2HJVA

Structure of the second domain (residues 207-368) of the bacillus subtilis yxin protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
TTRNIEHAVIQVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase dbpA
publication title Structure of the second domain of the Bacillus subtilis DEAD-box RNA helicase YxiN.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjvA00
2RGCA 2HLDD 4PFSA 1JAHA 1QHSA 1HQYE 1NSTA 5B64A 2IS1A 5P21A 2JJ8A 3AKEA 4CEHB 3NHAA 5DSZA 1E2NA 4RZXA 1Z6GA 2QAJA 3ADKA 4MKGA 4PC2A 1P2SA 4NP6A 4X8LA 1T0HB 5FPSA 4MA4A 4PSVA 4Q48A 1OLOA 2WMNB 2AN9A 1IY0A 5JMTA 2XZOA 1KDOA 1NKTA 2EU8A 4L9SA 5LB2A 2JLZA 1T3HA 1UKVY 2ZUDA 3BK7A 1KDPA 1QHIA 1T3SA 5FPHA 1CRPA 2XITA 2ASEA 4F91B 1VCNA 3ZZUA 2CVHA 1YU9A 2EFGA 1NLYA 1TL7C 2QTVB 4DB2A 1QDEA 1F2TB 1Q3TA 4D4JA 1O87A 4JSYA 2FFAA 2MMCA 2OAP1 3EG5A 4KBFA 4DLZA 1W7AA 2OCPA 4WXPA 4UNNA 2IUTA 3RANA 4UNPA 3AH8A 4JVSB 4Q4HB 1DAKA 3CUEF 5FBVB 3K9NA 1FNNA 4ERNA 2ZU0C 1TQ6A 3QUSA 2QEQA 3A6PC 2OBLA 3C15C 1DAGA 4EQ6B 1ELOA 4II7A 1GWNA 2CK3D 4G5GA 1XFAA 5GADl 2H5EA 2PL3A 3O8DA 4HZUB 4U02A 3VQTA 3BOSA 4QHYA 3RHFA 4Q9LA 5KDOA 1P2TA 1N6PA 4G5QA 1IQPA 2OXRA 4URVR 1FFHA 1FUKA 3IHWA 4LHVA 3OIUA 4MKIA 2JIZD 3R8CA 2ZSEA 4PQFA 3K0EA 2V55B 3BWDD 4Q4HA 3TUJC 3SQXA 2ZE8A 4M1OA 4Z54A 4URXR 4KFSA 1N0VC 2AHOA 3H2YA 4YXWD 4Q1CA 1PUJA 4Q19A 1HV8A 2WAYA 3GEIA 3P4XA 2HCJB 2ZUBA 1J8YF 2C96A 2J0UA 2ODWA 4LJ5A 3NH6A 4HZUA 5C4MA 4BEJA 4EJSB 5ELXA 1GKYA 3UIEA 2EWWA 1X8JA 3EIEA 4BRWA 2N42A 3U5ZB 1RPZA 5LB4A 4DDUA 4DT1B 4TZ0A 1TF5A 2VHTA 3SFVA 1G17A 4JMPA 3TSOA 3GLHE 2B21A 5J47A 2QP9X 1P9RA 4KBGA 1ZP6A 5HKKA 4L16A 2WSSD 4EPXA 3AUYA 3T1TA 2RGGA 5FOUA 3M1IA 3B1YA 1XTSA 2NO1A 4BLSA 4IOKA 1ZC3A 2OILA 5J4LA 1SKYB 2A9KA 4EJSA 4URUR 