3FFXA

Crystal structure of chey triple mutant f14e, n59r, e89h complexed with bef3- and mn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDESTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELLKTIRADGAMSALPVLMVTAHAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Matching Biochemical Reaction Kinetics to the Timescales of Life: Structural Determinants That Influence the Autodephosphorylation Rate of Response Regulator Proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ffxA00
4MS3B 3KLNA 3IDOA 4WUTA 2PKXA 4G0MA 1GLGA 4EVQA 2FEPA 4G0PA 1DC8A 3HZHA 4KPYA 4YO7A 1EHCA 4MS4A 4EY3A 2IYNA 1FFSA 4KQCA 1JYFA 1P8AA 4XXHA 5KQMA 2GX6A 4JB0A 1USGA 5E3JA 3OMWA 3H6GA 5FBKA 3K4HA 3HS3A 4F06A 3CKMA 2MYNA 3RVSA 1C0EA 4RU1A 2WMYA 1JFVA 3H5OA 1I3CA 1D5WA 1GUBA 4P98A 5JS2A 5JNTA 2A9QA 4IF4A 1QMPA 2LP4Y 3QELB 3HJFA 3GL9A 1Z2DA 5FWYB 1ISRA 4FE4A 2PUAA 1NY5A 2M98A 4JASB 3DLHA 4N41A 3T38A 3H1EA 4GPAA 1QNLA 3H5TA 1Z13A 1NXOA 5KC8A 1H9CA 2FQYA 3MMNA 5JNUA 1USKA 5EWMB 1QP4A 1JYEA 4MS1A 4WT7A 3M9XA 4MQEB 4Q7EA 2A9PA 1U8TA 5GQSA 3GBPA 5FWYA 3H1FA 2E4VA 3GYBA 3EQ2A 1VKRA 3S99A 1J56A 4OLAA 3OQMA 1JWLA 4KVFA 3KHTA 2GI4A 2HQBA 4F12A 1TLFA 2FKAA 3OO0A 3D02A 4G86A 4MAAA 4MQEA 3C3WA 1L5ZA 3FGZA 3RVKA 2R4QA 5KQPA 1GCGA 4G97A 3L49A 3CFYA 1ZVVA 5TPWB 1D1PA 1BAPA 4QPJC 2MYPA 3KLOA 1FQWA 4ZMSA 4RXUA 5B3JC 3HM9A 4O1IA 1NXSA 3C6QA 4JB2A 1E6LA 1JH9A 2IDMA 3GBVA 2VYCA 3LUCA 3NNNA 3I5AA 5TPWA 4RWEA 1NXTA 4HNQA 3N53A 5PNTA 2OENG 4W5OA 1ZH4A 1NXVA 2L18A 3QEMB 1IIBA 5KI6A 3JTEA 1MB3A 2NT3A 3IPCA 1RNLA 3DZDA 4EYKA 1K66A 5I4CA 2L19A 3N0RA 8ABPA 2FQWA 2FW0A 3EDCA 3FDFA 3KTOA 4ZPJA 5KQLA 3QEMA 5DCLA 4O5AA 1FSPA 4PEVA 5TQ2B 4Z4EA 1Z25A 2B4AA 1RXEA 3JY6A 5KC9A 5CNMA 2JK1A 5BQ3A 1APBA 1YVUA 4H3KB 1JL3A 3ROFA 2FMIA 2FEWB 2IPMA 2OQRA 2GBPA 4MQFA 4EYQA 5TQ2A 2PUBA 4QYWA 3KSMA 2X7XA 4Z4FA 3G1WA 5F64A 3NBMA 3MYYA 4N47A 3CTPA 2ID7A 4LE0A 5GOTA 5TPZA 4E7OA 2FN8A 1F4VA 2FN9A 4PZ0A 4LX8A 3RVQA 5JNRA 6CHYA 4QICA 5JNSA 3C3MA 3OLXA 2YHAA 3H5IA 4OTZA 4Z4HA 3FMVA 3N0XA 3Q7RA 1YK0A 3OO1A 4N0QA 4FB4A 2PUEA 1VLZA 2QVCA 3SQNA 1BDJA 3LUAA 5JNVA 3H5WA 2FTKE 3EQZA 4XASA 4KK4A 2L17A 4RKQA 5DGCA 1RXIA 4W5QA 3RVOA 3HUTA 4TN5A 5C5EA 5EWLA 2JVJA 5CNKA 1VPWA 2MYUA 3E3MA 2H3HA 3UKJA 1QKKA 3DGFC 1JHZA 5T3YA 3TMYA 1ZITA 3EAFA 5T7BA 4KQ9A 5TQ0A 3A0RB 3F6PA 1A0OA 4MS4B 1GUDA 4H60A 1BA2A 4RXTA 3MF4A 2P4UA 2JB9A 3ILHA 4MR8A 3RVMA 2VUIB 3H6HA 3HSYA 4D6YA 2GKGA 3O75A 1KGSA 1QPZA 3LTEA 3F7NA 1D2AA 5EWJA 3RVLA 5HSGA 2E4ZA 2E4YA 3KYJB 4F11A 1RZRD 3O2JA 4HNRA 3Q7SA 4ML3A 3GWGA 1Z15A 1CEYA 2QSJA 2M1ZA 3KKEA 4ZJPA 1CYEA 4KFCA 3KYIB 3LUHA 4XAQA 2FVYA 4L4UA 4IMIB 4RK7A 2ID9A 4RK1A 4Y9TA 4Q6WA 5CNJA 4MS1B 3T8YA 5C5CA 7ABPA 3LMKA 4Z4GA 1CHNA 3CNBA 3JVDA 1YS7A 1U2PA 4M88A 1JF8A 3SAJA 1PNTA 2E4UA 2VUHB 4WZZA 3HK2A 3F73A 4RXMA 1Z17A 5ABPA 4EYOA 1Z2EA 2FLKA 2JVKA 2LUOA 4TLMB 4XFKA 1M2EA 2FEKA 5FBHA 3OLYA 6ABPA 4MRMA 4ETMA 4GNRA 4XARA 4W5TA 3HXMA 1DG9A 1XHEA 1JDNA 1U2QA 4LZLA 5JNWA 1Z16A 3QLVA 5IUNC 4W5RA 3CLKA 3T6KA 3JPYA 3R0JA 1BDIA 3D8UA 1MB0A 2W42A 3UUGA 4EUKA 4YR7A 2RJNA 4FE7A 1NATA 1R8JA 1SXIA 3BBLA 4G0YA 2R48A 3NHMA 3CRNA 4RY0A 4RZSA 1ZGZA 1OXKB 1EAYA 3GA5A 4YP9A 3LOPA 5IUKC 1PNRA 1JFTA 4NCAA 1DBQA 3FFWA 4HYEA 3DLBA 4N76A 4G0QA 3JVIA 1PEYA 2IPLA 4DN6A 4EVRA 1SXGA 2MYTA 1YMVA 3EULA 3DBIA 3HVRA 4MYRA 3LUGA 2CHFA 2J48A 1P6UA 2ZAYA 3O74A 2MSKA 4HNSA 1MIHA 4NICA 1SXHA 1KMIY 2GWRA 3IP5A 4DADA 1LJUA 1EWVA 1QO0D 5CNIA 2QXYA 3HDGA 3NNDA 1ZY2A 3OLWA 4MQFB 4G0ZA 3KCNA 1SD5A 2QZJA 2F8SA 3MIZA 4YGXB 5HQJA 1ZH2A 2A9RA 3T95A 1ZDMA 3N0WA 4DQDA 3RVPA 2WRZA 4EGSA 5BRAA 1F51E 4IMJB 2H0AA 2E4WA 2FSPA 4KV7A 4OATA 1ZHHA 2JCGA 2PUCA 3NNSA 1NXXA 1PHRA 2LIVA 3BRSA 1D4ZA 1USIA 5ED4A 3LUKA 1DRKA 1DRJA 3IP6A 4L85A 3KJXA 4RDCA 4JA2A 1ABFA 4QYMA 1M5UA 1KRWA 4RY8A 4G0OA 1NXPA 2PLNA 2HQRA 2PMCA 4OLBA 4MGEA 5KQGA 3O1IC 1W25A 3OM1A 5EWLB 3CG0A 3SG0A 4W5NA 2NZUG 1QP0A 1JDPA 2QR3A 3Q9SA 1TMYA 5HKOA 1ZESA 1YIOA 3DGEC 1QO0A 2WJAA 1MAVA 4O1HA 2PAFA 1FFGA 4UHKA 3HEBA 5TQ0B 1TM2A 1ZAYA 2L2QA 5IEBA 4MR8B 1EWTA 1NTRA 1AB5A 2NZVG 3CZCA 3H5LA 3HUUA 4LRQA 1DJMA 1HEYA 4PYRA 4D6XA 2R25B 3N75A 4NQRA 2QW1A 5EWJB 1ZGGA 3OM0A 2PE5A 2PJUA 2JBAA 3JPWA 4OG2A 2IPAB 3LUFA 4Z99A 5KWSA 1EWKA 2KYRA 2AYZA 3FFTA 4RK4A 1DBPA 4ZMRA 5HM6A 3GRCA 3LFTA 2DRIA 4OBBA 5DTEA 3MQ4A 3ILYA 2P9HA 4TLLB 3GT7A 1D1QA 1YS6A 2RJOA 4KRFA 3OMXA 2FXIA 3A10A 3QLUC 3LUJA 3G85A 4MLDA 4PE5B 4LDAA 4F3TA 3LKVA 4ETIA 2O20A 1B00A 3M9WA 2CD7A 4G0XA 2LBPA 3O2SB 4JP1A 2LPMA 1DZ3A 4XLTA 4YV7A 3UK0A 3CZ5A 2CWDA 1WETA 1JLKA 4MRMB 1DCKA 4UHJA 1YMUA 4ZYLA 3QX9A 1PEAA 3IP9A 4MS3A 2RDMA 4TMYA 4Z4CA 1E6MA 4S04A 3MA0A 5DLEA 3KG2A 3Q7TA 1BVHA 1AB6A 1UDRA 1ZN2A 4LDZA 4Z4IA 2I6FA 3C3KA 1LJLA 1RPJA 1ISSA 3Q41A 4RK5A 2YHBA 3IP7A 3H5VA 1U0SY 5D2CA 4Z0NA 1EFAA 2PUDA 4Q6BA 2F8TA 3N6VA 5CHYA 4RKRA 2FMHA 2A9OA 1DCMA 1Z18A 3P9YA 2Q5CA 4P1ZA 2WWVD 3N8IA 3URMA 4EVSA 5B3JA 1M5TA 2HPHA 3QEKA 4D74A 3BRQA 3HO1A 1RZRA 4RY9A 1Z12A 1W9HA 2JVIA 5TQJA 1PUXA 1BDHA 3QELA 2HJ9A 1DCFA 4IILA 2IPNA 1XWWA 4IRXA 4YRZA 1XHFA 1YK1A 3QLTA 