2HJVA

Structure of the second domain (residues 207-368) of the bacillus subtilis yxin protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
TTRNIEHAVIQVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase dbpA
publication title Structure of the second domain of the Bacillus subtilis DEAD-box RNA helicase YxiN.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjvA00
4A2WA 1T5LA 5JHHB 2CL7X 2OXCA 2JEOA 3A36A 1VKJA 1UDWA 1OFUX 4DXAA 3AP3A 2REBA 3OIWA 4HAXA 4B71A 1T0HB 4M22A 3AVVA 4F7WA 3RS4A 3TQCA 4PR0A 3K0SA 2ZR7A 4B2PA 4C0QC 1FP7A 4XSHA 2QENA 4IDPA 4LCBA 3AKEA 3T1TA 3VX4A 1XNJA 2QM8A 3PEYA 3NTUA 4B3CA 3ZD7A 4JT2A 2Q9BA 1F48A 2MSCB 3RYTC 3GJ4A 4OJKA 1VCOA 3IHLA 2X2FA 4HAYA 1NLYA 3L0IB 1JR3D 4IXMA 2NMVA 4TYQA 4V02A 4BE7B 4PZZA 4XWOA 2ZSBA 1A2BA 2YC4C 4Q9IA 3SBEA 2AKYA 4XD7A 1E9SA 1PJRA 2IXFA 4TQAA 4ZI2A 4RD0A 4LBYA 1IBRA 4ARZA 1LTQA 2F7SA 2ZJAA 3PEWA 3C16C 1XD2A 2EYQA 3ZVLA 5E95A 3KL4A 2BBTA 4LJ5A 4QBFA 4R7ZA 3U3RA 1KO4A 1Z0IA 5FOTA 3ZYCA 1KSFX 1OE0A 4Q1CA 2REXB 4ZIRA 4FXPA 3T34A 2KE5A 1EK0A 3GLFB 4YDHB 4K81B 3K09C 3RC3A 2PCJA 3OFNA 3W5IA 4HYYA 4DKXA 4HDCA 3RWOA 1HH4A 3QNUA 2ERXA 1Z6TA 3BERA 2QPOA 3GLHA 2GZHA 1SQ5A 3PG5A 4R9UC 3SQWA 3P32A 3L0PA 3L2OB 1P2UA 2HXYA 3C5CA 2CK3A 4QRHA 3SDZA 2G83A 1GKYA 3BS4A 4PAOA 5FUVA 2WICA 1NVVQ 1AQYA 2IYQA 2H5EA 3GLHE 1NG9A 1BIFA 1WQ1R 1H8EA 3Q7PA 1NBMA 1UJ2A 3NBZC 2WWIA 3QQ5A 2JLXA 1P61B 3OAAA 4BZPA 4DUGD 5AUQA 2ZQ5A 4MYCA 2O8DA 4QJ3A 2FFHA 3R8CA 1FNNA 4DLTA 2QM7A 2E1RA 1FP6A 3GEEA 3CX8A 3TW4A 1NBME 5ELXA 3DEFA 2XOKD 2IA5A 5TB5A 1IY2A 1MV5A 1NJGA 1TF7A 5FTMA 3FMPB 3WYAA 1TU3A 2FFBA 2ZYVX 4JJZA 4U7DA 3OIUA 5SZHB 1G3QA 1W4RA 3SJAA 5ANRB 1ZD1A 1OXUA 3EG5A 4KFUA 4KI0A 2YWFA 1IOZA 4D0GA 1Q1ZA 4RSGA 5EE3A 4RD2A 2W2TA 3IIMA 3VR3A 5TMPA 4O3MA 3HU3A 1YZGA 3L8YA 2VHJA 3B78A 1YRAA 3TR5A 3EWAA 1CJKC 1HY3A 2L0XA 2QQ0A 2V4ZA 3KXKA 1WMSA 2QTHA 3PQCA 2YWGA 4P0TA 2ZYUX 4GDFA 3TRFA 4JVNA 4B3BA 3PVSA 721PA 4AURA 2JLYA 3CNOA 3LBNA 1BMFD 5FTNA 4CEJB 1UM8A 1W0JA 2RGNC 3RVBA 4LJYA 1AM4D 4KCGA 1F2TB 2FN4A 1FTSA 1I2DA 2NO9A 4Q21A 5AUOB 2ZJZA 4OHXA 3CPEA 1KK3A 1NKTA 1EX6A 1TUIA 3FKQA 2QAGB 4OBEA 4WZ6A 4B44A 2BMJA 2CVHA 1NF3A 3TAHA 4LYHA 3QPVA 4O0MA 2X1VA 3RRMA 3QF7A 4C0SA 1TPZA 5EE5B 3W6OA 1ZVQA 1TUEA 2F6RA 2JCSA 3MMPA 4LZZA 4GFDA 5JBQA 2IS1A 4ESHA 2CE2X 3LO5A 5CB6A 4RJLA 2FZLA 4BFSA 5KYKA 4M1WA 5F2EA 5G53C 4TMVA 4RZXA 4HSEA 3QENA 2GEVA 4ZKEA 3LX5A 1E32A 1Y63A 2VP9A 3GLFE 3CWQA 2ZJOA 3K70C 3PEUA 2GA8A 2W83A 3CZPA 1LF0A 2QMOA 3K9NA 3WNCA 4C0LA 1YZKA 2BJVA 1T5IA 4EPRA 1NN0A 3DKVA 4BECA 2HXSA 1CTQA 5B57C 2OT3B 1EX7A 1IJEA 5FBWB 2B8TA 2VP6A 2IK8A 3T15A 2AR7A 3SYNA 3G0HA 1KI1A 1EFUA 3I8SA 5EP1A 4CT5A 4BEBA 3QPUA 1CJTC 1EESA 4LHWA 1E2EA 4AD8A 1AKEA 4Q4JB 1SKQA 4ASUA 3MCAA 3FWYA 3I4LA 4CEIB 2OO7A 1YKSA 3HYTA 1JXMA 5E7IA 4XVUA 1U98A 2YNMA 3U7FB 2PL3A 1HURA 2OHFA 3PJRA 4ZDWA 1E2FA 1GKIA 4TTRA 5E7JA 1DAIA 2C95A 4BFVA 1XPUA 1IXRC 3GJXC 1MOZA 1D5CA 2FPKA 2ZRFA 3M6AA 4JT4A 3IIJA 2VIIA 5GJVC 1LV7A 1JNYA 4OHZA 4CW7A 4JL5A 4JJKA 4LBVA 3B9QA 2QE7A 4C0KA 4UQOA 2GXQA 1IONA 4BZQA 3SI7A 4JLPA 2JJ2D 4IVRA 5J40A 1E79A 3PEVA 4QM6A 5HPYB 421PA 2QA5A 1XMIA 3MFYA 4CEJA 1XTJA 1FPMA 4BPBA 1E2QA 2WJYA 4US1R 3AF3A 3KKPA 2WAYA 5H1YA 1F2TA 1HEIA 3M1IA 4FN5A 4DVGA 3I62A 2R6CA 1R0YA 2VPPA 1HT1E 1N6NA 1EG7A 2XJ4A 2YJTD 3AVXA 5LD2B 1EXMA 2QAGA 2BCGY 4HLDA 4DB4A 5LDDC 3AF2A 4TL7A 3VU9B 2VP4A 3T35A 3REGA 1E98A 4O25A 3EA0A 4LC1A 3ZVRA 2XSZA 3AP1A 4LJAA 1CR1A 1ZC4A 1KO1A 1N6OA 4O2LA 1ZUNB 1CXZA 4MRSA 5FBLB 2XNSA 1G8PA 3MWYW 3TH5A 4B6FA 3IO5A 4N0DA 1D6JA 1ZD9A 1ZRHA 2OEPA 4F93B 1P2SA 1W7AA 2NIPA 3EIHA 3QXSA 4Q03A 3IUYA 4KSCA 4V0MA 4DLXA 3CPJB 2EFEB 2RCNA 1NMYA 2OXRA 5J4KA 4B2IA 4Q4LA 3K70D 1FL9A 2WWWA 4GZMA 2R6AA 5JMTA 2D74A 1PV4A 2MSDB 1E94E 1I4LD 5EXTA 2WTUA 2CHVA 2VRWA 3ZS9A 4DIDA 1E1RA 1CU1A 3CIOA 2F3TA 3C14C 1OXVA 3D3QA 4H1UA 1N5JA 2W6JA 2CHQA 1DELA 3FHCB 1LF5A 1J7KA 3QF4B 1UEIA 4Q4JA 4HB4A 1E69A 4W5WA 1R8QA 4JLBA 4U02A 4BASA 4BFTA 3KQHA 4UJ3A 1G17A 1NI3A 3RS5A 3NHAA 1GRRA 1NP6A 2GF0A 4Q7JB 3I61A 2FU5C 4Q9HA 5DSZA 1Z6GA 4ZKDA 1OKKA 3U3MA 3LQQA 5J4LA 2A2ZA 4MA4A 5IRCD 5EE9A 4XVQA 4GOXA 2P6RA 1U0LA 2BEJA 2CBZA 1KZ7B 3CRVA 3KQLA 3CH4B 2ZI3A 4P33A 4Y0VA 4TL6A 4YONB 5AK0A 3BRWD 1VCIA 2VYFA 3LFUA 1OH7A 4P4UA 4TLBA 1DAFA 4D0LB 4YLGA 1RVDA 2CEAA 1FX0B 3S1AA 1VIAA 4NBSA 3BH6A 1KI9A 3K9HA 1AN0A 1DARA 3TBKA 3EARA 1B23P 5IT5A 1U0HC 1IXZA 1JR3E 3FHTA 5TDHA 4QG7A 4TSFA 3VU9A 4A9AA 3U7GA 4DCTA 2CHGA 1SZPA 4GRAA 4ZDKA 4B3GA 3GP8A 4IXNA 5FL7A 3TUJC 4PQFA 4Q9KA 2JLWA 1BH2A 3IDQA 3BAFA 3X1WA 1P7CA 1RRGA 2VBCA 4JSTA 3THYA 4LUCA 2OBNA 3R9WA 1AS3A 2F43B 5FPYA 1ODFA 2I3BA 1CBUA 1VYTA 2A9KA 3EC2A 5FUYA 3SU8A 3PENA 4KFRA 2DHRA 2QAJA 2VF8A 3OFND 3CZQA 1SXJB 4LYFA 4MRPA 3WY9A 4I99A 4NYIQ 5L3RA 1ZNYA 2G0NA 2W0MA 4Z1MA 2BMDA 2Z43A 2G3YA 1K6MA 2J1LA 3HR8A 3GJ3A 3IQWA 4HLQB 3QE0A 2Z83A 1SVLA 3CF2A 1R5OA 4P32A 3B1XA 2DYKA 2AK2A 4B47A 3ADKA 4TTPA 3VR4A 1G6OA 3Q5EA 3QF4A 1NBMD 2IS4A 4TN1A 4S35A 2V54A 3CRMA 4QL3A 3OAAD 3DOFA 4HB2A 1E2KA 2QT0A 1WB9A 3FPAA 1KI6B 4DSOA 1LS6A 