2LKCA 1LY1A 1X6VA 1N0WA 3AF2A 1NSFA 1AGPA 2ZSFA 3OE7A 5J4YA 3I8XA 1NG1A 1ZJ6A 3WY9A 4C0KA 1WRBA 4URYR 5KSZA 5IDVA 1ZMXA 2UZIR 3KQLA 4RVCA 2NO0A 3FFAA 2F6RA 3QKSB 1T0JB 2DYKA 3BFXA 3AVQA 2GWHA 1TUEA 3FHCB 4WXRA 2B7BA 5JS7A 3KL4A 2C8VA 3SR0A 2O8CB 2H16A 3T1QA 1YR8A 1NBMA 2GXAA 1NVWQ 4CGZA 4LZZA 3FHTA 3TR0A 4DBLC 3ZIAD 4B6FA 2XXAA 1XXHE 5JCPA 4O0MA 2GJSA 3AGPA 2JATA 4PQYA 3TQFA 4PC6A 2FPKA 3L2OB 1Z0JA 3VX3A 1H8ED 1CEEA 3IILA 2FF7A 2FFQA 5JJIA 4P4UA 5AJVB 2QP4A 5K8TA 4DC9A 4UNRA 4LI0A 5FBWB 3MLEA 3UKDA 4AURA 4Q9KA 1EFCA 1CLUA 1N25A 2BEKA 1AA9A 4PAOA 1W5TA 4BE7B 3LLMA 2OG2A 3WP0A 2Z0MA 3Q7PA 5C1BA 1GRQA 1W4AA 5DE3A 1ZU5A 2WSMA 2PCJA 3CX7A 1W48A 2AK3A 2CNWD 3TMKA 1E2FA 3SBDA 4MGKR 5BN3A 2RGAA 4IRUB 3SFZA 3QXCA 3B78A 4OI2A 1SULA 1E0JA 2VP0A 3X1WA 1VHLA 4JLDA 2BBOA 4DCUA 1PV4A 4HDOB 1E32A 1XU4A 2OCAA 2QPOA 2OZEA 2RGDA 3B6EA 1GIAA 2YYZA 4Q4JA 2CL0X 1IAQA 4ABYA 1OYWA 2ATXA 2GDJA 3G0HA 1Z06A 4GRAA 4MKFA 1U8ZA 4XH9B 2PEZA 4NYIQ 1Q1EA 1DO2A 3L0PA 2ZS8A 4UJ5A 1CTQA 4C2TA 2FEOA 2RB4A 3GD7A 4K81B 3T1VA 3ZZTA 5FPKA 1AS3A 1UBEA 4PQRA 3TAUA 3QF7A 5TVKA 1E2KA 3LRPA 4PTLA 2O0JA 2V6IA 4OBEA 1OXUA 4OHYA 3IDQA 1L4YA 5DN6D 2R6AA 1EK0A 2IWHA 1ZUHA 2IK8A 3I1FA 1E2IA 1CR4A 3BD9A 4PPQA 1BO6A 4LPKA 3G82C 2Q9BA 2ZTSA 1IJFA 1WB9A 3H84A 1NJFA 2SHKA 4F93B 4LYHA 4DLTA 2HF8A 5DGXA 3SYKA 1ZIOA 2JIZA 1NP6A 2OXCA 3TW8B 2J5XA 4BZXA 1XMSA 2ERXA 4KU4A 3BAFA 1GSIA 2Q3MA 2CJWB 3SS8A 4B48A 2HYIC 1CJUC 1E94E 4JSTA 4JKIA 4D6PA 3FVQA 2FNAA 2QN6A 4YXWA 2E1RA 5A0FA 3JVVA 2XOKD 1E2EA 1W36D 1W5SA 3R7WB 1G41A 4D80A 4LYAA 4RKFA 2GK6A 2EQBA 4QGFA 3OEED 3RRNA 3JZAA 2GXQA 3AKYA 1UADA 2IYZA 5L3VA 4FWIB 2ODBA 3C14C 1PUIA 1MH1A 1N5KA 4TSFD 5EE9A 1UM8A 5CIWA 3REFA 3A58B 2CJWA 2GCPA 5C2JB 1E0KA 2NZJA 5FI0B 