3V34A

Crystal structure of mcpip1 conserved domain with magnesium ion in the catalytic center
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
157
Chain Sequence
DLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease ZC3H12A
publication title Structural study of MCPIP1 N-terminal conserved domain reveals a PIN-like RNase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 157
sequence length 163
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11977 RNase_Zc3h12a Zc3h12a-like Ribonuclease NYN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v34A00
4G23A 4G26A 4G24A 3V33A 3V32A 5H9WA 5DIZA 5H9VA 3V34A 4G25A 5FT9A
chains in the Genus database with same CATH superfamily
4ZYTA 2NSYA 1SXHA 1G8JA 1M1UA 1DXHA 4P4SB 2Z8YM 4RK5A 3R8CA 3KLNA 1BU5A 4MQEB 1IEVA 4AI6A 4IQFA 4L1KA 1TCAA 4NXMB 3EHEA 1XCPA 2XAUA 2OHOA 1E96A 3A1CA 3SYRA 2JD0A 5T3YA 4OHBA 1JQ5A 3VTZA 1LTKA 5I7RA 3G8CA 4QYXA 3PDIA 1Q3KA 2IKSA 1NXVA 1YBHA 2BR5A 1NIJA 1KF0A 2QX6A 3LZDA 4EGSA 2BZ1A 3IQZA 4LYAA 1DC7A 3HKBB 4DS3A 1XRMA 5CX4A 2GHQA 2QR5A 3F6CA 3KB8A 4DEXA 5JADA 1PLJA 4K88A 1FUKA 3ET4A 2LV8A 1JLHA 3A1VA 3MCUA 2XOXA 3Q3JB 3E8SA 4WNIA 3EDMA 1DRJA 4XLLA 3E27A 1XJWA 5F21A 5B2EA 3BXHA 2IZ5A 2B5VA 2R751 2BBWA 3F96A 4V0SA 1X92A 4Q3NA 5CP8A 4YRPA 3CUTA 4O1MA 3PC8A 3LCJA 2NO4A 3GAZA 4BFUA 4D45A 4AY5A 4PXYA 1CDEA 1F4LA 5BXYA 1VBMA 3TYXA 1K3UB 4OKNA 4DDWA 2D7CA 1JWBB 1GZHB 2W58A 2YINC 4QPJC 3USES 3V32A 1BMDA 3KS9A 1KKMA 2UZ3A 3AKDA 1F7UA 1Z6AA 3GMSA 4D0RA 1TF7A 4RULA 2NACA 5EIWA 2OG1A 1SVNA 1UKZA 2B4KA 2JG3A 1C30A 1FP6A 4CQMB 4JL8A 3R3YA 3MLAA 2FX2A 4U7TB 1SG0A 2G04A 4HDSB 2JGEA 4LRTB 3CRNA 1ZX1A 5IWCA 1N32B 4UTNA 1PYGA 4XI9A 1COZA 1WNFA 1NVTA 1L5RA 4Y7CA 1CRQA 3WSWA 4TKUA 4B2IA 4YP9A 3URKA 3AW9A 4UM7A 2VT2A 1FJXA 4CMHA 4IIJA 3THYB 1EDBA 3O94A 2COKA 4I1VA 2HBYA 4NBUA 1O8CA 4NABA 3RR2A 3F2VA 5BNTA 2HU8A 4B3SB 3VR6D 2BMWA 3D7RA 1GM5A 3S8EA 4JYBA 1UKYA 2GEDA 3TEFA 3SIWA 3FDXA 3NBFA 3D0RA 3NCTA 5EKDA 3GGCA 1PFQA 2J59A 3DA8A 4B80A 4DIBA 3PDJA 2Z2XA 2QSUA 2QVLA 2XW6A 1W0JA 3W3AD 1STOA 4IQ8A 3ZIAD 2I99A 4WJLA 1GRVA 3OLQA 5CB6A 3A8TA 4P8RA 4TTJA 1CY8A 2MMGA 4CM7A 1KZ4A 4FGWA 1N1GA 1J33A 3C6KA 1WOYA 4D96A 2HMSA 1MA0A 2GBLC 4PZAA 2VAWA 4EQ6B 1ZR4A 2QE7D 4Q05A 1W6RA 1XNHA 2GCOA 4J0IA 2REQB 5AM2A 4X90A 3OQIA 4PLYA 3GFOA 3EXFB 4Q01A 3FWYA 3ABOB 5YASA 3TG8A 4CF5A 5ALIA 2CCGA 1HETA 3OKAA 3FPCA 2V3CC 1NVXQ 5E3JA 2MHCA 3DO6A 4B17A 4YMUA 5H0IA 5IAJA 2H16A 5IEJA 5KTPA 1TIPA 2BFDA 2Q1TA 3GVCA 4I4TA 5E2AA 3VYSB 3LRPA 1A2BA 3D6TB 3QM1A 4B74A 4D56A 4E5PA 5KNDD 4ER7A 1M6VB 1W25A 4GRAA 1VFPA 2QMUA 3IJRA 4HUQA 4RZSA 2P4HX 1M2KA 4UUNA 1IWPB 2OXRA 3MGKA 4G67A 3K0EA 4D8WA 5CXUA 1DC5A 4KO1S 4UBNA 4Y2GA 4AUEA 1MMFB 1UDAA 1A7JA 1E64A 1U0HC 3LKZA 5CCEA 4KH0A 3MYYA 3ZBUA 1Y8QA 3BMQB 3K0AA 3WWZA 2NQ2C 1AGYA 1BZYA 1SG6A 5EHXA 1JF8A 4M8IA 4FWTA 1II8B 3B2QA 3L8HA 3ABQB 2W6JA 3MSXA 1VLQA 2XE6A 3GUVA 1ESNA 1P5FA 4JBYA 5T4EA 2I7TA 4BEVA 4A8JA 2I3AA 4INJA 3E23A 4PZCA 3WIOA 3ZDRA 1T34A 5K6AA 4N03A 3V42A 1RW4A 2V9ZA 3DL0A 1WNTA 4IX1A 4JJ8A 4M8LA 1JIQA 1M1YE 3G2JA 3G2OA 2DKNA 1IOLA 1EWRA 2JL1A 3WLRA 3DWIA 1RQPA 5G1NA 4GPAA 1S2NA 1EGQA 1RFLA 3H6KA 5JQGF 4HFMA 1EGHA 2BFBB 2WWTA 4PR3A 3PEFA 3O26A 3QYPA 2X5XA 3SN6A 4C0JA 1BW9B 1ONNA 4RTPA 4X7RA 3FCEA 4CRWB 2RHLA 1GQSA 1BE1A 1NWHA 2QD3A 3ETJA 4KOAA 3Q5EA 3FI9A 2P9YA 4B3MB 2YQZA 1FXWF 2VZEA 4QTXA 2QE6A 4CHTA 2D5IA 1AZSC 3BKWA 2RK4A 5BUZA 4GYWA 4XX0A 2DETA 4TYQA 1QLHA 1S8AA 1XMVA 2C96A 2XYPA 5LP6C 4OJTA 4EJSB 3OQ1A 3NBAA 4NS4A 4X1IB 1ZAKA 4MWCA 4H17A 3VHRA 2UZIR 3EXHC 3H9EO 3PI6A 1XQVA 4Y2RA 4ZVVA 1T6BY 3WISA 4DVJA 2Z4TA 5CK4A 1C2TA 1J42A 5BSFA 2L18A 4KVAA 5HKLA 1NG9A 1QPZA 1FJ2A 1LVHA 2XQFA 1Y9EA 3KJQA 4MVWA 5JH7F 1VJ5A 4ER0A 3QX7A 2IYLD 1JHXA 1A9OA 1GADO 2E89A 4BJ1A 3NBMA 5NLLA 1I4EB 1U4SA 2I2DA 4P32A 1OGYA 4MUBA 2JPDA 3JWPA 2AV6A 2J33A 3OX1A 4LDPA 4ND8B 5FF9A 5IASA 4HDRA 1YL7A 5L40A 5ARBA 2GF9A 4MO2A 4ALNA 2CEKA 2B37A 2ENUA 1C0EA 5ELLA 1BH6A 3N2LA 4K9KA 3AK4A 3SJ7A 4EMSA 5IH7A 2W6QA 3F78A 1ACLA 3REQB 1JXOA 4Y67A 2NUTB 1UUFA 2GM4A 3W8EA 4HNSA 3INNA 4RPKA 1TMGE 2C8JA 3IUMA 4DLYA 1V11A 2W2LD 1XAJA 3IJ5A 5DK6A 2DQYA 5DT2A 4ZYWA 5CFLA 2RIRA 3ICWA 3BCRA 3UJ6A 3BTSA 5H3HA 3WSTA 5K7SA 3CNHA 2WF5A 5E1OA 1TKBA 1CUCA 1XZLA 5J4LA 1FSZA 4B7ZA 3WGVA 4JD5A 2HL6A 4OFBA 3M5PA 3D4OA 5B36A 3JYLA 4DA4A 4FYIA 3O95A 2ZUVA 4RZIA 5HQTA 1KP9A 5FOXA 3TQTA 2VSOA 4S0XA 3QMPA 1XUOA 1RABA 1PFYA 1UBHS 5ECWA 2JJMA 1XELA 1PJCA 3Q8WA 1A5ZA 1M72A 3W06A 4DQKA 2WNSA 1WUYA 2NVUB 3GLIB 2KS6A 4JIMA 2HWUA 3DLIA 4AYXA 4RTKA 2ISQA 3GBPA 1RYHA 5FEUA 4EGCB 2VZ9A 3ICCA 4RD6A 4G0NA 4E0BA 5B2FA 2FMTA 4J1TA 2I54A 4BMNA 2PBLA 3DZ8A 3DMTC 4Z0NA 3GDOA 3LZ6A 2CL6X 3VTAA 3CVUA 4U7HA 1Z0AA 3H2GA 3QBTA 3RSSA 2X8AA 2XUQA 4Q4HA 1SK8A 2GNOA 4G0WA 1MPTA 2BZ0A 2DLDA 4O25A 2AIRA 1P4GA 2ZSKA 3HCCA 4ENWA 1B6SA 2EBUA 3BMCB 3KSZO 3MB5A 1YZYA 1XKLA 1OMOA 3PZBA 3Q3GE 5EWLA 4CV3A 5JMWA 3IVAA 5EFZA 3ZNOA 3I09A 1ZRMA 4M21A 1VJ1A 1W19A 1Z5WA 4GI1A 5T8KC 4E2YA 1TYZA 3BZUA 1JQEA 3LA6A 3NDJA 4BUZA 2Y68A 3BREA 1V6CA 4RJJA 5M04A 1DSSG 1NJGA 