3V34A

Crystal structure of mcpip1 conserved domain with magnesium ion in the catalytic center
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
157
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of MCPIP1 N-terminal conserved domain reveals a PIN-like RNase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ribonuclease ZC3H12A
total genus 48
structure length 157
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v34A00
4G24A 4G25A 4G23A 3V34A 3V32A 3V33A 4G26A 5H9WA 5DIZA 5FT9A 5H9VA
chains in the Genus database with same CATH superfamily
2H57A 2WUEA 3OJ0A 1VJRA 4OF4A 4Y7CA 4AC9A 1B8NA 2G80A 2FG6C 3P2EA 4QAQA 2RI6A 4B6PA 2VLBA 4RTLA 4HPXB 2VDNB 5M5BA 1ZM9A 4KDCA 4F1KA 3IT1A 4XSHA 4PRYA 2NUTA 1I6WA 4N0DA 4JX8A 4M8LA 3SLGA 2IHBA 2RHDA 2OCIA 3HNPA 4G8BA 1PZEA 5K8CA 3IR7A 2BZGA 1G5TA 3I28A 3G13A 4AT1A 4MV9A 3M6XA 4HQ0A 3MUEA 3UKDA 5HA5A 4Y9DA 5DHFA 1SKYE 3C8UA 1FTNA 1SR8A 1NVDA 3KR9A 3DPUA 3U0BA 4UD2A 4M9QA 4Z0PA 1CBUA 4A0GA 1AQYA 2CXXA 4JYCA 3IT0A 4IHJB 4WLOA 4HFMA 3B6IA 5CPBA 5DMXA 4FJ0A 1JRLA 3ZY3A 5C5CA 1KRWA 1SA0B 3QU5A 3IPXA 1ZUD1 1P2VA 2C7BA 2IEAA 1AXGA 2I1QA 4V2IA 1BGVA 5BN3B 1SBNE 2WP0A 3GLHE 3GLRA 3V2HA 1QPZA 2Y1GA 1Y81A 1FDVA 3TR0A 1DV1A 3NO4A 5G0TA 2XMSA 4M4SA 5C32A 4DRXA 3A6JA 3FAZA 3WK6A 1E2JA 1UFKA 3ZX4A 2NIPA 3L0OA 3IBSA 1MRZA 3E22B 1Q7BA 3DSRA 4CKCA 5LB2A 3I52A 4E5NA 5A9RA 1RHJA 3DMHA 1KVRA 1IHXA 1AZLA 2HB6A 4ZPJA 1K88A 4ER3A 3OTWA 2YRXA 4CZ2A 4UDYX 2PUJA 4OGWA 1LWNA 2GEJA 2G4LA 5AI0A 1J06A 3EZNA 1PRYA 5GZ3A 2PGNA 4QULA 4F2HA 3OU6A 1WXIA 3PNQA 1U0JA 2FFQA 4CNQA 2O0LA 3OIFA 3SJ7A 2FKAA 4R1PA 1LTHR 4BGEA 3ISTA 2ZRNA 4C0JA 2IW3A 5ADUS 4OHVA 2WSSA 1PR2A 4RQUA 1B26A 4EX7A 2E37A 5E8JA 1JR2A 3NX4A 5EUBA 2W2PA 4WOKA 2ILTA 1BHSA 3EIUA 2PZ8A 4JP3A 4CCYA 5BRAA 1KEEB 2RK6A 4JFRA 3SC6A 4KEAA 3K9QO 3DV0A 4JGGA 5K3CA 1NYTA 2N9UA 1DIHA 1SB8A 4RD4A 1UZUA 4DR2B 3OQJA 4RGYA 2HM7A 4XWKA 4KKVA 3U1TA 4WI1A 4Z0NA 3ENKA 1QU2A 2CE2X 2YHIB 2WG1A 1X9GA 1E94E 4FTWA 1EMDA 2O52A 3RDPA 4B4OA 1GZ3A 2W8BA 1WIWA 4L72A 4NTZA 1MJ5A 1TTQB 2WE7A 1W8IA 2HPHA 4Q3KA 4DJFC 5K3DA 2EZ4A 2HXSA 4ND6A 3AC0A 4QEZA 3ZI0A 3VMMA 1T9DA 4KQMA 3L93A 2I3AA 3PC8C 1RABA 1J8MF 1W2HA 2HSWA 4X3CA 1YR6A 4IHAA 4Q9LA 5EEGA 1N2CE 1RBZA 2DCUA 1VG1A 2XNDA 3EFOB 2B36A 2VHUA 3E2IA 2ID7A 4WZAA 4JXKA 3OIYA 2HCFA 3TIXB 4LVNA 1W88A 1T2UA 3CVXA 4BL5A 3ZDCA 3GWZA 3N07A 5DJ5A 4JVLA 4YDQA 5FEMA 4DMGA 3KZKA 4MJ3A 4AMGA 3MWDA 3OIUA 2OEPA 3AI7A 4TMXA 1VMAA 2OYRA 3ZJ5A 5JS7A 1SVNA 3NBQA 4C4XA 5IAEA 2J85A 1YC2A 2IV2X 1G8PA 4BO8A 3E9YA 1ID8A 5ITVA 1L7MA 1FFDA 2XTMA 1YUBA 3G0DA 5AIBA 2QLJA 4CMCA 1G8KA 4RQBA 2FR8C 1VOTA 1X7YB 1LBHA 3CZCA 4PZ0A 3EWNA 2BL4A 2OD7A 4RZSA 2VHWA 5E4JA 3RYCB 1CJVC 2QMQA 4IIDA 4XH9B 3C7KA 1O08A 1KFEB 2W2XA 4J1QA 1V35A 1M0SA 4F72A 3WGJA 3RRFA 3GJ7A 4WBNB 5LMUB 3SHTA 2G83A 3AFHA 3BB1A 4JU9A 1AMNA 1Z7EA 1N2XA 3KCQA 2JIBA 1JQDA 3LUDA 1DC4A 2IITA 5BT8A 3DLTA 1GUYA 4OQDA 4FCTA 1U3CA 3IE1A 3M8KA 2AZ4A 3IQZA 1CR6A 1KIMA 4YRBA 2O8DB 3ZU2A 1NZFA 4OM7A 3K70B 2XSZA 3ECSA 1E0KA 1M6YA 5G1PA 4P92A 4JI4B 4FMCF 1Z39A 4OXKA 2DETA 4WNYA 1WAMA 2J7KA 4ATNA 4F7WA 1SKBA 5H9WA 3IVAA 4M87A 1NXSA 1VJ0A 4HZGA 1AHIA 1CEQA 1Z4QA 4JXJA 1XTBA 1DBPA 4D9NA 5LIPA 1NI4B 4PIMA 1DELA 1G18A 2A0XA 2AWNA 3IQXA 4YJFA 4CHTA 5HQTA 3EVCA 4IXNA 5C1DA 4AG3A 1XD2B 3MJEA 1S8OA 5CVDA 9ATCA 1LC3A 1Y9AA 4K26A 3CEJA 4GPZA 4MVJI 3RPEA 4FHDA 3ZZ0A 4AULA 3C97A 1US8A 1O4VA 4PHFA 3IVMA 4IJUA 2D5BA 3NJRA 1PEYA 1N9ZA 3DOCA 3NJ8A 5AJXA 4KCGA 3A6GA 3FTFA 3ONVA 5E6RA 4OU5A 3VDQA 1FNBA 1AHPA 4TZ0A 2I2DA 1QTNA 4P35A 1R4MA 1A5TA 1PCXA 3L6CA 1Z5UA 4HXEB 3SYTA 3S2IA 3B6EA 2VTBA 4NBUA 2FK8A 3TIGA 2VBCA 1TAHA 5CUQA 2GCGA 2XGOA 5A2QA 2P5TB 4J0GA 5L3SA 5AXAA 4PYLA 5FPYA 3ZH2A 3V33A 5A6SA 4DIBA 1P17A 2O3TA 1B6RA 4Q4HB 2EQAA 2F90A 3QF4A 4IMPA 4R9RA 2XYPA 4RCVA 3UUGA 4Z4HA 3EPJA 4KQCA 4EJSB 2OA0A 4OI0A 5KTSA 4INOA 3K2EA 1NJ5A 4Y2UA 5IANA 2D4AA 2IHUA 2X86A 4WUVA 4J94A 1DKPA 3ORRA 1R50A 1EG2A 1WUIS 3O5AA 1SZPA 3OX2A 4YAWA 3SYNA 5ITWA 1IULA 2DWCA 1Q6ZA 3EZGA 4RPLA 1N3IA 3W90A 2PYIA 3AT1A 3ZHVA 5JCZA 3IKTA 2AH5A 1XRNA 2XXAA 4CLEA 3KVRA 5CA1F 2BGRA 5D1NA 2NPIA 4XOUA 3T7EA 4H7KA 4CYMA 3H1GA 1QR2A 2BMFA 4HS4A 4Y3UA 3DMGA 5FEUA 2I0FA 5DXJA 1OZHA 2QX7A 4DOMA 1K7YA 1CQIB 2BEUB 1ZOIA 2GM9A 1PR9A 3LQKA 3D02A 4XM2A 1UMCA 1O97C 1YBFA 2WSYB 3IBYA 3K9GA 3HI4A 2JLSA 2YW2A 1EA7A 3C3XA 3HFJA 4V2UA 3ZWKA 4AZSA 2XKJE 5A9SA 4AO7A 4L78A 1JEQB 5JWHA 2VPIA 3GGSA 5JNLA 1NF3A 2G63A 3VBCA 1ZUHA 5B1EA 1ADJA 2QN8A 2O3UA 2XB4A 4FMDF 2HK8A 1RM0A 2ZTMA 1EUYA 2MSLA 4URXR 4TTTS 1JTVA 1DRVA 1H1LA 3WE7A 3K9WA 1U8EA 3ZEIA 1HRKA 3PJEA 2HK6A 4OHRA 4ZV7A 1ECBA 3WBBA 3UK2A 1H4QA 1IE3A 2PX6A 2QWXA 4KPUA 4RADA 3QWFA 4UZSA 1C14A 1P5FA 4RPKA 4B87A 4RF3A 2X4IA 1FFSA 2PFGA 3CTPA 2XDWA 4B2LA 2XUZA 2V4ZA 3LKBA 2D2EA 3GFFA 4I2NA 3VXKA 1ONPA 2R6HA 4YCMA 2P65A 5DM2A 1M6VA 4KRXA 1MEEA 3SVLA 2I80A 1FSFA 2ZUBA 3CPSA 4M8SA 4EUFA 1SKAA 3OZTA 1G21E 4US1R 2ZI4A 2BGIA 3HR7A 4JKOA 3ESRA 4DADA 4BLWA 4RZ3A 5EQJB 3T3MB 4GKJB 1CTQA 1YR7A 3WO0A 2HRRA 3ETDA 4RJLA 2ORVA 3BZWA 3NYIA 