1ANKA 2BMEA 4TTPA 4A82A 5JHHB 1G18A 4O2RA 2WSSA 3E1SA 821PA 2X1VA 4G0NA 4J0QA 4JLKA 3DL0A 4IKEA 1TU4A 3Q7QA 3UPUA 4OK3A 1KI6B 3RRZA 2R8RA 3MUFA 3AVYA 1DO0A 3OF5A 1JR6A 1G5PA 3VKGA 3AKDA 3THYB 1I4LD 4CEJB 1QVRA 2ZRJA 1DE0A 2ZSBA 1N5LA 4Q1BA 2FH5B 2F1IA 4DB4A 3CX8A 4GP7A 3BXZA 3WHLA 1M2OB 2R44A 2RHMA 1S1MA 4P31A 1J2JA 4ZI2A 3EA0A 2GZDA 4GNKA 1N6HA 5KNDA 5JWOA 5FOTA 1E2DA 1AM4D 4NCJA 4TYQA 3A4MA 2ZREA 1T8TA 1XD8A 2HJGA 2IHBA 3B60A 4JT4A 5F2EA 4G1UC 4DHEA 1OIXA 4DEYA 3NEJA 2Z43A 4PAQA 5JSZB 1F5NA 4U00A 1VCIA 4JLMA 2BJWA 4L5BA 4L4UA 1HA3A 1VIAA 1H8EA 3I5YA 1XD2B 2J41A 4V02A 2QORA 2WJHA 2WJGA 2F9MA 3CZQA 2W2TA 3K0SA 2QA5A 4NYJQ 2G88A 4PZYA 3BBPA 1KO4A 4HUQB 4A92A 1U90A 1MR3F 2NIPA 2X8AA 1KI4A 3GLGB 2OFWA 2EFHB 2H18A 4KFTA 2F55A 4JVLA 1KJYA 4URWR 3V4FA 1W46A 1IY2A 1JEEA 1KDRA 5JSZA 4PO1A 1E3MA 4BUJA 3AF4A 4MUBA 3I5XA 4MRPA 5F9HA 4LBYA 4BFXA 3LA6A 4TMWA 4JLVA 2CNWA 4M1TA 1Z0AA 3WNDA 1TMKA 1GVNB 4MRNA 3OFNA 3BB4A 5JFGA 4LHYA 3ZGXA 1N3BA 4GPTA 3VU9A 3RS3A 2XGJA 3WYAA 4HAZA 2GESA 3LQRA 2BKUA 4V0OA 4BZPA 4MGIR 1IN4A 1IY1A 4R71A 3AP3A 4C3ZA 1D2NA 721PA 1VECA 1TQ4A 2O8BA 4KJZA 4ZO4A 3CH5A 1DPFA 2H1LA 1Z6AA 3Q3JB 3WBKA 3ZD6A 2AD5A 4WW0A 4WVFA 5JBQA 1DVRA 4KAXA 1A2BA 3FMPB 1XEXA 4FMBB 3RRMA 3ZDQA 2GCOA 2IS2A 1D2EA 1JNYA 2ZRPA 2CCJA 3LAWA 3LWNA 4ZPXA 3V00A 3GJ5A 4LK2A 1DADA 1KK0A 1XZPA 1GFIA 5KYKA 1W36B 1J8MF 5DN6A 1W0JD 3WNCA 3CBQA 4IVQA 5SZKB 3VR1A 3K0AA 4LJ9A 4DLUA 3K9HA 2RGBA 5EXPA 4IOMA 3FHOA 3OESA 4AYWA 3RSLA 3G5UA 4UNQA 2O5VA 4JBYA 5AJWA 4QJ5A 4HYYA 5TDHA 3RS0A 3T06B 4BLQA 1DAEA 1Z29A 4GOKA 4EAQA 1DAHA 1U8YA 4XWAA 3BE4A 1QHXA 1JPNA 3FB4A 4F4IA 1U9IC 4M1KA 1U0JA 4MRVA 2ZR9A 4UXHA 1OXVA 1RW4A 2V6JA 3CONA 3T1OA 3I3SR 3IQXA 1GOTA 1N6KA 2AL7A 2WJJA 2XOKA 2ZYUX 