5FR1A 4BZXA 1TEXA 1RZ3A 3WNDA 5JLJA 2ZR0A 4JLMA 4M1KA 3T1QA 3SYLA 3UMSA 3FKSA 4B3XA 1OPXA 4WAUA 2IWRA 4ON9A 4C2UA 3BIFA 3UG7A 1AK2A 2MMCA 2OCBA 4BUJA 4R2HA 2ZREA 1TNDA 4DSUA 1AJEA 1Z2CA 2HUPA 3VKGA 3RSOA 2H92A 1G7SA 1R8SA 4PC1A 3A1TA 2DPXA 1FMLA 4BLSA 3CLVA 3EC1A 1R0ZA 1FX0A 4HI0E 3VNUA 4GOJA 5GJCA 1Z0KA 3LXRA 4GMXA 4IVQA 2FMXA 3BD9A 2AHOA 2J0VA 2WPDA 4MRVA 2IF0A 4E07A 1VMAA 1BMFA 3QXXA 4EDHA 3GJ6A 1IQPA 5E3HA 4AKGA 3U60B 3BJIC 4E03A 2RAPA 2PLFA 1E9RA 2IL1A 1RJ9B 3R9XA 3P27A 2ZS9A 4G5SA 1W0JD 5EE1A 5TARA 1CRPA 4PO1A 5CIWA 1OFTA 4L9WA 3KFXA 3SJCA 3GCGA 2QAGC 2VSXA 4Q1BA 3B13B 3IPYA 4UNQA 5DI9A 2VLIA 2R6DA 4RD6A 4I1UA 5FBRB 3R20A 1E1QA 4HDOB 1VYVA 4OI1A 3SJZA 121PA 2BDTA 2OAP1 2YC2C 1D2NA 2BC9A 1SXJA 2IXEA 2NPIA 2Z5FA 3EPJA 2I1QA 1W4CA 3QI2A 3CR8A 3AVTA 3K0CA 3QJYA 3RDPA 1DADA 1XWIA 1SXJE 5DIFA 4G5RA 4DEYA 4LHZA 4M21A 1D8TA 5HZKA 3ONWA 4A92A 1G8GA 4ESVA 1W0KA 1IN5A 1J8YF 2OM2A 2AWNA 5CLQA 3K1JA 4OYHA 2W58A 2ZPTX 1NVXQ 3N70A 3ADDA 1KI6A 2ZSAA 1HE8B 3AP2A 2HT6A 3L0SA 1UADA 4DLZA 1Z6XA 4FMBB 5FOXA 1NN1A 1T8UA 2G0TA 1DVRA 4FD2A 2OV2A 4QGFA 2YVUA 2PLRA 3FDIA 2FPLA 5FFMA 1VTKA 3I73A 5KOYA 2DFNA 2GJ8A 2GTPA 2R8RA 3LD9A 1CRQA 1LVGA 1QHIA 1YQTA 4PHHA 1G21E 2FWRA 1ZBDA 1KDRA 4FMCB 4KBGA 4DLRA 4M9QA 1KIMA 2C96A 4RVCA 3JZAA 1DTSA 2FSHA 1C4OA 2ZE6A 2EQBA 2QUZA 2V6JA 4AIIA 1UEJA 2XZPA 1NSFA 3QXHA 3SE0A 4CYMA 2C9CA 3ZVNA 3PUXA 4ERNA 1YRBA 2ATVA 2QE7D 3MJRA 3OIVA 1GTVA 1XTQA 4KVGA 4DSNA 1UKYA 1FQKA 1E79D 1G8YA 2F9MA 3QBTA 3LNCA 1MO6A 2B7BA 1BYUA 3P26A 4FWIB 5KPJA 1E2HA 4HAWA 3MWKA 5JFGA 4LYJA 1VPLA 3VKWA 3PFIA 1ZCBA 2ZEJA 4JKYA 5LD2C 1HTWA 3B1WA 3LWNA 3VKHA 3L82B 1N5LA 2ANCA 1Z22A 2P2LA 2JJ8A 2PT7A 4Z8YA 4HAUA 4B2LA 1G4AE 4TLEA 3LXXA 3EX7C 2W2XA 1G8FA 3HWSA 5BYKA 4IVPA 5KHOC 4AKHA 2NZ8A 4DC9A 1A5TA 1E2GA 2XSZD 1F2UB 3U2QA 2PEYA 3PV0A 2G6BA 2J7PA 3AGPA 2NTYC 2ONKA 2A5DA 5B64A 1P9WA 1OSNA 1G5PA 3CPHA 1FUKA 1N6IA 1BKDR 1KJWA 1KI8A 2FNAA 3BORA 3CF6R 4P4SB 2IUTA 2N1BA 2B6HA 2IYSA 2FEOA 4EFNA 2BJWA 2FFAA 3BXZA 1TU4A 3WRXC 1XTSA 1W4AA 3QVVA 2RGBA 4PPNA 1NIPA 1E2NA 1Z8FA 5EP3A 4ZV4A 2D06A 2EFDB 4M9SA 5CB8A 1G7RA 1N2CE 4D4JA 3WYGA 4ZDJA 1AKYA 2Z6VA 5K8TA 3EIQA 1E1RD 5HR5A 2QNRA 4BWYA 3JZMA 1D2MA 2WJVA 2W6JD 3WBKA 4DDUA 5L3VA 2PX3A 1P72A 1WDTA 4QHTA 4PAQA 4UJ5A 1CJVC 1CKEA 1TEVA 4RD4A 1OH6A 5TVKA 4Q18A 1ESNA 3PCRB 2FGKA 3RABA 2J0UB 2ZUDA 2VSFA 4ABYA 2ZSEA 4ZPXA 2CLSA 2O0JA 1PLJA 1OKKD 4LOAA 3FFAA 2I4IA 4EPYA 3NDBB 5A4JA 3CRW1 2ECKA 3K0EA 4N3NA 1VG0B 1SVKA 1VHTA 4EJSB 4UNNA 4NL4H 3O8BA 2V8OA 4NCKA 1OH8A 3VR6A 1YZLA 3KKMA 2KJQA 2EWVA 1E6CA 1G3RA 5KUTA 521PA 2LKCA 1GKUB 4JLNA 5C4GB 5EXXA 1LNZA 4MUAA 4MDEA 2DWQA 3VR5A 1MO3A 4AYTA 3HU2A 4EQ6A 4Q19A 4RCYA 5KSOA 4B32A 2PT5A 2HV8A 2WKQA 3LX8A 1R5NA 1B0UA 4EFMA 4D0NA 3QVUA 2Z4SA 4M8NE 1VG1A 2O8BB 2XX3A 2ZYTX 1XRJA 1ZAKA 4M53A 4TQUS 3DM9B 3QPWA 4PPGA 4TSFD 1Z0FA 3P4XA 1LB1B 1WE2A 5CYOA 4BFYA 3TAUA 4EPVA 1XFAA 3ETLA 3I32A 3PXGA 3B6EA 1F2UA 3HYRA 5FL7D 3X2SA 2FSGA 2J5XA 4GZLA 2ZI4A 1QHHB 4O2RA 1IAQA 2GXAA 1UF9A 4M9XA 4PXAA 3VR1A 2ZVQX 5SZJA 3AVYA 2FH5B 2YWEA 4IDHA 1XCGB 2JLZA 3K0FB 4Q7MB 1XD8A 5C4MA 1XDBA 2ZRPA 1MO5A 1KO8A 3ZS8A 4PHFA 3VMFA 4DBLC 1I4TD 4P4SA 5DGXA 5FOWA 4DDTA 3IEVA 2VO1A 4TTQA 2XTZA 2OLJA 4DHEA 1G8HA 2Y8EA 4LRWA 1SXJC 3ND9A 2QT1A 1DO0A 1BOFA 1QHNA 2PJZA 2W6IA 4KBFA 4C0BA 3H0KA 5IDVA 3W6NA 1DOAA 3KQUA 2ZI9A 4HZIA 3MLEA 1XTIA 3K0CC 5EXPA 1DS6A 4DLYA 4Z1MD 2WV9A 1Z28A 3U3KA 2X77A 3CM0A 3DMNA 1ZU5A 2ZUCA 2JLQA 4JVMA 5JWOA 5G40A 3VTKA 1VG8A 1E0AA 2NGRA 2QG6A 2ZS8A 1CS4C 3AUXA 3UWOA 4U00A 4IEIA 5JI3E 3BFVA 3C8UA 1VCNA 3A4MA 4KODA 1JJ7A 1N5KA 2XNDA 3ZGXA 2RH5A 2RHDA 2J0UA 2JA1A 4JLVA 4LJ9A 3T06B 4YQFA 1N6RA 2HJGA 2ZI7A 4NCNA 4XVRA 4EAQA 2B21A 2F9LA 2VP0A 3QIAA 4LY6A 1XX6A 2HDNB 5EJEA 3WMFA 3FKSD 4DLSA 4NDZA 5EP2A 4BGDA 4EJSA 4RFSA 3RNLA 4B76A 1CIPA 2NG1A 2ZTSA 1VECA 2O0HA 5JJIA 5D3QA 1M7BA 2IYXA 2WSSD 3UPUA 3MD0A 2WIAA 3SOPA 1KI3A 4C7OB 1KDTA 1XMSA 3QKRB 1W46A 2W0SA 3IHWA 4NCIA 2ZU6A 1OXSC 2K5UA 1RW4A 1VYUA 5J4HA 2IC5A 2IT1A 4KO8A 1GDDA 3ZJYA 2GESA 4CDGA 2OAQ1 4RKFA 2IYZA 5FBVB 3H2YA 2WPDD 2O8BA 1ZU4A 2J7KA 2Z0MA 4PC3A 2DFTA 4N1AA 2OBLA 2C03A 2FJUA 1QRAA 4Q1FA 1NIJA 2QQEA 4L8GA 1W5SA 2KBFA 3FMFA 3QXJA 1KKMA 1E0KA 1MR3F 1XEFA 2UZIR 4TLDA 3EZ2A 4BLOA 2ZANA 1QHHA 4PSVA 4PO8A 2UKDA 2HCBA 2AN9A 2UVQA 2C9OA 4TMWA 3K0FA 4Q7KA 1W48A 1HYQA 1KOFA 2PEZA 1OT3A 1Z29A 3KFVA 1X1SA 4MGZR 4ZDIA 1Z63A 1DG3A 1E1QD 1FTNA 1JPNA 1TF2A 1ZM9A 2EFHB 1NKSA 3KTAB 1SXJD 4UXHA 1X1RA 4WXPA 2V3CC 2QL6A 4KFSA 3A4NA 3RS2A 4US2R 2QEQA 2GKSA 2HJVA 4LV8B 4PPQA 4OHWA 2NZJA 1XTRA 4Z54A 5IF9A 5JWHA 2H16A 4AWXA 3HU1A 4IOLA 3THXB 1SVWA 1RPZA 4A0GA 2XB4A 3A4LA 5IK2A 2O8EB 3KJEA 4GPTA 5F98A 1TQ4A 3FYHA 3TKLA 1W0KD 3C41J 1NRJB 1ZCAA 1JECA 2TMKA 4R71A 1XF9A 3ZQJA 2DWOA 5BW8A 3QSYA 1G7CA 3LRPA 2V1UA 3AVOA 3TGPA 2RGAA 1MRNA 1SULA 3CONA 5DYGA 4XTRA 5DHAA 4PO9A 2XZOA 3A6PC 1WA5A 3NH9A 3RSLA 3CWZA 4DLVA 3AVQA 4NYJR 1P3JA 4HB3A 1LY1A 1SVSA 3DPUA 1PLKA 2ZJ2A 4XH9B 4YDSA 1G7TA 1E9EA 4QC2A 1AS2A 3B1ZA 4FIDA 1IM2A 3CNNA 4C7OA 2G1JA 3KXLA 2IYVA 3QKRA 