1CQIA 2BEUA 1NBAA 4FFDA 1H3NA 1ZMTA 3FUXA 3O2QB 1FS4A 4TVOA 5F52A 2WWRA 1L7RA 4IUYA 3FZEA 2NSHA 3I2JA 3COVA 4LRWA 5ALUA 1ZU5A 2AFHB 5ELMA 1T4DA 1Y6QA 1J56A 3KEFA 4QASA 3D6UA 3JAKA 3B52X 5BSWA 1UINA 4FOPA 2BFDB 2HNKA 3FSEA 1EWYA 4IMIB 4JR0A 4M76B 1NBHA 3WNBA 3FFTA 5KMGB 1MB2A 1RT9A 4D96A 4BYMA 5CW1A 2A6PA 3A2LA 1VIMA 4TS1A 4DDMA 5HOEA 1DIOB 4D9IA 2ZAIA 4BC0A 4MWDA 1OV6A 4S2EA 4HLQB 4EENA 2J6IA 3PHJA 3MYRA 4RJJA 3G9UA 1XVAA 4PZZA 5K7SA 5DNWA 1V2HE 4G4SO 2EDCA 3AM5A 4DEYA 3GHYA 4H7HA 4DBZA 1W48A 2AOUB 2OGWA 2Q2OA 1WMFA 2J4CA 1GRVA 4CT0A 1LNQA 5IT9A 3KB6A 3W6PA 5GADl 2RB4A 1SQGA 1DG1G 4WD3A 1UBFA 3IAUA 1I36A 3WL6A 4BLPA 5CU7A 4FOTA 1NXPA 1A88A 2FCAA 3E3OA 4OG2A 4WZAB 5ECGC 2REBA 1OW3B 2XAAA 4YRFA 5BOSA 3UMVA 1XIVA 4YY3B 3N8GA 1I7QB 1DQSA 2G9UA 5K1ZA 4FEGA 2AE1A 3LT2A 5I7EA 1CQZA 1WETA 3HJFA 3TGWA 4FS3A 1PYDA 3FWHA 4JAVC 4FE3A 4LQLA 2XUIA 3WGUA 2Y1OA 3R3XA 1VA5A 5FPPA 4ZK6A 3IX7A 5F7OA 2YXEA 5ER6A 2QTBA 4O4IA 4GYJA 5JRDS 4BB6A 2EEPA 2XMRA 4LOJA 3G23A 4C3ZA 4EKDA 4TWZA 5BMOA 2R8YA 4HZUA 4XTCS 2CL6X 1JE1A 2QTFA 2YWRA 4C9BA 1ZA2A 4H18A 1SXHA 1KU0A 1AN9A 3CLTC 1TB4A 3DTVD 2PGIA 3PA8A 5ALTA 3WB9A 2QRVB 1THZA 3V55A 5JOQA 3AG5A 3RHSA 1P29A 4Q39A 4WNAB 3QXCA 1LX7A 4R9NA 5KTNA 2VYQA 3NC1C 3VPXA 3DDNA 2QT1A 1LDYA 2V97A 4M7OA 1U2SA 1L8OA 2ZWIA 5SV2A 1RIIA 4B76A 3OPXA 1TXGA 1NJ1A 2A86A 2C4NA 1VSUA 3RODA 3V8VA 4CCAA 1E5XA 2ISSD 3I3OA 1WNFA 5HF6A 1JIXA 1ZGGA 4L73A 2Z08A 4RSRA 1CIJA 1UXHA 3CKKA 1PT9A 4KO3S 1QG0A 1AB5A 5J2UA 1RFLA 5HQ3B 2HLDD 4EJ0A 4FE7A 3QBJA 3BMCA 3O91A 4MCIA 2ZKLA 1KFBB 3N6VA 4XVQA 2BSQA 3T5BA 4CDNA 3DMDA 4HVLA 2X5OA 3R2JA 1XQ1A 4W5TA 2H4HA 3GLFB 1KO7A 4UCQA 4BZQA 3DMPA 3ZHZA 1AUOA 1YRAA 1P8AA 2MYPA 3TXXA 4D9CA 4LF9B 2WWVD 2FAXA 5BNTA 1XNJA 3OFSA 1R3DA 4TTJA 3AVYA 1HT3A 4RQTA 1S01A 1MD9A 4NIMA 5FO0A 5D3QA 3G68A 1A9ZA 3E3LA 5FJJA 3TQSA 4FCWA 4DWOA 4CF7A 2WMNB 4UHKA 3L01A 4S1OA 4EHDA 3GRKA 4KJZA 1DCTA 5MHTA 1CUJA 3WOVA 4DG9A 1C0PA 5JPCA 1UK6A 4QRIA 1OLUB 1S4QA 4FD3A 5TMEA 1UDCA 3NANA 2CJWA 5K4AA 1OH8A 3DZ8A 1SUFA 5HTOA 3I2FA 2BDTA 1OA1A 1ZLYA 2N75A 3DNMA 1AZSC 4PXSA 1WD7A 3KOUA 3WL7A 1WZIA 4BXOA 4FYHA 2QX4A 2CDCA 1YB7A 2X58A 3VYUB 4GNKA 4C5BA 1NQUA 2WLSA 2NWQA 3WIVA 2ZIEA 4E2ZA 2WUGA 5E2IA 1LQTA 3GAFA 2X1MA 1GVNB 3GIWA 4DCTA 3BL5A 2EWMA 3ZV4A 4JY7A 4CMJA 3AEUA 4IDAA 4HEJA 3TD9A 2AKYA 2GN8A 3AFNA 5P8WA 3VX3A 3WYAA 5LZ2A 3EPHA 5CAEB 2J0EA 3LA6A 3E9RA 3EXHC 5LP1A 2MWMA 2O8FA 1ZN9A 1SO8A 1V3UA 2EG9A 2P6MA 3V9AA 4EUNA 4DRYA 2MSKA 1UJ5A 2I1LA 3ZW7A 2YN4A 1XZMA 2H3HA 5FD8A 1AUXA 5TPZA 1OPRA 2E3JA 1V1RB 3E3NA 1T0UA 2G0NA 5EGSA 1A9TA 1UC4B 1A82A 3BHNA 1Z7YA 2VRWA 3D54D 3OJEA 3LT4A 1A9OA 4K46A 5DLYA 5GONF 4FGKA 4BWGA 5DCWA 6ADHA 2VLIA 2PSFA 4GI3A 5CBKA 1Q15A 4DPKA 4L5IA 4FB4A 3DB1A 3RV3A 2XF2A 4C4RA 4WNIA 2OBLA 2G88A 3C5HA 4DSAA 3THXA 2GF0A 2Z3VA 1UMKA 3KVOA 2VNSA 2JJYA 4PSVA 4WTOA 5HKOA 1Q0RA 5KREA 1QQBA 2BTOA 5G0VA 3SC2B 5JCJA 1T3HA 1FX0B 1MH9A 3T1NA 3GDHA 1CD5A 3LU1A 3K53A 4L57A 4DA4A 1NA5A 1O4WA 2PSHA 2OUKA 2YYYA 3I5AA 1J4AA 5EP1A 4KQIA 4L15A 3I4CA 4BZXA 1GQFA 4ZOLA 2I34A 3L18A 1CQPA 4MHSA 1HYBA 2GN1A 3V7WA 4XE5A 1T9BA 1P77A 2FFRA 3L6EA 4QBIA 3TLMA 1C80A 5BSRA 4U3JB 4DXAA 3KG2A 2A4KA 4IDEA 4W7SA 4MVJF 4NNPA 5COBA 1EX6A 2EKZA 4LXUA 1VIYA 4TT8A 4XFKA 4BTLA 3M6FA 2B99A 4D9GA 2UUBB 2B4KA 4ZO9A 4ZANA 4CKWA 4KR9A 1G7SA 1VRCA 1SOUA 3O93A 1PX2A 2GK6A 4QQFA 1Y3FE 2QN9A 1YGYA 2BOVA 3B6JA 2KI5A 1OTXA 4OI2A 4OQYA 4RY0A 5AJVB 1C9JA 3VR4H 1EFRD 4TZKA 2CE7A 2H7CA 3L4BC 2OV8A 2HRQA 2I8CA 3OM8A 2QUKA 3BSYA 1WXQA 3R7SA 1SUIA 3QXJA 1E92A 3EEOA 5FOSA 3AERB 2X0DA 4CNBA 1YHYA 2XECA 4I1RA 3RS5A 3WMEA 1XUOA 2VP5A 2YXDA 3ESYA 1HNZB 4GECA 5ALKA 4J4HA 4ZGBA 1YOVA 3PWZA 2WB2A 2OAEA 4KR0A 4RESA 3OKAA 3RNOA 5HW0A 4Y1RA 4MJXA 2CLCX 5AHXA 3SYKA 4B84A 2PE5A 4PBRA 4Y2VA 3I6MA 1TCBA 4A92A 1UDWA 1ACMA 1DAIA 2BDEA 2GCIA 4MRPA 3S40A 4B3DA 4RKYA 5KKAA 4WN9B 2FMHA 2QMUA 3L02A 3R5TA 4WY2A 4Q1AA 3WLFA 4YLYA 4XQEA 4Z51A 1O58A 1SK9A 4G0WA 2OGSA 1WVGA 3DHWC 3FR7A 1OWMA 3OPYB 2FP4B 1SXIA 1KXJA 3QVVA 4RNDB 7MDHA 1M9NA 4KDRA 4FMBB 4MIEA 1W6RA 3HVUA 5KVVA 2QQ0A 3X2EA 2PGJA 3F6SA 4R9SA 4UVDA 5F51A 4JZKA 6AT1A 2R1VA 2H0RA 2N3ZA 3QV1A 4DUPA 4JI5B 3D3KA 4MRMA 4UEOA 3ZDRA 4FFMA 4RHTA 4LEIA 1KQFA 5J9FA 3I45A 2OCLA 2OC9A 2K6GA 3CX8A 1VGVA 2VZ0A 3CLKA 3MMXA 1W88B 5DTMA 1TT7A 4MULA 1R15A 2JGMA 1QHSA 2IT1A 1MPTA 2PUAA 4QWWA 3HKDB 1DMSA 2C31A 4M8NE 3WA7A 5JZBA 3D1VA 3GUVA 4W1QA 2HW8A 4LZAA 2VN8A 3OAAD 3BX1A 3KSRA 3HXQA 3TVYA 4NAVA 4PXAA 3DCJA 3GN1A 2NV2B 1GUZA 2VTDA 5FFMA 4B3HA 3N2KA 2FZ4A 3NHUA 1ZLXA 4GZ3A 4QAJA 5EE0A 4J49A 1QB7A 4DA0A 2AD5A 5IDWA 4XB6B 3BGSA 2OG1A 3C8DA 3L4BA 4QARA 3WP1B 3CMMA 1XTSA 3PYXA 3I83A 3F5DA 1H4SA 4X71A 2UYYA 1L5HA 1U2QA 3INYA 4EI7A 3LYLA 4ZIRA 1X0XA 3I9V6 2C3UA 1D4FA 2C78A 1RQ2A 2HF9A 4D6YA 4KAAA 1WPXA 1Z5GA 3NNNA 2PLAA 4MA5A 2FP4A 3S5JA 3PUKA 3DEHA 4JLAA 5CYOA 3GT0A 2J5BA 4HCJA 2XEDA 4OL0A 1P2BA 1Q22A 5EPUA 1BA2A 1EHCA 1X7GA 1ZUNA 3AR7A 5B7GA 5L51A 1XCLA 1W36C 2VXCA 1RHRA 4P98A 4U7HA 4S1PA 1NKVA 1UDAA 5FJIA 3V6LA 2ZSJA 5I3CA 1LC0A 3R3ZA 1B6SA 2DTXA 1Q7CA 