4M8NE 4QNRA 4OQNA 1GL6A 3R8FA 3QIAA 1R2QA 3BJIC 3RAPR 3KUCA 4GL2A 2QI9C 3OEEA 4JBWA 3VNUA 1FOEB 3FKSD 1E9SA 1XCGB 1NMZA 2Q9CA 1Q3HA 1WE2A 2OCYC 1UAAA 3ONWA 4TSFA 3MAAC 3DDCA 4D4LA 1JALA 4WAUA 1FP6A 4DSOA 1UKZA 1N5IA 3WMFA 4B35A 1F2UA 2GJ9A 1SVWA 2QTFA 4F4JA 1E2MA 1XMJA 2GZAA 2Q3FA 1KNQA 1RYHA 4WZAE 4ACAA 3KB1A 4TMTA 5D3MA 2HT6A 4QBIA 1FTNA 2IYTA 2WOJA 2IA5A 3KDSE 4LJAA 3KJEA 4Q1AA 2N46A 1YQTA 3FMIA 3ZLJA 2IEZA 4QBHA 4GSYA 4NMMA 1IXRC 3L0IB 2F43A 3RYTC 1A7JA 1XCMA 3LX5A 1BMFD 4AD8A 2YC4C 1CS4C 1N0UA 4M9ZA 4HSEA 3W5JA 1Z08A 4RCYA 2OCBA 1AN0A 4Q02A 3QENA 3A1TA 4Q66C 3RC3A 5JI2E 5E7MA 1M6NA 1S9DA 2QRNA 4DSUA 2KBEA 3ZVLA 4BASA 3WMGA 1ZM9A 1A4RA 2DFNA 1G4UR 1KMHB 3CR8A 1KSGA 3NBZC 2YHSA 1SVIA 3HU3A 5L3SA 4A15A 1KHTA 3K53A 1XP8A 1WBDA 4RJLA 3J81k 1KI9A 5J4VA 3NG1A 4GFDA 4HDQB 1L4UA 3PG5A 2VLIA 4EKDA 4MGYR 4IVRA 2KJQA 1GG2A 2YWHA 2ZAOA 4QFMA 4QC2A 1OH7A 1NN1A 2YNMA 4Y0VA 1P61B 4ESHA 8OHMA 3PUYA 4P3YA 2ZYVX 3LFUA 3QE0A 4B76A 5KSYA 3QVUA 4PR0A 2XTNA 2FN4A 2H7VA 1KMHA 2DR3A 2OFXA 3BC1A 3I8SA 1IONA 3L8YA 5DI3A 2P5SA 3K70C 2DWOA 1HUQA 121PA 1HH4A 2P6NA 3B9QA 4IDQA 4KO8A 2ECKA 3ZZ0A 5FTLA 2ZR7A 4L8GA 1AS2A 5AUPB 1ZVQA 3IBYA 2BHRA 3K8YA 3MJHA 4LBVA 3K70B 3FYHA 4H1VA 1VCMA 5L3QA 1COWA 3N5CA 4DIDA 1XEWY 1F3OA 3TVDA 2B8WA 3FGNA 3QKUA 1J99A 3UANA 4DCSA 2O8DA 4YMVA 2GBLA 2CVFA 3KJHA 1K5DA 2P65A 3E2IA 4LHXA 2BBSA 4AG5A 1RRPA 1W0JA 4IFBA 2GK7A 2JJ2A 4C0LA 1KSFX 2GEVA 3U6BA 3EZ7A 4GZMA 4A1FA 1KKMA 1G8FA 2O0HA 1E4VA 2VPPA 3AP1A 3DPUA 2QAGB 4M1WA 1T4GA 1RKBA 2R6DA 4BLTA 3ETLA 4ZIRB 3M4YA 3W8NA 3QXSA 1Z0DA 2CL7X 2XZPA 1S0UA 1CR0A 1VIYA 4DWJA 1CR2A 1XD9A 2EFEB 3KFXA 2IXEA 2Z83A 1P62B 1WBBA 3QKRB 5KDLA 4E07A 4AKIA 4Q7LA 3U7FB 5KU1A 2QNRA 2JJ1D 1IXZA 2PX3A 2H92A 4OHVA 2ZRAA 