4N03A 3A0UA 2TMYA 2XDYA 1LBHA 4KNYA 2FLWA 3QLVC 5EWMA 3I09A 3JS5A 5BRJA 2MSWA 1MVOA 1Z26A 2WB4A 4EYGA 1QQAA 1Y1LA 3KS9A 4MPTA 1SRRA 1S8NA 2B1JA 4RSMA 3RVJA 4N0PA 1A2OA 1T34A 4KZKA 4KMRA 3A3KA 3HV2A 1NXWA 2JRLA 4MLCA 4NV3A 1JX6A 3O1JC 3TO5A 1E2BA 3H1GA 4MR9B 5TPZD 4RK6A 1P6QA 1L5YA 1LBIA 2PUGA 5JS1A 4RS3A 3BREA 2ZWMA 3EJWA 3QX8A 3E61A 2FQXA 1GCAA 1JFSA 3RVRA 3F6CA 1M2FA 3O1HB 4YS6A 4MR9A 3VNAA 1TJYA 2HQOA 5FWXB 3I42A 1A04A 3NHZA 3EODA 3HDVA 3SNKA 3VNBA 2QU7A 1KRXA 3CHYA 1OXBB 3Q15C 5TE9A 3EGCA 3ROTA 1DP4A 4E7PA 3O21A 4PICA 5IUJC 3HCWA 5FWXA 4ETNA 2R47A 2V0NA 2VK2A 2FMKA 1DBWA 2FMFA 2N9UA 3FFXA 4WXMA 2RGYA 5BR1A 1DC7A 3I45A 2QV0A 4WXEA 2PUFA 3L6UA 2MSLA 3CU5A 5IX8A 2IKSA 3C97A 1VRVA 3O2QB 3H75A 2WJWA 3IPAA 2NUBA 4KREA 2E4XA 2WY2D 1YTUA 4JAVC 2BGGA 1C4WA 4Z9AA 3TX6A 3K9CA 2JBAB 4MR7B 3RH0A 1TVMA 5IULC 3LKBA 1U04A 1FFWA 2PL1A 4CBVA 1JBEA 2CHEA 3CS3A 3BILA 4RV5A 5DKFA 3QK7A 3B2NA 1URPA 3RVNA 3OLVA 3OQNA 4MR7A 4B09A 4S05A 4WWHA 4F8JA 5IBQA 4IGAA 4YWHA 3RQIA 3TB6A 3W9SA 1P2FA 2NT4A 4YCSA 3GV0A 2PL9A 1ABEA 3MM4A 3SY8A 1QP7A 1QQBA 3M6MD 1LK0A 3QLUA 4H3HB 2QVGA 3LUDA 3OLZA 2AYXA 1E6KA 4NCBA 4YLEA 4LE2A 5IEJA 3OQOA 1K68A 4JOQA 3SM9A 3CG4A 2HSGA 2IOYA 4Z9BA 5IC5A 4RK0A 4KK3A 9ABPA 4LE1A 3TD9A
chains in the Genus database with same CATH superfamily
3NTVA 2SKDA 4CMCA 1QORA 4YWJA 1BJTA 3TUJC 2HMUA 4G0PA 4IH9A 3T5MA 4CLEA 1LBTA 1M3SA 3HZHA 3JWJA 4UE3S 1Y8RB 4MYDA 4Q4HB 3WGYA 1B6TA 1JXQA 3PKIA 3C1AA 3EXHB 4NI5A 1FDSA 3C5WP 1JYFA 3DP7A 1EQ2A 2ETVA 1H2FA 3OH8A 3O8LA 1CUZA 5M3BA 1B8UA 3NOXA 5KJCA 5E6RA 2EARA 2JAPA 1FPMA 1SC6A 2ZSAA 4DS3A 1E2FA 2WUEA 4G9EA 2C7VA 4R4JA 2A33A 1D5CA 3SDZA 1QOQB 3WYEA 4HRVA 4W8HA 3COWA 3KSDO 5H9WA 4CKCA 4QJ3A 1DXHA 4YJGA 3C7AA 4WACA 2O1EA 5D1NA 4KAJA 4MAFA 4LJ6A 1Z2DA 1K6XA 2V6MA 2JGFA 1V6CA 3B53X 4XIIA 2YDYA 3ESBA 2X0DA 3GP8A 2H7CA 2IXGA 3H2SA 1KZ9A 1TIPA 2EBWA 1USKA 5KNCH 4G5SA 1PG2A 1ZXXA 3PR2B 5AW0A 3GCWA 1AKUA 4OXIA 1A88A 5BR8B 2LKCA 4DLXA 1FDIA 1JQEA 1E9EA 1EMDA 1QANA 3GCGA 3ND7A 1EVLA 3F2IA 1J56A 3G8AA 4QOIA 2Q4TA 4KGDA 1AIPA 5MGBA 1OLUB 3VU9A 3OQMA 3KCQA 1XALA 2GI4A 4F12A 2YQ4A 3K4QA 4KP7A 3B70A 1Q7GA 3MT8A 2FKAA 1QFXA 2NO4A 2O7NA 3WGZA 3IPLA 3VYWA 1OVGA 1Q1GA 1QHGA 4EDHA 3PNKA 5K0EA 3SVTA 4PXYA 3TUZC 1CIVA 3H4VA 5REQB 3HA7A 2BKEA 4JSYA 5CW2A 3JQEA 4B6JA 1BJRE 1SXJD 2Z3VA 3VU3A 4TL7A 4MW2A 4RD0A 3B7WA 4TKVA 1FY2A 4X1OA 1NXSA 4R2IA 4YAOA 4NAUA 1G9XA 4GX2A 1T9AA 4YUWA 3GUUA 4CXMA 2XNJA 3IB3A 3LC0A 4OPMA 4C6SA 4F9TA 1Q16A 2ZJ4A 4QFDA 3I4CA 1RI4A 4FYJA 3F4KA 2Q6IA 1B73A 5JV5A 3H0CA 1V5FA 4QU0A 3TZLA 1ZOLA 4QRHA 4XUEA 3VBCA 2V96A 5AI9A 5EHGA 3VTZA 2H9IA 3RGWS 2C7PA 1A98A 2R4UA 5JVDB 1WP9A 2NT3A 2QZPA 4BMVA 4ZREA 3ELBA 3L0BA 2IYQA 2L19A 3IQXA 4CNQA 1PGJA 3KTOA 4EKGA 3QEMA 2FW1A 1Q44A 2GK3A 4RADA 3ICWA 2ACKA 4Z4EA 2VCHA 5DSXA 5KYVA 3SJ7A 4BC1A 4B4VA 3UK7A 1CZKA 2W58A 4ZTZB 3UYKA 5CFPA 5IJXA 2XA9A 3IAEA 4CTJA 4KR0A 1WMFA 4O0MA 1K8XB 1KQ3A 3O2NA 4JENA 2CLEB 3HWX1 3WQBA 2P5YA 3DE2X 3LBIA 1JNXX 3MTBA 2FFBA 5FCDA 1ORTA 3AL2A 3G1WA 3H2HA 2GTHA 4IM7A 3RAGA 3ZYZA 4DDUA 4BO3A 5IYZA 3UH1A 4TZ6A 4YX9A 1MG0A 2BDUA 1ENYA 1WUKS 4R1SA 4RF2A 2XDAA 2V7QA 2XWJI 3BJRA 4P2BA 4FYYA 4Y8VA 3W3AH 4DRYA 4JBNA 2ID7A 4P80A 5C5IA 5CBPB 4Y9RA 4TZKA 4HVTA 1JKJB 4MVJH 4R1UA 4GE0A 5FJIA 3EXEA 3RVQA 1K7SN 5AHXA 1YA4A 4WPGA 5JNSA 1P1RA 3OZCA 3O82A 1M1NA 5ELMA 3T3NA 3HKBA 1Z3IX 2VRNA 3FMVA 2VZEA 1UJ2A 1A9XA 1W29A 2ZITA 1AKRA 1WBDA 3FPFA 2AHOA 4JEUA 2C99A 3KO8A 2NVUA 5JNVA 5DE3A 4XIFA 2FTKE 4Q47A 4EK9A 5KKNB 4DQUA 3EQ7A 4QUHA 4W9RA 5IJWA 1RXIA 5TT1A 3SDSA 5LN1A 3NHPA 3TDMA 3M34A 4E51A 3SIPA 5C8XA 4A36A 4IXWA 4ZDWA 3C8DA 2MHCA 2P7IA 3GFGA 1K8QA 4H31A 4MV5A 1AOXA 1M6NA 4OYLA 2IEIA 4P5DA 3UKJA 2QAJA 4AICA 1HE1C 2XXBA 2H5IA 5E7QA 4US0R 3B6MA 3QVXA 1MX9A 3RF7A 4KWCA 4C0SA 4L9AA 1U9JA 1OXMA 3R7WB 1QOZA 2PVCA 5E6UA 1I3LA 1V5IA 1JDVA 4XDGA 3R2JA 1JFRA 1SZDA 4MS4B 5TQ0A 2I6TA 4J7XA 1QZUA 1UPXA 1WVMA 2JFPA 3FUCA 1JVNA 4ZK6A 1JEQB 5I3CA 4F9GA 2XRFA 5T3UA 5TMBA 2IC5A 1V9LA 2PJDA 4P4LA 4J6EA 1F6BA 4UHFA 1GFWA 3RC8A 2ZE7A 3OFJA 4LKRA 1WXWA 1QPZA 2FPWA 2P78A 4K7JA 3O4JA 1V1JA 4NMLA 4HAIA 2WIKA 3H3XA 5JZ9A 1CF2O 3LP5A 3WWYA 5JU6A 1DDGA 3Q7SA 4IKPA 3OOEA 2OGUA 4C2UA 2AT1A 1XEAA 1Z15A 3A4MA 3HN7A 3N39C 4D8YA 1MJ5A 4OHWA 4UASA 5HGJA 1CYEA 2X0JA 4XAQA 5A3JA 1C4XA 4PHHA 4RK7A 3C5EA 5IKPA 1KMMA 5AW1A 3VYSB 3NKLA 4JGBA 5HOEA 3QWBA 3SYNA 5FTKA 1ZH0A 2BMVA 2ZTLA 1DS6A 3LL7A 1O6FA 2EDAA 4EITA 1EUYA 1ETUA 1BJKA 4H3VA 1HDYA 3RPEA 2LUOA 4IJ6A 2H29A 1K7EB 4AX4A 5G4LA 1R4MA 3HJTA 4RO0A 1X7XA 5A06A 3O4FA 2YNMD 2H1RA 1GQSA 3ABRB 1U2QA 2PQMA 4HGYA 3PTLA 2IU6A 4FEGA 1PR3A 4LZLA 5JNWA 3I76A 2VA8A 4W5RA 3HY6A 3TQCA 2YRWA 4J90A 4WOJA 5EIOA 1JB1A 5LQCA 1Z3CA 5JWHA 2XCRB 4DV2B 3M4JA 4X1KA 1YZVA 1MB0A 2W42A 2VFAA 5G02A 5DBGA 1SXIA 4AO8A 1UDXA 2J08A 3DJYA 4JFRA 5B2FA 2CDNA 3GLQA 3IKVA 3L7AA 1Y4SA 3G6WA 2FDRA 1QFSA 3LOPA 5DOVA 4YP9A 3D5QA 1POWA 3B36A 1NPTO 5K9ZA 5IAEA 4CKWB 3EXIB 1JFTA 3K0EA 2ZAMA 2EEPA 3DXXA 1UM8A 1BXKA 3LXUX 3ENWA 3RRFA 2AR9A 3SR3A 4B79A 4B75A 4G0QA 4QG3A 4C7OB 1JRLA 3OIUA 