5FTKA 1MKYA 4A8JB 4GNKA 1ZMXA 3Q72A 4Q5IA 1NY6A 1YR8A 2DFLA 4R98A 1QHYA 4URUR 2IW3A 3LVQE 1KNQA 2A5FA 4GP6A 4ACBA 4C0JA 4URWR 4BRWA 3AM1A 1AZSC 3DZ8A 1ZM2A 5CITA 1EGAA 1PUIA 4M1YA 3NC0C 3N2IA 1QHXA 3S1AB 1ZINA 4LBZA 3TLXA 2CMKA 4I4LA 4QBIA 1UPTA 2WJIA 4EUNA 3R8FA 3BB1A 2DB3A 2ONJA 2A5JA 1E9BA 2EW1A 3NDPA 3ZZUA 5BN5A 2C99A 2WOJA 2ZJ5A 3PUVA 4FMCF 2ERYA 1U9IA 2H57A 1UBCA 4MYTA 3SYKA 1KSHA 4DT1A 4BLPA 3H4MA 3EPHA 4D4KA 4QM7A 5F3WB 4BFWA 1UAAA 3GFPA 1NSTA 2AX4A 3NHBA 3PUZA 2GAOA 5CJPA 3T5GA 3BGWA 4NH0A 1JI0A 3THYB 3KTAA 3TSWA 1IN8A 3TNFA 1KO7A 3HJNA 2J7PD 4HUTA 1QVAA 4TL8A 3ASYA 3KUDA 1MT0A 5LB4A 3EA5A 4HUQB 4AC9A 3OF5A 2V55B 1GILA 4BRUA 2ZE5A 2V6IA 3THXA 2XJ9A 2XXAB 3NBFA 4M0LA 2GBLA 3GJ8A 3IILA 4KFTA 2WWGA 5CYPA 5DHFA 4EKDA 4V0ME 5H70A 2O8EA 5FI1B 2VP5A 3A1UA 3U6KA 2HLDA 4AY2A 4Q48A 5J4VA 2WWFA 4PAMA 4URVR 4D2IA 2VHCA 1QHSA 4YMTA 1KK1A 2OUKA 1Q12A 1U8YA 3QY0A 4TMKA 1ZP6A 3CX6A 5GJWC 1P75A 2WBLC 3SS8A 3GEIA 3U7EB 2EFCB 4MGKR 3H86A 1S9DA 5HE9A 4D80A 1P5ZB 4A2PA 5J5CA 1KO5A 1GNRA 1TMKA 5JZVA 2DY1A 3PUYA 3LH5A 3K9GA 4QGGA 1XEXB 4MH0R 4ITRC 4FWTA 3B5JA 1RE0A 2IS6A 3H84A 1GNPA 2FV8A 2BBWA 4Q1DA 4A8JA 3VQTA 2ZSDA 4NMMA 5UKDA 4MKIA 2WVJA 1BYIA 2CL0X 1D9ZA 4DCUA 2CLDX 4C2TA 3NBYC 4MKFA 4F4JA 3BB3A 3U3JA 3WHLA 2OSBA 3P20A 2RGXA 4MKHA 4YMVA 2ZRKA 3KB2A 2CCKA 5EP4A 5E7MA 2GILA 1XBTA 2BBSA 3W3ZB 2JLVA 4CIDA 1JEDA 2LKDA 2QP9X 3ZZ0A 2Q3FA 5JWRA 1W36B 1JALA 1OV4A 2HT1A 1YJ5A 3KX2A 3W34A 2P6NA 4PC6A 1E96A 3NBXX 1A4RA 2QN6A 3SHWA 4GT1A 3FE2A 2ZI6A 3AUYA 3EZ6A 4HLCA 5TY0A 1GM5A 2ZRJA 3AKCA 3SZRA 1N3BA 2ODNA 3MAAC 2ZM5A 1GZSA 3IPXA 1RKBA 4KVAA 1MO4A 2N42A 1FNMA 1CF4A 4FCVA 4AYXA 1GOTA 4F4CA 4TQ9A 1S3SA 3IIKA 4HUQA 4NYJQ 3WP0A 4QGAA 2GJSA 4V0OA 3TR0A 1NG1A 1G9XA 2CVFA 2XXAA 2GHIA 2WMOB 2W6ID 3RHFA 1LS1A 1NLFA 2J41A 2MMGA 1A2KC 2OILA 3FMOB 4OI4A 4P4TA 1KJZA 1A7JA 2CE7A 1MRSA 1L7VC 3RLFA 1J99A 4K8OA 4KXFB 1JPJA 1M1YE 4GI7A 5KNDA 3I1FA 1S1CA 3REFA 1GSIA 3T61A 5JRJA 2FE4A 3I8XA 1J90A 5LBIA 3D7MA 3LAWA 4L4UA 3SFZA 2VEDA 4B73A 1HV8A 2YINC 2R6FA 2YWHA 2XNDD 2MSEB 2IF2A 2VQSA 5FBQB 3CH5A 1XEXA 3HPQA 1A1VA 1Z06A 4NONA 5BN3A 4JBXA 2C04A 5KNCA 2WKPA 3B82A 1S4QA 3LLMA 1CR4A 3CB4A 4FCWA 3CUEF 4X8MA 2IYRA 1GITA 2WSSA 1DG1G 3W6PA 3X1ZA 2N46A 4DSTA 5KTYA 5HCNA 4JLKA 1TTTA 2QROA 2NO6A 4LJ6A 1ZW6A 1OHHA 5K8LA 5CM8B 1V5WA 4IRUB 3ZDQA 5M04A 1EWQA 1X3SA 5FUWA 4XOIA 3SC3A 1DE0A 2R2AA 1YR6A 4PZLA 4IFBA 2BM1A 2GVDC 4BEJA 2ASEA 1ETUA 5FH9A 3ZIAA 1RFLA 2OFWA 3IBYA 4IHQA 3GJ0A 3U4QB 1P4SA 3LDAA 4OI2A 3EAQA 1M74A 3HDTA 5KU1A 2ZRGA 3X1YA 4B33A 2F55A 3DHWC 1U9IC 4E09A 4CZ2A 3TJZA 3OEEA 5A5GA 3SQXA 1GRNA 5B2ZA 1Q0UA 4QJ5A 1Q1EA 2XTMA 1DO2A 1Q44A 1KNXA 2F1JA 2FFQA 4Q1EA 3B60A 4KLZA 2E87A 3GJ5A 2J0SA 2YOFA 4DZZA 3RS0A 5JJLA 1XXHA 1II8B 4B3DA 2IYLD 4GOKA 5L3SA 2J0QA 1SVIA 1J8MF 2R9VA 4IDNA 8OHMA 2WOOA 3V4RA 3AKDA 4URXR 1P73A 1G3UA 1G3MA 3NKVA 4OQMA 1KI2A 1O87A 1G64A 2GBLC 3K09A 2QSZA 2AD1A 4LI0A 4XWAA 2C98A 1RC8A 1KAGA 4BFUA 1PUJA 1SGWA 5IK2D 2EU8A 4OHYA 5D3MB 1GAJA 3A1WA 3Q3JB 4IDQA 1OF1A 2BVNA 5L3QB 4PQRA 4DDWA 4EPTA 3ZVMA 4LSGA 4UNSA 3AKYA 1G291 1KMHB 4KSBA 3I72A 3W8NA 1ZIOA 221PA 2B92A 5FL3A 4OQXA 5BQ5A 2R65A 4A2QA 1UKEA 4QGHA 3L8ZA 3GLGB 1EWRA 2C8VA 3DO6A 2CCJA 5L8VA 4XWKA 3A58B 4W5JA 1GFIA 2ODWA 5EUQB 4A8JC 4P31A 1KTVA 2KBEA 1N6LA 1XMVA 2LCFA 4IKEA 2D2FA 2NOAA 2H17A 4UNPA 2OE2A 4IW3B 1IN4A 2H18A 2QP3A 5B30A 2IX3A 4A4DA 2J9RA 4LV5B 1T8TA 4XJXA 1N0WA 4D26A 1XPRA 1NMZA 4GSYA 2PMDA 4TYWA 4EQ6B 3ADBA 2ZRAA 4POAA 2PCLA 3ZD6A 1OH5A 3VR2A 1GNQA 4A6PA 3U4QA 4UKDA 1P62B 2CNWA 4I81A 1QVRA 2PZEA 2XEXA 1ELOA 1WRBA 2GF9A 2OCAA 2JJ1A 5GADl 1OIXA 4Q1AA 2P5TB 1KSJA 4OQNA 1XU4A 4FW9A 1TQ6A 4G0NA 2Z4RA 4Q9JA 3WXMA 2GEDA 4ZCLA 2CL6X 1IN6A 3U44B 5JSZB 1XEWY 2PZGA 1FQJA 4X8OA 2H7VA 1G18A 3KUCA 2O8FB 2BMEA 5KO2A 1EFRD 3KZ1E 3FTQA 1II8A 2REOA 3KJHA 4IDOA 4JSYA 4WVFA 2OZEA 1G41A 1W1WA 1KSGA 4DB2A 3K9LA 3O47A 5DISB 5JI2E 4F38A 4M1TA 1UKVY 1W44A 2B8WA 4MRRA 1T6NA 2WHXA 1ZYUA 1X6VA 2QP4A 1ZM4A 2CDNA 3B2EA 2AL7A 2BIFA 2D62A 2J45A 5KSZA 4PZYA 3IKJA 3NWJA 3TK1A 3IO3A 4ZI3A 5D3MA 1YR7A 4FMDB 3EZ7A 5CK4A 2BV3A 2GZDA 1P60A 4A15A 2HLDD 1HUQA 1TX4B 5GJBA 4M1MA 5L3QA 1A82A 4WA7A 4B3FX 3UMRA 3F0TA 4LPSA 5AUNB 2WZQA 1E9DA 2VP2A 2W2VA 1L4YA 1KMHA 2Q3MA 1QG2A 1VHLA 4NZYA 2XAUA 1AS0A 1E0JA 1UBEA 4KHZA 1GUAA 4IJMA 5G3YA 1T4GA 3OE7D 4X8HA 4PSKA 3Q7QA 4W5HA 3GLGA 1E2DA 4HZUB 5FPTA 3SBDA 2P6UA 5CDFA 3JVUA 1NN5A 4NHOA 1KY3A 1WBDA 3W3AA 2O5VA 2ZJ8A 2JIZA 1HT2E 4Q4AB 3GD7A 4MGYR 2P65A 4TLAA 1MABB 1T91A 3DOEA 3E5HA 4RFSB 4AI6A 1E2LA 4TT3A 3GLGE 4UXIA 1M7HA 6Q21A 3V00A 3QKTA 3ZQ6A 1ZUIA 4BLQA 2WJHA 1S96A 4KYIB 3A1VA 4YC7A 5HCIA 5C18A 1T3HA 3TIFA 5KSPA 2ODBA 1WXQA 1Q1BA 3MWJA 1E9CA 3EPKA 1H8HA 5GVSA 5KDDA 1WBBA 1FW6A 4JVSB 2QMUA 4JLDA 1W36C 1L4UA 4EPWA 4V03A 3T1VA 3WHKA 4A1FA 2QMHA 2UZ3A 4Q02A 5HTKA 1W4BA 1G3IA 5P21A 2VSOA 3D8BA 3WMEA 3AEZA 3OZXA 1DAEA 2G1KA 1XZPA 1UDXA 2GVZC 2QI9C 1G19A 4CVNA 1L8QA 1OXTA 1KKLA 3U44A 5JSZA 4MDFA 4YMWA 2O8FA 1ZC3A 3UXMA 2ZROA 5FTLA 2KSQA 1IJFA 2VF7A 4C0AC 2I1VB 4NU0A 3BK7A 3UIEA 3I5YA 