3Q85A 1DAFA 3SU8A 2F7SA 1M7GA 2JLQA 2LWIA 4GT1A 1E79D 4EPWA 1ZIPA 4JZKA 1US8B 3UWOA 4RD6A 4ZDJA 1ZM4A 3GJ8A 3VFDA 4V0ME 1G3IA 1B0UA 2ZE7A 1HURA 4LBWA 4ZIRA 1G7RA 3IEVA 1RC8A 5JLJA 4AC9A 1M74A 1Q22A 1CR1A 2R2AA 2WWFA 1OXTA 1GL7A 3B2EA 3IIJA 3QNUA 4YMUA 4B44A 2VBCA 1NRJB 3RS4A 4Q1EA 2Q3HA 4Q5IA 4QBGB 4A36A 2ERYA 4MKHA 5EP1A 4BEBA 1JECA 1W49A 1OFHA 1NVVQ 2REOA 1GNQA 1UEIA 3TUIC 1GL9B 1EFTA 2FEMA 2QQEA 3V4RA 4Q00A 1US8A 1XJ0A 4YMWA 4DCNA 2YINC 3U3OA 1Z5ZA 6Q21A 2WJIA 2I1QA 5EXSA 4NPHA 4Q9HA 4AWXA 2IYUA 2P3SA 2V1XA 3KKMA 1TUIA 3OAAD 3QG1A 5AJYA 4QG7A 2BEJA 1BMFA 4XTRA 5L3RA 4C9BA 2DFTA 2G77B 3DMNA 3R9IA 5FL3A 1D9ZA 4YC7A 5KOYA 2YVUA 3C16C 4PANA 5AR1A 5EQTA 2BCJQ 5HCNA 3E5HA 3K9LA 4A8JA 5FTNA 1Y3AA 4LJ7A 5H70A 3TVTA 5FFMA 2ZROA 2J45A 1TEXA 3A4LA 4M0LA 2WWXA 1E2PA 1LF0A 1J70A 4HB4A 3WHKA 1C1YA 1X8KA 1MO5A 4BPBA 1AK2A 2OT3B 3LXRA 1S8FA 3B5JA 3TNFA 2GXSA 4M53A 2IW3A 3L8ZA 2ZJBA 4G5RA 5AJXA 1G8GA 2YWGA 2C98A 3B8HA 4DDTA 3IIMA 1SXJE 5J4KA 4ITRC 4S2EA 5JCZA 4MYTA 1KAGA 5G3YA 3C5HA 3BFKA 1VMAA 2WMOB 1IM2A 1L2TA 1NF3A 2XB4A 2NPIA 4B3DA 4A4DA 3KTAB 2B6HA 5TB5A 3GLFE 3B82A 3ZYCA 1VDZA 1SKQA 4KHZA 2IYVA 2F3TA 2O8FA 2HT1A 1E2QA 2FA9A 4A6XA 4G5SA 2ZPTX 1X3SA 2VEDA 1KI7A 4W9MC 2E87A 1KYIA 2VP6A 2W83A 3E70C 3U7HB 5E3HA 2IYLD 4LX0A 1R6BX 3KKNA 4CRWB 2ZS7A 2A30A 3C8UA 5CB8A 1R4AA 2J0UB 3CF6R 4LJYA 4B2IA 5HR5A 3ZVRA 3IO5A 2JEOA 3KXIA 2NGRA 4JL5A 2F1HA 2V3CC 1G7SA 3QPWA 2F9LA 4NCNA 3KTAA 3IUYA 2V1UA 2IHYA 5FTMA 5TV2A 1XEFA 1KJZA 3W8RA 4HUTA 4RKEA 3DVLA 1XXHA 4BRUA 3K1JA 4BFVA 1OKKD 2A7QA 4Y0AA 5JRZA 4LGMA 4EJSC 3U44A 2J0QA 2WJYA 2ZRFA 3SZRA 3QY0A 5M04A 1SVLA 2BVNA 4F38A 3THOA 3HPQA 2WV9A 3UK6A 3AF0A 1N6RA 2X77A 1MRNA 2YJTD 2DCUA 3CNNA 3NBYC 5IHPA 5FUWA 1XDBA 5JS8A 5JWHA 