1FQJA 4DCOA 4ZYWA 1CIJA 2H4JA 5JMOA 3T0IA 1SXGA 1UAYA 5COQA 4BX8A 5JNRA 1M7GA 2V6IA 3WNCA 4PGFA 2ILTA 5L3RA 1IHXA 3RFCA 5I4KA 1HE5A 1D2MA 2Q99A 3I5XA 2ST1A 4JJAA 1ZYUA 5DH9A 1YJXA 4JVLA 1SXHA 3GT3A 3FLBA 3S8MA 1GSIA 2KBEA 2QXYA 3NNDA 5ALIA 5CH5A 1WHTA 4HUJA 3L7KA 2VWGA 4JYPA 2PH7A 3I12A 1EEXB 4CQMB 2KWIA 3PHLA 1XTSA 4YGXB 2AK3A 5HQTA 1AKVA 4L8FA 4TQ9A 3FYTA 3NRCA 4OHPA 4YALA 3RS4A 4JI7B 5BRAA 4GEGA 2ZJOA 4EGSA 2ZLBA 5BNFA 1OT5A 1Q0UA 1DKPA 3HVIA 3VHXB 2I54A 2ALJA 2AMJA 2BIFA 1REQB 4XIYA 2VHTA 4F4JA 2QE6A 4HEA1 2FZLA 1YNOA 1XGKA 1RYEA 5IJZA 1QR2A 3GLTA 2QTVB 3WZ2A 1VPEA 3HJBA 4MQ6A 1E5DA 4P3PA 3D59A 4YN3A 1NUSA 1KU6A 4JR1A 2IKQA 4MQUA 4N9WA 2G5GX 3TMAA 1J0EA 2VLBA 2AF3C 2ZDGA 2QSUA 2Z3WA 3O1IC 2JIQA 3OJEA 4ADSG 2UZ4A 4YT4A 2BMJA 5CDUA 3T34A 4W5NA 4DCTA 3PPIA 3U4DA 2HHCA 3U6BA 1UZAA 1Q22A 4C4AA 1NAIA 1SBIA 2GPTA 4UOZA 2G40A 3IOCA 2J46A 3RC7A 3VA7A 4XM2A 3MELA 1E1QD 1U9IC 3HEBA 1SM4A 2BEVA 5GPBA 1P7PA 2AR7A 2PGLA 2CY0A 2ZJ3A 2C42A 1T2NA 2G9VA 3DE3X 3HMQA 2ILVA 5A4MS 2BYTA 3HUUA 4LRQA 4MI9A 4KMOA 1HEYA 2BZ1A 2FFJA 5F7OA 3PDCA 4X60A 1IFXA 3HWSA 1HDZA 1ISMA 4GBED 1RTTA 1EDEA 3P8ZA 5F4ZA 4EB6A 3THWA 1E62A 1XQYA 4Q9LA 1SUWA 1UP6A 3ACCA 5A4KA 1PWXA 2PTGA 1NW9B 3LHFA 3GLIE 1O4WA 5A5DA 3DDNA 3ZZUA 5B6IA 1NIPA 4WKNA 3GRCA 2DHRA 2C31A 2QI9C 1I9GA 4I4IA 2OTCA 1XX6A 1Z7EA 2EQBA 1OBFO 2J0UA 1GTVA 4LRUA 1SIUA 3U9TA 4I8XA 5EN4A 1M8KA 2F8LA 2PH5A 2OBBA 2RJOA 3LKDA 3Q0IA 3CA8A 3OMXA 3ZWMA 2GERA 5JJKA 4BUJA 2PU7A 3QLUC 3VRHA 4F2HA 3H2BA 2VR1A 1EFTA 1KZYC 2XYGA 4M1MA 2P2ZA 2JH3A 2BFDA 2EGUA 4YUXA 1YF3A 2HRRA 1HE3A 4Y18A 3O2SB 1E1CA 1LNSA 2A14A 1QYXA 3TIIA 4DMKA 5C9ZA 2F64A 1Y3CE 4AF6A 5HOQA 3MMXA 4NOMA 2XUDA 3WZMA 1DCKA 1X19A 3QWAA 3MYRA 1XVLA 5LA6A 1MA0A 4BX3A 2ZRQA 3IAUA 1KEPA 3L43A 2HY7A 2IF0A 4B2YA 4FI3C 2CFSA 2FMUA 4EB8A 1JFFB 5BMVB 2EQAA 2ZWAA 1HT3A 3C15C 1DBRA 3QBTA 3SYLA 4ZI7B 3WGMA 1L5SA 3QW4B 4ZOAA 4ENTA 2C3OA 4LFBB 4LXTA 1RWPA 3CVJA 3KZOA 1KYVA 2WFZA 1P81A 1DDIA 2F00A 4ITRC 4POOA 1IQRA 5EE3A 3FZEA 1O57A 2HK6A 1A2QA 3L8EA 2WAOA 1XKTA 2NU7A 3DE5X 4A1OA 4B8YA 1VDZA 2HA6A 2EG9A 1RYBA 2XV1A 5CXSA 4AK9A 2PUTA 5EJ4A 5FOUA 5J2TA 5C1DA 4EX7A 3FOZA 3HCOA 3UOGA 2OCYC 1R4AA 2IX9A 1RWWA 1NBMD 2RAPA 1BMFA 1VM6A 3IV6A 5CXQA 1DTWB 1W5EA 2DH6A 2GN8A 1DARA 3CURA 4IFTA 4M7PA 4MP3A 3TH5A 5L51A 2DGDA 1XF9A 3BKWA 2YWBA 1EX6A 5KAMA 1WZ2A 2PH3A 2YYSA 4HAWA 2D1RA 1XMQB 3MT9A 4IPTA 4KWHA 1KI7A 2RHCA 4QPCA 2QRJA 4E0BA 4JC4A 2RC6A 3VH4A 3E8XA 5JD5A 3EMBA 4R1LA 2VYNA 2G0AA 1BWQA 2W37A 3TTYA 3QUAA 4TV8F 3W34A 4EVIA 2HHHB 3AVTA 1RVV1 1CJVC 4HDMA 4X0EA 3R3XA 1B1AA 1WVGA 1A8UA 3DFIA 3QHPA 2CSUA 4RK6A 4RH1A 1OFTA 4F4FA 2CV2A 2J4DA 2KMLA 1SCUA 2RHHA 3L0DA 3ZV6A 2KB0A 3UIEA 1XIVA 2ZYGA 1GG8A 1N2IA 2XXJA 3RVRA 4G25A 5AVUA 2OWDA 4LDRA 1Q1QA 2CNWD 1MC5A 1UEIA 3KXIA 3OE7D 1RTKA 1UMDB 1B8PA 3QMWA 1TO6A 4Z4QA 2OPBA 1L5LA 4HGRA 1H8HA 1KVTA 1IHPA 1WUTA 4D8TA 1KXZA 1C80A 3O3MB 4ID3A 3B3JA 1CU1A 1ID1A 1QUEA 3OQBA 1N0VC 4M1EA 5SZKB 3SEQA 3V4SA 2CZQA 2VWPA 5JSYA 3QTLA 5ALEA 5KNDD 2GASA 3V32A 4RAQA 4MH0R 4Y9UA 1J2YA 3VSBA 1CQWA 4Q9NA 5ES4B 4REQA 5BR1A 3A6LA 2HFKA 4D0SA 1OFGA 2OO5A 2QV0A 3HQ4O 4WE3A 3OT1A 1IZYA 1BXGA 1JKIA 3PJEA 4TN1A 3ZXYA 1U2DA 3AETA 5C7IO 2QRGA 1T4GA 4IQ0A 4ARAA 2J32A 2Z1NA 4BNXA 4YCMA 3DKVA 2FVXA 2HBZA 3CCBA 1K7YA 1V8FA 4DV0B 2WPDD 1D6NA 3WWZA 3BGWA 3P2JA 3K70B 3FTCA 4Q00A 2E4XA 1M83A 5FEUA 4GHWA 3HB0A 4XX1A 3TX6A 2GZHA 3SKXA 5K8LA 2I67A 5IU6A 1TVMA 1EDBA 5JEEA 3I2FA 1JIXA 1CD5A 2HHJA 2G7ZA 1FX0A 2UVQA 2YHIB 3NXKA 4MB2A 3DVAB 1GAEO 1KOLA 4BGEA 4TLCA 2IYRA 3OQPA 4CEHB 2WT4A 4MIEA 4WKGA 1KJIA 5SY9A 4JP2A 5EZ5A 1Y7IA 3OQNA 1TU4A 3S70A 1GR1A 3FHJA 2C4HA 3QE2A 2DCUA 2X22A 4WN9B 2OQVA 4BHTA 1U3WA 2IP2A 3M6IA 4X7BA 5LJIA 3C3JA 2DT8A 5H4HA 1WLSA 1DQSA 1EQAA 3OLCX 4OFWA 4TTRA 5G4KB 4EW2A 4ZYZA 2RMKA 3NDPA 2G9QA 3FDZB 3MM4A 2W2KA 4HAOA 1ML3A 1XTRA 1A2KC 2RHRA 3UOWA 2AI2A 2BTQA 2H4HA 3HU5A 4EHIA 5K5EA 3OLZA 2ASVA 1N9KA 5JAZA 2O8BB 3HJGA 2WYHA 4DLTA 2CL5A 2FV8A 3HHEA 4BS9A 2Y1WA 1AQ6A 4JEMA 3ZLTA 2ZVPX 4KLRA 1XR3A 1B76A 5THQA 5DEIA 4EA7A 4CTKA 3EB9A 3GHYA 1NWHA 4QZVA 2TSYB 3DQQA 4YTEA 2PS1A 1E64A 2OV1A 3GRRA 1E1KA 1KE2A 3T7IA 3T7CA 2G9RA 1EGHA 5BNTA 3ANTA 2C8LA 2WMNB 3RSLA 4E46A 1Z39A 1I7DA 3CF2A 2NN3C 1KYIA 3Q4GA 1T2VA 1E5QA 1G21A 1WJGA 3AEZA 4ARUA 2ODPA 4FR5A 1TYZA 1RYFA 2PR2A 1W1UA 121PA 2BI8A 2JKZA 1MNAA 2W00A 3CKMA 4JQSA 5FPHA 5LQSA 3T4UA 4E11A 4DV5B 3H5OA 4MIYA 2FRDC 4XCVA 1EIZA 3RANA 4B4WA 2VK4A 1QRRA 1HETA 1R0KA 4RL4A 2VHVA 1HFEL 1QMPA 1TAGA 2IYXA 4BDTA 1GPH1 4O4IB 3AB8A 4JASB 3QPCA 3NP7A 1G0NA 1D9XA 1NXOA 1YQDA 1U2GC 2PXXA 2Q1SA 1YS9A 4FSDA 2QVXX 4HMQA 4DLYA 1C7EA 2E18A 2OBYA 3UKOA 1P2BA 3M9XA 4PFKA 5D3MA 2QA5A 1U8TA 4TZ0A 5IFKA 1WCXA 3ZBPA 2JFHA 4AMUA 2BY4A 3K1AA 3MWJA 2EVWX 4K9RA 5F1OA 4KVFA 5KSZA 4HCJA 4RZ2A 4V0LA 3M6FA 1YAJA 3SHVA 3N2NA 1Z4KA 1E7SA 3OFKA 5KQPA 4KE9A 2AFRA 3D0OA 2HXYA 4RSRA 2QYHA 3DMHA 3EZYA 2CHGA 1U8UA 3FYUA 4PAGA 4TV8A 1R2QA 1XP5A 2DUWA 1Y5RA 2QLLA 1PX2A 2YVQA 4YV2A 3THYB 4P0QB 3LQFA 5TPWA 1Z74A 3C8MA 3QA9A 1U0BB 4OLFA 1UINA 1F0KA 4NMWA 1FP2A 