2VXBA 3KOMA 4CM8A 3AYZB 2DSTA 1JHXA 4LSMA 3REQB 1K3TA 5JCOA 3A6KA 1FNDA 1MAWA 5DXFA 3WL4A 3HYTA 4DKJA 1W36D 2Q21A 2BJVA 1GTVA 3IOCA 4RAQA 5C34B 3LS2A 5DTQA 5JAMA 3DF7A 4AG5A 4G3XA 3E03A 4MEAA 2E9SA 2WOJA 1SC1A 2UV8A 4OX9Y 2DVMA 2P3OA 3DC2A 1XL1A 4RPJA 3DBRA 3OPNA 3G2KA 3PRKE 2PFKA 3ZZTA 4B8ZA 2Q6KA 2ID4A 1HQYE 1XMIA 2OXCA 2QI9F 4BATA 3DXFA 4G41A 4NVRA 3M3DA 1UEXC 3RRJA 3WR5A 1V16A 4Y0VA 5A0VA 3OOEA 5JH7B 3G3EA 4D8WA 2DHDA 1SULA 3P9QA 1DE0A 2NZ8A 2Q5JA 4C7KA 4REMA 4D8XA 3FLBA 3FPBA 4LJ4A 1KQNA 3H1BA 1E60A 1RXYA 3B6MA 1Y8QB 4IYJA 1GTL1 3E61A 2YV4A 2Y1DA 3F46A 4PO8A 4UOQA 4EPXA 5IBCA 3HKCA 2RHBA 3ZNNA 5EIWA 5K03A 2V3CC 2M2IA 2NLOA 3TLGA 2Q2WA 3NV7A 1C3EA 1F12A 2KS6A 5AI6A 3ZIAD 4BVGA 4CG1A 3LPAA 1YO6A 1I7SB 5DNYB 1NP7A 2HYDA 3EOZA 2FMTA 1HPLA 1W76A 3W8FA 5GJCA 1MX9A 3UCEA 1IQPA 4MPJA 5EOVA 3HTXA 2BR4A 3VSAA 4KNVA 5AKHA 1TKAA 2OHJA 4BMPB 3AIOA 1SKYB 1NBIA 3OJCA 4LY9A 2O2ZA 1G8GA 3LZCA 1XNRB 4HTAA 5DHQA 4F4UA 1KA9H 2FPGB 1KO4A 3CZAA 5FFNA 9ABPA 2FLWA 5KNBH 5IHPA 3K92A 1E5TA 3L7CA 3QPAA 4KO1S 4PWZA 4PQEA 4RIGA 4C0WA 7ADHA 4KX5A 4D80A 5KSPA 4L5JA 3ZJUA 2JFOA 4K86A 4O6VA 1NVGA 5H82A 3UT5B 4V1CI 5JDIA 3GRPA 4DY4A 4E4TA 4ALJA 1IY0A 4MR8B 5TT1A 2GBIA 2QJRA 4RK7A 4GI5A 1BAPA 2BGJA 2Z4SA 4IDPA 3MUOA 2AMJA 2P4SA 4V0KA 3VAAA 1G3IA 3WXBA 2OFOA 2AUTA 4C4ZA 3L8MA 1E59A 3O8NA 4PC1A 1FX0A 4J7XA 5KTKA 5HRUA 2XOXA 3CC8A 3QBVA 3V4ZA 1KKUA 5JSHA 4TRJA 4EMTA 2C4WA 1ZEJA 3HYSA 3R3YA 1P75A 3A6DA 4P53A 3K0HA 1TQ2A 1WCWA 4CQMA 1ZH8A 2V8OA 4PSAA 3PTZA 3WDKA 5NULA 5AI4A 5DTJA 2Z5FA 3HB1A 3A27A 2FUG1 3PGVA 4YP5A 5HF8A 4ZZ3A 2BT4A 5LQKA 1FB5A 3DE0X 1SIBE 5I7WA 1WBBA 5D85A 4K9LA 1U31A 1E0JA 2Q4OA 4LJSA 4A16A 4HRVA 4BCCA 4KLZA 1GTG1 4HV4A 3EPKA 4UEJA 3SDZA 4ZCPA 5CA0A 2REQA 1W4AA 2GCOA 3PVSA 4L6AA 3QX3A 2XB2A 3AHJA 1RYEA 3R4VA 1XAJA 4ZMBA 1VJ1A 3HY4A 3M4XA 1M5UA 4YLEA 4RHYA 3HQ4O 4OHCA 5IBRA 3SNKA 3WL5A 3ZWWA 4AJHA 4ALIA 1F51E 2W7TA 5DZSA 1P9WA 2ZJFA 2VP4A 2G08A 4L07A 1T5IA 3N9IA 1DI0A 2XUDA 1OWPA 2H1WA 5FLEX 1KDRA 1MTOA 1JT2A 1T9HA 1Z5ZA 1T1SA 4P22A 5FTMA 3WJ7A 4ECAA 2VFAA 2I3BA 5EHIA 4YRKA 3Q8LA 1PBNA 2G07A 1JEYB 3M7IA 1P45A 2DPXA 2GZ3A 2O1EA 3GZNA 4TXHA 2RGUA 4RK4A 3RTCA 1YL5A 2OO5C 3CXRA 1JQKA 1T6YA 1UWLA 2AB0A 3ITDA 1PWEA 3K0CA 2P9FA 5LXTA 4W9NC 1YAHA 2QRMA 1MHPA 1O95C 2P9BA 3D4NA 4R6XA 4YRZA 5K8TA 2NQ8A 1VPLA 4MLDA 3MOSA 2QY9A 4DBLC 4ER7A 5AUNB 1EVJA 1OJLA 1GU1A 2GK7A 3N3AC 3U16A 2NSYA 1NMYA 3WLIA 1DFIA 2YIDA 5BRNA 3WQHA 2H1VA 2NNLD 2WIFA 1QYIA 3JQQA 4GPTA 5FUWA 3RLIA 2IH4A 4ARZB 3DLHA 1HOTA 4G0VA 2R6DA 2H29A 3X1JA 1V3QE 3LXMA 1MQSA 1U1CA 2A88A 3NH6A 4X8MA 3MXOA 1MX5A 1NW7A 1YJAA 4RHCA 5IJ9B 2JIQA 3RAFC 3OM0A 2CFCA 4CDRA 5M04A 3EIOA 4QVIA 5JFOA 2CCJA 4OBEA 2DR2A 2YFYA 4IJKA 3RQSA 4AXXA 5A4FS 1WJGA 1W0JA 5ARDA 4DV5B 4FX5A 1EGQA 1VPVA 4K8RB 2I03A 3H86A 2XUQA 1RTTA 3AZPA 3LQFA 5L4SA 3AF2A 3TTVA 1RC1A 3O26A 4OIFA 5B1HA 1XMOB 1C2YA 3NHJA 5FADA 3V48A 3MILA 5T4BA 3Q1LA 1JUDA 1LPNA 4WLEA 3R9KA 3R6TA 2IU4A 3AO0B 4ZZ2A 3TRIA 2AGVA 3AEQA 1HT1E 1II0A 1Q7GA 2INGX 2NU7B 2HDHA 4Q82A 1TF2A 4YMHA 2X19A 1JT9A 2Y93A 3A4NA 1CB0A 3BG5A 4GPD1 4GZ5A 1GRNA 4O2AB 5IW8A 3VPGA 4ETNA 5GIPE 1U3GA 2C4TA 3MUNA 4GH5A 4DLKA 3G9XA 3OF2A 2DWQA 3S2FA 3A70A 3OZSA 1GKKA 3PD7A 3KEQA 3TMKA 1XBTA 5LFAA 4GLJA 2RH8A 3F6EX 4B3TB 2Q1UA 2R8EA 5EMKA 4DA7A 2R8PA 2Y1XA 3AF3A 3MJFA 1A98A 1JQEA 2O2DA 2JI7A 1NM5C 3AJ9A 5GZ1A 1J1IA 2PKYX 3Q7TA 5HZHA 3EMVA 4IY1A 4O4LB 1B74A 1H8ED 1BW9A 1NFFA 1NVWQ 3SSMA 4E5DA 3N0WA 1M5RA 5G4LA 2O7VA 3F7OA 3V8MA 2P4EA 4BASA 1IQRA 1XZLA 2OB2A 3UAGA 1PAUA 2I9PA 4HEHA 3W2TA 3OT1A 2V7TA 1SQFA 1ZRNA 3B8HA 4L8FA 5KVQA 4K2AA 5ILOA 4DQLA 1W5BA 3DR5A 5K6TA 3LI2A 1U8ZA 4BMCA 2PUDA 3DCNA 1IMOA 2J5RA 3HCPA 3KALA 3Q8XB 2Z9CA 2BGKA 1JFTA 3BXGA 1YD7A 1OFIA 3HE3A 4WACA 3WTBA 1CRWG 1NMQA 3WLAA 1IHUA 3L7NA 3GA0A 5FPTA 3L8CA 1WXWA 2HV8A 2PRSA 3EAQA 5DBGA 4LSGA 4RD1A 4CLDA 3GOHA 3OE1A 3FDZA 1D9ZA 1L4BA 3STYA 5AKKA 1TIBA 3E2MA 3RUHA 3SS9X 3ZTTA 4J4BA 4R0NA 2ZZKA 2AE2A 2XWBF 4U7DA 2WD9A 4YRGA 2NAPA 1LK5A 2C77A 3DLBA 1P2GA 2C83A 1MQ9A 1CV2A 3FUUA 4JJKA 2P1RA 1P7ZA 4L5CA 4CKWB 4EGJA 2E0IA 1R74A 2QXTA 3HLYA 5DYGA 1MA0A 5E7MA 1Y9EA 3N6XA 3UGTA 1CDOA 3I64A 1F4LA 1HFKA 3MPOA 4WXEA 3WWZA 1ZNQO 2VNAA 3ANMA 3ZQUA 2IHTA 1UAAA 3GEEA 2NUTB 4IWXA 3HP4A 3KRTA 4N5IX 2J7PD 4NDNE 3DHNA 4JLWA 4O4LA 4F2DA 5JXWA 1A1VA 1NZJA 2QIPA 5GM1A 1J23A 4I8XA 5HF9A 3G9TA 3ICEA 4BMNA 4EO4A 2Z8YM 4N5HX 1Y5MA 2E1PA 3FLMA 3H1FA 4EP1A 3E82A 3H7AA 5EKTA 1PS0A 1UOEA 4NCJA 4RFLA 5FL7A 3X44A 4CM5A 2WIDA 4FLEA 1BD3A 2CBZA 4V38A 2JGFA 2YDYA 4WCVA 3EH1A 2PO7A 4EEKA 3SY8A 2F4VB 1NXQA 2R5NA 3BFPA 3CMCO 4PO9A 3NCHA 4P84A 4C6SA 1TAGA 2J5XA 3GGJA 4EM6A 4IHQA 1GXSB 1XMVA 3EXIA 4HRAA 1SA0A 4EY5A 1AE1A 4KQGA 1BWRA 1I7LA 4NDZA 1GPYA 4D1YA 3BRCA 3R6LA 5A04A 4RW0A 1SQ5A 2YN2A 3PXEA 4V03A 3S8MA 3MMZA 4KQJA 1SPXA 1GNVA 2A9PA 3GLHB 5CFLA 3W9SA 2C2OA 4PLTA 2GTHA 4NR0A 3GUUA 3R3JA 3HA7A 1NONA 3DOOA 1SVKA 1PJCA 4X1IB 3F78A 4QFMA 1VKRA 3IA2A 5E1OA 2J9GA 1T0HB 3HFSA 5DASA 5JJ5A 3K3PA 5FOUA 1OZGA 2GRJA 3M83A 4JENA 1W93A 3I92A 4CM9A 1HEUA 1TCAA 2B1JA 