1YQEA 3HU1A 4EA8A 5DGTA 5HP4A 1KHHA 4OUDA 2V54A 5IC6A 1QNFA 1WULS 4JHLA 4NSNA 4GSYA 3ROEA 3LG2A 4ATNA 2G4CA 4D6XA 3SMVA 3O1LA 5KUTA 5CH5A 5HTKA 2WKQA 3SQMA 1FYXA 2O19A 4YRLA 3ZZ1A 1B7GO 2QR3A 4MVXA 3ZHQA 1GPLA 2OXTA 1RMYA 1K6XA 1H3FA 5TJHA 4UTZA 3ZJ4A 1M10A 4N18A 1YKGA 2NYAA 3K0FB 4HH3C 4J49A 5EPUA 3HXLA 1JP7A 2WD7A 4P33A 2DULA 1BE6A 1C1DB 4YLGA 1G3QA 1XTJA 5EZYB 3RYCA 2FZKA 4INOA 4WSOA 1H9CA 3MB8A 3B3AA 2B3DA 3OCXA 5CDFA 1NVBA 5HRAA 1DAKA 2NZJA 2HIHA 5I9LA 3GG2A 3H16A 2PKQP 1Z15A 3M5DA 1NDHA 3QWAA 4LRYA 4XR9A 3CUKA 1XYVA 4OA8A 3VTKA 4XAQA 1QVVA 3WKBA 5ABPA 1W9MA 1YJQA 3TDNA 2WAMA 4ZCPA 1WLYA 3M2PA 1A77A 4XSGA 1JFRA 2LNDA 1JEAA 2IYOA 1U7OA 4NYIQ 1DO0A 3FOEC 4JYZA 2C7BA 3LC2O 4ETMA 2IDKA 3ZI7A 5BRAA 4KN8A 4DR7B 5H9VA 1APBA 2SKEA 4R7ZA 3G2NA 4W82A 2ZSFA 1V5FA 3DLAA 1QJ4A 4QWWA 2Y67A 1PFGA 1F5SA 4HWTA 4MRRA 4N8EA 4G9GA 3KOZA 3OQVA 4MP8A 4B2PA 1QF9A 1H94A 2UAGA 1KS2A 3MCZA 4TV9B 2L42A 1NXSA 2OO3A 2VJNA 3NBQA 3GIWA 4IV8A 5GGXA 5EXPA 3PT5A 2C97A 3SQOA 3ZDFA 2PYIA 5AW9A 1F6BA 2IEBA 3AINA 1EG7A 3FFBA 1NLZA 3G13A 4UXHA 2O3TA 3ND8A 4RAOA 4BFSA 5HKOA 3CF4A 1XCJA 1UP7A 4JBHA 2DFTA 4WK6A 4MLPA 3QFHA 5FQOA 3WB0A 3U7HB 1YUMA 2DPLA 2QPTA 3FJOA 4NH0A 4OHVA 2FXIA 4RNDB 1KKUA 4HN4B 5E7MA 4N65A 2IKQA 4AM8A 1UPFA 7REQA 4F92B 1ODTC 4KQCA 4A15A 3KEOA 2IXEA 4O6VA 2B4TO 4IIJF 4ROTA 3WMGA 1AS0A 3LF1A 2DU8A 4HWKA 1RAEA 3P0RA 5DI3A 4RLHA 3T5GA 2YY7A 4IXWA 1XXHA 5JNTA 3UMMA 3UO8B 1KS9A 5JJCA 3C3JA 3DE2X 3HN6A 4FYJA 4I36A 2OA0A 4DLKA 4ZHQB 2H92A 3TRHA 3FETA 2HO5A 1NVAA 1BD3A 2J9RA 5JYDA 3AIMA 1W52X 2HIGA 2WSYB 3G85A 1JR3D 3PPIA 4W4TA 1MGPA 5HK8A 3AEXA 3O1HB 4UUQA 3UGKA 1XLWA 1JAIA 4X93A 3DVLA 4LBVA 3FAZA 1X86B 4H16A 4HX9A 3TFQA 1QH8A 4IF6A 3U7RA 3R76A 1JE1A 2YASA 1QP4A 4X8OA 1QZZA 1GL7A 2NO7A 1CD5A 3F3MA 3C3MA 3GOQA 5K3CA 3QA3E 1FX0A 4WLVA 4LI0A 4BASA 1P4SA 3V4PB 5C80A 4W5TA 1GYQA 5DSTA 2L69A 3RS8A 4EG6A 4YCMA 3B5IA 4Y1RA 2RAVA 4JLBA 2EZ8A 2HO4A 3NTRA 4REQA 1XPRA 4QGSA 3KJZA 1XZCA 3L04A 2JJQA 3BIXA 3PC6A 4I4TF 2HQSA 3FFTA 1G291 4RW0A 2NTVA 3OM0A 4W99A 5DRTA 4DMGA 5JHGB 1AHPA 1USVA 1WUKS 1NVGA 5ICFA 4Y2VA 1GRNA 1CUBA 1V7QA 4Y98A 1J2UA 4IQ4A 5D2CA 1GTJ1 3HJFA 3KRTA 2HSEA 1J7KA 5FYDA 4YJ2A 4KXMA 4C1NA 2FZEA 3B7GA 4EUSA 2ZIUB 3Q7RA 3UPDA 4CCSA 4CHGA 2QRVA 3CISA 1AQIA 4U2GA 5FUYA 4BQQA 3GLFE 4QD3A 3L0PA 2BN4A 2AOWA 3L0YA 2DR3A 4QARA 5F1YA 5KHAA 5CBKA 1Z7EA 5K6TA 3HK2A 2ZTVA 1Z0IA 4JJ7A 4PSUA 3BHJA 3CZPA 4G4SP 4BCCA 5KVAA 2Y0PA 4GVXA 3RJ9A 1NPYA 3SBXA 3ASZA 2C8VA 4TV8A 1SCNE 2C1ZA 3GLGA 3CF0A 4BGEA 4NCAA 2ZAYA 1QFZA 4RELA 4K2AA 2OXEA 1R10A 4EEZA 4IOMA 2IHNA 4GEKA 2YVLA 2QN7A 4C6TA 4YJHB 4TZ6A 1OV6A 3O7WA 4AY4A 4LGMA 4YRMA 4ZDKA 2DOKA 3TR5A 5I4CA 2GMWA 2VEDA 3HY6A 2CF5A 2BGTA 2GCIA 1BWSA 3HR8A 3LCVB 1TQ2A 4GXQA 3COZA 1EU1A 1UK8A 2CVZA 1V8FA 3VO8A 2BEVA 4UD2A 3SX0A 4YYZA 1JJVA 3P27A 4NK5A 5C8YB 3VNUA 4YS6A 5K8VA 3MTGA 3JTEA 4BE7B 2HEGA 3W9YA 3C3AA 4A26A 3BK1A 1HNNA 1A9QA 4DMFA 4LZAA 1QDLB 4O3FA 1KC1A 2O8CB 1BVHA 1SKYE 2P77A 1KH3A 2PH3A 3O8OA 5DN9A 3K72B 1N3BA 2BEWA 1XZPA 1PF7E 3OT4A 4L15A 3M6MD 1FRQA 4QU5A 1Z18A 1CQPA 2CZQA 3ND9A 1YVDA 1R6UA 4FLEA 4FFWA 3VOSA 4RDIA 4JP2A 3AV0B 2XUKA 4J0CA 5FWYB 4PC7A 3LC1O 5ECYA 4M9QA 2OLJA 4DA7A 4BYMA 5C5EA 1VB5A 1D7OA 4O4IA 2YTZA 1NUQA 1KL7A 3CXRA 4M1MA 4KQFA 4QDXA 4UU7A 5TGDA 4AB1A 5DM70 1IY1A 3JWEA 2PUVA 4ARCA 1TJNA 1TEVA 1QHNA 3R75A 4EY7A 3HUFA 5I9SA 4OA5A 3CKMA 2AGVA 5GAJA 1TU3A 1DB3A 3QF7A 1IL0A 1HX7A 2Q7XA 2OV3A 1TCVA 3W2GA 2O8DA 3MFQA 3SHOA 4LE2A 4TUYA 3U3OA 4MZXA 3DBLB 1XTIA 4OHYA 4C0AC 2FEPA 2QRPA 4QVKA 5FWDA 3SFTA 4Q1VA 3NT4A 1E1QD 1E3IA 1U0BB 2XQIA 4FSHA 5FBKA 4LW8A 2TECE 4J4HA 4L9AA 1JDZA 3QVGA 2G1PA 2IHVA 2JBWA 2YR0A 4R0VA 5JSHA 3B5EA 4PZLA 3UT6A 1L3BA 1K08A 2WF9A 2KSQA 4G81A 4OLBA 2BEKA 4BC0A 5KOJB 2ZAOA 3UT0A 4TLMB 4K9NA 4EA9A 2PR2A 5D7NA 3ZW7A 3A3YA 3VOBA 3GJ0A 2ZRBA 3NHBA 2V7PA 2J9GA 2GRJA 4H7EA 3EPRA 3GQVA 3G2HA 1XBTA 3HPQA 4G84A 1LXCA 4L3VA 4MGEA 3MD0A 2APJA 2EJTA 3H8VA 3DMDA 3ITDA 1PP4A 4TTIA 4X1YB 4AO7A 2QL9A 1O5IA 4F9FA 4AZ0A 4MLDA 4UM5A 1ZWKA 1IEXA 5AP9A 1KSHA 1C1YA 2CMFA 5J1TB 3H83A 5IAOA 3USZA 3JQGA 3FGOA 2WTMA 3OETA 1BX1A 3FGNA 5L3ZA 2FSVC 2WF8A 1XTPA 4JCCA 2BGRA 2ZDQA 2ILTA 3GP5A 4PNZA 1DINA 2A5DA 3OEEA 5HOQA 1YBAA 2HBRA 3NUZA 3EF3A 1N6LA 3WO1A 5IT5A 1GXSB 1YS7A 2ZW9A 5I6DA 1T3SA 2A2ZA 1U1IA 2E0IA 2AJCA 3L8FA 4TSRA 4W8GA 5DM2A 4EF6A 4A1FA 4GI7A 2FFAA 4BBZA 3KJXA 4JUDX 2AI1A 2R00C 2YVUA 3THOA 2Q3MA 9ATCA 1QAMA 2OOKA 3IELA 2WFMA 4EJ2A 1J90A 2VOJA 2CNLA 1VLMA 4B3GA 1Z2PX 3LRTA 3DAHA 1CU1A 4UEKA 4YRKA 1IN4A 4TMFA 4DY4A 5KYXA 3WC4A 1IATA 1QH1A 3PI7A 4G5YA 1E6KA 1JEEA 3RWBA 4M1WA 3TMAA 1Z2EA 2AE1A 4CLEA 2IZ7A 1DRKA 2YJ3A 2BFCA 2HHAA 1JHOA 2ZSAA 3JSXA 2GLUA 4OU4A 3LQ1A 1YZQA 3U39A 3ZHCA 4F8EA 2OUKA 1U2DC 1M2FA 2JI7A 4R51A 2R97A 1VE6A 4CI9A 2FY8A 3DNPA 4KI7A 3OQ6A 1PX0A 1S7GA 2H57A 3IMCA 3G8AA 4K0KB 4QBGB 3UTDA 2CK3A 2ECPA 2VIIA 1OFUX 1Y1RA 3ESXA 3MT7A 4LXTA 1HR0B 4MV3A 2JI8A 3OF3A 3QKIA 4EHFA 4AZWA 4YWHA 2OHGA 2I33A 2O52A 2X3UA 3EXEB 3T8YA 1M1XB 4NMMA 3UCXA 4B3BA 2ZUFA 3TZEA 4W6QA 1TTTA 1EWTA 5FLYA 3UBTA 2YJ5A 