3RW9A 1BVRA 2YXDA 1ZOOA 1AA9A 3T1HB 1XMSA 2Y4NA 2QR5A 3PNVA 1TQDA 4WKOA 3VKHA 1M2OB 5EIXA 4JL6A 2ECQA 3DZDA 4EYKA 4IDAA 2BZGA 1UBRS 3M83A 1NE2A 2B94A 2F3QA 5CLJA 1YQUA 3IBTA 4QUIA 1BMTA 3HN2A 4LZJA 3LDFA 1I7QB 1N32B 1RYNA 1G3MA 1QH0A 2FGKA 4B3HA 2JIPA 1N5RA 1HSZA 3MCUA 1H0HA 1RJDA 4NS4A 3L0ZA 4KR9A 1J8FA 4CM1A 4NU5A 1RYZA 1DTEA 1B3BA 1OC2A 2DTDA 3GJ6A 3HKEB 4FCCA 1FXSA 2P9FA 3EGOA 3DDZX 4XVQA 3SEFA 2GLUA 5DHSA 5MFPA 2Z9DA 3FW1A 3RC3A 4Y6RA 3OLQA 3ANLA 3GIWA 4PIMA 4R9UC 3WLQA 3U7HB 2C2KA 4X6UA 1M0EA 2NZJA 8MHTA 1WNTA 5ITZB 2D6FA 2TECE 1O95D 3WGKA 5C8DA 4DLUA 4FVTA 1M0WA 3F9IA 5TPZA 4PRLA 4ZCSA 1PT7A 2IXFA 1NRXA 1QHSA 2IODA 5HMLA 2H5LA 3V6LA 4U3JA 1U7PA 4GX5A 1R10A 3FH0A 2O2EA 1RCUA 3OLXA 1HEIA 3PT9A 4HH1A 4O4HB 4Y2VA 2PGDA 1FMTA 2LZ0A 4P3NA 4D9CA 1KMQA 3GNSA 4QOJA 3IEVA 4O02B 4XGNA 3WS7A 3J81k 4IGEA 3AIMA 4YRNA 1GAQA 4FBGA 1P2UA 3MLBA 2X2EA 3O7WA 3QMPA 2CJXA 3D4IA 3MRXA 4LQDA 2YJ4A 1U8EA 1A4RA 1NW3A 2W7TA 4AUMA 1ENZA 3L1UA 1PJRA 1Y3HA 2BFOA 2MYUA 2G8NA 2W43A 3CTMA 2UUCB 1NSFA 1W6RA 2P9EA 3F8TA 4R54A 2A92A 2XMCA 1FLVA 3KJGA 1ZWLA 4EY7A 2AL7A 1HUQA 1ODTC 1SQGA 3IJRA 4ZJUA 4M53A 4N5MA 1KKUA 4YLGA 5FBQB 3SOPA 1I51A 3BAFA 3AESA 3QOFA 1CZRA 3JQAD 3W5BA 3JQGB 2D7CA 4OQLA 4BO6A 1T0HB 1JI3A 2X6QA 5ALQA 5KWJA 1N2CE 1UL1X 4MUHA 3VR4H 1YVEI 3C7CB 4RGQA 4UKDA 4JVSB 1WULS 3QE9Y 3U09A 4XOIA 2RB5A 1E3QA 3IXQA 1C3JA 2FZVA 4Q1VA 4IDOA 1EXVA 3VO1A 3LP6A 1XZGA 2ERXA 1XZDA 2O0LA 4TXHA 5BN5B 2EWMA 2JGAA 5F12A 2YC2C 3KE9A 4M87A 5BV8A 2KI5A 2J0EA 1OTHA 1HLDA 1Z7WA 4WW0A 2VJDA 3NTUA 1TVKA 4RWZA 1FFYA 1RIIA 2HIHA 2OZEA 1MRSA 2CLCX 2G6BA 3NVMB 3OM9A 4UCXA 4UNRA 5I8WA 2V97A 1UZUA 3KSAC 1E0DA 1VKNA 3HU3A 4ZN6A 3GN1A 4UATA 2SCUB 4UM7A 3X2FA 3ZDZB 1FW6A 5KDOA 3AHIA 3GT4A 3LT2A 2FUG6 4N5DA 4WLUA 4Z0TA 1SCIA 4ZIRB 3RQSA 4JU8A 1FS6A 4BATA 2C2WA 1JDNA 4WK4B 1K92A 4M1YA 4GEKA 5LLSA 1Y8CA 4OLJA 4URHA 2WVAA 2DFVA 2DEUA 1EX9A 3OZFA 1NSYA 2WU8A 2JFZA 2X8AA 5AKKA 3TLAA 2AOUB 2PWPA 3TLXA 2RJNA 3BBLA 1ATZA 1J8YF 2YVKA 4HS9A 1OXVA 1GCOA 1MC4A 2QUHA 3QKSB 5DNDA 1YVDA 4COKA 4LF7B 2O5EA 1ISPA 4FT2A 3M49A 4PO8A 2OCIA 2C78A 1WPGA 1SZCA 2A5DA 2OHIA 1T25A 2G0NA 1NV8A 3IE0A 3NV9A 3PUIA 4HLDA 1W8DA 4QATA 4QSMA 5FTMA 4EWLA 3PJGA 3SYMA 2NW6A 3IOEA 3MOGA 4E32A 5E1DA 5FFNA 2A1UA 4DFDA 2ZAOA 4AKIA 4G5XA 3KV1A 2B4QA 3F3KA 4LJYA 4GI5A 3RUFA 4C7KA 1W5BA 1OH7A 1ISIA 3UTCA 1A7AA 2P5UA 4Q16A 1TAQA 5C4IA 3FBWA 4HHEA 4L57A 3B8EA 4CMIB 1C4KA 3COYA 3ADCA 3NT4A 3G5AA 3JASB 5CVDA 3TRIA 2JLXA 4DADA 1JHVA 2JBHA 1XTTA 3OLWA 4UOEA 3W77A 4EATA 1NI4A 3LSYA 3PFGA 2AKAB 2OZKA 4LDQA 3FBGA 4PZUA 4QYIA 5GGYA 1R37A 1STOA 2BSAA 3G6KA 2BF4A 3CO0S 3PWSA 1EIWA 3VKUA 5CG1A 1T8TA 3AEKB 1XP8A 3KZVA 5DZSA 3L04A 4MUGA 1V2GA 5BN4A 4EGFA 1NULA 2QMHA 5FBZA 5IK2A 5KNBD 2M6SA 2R5WA 4RABA 3E7XA 5BQOA 1WOMA 4FLEA 2A0WA 4QBIA 3HJRA 5IAJA 3CVUA 2O57A 3LT0A 3EWIA 4ZYYA 1GZ6A 4IDGA 3CY6A 2HV8A 4Q48A 4EW1A 1JPVA 4UMDA 5AK5A 2VH2A 3PEFA 4R05A 2ZCVA 2A9KA 4N8EA 4R98A 3I04M 4IR7A 1D8TA 1RJGA 4LN1A 2A8YA 2HEGA 3NW9A 4QLBA 4NDNE 3PWKA 4C04A 1BRMA 4IIVA 2I3ZA 1XU4A 5FD8A 2LCQA 3V2UA 5COAA 3VDXA 3LDUA 4WINA 3IDZA 4KSYA 3FMPB 3GMSA 1XKXA 2R751 3SEZA 2CXXA 1HT2E 4OHOA 3M9LA 5DPMA 4Y7CA 4US1R 1BNCA 2I7DA 2IU4A 3ZQ4A 4DWOA 1IXKA 3PFKA 2ZREA 3DUWA 4ND5A 4S1WA 1MAVA 4CM7A 4LYHA 2MR5A 2F1KA 3WYGA 3HGMA 3DG9A 1MRZA 1UZMA 2MWMA 4M9UA 1FNDA 4FCTA 2QLMA 1E59A 1IZ0A 3U1VA 5B7NA 1XTBA 3IA2A 2QD5A 4LJ9A 5H5JA 1GKIA 2AD1A 1LTQA 3MLAA 4OMCA 2VBIA 1U98A 3GAFA 3GRZA 3LE8A 3GRAA 3Q5GA 4I4TF 4QL3A 5LXTF 2ZKIA 4MUYA 1DBPA 1BHSA 1XROA 2YFKA 1NA5A 3OPYB 3Q5EA 3UAWA 2WT9A 3LF2A 3VI3B 1THMA 2VHJA 3F4BA 5A9TA 5J5AA 2UZAA 4W63A 1F2UA 3D4NA 3ZVLA 5CLQA 2DHCA 3WWEA 3D9QX 1E2IA 2BT4A 2YC4C 2RJ3A 2CYCA 3WB9A 3OT4A 2P8SA 2VWHA 5JT1A 5EMLA 2FZKA 4HSGA 3E5RA 3KAQA 1FTSA 2ZQ5A 3THXA 1RYHA 4HAUA 3BPSA 4MRMB 3PJFA 5T4BA 3M7IA 4DL9A 1XQVA 1ESDA 4HAVA 4QU9A 2FPUA 2YX1A 2NU8A 4QGAA 3BZBA 3LA6A 3KYCA 4BBPA 5H70A 1KDVA 1E99A 2B36A 4IWXA 4W82A 2OMEA 1P9OA 3OY2A 4UNQA 4XYBA 5L4SA 1OLSA 2I4TA 2WSLA 5DBOA 3FVWA 1UDRA 1LC0A 4H18A 4KBFA 4AF8A 4QGFA 3C3KA 3NUQA 2VTDA 3PQCA 3M6UA 2GZ3A 3OMLA 1FJGB 2IS6A 4NVRA 4Q15A 3LZCA 3ZDEA 1ADGA 4N48A 1T8WA 2ZR0A 3OTQA 1XTIA 2I2CA 2IK8A 1YR3A 3CX3A 4R3NA 4ECEA 1E2NA 5K8VA 2J3MA 4BZZA 4DDWA 1E8DA 4UU8A 3Q3HA 2Q5CA 1E3EA 3H9UA 1KMHB 3NG1A 4Y1FA 5DRTA 5EIFA 3ZJ4A 2ZULA 5J63A 4BAZA 4BFLA 1KMCA 1LJ8A 1ZCJA 2COUA 1ZMXA 2OSBA 4RY9A 2ZQZA 4TX1A 4HNUA 5TIIA 1BD4A 5I8ZA 4UVEA 3EWSA 1T8SA 1EP2B 3BHJA 2F1RA 1DQYA 2OBLA 2ZI7A 4ZQGA 2BGKA 3ZWVA 4QBGB 4WZAE 2IPNA 1XWWA 3DFUA 3NV7A 5CM2Z 4AS2A 4OMFG 3L1IA 4ARCA 2TMYA 5AXAA 3UJ6A 1QU3A 3DPIA 4BWGA 5E9WA 2GTPA 1G8JA 2WZDA 5B7PA 4K9LA 2DTXA 5JJ5A 2MSWA 1LPOA 3T94A 1XB2A 4NFSA 2WUVA 4RSMA 3OCUA 2XR1A 1IJEA 1COWA 2M9MA 3MB8A 1CEEA 5LLDA 1I1HA 2J9FA 4EM6A 3HV2A 3MFYA 3HA5A 2W8BA 4G5QA 1RI5A 3S29A 5JQGB 2YQ5A 2W6MA 3O1JC 2QTTA 2D1TA 1Z6YA 2HW8A 3LVRE 4OJYA 4BJ6A 221PA 3USZA 3ESRA 1KU0A 1I33A 1L7AA 3UHFA 1JJFA 4BYMA 2O2YA 1JFSA 1CK4A 2FPGA 3JQ7B 3LGXA 1XEXA 5F98A 3PWZA 4W6QA 4C20A 1ESMA 1WY5A 1J70A 3RBVA 4E6PA 4QXPA 