1FSGA 3ANYB 1R8SA 2ZT8A 3C3EA 3C85A 2H2GA 5EIBD 2VEOA 1TLLA 1GCUA 2EHDA 1WUYA 2QQGA 2WILA 4L9WA 1L7XA 4YMVA 4FBMA 3GVXA 3LGSA 3PC8A 2H3EA 3D4PA 4EWLA 2NX2A 2HBYA 3A58B 4QYTA 3K0FA 1BX0A 4HAXA 2XITA 4CR8A 1F2UA 5CITA 2QBYB 1OIXA 3DOUA 3L1KA 4FR5A 2C9DA 1AO0A 2Y1LA 3KLPX 3G7NA 3REFA 2VT6A 3MJ4A 3LHFA 4ZT3A 4RHXA 4NBWA 1DZ3A 3I04M 2FN4A 4O33A 4J7CA 1EYZA 2IZ5A 3AFGA 3ER8A 4JT2A 4I19A 4NMWA 3V9PA 3G2HA 2NTJA 3AF6A 2R1TB 4JP1A 4TL8A 1ISHA 2VT3A 4NZZA 4CEHA 1VA4A 3GLUA 2F3SA 4IPTA 4K88A 3MS2A 2ZYSA 3D4BA 3H0CA 1KZ1A 5LZ7A 1YQQA 2HQOA 3GJYA 1LW7A 3KC2A 3DGFC 1KK3A 2DLNA 4G0NA 3UATA 2AZDA 1P9NA 4V0QA 1P60A 2EX4A 4X94A 3K6RA 3W5JA 3W5SA 1FSPA 2I1VB 1CW2B 2Q6TA 4KN6A 2JGIA 1JAIA 1B93A 3AB8A 2A9VA 2WRZA 3RKUA 2C95A 5HZKA 1JNXX 1GAQA 1QFJA 3F6CA 3EG9B 3GIDA 3HZOA 4Q15A 4YV7A 4PLPA 1EKXA 2AV6A 3UK1A 2H7VA 1KO1A 3OETA 4RDCA 5AKXA 1RYDA 2J0QA 2GDJA 2ZTLA 2YIVX 3R1IA 1X15A 1KAEA 4QBFA 3O3NB 3VFDA 2B94A 4BX9A 1WULS 4BQQA 1A27A 1AQ6A 4QUGA 2WIKA 4PZYA 1CS0A 1IZ0A 4IHJF 4IDBA 3UJBA 2IU0A 3K9LA 2HA2A 5EC8A 1RWVA 2W0MA 3K6SB 4YWJA 4MMZB 4MWEA 3BF8A 2QA5A 5CB6A 5MFZA 1CEXA 4LXXA 4Z7NB 4AWAA 3W3ZB 5LWQA 4KAFA 5JAUA 3U7HB 3L92A 5DNDA 3E05A 5E6UA 3SF0A 2BI7A 4QPPA 4CLRB 4EKYA 4I0WB 2DOKA 2CMFA 5F33A 1QFMA 3FLAA 4RK5A 1DG3A 3JWJA 4G5HA 4PY2A 3EISA 3HN2A 4FFVA 1II8B 4J0IA 5T8KA 2UYHA 3U4MA 4CV2A 1VLJA 1BU5A 3MFQA 2ZBEA 2NQTA 2OMKA 2V8BA 3PFKA 4CFYA 1IVSA 3JASB 4BNIA 1BRTA 1Y3CE 3WP0A 4YCLA 3UY4A 2JD2A 2R7MA 2SCUA 3AMVA 4P5EA 4RF4A 4Y2JA 2XYVA 2J4FA 2CLOB 5EGNA 2RGWA 3PZRA 4HWOA 1DBIA 2IZ1A 4UHFA 2YOGA 3ZE0B 3KETA 1GQYA 4XIFA 4UUQA 5KYYB 3OE7D 4DQDA 1MP0A 4X7RA 3WLKX 1C3LA 1Z75A 4OLBA 3MHPA 3UOGA 4AS3A 1AT1A 3FJ1A 3DM5A 4PHCA 5ALGA 2V0GA 1FYVA 1V8DA 3BB4A 1RQGA 4FYJA 2X3UA 1BEUB 3HCNA 1WM1A 4KZPA 4K9OA 3WFJA 4QJ4A 4DR5B 1FS6A 3RIEA 4DDVA 1VHQA 4FMCB 4MKHA 1CPYA 1RHQA 2I7CA 3DLAA 3REOA 3LP8A 3ZHOA 1IHDA 1I6KA 1ISFA 2I4OA 4RSHA 4YCDA 4RIHA 5AIAA 3ZDAA 2C5BA 5H9VA 1OWOA 3T0GA 3G9ZA 1EWVA 1KZ4A 2HXGA 4HDCA 4MKIA 3RSCA 1UC9A 1ZM4A 3ZHUA 1KNXA 2B0JA 3LP5A 1IN5A 5TPZD 2W2OA 3QKSA 4MS4B 4RHUA 4CGYA 3GDFA 1OX4B 2XCSB 2I4MA 3ZXYA 3HJGA 4N82A 5CD1A 1NHWA 5K8JB 3WWOA 2OCGA 2EYQA 2C98A 4PPYA 2PMCA 3LHKA 4Q6WA 1ZSVA 3QOFA 5F12A 3UV6A 1T0PA 3TSWA 3PTAA 4DDUA 3MS4A 3QH4A 4CM3A 5ALMA 4B79A 4Z3DA 2EL7A 5DVZA 2IFTA 1XN1A 2V74B 2QR3A 2Y1WA 5CTJA 2AEEA 3AK4A 3Q2IA 1E1QD 3SDBA 3UGJA 2ZROA 5IKOA 2ZSUA 1BXGB 2WWFA 4OHZA 4OB8A 4AMZA 1OXUA 4DYDA 1CCWA 5AHKA 1U1EA 3BEOA 4YRTA 1LA2A 5AVQA 2BM1A 3HPQA 2Q50A 3DHVA 2F8MA 5ITZA 1Z7WA 3FCEA 3L7JA 4PG8A 3CT4A 1FNMA 4KYVA 1L1QA 3ZY6A 1U04A 5DT2A 4EY4A 2X7XA 1FQKA 3JTEA 1NMZA 5EZ5A 1ML4A 1F0PA 4CMHA 2GK4A 2GETA 2XT6A 3O8RA 1PUJA 3EGCA 3T7CA 1OLSB 1R64A 3GZNB 4MK4A 1A7UA 4H7PA 4V3BA 1ABBA 4QPCA 3ACDA 4A73A 4P32A 5DHSA 3KR2A 1P9RA 1VDZA 1XU9A 3D0KA 2JFVA 3BK1A 2KW5A 3O8OA 1RQ7A 1JJAA 1NX9A 1PTJC 4IV5A 1LGYA 2ZSDA 3GGDA 3A9RA 4LQ4A 1KEWA 3NB0A 1HY3A 1NYLA 4S1TA 4FKMA 3AHCA 5DLQC 2OK7A 1JA1A 1XN4A 4GBGA 2D74A 5C1PA 5CMLA 5AUPB 1GUAA 5FBHA 4Q1BA 5BT9A 4C87A 3Q2KA 3QFTA 4NH4A 1Q0QA 2YMPA 4NOMA 2GZMA 3V4SA 5DYNA 3WYBA 1VC2A 1N34B 2O8VA 4F06A 2PX2A 4U8HA 5A71A 5DV9A 2V7WA 3SIPA 4CG3A 3W8DA 1H0SA 5CCEA 4P1ZA 1T6XA 2OECA 3GRVA 2IJGX 3PGMA 4LHYA 5FWXA 3JARA 3U44A 4RDXA 2C5LA 2ZVJA 4RVHA 1VRVA 3EFOA 4QXOA 3OBBA 2OWDA 2J3MA 1GM5A 2MR5A 2YVKA 3D81A 4ZV4A 4NFYA 2OO7A 2PZEA 4UDNA 5JSKA 1Q6YA 1VECA 2Q0SA 1QQ7A 4C03A 4NCBA 2QMHA 2GN6A 3ZXUB 1KEVA 1W1IA 2V5UA 3MPUA 5KYGA 2XGSA 1NVUQ 4L6CA 4M1KA 1ZR4A 1HE4A 1DBRA 4M0EA 4XQGA 2JI9A 1D6JA 4FNMA 2KLHA 2OILA 2VI5A 2W71A 3QK7A 1DMRA 1YKSA 1VGQA 3KVYA 5CXXA 2WYWA 2AUMA 3VZSA 1HH4A 1ZM7A 4HGNA 3NNDA 1DZIA 4KE7A 2FPRA 4GP9A 1OMOA 5TMDA 5G02A 1ZHOA 5BQOA 2Q7OE 3Q3JB 4B3GA 6Q21A 2VSYA 2QTGA 5HUQA 3ZGOA 5CVTA 3MWYW 4QNNA 4FFWA 5EWJA 1Z4KA 3A1TA 2OTCA 4UEKA 2B0CA 4YGYA 1HNNA 1G2IA 3CYFA 5JIBA 2DFLA 2BGNA 3LFUA 1WY7A 4C08A 2CVQA 3I6YA 2AC7A 3HS3A 2WFLB 3UJ8A 2JS7A 2GPAA 4CM4A 5FPQA 5JSFA 1OLOA 1XZPA 5J63A 1X1EA 2MYUA 3UIEA 5IWCA 1ZWKA 4E32A 3UJAA 2BHSA 3F97A 3FNEA 4YT4A 3RLFA 4ARAA 4KR2A 3R6GA 5AOAA 4LXIA 2P2SA 1T5BA 1GNLA 5JU6A 5B55A 1J00A 2F1JA 2JA1A 4MJ7A 4QYIA 1ZN2A 5HK8A 1DDOA 4CW7A 3D8SA 2FETA 4N5NA 3DBLA 2ZAGA 4FYYA 1AKRA 3GPIA 4LSWA 4R3UC 3UH0A 2I2XB 1CR1A 2VYVD 2Q45A 1VE3A 2XD9A 3MGGA 4R6WA 3T9DA 4JI2B 1RAGA 4PAWA 4A8JC 2LR0A 2QMYA 4AECA 5K8VA 3ILHA 4NENA 2H1IA 4JSTA 3DQQA 2EFCB 2QLBA 4FGSA 1GZ7A 4MA4A 4YAFA 3EZ6A 2A1UA 1U5AA 4LUCA 5EAIA 3UWPA 1AGXA 3PEFA 1NQVA 4OXYA 2BI8A 1E2BA 1N2BA 3C4VA 2P67A 3HLKA 4A0SA 4KMRA 4W5NA 1HLGA 3D43A 4BEWA 3PFHA 2V9ZA 3IBTA 4RD3A 1JG1A 3RGWS 1I14A 1EJ2A 3BILA 1QE3A 1KP3A 4IIFA 1M0TA 3FOCA 4Q3EA 4DQKA 5HX7A 2VHEA 3INGA 1ZJ6A 4Z9YA 3LT1A 3LXXA 1OYYA 3M5CA 3L0CA 2J0UA 4I5IA 4JV5B 1IB6A 5JO0A 3LX8A 1JL3A 1R4MB 1NATA 1Z2OX 2PQ6A 3AIMA 4HWTA 2P27A 3WYNA 4DEXA 4AJ1A 4X6UA 2ZYAA 2BKUA 3L4KA 3ROEA 4D3SA 1NIJA 4KIFA 3ZHSA 4DZZA 5I7AA 3ZV7A 3B1FA 4D4GA 2UAGA 4JGIA 4BVEA 1J90A 1YCFA 1TMKA 2AD1A 2FSHA 3I9LA 4LI3X 4O4HB 4S3MA 4RQAA 4F60A 5KB3A 1T8PA 1I01A 4AWXA 1YKGA 1YZNA 2VOJA 