4CDMA 1ENPA 1H2ZA 2AA3A 5LDGA 3GQBB 1PT6A 2W43A 1GYPA 2HDNB 1GL6A 1AG9A 4WVLA 1ZD2P 2QUZA 1KPIA 2C5GA 4TL9A 4DJDC 1Z7BA 4NV0A 1JT2A 2JVJA 3FSRA 3MAAC 3CWCA 2E48A 1A27A 1GG9A 1BHQ1 1G6HA 1YASA 3OOSA 3OE4A 3ORYA 3PUVA 4IWXA 4DUGA 3Q8KA 3ONFA 2CHGA 1D07A 2GPSA 5B1DA 4KAAA 1PR0A 1RQXA 1OH5A 3KWLA 1R12A 2PH1A 3I4CA 3V4OA 3MYRA 1C4OA 4L16A 1FUIA 3AHDA 4LJSA 1M8FA 1QGUA 2YYSA 1H1LA 2Y0BA 4UBLA 3ADPA 4RPGA 1Q20A 2ES4A 1X7YB 1P0MA 3B7WA 1EUQA 1ZY2A 1KDPA 5BNIA 4UREA 3KB2A 4KACA 1ISIA 4IH4A 4NFHA 1KSFX 4KWHA 1Y33E 3AKCA 3Q12A 4AJLA 5FV4A 5CHEA 3U31A 2NT4A 4ETNA 4AZ3A 2OLKA 1QHXA 1QB8A 1FP4B 2MSCB 3BE5A 4OYHA 5IHXA 2E2WA 2C58A 2ODPA 3SSMA 3B1WA 1I7PA 3FKJA 1P7PA 2IYTA 2ZYSA 3A1WA 3MGCA 4W9NC 3SU8A 4DEVA 5A0TA 1L1QA 4O1IA 4OI2A 1PR9A 4IIFA 2Q9AA 2GN8A 4ID3A 4EPWA 5ALHA 2HBZA 1I32A 3TSYA 2ZYUX 2WT9A 1DKQA 3CJRA 3ADDA 1LWNA 1DAFA 1R1DA 3UGQA 1KJNA 1N7JA 3CCFA 4OUKX 4QFDA 2XTMA 2HCJB 3PUJA 3NOOA 2AI2A 5CGQB 3K6JA 2P2NA 4I1SA 4XJVA 2J5QA 3JQ8B 5DTIA 3VPBA 4R98A 3ID6C 2ZCUA 1GFWA 1YHNA 4PX9A 4GP7A 1W8IA 3UK6A 1OI3A 5DE3A 3ODGA 3STXA 3HZHA 1UH5A 3ZW9A 4X65B 2FUG1 2O2XA 3I9OA 1UAAA 3D8UA 1YULA 2JK1A 4FC7A 3MN1A 3WXMA 1Q0TA 4NI5A 3CVJA 1XTZA 1AIPA 2A9RA 4RMHA 1A4XA 3CLSD 4S1WA 5M34A 5F35A 4CTJA 2HWWA 1T36A 4QFBA 1TO6A 2DPYA 1JVSA 2C8LA 3GGGA 1F2TB 1VTKA 3B8HA 2GQ0A 1E0SA 3QUSA 3QVSA 2VZLA 2Q3EA 3AW8A 2ZWIA 1MDBA 1W0KA 1N34B 4W1SA 4RQUA 4DPMA 2ORED 1QHSA 1QV9A 1YKSA 1ZU5A 2HQ1A 3E1KA 3IXMA 4IDEA 3FHJA 4BFZA 4EHBA 4QDZA 3M9XA 2YV1A 3OFJA 4JB3A 1A9RA 2GBGA 3GARA 4JU8A 1TE2A 2VR1A 1KO8A 2OE2A 1D8TA 3D8RA 2X6TA 4IIXA 3QRWA 2VPXA 4OOEA 4B3CA 3HXQA 2JLZA 3V4SA 3NNDA 4RK0A 4LKRA 1PWHA 4TWZA 2EQBA 2QTTA 4NBRA 1KTVA 3VSCA 1W36D 2QV7A 1M5TA 2AW3A 1JBEA 1CUIA 1DTEA 1TMOA 3TQCA 2J7PD 2ERYA 2BGKA 4AN0A 1QSGA 1GPMA 1YQUA 2X5KO 4CGYA 3SJBA 2RH4A 3C3KA 5H4HA 3SDBA 1RPZA 1TCUA 1YZHA 4HTFA 5HDBB 2ZSHA 4Z0PA 1MJFA 3RJ5A 1QP7A 4KC0A 5IZCC 2C1XA 4YJ2F 1U1DA 1EYZA 2F3QA 5BRNA 3U13A 1ZNYA 5BV7A 1S9HA 1EXNA 1NF3A 1OREA 4KVGA 4UTPA 4KTVE 2B69A 2WLTA 4P7FA 5JAQA 3OH8A 4TLDA 2QORA 5LQNA 1O2DA 4QYWA 4DIFA 1V39A 4AJ4A 3KUUA 2QMZA 2AFHB 1UBSB 4BX8A 3VZDA 1D6MA 1AF4A 3GDGA 4P4SA 2H4WA 4TV8F 5JCJA 3S1LA 2CMHA 2JKYA 2MSEB 3LWDA 3K05A 2I3ZA 3PQ4A 4LPKA 4MQEA 4Y9UA 4ECAA 5AVXA 1JMVA 1H2RS 5BQ3A 3RSGA 1F1BA 3OOEA 5FL7D 1SHJA 4DJ5X 4E88A 2HPZA 3F5SA 1MORA 2QVBA 3OMWA 5AVVA 1ESDA 3W2EA 2PU7A 4MO9A 1IG3A 2J6BA 4C22A 2NZ2A 2FH5B 3D6UA 4PNPA 4P9NA 4EKDA 3P96A 1C4XA 1E2IA 2W83A 3AYXB 3HKBA 3RGWS 3AVYA 1LBTA 4Z4FA 1V26A 1J8YF 2D00A 2RGCA 4HNVA 4HP8A 3RHZA 3A9SA 4B83A 5AW8A 5C1OA 3TQHA 4CCWA 3RW9A 3QNMA 4FXOA 1O97C 3OJEA 3RAEC 4AG6A 4DC0A 4K1XA 2P6MA 4C43A 1UBCA 1OLUB 3SI7A 3ACBA 1MQ8B 5K8TA 4HJXA 1JHQA 3PJRA 3H5WA 3D5QA 4G5GA 821PA 4RXUA 2H1LA 3G9TA 4NE2A 3UOAB 4EZIA 3DSRA 2BM9A 2OYCA 1RWPA 4LY3A 1VG8A 1XA4A 2FA9A 1B8UA 1XVVA 4O4IF 4IX9A 4CQMA 3ZVMA 4RWZA 4HDSA 2I6SA 1V4NA 1HYBA 2W00A 3I6IA 3IJPA 3L3BA 5DLQC 3LGSA 2PZBA 3V1KA 1EJ6A 1GYRA 3F2IA 4WKPA 4BUCA 4IDNA 1P3DA 1CDZA 1O8BA 2P4EA 1PEKE 2O4UX 1X42A 3LLMA 3LIIA 1TKAA 2A33A 4N82A 4QQFA 3P9RA 2JAWA 1Y8RB 2C0PA 2DYKA 2RGGA 4TUYF 4CG2A 1IM5A 3THYA 2X86A 1I7DA 3DWFA 1I2BA 2C4HA 2GZRA 1EUCB 1KRXA 3W4KA 2WWGA 1RXCA 3EQ7A 1VQ1A 3GWZA 5FHQA 4B44A 1RWOA 3EVGA 4ZHSA 5K0EA 3G0DA 4B0OA 4C6SA 1JDPA 4G5HA 1U2RA 4U8GA 1L4EA 3ZPXA 2C59A 4C76A 3WYEA 2C77A 3C6YA 4IINA 4C4XA 1WR8A 2ZUSA 3LBIA 3W2IA 3B9BA 4ZVMA 4MKXA 2VJLA 2ATIA 3DDWA 3RVPA 2VDWB 3F7NA 4F21A 4P7GA 3E22B 2PQMA 3SF0A 2WJIA 5F5LA 4ZXPA 5C3MA 2QN3A 4N39A 3SJZA 5LDHA 5TQVA 3A26A 4EK9A 3OIYA 2EDCA 4X92A 4EQ6A 5TEVA 3MWGA 1NVVQ 4JBIA 5NULA 2REQA 3ZZTA 3AHCA 3KEQA 3EXFA 2ADMA 1Z37A 1RTTA 2YV5A 3IAXA 4PLVA 3BL5A 4OI0A 4FFBB 3AUFA 2Z56A 3B3JA 3D3QA 4AG3A 5AUOB 2LPMA 1J21A 1HK7A 4EEKA 5IJ0B 3IEKA 4N48A 1QM5A 3GBVA 4FW8A 4BZXA 1MAHA 2HK8A 4FS3A 1TQHA 3DDUA 3WK9A 3AY6A 1VBNA 5HCIA 4R3UC 1T8RA 4QTYA 1DP4A 1M6VA 3BMXA 3H75A 3QZUA 5DOZA 4ZT6A 5JJ5A 3CKYA 3WGMA 1R18A 3W9SA 1A9ZA 3UKOA 1XF9A 3BA6A 4PPQA 1O89A 3L01A 2YXLA 2PUJA 3CLRD 1OH7A 3CIOA 3FCXA 3T4PA 4KR7A 1D03A 2HSDA 3BRCA 3PGXA 4NCXA 5F3RA 5I7OA 1QFMA 1R8YA 3MQ4A 3OURA 1X8JA 5FORA 4D8VA 3DAGA 2PMEA 5T4BA 3BMQA 1M33A 4JL6A 3OPXA 4BDTA 1RS0A 5TT0A 1OTYA 1Y7TA 4UVGA 3ZX5A 3F1KA 4HZGA 4U9IS 2R8YA 1II8A 1KQNA 1NW5A 5SZJA 2ZYRA 4FYWA 4ZV9A 2EHJA 5ALMA 2P65A 1OWMA 3B52X 4Z86A 5TRTA 3AY3A 4YCLA 1Y9JA 2VDOB 3IAAA 2H5JA 2OB1A 2AC2A 2PT6A 4JJGA 4S12A 4V0MA 4XDGA 4BJ5A 5FLEX 4PSCA 2PUEA 4DJJA 1ZEJA 1Z73A 2OSBA 2C5HA 4DLZA 5ECGC 1Z62A 1KXJA 4RC9A 4ZEOA 5T8KA 3LW8A 3FUTA 3C70A 3A27A 3HB9A 4BDSA 5M29A 4FDLA 3L6BA 2YN0A 4FBLA 4MUYA 2RHBA 1RCTE 3DD5A 3DZGA 1T4GA 2QV0A 3EYWA 3ISTA 2VCEA 2BFBA 4BVGA 4EKIA 4PO8A 3R5JA 4WUTA 1R8QA 1BW9A 2HRZA 1RRVA 4ZO9A 5KTOA 2HNBA 4DYDA 3VUEA 3RUPA 2BLNA 5EEGA 3NBXX 3AGPA 1PD0A 2OLEA 1ARZA 3RKSA 1JMKC 1YAJA 1RYNA 3IOMA 3SSAA 5I48A 1RC0A 3W2FA 3J7AC 4IGEA 4UULA 2GVDC 3T4EA 4MJLA 2AG8A 2IHZA 2HC9A 1MQAA 3O2QB 4V03A 1Z5NA 2G9UA 3M5CA 2QBYA 4EJSA 4X1IA 3WMWA 5KMGB 4KRYA 2YDXA 1V8OA 1XKXA 2AF4C 2NXEA 2C20A 3E1GA 5F78A 4XTCS 4DSTA 1XDWA 4P4GA 3N59A 