4QJIA 1Q0RA 3AB3A 1S8AA 1NN1A 3R09A 3HDTA 1IN6A 3VKFA 4P93A 2BC9A 2OYRA 2V1UA 2DU8A 4MLPA 4I3GA 5FWXA 2NXEA 2QLBA 2P4HX 4Q4LA 3V4ZA 5G53C 3V8PA 4G07A 4C0QC 1IYZA 4EB3A 5LVAA 3X1MA 1KSJA 2RGYA 1YS4A 3N3BC 1JLMA 5A3RA 3VDNB 2GMWA 1M5RA 3W8DA 2PUFA 4E5UA 3W8EA 3CRZA 4L2IA 3PZBA 5KYKA 2WB2A 1ODCA 2ZIAA 3AY7A 3O3CA 3VOBA 3NVAA 4CQLA 1WB9A 1CQJB 1J21A 4B35A 3UV6A 1KJWA 1E3IA 2GN6A 1OV4A 2FB9A 2GPBA 3T12A 1SXJC 2WY2D 4KX3A 1XJ0A 4A26A 4D80A 2C95A 3ZY4A 3EJ6A 4FTWA 2Z95A 4XWKA 3AVYA 2HDHA 1P6XA 1VHJA 1Y1KE 4LC1A 3DZHA 2G0TA 1OYOA 4O4LB 1E89A 1A9PA 2P8JA 4BNDB 3SMQA 4CV0A 1DX4A 1PFUA 1RMQA 1GT91 3BEDA 2ZSFA 1NV9A 1X7YB 1Q50A 3WLPA 3HJCA 1VKHA 1VE6A 2W0MA 3RKSA 4KXLA 5IC6A 1JHQA 2ZZKA 3D7KA 4RTPA 4MR7A 2GNAA 4I0WB 5EP1A 5DMXA 5LXTA 1QHHA 1QK4A 3KDPA 2WMDA 2XITA 3LECA 4HO1X 5FP0A 4JODA 4LGVA 3DH0A 4JLDA 4ASUD 4DNOA 4KXMA 4Y67A 4QNRA 4YP1A 2DX7A 2NT4A 1T6ZA 4O3FA 4PPNA 4ANFA 1AO0A 2ZRDA 3EBPA 1T4MA 3E1GA 4FYPA 4PQFA 1J09A 2Q3JA 3Q7IA 2PG3A 1W59A 2IOQA 1Y4DE 4HYYA 1GZSA 1LI5A 2IYUA 1D4OA 3D3JA 3DKPA 4LE2A 5DEOA 4FYWA 5DOZA 4PNEA 1F0YA 1IDOA 4A0FA 4WY8A 4JT8A 3PUKA 1CRZA 3OX3A 5IC5A 2KPOA 4KK3A 4MWGA 4WSOA 2IH5A 2W2NA 3DQZA 4K6CA 4MS3B 3RTGA 4V0OA 4I1RA 3L7NA 4G4GA 3V42A 1XRMA 3ZZ0A 3L93A 4HADA 4I7EA 1J0CA 5T41A 3W5HA 4KV9A 3DMYA 2PRYA 4CZ2A 4TTJA 1AE1A 1TTQB 1Z75A 2DWUA 2IQIA 3F1LA 3RBZA 3A4VA 4QBKA 2FUKA 3A2KA 1BQ4A 2ZRPA 4XEHA 1AN9A 2J3JA 1WE2A 5I47A 2NVWA 3AGPA 4R2WA 4YJHB 3MRTA 1V9CA 3CPEA 2XHEA 1DL5A 4PBSA 3RRNA 3GD5A 3KETA 1OW3B 5IM5A 3P0EA 4EEKA 5K8CA 4US2R 3QVUA 2HF7A 1OKKD 1HZZC 5KYUA 3Q3VA 3OFND 4ILKA 4Q24A 4P36A 3OQJA 4P98A 5FTWA 4F72A 3J81A 3QU2A 3UJ3X 1F2TB 1M72A 3QEJA 4FINA 5C37A 4BKOA 4R0MA 1SC1A 2CLFB 4AAYA 4ZEXA 5EJ7A 4JNKA 5GADl 1QG0A 3UICA 1O97D 2AG1A 3DW1X 3GW8A 2ZK7A 4L4YA 1XG5A 5BSVA 1A4XA 4DIMA 1YWGO 5HIAA 1GPJA 2LW7A 3AJRA 3ANSA 3IO5A 3MOSA 4C0WA 4DSOA 1E1YA 1KH2A 4YJFB 1PJTA 4EA9A 4FCVA 3U37A 4J0QA 1B26A 5GQSA 2OV8A 4GI2A 3RBXA 4C22A 1OA0A 4DA0A 5CB4B 3AVWA 3ONEA 1U28C 5ESXA 3REFA 4I66A 4AJOA 1ZX1A 4MW7A 2V7XA 1KYXA 5AM2A 4ZT6A 1OH5A 4G86A 1HLGA 3PXDA 3C3WA 4JT2A 2JLZA 3HCAA 3PNOA 5B58C 1V43A 2R8YA 1NIJA 2VH5R 3PS9A 4LZZA 3LLSA 3R7DA 5AI5A 5TS3A 1QX3A 1D1TA 4O4JB 1YZHA 1D1SA 3DEZA 3KLOA 1DHTA 4LZWA 1G8HA 2HMAA 3MLEA 4RXUA 4B3FX 2P6RA 3HCEA 1ESZA 1VOTA 1Z6XA 1E6LA 5CVEA 1Z4QA 3FJYA 3I5MA 3LWDA 4IVPA 4C01A 4HXFB 3O94A 3TBKA 1E1MA 2H1LA 1S7CA 4L6IA 4X92A 2GZ1A 1EG7A 1NWCA 2BSXA 2YWGA 2PA0A 4GYWA 3R0ZA 3WJ2A 1JTVA 5ALUA 1LW6E 4H59A 4CPDA 3KKNA 4QNMA 1ZD3A 4RIFA 4OI0A 1R8YA 4TWRA 1ZGBA 2JFWA 5TVKA 5DIFA 5K03A 3A1FA 3U48A 2DBYA 1XWIA 1O89A 1J5EB 1USWA 2QIPA 2I4MA 2RGUA 4ZODA 4XE5A 2IXAA 2IGBA 5CURA 1UFKA 5I9NA 1TKBA 1B74A 1FOEB 3UF0A 2N47A 3QIAA 3GQBB 4Q3BA 1CFJA 1I5EA 5TQ2B 3HXLA 3U7QB 3CWCA 5BQ3A 3KSZO 3K8ZA 4OYRA 1TUBB 2YNMC 2F3PA 1IG0A 1IIRA 1ZJWA 4HGPA 4YRFA 2JKYA 2VNSA 2BFEA 2Y05A 3EYWA 5DIZA 2FMXA 3VM6A 3VZPA 4Y2GA 1L1RA 4CV2A 1E3DA 4L07A 1AKYA 1I24A 3QVGA 3NS7A 4E5MA 1BG6A 3EIWA 3NRBA 1DV1A 2PDAA 4OXRA 5KYTA 3QVWA 1UC8A 1OR8A 3DOEA 4XLZA 3OT5A 3DNMA 3OIDA 2EFCB 3PWTA 5I7SA 3O8RA 1ISHA 5MDHA 3C3MA 3WRWA 3NM6B 5B6PA 2QIOA 2R8RA 1DUIA 1R66A 4HS4A 4RMJA 5KVQA 4EUHA 1RFGE 5BN3A 5KNDH 5LIPA 4ABTA 5BRNA 4O3MA 2D5AA 2PKEA 3ZCUA 1GPUA 2QL5A 4WKCA 1JR3E 4HK4A 1X39A 3RGGA 1RE0A 5LUBA 4GBGA 2RKBA 1JEYA 2VDVE 3A3NA 3U5ZB 3EDRA 5IVPA 1HLFA 1PJBA 2VDJA 3TLYA 5JSQA 5CNKA 3K09A 2VH1A 1Y6RA 3ZDRA 3HO8A 3KXLA 4DGQA 1IONA 4DLAA 2FW8A 3HLKA 3VVCA 3SVZA 2Q50A 1SOMA 2E87A 3DOFA 5LM3A 2EBFX 3FSEA 5T3YA 3L1HA 1NM5C 1G3IA 3DMRA 2XLBA 2JJ1D 1T6XA 5I01A 3QPVA 4GP7A 1WZIA 2Q2NA 3ZCSA 3S1SA 2AG6A 3D3WA 1UP4A 1U63A 4JLMA 4DV1B 3GD7A 3WO0A 4YRRA 3AF5A 1T5LA 1DU4A 3FMOB 5FI1B 9ATCA 4YRAA 2GVNA 4K9SA 3U3DA 3KQHA 1LLDA 2FEXA 4B7ZA 1KZ6A 5CA1F 3B51X 1KGSA 2YWDA 3MS4A 3OZTA 4D9GA 3IR5A 4D9HA 5CJ2A 1I1OA 1H85A 5L95A 4DBLC 3KVNA 2QY9A 3EPRA 1QIFA 3ZI4A 1FP4B 2ATXA 4RKEA 3FSGA 3TXAA 4D3SA 4ZT3A 1BFDA 3SI7A 2QRQA 4RA9B 3EPPA 3TOXA 4Y2TA 4F8YA 4HAZA 3TSAA 2IFTA 4RK1A 3TLBA 4YB8A 2DLCX 1U0LA 1SEVA 2JS7A 3H17A 1Y81A 4DSNA 3AF4A 4DG8A 2FEMA 2RIRA 3GEIA 4WFQA 4Z4GA 2BP7B 4CM8A 4WZZA 4QOFA 1KP9A 3OZBA 4JY7A 1YFJA 3DM5A 5C8VA 1P1JA 5CVTA 1UPTA 2GBCA 4XFKA 3WXMA 1Y7LA 2ZRCA 4WLOA 3WHIA 1WU7A 3KZNA 2WHEA 1HYHA 1QYDA 2FPXA 2I8AA 2O48X 2Q5EA 1QV7A 3IQDB 4KO1S 4XARA 1MOZA 1TA0A 3K16A 3DFMA 4M2LA 1VYUA 1NF3A 5AKEA 4KLNA 4TYMA 4NZYA 3WL3A 4ZPXA 3A6HA 2BFBA 3CUYA 4HNTA 4G85A 4N12A 1XLTC 4P54A 2OCLA 4L1KA 3LX4A 4M8IA 1FU4A 5IKOA 4DNFA 6REQA 4BJHB 2E1PA 3FUXA 4XB1A 2FJ0A 1YL5A 5EXSA 1QQ7A 5EJ5A 1A7UA 3SHTA 1PL6A 1L5RA 1A5SB 2NGRA 2PRKA 4ZT4A 4E07A 3OTGA 3ME5A 1CDOA 3BH6A 1SWWA 4TLAA 1HY3A 1PNRA 3PYMA 3DXZA 4QGSA 5JRJA 1AURA 1YCHA 2VC2B 2XWBF 1NURA 5KTRA 2PIDA 1E8MA 4X41A 3UMFA 5HR5A 3FWPA 2R9VA 1GGJA 3NJ4A 1GEGA 2ORED 1JXAA 3G0DA 4IOKA 1P7YA 5CCEA 1I32A 2PJZA 4KN6A 4NE7A 5C4GB 2VJCA 3KPWA 4Y6QA 4IMRA 4JYAB 5KVAA 2NPOA 1K86A 2I55A 3E23A 2XDQA 2OFFA 5HQ3A 3ZQ6A 4YI3A 4ZARA 1ZP6A 1HDIA 5FBVB 2XYVA 4UPVA 4UBJA 2XEDA 2I7TA 2Y8EA 1E2UA 1KQPA 5C18A 1O94A 5DI9A 2QRPA 4FBMA 