2ZP1A 5IKMA 4A0RA 4G01B 1BEZA 1XMSA 3F3SA 4B2IA 1NDQA 1W2WB 2NXCA 2YV3A 3EJ6A 3JYNA 4YJDA 5HFNA 1UP6A 3T6KA 4NS1A 2EJBA 4KXXA 1XTJA 2I3DA 1FBNA 1N8NA 3I9V1 5DT9A 1QP4A 2NZVG 2BH9A 3P9ZA 3DL7A 3BQMB 1XG5A 3WGKA 4HNTA 5F76A 1FFCA 1G3UA 4MUNA 4DR4B 5I4KA 1A8HA 2Z09A 3AJRA 3BORA 3DTYA 3ND8A 4NYIR 1ZRMA 5H70A 5ES3A 1SXJC 2FWBA 1Z16A 2PZJA 3KKQA 5TX7A 1UFQA 1YJ8A 1DPFA 2O05A 1U7PA 2F3RA 3BRWA 1WVMA 3G0OA 4U9HS 3T3HA 2H5LA 2JFPA 1R6BX 1PNVA 2BGTA 2QXYA 2RKBA 3GLQA 3M3HA 4TKMA 4YIKA 1OFUA 2HJVA 4I1YA 4I6EA 3VKWA 4OHFA 3H9GA 1N7HA 1VHJA 4G5FA 3K09A 2PMDA 4NG4A 4DLAA 2IOFA 5C46F 5CVVA 2IHNA 1QO9A 1TJNA 1FFYA 3CO5A 4GSLA 5LMZA 4MAFA 3UAWA 1UDBA 4A2QA 4RS4A 3ORSA 1JJFA 4TL7A 3ZTWA 2H2HA 4FW9A 4HWPA 3FYUC 2ZU0C 3EG5A 1G20A 3DT8A 2FQ1A 1SVWA 4YCNA 1L1EA 3NHSA 2O3RA 3C7DB 3PR1A 2JATA 4MV5A 4UTXA 1JFSA 3MLEA 1N6IA 3C14C 4XUGB 1U1DA 4AF6A 3HB0A 1AH2A 1QBGA 4YREA 3ND6A 4FHEA 1G1MA 1AV6A 1N5LA 2X3YA 3FPLA 3EHDA 2P9CA 5EXPA 1XMJA 1TT5B 1A96A 1Z33A 5CXQA 4NY1A 2YC4C 1H2XA 1RHMA 3MMSA 4JYBA 4KRYA 3A1CA 2F55A 4QUIA 4NOLA 2ZE5A 1TW2A 3AGPA 2OESA 4JBNA 3HWWA 3W8NA 1C7FA 1QYXA 3HL4A 2EX1A 4PX2A 3ZGYA 3I2YX 3U19A 3UAVA 5CDUA 3LIIA 3QEAZ 5EJAA 3T34A 3ZI7A 3C15C 4CMGA 5J40A 2D13A 2RSLA 2Z98A 3CCCA 3JZFA 2EJVA 3OAAA 4ENTA 4TVBA 3GJZA 3LTNC 2XMQA 2G67A 4XGNA 3NDPA 3DF9A 2NGRA 1YRHA 1H2WA 3DE7X 3HXTA 4RETA 5CXSA 5C1IA 1I24A 1WF6A 2ZIXA 1XWIA 4GE3A 3WGTA 4MV3A 4Q9DA 2WM3A 1QDUA 1F7VA 4B7ZA 1TE2A 4QOGA 4C6HA 2HQ1A 3KKPA 4WLNA 3VH1A 1RLOA 2E21A 1VYHA 2GD0A 2VK2A 4RM3A 2C1ZA 4BV3A 5E6UB 1L5MA 3U7QA 1OTHA 1N5JA 2ETVA 1A8PA 1H2ZA 3IESA 4GSKA 5E3JA 3RUCA 3UM9A 1WCIA 1U7XA 5DNCA 3NBYC 3JQAA 2Q4TA 2NVUA 5F23A 4E09A 1AQIA 3ZVLA 5JECA 4BNLA 1O5TA 4YFVA 4CLOB 1TT5A 3OTQA 3ML1A 2I76A 4QGGA 5MFPA 2W70A 5A3QA 5IU6A 1HV8A 1WXGA 2E55A 3NKVA 2QD5A 3GBVA 5IWAB 5JNVA 1ZM3A 3HM9A 1JEYA 3SQDA 1X87A 5IH3A 3I62A 2JI8A 5SY9A 1G1AA 3FI0A 3RYCA 3VC3A 3H9BA 4B32A 1VZ3A 3TCKA 2JDID 5C5DA 4LCBA 3ZCTA 3QIAA 4HSGA 3IIJA 5FULA 4LMPA 4DTIA 4OK6A 2QRNA 1BE8A 3H6HA 2FDXA 5FPHA 3V8PA 3DEAA 2BFNA 4NQZA 5BQPA 1GJRA 1ODIA 2PX8A 4K6FA 1DCMA 3BA1A 3C6XA 1F2UB 1X2BA 1GNQA 2C5GA 3VHQA 4PPNA 2AG8A 2OBBA 1PDVA 2OE2A 2EJTA 3H5WA 2Q8NA 1AX9A 1V25A 4LYAA 4GOJA 2I3GA 4KFRA 3S1AA 1N32B 3HY6A 1RD4A 2XCLA 4R1SA 1GHTA 4FILA 5LPNA 4JOQA 3CJQA 1UBNA 1P9OA 3IVXA 3D3WB 3BERA 1TCCA 5CD9A 1OZ0A 4BHTA 1AN0A 2BP7A 4EJ6A 5T7BA 3AL0C 1N33B 4N41A 4U0KA 3QW2A 1OYOA 5KNLA 1CG6A 2EFGA 2OAGA 2BI4A 3C45A 3HNRA 1ZWLA 1SKUA 3W1EA 4ZI2A 3DKVA 2VNJA 1CF9A 3FKSD 3IAXA 4JVOA 2ZWAA 4Q03A 5DYTA 2ATCA 1T2VA 3AEXA 3CRMA 3FNHA 4I1SA 1QB8A 1YJXA 4EFNA 2V6JA 3A10A 2IY7A 2P75A 3QMPA 1FNCA 1NU6A 3K32A 3ZWDA 1UANA 4B6QA 5IN4A 1F06A 2X2PA 4QYXA 4AWBA 1U5BA 4BMOB 5DWQA 4P7BA 4LZPA 2JG3A 3WLPA 1SZJG 4ARVA 4UTRA 1VCMA 2XXJA 3JWIA 3NDIA 1SMKA 3RJZA 5JANA 3NGMA 5C81A 5JSZA 2FVYA 2R7AA 1YJCA 1K63A 1JHUA 5DEIA 1VL2A 1RAHA 1Q21A 1FZTA 2VF2A 1IBLB 4HDSB 3ZCSA 4QIHA 1LPBB 3CVYA 1YHNA 3P7MA 1DO0A 2HMWA 3JQ8B 3ROKA 2G5CA 3R3SA 2J3EA 2O06A 4MVCA 2XDAA 1GZ6A 2J0UB 3CPJB 3T94A 2PCLA 2NW6A 3EVTA 4GRAA 4U7WA 5I5GA 5EE5B 3S1LA 3X1DA 4CMIA 1JEEA 5GPBA 2EERA 4C07A 1SUDA 2PWYA 1PZFA 5THQA 2E49A 1AMOA 1DWPA 3IEXA 4W8OA 1TA9A 4EHJA 1RAIA 3BN3A 3LZDA 3G8DA 3R20A 5HRCA 4EB8A 1DEHA 1FZQA 3FI9A 2PMEA 4XSGA 4DLWA 4CTMA 4ZYYA 1HC7A 2FE1A 3C2QA 4D9HA 5FTLA 2OP0A 4W4TA 2RHGB 3LGAA 1I5EA 1VE9A 2C2HA 2OXTA 3RVRA 1GAWA 1LQ2A 3I8SA 4IM7A 4OO3A 3FBGA 3EWAA 2CDNA 2UZ1A 2VJYA 2Y4NA 4XYEA 5AVOA 2JGAA 3X1MA 1P7CA 1RFGE 5K6AA 3GH3A 4X24A 2HNAA 3MB5A 3HJHA 2GBFA 4J3JA 1OCEA 1H6AA 3ND7A 3CLSD 4YQEA 4BMSA 3GPLA 2TS1A 4AJKA 1P3DA 3TO5A 1ZUIA 3ZWPA 4J43A 1VJ5A 2XJ4A 4AYXA 5CLFA 3F0TA 5T3YA 3W79A 3ZS9A 5ALEA 2EXXA 2QD1A 3EMBA 1EAYA 2IV3A 4LRYA 2VYVA 3BBPA 3PJGA 4JLBA 3CEMA 3UN1A 1K8XB 5GZ6A 4MWZA 2ACWA 4H0NA 4ZAFA 1G0NA 1JDSA 1TRKA 3PQEA 3RBVA 4F4JA 8GPBA 1DOHA 2PIDA 1SEPA 5BSMA 3SZMA 2MMCA 3STVA 3S4YA 2GPWA 4EYEA 3LHIA 3C16C 3DUWA 5ENDA 1Y9ZA 2XUFA 3ADBA 4LF6B 3V1LA 1IY1A 4GG1A 2W2KA 4BKOA 3V6MA 3E15A 4ZKDA 1SQSA 2CK3D 2WWWA 2F17A 1JLSA 1PR1A 1SBHA 3ACCA 3LWDA 4WGFA 1NNLA 4E4RA 4I1PA 3ZJ4A 3DNFA 1Z45A 1TKRA 3E4DA 3KWJA 4FGJA 5CDHA 2PRZA 3IJPA 1O87A 3L79A 1J8YF 3IR6A 1DIAA 3FDFA 3F3MA 4RY9A 1PFYA 4ZODA 2WM2A 1QK5A 5FFFA 1V71A 2W6MA 3LFTA 5FHRA 3QLVC 1JBQA 1N0UA 3TBFA 4I55A 4KUHA 2YHIA 3L8HA 5T5QA 3FGOA 4HH3C 5AKZA 5JS8A 1R27A 1M34A 3VTZA 4C2AA 1XVVA 1R4NB 3I37X 3E53A 1Z83A 2OXRA 3I0MA 2ZB4A 4HAOA 3GG2A 4P80A 4YRIA 4FEYA 3DMRA 4F8YA 1T35A 1TYZA 3EEQA 4A2CA 4C6TB 5CEJA 3SM9A 4D7AA 3QPWA 2CVOA 1CUFA 4FZJA 4E12A 4MYDA 2ZRDA 3BXFA 3A9TA 2JI6A 1G63A 5D87A 3IHKA 3MD9A 5L3RA 1FP1D 3H9EO 3QU9A 5C0OE 4ER5A 5CIYA 3JYPA 1TUEA 2X7JA 3CUSA 4QREA 5D5PA 4KDEA 3TLZA 4BS9A 1O9GA 4CDGA 2BM0A 2H8GA 3AW8A 4HQOA 1RC8A 3DV9A 5KYUB 2B8EA 3N6RA 3MGBA 4JH0A 4G84A 4DVGA 4MI1A 1VSQA 2IIVA 4WEOA 1M5TA 4LE0A 3OFND 4UMEA 5FUVA 1E1LA 1I2DA 4NS4A 4P3KA 4V0OA 2PS9A 3ESBA 1E1CA 1V43A 5EVCA 3PXAA 4MV1A 3VR6H 1U7WA 3B9PA 1N5DA 1RI5A 4D46A 2P8JA 1WB5A 1A7AA 3K31A 4WADA 1JQLB 3OZAA 1RMYA 1Z6PA 1BVHA 2PRIA 5GOZA 1U0BB 