3GHHA 3V8QA 4C0BA 3R3VA 4N5NA 1SELA 1VI2A 3KR2A 4LFAB 4LZPA 4JL5A 3L2OB 1T15A 1E6CA 3CH7A 1XZDA 4TL6A 3UQZA 8AT1A 1GRQA 2CCJA 4ZV4A 3GD7A 5DCUA 3OFND 4LYFA 5E6RB 3ISVA 2Q21A 4YUAA 1RWBA 2ZT6A 3I9FA 5TPZA 3L18A 5C8DA 1GSOA 2BI4A 4HFNA 1DO8A 4QUDA 4XIYA 3OZUA 4FHGA 4LXUA 4NCHA 4C0LA 4C4ZA 1SU6A 4ZA2A 2Z6AA 2BHTA 3KX2A 4ND8A 1YZTA 3DWEX 3HH8A 1J2RA 2EDAA 4J1SA 3RABA 3LW7A 3S99A 2JIQA 4IBOA 4KGDA 3NYRA 1QANA 2VP4A 4WXEA 1AV6A 3Q3HA 3BWMA 1OBFO 2QKYA 3G5LA 1M8KA 3PC2A 4HSGA 5ALYA 3I62A 1N92A 4C3OB 1QDUA 1MABB 3G6WA 3REQA 5LLTA 3MJCA 3PX7A 3CW8X 2IL1A 2NUTA 5G53C 4OHKA 1A1VA 4WLUA 3UJHA 1SRRA 3KD3A 1L8AA 4D74A 1U7TA 1UF9A 3CG4A 3OJXA 4CT5A 3C6ZA 2OT3B 2F3UA 1YHYA 1FY2A 4YXWA 5JNVA 4L22A 4MQMA 1XTRA 3Q7QA 2HAEA 4OFXA 5I7UA 4M8SA 1FMFA 4W5HA 1RXIA 1XE3A 3K1YA 3TF5A 5KVCA 2P9EA 4B4DA 3QWBA 3I04M 2H7CA 4JT4A 1K6JA 4LJLA 4D43A 1V43A 1XDBA 2QF7A 3SC6A 2G5TA 3Q5DA 4Q12A 3ZWKA 4M3NA 1C7EA 3I32A 1LI7A 3KTFA 5SICE 2H2GA 4D6YA 2XF8A 3KKOA 4BE4A 2IXAA 2R44A 5DWQA 3AQ4A 1PS8A 5CDUA 3V2UA 2EF1A 1CKEA 4JU9A 3KZNA 1NBEA 2NVUA 3GLIA 2HLPA 2RMKA 1FNNA 4YLYA 3ZWPA 3C8HA 1G6OA 3KVRA 1N0IA 2HJHA 4D4HA 1ONBA 1VJDA 4Z9XA 4QC2A 2YZNA 2W2KB 4Q9KA 1LSUA 3BAFA 4AECA 1KJIA 4G23A 2WT4A 1FX1A 2Y2VA 4TLLB 4X41A 3NHZA 4W5WA 5B3LA 2ATXA 3L8MA 4EQZA 5K3EA 3K0KA 4OH1A 1JZQA 3FROA 3PFFA 4QREA 1H4TA 1OIXA 4ZJUA 1QHHB 2D1YA 3JQQA 1QTIA 4HAVA 2YWFA 3FUWA 3WKCA 2QN6A 5HUHA 3G5AA 3CONA 3I30X 4BJHB 2CBZA 4OXQA 4DIUA 1S8NA 4OGWA 3VZQA 2RGAA 3FOBA 4UW9A 3GH1A 4J8PA 3PJFA 1VE5A 1VE3A 5JD3A 3T4XA 4L2IB 1GNRA 1VIAA 3OCCA 4IQGA 1L2TA 4UD6A 2Q4TA 4B4WA 1AA9A 4YBZA 1OWNA 4AS1A 4MROA 3G1TA 5BT9A 3GJXC 4MEJA 2EIXA 4UOEA 1AHNA 1FIUA 4CWAA 2BKUA 2PS1A 4OQPA 3W4JA 1ZI9A 4N3NA 4X7BA 3ZGXA 4NR0A 1AMNA 3ELDA 2J0EA 2C4TA 4FVTA 3BK2A 4QLAA 1JPVA 3CLTD 2IPAB 5DGCA 4GBMA 4ETIA 2PX0A 3LKBA 3H1FA 1XZKA 2B78A 1L5HB 2Y71A 3K0FA 3QPWA 4I1YA 1J09A 1N8SA 3FPSA 1P1FA 4LIPD 4S1TA 1C1DA 2FHPA 5EZYA 5J47A 1RLIA 1UQUA 2CL0X 3FPJA 1MRZA 5EJ6A 5M5BA 4KRFA 4MUGA 4X7PA 2IC5A 4P53A 4Z6KA 5GGYA 1HZZC 1E5LA 4I9UA 1KZ6A 1M8JA 4UU8A 5TLSA 1ZVQA 3GK3A 5TR9A 3I34X 3WDMA 2CT8A 4GAEA 1LV7A 3PQCA 1TO2E 1N6RA 3ESBA 4NMLA 3AYZB 4LZLA 1YCGA 3P45A 5K0JA 3C98A 3SC4A 3ESCA 2YBEA 3JARB 3L4EA 3GA0A 1P60A 3STTA 2FKAA 4NH4A 2PBRA 3UK1A 3RC8A 2R7KA 4EPTA 2PSJA 5IM4A 2WQ7A 5G3YA 2XNSA 2ZZNA 1EFLA 4IY1A 2MIIA 4US0R 5IAAA 5D1HA 1WKCA 2G70A 2WWFA 3C41J 5EEHA 3KUCA 5JI2E 4X61A 3V80A 5HF8A 1IU9A 4XGIA 2ZUDA 1C3VA 2XIJA 3A1TA 2A57A 3OO0A 3TSAA 2XYGA 2QW1A 2HR1A 2PRSA 4TV9A 4JR1A 4JI8B 1J70A 1IHDA 2CLMB 1LF5A 1XP5A 2ZANA 4IDDA 4IWNA 3E4DA 4RJ2A 4WKGA 4BX3A 1J22A 4B4VA 2B4AA 5HIMA 1USWA 5BOVA 4JDPA 4IVQA 1RQ2A 1WMFA 1NBHA 1BQEA 5JAHA 2DFVA 4I8DA 4HQOA 1RWWA 1Z7YA 4JMPA 3GLIE 2CXXA 2EWMA 3S5UA 2XBUA 2FR8C 2POQX 5IKOA 2RONA 2NV6A 4PVDA 2GNAA 1BN6A 1Z7GA 2GHRA 2PMWB 3FXAA 521PA 1YVUA 4HX2A 1WZCA 2EBWA 4JQCA 1JPNA 5B55A 1U5BA 2P0YA 2QMEA 1WZIA 3JSAA 1GNSA 1YXMA 2WG0A 3K9HA 3G88A 1FCJA 3OJ0A 3LNCA 1AKNA 4HEQA 3HJUA 4FFOA 4OATA 5AKYA 4HNGA 3RSOA 3T1NA 1P39A 1PW7A 1NUSA 2QY9A 2ID9A 1P0FA 4GLFA 4J91A 3HDJA 4B85A 2IYUA 3NH6A 4MPPA 4DILA 1TC2A 5FPHA 2WJWA 3PQDA 4ZHQA 3LE8A 2IW3A 3SR0A 1MT3A 2EV9A 5AWFC 1MX5A 3LTNC 3TH5A 3Q9LA 4CTKA 4HDOB 5ERXA 3ABSB 5I7WA 3H6GA 2H4XA 3QBEA 1ESEA 5HCNA 2HOQA 4FGLA 2BEJA 4NZZA 1IC6A 5F3WB 3T9FA 4TT3A 4X71A 4M7PA 3RIMA 2FI1A 3AJAA 3NTLA 2IZZA 1SB9A 5JRZA 1XNQB 3ICPA 1QCDA 3EG5A 3IURA 4FFMA 1GGVA 2F62A 4JX8A 4MB6A 1IVSA 3MEQA 1AUXA 3H2SA 2VHCA 1Z2NX 4R6WA 4IIDA 4ZRNA 4IH1A 2YNMA 3WYBA 2WYVA 2WIKA 5BQFA 4TQ9A 4KFCA 2N42A 2GF0A 1BSVA 1VHLA 2VH2A 3A6EA 3BJEA 3EQ6A 5AJZA 3SIPA 3HXOA 4BNTA 4FDTA 3A10A 1Z4IA 4EYSA 5THQA 3NHJA 4PV7A 2FKNA 2HF7A 1KNXA 3THXB 1X0XA 5LWQA 3ZDBA 3JAWB 3CVWA 3WQHA 5C8XA 3I2IA 3D7MA 3FZGA 4GNKA 1XK6A 3UUEA 3KQUA 1AS2A 2ZSBA 4P3KA 1NQWA 4JS0A 2JBHA 3HY3A 1ZC4A 1YRQA 1Q6YA 1VP9A 3GRCA 1ICEA 3OX3A 4XYMA 3FNGA 4YJKA 3VZRA 4H60A 1Y37A 3F6SA 2ZJ4A 3N2ZB 4YASA 3V8EA 3C5VA 1FU7A 2VHTA 3OJOA 4U7GA 4X9XA 3W5DA 1DLIA 1PTKA 4L4SA 1P0PA 5KHLB 3KSMA 1QQAA 2O0KA 3KXLA 1T2CA 5BSWA 3IILA 4YR7A 3NIFB 5D3MB 2XECA 1KDZA 5MGNA 4CM8B 4G0VA 3VSBA 4RU1A 1LTQA 1A8HA 5DB4A 4CEIB 1N1DA 1JG2A 3ESAA 3EVTA 3K15A 3MGAA 1R88A 4O2AB 3U4AA 3G82C 3MQFA 4BX2A 3JAMA 4R8LA 1KBOA 1D2EA 1HOTA 4FE7A 1JR2A 3VNVA 1GTZA 4A0SA 3B7PA 4YJHA 1EQAA 3M6VA 3VUFA 2BPOA 5ALOA 2E1RA 4MWBA 5FFFA 2JFWA 3BL6A 4B7UA 3PD7A 3AJ8A 2MU1A 3PQEA 1X1RA 3G9ZA 3C3YA 3EC1A 1M7BA 4XYEA 3AF6A 1LC3A 3O3CA 3QA9A 1AKEA 3BFJA 4H1HA 3ZUGA 4KU4A 2PKYX 2WM3A 1QJCA 4UM9B 1C9JA 2O3JA 5LD2B 3LUPA 4YDRA 2J31A 5L4SA 3SAJA 4BN5A 2K5UA 4FYMA 3GNQA 2O8CA 4MIOA 4EFKA 4BVKA 1W0JD 5DNAA 1KH1A 5K0BA 2DF8A 2FTKE 3LD9A 5ALDA 1II0A 1LBHA 3D4IA 4QVIA 3EPLA 2VP9A 5GV7A 2FUNB 3KTAB 1N2CE 2VS1A 2X40A 3RYFB 2CYAA 3D54D 3I12A 1A76A 2VSNA 2FFJA 3MS7A 5FWYA 1BDHA 2WE8A 2J3EA 2M1XA 1C9KA 4WCFB 3R8XA 2O8BB 1JG7A 5ILQA 5C8ZA 1LNSA 2BP7B 3LYLA 2XD9A 3FWNA 4FEGA 5KSWB 2ZJ3A 2Q2OA 2PMCA 4RF3A 1DT5A 3WA6A 3MHTA 3ROGA 1EXVA 5COQA 5CVVA 1HGXA 3L7AA 4FUTA 2H4FA 5LQAA 3GZNB 5AJYA 2VQSA 3DBLA 2ST1A 4S0ZA 1BVRA 