4II7A 2IWHA 1DAKA 5BYJA 2FOLA 4W7SA 1XZQA 2NO1A 3C7KA 3M4YA 4LJ7A 3I92A 5KPDA 1GP2A 4E5UA 3WBJA 5C46F 2IUSA 4LWZA 1WP9A 3RRYA 3RAPR 2QZ4A 4A6XA 2WIBA 2ZRCA 4B43A 3BC1A 5DN6A 2AK3A 2QGZA 2X19A 4I1OA 1VG9B 1ANKA 5C1BA 1T3SA 4HDQB 4WZAE 4MYHA 2ZRDA 4QOSA 1ZJ6A 3EWSA 4OL0A 1OXXK 3K53A 4EFLA 2RHMA 4W9MC 5AJVB 1HQCA 1SKYB 5DH9A 3DZDA 2CCGA 5CLLA 1ZNXA 1DBSA 2DR3A 2PZFA 1QBKC 2AKAB 4RZUA 3DDCA 1DAMA 1G5TA 4MRNA 1TADA 3L43A 1Q21A 3B1VA 1R5BA 3IEUA 3BWDD 4H1VA 1M6NA 5AUPB 1UBFA 4LDJA 2ORIA 1RIFA 4HZUA 1U0JA 4DLUA 2GDJA 3E70C 2Q9CA 5CK5A 2XB2A 1E0SA 1GL9B 1E9FA 3EZ9A 1E9AA 1K5DA 4J0QA 3X1XA 1OIWA 1ZM3A 1E2MA 4Q4AA 3UKDA 1VDZA 2DCUA 2HYIC 3HPRA 1MABA 2ZJYA 2IEYA 3KKQA 4QFMA 4B35A 5K8IA 4L5BA 2A78A 4D4LA 1ZUHA 2QTFA 3CRQA 1V43A 2ZU0C 3W9YA 4I1SA 3RRNA 4QXAA 4IFEA 3DL0A 3GFOA 2D4HA 2FDCA 1TF5A 3LW8A 1II0A 1OHHD 2GNOA 3TQFA 1IXSB 1Q20A 3SN6A 1R7RA 1E99A 1KJYA 3HR7A 4RCZA 2XITA 3RRZA 1IHUA 3DMDA 3EPLA 4TWZA 4UNRA 2ZRHA 1W36D 3MSXA 5TXGA 2WJJA 2FEMA 1OYYA 3RS7A 2EFGA 2CXXA 3THWB 1UFQA 1RYFA 1US8B 3ZIAD 4NCJA 1QF9A 1IY1A 3A8TA 1NNEA 2A5YB 2GK6A 1Z83A 3K0AB 1AGRA 1KHTA 3O8DA 1Q57A 1D2EA 1N6HA 4M1OA 2JASA 2ZRMA 4DT1B 5C2JB 2HEIA 4XIGS 2PJRA 2EVWX 1S0UA 3IQXA 1HA3A 2ORWA 2JDIA 2ZETA 3FVQA 3OEED 3BH7A 2IYYA 3FMIA 3GJ7A 3V9PA 1PVOA 1GL7A 1ONBA 3CR7A 1M8PA 1Z2AA 3NXSA 2J3EA 2AFHE 3SFVA 1GWNA 4CEHB 4DJTA 1XPOA 2B7CA 4ILEA 4OJQA 1Z07A 2O52A 3N5CA 4D25A 4CT4B 1FOEB 2QU8A 3CW2A 4M1SA 1ZM7A 4WW0A 2D7CA 1QDEA 4DDVA 4KITB 3QBVA 1OFHA 1Z0JA 5SZIA 2BKUA 3GLFA 3DVLA 4NCHA 3ADCA 2V9PA 1M2OB 1N5IA 4A36A 3GFTA 2NQ2C 1AGPA 4YMSA 1G20E 4PTLA 3TVTA 1T3LA 1AA9A 2ZUBA 4C3ZA 1OW3B 4K46A 1LFDB 4TLCA 2ZXUA 2BOVA 2GRJA 1N6PA 3J81k 5KNBA 2AXNA 1SKYE 5AJWA 3UANA 3VHLB 5CIQA 1IN7A 2A7QA 1KZGB 2FGJA 1I4DD 2GJKA 3VFDA 5HKKA 3KQNA 1K5GA 5DNYB 2AFIE 4TYYA 4D6PA 2ZRNA 3GPLA 5JECA 4AKIA 3ZH9B 2IYTA 3KB1A 4V0NA 4JL6A 3CBQA 3BBPA 3LBHA 5AWFC 5HZHA 1X8JA 4JBWA 2XTNA 2BCJQ 1XEWX 1KMQA 1XCMA 2DBYA 2WM9B 2ZR9A 3EZFA 3ND8A 3A37A 3N2EA 4LGMA 3ICQB 3I5XA 1XP8A 1N0VC 2WJGA 4S2EA 2NPFA 1JR6A 4HAVA 2QMEA 4OKSA 4Z8XA 1FFHA 4TMXA 4G5GA 1SHZA 4MYUA 2HYDA 4NKRA 3CRRA 5HE8A 1YZUA 1Q22A 2G77B 1YHNA 2R44A 1OB5A 3TSOA 4CRWB 1M7GA 2GAAA 3U7HB 3THWA 3E2IA 4NYIR 1S3GA 2KB0A 1US8A 4M4SA 3OEHA 4G1UC 1CP2A 4YXWA 1Z0DA 1XCPA 3K0AA 4TL9A 3DKPA 1U94A 3B85A 4JIMA 1OYWA 2CNWD 1CR2A 5BWMA 3LQRA 4V0KA 4LHYA 5JEDA 1KAOA 4TYPA 4L15A 2V7QA 1X86B 2ODEA 2JJ1D 4Z51A 3FOZA 3LW7A 1U2RA 4X8LA 2C5LA 4RD1A 3TE6A 3CKLA 1GIAA 4JZKA 4NE2A 4TYNA 1EFRA 3ZLJA 1N25A 2YOGA 1Q3TA 3CNLA 3GEHA 3GLIB 1JAIA 4CEHA 3L0OA 2GZAA 4JKIA 3T12A 1BO6A 1YZNA 3SNHA 2OFOA 1M34E 3B9PA 1G16A 1KY2A 3AV0B 3Q85A 3Q8XB 3H1TA 4G5QA 2RKOA 1OIVA 1RYHA 2PH1A 3B1YA 1YZTA 3OESA 2G9NA 4L9SA 3W5JA 3LLUA 2BKEA 3QEOA 1GRQA 5BN4A 1XJQA 3R7WB 2RGDA 1S9HA 4QKQA 4IOKA 4RZ2A 1EFHA 2OESA 1KI4A 4BLTA 1OJLA 2FG5A 2GK7A 4IEEA 3I3SR 1O3YA 5KDOA 1OB2A 2FSFA 2QBYB 1KGDA 4QBHA 1NVUQ 1KI7A 3TUZC 2EWWA 4XTCS 3RC8A 3PIRA 3EXAA 4LBWA 3RS3A 2C78A 2J59A 3G5UA 4AG5A 2QPAA 4M9ZA 4F92B 3OE7A 3ASZA 4LPKA 5JCPA 4V0LA 2D2EA 2A3RA 2X8AA 4QNRA 3Q5DA 2QORA 4OK3A 1YZQA 3BFKA 3SEAA 3W90A 1J2JA 1JJVA 1S2MA 5A0FA 1RRCA 5EE0A 1WF3A 4JVLA 1SHKA 3ZZTA 1WCV1 3P4YA 1P2VA 2RGGA 3UG6A 5BXQC 2OFXA 4FINA 4FI3C 3B8HA 3C5HA 2JIZD 1Z6AA 4EJSC 5JS8A 2FPMA 3CF0A 4BQSA 3LY5A 4HB0A 2WWHA 4CEIA 4FMDF 4D81A 4JYCA 2F1IA 2Q21A 1G6HA 3C4JA 3QUSA 2NO7A 4TT3D 1COWA 2DFKB 3WNBA 4TZ6A 4Q9LA 4PPFA 3U6BA 2AXPA 1F5NA 1ZD8A 3VHXA 4JL8A 4ZCIA 3NIBA 2IBMA 1H8HD 2P67A 3V4FA 3TSZA 2IXGA 2BEKA 1P2TA 4Q00A 2P3SA 2JLUA 3MJHA 1DAHA 4LHXA 5EQTA 4F4IA 2GCPA 4HLUA 4OQLA 1RRPA 3F8TA 4JS0A 4WZBE 4MUBA 2QGNA 3KJIA 4JYBA 1GVNB 3OIYA 2YHSA 1JR3A 2JATA 3UWKA 1JQLB 5G41A 3U61B 4Y0AA 1W2HA 1Z08A 2OBMA 3GLIA 1JB1A 1HQYE 3UATA 2PBRA 2ZAOA 1F6BA 1RRFA 2VH5R 1E4VA 2ZRIA 5FPKA 1XD9A 5DE3A 3QOFA 5SZKB 2OG2A 1KYIA 4XD7D 1S1MA 3FGNA 1YVDA 3NC1C 1U81A 4YMUA 1GL6A 2ZS7A 3X1DA 1CEEA 4DCNA 3GLIE 4JLJA 1NN3A 3R7WA 1ESMA 1XXHB 3D31A 1I2MA 3JVVA 1E2IA 4ZO4A 5L3SB 1Z6YA 5F9HA 1XB2A 1JQJC 1XMJA 5H8WA 1PZNA 5DN6D 2QBYA 4PQYA 3ICEA 5JS7A 2XZLA 2J87A 1JXOA 1P9RA 2SHKA 1OLOA 3LVRE 4MQBA 3PITA 2BBOA 3IGFA 1ZNZA 1LW7A 4ACAA 3PR1A 1U8ZA 2R6GA 2GCOB 2E9SA 1U99A 1DEKA 1DAGA 1FMJA 4KU4A 4Q66C 5FI0B 2R62A 4Q01A 1G5RA 1CJUC 2GJ9A 1R6BX 3WMGA 2IUUA 1FUUA 3EIEA 3KJGA 4H9GA 2AWOA 1XJ0A 2CK3D 2YKGA 3LBIA 3QG5A 2HCJB 1JBKA 1T9HA 4DRZA 2JLSA 2ZITA 1KDPA 1CLUA 2BM0A 4URZR 5FTJA 3F5FA 4DUGA 3QEJA 2W00A 1W47A 1MH1A 2RB4A 1H8ED 4CF7A 1CULC 3O8RA 2GXUA 3KKOA 5AJZA 1L2TA 2Q0HA 2XOKA 4QHYA 2QRNA 4KV9A 4B75A 3THOA 1XJCA 1VCMA 4UXJA 2DWPA 2CLCX 2P5SA 4LHVA 2PMKA 1TQDA 1E2PA 2FX3A 2JAQA 3A1SA 4E22A 1F60A 3WYFA 1U8AA 4OHVA 4RY2A 2HF8A 3AF0A 5J4YA 3TUIC 2IYUA 3HP1A 2PX0A 4OI0A 5EZ6B 2WWXA 1Z3IX 2YZ2A 4KAXA 4PSAA 3PUWA 4PFSA 4I1VA 4AYWA 2YV5A 2Q3HA 4OK6A 4D4MA 2ZIAA 2X2EA 5LB2A 2RGCA 3SHFA 3RWMB 2KWIA 1P9NA 2ZVPX 2QY9A 1AQUA 2IEZA 5DLQC 3QG1A 3BH0A 4DWJA 4LYAA 1JEEA 3AF1A 1E3MA 4A0RA 3GQBA 5DO9A 4DCSA 1R2QA 1X8KA 4Q7LA 1NY5A 5JHGB 3OHMA 2F3RA 1TL7C 2QSYA 2F1HA 2ZJBA 3B7GA 