4W5HA 1Z8FA 2XEXA 2QE7D 1CJTC 3EW9A 1IN6A 4XWKA 3LLUA 2XJ9A 2I4IA 4D2IA 1OF1A 5BN4A 1W4CA 1P75A 1AKYA 1Q57A 3NHBA 4XWOA 2DB3A 4OJKA 1AQUA 1E9DA 4F92B 3LVQE 4TLBA 2RGNA 4US2R 3AVUA 4ESVA 2Q21A 3THXA 1XPOA 1NN0A 2V54A 2XXAB 4DSTA 2ZRKA 1AZTA 3O47A 2ATVA 1E9RA 4CEIA 1QG2A 1W1WA 1OE0A 3MD0A 4I1SA 1WDTA 4MYUA 2P2LA 1WCV1 2UKDA 1V5WA 1GNRA 1QZXA 2BCGY 3L0OA 2QMHA 2GF0A 1UEJA 4WIAA 4QGGA 1YZKA 2PJRA 1R8SA 2CDNA 1A5TA 3GJ6A 1YKSA 4QM6A 3DM5A 3DOFA 4OI0A 4YMTA 3FTQA 1KSJA 4FXPA 3Q72A 1SHKA 2B92A 3VHLB 1T3LA 1JPJA 1YR6A 4CT5A 4X8HA 5C46F 1Q20A 4D26A 4X8OA 1KSHA 1W0KA 3FMOB 2XAUA 1IN5A 2ORWA 2IUUA 1OHHD 3OAAA 3X1XA 3A1VA 4IXMA 2QG6A 2HLDA 2REBA 2ZRIA 3MWJA 1HQCA 3ZQ6A 3IO3A 3H4MA 1II8A 2GILA 2WM9B 1KO8A 2VP2A 4BFTA 5UKDA 3NBFA 1XJCA 1DS6A 1Q1BA 4I1VA 3VR4A 4Q4JB 1IJEA 3AP2A 1JJ7A 2WICA 4A0RA 3GJ7A 2BIFA 4IDPA 4NE2A 2GEDA 3RRYA 1FPMA 1JQJC 4V0LA 4TYWA 1EFRD 4JL8A 1U0LA 1G5RA 3HWSA 4HAVA 4A9AA 5JEEA 1R5BA 1X86B 2R6FA 4Q4AA 5DISB 3QOFA 4Q7MB 3OEHD 3FOZA 2HV8A 4HZIA 2PEYA 5FTJA 3U61B 1G5TA 3ADCA 1TF2A 3SJBA 3C41J 3MWLA 4B43A 2ZRCA 2ZJOA 2FX3A 5KDDA 3L43A 1Z2AA 1T91A 1G64A 3AQ4A 1KI3A 2WPDD 3C5CA 3GLIB 3U60B 4HLUC 1GDDA 3ZD7A 3TSZA 4CZ2A 1LVGA 2WWGA 4A0FA 2B7CA 5GVRA 5EUQB 4GMDA 4LHWA 3TW4A 3SC3A 4FW9A 3AVTA 1XTIA 1Z22A 2NMVA 4IOJA 4RSGA 4CDGA 1OPXA 1BYIA 1ONBA 1LNZA 2VP9A 2CK3A 2R6GA 3HU1A 4OYHA 5DH9A 2IYWA 4TN1A 1QG4A 4TYNA 2NG1A 4PAMA 2QGZA 3HJNA 1X1RA 4MRRA 3K09A 1NKSA 2XZLA 3GLIA 4M2LA 3U7EB 1G8HA 3KKOA 1ZCBA 5CYPA 4H1UA 2WBLC 3SYLA 3DZ8A 4BFWA 2PMDA 1OB2A 1OW3B 1SKYE 521PA 1MO6A 1XJQA 1N6NA 1ZW6A 5FI1B 3B85A 1CBUA 1OKKA 3P4YA 4BFSA 2VTKA 4G01B 4AKGA 1A1VA 1MV5A 3W34A 2A5GA 1DTSA 3EC2A 5DIFA 1DAMA 2QE7A 4C4PA 1E4YA 3RWMB 1LS1A 2PMKA 2V8OA 1F60A 3QEOA 2G9NA 