1J9ZA 3JVDA 1YKFA 4M7WA 4F2WA 1H2FA 2A78A 4D97A 4JJ4A 1XMQB 1E8NA 4JN6B 5MGBA 1AHIA 1EWVA 1SKQA 2JCYA 3KAJA 4OMDA 4Q9AA 2Q45A 2KM1A 3FBGA 4LG1A 4PN7A 3SVLA 4DV2B 4PQRA 3LOPA 2ZAIA 3W6OA 4CR7A 4A36A 1RI3A 1J2TA 3H97A 3HGTA 2ROQA 3DVQX 2Q5CA 1MEOA 1Y81A 2AQ8A 3FYDA 4URYR 1ZH0A 4B71A 3NT2A 3PL1A 2LCQA 4FFVA 2JB9A 3HSYA 2ZVJA 3M4ZA 2AD1A 1SU7A 1U7UA 1MOPA 3K8YA 5E0KB 1Q3TA 3WLFA 1L4YA 2DZDA 2Q2VA 5KOJA 2FSGA 3JWGA 1BX0A 2GWRA 3KL4A 3MLBA 2WICA 4IDGA 2HEIA 4O63O 4Y1GA 2W6JD 3B60A 1EFDN 2I8AA 1JEQB 3UMYA 1DG9A 1I51A 3R9XB 3NT5A 3JZAA 1OLXB 3FOWA 4E2XA 5T6MA 4EENA 3ZDCA 4UCFA 1LK7A 1ZLYA 2J0VA 2PSEA 2PRJA 1JKXA 1JDUA 3DGEC 3M6WA 4RQBA 4IMPA 4X1YA 1VSQA 3PJEA 2P78A 3TLAA 4A1OA 1G2QA 1RYEA 2VL7A 4DLXA 5DWDA 4C7JA 5J5CA 3E82A 4TLBA 1GGJA 3GPIA 2AOVA 4J7XA 1T5LA 3MINB 3TCKA 1TVCA 4RO0A 3K0BA 4DABA 1FYDA 2CLIB 4BRUA 3RIXA 1CLEA 2XMBA 1XDUA 1IZ8A 3BFPA 2CBXA 1Q6ZA 4MYSA 5EE5B 1N36B 1GXSA 1CZNA 3MF4A 4B2LA 3G7SA 1PWEA 5ICGA 1U0NA 4Z9FA 3JD0A 3DC2A 3KFXA 4G37A 4MVJM 2Y8EA 5EGNA 5F52A 4MTLA 1RD4A 3OY2A 5HMMA 3LVBA 2WTEA 1X1TA 4HQ6A 2GRAA 3A0RB 3MBIA 1ESMA 3ZU4A 2JAQA 3O8CA 4AKSA 4GMFA 3QEAZ 2BFEB 2Q49A 3IKLA 1EQUA 1CRPA 1VL2A 3OLYA 4FU0A 2C4NA 3AP3A 4NYJR 1W4LA 3FUUA 1VA4A 2ZB8A 3NI2A 2NUAB 4DJAA 4JLVA 1RM3A 2XPCA 1YR9A 3JZIA 1F2VA 2QGNA 4O3MA 3VPAA 2BFAA 2G9QA 1RPTA 2ZSDA 3V5NA 1U81A 3GOHA 1X6VA 1O95A 4UPDA 2WVHA 1E2DA 2ZR9A 3V6LA 1TEZA 4J0EA 3G0HA 1SVLA 1YDHA 2B1RA 2XKBA 3ORRA 1JDBB 4RXMA 3I8SA 1PK8A 2WIDA 2P2DA 3E61A 1R6DA 4QO7A 5IZCA 3EXEA 3PFKA 1LFDB 1E1YA 1Z68A 4DV1B 2YIJA 4GX0A 2XODA 5DJ5A 2A9OA 5KSYA 3DP7A 3B8EA 2CV1A 2FN8A 3I37X 3Q7SA 4H6XA 4JBWA 4PS1A 5JBQA 4ODIA 3GQBA 1EZZA 2ZFUA 3LX8A 1CP2A 2D3WA 2GS9A 2JH9A 2Q6LA 1JFFB 1VCNA 2NQTA 2VP5A 2ZB4A 2ZE5A 3HA2A 4KXQA 4WWHA 2OYRA 4N7BA 3LQFA 1LZLA 2ACKA 4HBGA 5EZYF 3TWOA 4CMEC 1H4VB 1Z0JA 1Z12A 3F9RA 3IQIX 3QYJA 3MRVA 1ZLXA 5IXYA 2NTEA 2XWJI 1WU8A 2PFSA 3RODA 4AJNA 3ZHRA 4F38A 3R1IA 2HHHB 5JYEA 2V7VA 3RV3A 1X14A 4RKWA 4TWBA 4G1MB 3HBAA 4A82A 1KJJA 5KQPA 2FFRA 2WA1A 2F7SA 2QROA 3EIWA 1FNBA 3IPYA 4YP0A 2A35A 1B2LA 3EEBA 3OJWA 4DIDA 2DWPA 4DM3A 3WIDA 4FI3F 2VH1A 3TBFA 4Q03A 4ZOAA 1X7YA 3K9GA 1HWYA 1G98A 4ZVOA 5IVDA 2WVAA 2AJTA 5D5HA 4LY9A 3MG9A 5CJ2A 2ZIAA 2OHHA 1T5OA 2VDNB 3D02A 4PG8A 2D2EA 2G4LA 5IM4F 3NMUF 3KXPA 1FP4A 4RD2A 1LLFA 2CE2X 4J1QA 3CNOA 5A4FS 4RPHA 4LF5B 3BF7A 4IIUA 4K0RA 1U8FO 2OR3A 2X9LA 4JQOA 4UMDA 3WP1B 3GELA 4KYUA 3GCXA 3CBQA 3HV2A 4TV9F 3T3DA 1JTEA 4TRRA 2OSVA 1PWYE 4QU9A 1Q7EA 1DBRA 2QX4A 2VOEA 4MCJA 4DJTA 1ANKA 3F6PA 1E5DA 1WEHA 3N0WA 1EJBA 3JQ9C 4IXNA 1RLMA 1RSZA 4ZOLB 3ESDA 1SCAA 3TTUA 2FLVA 3NGXA 3ACDA 2LIVA 2HPAA 1E62A 1LA2A 1EB9A 1FDVA 3E7DA 3KKQA 3UHPA 3AVTA 4D99A 3CUWA 2IUEA 3JQ8A 2A1TS 1LJLA 3SICE 3GU3A 4XWGA 2XNCA 2QRLA 3DPUA 3E03A 4ARBA 4DNQA 4JB0A 2B35A 4HQRA 1TYAE 4F46A 4BRZA 4QHSA 2I7XA 1XCBA 1G3IA 1AX9A 1PR2A 1DC6A 4LZNA 4M7OA 5EWMB 2JGFA 3FVWA 3JQPA 4DDVA 4KPEC 1L5KA 6PFKA 2C7OA 3RSQA 2ZROA 4ZHQF 2JFOA 1S8FA 1BN7A 2TS1A 1T2FA 3P94A 4MS3B 1IBKB 2C1EA 1Y82A 4GSKA 4H4CA 1KYWA 1SC3A 1F2TA 3BFXA 3ICOA 4D1YA 4QPZA 4BBJA 3OTIA 2I2WA 3O8BA 5EKTA 3WLOA 1FL9A 4MGYR 4K6CA 3C8DA 3KVYA 2UU9B 3ZY5A 3L4KA 3QKUA 1IRIA 3IXLA 4OBXA 3OECA 4PM4A 4BU0A 4A91A 2EEPA 4JODA 1OUMA 5LZ9A 3IALA 3K0HA 4E94A 4LWPA 4OHCA 4BKUA 1M1NB 3FZEA 1HT1E 1YBFA 2GA8A 3BSWA 3NYQA 1YR2A 1YOVB 4KMOA 3RV4A 3TVDA 4DBLC 5HFNA 1SXJE 2I34A 2ZGVA 4KRXA 1F06A 3CIFA 1G7CA 3PQ7A 1QRTA 2ZI3A 4R8RA 5JRDS 3DZKA 3K2EA 4IDHA 3U26A 1CYEA 5DX1A 1J1IA 3C6QA 1QO7A 5G0VA 4YT8A 1GVHA 5BR7A 1JDBC 1JIVA 2IIBA 4GI3A 5F5NA 3TTTA 4BVFA 3T5PA 1FXUA 1E1DA 2CJFA 4ZC8A 5FOUA 4IRUB 1OFGA 3UMVA 2AR7A 4R41A 3HB7A 2C4VA 3T1QA 3RRYA 3GUYA 3WGKA 1FEZA 3CH4B 3PRJA 5KTTA 1BDIA 2A8YA 2HJGA 2N9UA 3C14C 2CVFA 4KWIA 2A4KA 2ZT5A 1YF3A 1GPJA 4BUJA 4YCAA 5KREA 1FVOA 1XZ8A 2V6BA 2W93A 4H7HA 4Q1EA 1OZFA 2WW8A 3R5SA 3D6FA 4ZCLA 4BN4A 5ALFA 2AFHA 3LTEA 3P32A 4E1VA 1WPGA 2WSSA 1K3TA 1Q0QA 1EX9A 4AMYA 4JP1A 2OCGA 2QSYA 1ZOSA 3TRKA 7YASA 5ADWA 3OBBA 4EUKA 4C89A 3AP2A 2FOLA 3X43A 3Q1KA 3QYFA 1YR8A 3FNRA 1PNQA 4B6OA 2H31A 2JI9A 3ST7A 3VKVA 5B3KA 3LT1A 5JS7A 1HLDA 2O7SA 3UAGA 1RWXA 2Q28A 1OC4A 2IOHA 4KE8A 3GPLA 3RVMA 1TDJA 1ORDA 2I6TA 2XXBA 3UWSA 2P5SA 4IUBS 5FOTA 4HB4A 2H17A 4TWJA 3KOOA 3RYHA 3ZZMA 2BGGA 1A5BB 3HLKA 3AR7A 3B6IA 3QP9A 1I4TD 3QUAA 2VZ0A 2XQKA 1P3Y1 3KXDA 4BV2A 4DV3B 4TN1A 3I4FA 5HKKA 2G67A 2ADOA 2CXPA 3UNXA 1ECFA 1THTA 2VTVA 3KOMA 4QNNA 4ZDWA 4TKVB 4YGXB 1CNEA 4DR3B 1L7DA 4L73A 5DM4A 1U8AA 1E2QA 3H1GA 1ZXBA 2QI9F 1YJBA 1OLUA 4CF4A 1BE0A 1U8CB 2Z04A 1X0VA 5LNK6 1RQ7A 1PJ2A 1CFJA 2CUKA 1GZDA 1JHYA 1NN3A 3AUYA 3GT7A 4NZNA 1V8BA 1WJGA 2C3OA 1JLMA 2W6PA 3B5JA 4LZWA 4MJ7A 1QV7A 3GEHA 4V3BA 1NAIA 1NW8A 4R8VA 2EP8A 2DKFA 2CXNA 2JH8A 2RHHA 4AWBA 2X15A 2WJ6A 3ZS9A 4RA6B 3UHJA 3AY7A 3EZLA 2F1OA 3HBLA 4LHVA 3L1KA 3IPLA 3PYXA 4GF5A 4MWGA 4BKRA 3V7YA 3DMNA 5K0LA 2OV4A 1WXWA 1E2FA 1OYVA 3BXZA 3Q2IA 2O59A 4L0CA 2D7JA 4LOKA 1Y8RA 1H5QA 2PPLA 1NW3A 3DEJA 1QB7A 3UJ9A 5KYUB 1VHWA 4K9LA 3WBFA 2ECQA 3B1VA 2W6IA 5FA8A 1EUCA 1UBGA 4Q7EA 5CLQA 5ALEA 2JHGA 5SYAA 