5JRZA 2GJAA 2JDID 3MGCA 5DYIA 2IS2A 2C9YA 1BS1A 2QTVB 4PANA 1R4AA 4QHSA 1UKZA 4WIAA 3AVWA 3BFXA 2OLKA 3TW8B 4C0HA 2ATXA 2VTKA 3AVPA 1JAHA 4NYMR 4GP7A 1X8LA 3CO5A 4LJ4A 4RD3A 2ZE8A 3D6TB 5J47A 2CJWB 1G4UR 1QHGA 3NVAA 3QKUA 1F3OA 3FHOA 2OCPA 2P0EA 4L16A 4TMTA 2O8CB 2EYUA 4TMZA 1HE1C 1NJFA 1EFTA 2YOHA 4MKGA 1XXHE 3T1OA 5DI3B 2C77A 2F43A 3RANA 1AIPA 1NVWQ 4Q4HB 3G82C 1VIYA 2GCOA 4AK9A 5G3ZA 3DM5A 3R9IA 1T0JB 2Q6TA 2WKRA 5JJKA 1N6KA 2XGJA 1Z5ZA 1W2GA 2ZE7A 4C30A 4JMPA 4JLAA 2VHTA 2GXSA 1Z47A 3LV8A 3K70B 3AF4A 3M0EA 5FOSA 3E1SA 4G3XA 3TVDA 3CX7A 4PHTA 3O8CA 2H1LA 2IHYA 3AQ4A 5HKKD 1KK0A 2C2HA 4BFXA 2ZRLA 2LWIA 3BOSA 5GVRA 5F9FA 2QRZA 3VNVA 4KJZA 3WP1B 2GEUA 3K8YA 1H65A 4AKEA 2ANBA 4WBSA 1NLZA 3KQKA 3AGQA 4GMDA 1YE8A 2RGEA 1C1YA 3NH6A 4LV6A 1SVMA 4P3YA 3VAAA 1R10A 4BFZA 1SVOA 4M2LA 4URYR 4BLRA 2WSMA 2VL7A 2ORVA 3GMTA 4EPXA 3ECCA 3EW9A 3MG9A 1NMXA 4GL2A 1II9A 2NO0A 2JLRA 1XTKA 2VHUA 1N0UA 3MUFA 1DPFA 2GCNA 3UK6A 1TAGA 4N0EA 3UMFA 1OFIA 2ZAMA 4ASUD 5IHPA 4IOMA 3QKSB 1S8FA 3MWLA 1CJMA 3QXCA 4RKEA 3F3YA 1W49A 5LPNA 4TZ0A 2FA9A 1J70A 1D9XA 3KKNA 5FR2A 4DEXA 4NTZA 4U5XA 1QG4A 4DCVA 3W8RA 2KI5A 3U3OA 4AG6A 4NP6A 2WWYA 1Q1QA 3OEHD 4PC2A 4A0HA 3MRSA 2H8KA 2VHQA 4HEJA 4YXWD 1KDOA 4FCTA 4GBMA 4DIEA 3P1JA 1NVVR 2WMNB 4HLUC 1KK2A 2JJ2A 1PLLA 2V1XA 4RFVA 5FPHA 4F91B 1G1MA 4G5OA 5E4FA 4CGZA 1K8RA 2D3WA 2AD5A 4XSGA 3IBGA 1GG2A 2D7DA 5EZ5A 2V7QD 4RZ3A 5FOVA 5KSYA 4KYUA 2RGNA 4HATA 4MGIR 1RJ9A 2GETA 5B58C 2Q9AA 2ZRBA 5JEEA 4ZCMA 2WAXA 621PA 4B6EA 4G01B 1U90A 2CJWA 2FZ4A 2GWHA 4B34A 3SR0A 4ARZB 3LA6A 2ZSFA 3FB4A 3NEYA 1C9KA 4Q47A 5FPSA 1XD2B 4DLWA 1IY0A 2O8CA 2IHBA 5AJXA 1R0XA 5EXSA 4QJ4A 1Q3HA 4LJ8A 1W5TA 3C15C 5DI3A 3SJBA 3Q9LA 4R2IA 4US0R 5EUMA 1UBGA 5K8UA 4Q4HA 2BHRA 4HAZA 4PHGA 2A5GA 4MITA 5KDLA 4QNMA 1NL3A 1E4YA 2BWJA 5CJ2A 4ZIRB 5FUXA 3AVUA 2O0KA 3EASA 3NG1A 5AJYA 3TMKA 4LX0A 1P6XA 4EIWA 1Y3AA 2G88A 3U5ZB 4OQFA 4WOPA 3FFBA 1ZNWA 2YYZA 1EFCA 4PX9A 5H68A 2F1RA 3GLHB 1FZQA 4JBYA 2ZYWX 5CM9C 5TV2A 4LK2A 3AB3A 4IOJA 2HF9A 2VA8A 1E2JA 4PC7A 5JCZA 1QZXA 4QBGB 1CR0A 2JGNA 2OCYC 4KLNA 4OK5A 1AZTA 821PA 4C4PA 4LC0A 1YU9A 1R0WA 3NEJA 2FSIA 4WXRA 2FF7A 5AR1A 4B74A 3KDSE 1YR9A 1ZIPA 1TQ2A 3WRYC 2BMFA 3VX3A 3KXIA 2QPTA 4JLOA 2O8DB 5CDFE 3BB4A 2ZI5A 3BE4A 2RMKA 4B48A 2J46A 4A82A 4NYMQ 4D82A 3QKSA 4C9BA 2A30A 3AH8A 4NPHA 2IYWA 1COWD 1Z0AA 4A0FA 5FOUA 3T5DA
chains in the Genus database with same CATH superfamily
4O3FA 1T5LA 5JHHB 3RJ5A 4KXMA 5ETJA 1T9GR 2EW8A 2H2AA 3OIWA 4HAXA 4G8BA 2QRLA 4EHBA 4TQGA 3BEDA 3KOYA 1QVVA 1D1QA 1UPCA 2XVXA 2ZB7A 3PXXA 4PR0A 4RKRA 5CHYA 1R0RE 4B2PA 3K0SA 4IQ4A 2HSZA 3VSBA 2X6TA 3T1TA 4I55B 3AKEA 1XNJA 4A1OA 3BCRA 1ZS9A 3ZD7A 3UPTA 1AT1A 1F48A 2MSCB 3ENNA 1BD3A 3GJ4A 1P9OA 4W5QA 4IXMA 1NLYA 2ACEA 4RVSA 4FC7A 2GAFA 4BE7B 4GU5A 4XWOA 1YB2A 1DCKA 1ORVA 2H0QA 3DNFA 3C3AA 4Q9IA 4MWTA 1E9SA 1VKZA 2FSVC 2IXFA 4IMPA 4RZSA 1OXMA 4LKRA 4TQAA 5BNZA 3E1KA 3K15A 1LTQA 1W9HA 2F7SA 4M1EA 5KAPA 3ROZA 4GRDA 1B3RA 1RYZA 2HOQA 4KN8A 5CHEA 1M72A 3FYSA 3CH7A 5EGNA 1YUMA 1RR6A 2YXEA 3K7EA 4X20A 1BHO1 4R8LA 4MS1A 4QBFA 3G2HA 4CF5A 4I9FA 2AUNA 4QFBA 5DT2A 4DA9A 2G40A 1Z0IA 4OGGA 3CZ9A 2QLJA 3CLHA 1KSFX 3SIXA 2GZ3A 2PJDA 1I10A 2Q1YA 3EMVA 3I6QA 1DRKA 1XA4A 2Q28A 2VZEA 3M9XA 3WDSA 2HHHB 5AVZA 2AI1A 4OEHA 4AIRA 2PGNA 4KX3A 2WW8A 2GYYA 4YDHB 1TT5B 5A4IS 3S2FA 3GLFB 3W5IA 2AC4A 2NACA 3PDIA 1Y89A 4G23A 4XIJA 3RWOA 1PT9A 1A8PA 1GHTA 3BDIA 3P5BA 4GPAA 4XB2A 1U9ZA 1Z6TA 2J5BA 2NZ2A 2GZHA 4R9UC 3PG5A 5A4MS 5IANA 2OMKA 5DASA 3L0PA 1I0ZA 3UJ3X 1NX6A 3HDQA 1F12A 2G83A 1GKYA 1YTLA 3AXTA 3IMFA 2WC1A 4IDCA 5CXSA 2XXBA 4DJAA 4OHCA 3S29A 3SSMA 1RI4A 4NNPA 1B6RA 2B4QA 4ND8A 5FUVA 5HGJA 3FUWA 1APBA 2YCLA 1W5EA 1JGTA 3I83A 3NKLA 5FNVF 1BIFA 4HF7A 3O1IC 3SG0A 3TWOA 3U31A 4E88A 1H8EA 2AI2A 2CB9A 4HTAA 1D2RA 5L40A 2WWIA 3EZGA 1NR1A 4BX8A 1XRRA 3A4VA 1M10A 1P61B 1A72A 2Y1KA 3OAAA 4OQPA 4BZPA 4DUGD 2QYTA 2DBVO 1OWNA 4YP5A 1LLQA 1MIHA 1R9GA 3DWEX 1F51E 2FFHA 2AC7A 2X4IA 2B36A 2QU7A 1OGJA 2E1RA 3E3OA 5F2OA 1LK0A 4Y2UA 1NMEA 2JFBA 2ZQZA 3LMKA 1L7NA 1MV5A 5IMBA 5TB5A 5JYBA 1GPKA 1NLUA 1TF7A 2WK1A 2ZUUA 1EJ2A 3WYAA 1RM3A 4G5XA 2FFBA 3IPLA 3OKFA 3OMWA 4BNJA 1L5YA 2C5BA 2Q3BA 1QP7A 5SZHB 3FETA 4PX5A 2Q2OA 5H80A 2WA2A 1ZD1A 2DR2A 4KI0A 2D1TA 5CDTA 3NHZA 4CV2A 1EFPA 2I4OA 4RSGA 4MDHA 1XDWA 4R41A 2JIRA 5EE3A 4EW3A 1J1ZA 2DFPA 2W2TA 4WECA 4ZOAA 4JDPA 3WGZA 5TMPA 1SQ6A 4RWEA 3D0RA 4Y2GA 5E3JA 5JQGB 2FW9A 3B78A 4N0MA 4PZPA 1YRAA 4Z2YA 4YT5A 4IO1A 4PONA 3F1KA 1CJKC 1HY3A 1M73E 2L0XA 2QQ0A 2QTHA 1A9OA 2ZYUX 1XTBA 4WGGA 3T3GA 5KREA 1N92A 1U2DA 4GDFA 1Y1PA 4HYEA 3SGLA 1R4NA 4PCVA 4XDHA 3FOCA 3N53A 3VPXA 4AURA 2P0YA 4BMCA 721PA 1LQ2A 5IJ9A 3JYLA 4N7JA 5L9AA 2JLYA 4TV8A 4UAJA 4Z86A 1SC3A 1ZISA 2F4NA 2W2LA 4K5QA 5A3JA 1QZZA 4QQNA 1VKOA 4EYKA 5BP7A 2VNJA 1EXNA 1N57A 3CT4A 5ILQA 3GK3A 4D97A 2QR5A 2VQEB 4C4TA 1DLIA 1TUIA 5GADl 1X1AA 4OBEA 4B44A 4UTNA 2XUGA 2VSQA 4AG3A 3QPVA 2Y3IA 2X1VA 4M87A 5K0NA 5EIFA 3VV2A 4MMXB 4XFDA 5FWNA 5E6SA 4KDRA 2BGWA 2F6RA 1QHEA 4IXWA 4NJOA 4DR3B 1DNPA 2QD5A 5TE9A 3D2AA 