1NMSA 3GAZA 2NVUB 1C0EA 3C1OA 1I0LA 3H6GA 4H77A 1MB4A 1V7PC 3VNSA 2IXTA 2A78A 2BMJA 3BWXA 4PAOA 1PUIA 3FUVA 3OIDA 3TKLA 3P2YA 5AVTA 4QC2A 1PJBA 2DFVA 2L69A 4OQEA 3O8BA 2RK4A 4IIXA 4NPAA 1OAOA 3HLTA 3L1JA 3R5HA 4LV8B 2V4MA 4N7BA 2X0FA 4YCBA 2M98A 4TTAA 2B35A 1LI7A 4BWVA 1FU8A 4YDSA 4RUKA 3WIBA 2V65A 5KQGA 1R00A 3RJMA 2REQB 3ZWOA 4OYLA 4C6RA 4IX9A 4K6MA 2GPBA 5TVGA 4P93A 2DERA 3TZQA 1H22A 2B8JA 2VDPB 2YY7A 3NEJA 3OVMA 5DLEA 4CIXA 3MQ2A 3V8NA 5CLHA 2MINB 2AKAB 3I9OA 1A5ZA 1EI9A 2OD2A 5FQOA 5H3LA 1L8LA 3DAGA 1OVGA 1VFNA 3U7JA 3NXKA 4DV4B 4UBNA 5IDQA 4UASA 1QQ5A 1QUFA 1SN7A 1UMDA 3HC7A 4QUBA 2AJDA 4B6SA 1RKUA 3E27A 5LQMA 1Z6GA 1M8JA 1OGJA 1QHGA 2Z4RA 3DLPX 4QUJA 2IF0A 3U3DA 4F2PA 2O1XA 2PS3A 5BV0A 2WD8A 5JXJA 2R8BA 4IL5A 4US2R 1QK4A 2DPGA 2LCFA 3C6KA 4Y67A 4GPBA 3ZK7A 2WJYA 4GOKA 4PZUA 2D59A 4M99A 3OCCA 1NFRA 1PJ3A 5KTRA 3VA7A 1NVEA 5DM70 2JD1A 4TWAA 1P5RA 5IBQA 4D9BA 4DILA 5BWBA 4KQWA 1X14A 3LYAA 2R47A 3BL6A 2X8JA 3KJZA 3CWCA 5DYYA 1QWOA 1OXMA 4FGWA 4G65A 4ZALA 4QE3A 2A33A 3NC0C 1KMHB 3CNNA 4K40A 1M34E 5ALZA 2W2LA 3V00A 1XEAA 5K0FA 1UBOS 1QDEA 1JAXA 5T41A 3TN7A 2VHCA 2Z83A 1ARZA 3JD4A 1LF0A 4LWZA 5JD6A 4F8EA 2I55A 4Y2XA 2HMUA 3L6UA 4C20A 5JNTA 4QXPA 1OU0A 4D3YA 3U3KA 1EVYA 5JY6A 2JCYA 3WGNA 2PA0A 1BFDA 2MINA 4EL5A 1KFJB 1TUBA 2FY8A 4MKGA 1FRZA 1JYEA 4QGAA 2YJ3A 3V8QA 5JDIC 2WHPB 5HUJA 2CBGA 3NT5A 5AW3A 1CIVA 1T5DX 1OC4A 2HK9A 3TJMA 5A7FA 3T3OA 5LLTA 5DW3A 4KZKA 3EEBA 1G42A 3NHBA 4W5HA 3FYUA 3CX6A 1OXBB 1E1YA 4OHUA 4Z1MA 3RUDA 1MT0A 4WINA 3WLLA 4CL2A 3TI9A 2W8ZA 5KX5F 1QSGA 5LCXA 3DL0A 4J4TA 1YOBA 2X2FA 1EUCA 3L1UA 3MERA 3ZVMA 1RXWA 1CZOA 4L5AA 3VR4D 4TM8A 2PBLA 3QW4B 4KJXA 4MV7A 2Y99A 1P2TA 3E0QA 1EGVB 5I6DA 1GV1A 1LJLA 4KO8A 3RT7A 5B6JA 3QLUA 3V4RA 3ZLVA 2KBFA 1XTTA 1UMCB 2A8YA 2C2WA 2VHYA 2FSFA 3OCJA 4M1OA 2XHZA 1PWYE 4QBKA 5AR1A 3Q7EA 3HY3A 3B2EA 3GQBB 4AQDA 2CNOA 1E58A 1ES9A 1P62B 1S8FA 1ZL2A 2Y1CA 4ZRDA 4IG4A 3CBGA 4HYTA 2GAIA 4LPSA 4ZOBA 4ZU6X 2W4MA 5JAOA 2PU5A 1B1CA 3HDGA 3DOJA 5BSTA 1C2TA 3IT3A 4BQSA 3OT1B 4ZEXA 3KYCA 3AL3A 1Z4MA 3ACBA 3RSSA 3KUXA 2CWWA 5FUYA 2RONA 1COZA 1KSGA 5U4XA 4M8IA 3D8NA 5HZGA 1YFLA 2FRVA 4ZOEA 5AM2A 5BQ5A 1K0FA 2B83A 2YV2A 1SU6A 1WABA 2QZPA 1KK1A 4MW6A 2BBTA 2EFEB 3P9NA 4K81B 3NORA 3BXXA 3OZDA 3HB4X 1M2VA 1AV7A 3VOAA 2BTQB 2A0YA 1K6XA 2G76A 3FX2A 2VDOB 5COQA 3TW0A 3B82A 4NJMA 2IYOA 4M53A 1EU1A 2BM9A 2Q27A 3VQTA 1E3MA 4WBSA 3BMOA 3NZEA 4IIJF 1THMA 4LHEA 1QZZA 2FWRA 5CH5A 4AMUA 2PLFA 2GZ1A 4BKPA 1WB9A 1RRKA 4KE8A 2C7RA 2YHBA 4I5FA 5A4KA 1IUNA 1IUKA 4NBTA 1Y4UA 2BFEA 4DFDA 3VU3A 1C4KA 2VDUE 2SICE 1I7NA 3C4JA 3STWA 5JHGB 1L7PA 4MQEB 2OCDA 1GZVA 3HBLA 4TKZA 3CPEA 3WQSB 2YV1A 1F5NA 2EDAA 1NRIA 1D2RA 2Q99A 1KZ7B 2VUHB 3A1VA 2CJFA 4HVCA 1KVSA 2I7VA 4L22A 4WY5A 2VRCA 4V02A 1E2LA 3NPMA 2PIAA 4X8LA 5M2QA 4PN3A 1YU6A 3DEFA 2WWIA 3GT3A 2SBTA 3LK6A 1K66A 1XNGA 2XD4A 3R8CA 4CKCB 4DV1B 4L0CA 1N5KA 1CUXA 2SNIE 4MYRA 4WA8A 4F91B 1G5RA 3W77A 3GGOA 4HGRA 2P1DA 4A5OA 4CMAA 3SS7X 2V1UA 1TM5E 1PT6A 2POCA 1Q95A 3P2MA 1U2EA 2HRZA 4IH9A 3T0FA 5LNK6 3G88A 1REQA 3H8WA 3QFFA 2CEAA 1XROA 4NMMA 1KEKA 3ILYA 5C5EA 2FW9A 1JXAA 3L5OA 2RDMA 4IJ5A 1Z63A 5CFPA 2NU9A 3GDOA 4E6PA 5IUKC 4FWBA 2WZQA 5DEOA 3AUSA 1CDEA 4C0LA 5KJ1A 1N77A 4X45A 2LKDA 1UXOA 4TKUB 2K7ZA 3OFVA 4BFZA 4I5DA 2L19A 4N5MA 4O2BF 4JI6B 4EGSA 1D1QA 2QDXA 3FPJA 3AOEC 3NONA 2K4MA 3Q3EA 4NYIQ 2ZYRA 3N2YA 4B2PA 3G1TA 3LQ1A 3X1ZA 3L7BA 5I7RA 3AVXA 5KHLB 4NXNB 1RM3A 4N5DA 2D8MA 2F8TA 4FBLA 5J1TB 2QAGA 1R5JA 1U8CB 2HXYA 1K97A 2VRNA 2JKZA 3GFPA 4S0XA 3CGWA 3WRVA 5HIIA 4IIJB 3ZGZA 1VPDA 1U0TA 1BD4A 3PFIA 4UVGA 2QXUA 2IEBA 2P2LA 1YRWA 4YMWA 1MAHA 3PSHA 3INRA 2WUDA 3Q2OA 4TLAA 5JLJA 4IQ0A 1S3SA 1KO8A 4OH1A 1FSSA 2O20A 2PLWA 4INPA 4Z49A 1DBVO 1F8XA 1G6KA 4LYEA 1GGFA 1B14A 1PP4A 2DUMA 4QLOA 1NQTA 2OV3A 4R9VA 5LJLA 2AQIA 4GVPA 1GEGA 3FBTA 4BO4A 4GP7A 3EZ2A 3MCWA 1PD0A 3IQGX 2KLBA 1CVIA 2AQHA 1GGKA 5H3CA 1FFHA 2GKGA 2Q9BA 3GF4A 2PKXA 2RJOA 5AI5A 1T4GA 2CYCA 3TJZA 421PA 3OPMA 1AGYA 3M70A 5TC4A 3RYHB 1MU0A 3BIXA 3PFBA 4JEHA 2HCTA 5TNXA 3WL3A 3RVSA 3EIXA 4E07A 5KDOA 2EKBA 4KGXA 4YIHA 1IUOA 1IXKA 3ETGA 3DDUA 1OX6A 1D4OA 4MDEA 3H5NA 5G1OA 2Q5FA 2VDWA 3VJKA 5F5NA 1A8UA 2H2DA 2L0XA 3T7SA 2GASA 4RHFA 3DXYA 4M6WB 3VZCA 3PNYA 2C0CA 2FJPA 3SN6A 3OCVA 4HJRA 2PMFA 3D1LA 3E7FA 4ZCMA 2BGLA 4NI5A 5C3UA 2FN8A 2VK4A 3RO7A 3IRVA 1BW9B 1UOQA 2ZBPA 3GJTA 5AK6A 3C98A 2PZLA 3EDRA 1G55A 3LLMA 3NIWA 3W2GA 4ACAA 2DAPA 2JIMA 3TD6A 2VDMB 5BR1A 2JLCA 3DP9A 4OU4A 3TR5A 2ZAOA 3KZCA 2ECPA 4LXHA 1C8LA 1S2LA 4G09A 4AJOA 4ZJYA 1EVKA 4OHKA 3TOCA 2REXB 1Q5PA 5JQWA 4UAVA 5ESXA 1F1BA 2BSAA 4YJGA 5JS2A 4E08A 3DD5A 3IQWA 4OQLA 1GGJA 3P97A 1E1DA 3T3NA 2B3TA 3R5FA 3SC2A 1Z6XA 1CNMA 4ADSG 5A4DA 5FX2A 2OHHA 1MJGA 2Q1TA 4RIEA 5EHNA 5H68A 4CTOA 4FUTA 2YTZA 3G0HA 1UBUS 3F9RA 1V2GA 3E58A 4RLHA 1ACJA 4UM7A 5A4MS 1QIMA 4KQ6A 2XUGA 3S2YA 3ZGLA 1TAQA 2CKDA 3BREA 1PKXA 1OI4A 1ULUA 2VUTA 5KCZA 5AK4A 2PVSA 2P4UA 3ADPA 3QXXA 1JDJA 2FMUA 2IEZA 2PPLA 4DCNA 5IF9A 2LBPA 3IHTA 3EY9A 4TLMB 3T3DA 4G86A 1C3OB 1DEAA 3AUKA 2QVXX 1Y1KE 2GJ9A 