1U2QA 1WIWA 3GRYA 1BWPA 3Q3VA 1AKRA 4ZCTA 2YUTA 2XYQA 1U1EA 2CEAA 1YB7A 2OZLB 2R8EA 2R84A 3KEFA 3NP7A 4BNXA 5ITZB 4KQIA 1E7YA 3LUBA 3PTLA 3N1UA 3U19A 4RDXA 2ZSEA 4BMSA 2VDWA 1SA0B 5HDQA 1L4LA 1KOJA 5EIBD 3OCJA 3W05A 3E22A 2PSFA 3QITA 5I8ZA 2P9HA 3FYHA 4BO8A 1EZ1A 4XVUA 1OAKA 1VCOA 4CMCA 3FTNA 5AICA 3HY4A 1QO9A 4P3NA 4Y1EA 4A0QA 5LVAA 5TV2A 4IZHA 2PJRA 1XLTA 1MGOA 4PC2A 1QP0A 3RAFC 4KZPA 1DQSA 1VCMA 2HIAA 5DOVA 4AICA 1PGQA 3Q3IA 3VO2A 4ZDIA 4BZZA 4RIHA 5ALPA 4TYYA 3N7AA 4UDNA 5ALZA 3E7FA 1KYXA 3OP4A 5E7IA 2O7NA 2ACWA 5EHGA 2AVNA 2OECA 3O90A 4FFBA 1YJ5A 5IJ0A 2P6UA 1WETA 3LUJA 4KZKA 3ZK9A 4F1WA 4NQZA 1ST2A 4LJ7A 4C9BA 1OU0A 4XB6B 4TMVA 1U94A 4LRQA 5E6UA 3CHYA 4ZAVA 3PEWA 2H52A 2Q5HA 3DL7A 5HJEA 4MYDA 1AZLA 1Z74A 2X9QA 4IEEA 3VDQA 5I9NA 4JJIA 4FZRA 2Z3WA 1R2QA 1RVV1 4URXR 2WDZA 3IIEA 3OA2A 2ORVA 1FDOA 4WFKA 3X1YA 4D6PA 1DEOA 3D43A 3E81A 4WJKB 5IJZA 3I1JA 1U7ZA 1QMPA 1X1EA 2GKSA 3ABZA 3O91A 5E1MA 2UZ4A 1TPZA 1CF4A 2D2XA 1RXEA 2OAEA 2GXAA 3K4HA 4GZ6A 4MQ4A 2F8LA 3PGLA 3V48A 3I53A 4RY2A 3WLMA 3X1ZA 2WU0A 3SVTA 1R4ZA 1XIVA 3GNSA 4GGOA 4RMJA 4GYJA 1DWOA 1XPUA 2GZSA 5K0CA 1VMAA 1OX4B 2JEZA 1U3CA 2QG6A 3K0CC 4IPTA 3DKIA 3ZCRA 2Y1GA 1R4NB 4GSLA 3ELBA 2N46A 4OQNA 1U3UA 3PC7A 5JXJA 4GU5A 1V47A 1F8YA 2XEXA 4LF9B 1SULA 2GZ1A 2AFIB 2DT8A 1TX4B 4WDRA 3CEJA 4LMPA 4MLZA 1LVGA 4NCJA 4PAOA 1W48A 5DIFA 2WTAA 4Z7QB 3HFRA 1RPJA 2DHEA 1BFKA 3B2NA 2I8LA 2LCFA 2AE2A 3C5WP 4OQLA 1K0FA 5ADUS 1Z6XA 5CDYA 4RK1A 3B9RA 2ZR7A 1TA9A 2EF0A 1L0BA 1QGDA 1IJBA 3UM9A 4F71A 1T2VA 3L8GA 2C3UA 2Z4RA 4ZICA 1MC1A 3S2IA 5LZ2A 2XGGA 1QHEA 3N2NA 4JZYA 2I2XB 1DQPA 5GMOA 4D3FA 1WABA 3P9XA 1O9GA 3LAWA 1NZDA 4P7KA 2X0RA 3DNMA 3VI3B 4S1OA 2CD9A 1TIBA 4RVCA 3SBEA 3PENA 5KMGA 1NY5A 2H5IA 4PBRA 5AI0A 4WK4B 3ZIUA 5IXJA 4OLAA 3I42A 3PK0A 3U3MA 2YC4C 1A7KA 2JLBA 4QODA 1J56A 4XW2A 4YN3A 2SHKA 4CXMA 2E18A 1C7JA 3HGMA 2W6OA 2IEZA 3HO6A 4Q37A 3TX6A 1JILA 1B8VA 1HDOA 4Q7QA 5E6RA 4L74A 4CIAA 4UTOA 3A32A 1R8SA 4Z2YA 1GZ5A 2YBDA 4KIWA 2KW5A 4QBHA 4BO6A 1FMJA 1T8TA 3L05A 4I3FA 1LLDA 1GQYA 2Z2JA 3OEED 2VFAA 4V0KA 5BVHA 1JGTA 3O2JA 1PQWA 2BTQB 1RACA 2JEYA 2GDJA 1F14A 2C9YA 2IU4A 1MABA 1F60A 2JA2A 2VPZA 3CNNA 3NJ8A 4Y2JA 5LQRA 1BHSA 2H2AA 2JKVA 4A9AA 3BXPA 1KFJB 3W34A 2X8BA 3QLVC 3QTBA 2J9YB 4G89A 3W6ZA 1NUAA 2AMLA 4X62B 2I78A 5DXAA 3AR4A 1L5FA 1KVQA 1QR2A 3NHYA 4LQLA 4B3FX 3LUGA 3DH0A 1JJBA 3PQ5A 5LXTB 5FV7A 2QA5A 1UBJS 2QPAA 1O03A 3SYMA 4B5KA 1IY9A 4YK7A 1BS2A 3KQSA 4RTMA 4Q5IA 5J43A 2O54A 1YDWA 2YVQA 4XWOA 2QGFA 3AR6A 2CMGA 2FR8A 3SFZA 4EUEA 2VPYA 1L3CA 4HWPA 4AX8A 3NVDA 2CUNA 5F1PA 1ZO8A 1NOIA 3HI4A 4DVGA 3RGGA 2JFGA 2PGNA 1BDJA 4N8DA 5A0VA 4V2UA 3IEMA 3LWBA 4JITA 3QUTA 4ABYA 3OO1A 5T57A 1N2OA 4KR0A 4D8XA 1W4BA 1ZIXA 3HL4A 1P77A 1EFVB 2CK3D 3BB4A 5T3UA 4XSVA 3KHSA 2BJVA 1RM5A 1VL1A 4U9UA 5F4BA 1NPDA 4BTEA 1TFUA 4MW0A 1QG0A 5E4TA 1MAWA 5KSOA 2OVFA 3G0OA 2POCA 2R6CA 2ZRDA 4RJKA 3EIHA 4L8FA 1QKJA 1BD4A 5CNJA 2W2KA 3WGUA 2X4GA 4CT4B 2D6FA 1GP2A 3NGMA 4R1PA 4HZIA 3F6BX 3ZGVA 3FF4A 2HMWA 3MMSA 3V7UA 5LZ5A 5CM8B 1IYZA 5EMKA 1QHHA 3B6JA 4D8UA 3WK7A 2OPHA 2HI0A 2NPIA 1FLVA 3IA2A 3BWYA 3JATB 3FAKA 3ORHA 3ETNA 1Z5VA 2OQVA 3OOYA 4DUGD 2PEZA 3O1JC 4K9PA 1OC2A 4KREA 4JT8A 1G0NA 1SB8A 2R8XA 2YHIB 1M76A 3ESQA 2OCIA 3C3BA 3AO0B 3AHEA 1TI7A 3GEMA 1OAOC 3BCUA 3PCRB 4PGMA 1E9AA 3T99A 3TQRA 1KWGA 3BCSA 2WWYA 2DUMA 3DTVB 2R9VA 3IEXA 4L2IA 4UDXX 5IDVA 2H7XA 3SQNA 3OZ7A 2D5CA 3AF3A 4Q7MB 2NTJA 5JCOC 3I01A 3WLIA 1IUPA 4BQSA 2OXIA 2AUNA 3WE7A 4WW0A 4HDNB 5L7TA 1D6JA 1JSXA 4PZYA 1SVIA 3LA8A 4FMDB 1DLJA 4B79A 1XI2A 2YWBA 4PBTA 3ZGOA 4MKRA 3OJCA 1XZNA 1JZSA 5DMHA 2JJ1A 2VTBB 3PDUA 1LPMA 3ZXIA 4DV7B 2QRGA 1OFUA 3ENWA 4M2LA 1PL0A 1E61A 2BC9A 1DHRA 1U04A 1UZUA 4IIYA 4KXVA 1TUBB 1L5HA 4PLPA 1U8ZA 4CW7A 3A4MA 4MQ5A 4QAJA 3CT4A 2YMQA 3TLMA 1MAUA 1YS9A 2O1EA 1E4YA 3A9WA 1Y5NA 2JAPA 2FR0A 2JFYA 1N5MA 2JD1A 2YXDA 2JIZA 3QVTA 3R20A 2IEAA 1ZD4A 2XCRB 2O1SA 3MAJA 4I9HA 4CNBA 2UUOA 4D9KA 4GZMA 5LCXA 1N6KA 2PGOA 3GCZA 1CERA 3K2BA 4BV9A 3F7MA 4FDVA 4FZ3A 1AB5A 1COWA 3ZCSA 4V38A 1WZ2A 3IFSA 4EELA 3P9ZA 1EQ2A 2GERA 4DNOA 1QFSA 1EDZA 5LQMA 4YO7A 1Q21A 1ZBQA 2ZI5A 5LIPA 3I9LA 3D0QA 3EVAA 1VBKA 3JARA 4LSGA 1L5NA 3ZQUA 1S2IA 4DYHA 1G6Q1 3C5CA 1V5IA 4AN1A 1Z5GA 3TE7A 1CUHA 4PC1A 5TX7A 1UOEA 3GJZA 2O8EB 4BL5A 1WPQA 3UOWA 1CHDA 1B43A 3FBTA 3N3AC 4L57A 1Z0KA 1ISPA 3FR8A 3WAGA 1DIRA 2J32A 2QT0A 2Z8XA 3QXCA 3BQMB 4IOLA 1W0KD 4Q3EA 1XJ0A 2XYHA 3I6QA 3INYA 3C6XA 5AOCA 4QHYA 3C8ZA 1RAIA 4YRCA 3EUAA 3UKJA 3WYAA 3I0ZA 1BMQA 2CGEA 4FIDA 2H5EA 2YV4A 3QLTA 1RCFA 4NOJA 5BWBA 2FB9A 4NG4A 1N6NA 4IXTA 5DP1A 1IPFA 4BO7A 1USUA 3IVMA 4JQYA 2Q3HA 3H86A 3SOPA 3BDIA 5MN5A 2E5WA 1M67A 1MB3A 2VYFA 3OT5A 4EVRA 1NV8A 5K3FB 3EVDA 5A7GA 4IG4A 5K0GA 2UYQA 1ZVMA 3M3PA 1IK4A 1R5NA 5L9AA 3P20A 5BR8B 1ZCJA 3VAYA 1KAOA 4I4IA 3C7AA 3EZ7A 2VJOA 3CF6R 3WFZA 1UP6A 3NIDB 3CW2A 1H3NA 2O20A 4XD2A 5B2ZA 2WOOA 3RASA 1D2MA 4YDHB 3AHGA 5ITWA 3P5SA 5AVTA 3L92A 4CL3A 4R1SA 2Q5LA 5ELXA 3UUFA 4DSUA 1ODLA 2GLXA 5LJLA 1Q50A 1UBUS 4M86A 4IZOA 5GZ1A 2JLWA 1FLNA 1RYYA 3HUDA 1GN9A 2I55A 4KBGA 1XD2B 4M1SA 