4GFDA 4LZPA 4F04A 5JBQA 3OQ1A 4ESHA 4ARZA 4X6LA 2FZLA 4IYRA 3ZWOA 5SY6A 3WS7A 2HU8A 2H9YA 2X6RA 4ALJA 2E55A 2FUG1 1NE2A 1EH5A 1V35A 3CR3C 3DYVA 1RQLA 4C4AA 2J3QA 2C57A 2GEVA 3JQGB 4EUEA 2R47A 3LX5A 4UTVA 1H9AA 4X85A 2HU7A 4QLOA 1Y9EA 2ZJOA 3E2MA 3PQ2A 1T0BA 4G8CA 4YPVA 2JFWA 2QMOA 5IAJA 1JHUA 2WRZA 3ZHUA 4C4RA 5KQPA 1VXRA 5IJ0B 1YZKA 1KWKA 1SD2A 1BRMA 4FYHA 2E2WA 4G84A 2HXSA 2FW1A 3DBIA 3O2JA 4QUDA 1VE9A 1IJEA 1PFUA 2Q3DA 4HNUA 4AO8A 1GDTA 1OXKB 3SYNA 3RBXA 3SSAA 4N47A 5EP1A 1W2WB 4CT5A 3RHZA 2XDWA 3LQKA 1YAJA 3R3SA 1G5QA 2QQGA 3PC7A 4LHWA 1PR5A 2EKBA 3NHJA 4AJJA 3CCBA 5KTMA 3PVCA 1E20A 4Q4JB 3WL6A 3FWYA 2PUBA 1FCJA 4Z4FA 3HYTA 4B6JA 1JXMA 5E7IA 4KPFC 3FFXA 1U98A 3P9CA 5KTTA 5JCOA 3U7FB 3HA5A 3VO9A 3E15A 3PJRA 4MWGA 3JARB 5IC6A 3Q41A 3C1TA 4LY3A 4ZDWA 4CFZA 1GKIA 3IKTA 1MW9X 4JHLA 3TTSA 2C95A 1NA5A 2A0FA 1MOZA 3LOUA 5KKNB 2BL4A 4QYTA 1D5CA 5T4EA 3T9FA 2JVKA 1QWOA 3M6AA 4JT4A 1T5OA 2LPMA 2REQA 2VIIA 3IIJA 3TLCA 4B4UA 4CV3A 4YROA 5J63A 2IH5A 4JL5A 3GXBA 4QEDA 1V5EA 1DKMA 3PNLA 4G0VA 2GXQA 2WT4A 2XPCA 3KOWA 3LLSA 4XFKA 3SI7A 4JLPA 1QUFA 1W73A 2P5YA 1OU0A 1ZN8A 421PA 3AIOA 4EMBA 3NP7A 1TM7E 2AOWA 4KJXA 4OO3A 2IIVA 1V6SA 3OLZA 1GD1O 4G0OA 4M49A 4KRYA 4S05A 4RTPA 1R0YA 2VPPA 5H3HA 2XJ4A 3VR0A 1C30B 3VSAA 2YJTD 3AVXA 4RKQA 2XQKA 3DPIA 2QAGA 4DB4A 1I0LA 4NXNB 1HBJA 3L46A 2P30A 5I7OA 1DJNA 5K0GA 2VP4A 3T35A 5LQMA 1WDLA 7ABPA 3CNQS 3OKCA 4QDXA 3DDNA 3W9BA 4BNXA 4M8SA 3ZXIA 1K7SN 1LW6E 3D7NA 1I2CA 2UYHA 1CNEA 1J23A 1CR1A 1YOBA 1N6OA 4JODA 1ZUNB 5KVCA 3K71B 1BXGA 4PTZA 4MVJG 3IEMA 4GYYA 4KRGA 1FNSA 4WOKA 1F0YA 3VU3A 5F4BA 5DW0A 4IDGA 2UYGA 3IYLW 4J29A 3CLUC 4KE8A 2F67A 3ZHQA 4Q03A 4ZO6A 4V0MA 4YCJA 5F51A 5FBKA 1NMYA 5L4LA 2QMZA 2O2CA 5DJ5A 4P4GA 1JA1A 2YN4A 4Q4LA 5HZMA 4Q37A 1KVTA 2GPWA 2WWWA 3RK1A 1R66A 3ET5A 3RCBA 3ICVA 1C80A 4FDVA 3CF4G 1E94E 3LUJA 4DPKA 1L7AA 2BGUA 1I4LD 1VJ5A 1IUNA 2CHVA 1ENZA 3DYBA 3ZS9A 4EJ2A 2R25B 1E1RA 1IIBA 1KEPA 3AEUB 2AQ8A 4IIXA 1C7QA 2W8ZA 4P3XA 5H81A 2W6JA 2F9FA 4EYEA 1K2VN 3IUJA 2QQFA 1TRKA 1LF5A 4K6FA 2Q5JA 1GXSA 4W5WA 2K2QB 4R2JA 1BTOA 2Q4EA 2V97A 2BRUA 3EUEA 4U02A 3KQHA 1J25A 2YQZA 3EFHA 1YS1X 2PKQP 1NI3A 4AF7A 1O0CA 1GRRA 4Q7JB 2GF0A 3TLBA 3I61A 3I1JA 5DSZA 4CV0A 4HL6A 1Z6GA 3C39A 4WADA 3JWJA 3A28A 4MUEA 1WW2A 5CVEA 1ODLA 2JFVA 1OVGA 4R05A 1DRJA 1SH7A 1N77A 2A2ZA 3B5IA 1YKFA 3M70A 3U9TA 3IQZA 4FMPA 1I9GA 3VZDA 3LU1A 1DIGA 4GOXA 2W90A 4M7OA 5EJMA 4EWLA 1CJSA 2BEJA 2CBZA 3CUWA 5ESWA 3C4QA 2BSQA 4P33A 3GLKA 4JBIA 2YS6A 2O6LA 3FDZA 2GUWA 2VYFA 1OH7A 1K3TA 2OCGA 3JXEA 3LKZA 3BHNA 3N7UA 4TLBA 1ORIA 1UANA 3F9RA 4KE9A 4FI3F 5BSTA 1PZEA 2WAOA 3WWPA 4D0LB 5JS1A 1TVEA 4ZCRA 3KAJA 3T5BA 2CEAA 2VRCA 3H1BA 4HGOA 2ZSUA 3DZCA 3K9HA 2D0DA 1PQ4A 2L42A 3PGXA 1J1UA 5PNTA 1U02A 4BVGA 1B23P 2BGNA 4DHWA 4GE3A 1Z62A 3FHTA 4F2PA 5P8WA 5CG2A 1V11A 2SICE 1G0OA 3LG2A 4YRJA 1QB7A 4AMUA 2O8EA 3KUKA 5LP6F 3HKDA 4E2YA 3GP8A 3SYMA 3EDYA 5FL7A 3NVKI 1P4JA 4EG0A 1WDKA 1YHZA 4DNPA 1HQDA 1OZHA 5IT0A 1SHLA 4XWTA 5DM70 2FZ5A 1RKXA 1QPZA 1Z34A 1XZGA 3C6BA 1O08A 4U7TB 3X1WA 4H6XA 1UKBA 4JX9A 1K6EA 2XQVA 1BWSA 4RE6A 4DWOA 2EJTA 4B3RB 1A9QA 5AKGA 1A71A 2DHDA 4RMGA 3GGDA 2C5SA 3LF2A 1V8ZA 3O03A 1DIRA 4UHJA 5FPYA 1GQYA 2M6RA 4JYZA 3NHMA 2AGVA 1CBUA 4ND5A 3OQHA 2EKLA 4F6RB 5T3YA 3FTDA 2DHRA 1J42A 2QAJA 4MRPA 3CZQA 4R83A 3DLHA 1HE3A 4N5LA 4YO7A 4NYIQ 1SG0A 2NUPA 4IO0A 5JSKA 3H9BA 1ZNYA 3LPAA 2WR8A 2Z43A 4TTAA 3HR8A 2J1LA 4ZI7A 1CQXA 1JWBB 1X87A 2HRDA 2R3SA 1F14A 3EIFA 1ZR2A 4C7VA 2TECE 1SFRA 4NE7A 3M6XA 4RSMA 3HGTA 4ND3A 4P5PA 4XKJA 4PGHA 2AK2A 4D9KA 3QU9A 3WSTA 5KVSA 3KKKA 3QF4A 1NBMD 3KVOA 4J0KA 3LQFA 3TMAA 4D9GA 4QARA 1W0CA 4ZEMA 2UYYA 4R31A 4F45A 1E2KA 2QT0A 3BM5A 1XKTA 4JR2A 5FAXA 4G9GA 5LQKA 2Q8NA 2P7IA 3H18A 2XE4A 5LIRA 2ID8A 1VPDA 2H4WA 1FVOA 3JRXA 4DSOA 3AR8A 2CT8A 3UK2A 5CX4A 1YCDA 1WSBA 1JSRA 3IJEB 4AW9A 1S02A 3JQEA 1E3WB 4M1KA 5JZ9A 2VOEA 4AQDA 1HM5A 5COAA 4DBVO 4L6IA 4HLNA 3HVHA 4E7PA 2P5UA 4WAUA 1NZDA 3OH8A 4EGJA 4C2UA 3UG7A 4PGAA 4R8RA 1GQFA 2G07A 2MMCA 5FAKA 3I53A 1P39A 3I6YA 1W581 1XALA 4K6MA 1R4MB 2J6IA 4AVYA 2XMDA 5B37A 3ZKWB 4XM2A 1G7SA 1BWRA 2DPXA 3LP5A 1J5XA 4E3ZA 3NZEA 4QUGA 3P2IA 2Q0SA 4JBLA 4UMFA 2D6FA 1R0ZA 2ZIVB 2A86A 4FT4A 4HI0E 4GOJA 4WCVA 4MA0A 5GJCA 4EARA 1RNLA 4IVQA 1HORA 1L5OA 2J0VA 4L1KA 3K2EA 1QQ7A 3AB7A 3QJ5A 2Z2YA 4UM7A 3GJ6A 3WL5A 4AAYA 5LOVF 4YR7A 2NO5A 3I23A 4BMDA 1VJTA 1P0MA 1E9RA 4D96A 2IL1A 3R9XA 1EEHA 2XODA 3LVBA 1FSFA 3MGAA 4FLFA 1V5IA 3OFJA 2HF2A 4PO1A 2F1OA 2YQ5A 3KFXA 5C9ZA 3T7KA 2EZUA 2FDRA 2J32A 2XGSA 4LVUA 5C0OE 3B13B 4ICIA 4D9BA 2OP0A 4MMZB 1ZGAA 1ZK1A 4QYIA 2X5NA 2F59A 3H13A 5DP2A 3C3KA 4AJEA 4GZ3A 1TA9A 3R20A 2NU7A 4YT8A 3CZ4A 2VDPB 2HA0A 1FNBA 3H11B 4D3ZA 3I2HA 1E1MA 2OHVA 3A11A 1VYVA 3DCIA 3G1TA 121PA 2F64A 3GAMA 4HDOB 4OI1A 3K2QA 4Q15A 4C20A 5I4BA 1O6FA 4AM8A 1J7JA 3B1FA 1N8SA 3EVCA 2HHAA 1SXJA 1DQNA 1UCFA 1ECPA 5K8JB 4GXRA 3G1UA 2Z5FA 2I2WA 1IJBA 1Q1NA 4PRKA 3EPJA 4X44A 5BQFA 5IT9A 3IESA 2P6MA 4MVJH 3AVTA 4HGRA 3QJYA 4K26A 1COZA 1JEOA 2C54A 2WY2D 1N2CB 1PT5A 1XWIA 2PMFA 4QU0A 3IERA 