1SD5A 2WG0A 2HX1A 1V35A 2B6NA 1EBFA 1ISJA 1C1HA 2D0DA 2H4ZA 4DDKA 2JK0A 1SXJB 1TZCA 1TU0A 3NGXA 5JALA 5KYYA 4CETA 2GUGA 5K8UA 5L6MB 4BVEA 1AXGA 4RPIA 1BHJA 2H0AA 1IBMB 2K2QB 2REXB 3ZX5A 2O8VA 2PZKA 3VHRA 1EUCB 2AEJA 4TMZA 5C8ZA 3BULA 2KBFA 3B2QA 3ND9A 2JAWA 1T8RA 3O8OB 1L1FA 5A4FS 3QKUA 4J2OA 4H6VA 4IIFA 3UMVA 1FFXB 1FUIA 2IU3A 2VYVA 5F73A 1VRWA 2R1ZA 3KOUA 1VLMA 2IYVA 3KJXA 2FPPB 2OFPA 2G82A 3NIDB 1F3LA 4PIVA 1GPYA 2H08A 2NO6A 1MV5A 1SKBA 2P3SA 4BJ1A 2QG6A 2X58A 3FD8A 3NX4A 3CUWA 2PLNA 2VXCA 2UAGA 1DNPA 1H66A 1EUZA 5CB6A 1FFEA 2UVPA 5DTJA 5A5EA 4XGIA 4JNCA 4EI8A 1H6CA 1HRDA 1JS1X 1GAXA 5SZJA 3H42B 5KOJB 2B99A 4N3GA 3GJ0A 4OJNA 2AN3A 3M1LA 1EVQA 1Q7BA 2GEKA 3BF8A 4GMHA 4HQRA 5FT9A 2E3JA 4YA6A 2MJLA 4EZBA 5JXJA 3GIDA 2CUNA 2FSHA 3D2LA 3COSA 4BLSA 3BORA 2C8VA 4O2AB 2O8CB 3EY4A 5HNKA 1DAPA 4I50B 1DJMA 2CXOA 4MDFA 2Z2YA 2IHVA 1H1LB 1QLHA 2QYOA 3GLUA 3EEYA 4JLWA 1TECE 3I62A 3ZDFA 4YAEA 2H1WA 1ZRHA 2JBAA 2IPAB 3MIIA 1FPQA 2BUBA 3IUEA 4JUIA 2Y6VA 4M0PA 5LZ5A 1GZ4A 3SYRA 4E88A 3EOBI 4JXKA 1PJ8A 1CZOA 3LFTA 4UD2A 5CA1A 1TT5A 3S4YA 1MTZA 3DHEA 3JQ8A 4LXQA 4E4TA 4L0CA 3W9YA 5D87A 5U4QA 4RTOA 3GT7A 2XKBA 1ZI9A 1UBLS 3LHDA 4KXQA 2SHKA 2WD8A 5FNVB 3REQB 2VK1A 3RSHA 1J22A 4E5SA 3LKVA 1W88B 1ZM4A 2VQ3A 3M9WA 5JFOA 1LQTA 1J8QA 4XZ3A 5A4AA 1QHEA 5K0GA 4FJ0A 4IV8A 2X0EA 2LPMA 3EX7C 2JI4A 4EYEA 2H1IA 5FOQA 4H4DA 4L95C 1YQWA 3D2AA 4UQPA 4AECA 4JSTA 1WV1A 4M0UA 3SS8A 3PGJA 2XUKA 4JQCA 3U44A 1KFBB 1WDWB 1MX5A 1Y0BA 3ZNQA 3DWIA 3O95A 1OIWA 5M29A 2AQ8A 4ZAVA 2CCKA 4MUJA 3L4SO 3MRVA 4V0MA 4CODB 1BVHA 5JH7B 4FD3A 1K6MA 5HJ2A 3X3HA 3GJRA 1T3GA 3QWFA 5DI3A 5FUMA 5E7JA 4Z4IA 1GG5A 1C3OB 4URVR 3HWWA 1DRUA 4Z2YA 4EPVA 4CFSA 3PCRB 1L4KA 1AKMA 2FWRA 1P4RA 1E2PA 4NYJQ 2R6FA 3QHAA 3UXHA 5CHYA 1C2YA 3IR6A 1K1EA 3DO6A 3HB9A 5FAKA 1P4SA 4P1ZA 1U8YA 3P9NA 5B3JA 2A2ZA 3H05A 3P2IA 4KVGA 4RE6A 4B3CA 1FXUA 1VE3A 3GEDA 4PSKA 4QDUA 4YCDA 5EMKA 3OJ0A 2QSZA 1O6CA 4ZZ0A 4FGLA 4ZDJA 1ZK1A 3OWXA 1W44A 1PUXA 1VDMA 3Q2OA 1OBVA 1GUZA 3SLGA 3M6XA 2HWXA 3LWNA 2IV3A 4XM0A 1SBZA 3DHWC 1HNWB 2XDYA 2VSFA 3TL6A 1X7GA 2P0EA 3BFPA 5BVHA 1YDFA 4U0KA 4NU8X 5F1PA 3ASYA 4QXOA 4C3ZA 4LPSA 2BRUC 1DQPA 1O4VA 1IY8A 1O5TA 2GD1O 1Q3HA 5D01A 2XX3A 2Y1LA 3AERB 3GYGA 3PEUA 3D81A 5F2EA 3GGDA 4DCSA 4J0EA 1GTL1 4KHZA 1E2BA 1JX6A 4CN8A 3IO3A 1V2HE 4TYWA 1NW5A 2BFCA 3AR3A 4OHZA 3EAQA 1N2ZA 2Q3BA 3WFJA 4BQPA 1WU8A 2YV2A 3E61A 4C2TA 2FQXA 2PCLA 3P7MA 1B0UA 2H11A 3GRKA 2XIJA 4PQEA 2W2PA 3FLAA 3GCDA 1Q1AA 2C4VA 4MR9A 4KPFC 3GK3A 4KQJA 5ICCA 5I7FA 3LPMA 1D6SA 1UKCA 2C9DA 1N7HA 1ZZGA 3B60A 5C32A 4JR0A 3Q15C 4A3SA 4HN4B 2HA4A 3ESZA 3O21A 3K05A 1K8YB 3IGFA 5DGIA 3U3OA 4A27A 2B1RA 5JPCA 1LTHR 2I22A 3HACA 4YFYA 5KAPA 4E08A 1RXWA 1WCIA 1FSSA 1NVGA 3D0QA 1E4EA 2IGTA 1JQ5A 2ONZA 3QU9A 2WJ3A 1QTIA 4IIJB 2O54A 4OGFA 4CIAA 1PFKA 3CNEA 3NJ8A 4GT1A 4K5QA 2XLCA 1EK1A 5L3SB 3UA3A 1J5XA 5DTMA 2O8FB 4YMHA 2IYAA 3NHRA 1GNSA 3A8TA 4TKUB 3L6UA 4IRMA 3I1IA 4KHPB 2ON6A 2Q3FA 3HGTA 5IX8A 1LSJA 2ZVDA 4UHHA 4OGLA 2W4QA 2EQ5A 1GM5A 2QRHA 1CT9A 4JOCA 2PPLA 2Q2QA 3PGKA 3TTUA 1TGVA 2JIDA 4Z3OA 4CF4A 4MRAA 3I5UA 3EPHA 3CGWA 2AEEA 4ALNA 1KRHA 3ESCA 2PSJA 1SD1A 2HIMA 3EVCA 4XCXA 3RH0A 5KREA 1RHRA 3F74A 3LKBA 3AI1A 4FSXA 1PUJA 4OL0A 3ZV5A 1FLDA 2X19A 1JBEA 2YXLA 4J0JA 4LBZA 4LI0A 1W4CA 2WJVA 4WEOA 2B7BA 1Z0AA 1U0JA 2YXBA 3KSBC 4WBNB 4KQXA 5LBTA 4D9JA 4L0DA 1X7ZB 3UAOA 2XBMA 3N2LA 3RS5A 4IUCS 4Q3LA 4X1YA 3BE5A 1Y6GA 2GETA 1KR5A 1FBNA 3KXDA 3I01A 1NX6A 4FYMA 5K3FA 3USES 3W7AA 4G0WA 2P2NA 1EGVB 2QN9A 2HUPA 3B82A 4LXIA 3TQQA 4FW9A 1H6AA 4K8RB 2O19A 4ZT5A 3OQOA 4ITVA 1AF4A 1UBHS 3SM9A 3RNOA 3QWIA 3TCNA 4C6TB 2ZPUA 5GZ1A 4DUYB 3UWOA 1V37A 4XGKA 3E1KA 2BFNA 4IS3A 2AWOA 4FFMA 2EKBA 4NMXB 3KLNA 1S8FA 1RHMA 2XMBA 3CEJA 3IBSA 3H84A 2ZPAA 1O6BA 4JB8A 4YK7A 4PAWA 5WRFA 5HPYB 1HDGO 2F62A 4LYEA 1IOZA 2BJHA 4UHBA 4FCWA 4AZ3B 1ZW6A 1O95C 3DXFA 4M8KA 4MJLA 2RHMA 3A6FA 1GTMA 5F7XA 1CY1A 2JF0A 3SBOA 3CB4A 1IPFA 1JIVA 1KI3A 3H6GA 3L6BA 4A8PA 4Z7OB 5C35A 1Y8RA 4YMVA 1Z5OA 2NSJA 2Q7DA 3BXEA 2WIJA 4MWZA 1I3CA 3AR4A 2TRSB 1RR6A 3GLRA 4TSKA 1JLHA 3TD2A 4CUZA 3U2QA 1IM8A 1NQXA 3CNHA 4JIMA 1LNQA 3MJEA 5AKLA 1DFIA 3VPAA 4ONEA 4ZXFA 4EHKA 1ZMTA 1HTWA 3ZWBA 3K8YA 2XA2A 1NY5A 1SU8A 2M98A 4IHJF 4WLEA 3ZLUA 2Y1EA 3GAMA 4FHEA 4N41A 2X40A 2EFHB 1L6IA 5KC8A 1H9CA 1MZPA 1RWQA 2FQYA 2YYAA 1CB7A 3PLRA 4NULA 3UJPA 4P4SA 3OX4A 1JYEA 4MS1A 1BZYA 5CA0F 3IXMA 5LOVF 5EE1A 3DD1A 2BH2A 1EINA 1UMCB 4MQBA 3CXUA 5GM1A 1HXHA 1PV1A 3ICCA 1BX0A 2AHRA 4I3HA 4C0AC 1OIXA 3M3DA 3ZHVA 2ZFUA 3E7PA 4BEVA 4KXNA 4OREX 1XBTA 2NNLD 2WYVA 5BSMA 2JDID 4UXIA 1WZEA 3EG5A 3PB3A 2H2DA 3E3NA 1UP7A 1XCJA 4QPJC 1TA4A 4DEYA 1FQWA 1OF1A 2DC1A 1FYFA 1SVLA 1T9KA 4NWIA 4TUYB 4UAJA 5GONB 3UEOA 4FS3A 3BSWA 5D3ZA 2K7FA 3EF3A 3GBVA 3EVAA 3LUCA 5REQA 1VECA 3HJUA 3PQ2A 3VR6D 1Z2AA 2IUYA 4NPCA 1L3CA 2X76A 1XCOA 4RCYA 2OK7A 1QAQA 2FKNA 4W1SA 3C85A 2RGXA 1KPIA 5AJUA 1V96A 5M2QA 3O1LA 2C5HA 1M6VB 3R41A 3MMPA 1EU1A 4FFBB 1RQNA 4HAXA 1U7ZA 4NS1A 1VJTA 5I4CA 3D0KA 2FQWA 2FW0A 3OC6A 1T36B 4HZUB 2Y0PA 3RFXA 2P62A 1ULSA 1ZONA 4PYMA 