4RIIA 3B82A 1E6LA 2WABA 5LSAA 5JCJD 3NALA 2PD3A 4PO3X 1DVRA 3RD5A 1MB9A 2LDXA 3ABIA 2I3DA 3TNDA 3LDAA 3VV2A 3Q9NA 4K9RA 1IY8A 2WC1A 3PUHA 2OBBA 4X6UA 5K45A 2IV7A 3SCZA 4X95A 2CLEB 3KQTA 4ZVTA 1YDEA 3COVA 4G09A 5I5GA 3FY4A 3ANNA 3DDSA 4DB4A 3WRYC 3AF4A 1ECLA 4CL0A 4OHRA 3THXA 5DTQA 1KIAA 2OZVA 3JAWA 4DCUA 3KDPA 1FFDA 4R1LA 4OOFA 3THRA 1AC5A 1PX2A 2NT3A 3HUUA 4S1VA 5K1ZA 4DV5B 3AH8A 1L9XA 1PTJA 1K8YB 2BIFA 1FRVA 4K6KA 4KO3S 2OCXA 4CQNA 3BJMA 5DKFA 2X6RA 4AN4A 2C2GA 2X76A 3MK31 4HVTA 4M9UA 3TJZA 5DTMA 2EP7A 2ILVA 3L79A 5JXIA 5GM2A 2EEZA 3BN3A 2O50A 3EZ9A 3UAVA 2W48A 1HE5A 4X8MA 3T9DA 1E69A 1IB6A 3BUSA 3KQPA 5TF0A 5HCUA 1OY1A 5D3MA 4ID9A 2PMFA 3L4BA 2PVCA 2O0JA 3MILA 2X3FA 1MX1A 2XDWA 4IHKA 4J6EA 4CM8A 3T3GA 3ZGZA 3ICQB 1EWKA 1R9GA 4CEIA 4O2AA 4PEVA 3WMEA 1EIWA 4MYUA 4CQMD 2FPKA 2BZGA 2VHUA 3DYIA 3DLPX 3F5DA 1X7ZB 1FPQA 1JXAA 3D6NB 5DDIP 5ALGA 3U48A 4EHAA 5JS8A 2DLNA 2J4FA 1R00A 4LMAA 5JD4A 4RGYA 3WKAA 5B4TA 3LHKA 3D7KA 4O08A 1R74A 4YRIA 3Q85A 2VLBA 3LHIA 3S27A 3TK1A 5I4IA 3FLMA 3V55A 4UASA 2XCTB 1MQSA 3OCWA 2RH5A 4G41A 3ETCA 3Q0TA 1POXA 4ZARA 2C5EA 2OZEA 3IQGX 3OPMA 4XM1A 1XQ9A 4MQ6A 1H0KA 2R1VB 2NU7B 1EGMB 2H2WA 4AXBA 2RC5A 3LLUA 1M6NA 1PEAA 3IBFA 4R1UA 3L7LA 5JSFA 1PT9A 2VDMB 4LGYA 3KTAA 4H2DA 2HGZA 1MZVA 3RYFA 1LC0A 4OYLA 3UAYA 1JAYA 2AG0A 2I03A 3ROKA 3VGJA 1T1JA 1HORA 2VK4A 3VXKA 5INTA 3L6OO 4ZVSA 1MC4A 1E1LA 4TQGA 1U5AA 7ABPA 4WCFA 3W6PA 3FJYA 2O8BA 2BP7A 4HNAB 2D5LA 1R6TA 5CPFA 4CL2A 3NDPA 2OTCA 5A5DA 2WYUA 3ZY4A 2MSDB 2V7TA 3AF1A 4FINA 3HJTA 3TQIA 4JI7B 2VUHB 1T2NA 3LBHA 1X87A 4R5MA 2D4AA 3PXDA 4XQCA 4R9SA 4Y2UA 3VZCA 1ZITA 3FBWA 3GZNA 4H3VA 3H5OA 421PA 3G8YA 2PKQO 5DTRA 3DMFA 5EG5A 1KK1A 2ERXA 1KMNA 1RI2A 2FPOA 2TYSB 3DKKA 1KIFA 3O4JA 1UFRA 2IZOA 6REQB 4LS3A 2RGNA 2JCXA 4HAOA 4G3XA 4M8KA 1ZUHA 4ZWNA 2NYRA 4R71A 4GOLD 1LRLA 2BGNA 1TJ5A 4CLRB 2IYYA 2GB4A 2ZJ2A 1RRGA 5JAZA 3BB3A 3PITA 5H81A 3L1VA 1E5TA 4OMUA 3RVNA 2OP0A 5J2UF 2D2VA 3H1PA 1RMTA 1Y8ZA 1RDFA 2D54A 1WSWA 2RC6A 4K9MA 1GUAA 4XSHA 1E9BA 3JQ9A 3DWGA 2QVXX 4Z0HO 3H19A 1IFXA 3H5IA 4D4LA 1GPWB 3ETLA 5EXDA 4DCTA 1JEQA 3BC1A 5TQ2B 1YB4A 2LKCA 3R9XA 2G76A 1TA0A 4ME6A 1OLXA 4NY1A 1GSAA 5CDGA 2WPNA 2GCGA 3KV3O 3T1HB 3CZ4A 3T3NA 1H69A 5GOZA 2OWDA 1AVTA 1KVUA 2OBFA 1NBAA 2C2ZA 3N86A 3BGWA 1PYDA 4DV4B 1QAOA 3OICA 2IXGA 5C52B 3GDWA 1OI2A 2B1GA 3ZE8A 4HNQA 3MINA 1XAHA 2Q7DA 3I0NA 3A1UA 2PU5A 4OP2A 5KVVA 4AO6A 1R5BA 2BKEA 5AKJA 3ADOA 1PIWA 5KQRA 2X7HA 1ABFA 2BL4A 4NBNA 1II9A 3IULA 1ZBDA 3KNZA 4N0EA 2DFNA 3VYVA 5GONB 1AXEA 5FUWA 1QK5A 4L78A 4LMRA 4YT2A 3KOWA 2IOFK 2AK3A 2YZMA 3N2KB 5DEIA 1ZUD1 5LB4A 2B92A 4DHEA 5GVSA 2DT5A 1JI3A 2LWIA 3QY9A 1TF5A 1WY7A 1JNYA 1ZKMA 2BFEA 2FN9A 7MDHA 4GC9A 4ZAWA 1E9SA 3WIBA 4ZO6A 4DXAA 2G06A 2NUAA 4XR4A 1CC1S 1FJHA 1U0LA 1TYDE 1JYSA 1MJHA 2ONCA 2ZG6A 3EGCA 4BEWA 4LYEA 4H6VA 3CX3A 1UAYA 3VO9A 1HYHA 1SPXA 1WUHS 2P5TB 2HA0A 3KQOA 5ALJA 4AC9A 4HN9A 5TPZD 3IKVA 4B6SA 621PA 3DLHA 3MIIA 2RAUA 5JH7A 1JB1A 5EP4A 3FFWA 3FM9A 1T91A 4G0YA 1NSTA 3HZZA 3SYNA 5EJ7A 3H18A 3VYTB 3VC7A 1EM8B 1XMPA 4AMBA 3ANMA 5EE0A 3ROXA 3DV0B 4L9RA 4LKOA 2XT6A 4YFVA 1XCMA 1EXDA 4Y2SA 3GFVA 4QBFA 2PJZA 4MI3A 3UHAA 2AZMA 3M9LA 5AVQA 16PKA 4C2TA 1ZJ4A 4TMZA 1PR5A 1QVWA 3O03A 1GRCA 7AT1A 3IMFA 4B9AA 4ISBA 4PX3A 1KDRA 1JFFA 2YWJA 3TAXA 2FSSA 3NW9A 1VYVA 2MSLA 3WI7A 5IHPA 3KJGA 1A72A 4IS3A 4LJYA 4LXQA 3CZCA 4DZZA 1U7DA 2OEPA 4NU0A 2WF7A 2OK7A 4C20A 3RRFA 2VF8A 3AX6A 1IZYA 1Y3BE 3NUQA 2Y2UA 4IGIA 3VH4A 5EN4A 2IEDA 2L0XA 4YXWD 2ZXUA 1GQOA 3PX3A 3VISA 5E9WA 2I5PO 1E8DA 4B4KA 4G4SO 2GHIA 4ARVA 4TVOA 1IHXA 1JQBA 3NC4A 4DFDA 1HT3A 3RAJA 3U3KA 2JGLA 2ZUEA 5AM3A 1K5DA 2R62A 3VO1A 4KHPB 2PBFA 3SYTA 4A0FA 4XJXA 3H13A 2JGJA 3MWJA 3BD8A 4PANA 4BVAA 5DLPA 2VKQA 1UC4B 2CHQA 2EKZA 2HKIA 4Q93A 4RAQA 5L4NA 2XE8A 2QB5A 3ZWYA 4HQFA 4OXIA 1HEUA 1CYDA 3GJ4A 4HLCA 3TUIC 3BK7A 3LCRA 2CFIA 1WCXA 4H27A 4TWRA 3VVBA 1QC5B 3TE6A 2V3VA 2P6OA 2Z9DA 4E22A 5B5SA 1JLSA 1EGVB 3BTUA 4KXUA 2HCBA 4W5RA 1ST3A 1WOMA 4FEEA 1C3LA 2ZIVB 1ML4A 3WHLA 2C78A 4LJ4A 4OSEA 2EIHA 1KJZA 5DFAA 4HR7A 3KVNA 4H31A 4ZOLA 4AL4A 4ABTA 4CG1A 5HX7A 2YV2A 1CUEA 4AP6A 2GSWA 1B4DA 2XA1A 5DBGA 3NHSA 1E1NA 4IJQA 4B9EA 4TMXA 4YRGA 4P84A 4QQ8A 4X3OA 5A5FA 5BN3B 5JEEA 3TL6A 3HCDA 4JKOA 1UM9B 2PZLA 4P34A 3ZH2A 1FW6A 1C8VB 2BMEA 1ZJ6A 2ZVPX 3CLSC 3K09A 1LU9A 2P5UA 5DU2A 3UFXB 3T52A 2KQUA 1NJFA 3IT0A 5EWMA 2D3TA 4MIEA 2FF7A 1SY7A 5B4VA 3RC2A 3LFHA 2WUFA 1X7HA 5FI5A 4MS3A 3TG2A 4F9EA 5EQDA 4D0GA 3GJ6A 2J5RA 3CQ9A 4U1RA 2IHYA 3O8NA 1E99A 5KSPA 3EZNA 5F98A 5F51A 3HYLA 1E4OA 4YACA 1C4WA 4DCPA 2DUUA 1HY3A 1KI8A 1S2MA 4QXRA 5BQXA 3HGQA 3JTMA 2LGJA 3KU4A 3ZHXA 3OPNA 1RRKA 3LL4A 2FLWA 3K70B 3ZU3A 2LP4Y 4G2TA 4ZI5A 2FEAA 1W36C 1RIIA 4URHA 4HNUA 1TRHA 4QFCA 5A05A 4QTZA 4MVCA 1M1NA 1WP4A 5KTMA 3DHWC 1YOVA 3QWFA 2JDIA 4YHHB 1PR3A 5E4FA 2H00A 3ZE7A 3V8PA 3MT8A 5LL6P 1PL8A 2FWMX 1P2FA 5JSZB 2R86A 3ASVA 3DR5A 1KOLA 5F9FA 3QE3A 2JD2A 3N07A 1NX9A 1OBVA 2QQ0A 1DRUA 2JFNA 2HZBA 3OX2A 4ZYLA 4L02A 4YP7A 5LQCA 4ZAFA 2PH5A 3RVQA 1Z0ZA 1CJBA 4IW3B 2A86A 4Y6OA 3W1VA 1PVDA 4BHTA 1ILEA 