1PFWA 4DEYA 2PKYX 4ROSA 4BCDA 4M21A 3MWEB 5CX1B 3AIMA 1C1DA 3ONWA 4G9EA 4IWNA 5AVKA 2WINI 2QTBA 3GCXA 2PH5A 3O5AA 1IN5A 3T9DA 1JIQA 1RWOA 2RKBA 4Y2SA 1TRHA 3NT5A 2AWNA 4HQOA 3GGPA 4XB1A 4L76A 4OYHA 1B8VA 1NVXQ 1T8PA 2G04A 3HJCA 4OGWA 1KI6A 3WA6A 5L7TA 2M32A 4UHBA 1J33A 1Z8NA 2AN5A 4FGSA 4I8DA 1UADA 4G4GA 4INAA 4CG0A 5IP5A 1JIXA 1OZGA 1V2HE 3IIEA 5HP4A 2FPLA 3DLPX 1W8IA 4I46A 4IBOA 2GGSA 3I73A 1UH5A 1GAEO 3KYDB 4R0NA 1GZHB 4XYEA 2DJ5A 5L7WA 5BUCA 5DF1A 5ERYA 5CAEA 1JKFA 2YXBA 2Q5LA 2PV7A 2PS9A 1ZBDA 1KDRA 4KBGA 4DLRA 3KLBA 5DWDA 5IH7A 3RAFC 4RVCA 2C96A 1HL3A 2FSHA 3ETJA 9LDTA 1C4OA 5CFRA 2IPXA 3DDSA 3LIPA 4YVFA 4JFAA 2ZE6A 1E5LA 2EQBA 2DSTA 5K0SA 3DAYA 3FYUA 4YALA 4ESEA 4F84A 1NSFA 3SE0A 2GYWA 2V4UA 4TMYA 9ATCA 3MRVA 2ZBUA 5B3KA 4MROA 1BCSA 5FEUA 3T1HB 2VHEA 1XTQA 4K6HA 5JC8A 5K9ZA 3MOIA 4U8GA 1H1LB 5GGXA 4JAVC 3D1VA 4YT4A 4N03A 1FQKA 1EUDB 4HG2A 4D1YA 1G8YA 5U4QA 1H9BA 1MO6A 1BYUA 3EGDB 4QATA 4N8EA 2XE6A 3UV7A 2B1RA 4JP3A 1VPLA 4KGXA 4LYJA 2XQFA 1CF2O 2LV8A 2IU0A 1LPAB 2EKDA 2NVUB 3JZDA 2NZYA 4ZAYA 3QVGA 2OHJA 1QIIA 3L93A 2P2LA 4V1CA 3LHIA 1R4ZA 1JNXX 2DLDA 3KR1A 1HLFA 4XWWA 3EX7C 3MELA 1EPUA 1ZOPA 3DMTC 5M2QA 4IJQA 4AKHA 2CDBA 4YYZA 2FP4B 2CVOA 4H59A 1N2OA 1DT5A 4N54A 4YJKA 4YB8A 3VR6H 4XX0B 2O07A 1URPA 1ZESA 3P2JA 3CF4A 1J56A 4TRJA 5GQSA 2J7PA 3OLQA 4KAFA 2OOKA 3MPUA 3VR5H 3TSYA 4D41A 4YV1A 1THMA 2ONKA 3FM9A 1BFKA 3OOHA 1DTWA 5I48A 4G0UA 4NARA 1BKDR 1KJWA 1ISFA 1KI8A 2I4LA 3CF6R 3CUUA 4CR6A 2O59A 4EEKA 1JEYB 1GGEA 1GPDG 4GNRA 4LNUB 3VOSA 3MUNA 1FUYB 1Y3FE 3P9RA 5FI3A 3E5RA 3G0GA 2GPTA 1O8CA 2XGMA 2YWRA 4HH1A 4OA8A 2SECE 5EUBA 1F17A 4HPJB 5HS6A 4ZV4A 1ST3A 2NVOA 1DBWA 2EFDB 3H2BA 5CB8A 2P41A 1A5ZA 3PTLA 1QVWA 1VL5A 1THTA 4PX3A 1AF7A 3HB9A 3SIPA 1T4BA 2Z6VA 3EVTA 2ONCA 1AXEA 2YFQA 4L4RA 3N5KA 4KVFA 1KFJB 5L3VA 4MV9A 3BX1A 5AQ1A 1EB8A 1P72A 4LIPD 5A3RA 3MT8A 4GM1A 3VZQA 4UJ5A 1FFGA 1CKEA 2P4EA 4QG3A 2ATIA 1TQ8A 2IKQA 3NHFA 4MW9A 4FR2A 2BF7A 4PLGA 5LUBA 3EY4A 4ABYA 3HXQA 1EVYA 1XNHA 2H5LA 2IDMA 2ZSEA 3UKOA 2AMYA 4ND1A 4EL0A 2NZWA 1E63A 4KXYA 5HTOA 3FFAA 4EPYA 2KW5A 5A4JA 3NDBB 3L4JA 5GONA 4B6PA 3K0EA 4LE0A 4DJEC 2X15A 1VG0B 2WNHA 1L7EA 1SVKA 4LHEA 4R1OA 4UNNA 4A23A 1JDTA 2OFFA 2WUGA 2V8OA 3WFZA 2W6NA 3TG8A 1Q7CA 4W82A 2R1ZA 1YZLA 1E4EB 2KJQA 3RC1A 3VR6A 2CD9A 1OH8A 1NP7A 2EWVA 1E6CA 4BQRA 4NMWA 4ZVKA 3SQNA 5KYWB 1V9CA 1Z4OA 521PA 1GKUB 1H0RA 1V7QA 4JLNA 4G0WA 1V3VA 2OK8A 3QHPA 3VR5A 1T2VA 1RI1A 2VUIB 4WACA 4EQ6A 3I01A 4B32A 4MLDA 3GNQA 2HV8A 4Y30A 2CNOA 4KMOA 4D0NA 4REQA 5T8KC 2C2WA 3SPXA 2GCGA 1XMXA 5DULA 4HNQA 4LYDA 4C6HA 2O8BB 4ZYTA 4OFZA 1XRJA 1OWOA 3FLMA 5DEOA 5MHTA 4PIMA 1JIKA 1TJ3A 4IFIA 3LCJA 1RRMA 4BS9A 2BFEB 4BFYA 5CA1A 2JHAA 3EF1A 3OZEA 1RHJA 1XFAA 3IBTA 1H1TA 3PXGA 2DQYA 3KLOA 4L0QA 3MQ2A 3KUUA 2FSGA 3H4TA 2PUFA 1PS9A 1UF9A 5SZJA 2PUJA 3AVYA 4X84A 4TWIA 1TKBA 1X7GA 4AUEA 2JLZA 1J9GA 2UXCB 1EQAA 1XD8A 3EIUA 4Q7MB 1KR2A 1W30A 3AFIA 3WGKA 4DBLC 2GLXA 5K0CA 2V7TA 2GBFA 2VDOB 1MU0A 1W88A 3VMFA 4DDTA 2VO1A 3WAJA 1IK4A 2OLJA 4JUDX 2CWDA 2X0EA 1G8HA 2Y8EA 3EWNA 4LRWA 2IHKA 4MVJI 5EJ5A 2QXTA 2CBGA 1Z2OX 5FWAA 5KKAA 1VQ1A 2W6IA 3JX9A 3KQUA 4OCZA 2P91A 4V1CI 1G60A 4L0DA 4HZIA 1DC7A 3MLEA 3B36A 3K0CC 2NSLA 3LDHA 4Z1MD 3ZHSA 2W4MA 1V16B 2RHCA 1LI7A 3C24A 3CM0A 2RK4A 1R0KA 1J5PA 5AXCA 3DZGA 4DABA 1J97A 3GFQA 2ZUCA 1PK9A 2JBHA 3N2NA 4LDNA 4UFOA 4UEJA 5D51S 5JWOA 1A8QA 1G59A 3GWGA 1ZGJA 1R6AA 1E1YA 3AESB 2F3QA 3FF4A 1KERA 1Z7BA 2NGRA 3DHVA 4R1LA 5KNDD 5AD1A 5B1YA 2ACKA 1XRQA 3BFVA 3PQ4A 1JJ7A 5EIBC 3FNBA 4MIKA 3PNSA 1JDZA 4EFDA 3TM4A 3HEMA 1ZHOA 3NHRA 4LJ9A 1WL8A 4B4VA 1ISRA 2ZI7A 2BP7A 3M7IA 3R40A 2FCAA 4XVRA 5AICA 4EAQA 2RFLA 4LY6A 4LRTB 2WF5A 4O2AF 1XX6A 2HDNB 3CGGA 3WMFA 5KNCD 2ZUSA 2FQWA 4B7UA 4KQKA 3F49S 5EP2A 4BGDA 4FLMA 4B76A 2VUSA 1CIPA 3DUFB 4WNAB 1HOXA 2JFZA 3CE6A 5D3QA 1RKVA 1NHWA 3A05A 3FUCA 4RF3A 4UCXA 3SOPA 4AICA 4HQRA 3ONVA 3E3MA 2AOTA 1QE0A 1BD4A 2C8KA 2VYQA 3MLBA 1OXSC 4MV6A 2Y1XA 4I0WB 1C3OB 4NEQA 3T52A 1VYUA 5JO9A 5J4HA 4XFJA 2FFJA 1E1NA 2GESA 3DC2A 4HVTA 3W77A 5ALKA 4RKFA 1YS7A 3LRXA 3GGGA 4M9UA 4IJ5A 4CU5A 5DGCA 2X5KO 4OPMA 5HG0A 3AB8A 1W93A 3H2YA 4LI3X 2AOUB 3KD2A 2Y0PA 2WVHA 1AB6A 1KAQA 1K5PA 3GRFA 2Z0MA 1ESDA 1F6WA 1W5FA 4FD3A 3OJOA 5C8DA 3ZHTA 3ACBA 2QQEA 2H2HA 3OUTA 4JHXA 4O8ZA 2KBFA 3AOEC 2IOYA 4DN6A 1T6YA 4YJ3A 1WQ3A 1MR3F 1XEFA 1I4EB 4TLDA 3EZ2A 3G8BA 4PO8A 1NNI1 2HCBA 1GUFA 2C9OA 1I7PA 3K0FA 4JSRA 3AF5A 4KYTA 1KOFA 1OT3A 4LSMA 3HHEA 3HB7A 1T3ZA 2G7ZA 2PH7A 3GJQA 3L1HA 1HKHA 3IMEA 1TF2A 1N0IA 2EFHB 3L79A 4EI2A 1MNQA 3LUAA 3NCTA 3IT0A 4LHSA 2WF9A 3U7RA 4ESOA 3RSQA 2H2DA 3E7WA 2RCYA 3JQ6A 3KB8A 1JTFA 3S28A 2W2MA 1T9CA 1RC0A 1NJ8A 4US2R 1XE3A 1RM0A 2QEQA 4LOHA 3HL0A 5E4YA 4LV8B 5TIIA 1INLA 2G63A 4PN3A 2XB6A 2UAGA 3GCDA 2H16A 1RPZA 4IOLA 1MXHA 1QSGA 4A0GA 2GLUA 4UE2A 2W2KB 3A4LA 4H4CA 4UQPA 5IK2A 2WWVD 4CQMD 4BV2A 2PRJA 2XRZA 3ZGOA 4PAGA 4J1TA 2PLNA 5D5PA 1XAIA 2A9JA 3GUHA 3L8MA 4DLBA 3ZJTA 1XU9A 1JECA 4FXOA 4P98A 2Q2NA 3KHSA 1EX1A 3WGGA 3CPSA 3TN7A 4DNFA 3ILXA 3L8EA 4UHHA 4BQNA 2EX0A 4DF3A 3HV2A 