3L0SA 2YFYA 1U0SY 3A2KA 3BJZA 5CH3A 3A06A 1NULA 4C7BA 4I1OA 4A26A 2PX3A 2V7UA 3KTFA 5EMKA 4AXXA 5FOTA 3AP1A 3QX9A 3I9V1 1ZMXA 1YQWA 2RG7A 1Z2OX 4MR8B 4R1SA 1T3HA 1P7ZA 3DA8A 4ZWNA 3TNDA 1RM5A 3IMGA 1XTJA 1OFGA 3KVNA 1CK4A 3M9WA 3KWMA 5FNVF 3V55A 5H4GA 1BQEA 1O5OA 1R8XA 3JQFA 4OP3A 5MGBA 3AI2A 4LPKA 1V3QE 1XCJA 4UVDA 1JFLA 2PKEA 4GMGA 3IT0A 1O0CA 4CU5A 3DP9A 2R3SA 1IXKA 1M1UA 4LXXA 4R1NA 1NQ5A 1G8HA 4TLLB 1DFIA 3CO5A 3V2HA 3BPSA 2C7RA 4F4IA 1EZZA 1YOVA 4MK4A 5H5JA 1FTWA 3GIDA 2TRSB 4BN4A 4L0CA 2PBFA 5G4KA 3A1CA 3FGZA 2X0IA 4UARA 2IXAA 4EUSA 3RGWS 1Q0RA 1HRKA 3LVQE 3OTHA 3PRJA 4KK3A 4R8SA 2ZAIA 5BQ5A 5HDQA 1E3WA 2WUFA 5HF8A 5FTWA 3ZQ4A 4TMZA 1R8YA 3N39C 2V9ZA 1FY2A 3LXRA 3RYCA 4NBSA 2IGBA 4BLWA 1CZKA 4ZGBA 1KHTA 3ICCA 4RA6A 3SDZA 4WJLA 3BWVA 3KOXA 1Q1ZA 1UXGA 3PD7A 3QF4B 4KVZA 2YJGA 4NNJA 1L4GA 2I7XA 4FNMA 4L0DA 5EIXA 2D1SA 3WP0A 3L8MA 5HGXA 2CVZA 1G38A 3H2ZA 2G83A 5JZSA 3U1VA 3ZNPA 4BWFB 5IFLA 3NHKA 1RHJA 4IGFA 5J4VA 3LSTA 3FBTA 1ISHA 3A4VA 4WUTA 3OQVA 1GNQA 3KJFA 2XE8A 4KPUB 4MUNA 4QDZA 5FBQB 4BCDA 2N9UA 4UEQA 4YQZA 5FTKA 5KYWA 2GVZC 4N18A 1DG1G 5IJXA 1Q7TA 3C3JA 1MDBA 1CJSA 221PA 2EJUA 2HM7A 1CRZA 2BBTA 2QEQA 2VHXA 3BSFA 3COVA 3MLAA 4GO1A 5G0TA 4EGJA 2C9MA 1CHDA 1XROA 2COKA 3QY0A 1N2CE 4EHNA 1UOPA 1SKUA 2PL1A 4CLEA 3YASA 2G08A 1TTQB 1E89A 3BAFA 3JD1A 3NYRA 5F12A 1E4YA 2IYVA 3VH4A 2CXUA 2DPGA 3UW3A 4GRDA 13PKA 2YYAA 4QASA 1RYMA 3OQIA 1WHSA 1PL6A 5H16A 3W8FA 2EXXA 2CVPA 2EHDA 2Q4OA 4K9PA 5TGTA 5K0CA 1XVVA 2IYQA 3X2SA 2QL6A 2PMDA 4B4DA 1OYWA 1PK7A 3NHWA 2AG5A 4MQ6A 1QFXA 1O4WA 1E1YA 3DNMA 4MQFA 5LD2C 1UC4B 3NFRA 4PY2A 1M3SA 1YT5A 2HGZA 3LUAA 4RK5A 1DKPA 5JVDB 5AI9A 2BH9A 2JBWA 2GK7A 3OPYI 3KSAC 4MS3B 2BP7B 1ND5A 2ILVA 3IR5A 4P4TA 5DNDA 1KQGA 1H69A 2UYOA 5CA1F 1JT9A 2O2EA 16PKA 2F3TA 5REQB 5HIMA 5CLQA 1XEWX 3RYFB 1ZO8A 4RO0A 2UVPB 1LPAB 3GPIA 2J9YB 5F5XA 1P4HA 5ICEA 2EX4A 3MMZA 3V7UA 1SRQA 3PUHA 4K86A 4RXMA 3WK9A 5KIAA 2V5VA 5JNVA 1ZD8A 4IH4A 3HZOA 5ALYA 4TTSA 4XRRA 1NJ8A 3PUYA 1HR0B 3UOWA 3STYA 2PEYA 3QP9A 2X0KA 3H2KA 3ZLUA 4MRMA 1I5RA 2UU9B 3UH0A 1SCJA 1D3AA 2O8EB 2AJTA 2R6CA 2YWRA 5H7XA 2YHSA 1RVV1 4GD3Q 3BIJA 4LRSB 3HVUA 2BFNA 3C41J 4DTIA 1QRAA 4PGAA 2G9ZA 5AYVA 2CDCA 3SE0A 5D51S 4DEYA 1MHTA 5LXTA 5IC4A 2H48A 2UZ0A 3CEMA 3N2NA 3T0IA 1AB5A 2PIDA 4B3IA 4DNFA