1E5LA 1YSCA 3DBRB 3AIKA 4EPTA 1L8QA 1QONA 3W3AD 5BNWA 1J9GA 3L0DA 2X4LA 3W4JA 3IP8A 1J6UA 2V96A 3HDTA 4NNOA 2Y76A 3T4EA 4C3VA 1JLLA 1YAJA 1KJ9A 2R6R1 2VDKB 3A1DA 1W5AA 3IPYA 3D64A 1EWTA 3TZCA 2YYAA 2IUSA 2BHRA 3LUJA 3ND5A 1GXSA 1OYVA 3EXIB 3ZEAA 4H08A 1QRAA 5CK4A 1L5LA 4JUDX 821PA 2C8LA 1E2NA 2NUBA 2PN1A 3TGLA 2WU1A 3NWEA 5K0SA 3G5LA 2P7HA 2ZRCA 3SJCA 3M6LA 2VG8A 5K0LA 4IS3A 5BYBA 3UMCA 4KAJA 2VDLB 3Q15C 5LP6A 3GLIA 2JLAA 1MAAA 1IY2A 2VK1A 1J8DA 2AFIB 5DYIA 2VF4X 3PT5A 3ELUA 4QUHA 1MN6A 4GM4A 4NCNA 2C84A 1MC4A 2VWQA 1AIPA 5KTMA 1JKXA 3MQ4A 1O9HA 3USES 4BN0A 5L7TA 3C74A 1IBMB 5IYZB 4BTEA 3FGPA 3GLSA 3ZGNA 2FP3A 3V42A 3INTA 4EHBA 4CQJA 4RPGA 1TW3A 4YUWA 3MTDA 4AB1A 1XPRA 4K1XA 1N9GA 4HYEA 3U26A 4B6RA 1EZZA 4BUCA 4QJBA 2ZBFA 5IKXA 2AX3A 4B3BA 4U63A 3TW6A 3CZMA 3JZIA 2EV9A 2DBRA 5JHHB 1V9LA 1JDPA 1TMYA 5LVAA 2HCBA 2OSBA 4JMPA 4RPHA 4B6GA 3U61B 2EBFX 3IAS6 1UKCA 2ACKA 1QX4A 4IGEA 4LGCA 2BFDA 1KOLA 5LU8A 3WLQA 5C7YA 3IYLW 3DBHA 2G4VA 3V7UA 2TECE 5E1DA 4MP8A 3PWTA 1AKTA 3PXUA 1QHIA 1EVLA 1U2RA 1A71A 4UMFA 4MW5A 2PEZA 1TCUA 3S2EA 1B0ZA 1DLJA 1J33A 2BMDA 2PZMA 4NQRA 5EIBC 4BE4A 1IZ9A 5D6NA 4M1SA 4KH0A 2QE7A 2F1RA 1BCRB 1CE8A 2X4GA 4GLLA 2QTHA 3GVPA 3KPUA 2Q7DA 3ZXXA 1DHTA 2EF1A 2DXIA 5KS2A 1V6SA 1C0IA 1E1KA 4X97A 2AHRA 1M76A 3ZQ4A 1DT3A 4ZTUB 1NW6A 2ZI9A 3GJSA 2ORYA 4K6OA 4MLZA 4QT0A 4UQOA 4CM9D 2NYUA 2RD2A 3QLJA 1JV2B 2Q4RA 1IU9A 4KQEA 3KKZA 4M1ZA 1Z0ZA 1X19A 2C3OA 3JATA 1WQ1R 2OBMA 5IP5A 1KWKA 1Z7BA 5LL6P 3G2IA 1UJBA 2I6XA 4MQMA 1HF3A 4RA6A 1NFQA 4DIOA 2C2MA 3UJPA 3EVNA 2JBAA 3GK3A 4KHZA 1NHGA 2EWWA 1M2HA 2QVLA 3K2IA 1TDJA 1WLYA 3GDWA 3JZMA 3H9QA 4JJEA 1NY5A 4NU5A 5TQ2A 1EINA 1XJWA 3MELA 1PU2A 2Z1DA 4MR7A 1ZIOA 5EKUA 5HM8A 5BN5A 2GS9A 2PGOA 1EP3B 3OLXA 3PNOA 2OV4A 1HSZA 4P82A 1N7IA 3S6JA 5DKFA 2BY4A 5CVCA 4GKKB 2CJPA 1Y5LA 3DXZA 4N8DA 2WHEA 1C8VB 2BHTA 2GILA 2XDQB 3AI3A 4NK4A 3CZQA 1VJGA 1OAOC 4NU6A 1Z17A 3NATA 5CJPA 3LUHA 3RF6A 2UXBB 2FEKA 4GKBA 1N78A 3QPBA 2HCJB 1G60A 4RGVA 2WV9A 3BJIC 3MLBA 1HEYA 5JALA 10MHA 1CEYA 2YKGA 4GD3Q 1I3OA 4X7PA 2CHFA 5JVDA 3E48A 4RYDA 4ZMSA 3IQHX 5J4YA 2ZM5A 1ZL0A 5F7ZA 5KQPA 1RC0A 1SUEA 1XT6A 3KBBA 2PLRA 1V41E 3VNBA 4JJFA 4FHGA 5KI6A 3ZD7A 1HDYA 2F3TA 3RAPR 4BEBA 4NDAA 2NVOA 3KDSE 4MB0A 2BMEA 1Y48E 2D00A 3F73A 1MCZA 2JGEA 1YJBA 3GEBA 4R0MA 2C4KA 1MORA 2B1IA 1NBWB 4F56A 4KQ2A 3QXGA 2WZCA 4MSUA 3E5HA 3O3OB 4LRSB 3CG0A 4HLNA 1YA4A 3HCCA 5DWVA 4QQRA 4X7MA 2EARA 3FDIA 1BQ4A 3EEFA 2ZSAA 1UC8A 1RWMA 4IFTA 3OKPA 5FDFA 4ZT2A 1D5WA 4ANFA 1XJQA 4I99A 3IUQA 3G8BA 1JWAB 2LPMA 2O2GA 4LX8A 4NZPA 1OXTA 1Z5VA 3GY0A 3ON5A 1J2TA 3L6DA 4FEEA 2NN3C 3IPAA 1G59A 1XQXA 2P5YA 4DLXA 4EO9A 1LZLA 2I99A 1QGZA 4JWKA 2B9EA 4QU8A 1VKHA 2Z04A 3ITEA 2IYSA 5AHRA 4G8JA 4K9KA 5HGXA 5SYAA 1I4LD 1VMIA 4QQ8A 2WYVA 4KE6A 1Q0UA 3P0FA 3PHCA 1GLNA 1O6CA 2OMEA 3GG9A 2BPOA 2CLFB 4LGYA 1QYRA 1G38A 2AFRA 4J16C 3RRMA 2JKVA 4Y2GA 3RUPA 1IK4A 1V4BA 3GP5A 4DB4A 3K9NA 4C0XA 4F8JA 1Z6TA 4UU0A 2D0OB 3G85A 4AM8A 2I91A 4UE3S 1J0DA 2J3IA 2VQFB 1NUUA 3Q6IA 1GGEA 4OXNA 4Y8VA 3VKGA 1FP2A 1C9KA 2P62A 3D8TA 2A9QA 1G20E 1XNQB 3R5JA 2XYRA 1VQ1A 1ZRHA 4AFNA 2ZCJA 1RXCA 1RLJA 3BMXA 4OKIA 4IOJA 1ZJJA 5DBHX 4LHZA 5JAHA 3JQ9A 2ZR9A 1QGDA 4OLHA 4P81A 4HWSA 2OO3A 2YS6A 4UFPA 1BH2A 2KMLA 4WCFA 4D6PA 1BDMA 1RW4A 2QRZA 4IGAA 4XJTA 1QTQA 2OC4A 2WUFA 4Q9HA 1NQWA 1XZQA 5CA1A 3J81k 2FQQA 1K2VN 5F21A 4JYAB 1XFDA 5GTDA 1IONA 1KMMA 2ZRJA 2P7IA 2AHOA 5C53B 5I48A 4OJMX 1TFRA 3EVZA 1E9AA 1TYAE 1YR2A 3K1AA 3SZGA 3W2IA 3JAKB 3C3MA 1JLMA 3GBSA 1XV5A 3GNSA 4Z86A 4EF5A 3NHZA 3CJRA 4YUVA 4HQRA 3SC3A 2WU3A 5FOTA 1LBIA 4QU0A 5I9BA 3UJCA 1NVKA 2D0IA 2Q0QA 3TQTA 4YT2A 1BXZA 2X0JA 4I55B 2Z9DA 5U4QA 4ZQIA 2Y71A 4G85A 1GCOA 1YONA 1YUMA 1DJOA 1Z9BA 1YQXA 2F8LA 1M74A 1UOPA 2I33A 2WTNA 1VL6A 2XQGA 4CEIB 1XTIA 1DQZA 3A06A 3KNZA 4PG5A 1UM9B 1S8AA 2HTEA 3T1VA 4KU4A 4O3MA 4HQFA 3DV2A 3NRCA 1Q83A 4IRXA 3AETA 4RPCA 3RVDA 1R5OA 5A9TA 4DJJA 3CLVA 3IMGA 2AIRA 2ARKA 4MX8A 1L7AA 2G1PA 3N2EA 1PO7A 6LDHA 4R51A 2BUAA 1E2GA 3DEYX 4NZOA 4KITB 4ZTBA 1I0ZA 3KZNA 5WRFA 4ETIA 4MQ6A 1MX3A 5ALLA 5JAQA 1T8TA 3FD8A 3OU2A 4Y18A 4WFJA 2HA5A 5LP6C 4RVOA 2GN9A 2J59A 1VZ2A 2GUWA 5KWSA 3HCAA 1TM3E 5E7IA 6GPBA 4HRXA 5JS1A 3TKAA 5H81A 4BNVA 1LBQA 1T4BA 1PWHA 1XVTA 5FP0A 2J09A 4C4AA 3O8LA 1NVVR 3QMVA 4OMUA 2UYCA 2CYBA 4UTNA 2FE4A 3AERA 2GHRA 1FLNA 3F7MA 1KF0A 1ZCFA 3TTUA 4M38A 3WLOA 1LWOA 4YRCA 2Y4OA 3Q98A 1HKUA 1KHHA 3O21A 1JHYA 1P7WA 3HCFA 3N75A 5EUCA 4BEJA 5KYWB 1STOA 1K0UA 1M1UA 3DYVA 2GLTA 4HKTA 2QLMA 4JT4A 4YTEA 3VSDA 1YZKA 4N9WA 1USIA 3I6BA 1I32A 4QQKA 2C42A 2ZTVA 3ZD9A 2BZ0A 2FN7A 5HMMA 2VT7A 5DU2A 3LBYA 1JIIA 4HUQB 4IH4A 5E1MA 3NAQA 1JJIA 4B6JA 1KY5A 3A9UA 5BN1A 2WF6A 1NW8A 1RMTA 2WT9A 2ES4A 3NOVA 4YO7A 2M9MA 4DSOA 1RAAA 2QD4A 3M9XA 4TKVA 3HUDA 1X77A 3NHYA 2ZATA 4N3CA 4XQ0A 1IRXA 3HSSA 2CVPA 1U80A 4KE9A 1Z08A 2C88A 3BXOA 5DB4A 3RU2A 1DKLA 3MIIA 4AD8A 4LV5B 2IYYA 2WWHA 4DMRA 1QO0D 4ZOLF 5FR1A 4QHYA 2NZYA 2Z1MA 2P91A 4QTZA 4F85A 1L5VA 5KX5B 1D6SA 2CXNA 1D0VA 1ZVKA 2ZUWA 3D9QX 4LWOA 2WM9B 1L0BA 3VPAA 2DBVO 1XLVA 