2GXSA 2R96A 2XWQA 3AXTA 3A1DA 1XSEA 1N57A 3D64A 2WY2D 2VRCA 3EK2A 4LI3X 2Z95A 3R40A 5FKJA 3OQBA 3W5HA 4NWIA 3D4NA 3H3JA 4N76A 4ZJYA 3KL2A 3RTDA 2HHLA 1K06A 4KFUA 4G9BA 3V00A 2A94A 3HM9A 4OQQA 4LE1A 4JYPA 1XL0A 2RK6A 3BS4A 3KTOA 3ZWDA 4BN0A 1PDOA 5ESXA 1C1XB 1ZK1A 2Q29A 4KX3A 5I9MA 4DDKA 4IWYA 2F4VB 1L4BA 4L85A 2XR1A 3IT1A 3IO3A 1TOAA 1R0RE 1Y3FE 1OJLA 2UVQA 4XUDA 2OC9A 1ZL2A 4HAZA 3LO8A 3HNPA 1IUKA 1I01A 3IODA 2C2HA 4O2AF 4UM8B 4U5QA 1TVEA 1T13A 4YAJA 3NFYA 4K9DA 3F73A 3CWQA 1D9ZA 4HYEA 2NP7A 4EDFA 1KC3A 3GPDG 9ABPA 3QVJA 3MOGA 1C0KA 4E30A 3FCUB 1E2KA 1E77A 3BIFA 2YZ7A 1ONSA 3AEKB 4EVQA 4NXNB 4CU5A 1WSBA 4WGGA 4OFZA 2Q0XA 5JG7A 3DM5A 2A9QA 3REFA 1NNUA 1UZAA 1Z6TA 2FETA 2EBHX 3OP1A 5CXQA 2DVMA 1OFVA 1AMUA 3V9PA 2IJGX 3VC3A 3TVTA 2C4WA 1TU4A 3TSZA 2B3TA 3OZGA 4IJVA 4KVZA 1W2WB 3QV1A 4LDJA 4UJ5A 1FFHA 2Y1EA 4J3FA 1LNQA 3D2LA 5EPEA 1Q11A 3AVPA 3A58B 3QW2A 4BS9A 2PJDA 4NFLA 2WJGA 2WIGA 5GADl 2PGJA 1USIA 4TKVA 1RP7A 2SBTA 5IAKA 5TSDA 4E5NA 5EWJB 1HDCA 4Q00A 1M75A 2FF5A 4ARAA 2QX7A 1IPEA 2WAAA 3M4XA 2YIMA 1E6UA 4RPIA 3T5MA 3WNVA 4B73A 4E11A 5IT9A 1MG5A 1EHYA 1Z06A 4TT3D 3WBJA 3ZH9B 5BMOA 3I5UA 2GN1A 4LXGA 5FBVB 5JWRA 2I29A 1LK0A 4NU6A 2RAFA 2X0NA 4OK3A 3HCEA 4R3NA 4BJ6A 3WGIA 5BUSA 3L7CA 3DTNA 1XVTA 4E5KA 1QZXA 2FPLA 3OZEA 2ODQA 5L6MB 2YNMD 4RIFA 2GEVA 4U8HA 2OXFA 3U7FB 2QTCA 3A0UA 4RA6A 1OFIA 5FR2A 2FPGB 5BWLA 1FW8A 1X9HA 1SCKA 4JA2A 4DUPA 4EHJA 3ILVA 1CFZA 2OXCA 1QUFA 5A0FA 5IUNC 3GJYA 3GJ7A 4TVBA 1ADFA 4G1CA 1CXZA 3LX4A 4EI7A 1YMQA 1QZUA 3S2FA 4B3DA 4QKQA 4UPEA 5KYUA 4FCVA 4DHWA 5FJJA 4F8JA 4W7HA 2WMYA 1D6NA 1KU6A 1NE7A 3BJIC 2VHZA 4PHGA 4OG2A 4M0CA 2TMYA 1L5OA 3SXPA 5LJIA 2B82A 4G0XA 4YMSA 4M36A 4KCGA 2GCNA 1VSTA 4JP8A 2OZLA 1WXQA 4M76B 1Z5OA 4NOKA 3R0VA 2PEYA 2WDPA 4YONB 1JU3A 1NXTA 5ITZA 2ZRQA 1B00A 3FNHA 5M3BA 3U7GA 3EX7C 5AH0A 5FWXB 1C2YA 2X22A 3O0DA 1SA0A 2YFHA 2RB5A 3ZI4A 3DXFA 1F2UB 3ZDXB 3VX3A 3WMRA 3QLVA 3M70A 2RBKA 3C7TA 2PS0A 5IBRA 5JHHB 2G1JA 1SNYA 1RXWA 2B94A 4HXFB 5EIOA 1XPJA 2RGWA 2Q99A 1PKEA 3M82A 2VJDA 5AFSA 2M6KA 1NDQA 1PEDA 3DONA 1PHPA 3HP7A 4M87A 2CBGA 2J9XB 3CUSA 5KWJA 3BSSA 1DDOA 4K8OA 3NEPX 3MA0A 5L45A 2ZJFA 1T0IA 2PUTA 3NHLA 3R3UA 1PJLA 1KGDA 3ON5A 3ER8A 1W87A 2Z0MA 1HM5A 4RVSA 1T9GS 3VYWA 4LVUA 1QFXA 2AG6A 2DM6A 3JQFC 3VJLA 5FT9A 2IH2A 1YU9A 3S2EA 3CLRC 5DLDA 1IUOA 5EUCA 4FE3A 4OM7A 4XOUA 1WXHA 2WKWA 3HWRA 5IULC 5JJLA 3G2PA 4C7MA 2OC4A 2QJTA 3I2FA 4ZVRA 4LCBA 3CPEA 1PZMA 3VR4A 1E1CB 3O92A 2ZR0A 3N2GB 3T9EA 1MDFA 3WYFA 4Q4DA 3U56A 5CVEA 2RHMA 5F77A 3TQFA 1UC5B 4FN5A 4HMPA 3H4IA 4AWAA 1K4YA 2GSDA 3U3RA 2MR6A 2XKKA 3GVPA 1URPA 4MWEA 1KFBB 3O1IC 4MV9A 3OQHA 1EK6A 1H0SA 3PLAE 4AKIA 1Y89A 2GJ8A 3BT7A 3SBDA 4KLRA 2P91A 2LUOA 3I92A 1QLWA 3IAM1 2QP9X 1S3IA 4LHWA 1DXOA 2NO0A 1SQFA 2HCFA 3BGOS 4FXPA 2E21A 2QDKA 1W1WA 2XJ4A 5ERYA 3K5HA 2ZI9A 4MYHA 2PZJA 2OESA 2WP0A 3D6AA 1OX4A 3ZWCA 4ZMRA 3U60B 2O2ZA 3HB1A 5DHTA 4F6RA 1R4NA 1OAOA 3KHKA 5KVQA 1PZHA 1KEZA 5BYBA 3WMXA 4B5LA 1G1AA 3W8NA 4KO2S 2C5BA 4HQ0A 3VNAA 2R1TB 3AOEC 1RBMA 5JCOA 3TRJA 3GLVA 4I5IA 2AFIA 2V4UA 5F7OA 2VDKB 4PTLA 1ORWA 2J3IA 2UVPA 4UKDA 3ZVRA 1VGVA 4XPIB 4DV0B 3QE9Y 1OXXK 3T1YB 5EIFA 3L1HA 1FUYB 3HG7A 4P3YA 4QGBA 5CVJA 5J59A 3U3DA 4UOZA 1E92A 3ML1A 4KXYA 2DBVO 2FPPB 3BWEA 4UUOA 3EF0A 4POOA 4DDUA 3NXKA 4MHSA 5CLHA 3TQQA 4U4AA 3KKMA 2QTZA 4Z0TA 4WLFA 4TT8A 2NU9B 4E15A 1HE2A 4HRVA 3MMXA 2P7IA 4HEA1 5IZ4A 4WOBA 2PWAA 3O4HA 3OG9A 3T7DA 4E51A 1HQKA 3IKJA 1HOXA 1F8GA 3R5TA 1M5UA 3IIKA 4CQLB 1ETUA 3IEPA 2J30A 4GLOA 3SS9X 5GPBA 3I2GA 3E9ZA 2CN1A 1W4ZA 3H04A 4P0QB 3S8MA 2IYWA 4M9SA 2QM3A 2GEJA 2R7LA 1DJPA 2Q5JA 2ZBUA 4JDUA 4NMXB 4QT0A 4OP1A 4EFMA 4KDRA 2OFXA 4KXWA 1Z17A 4TMWA 4FOPA 3RU2A 2AMFA 1WQ4A 3L7IA 4EPXA 4S2EA 2H4YA 4MA0A 4QPNA 3DB2A 2GCEA 4BPRA 3VZBA 4H6WA 5DGXA 3NWPA 5JISA 4FE4A 2BTQA 4TVSA 1M8GA 1NVUQ 3QE2A 4AMVA 1Z0FA 6LDHA 1T1EA 1XD8A 1WPXA 2GKOA 1XDSA 2VRWA 3CSSA 4UHKA 2IYXA 4X6XA 4RTSA 1ZUWA 3F4LA 3U6BA 1V7PC 3VFDA 4ZOLF 3TLXA 2VKTA 3OE7A 3QUCA 1A82A 1KAQA 1OGIA 3LP8A 4PXSA 3TNFA 1KFKB 3P2KA 4YBRA 5LQKA 5LXTA 5FL3A 3I28A 2ZYIA 5AM4A 5TE9A 2ZBVA 4M55A 1L5QA 2OBMA 2WU3A 1KHTA 4R2LA 1NFQA 3PHLA 4UOQA 5B37A 3NKFA 5K2MA 4TZ0A 3R6DA 4OJYA 4NJMA 3E9NA 4KKVA 2YHUA 2VHYA 5C1PA 5C8YA 1K2VN 4FX5A 5P8WA 3FG9A 5AHXA 5KJ6A 1J99A 3I2JA 4KQJA 2TRSB 2YMMA 1ZW1A 1WB4A 1O95D 1NPTO 1Z63A 4YHBA 2JLVA 4PAWA 1EFVA 3RAGA 2BMFA 2CE7A 1OHHD 3C74A 3DLCA 2QM0A 4HYYA 5DHRA 5FBRB 1KH2A 5EHIA 1ND5A 1UJ2A 4UE6A 3ZY3A 1E0AA 3WP0A 1NULA 3I45A 4BNGA 1TK9A 5ES4B 1D2HA 5KWSA 3RT1A 2ZPUA 4P7JA 2W8BB 3QXXA 3ZVNA 2IS4A 2OCYC 3ENVA 5AI6A 1ORTA 3B20A 4O2BB 2JLRA 1SVKA 2FUEA 2JRLA 2WM2A 4WNCA 1IDOA 2J41A 1LUAA 5HR5A 4M6WB 3T3PB 1RPNA 2HK7A 1IXZA 1W6UA 2AFIE 4XX1A 3DCIA 1NFFA 3N0TA 4Q9IA 1NJ2A 3CLUD 3LUCA 1V25A 3MRSA 5TEWA 1P9LA 1NW7A 2YHIA 3D1VA 2VUIB 4EG5A 3VDRA 4M1KA 3THWA 2XTJA 4PYMA 1HURA 4ISCA 2AJBA 1RWMA 5KHOC 5F4ZA 3DTVA 1Q57A 1GA1A 1FS6A 3EIEA 2CLKB 2QDXA 5BSTA 2V5VA 5D01A 3OCZA 4CQJA 2HU5A 4G1FA 4TS3A 1L6RA 2Z5FA 3CLTC 2OHJA 3D8SA 4HEJA 5DRYA 5KJEA 3RS3A 3SS7X 4HDNA 4MPTA 4RL6A 1IBLB 1GZSA