5J40A 3W0LB 1QCZA 4HFMA 3FR8A 1XAIA 4JUAA 4DMHA 3OECA 1APBA 1YVUA 3SXUA 2UZ3A 2WSSD 4PLWA 2CL7X 5AJVB 1G5HA 1J2TA 1WDMA 3T7DA 3QU5A 1T0BA 5BMOA 4UW9A 4MPJA 3PL5A 2JJ2D 5HCNA 1TQ6A 3NHSA 5CJPA 1Y8QA 3ZWAA 5KTPA 1OX5A 1GGEA 3W5AA 1CXZA 2XTAA 3OPYI 4G5YA 4P3XA 1E2QA 3PXEA 2H2FA 1XD8A 5MN4A 4DNXA 3RYIA 3OG9A 2BHNA 1SJ9A 5DGDA 4R68A 3KOOA 5EYPA 2NAFA 1COZA 2WZCA 4GGMX 4AX8A 2BELA 1K8RA 2GYUA 6CHYA 1SHZA 4JT4A 3V3KA 1ORIA 5L3QA 3TB4A 4F96A 3NYIA 1PV2A 2RAVA 2M1XA 2NO9A 4K9QA 1U1IA 2DWQA 1X9HA 4QARA 4KOAA 1UBSB 4LZAA 1L5KA 3LQKA 4A91A 3GZ4A 5KWIA 1M2KA 4LOKA 4XFDA 4GI1A 5DX8A 2Q9UA 4IQ4A 2OHOA 1N6NA 4HPXB 1Q20A 2WTBA 5ESWA 2JJYA 3TIVA 1V16B 4AY3A 1ZLYA 4PCLA 2CJFA 3B6JA 3H8VA 2G36A 1SCQA 1YR9A 4F0JA 4NFLA 3L7IA 4RMHA 1K5PA 4Y0AA 4TRMA 5LUAA 1F6DA 2V74B 1P4JA 4PXSA 4OAQA 4P35A 4S0ZA 3T7TA 2ZJ5A 3DVLA 1F06A 5JE8A 3O8BA 1DHRA 1S4MA 3CEAA 1KK1A 5CT6A 4UZFA 4BP1A 1KDYA 3KPUA 1G41A 1QQTA 5EGSA 1PKXA 5HSGA 1RZRD 4LMPA 1RAHA 3WHKA 3TW8A 3LDGA 2CGEA 1W7AA 3A9SA 4BRUA 3H97A 4CFYA 5L6LB 3OZUA 2GNPA 3RYFA 2D0PB 5GMOA 2YN0A 3SSNA 1BROA 3PKJA 3NT5A 3ZDAA 3KYIB 1QRTA 1YBHA 3GEMA 4YCLA 2PN1A 3D1LA 5F5XA 4J16C 5I9MA 4Y9TA 2BGJA 3QUQA 1ZUWA 4CU5A 1ODSA 5I3ZA 3ONNA 4IHJA 4BXOB 4JI1B 5B57C 3QW2A 1YKGA 1L7RA 2GZRA 5DV9A 4WA8A 5CUQA 4F4DA 3F73A 1LV8A 2J07A 5IAOA 1UXGA 1KJQA 1MO3A 3PICA 4CMGA 3NALA 1M2EA 3P9IA 4G4SO 4D4IA 2VRWA 4UNIA 5CA0A 3QKRA 5LOVA 4RKFA 3BRWA 3G2OA 3VFDA 1E3SA 2OV2A 3WK8A 1XA3A 3R7FA 2OCBA 3K0AB 1I2CA 1N1MA 3PR3A 5HTKA 5A6SB 4U2BA 5FTNA 4ALLA 4MICA 1DMSA 1WO8A 3JPYA 4LSGA 2GEUA 3FWYA 2ZSIA 3KKQA 4LBVA 4I6EA 4BVFA 5A5VA 1XZAA 3IRUA 3NH9A 4JGGA 3FOEC 3ZZ1A 1NR7A 4UVIA 2ZIUB 5JC1A 1XLVA 1BTOA 3VAAA 4OJMX 3I34X 3PXXA 5FO0A 3IVAA 4I9NA 1KI8A 5FLKA 2ZAGA 1QH9A 3IERA 3GC6A 1UBUS 1Y9EA 5JO0A 3EOAI 3BWDD 5BV2P 5JISA 1SO8A 4B40A 1QHXA 4UREA 4PTZA 5FPKA 1J8DA 3EEBA 5T6MA 2QTBA 3OKCA 1J49A 1GPMA 3CC8A 3EXIA 4HPJB 2OPHA 3WX0A 4DCMA 3PEVA 2CHFA 2FFHA 3LG2A 1FZQA 1RQGA 2GN1A 2JZOA 2WVJA 2MSKA 3G2HA 3INGA 3JQFC 4KXYA 5KYWA 1RXCA 2IPXA 4QE3A 2I6SA 4PU0A 1VFNA 3V7FA 2IUEA 3VR5D 5K20A 3GVHA 3DBLB 2X6RA 2OORA 1ZR2A 1LEHA 1QZ3A 4N8SA 2VDNB 4PPFA 4Q5IA 3GFOA 3R5FA 2JH8A 1CS0B 5AM1A 1E6CA 4O5OA 3VZRA 2R79A 2OYSA 1AGXA 2WE8A 2PD4A 4W4TA 1JQLB 1PJZA 2QM3A 2XODA 5HZHA 1YD7A 5AFSA 1GPBA 2E4WA 3EFOA 1TM3E 5FI5A 4BYGA 2B4TO 2V5VA 1OFVA 3F3MA 4BMZA 3A1CA 2AMYA 1Z62A 4X1IB 2M6LA 3UJCA 4AQDA 1LFAA 4CQMA 2QMEA 2WJ6A 3IAAA 3ELWA 1T5HX 4LSWA 3R7SA 4DAOA 5AVKA 1GUAA 4LFAB 4CYMA 4CKEA 2HBRA 3WB2A 3ROMA 5ISMA 1WPXA 2XQFA 3AW8A 1YJQA 2RH4A 3KEFA 5KYXB 4UEKA 3VNUA 4UM9D 1JAXA 3CNOA 4UAUA 1F8YA 1REQA 2HK7A 3OTIA 3VPGA 1BEZA 4CMBA 3DBRA 2XMGA 3IRVA 2A4KA 3PDWA 1FU7A 1GDTA 2CLHB 2BFWA 5NLLA 3OM1A 1RXSA 2PZFA 3O4IA 3CG0A 1G1AA 1W93A 4I5EA 2YVAA 3WBBA 2AZMA 4UBKA 2GA9A 3WDMA 1CZUA 1IAVA 2RGWA 4D3DA 2D2IA 2OO3A 2JGIA 3D3KA 2X0NA 3L18A 5ALJA 1XQ6A 4O1HA 2I9KA 4XSHA 1TM2A 4ZYUA 5I9LA 3V2HA 3CWZA 1K9SA 3H1TA 1ZAKA 3SK0A 5K3CA 2CUZA 4ITUA 3CW2A 3HYLA 1KR2A 4WNIA 1MJHA 2R25B 3N75A 3S44A 3SZRA 3BGVA 3EZ9A 2VCYA 3LJKA 3U3RA 4BVJA 2ZUFA 1L7MA 4GOOD 5IDQA 5KWSA 1RRFA 5HXAA 3U6KA 1SRQA 1F1BA 4JA0A 4B80A 3SBXA 1PQYA 1SOWA 2ZYIA 1CDDA 2WUDA 4OBBA 1QH8B 2X2PA 1NGSA 4MW0A 5TEWA 1HRKA 1U2SA 1V11B 1QWOA 4GOJA 1DT5A 3GNQA 2ZUUA 2RGEA 3BK1A 2ZRKA 4MXDA 1GR0A 4MB0A 1VPTA 1DXYA 4OA5A 4XCQA 3R75A 3UK2A 2QBYB 1K8ZB 4ZJYA 1TMKA 1B00A 3ESXA 1EH5A 3DDCA 2O8EB 3CRW1 4Y2YA 2O52A 1D04A 1UOOA 3KTAB 1CBUA 4EGJA 2DWPA 4AKTA 4KQ1A 4NC9A 4U8GA 1HI9A 2XB6A 3QKWA 4I81A 4WZ6A 4ZOBA 5BT9A 3RTAA 2FN7A 5JS7A 3KJQA 3SMVA 1L7PA 1U5CA 4Z4CA 3QG1A 5DGXA 4C4YA 3GARA 1OPXA 2I6FA 3MTDA 3ABZA 4M0KA 4F2GA 4KH0A 1OB2A 3JQPA 3Q41A 2D1FA 3LC2O 3DJFA 1KARA 3KJNA 2D62A 5CLIA 5KSPA 1ECFA 3RFVA 1JDBB 2NUPB 4LY3A 3HRKA 1K97A 1OX4B 4JLAA 2Z6AA 4L0QA 2BGIA 1NVTA 1Z18A 1ZSVA 2ONJA 4LF8B 1MVNA 1KO8A 1IB6A 4E2ZA 1C1DB 1U5AA 2FWMX 2FRVA 3H87A 5K09A 3FVQA 4HQFA 1U11A 3R6WA 1ODKA 4ZVPA 4U9UA 1PR4A 4CV3A 4TSFA 4TROA 5AW3A 3S2UA 4B46A 2R8XA 5C3UA 2VTVA 3N5KA 3Q87B 1RE1A 4O4IF 1XA4A 5I7AA 3RAEC 4B34A 4RM2A 3UC5A 2F1OA 2IY9A 1CDZA 1RRGA 2P30A 1A71A 2ZRNA 3UNXA 2PQ6A 1QG6A 2QTAA 3JS5A 1P61B 2PBRA 2ZJBA 1N8TA 1Y80A 3EC7A 3WI7A 1Q3TA 5HIIA 2O3UA 4Q12A 1FYDA 3GFPA 4NPHA 1N5DA 1VPDA 3BWYA 3EVDA 2DR2A 3A3KA 2H92A 3WK5A 2Z30A 2X8JB 4NV3A 3WGJA 5CFOA 4GRIA 1N3LA 1JWAB 1X8XA 3NR2A 3KQPA 2W6IA 1C41A 1Q14A 1ZU4A 3MTAA 2YTZA 1ZW1A 3IVMA 5AVJA 3FHTA 3LYUA 1F14A 4WEQA 2RAFA 1KPHA 3H2GA 3K9NA 1WCV1 2JI7A 2XCQA 3OIFA 1E58A 1CYDA 1A9SA 1AV6A 2AJDA 2CVHA 3HXOA 3B9QA 5AKYA 3HYCA 3I9NA 1CP2A 4NBVA 1Z29A 2VYFA 1U6KA 2JGEA 1RWNA 1O9BA 1OXBB 1T3SA 2CMHA 2G6TA 4HDNB 4X94A 2W6NA 2CJWA 5JJLA 2QP4A 4JVNA 2DE0X 4E7PA 1OXXK 4YMLA 3E82A 2VHWA 4G8DA 2R47A 1UH5A 4WXMA 5JDCC 1YUMA 2H1HA 2NP7A 2ZJAA 1TA9A 1BN7A 3ZH2A 5C7LO 1DC7A 4DQKA 1JNYA 1VE9A 3IODA 3UMJA 3ADPA 3WA6A 3GY0A 2XNHA 3OUTA 4AJ2A 1YB2A 1IZ7A 2JFYA 3IPAA 3GLFA 3VTAA 2HH9A 3UMMA 4I4CA 1S96A 1IZZA 4XYEA 2CFIA 1DQNA 4JWKA 4QTTB 1XI2A 3C24A 2VAVA 3JAWA 2PQ0A 4ER3A 1XDZA 4BTLA 4RV4A 1SURA 2QGNA 3BGSA 1FFWA 3A1DA 3LCJA 