4JR2A 1YR1A 2JGJA 5JO9A 2IXDA 3X2SA 1ZD3A 3IO5A 5TGZA 5BWNA 4XIJA 3DDCA 3CH6A 3V8RA 5JBQA 1DTWA 2GF2A 3HV2A 1UK7A 2CGEA 1RRFA 2F1HA 2IYUA 2ORWA 3KHKA 1EG7A 2O8FB 4B4DA 1TO6A 1X94A 2VF8A 3Q3VA 4MS3A 2AEJA 1NN1A 3E6AA 4GQIA 4KIJA 2IPAB 2D54A 3ORQA 1E79A 4IIHA 3MTGA 2Z57A 5AW5A 4O1HA 3UAXA 4EF6A 1S3GA 3MTJA 1H66A 4HMQA 5L3ZA 1XDDA 4NG5A 4M9UA 4D0RA 4GZMA 5I4BA 3S8YA 2QJWA 4RGBA 2Q3CA 4O4HA 1GTZA 4DJ5X 3JQBC 3ZWXA 1VBMA 5EWMB 2P3SA 1XI2A 5DTIA 1MO2A 2X9GA 3FFXA 4MI9A 1QCYA 2F2TA 4JQOA 3PB3A 1F6DA 3EC7A 5JSUA 3IT2A 2VXYA 2BFWA 2PCJA 4BRZA 1MB9A 3DLIA 1RWQA 2QN1A 1KKMA 1XDGA 3EZXA 3FUTA 2XB9A 3H3FA 4INJA 4NF2A 4B5KA 1QHNA 3BRSA 4ASUD 1KY3A 1GIAA 1JHAA 3IVCA 1Z4LA 3M9WA 4LTMA 1WXDA 3KOOA 3EGOA 2IYAA 2H11A 3DH0A 4IIYA 5AW9A 4BO6A 1DX6A 1UBGA 4FFBB 5KSOA 1M66A 4YRJA 1E7MA 3F7TA 3D7MA 3Q6MA 1E20A 4A5SA 2B30A 3FETA 4E88A 1JFFB 1PJ8A 1IN1A 3CEAA 3CE6A 2QLNA 4GL4A 5KQLA 2KSQA 3JALA 1XTKA 2JZCA 4PX3A 3S7ZA 2HYIC 2FPXA 2ZXEA 4ZIRB 1L1FA 5EZYA 1QZTA 2G72A 3SOZA 1NBOA 5HIKA 1V1MA 3KQHA 4B3SB 2JCGA 3GRYA 4NV3A 4I3GA 4CUKA 3A25A 3UF0A 3QITA 1O6BA 5KWJA 1PGNA 9MHTA 2ZWPA 3OEEA 1FS5A 4NBKA 1YR9A 4QGBA 1WOMA 3OF3A 2WHRA 4C5CA 5HVNA 4FT2A 1VE7A 1G3QA 2FG7C 4RL4A 3UK6A 3FPKA 1H2YA 1XLUA 2DJIA 2VZLA 4M1YA 4WASA 1FL9A 1TA4A 2FR0A 2WU0A 4C1BA 2I67A 1G16A 4IRMA 5TF4A 5EUMA 3ZBUA 4XUEA 1GDTA 1NNI1 3AR3A 3E3MA 3QHPA 4CG0A 5IC5A 1P31A 3FMVA 3FPHA 1YDWA 4OYRA 1QKJA 3TI7A 1Y8AA 5C7OO 2FRDA 4RF5A 1SCNE 3FCYA 4WMLA 3C39A 3QA3E 3OX1A 2GJ4A 4J1NA 4II3A 1XPJA 1D0IA 3SHVA 4F45A 1VCIA 3DW3X 5IAOA 2QUJA 3A14A 1RSZA 4ASUA 1P0PA 4I4IA 3RJ5A 4KSCA 4HBGA 5FT9A 3SKYA 4HNRA 3ZDZB 2KBEA 3RTGA 1YZQA 3OHMA 5AVSA 1SC3A 4FIDA 1YDEA 2UUOA 1OH6A 3Q0TA 2QTNA 1U7HA 5AO9A 2LTAA 4UQPA 3KIPA 2GEBA 3MMNA 1ADBA 5AM1A 3TNFA 5JRJA 3DHEA 2GZRA 3ZHXA 4JK3A 5E1BA 2ZK7A 2ZJBA 1ANKA 3HDVA 4BX3A 1P44A 1UT6A 3LOQA 4KXLA 3AXSA 2I4LA 2LDBA 4U2FA 5ALFA 3R7WA 5L95A 5ENZA 1FXUA 3Q4GA 3K4PA 3S7TA 3AY3A 4EBFA 2PTHA 1LUAA 2HBZA 3GQVA 4ILEA 2GKSA 1XZEA 2CC2A 3AH8A 4RVDA 5NLLA 3MB8A 3RTBA 5AVUA 2K7FA 3D2LA 3CUWA 1ATIA 2WA1A 3H1PA 3LF2A 1UH5A 3ZX5A 3W4IA 3LUCA 2AXPA 1T10A 3HVKA 4BPBA 3REGA 5CFQA 4LHWA 2YWHA 4ZAXA 2AEMA 5HBRA 4YAIA 3W5VA 3A3YA 1L4UA 4IX1A 3OU7A 4PYRA 2O5VA 1ORIA 1DBQA 2C2YA 1C8BA 3AWIA 2FJUA 1KZ6A 4RNCA 1JJVA 5FUBA 5CBPA 5DXAA 4TRRA 4DQXA 2VQDA 1RWBA 1RWXA 4JBXA 1HE1C 5LB4A 3KJXA 3EBLA 4LZZA 1L5ZA 2DQSA 1VDMA 2DY0A 4GRDA 2RCYA 2WVGA 4P2BA 4EB6A 4OJYA 1NOIA 1IXZA 1R6AA 3PYLA 4QPZA 4EVRA 5LZ9A 1W47A 3ZNPA 3Q8WA 1X6VA 3HXLA 4HXYA 3RFTA 3DYIA 1VL1A 3RU7A 3K94A 1IOZA 2P0EA 4A0HA 2VATA 1MG0A 4FDAA 2V6IA 1UPAA 2CXPA 2ZB3A 5JC8A 1X7XA 3OZUA 4FWIB 1OWLA 1RXUA 3EEYA 3PSAA 5DLDA 4WWHA 2D4HA 3TQFA 1SVLA 1SCAA 1XAHA 5CLGA 4ZGGA 2C2GA 1YS7A 3B13B 2BJHA 4NP6A 1KPHA 3X1XA 4F5EA 2P11A 4RD2A 4MA0A 4M0MA 3NUQA 4AIIA 1K5PA 1NL3A 4EG6A 3H87A 1QHHA 3VV3A 3FF4A 2RH9B 4LRXA 3EGXB 4PO3X 2WUWE 3MS7A 4TRMA 5LM3A 2ASEA 2V55B 4YAOA 4BNYA 5HIMA 3EWIA 3KKLA 4QXQA 3HR4A 4AN4A 3AR6A 4E1BA 3K0SA 4IJ6A 3ER6A 3OG9A 4UU7A 3MTEA 5HBGA 2PKEA 1NULA 3ZWNA 1FJ2A 2I29A 5P21A 1KYTA 2NTYC 3KQWA 1N1EA 1NJ8A 1QF6A 4PHTA 3PI7A 1OH5A 1AXEA 1I4OA 3A3NA 5A5DA 2D1QA 1T2AA 2VDWB 3AR2A 2QP4A 2WJAA 2JL1A 1EIWA 5K51A 1U8FO 2ON6A 4LECA 4NABA 3WI7A 4CU2A 4FZ3A 4GZLA 4OQMA 3T5GA 4PG4A 2A84A 1GSHA 3VDNB 4V0MA 1F2TA 3HDYA 3P2KA 4RA6B 4OHOA 4NBSA 1OE0A 2CLMB 1ZQ1A 3E4CA 1GWNA 2H1OA 1T5TA 3G59A 4D25A 3BZUA 1L7DA 3QMWA 4L5YA 5JCJD 2XB6A 1KJ8A 3H9CA 4JR1A 3DTVA 3V2GA 4AZ3A 1VLHA 1H9CA 2A1UB 4POOA 3N87A 4XB1A 1QIHA 4X85A 2WJZB 1FUKA 2BCJQ 4DARA 2QZSA 3BJMA 5DI3A 3W6ZA 4Q3AA 4D56A 1V16B 2J45A 4RZHA 1DUIA 5ILGA 3ZU4A 4LF8B 2AX4A 4NFSA 2X5JO 1EFHA 1RBYA 1TVKB 5TQ0B 3S2GA 1CIPA 3KE9A 4NOJA 2XSZD 1PFUA 1MZPA 1BS2A 5HUHA 5I47A 1BA3A 2IKSA 2WA2A 2QR5A 4DRZA 1QFSA 3L1HA 4RH0A 1EIZA 3IMKA 4MUYA 1E98A 4Q3OA 1YFKA 4ZO7A 2D3WA 3T1TA 3PUYA 3QRWA 1BIFA 1LVHA 3HUEA 2ZRMA 4BQNA 2G9QA 5LYJB 5FXMA 1EH5A 1XQ6A 3EXG2 1E1NA 4BVBA 2PL1A 2QK4A 3L7KA 1O2DA 3E23A 4P4TA 5TE9A 4X66B 3UICA 2Z4TA 3CVWA 4MQLA 2GXUA 2YWDA 1CP3A 3Q5DA 3CRVA 3EF1A 4BNMA 3NBMA 3RV4A 1XFAA 2HADA 2WU4A 3DOHA 2V9CA 4X44A 2ODEA 1PEKE 3KL2A 3MBKA 4MICA 5AM5A 2YZ7A 3R9IA 3A2KA 4M0DA 3IP5A 4W6QA 1OF1A 1CJTC 3AW9A 4WJKB 2GCNA 1ORDA 1RU3A 2X22A 1TIPA 1NN3A 3RRYA 4NV1A 3LRPA 4B45A 1ONOA 1JIKA 3HWSA 3TFWA 3FUCA 2FLVA 1LTQA 1YV9A 4DC1A 2AZXA 2JJ2A 1DJMA 3G8CA 4M0CA 3ILVA 1CFZA 1O8CA 2P0AA 2VOEA 3HV0A 4G9GA 4JLUA 3N5KA 4TV8A 4QBTA 2P9ZA 2H54A 1GPWB 2O6LA 4E2FA 1PK9A 3DC7A 2OPHA 3HGMA 3SIXA 1MF7A 1KPIA 2BONA 2WICA 4HX9A 5C4MA 2Q5CA 4TS9A 4CMKA 1Z0FA 3MW8A 3KK0A 5THXA 1TF5A 2E2WA 3A1FA 5FWYA 5BNIA 1MQ8B 2AA3A 3CV3A 4HI0E 5FTNA 2PDAA 3JW8A 1U7ZA 3Q6NA 1J21A 4ZXFA 4HNSA 4HWGA 4JXZA 4KXYA 1XXLA 2AOTB 2OV6A 3QJGA 4MS1B 4AKTA 5EIFA 2VZ8A 5L4LA 4RZ2A 1LPSA 3NBFA 3QEBZ 2COUA 4OSPA 1U7OA 4UHHA 4XW2A 3PUWA 1ZSNA 2ONYA 3U4AA 1RZVA 5JYEA 3J81A 1V8FA 3U2QA 1VIVA 3O9ZA 1MFZA 2JHCA 3FCAA 4PU0A 4KIWA 5JS6A 3GFVA 4MQ4A 2AXQA 3IDFA 4F97A 1NC3A 2GN2A 4GGPA 1DRKA 3C6MA 4GYWA 3QYJA 2GD2A 3TNYA 1FUIA 3JVDA 2DR3A 3SM3A 3VTAA 3WS7A