1WULS 3HWX1 4YV0A 1EP3B 3CU5A 4D0RA 4F72A 2G5TA 3TGPA 3SF0A 4WLUA 2OWDA 4P7KA 2XI4A 4PO9A 1LPSA 4FFVA 3SJ7A 4AJ2A 3SD7A 2VDNB 1PF7E 2AFVA 4OAOA 1XRMA 4TXNA 5JNLA 2OK7A 5MN5A 3RSLA 4DLVA 3CWZA 1ZH2A 2C4KA 3MD9A 3O26A 5CURA 2MOKA 3CCCA 4DR2B 4LOKA 1SVSA 4XH9B 1G7TA 1Y8ZA 1RLJA 4ZMBA 4QC2A 4C14A 1MFZA 4U63A 5HRCA 4EABA 4K8RB 3FI9A 1PW7A 2XV1A 4CKZA 3KQTA 4TWJA 5FTKA 3QKRA 4ZQBA 3G85A 2IUFA 1NBAA 4Q5IA 4BL5A 5C3MA 4DLAA 2HJHA 5HDBB 4XR9A 4ACBA 2IODA 3R5FA 3IR7A 4RJTA 1FXWA 2WILA 3MOSA 2GPBA 3IT2A 4YRBA 4C0JA 2GHRA 4OG2A 4URWR 3OOJA 1DDGA 3HM2A 4W9NC 2DP4E 4LFAB 1ZM2A 1JH8A 1EGAA 1PUIA 2B6NA 3F8WA 3BUSA 1BQ4A 5CITA 3GMSA 5I9LA 1UAYA 4OHFA 3ZI7A 4WINA 3JD0A 4LBZA 1U8CB 4UUPA 1H2BA 3EN0A 1ISPA 2G71A 3PI6A 4QBIA 4QODA 4ZV9A 5CLJA 1KZ9A 1Y7IA 1Z4LA 2BW0A 2OCLA 3SS7X 1L1QA 5IFKA 2EW1A 2RI1A 1EVZA 1KYTA 3NDPA 3R6WA 5AM1A 4MS4A 4CN8A 5BN5A 5JD5A 1OAOA 1XTPA 2P40A 3BZWA 4GPZA 4IAOA 4NJEB 2EF0A 1U9IA 2H57A 4MYTA 2YIVX 4K9NA 5K6AC 1BEUB 4D4KA 4ZRMA 1UPBA 4CT0A 2IFTA 4B3SB 1M3SA 4O4JB 1FYXA 1XYGA 2PFGA 2QD3A 1M6YA 1IHXA 1VHQA 2AX4A 1PVVA 2XWJI 4R3UC 5CBPB 2GAOA 2C2ZA 2H7YA 3BMNB 3OOSA 3BGWA 4FX2A 4FFDA 1VRVA 1Z4NA 4NH0A 2FR0A 3G02A 3CURA 3THYB 4RPJA 3TNFA 4L8FA 1FU7A 1KO7A 3FF1A 2I87A 2VDVE 5ALNA 4TS4A 3M1YA 5JW6A 1ZN7A 4HXYA 1QRTA 1I30A 1PGPA 1TOAA 4AC9A 2ZJ6A 1B2RA 4Q7EA 2O2YA 1IWOA 2HBQA 4BRUA 2VF5X 3JRNA 4YAEA 2IIBA 2V6IA 2XJ9A 1M1YB 2GBLA 1I51A 1L5SA 4HO1X 2J3KA 4M0LA 3N3AC 1KARA 2Q1WA 1WZUA 1NW9B 2AHRA 2VDWA 4MJ7A 4V0ME 5FI1B 1QE5A 2QR2A 3EVNA 4X65B 3S7ZA 1M2EA 1OBCA 2BH2A 4RXMA 1V8FA 2WWFA 2BFCB 4PAMA 2GN1A 4R51A 1Z0ZA 2QVBA 2IV3A 4D2IA 3OSZA 2OUKA 3WC4A 4YMTA 2F8LA 3CUTA 1LPMA 3SSNA 3LPLA 3QY0A 3WYNA 3EIWA 4TMKA 1CC1S 2G5CA 3CX6A 2ADFA 4LRXA 5LZ5A 3UEOA 2PUTA 4CMEC 4B8YA 1U31A 2Q5EA 3QMVA 1RABA 1UR5A 3EUAA 1SUDA 2I3AA 4ZODA 4CCSA 1P5ZB 5A05A 4DPLA 2V3WA 1GNRA 4RLFA 5A4KA 1J8DA 2DY1A 1L1FA 1QF7A 3VH4A 1V3UA 4DCPA 4HNVA 4DUZB 3DDOA 3AJEA 4EEXA 4BDSA 1O6CA 4ETWA 4AJ9A 4IQ0A 4INPA 1Q6YA 3NLLA 4RY8A 1E58A 2ODQA 1WUKS 2PS1A 4XLTA 2H7CA 3OQNA 2J3MA 1MG0A 1QYRA 1I36A 1RE0A 1U5BB 2DHQA 3ZY6A 3I6IA 4UUBA 1XQ9A 3T7IA 4X90A 3JD3A 4XIFA 1EBBA 1NNLA 2QVGA 2WJWA 4Q1DA 2W70A 1XRLA 4A8JA 3VQTA 2QNBA 1AY0A 1SN7A 2WZCA 2ZSDA 4C08A 4MKIA 2WVJA 3EFOA 4DCUA 1D9ZA 2OR3A 5LVAA 1CNMA 1YIDA 4MKFA 1VYHA 4IV0A 4F4JA 3U3JA 1NRWA 3KVVA 1HZZA 3LK6A 4MKHA 3ANNA 1ZPDA 4ZAZA 5BT9A 5IWAB 2MTBA 2AQHA 3KB2A 3ML1A 3NCHA 2VT6A 5TT0A 4IWYA 3ZWQA 5E7MA 2VTEA 2PZMA 2BBSA 3AC0A 2CDCA 3KO8A 4GX1A 4HEHA 3C6ZA 4FR0A 4JVOA 4TWBA 4L3VA 3TD2A 4A16A 5JOQA 1Z75A 3FOWA 4TT8A 5LIPA 2C4MA 1RBYA 3E9MA 2V74B 3OZIA 4O02B 4PE5B 3PP8A 4HJXA 3Q6MA 1XDGA 1F9AA 1Q0LA 3ZE8A 5JBNA 3FW1A 3W34A 3N0XA 1X7DA 2QDXA 3PUJA 4PC6A 4D6YA 2QTRA 1DQPA 2WG1A 4F60A 3QXGA 4K0RA 2QW8A 3TZLA 1RRVA 2X1HA 1K89A 4L5AA 4HLCA 3I34X 4WASA 4XGKA 3WLPA 2JFFA 3AK4A 4LF4B 4TS3A 2QIPA 2X0KA 4AKSA 4A5SA 4C3VA 3BMCA 3ZGZA 3KAQA 3GV0A 3U4IA 4FFOA 4R0MA 3U39A 3H0CA 4MTLA 2BJHA 3CRZA 3W1EA 4IXDA 1VP9A 3N2GA 4DCMA 4G0MA 5IAGA 4WXEA 4DC1A 3SF8B 3MHTA 1YDWA 4CQLA 3H6GA 3M3PA 2ATEA 4YAOA 5DHFA 1V6AA 3GELA 1QTNA 1ZGZA 1FY2A 1G9TA 3VGPA 4AYXA 1AKMA 2Y6VA 4RA6B 3UAOA 3OE5A 3HUEA 3B48A 3JSXA 3TLYA 3WP0A 2GJSA 1DZ3A 2GD0A 4MWCA 4RABA 1XP5A 3O93A 4RNCA 4YS6A 3KSRA 4A10A 4K9OA 3HKBB 2CVFA 2I7VA 2JGFA 2GHIA 2X9GA 2BLNA 1SXQA 4D5EA 4F3TA 3RIHA 3V4LA 2QRVA 3GR6A 4RTLA 2GT1A 3L4BA 1P0QA 2OQRA 1U3VA 1WVMA 3E9DA 5ALSA 1AXRA 2OILA 1M5RA 3A31A 3PB3A 1XIVA 3O84A 1XHLA 1A7JA 2DFVA 1MRSA 3TQRA 1PI3A 1N4DA 4EHIA 4GI7A 1UJ4A 3D54D 4YP6A 3SLKA 2X4LA 1PV1A 4WRRA 1Q3KA 1M66A 1VPTA 4I6EA 1NXTA 3F7NA 5G0TA 2WTBA 4L73A 3DMYA 5LBIA 1XYYA 3S2ZA 1EM6A 3B6KA 4DNOA 3MMSA 2YXDA 1LEHA 2VUUA 3FZNA 3ZGNA 4C3OB 3BF7A 4E6PA 2XNDD 3OEWA 2IF2A 2SNIE 2CXRA 3CH5A 3WNVA 3OIDA 2O06A 2W6MA 3H87A 3ESCA 3DULA 4JBXA 1Z4MA 1UDRA 2WKPA 1VSUA 4HS9A 4MPDA 2J9ZB 4X93A 3KT8A 4OHOA 4KB5A 1MW8X 1IBKB 1CR4A 3CB4A 5EGSA 4X8MA 2BD0A 3LZDA 1DUVG 3OX4A 3PQDA 4UTRA 1EK5A 2WSSA 2WMYA 3W6PA 3X1ZA 4BN5A 4DSTA 5KTYA 4ED9A 5HCNA 4JLKA 1P74A 2GTHA 1ZA1A 1TTTA 3TRDA 3IAUA 1X7YB 4LZJA 4ZVPA 2NU6A 1UJCA 4KE7A 1P6QA 4PWYA 5DDIP 4JJGA 4MEJA 5C1IA 4E5MA 5ILOA 5M04A 3STXA 4YRRA 1X1QA 1ZH4A 2MINB 5DCUA 3EPLA 2C5HA 2I2DA 1X3SA 3R6DA 4GR5A 2BFPA 5CT9A 3WK9A 1H93A 1V9LA 3COJA 2PUDA 5DLDA 2OD7A 4G8DA 1YO6A 5DNWA 5CH5A 3ZWNA 4U2GA 2OV3A 3K5WA 4RGVA 2WUFA 3ZNPA 4EGAA 2VNIA 2V7EA 2AG8A 4BEJA 2RG1A 5FH9A 1B16A 1V7CA 2E18A 2RHJA 1HC7A 3M82A 1PKEA 3IBYA 1AN9A 1TUBB 1GQ2A 2APJA 2QIOA 1PQWA 5H82A 3I42A 1LDYA 1P4SA 4QO7A 4F6CA 1RLUA 3JW8A 1BGXT 1M74A 3ESDA 2ZZNA 2P79A 3MTDA 3X1YA 3OM8A 2R85A 3WLAA 2ZBPA 3HDYA 3L7NA 1BZYA 3TJZA 3OEEA 1Z88A 3R7FA 1FP1D 1GRNA 5B2ZA 1ZLXA 3AJ9A 4H7FA 1Q1EA 1I3CA 3B12A 4GWLA 5KS2A 1NNUA 1O5IA 4BN0A 4FDLA 3V7WA 4M36A 1V41E 2DJIA 3B6MA 2PZBA 3U19A 4W1PA 2G4LA 4DZZA 5IABA 5IDYA 3BK2A 4DR4B 2JA2A 3ZCPA 3D6HA 3HKEB 4AKTA 2C00A 1J8MF 1IHOA 2FR8C 2GH1A 2YFKA 3HP4A 3KT6A 4HDRB 1UMCB 4HRAA 4JJ7A 3UWMA 3O1HB 5K20A 2ZP1A 3AKDA 3E6AA 4HXFB 3GN1A 1G3UA 1YBAA 1G3MA 3NKVA 4G1CA 4NFSA 4WY8A 1Z26A