2ZJZA 3WC4A 2JFUA 1SQ6A 3WRVA 1T9GR 1GUFA 5DKFA 2P9YA 3GZJA 3RVNA 2NWQA 2OA0A 3C70A 1YH3A 1C8KA 4G24A 2YQZA 3VGJA 1N6RA 4G01B 3X1XA 4K9MA 3VH2A 4IKOA 1NY6A 3ZLVA 1ULUA 3FPEA 3NBUA 2YHIA 4MVJF 4PHTA 4B76A 2HBQA 4D79A 3DVAA 4HDSB 4GLBA 1T9BA 1LDMA 3W9SA 2B61A 2BR3A 1OCEA 1MEOA 3GFSA 4PTYA 3T3GA 4RH0A 4N0DA 2XTMA 3TSWA 5JHGB 2PL9A 1LB1B 4Q9DA 4DR7B 1YRYE 1B4DA 4WLVA 2XZPA 4CL3A 2UYOA 1X70A 4IJMA 3ECSA 1YKFA 5FPPA 5DRYA 4C29A 2Q49A 3DZGA 4XD7D 1NW4A 4ND3A 3LBYA 1XVUA 1GNRA 4JOQA 2XOKD 3D6HA 3FDZA 3OPQA 1FNCA 3AUJB 3N7UA 2OXFA 1N2BA 5FOSA 2PLRA 1OY1A 4MDHA 4JYMA 3O31A 2P1DA 4CMHA 5FV4A 2WICA 2YIVX 4OSEA 1L8LA 3HRHA 3TCXB 2FEPA 3JCZA 3NHJA 4HGOA 2BFFA 2B7CA 3NPMA 4JBHA 4N5HX 3RT1A 5ECGC 5BQPA 1SAYA 4FI3F 2GM3A 4ZV9A 3ZHZA 3JSAA 4OHRA 1W4RA 3EBLA 4NZZA 5B7GA 4TQUS 2VTBB 5ERGB 2G72A 1LQ2A 1Y9AA 1USGA 2HUNA 4WNCA 5E3JA 4KVAA 2G9NA 4J0KA 4BX2A 3JQQA 2WW8A 3JALA 3ML1A 3K4HA 3E5MA 5B55A 2B1GA 1NVEA 4K9KA 4D4JA 1EG2A 2FFAA 3O9VA 1QX4A 4G36A 3NEAA 1NLFA 5U9CA 1HDCA 2R7AA 2L69A 4R5HA 4IYJA 2C1XA 1RPNA 2QVLA 3NIWA 4PS1A 3GL9A 4WMLA 1YR6A 3DEAA 3DLHA 4FE4A 4UTRA 3O9MA 5E2IA 1KY3A 3N2EA 4RF5A 1UAAA 3H4IA 2XMQA 2GCOA 5ULLA 2NSHA 3QFRA 1BGVA 1H8ED 3I92A 1JTEA 5EWMB 3VZQA 4G2TA 2IITA 4A6EA 2FQ1A 2O05A 3ETHA 3F8WA 3ROXA 5DLPA 1O58A 2GLXA 4O4IA 5F3WB 1KAHA 2CEKA 4M98A 4GKVA 4YQYA 2B69A 2IXDA 2YW9A 4IZ6A 5F9MA 4AJIA 3AUXA 3LBHA 1PFGA 5BOSB 1E5LA 3SFVA 1FMFA 1KFEB 2JIRA 1XZ8A 4JROA 1K5HA 1C0KA 2PWAA 1DJLA 3ZE7A 2OXEA 5K0TA 5AJTA 3RVKA 5KNCA 1VI6A 3GP5A 3TLJA 5CP8A 2FWPA 4TYYA 1Z5PA 3BD7A 3E5NA 1BE6A 4K3UA 4W1RA 4HB4A 4X3CA 2MYPA 1ES9A 1YIAA 2YZKA 3GBSA 4HZGA 4U5XA 4YREA 4RUKA 1N8SA 3TNJA 4E31A 2C83A 3KU1A 1OX6A 1S6YA 4OBXA 3WMWA 3C6QA 3ZDBA 5I5EA 1C3VA 4PG4A 4N54A 2VYCA 4YY3B 3NNNA 1PZEA 2W70A 3FG9A 4HG2A 1IQPA 4RWEA 4JH0A 3D3EA 5AHOA 3WLTA 5A3SA 1LSSA 1JTFA 2QQ0A 1TAUA 2PGOA 1JYSA 5JTUA 5F9HA 4TS1A 4BVBA 1DFGA 2R1VA 3JTEA 4JITA 6Q21A 2QN2A 2WJIA 2H1VA 3DA8A 1W5SA 4URYR 2ZCUA 1PG0A 3D2CA 4UUBA 1GOTA 4UUMA 8ABPA 3EDCA 1CQIB 3FDFA 1PN3A 1DWOA 4KRXA 2FOLA 2QX6A 2WYWA 2A0YA 4P31A 3QJYA 2X6TA 1MO2A 1ULTA 3ECCA 2GGSA 4H7PA 1BKDR 5H68A 1T9DA 2JGDB 4P4TA 1Y9JA 3MEQA 4MZXA 3U7RA 3IX7A 2FMIA 3V4PB 2DG2A 2IPMA 1C81A 1J25A 1XZIA 3C45A 4MQFA 4PO3X 4EYQA 1RJWA 5ERXA 2Z5VA 1KL7A 2A30A 2D1QA 4RMNA 3UM9A 4UUQA 3OD5A 1DI0A 4KB5A 3MYYA 3PQFA 5I8PA 3MAGA 1I3OA 4C4RA 2DFKB 2OHVA 1R5OA 3EEQA 4G1EB 1M7HA 5THXA 1LH0A 2I4IA 2OXTA 2G09A 2CBGA 2GBFA 2C3YA 1BCSB 2FOXA 1UWKA 2YH2A 3HR7A 1U7UA 3TNLA 1T43A 3HCRA 1QYIA 4GXQA 4C07A 3K2EA 4MV7A 5E8RA 4JI5B 3N0XA 5K3SA 1PJ3A 1ZOPA 3W3AA 1WPRA 1NOIA 2CD9A 3VV2A 2X13A 3LUAA 4G5HA 1BA3A 4MVJA 1BYIA 1XK7A 2YCLA 4ABYA 4MPPA 3ZYCA 3E6AA 2Z04A 3MN1A 4ZO8A 1K89A 5EOVA 4S2UA 2RARA 2P2DA 2AXPA 1X8JA 2VBCA 1IOWA 2WYUA 2ZTMA 3TG2A 1UQTA 4Q3EA 4GWKA 1WABA 3CUUA 4RHFA 1GO2A 1KP3A 2HJHA 2H4FA 5KHAA 5J9FA 4ZOCA 5EMNA 5EJ8A 2GQ0A 3FVTA 5IHPA 4GI7A 1Z07A 4OL9A 1JHZA 2AG5A 2G88A 1D7AA 2D13A 3FWZA 1CRQA 1N36B 3RIGA 1G2PA 1RKQA 3QVTA 4X71A 3AKZA 4GPBA 4A6DA 3EPLA 4CN9A 3U3MA 2QENA 2ZWPA 2D8AA 4NV0A 1O8BA 3H6HA 3U4IA 4K05A 4TLDA 1RT9A 1WVIA 4DLZA 3VR2D 3K5WA 5EJ2A 2JD1A 2ZYUX 1MW9X 4IXTA 4KJZA 5AVRA 3IB6A 1L1EA 3QXJA 2WF5A 1UMBA 5IHXA 2QQFA 3F7OA 2F3RA 4PW0A 2G25A 2WHRA 2O3SA 1BWRA 1GCIA 2J7PD 2L42A 3R4VA 3HBLA 4AZSA 2GRJA 3FHOA 5DYYA 4BKPA 3LUHA 4XLLA 4ZO9A 4BCCA 5I7RA 1KAQA 4PANA 1N78A 1L8XA 2A5YB 2BE9A 4E2YA 3KQNA 1OH8A 3LQ4A 3BB3A 4J0HA 4GO1A 5TT0A 3Q8XB 1ATIA 3WLEA 1NYRA 3WNVA 5ETJA 3IQZA 4N0EA 4P86A 3TJZA 1ZN7A 1D7OA 2W22A 2NPFA 2ZBUA 2VUHB 3B1KA 1IEWA 3NTRA 1PYOA 4Q18A 2J5QA 2CL0X 3ZNNA 3PGMA 4O2BF 5DFAA 3X1DA 4A8JA 4EKNB 1VLLA 4UE2A 4UTXA 1JN0A 5AHKA 3UQYS 4MARA 2SCUA 3DUFA 3AI2A 4HQLA 2WK1A 2BGMA 3O8QA 4TV9F 4EX6A 3FDJA 2Q5OA 1BDIA 3ZHQA 5DCYA 3A70A 1CQPA 3FGOA 4I1IA 1BOOA 1M1ZA 4PRZA 5ALFA 1WL8A 3URKA 4RZUA 3WL4A 4ALIA 5AQ1A 2PKRA 1P60A 4GMXA 3HB5X 5CIWA 3LX8A 2HHLA 3MPOA 1PWZA 3U4CA 3IP8A 4ZV4A 4H7IA 3VR3D 3DO5A 1UBJS 2DBZA 2TMGA 4NNPA 4OHKA 2GTIA 4XJTA 1D2GA 3B1WA 4YHBA 5C81A 3QKSA 3KE8A 5D8DA 4Q1AA 3AR2A 3C87A 3JVIA 1J1UA 4KN5A 2Q2WA 3A7EA 5LXTB 5CDGA 2VSYA 5T8KC 1XFAA 2ZVQX 1KP2A 3F4LA 4L8YA 1AGRA 5JSUA 3AV0B 4KYUA 4X6XA 1V1RA 1GARA 4CUKA 3IE1A 4Q7QA 4CI0B 1IJFA 4NICA 3K9FC 2Z98A 2UV8A 2I80A 4R16A 3P2EA 4ZMBA 2AC7A 4C5AA 2NG1A 1ONNA 3BWEA 5B3LA 4CMIA 1PS9A 2IXTA 2QF7A 4RJJA 2QZJA 3JQ9C 3V80A 2CVPA 2VRBA 4JMPA 2IZZA 2XADA 3KVRA 4L02A 4RVNA 4C89A 4D9MA 3GFBA 3RS0A 3JASA 3U7JA 2A9RA 2QLTA 2ZZNA 4P4GA 3O91A 2R7LA 3RVPA 4ZALA 1JHUA 1L6RA 3G2MA 2RKOA 4Q7JB 2H57A 3NWJA 4KV7A 1X87A 1RWMA 2R2GA 4YUVA 3VR6H 3VO2A 1B8OA 2ZP1A 1XV5A 3IEXA 4TWAA 4OP2A 1MOPA 1L5FA 4KWTA 2RGBA 2YWXA 5A6VA 4U7GA 2QDXA 3F98A 3A1WA 1CF9A 1O96A 3O92A 5BSWA 3ZGXA 4HY3A 5JMTA 1C29B 4B33A 1SKUA 2RI1A 1P7ZA 1LY1A 4HX2A 2A35A 2VJMB 3B3GA 3LLCA 1NT2A 1O9GA 1ZD1A 3KZMA 4DBLE 5H4GA 2CVFA 5KTMA 1F9EA 1SCNE 2QTRA 4AO7A 4EIWA 3N9IA 1RDFA 4RY8A 1F4PA 5JFTA 1PBTA 1T1EA 4MGEA 5DLDA 3B78A 3NYWA 2IRWA 3IVCA 3UXYA 4UUNA 1NT4A 3AR5A 3NGMA 2MTBA 4OQXA 3QPDA 4R0VA 3WJAA 4V0NA 1HR0B 1JA1A 2CK3A