3ICQB 3BH6A 4BECA 1ZUNB 2H57A 4CIDA 2Z4RA 3QPUA 1GRNA 4QBFA 1CJMA 5FBQB 3F0TA 2CL6X 4LCBA 1ZCAA 4M9SA 5G3ZA 1GRRA 4RD0A 4N1AA 1NJGA 3SYNA 4RZ2A 1E1RD 4DKXA 2FU5C 1GITA 3WRXC 3X1DA 2QP3A 5CDFE 1SVMA 3IKJA 5HPYB 5EP4A 1DG3A 3BH7A 4RD1A 2Y8EA 1HEIA 3SBEA 1Z83A 3EIHA 4W5WA 1DEKA 5K8IA 1GP2A 3KB2A 3CPEA 4MDEA 3CM0A 4LBZA 4C0AC 3PVSA 2YWFA 1R10A 4C2UA 2PBRA 2WWWA 4TLEA 3WBJA 4QOSA 1IXSB 2FSFA 4M21A 4QRHA 1HY3A 2FPMA 1HYQA 1OXXK 3LDAA 5BN5A 3ZIAA 2IBMA 1UFQA 2OEPA 5D3QA 2QTHA 3WNBA 3WXMA 2I1VB 3BFVA 3QEJA 2ZXUA 2CLDX 3PXGA 1FNMA 1KY3A 4TL9A 2VQSA 4UKDA 3F8TA 3VU9B 2J1LA 5BW8A 4KVAA 4NZYA 5FOWA 3RVBA 1OV4A 1YZNA 1P9NA 4XVRA 5G41A 3BERA 2A5DA 2OM2A 2WIAA 1F6BA 2P6RA 1QVAA 4CF7A 2O8BB 1TTTA 3FE2A 3TQCA 1YJ5A 1L8QA 1E0AA 1JR3E 2IYYA 1S3SA 2JLWA 2CXXA 1EFRA 3L82B 3OHMA 2CHVA 1U0HC 3HP1A 1U94A 5KSOA 3W5IA 1XEXB 2ZJ2A 2GCOB 2ODNA 3EPJA 1KI2A 1ZD1A 2D74A 2W6ID 3OEHA 1KGDA 2VH5R 4BLPA 3KQKA 1BOFA 3K0CA 4B47A 5TARA 2GVDC 1C4OA 1G3UA 2ZSAA 4IOLA 4P32A 2I3BA 3K0AB 1J7KA 1W44A 3FDIA 3GMTA 1RIFA 3GEHA 1XMVA 4TTRA 2YZ2A 1Z47A 2D7DA 3GJ0A 5CYOA 4ZCLA 2EYUA 2G0TA 2WPDA 1G4AE 3Q8XB 4D82A 1W4RA 1RYFA 1W2GA 1LF5A 1KO5A 2R6CA 4EPYA 1OSNA 3SJZA 2QSZA 2WIBA 3H86A 4JVNA 1VKJA 1Q0UA 4U7DA 1PVOA 1W36C 1KNXA 4OHXA 3BIFA 2XNSA 1MRSA 1OFUX 3L0SA 4Q9JA 1D5CA 2PCLA 1Y63A 4IW3B 5H68A 1DARA 3NC0C 4Q18A 2JLRA 1II0A 4Q7JB 3TH5A 2V9PA 2YOHA 4FD2A 5E4FA 3THWA 3CNLA 3PQCA 3TUZC 2GNOA 1UBFA 4C30A 5CM8B 1H65A 3C4JA 5DYGA 2DWPA 3KQNA 3B13B 1G3QA 1QHHA 2BM1A 1NY6A 5FL7D 4BWYA 4JL6A 3I92A 1YE8A 4B2PA 3X1YA 1PLJA 5JZVA 4R7ZA 5EUMA 4LV8B 5KNBA 1A2KC 1MOZA 4GI7A 4JVMA 5FBRB 3X2SA 1M34E 4OK5A 4B3BA 5BWMA 4NYMR 3ZQJA 4IVPA 4EPVA 4O25A 1F2UB 4POAA 5KO2A 4WA7A 1YZQA 3HYRA 3MWYW 3KQUA 1P3JA 4ZI3A 4LDJA 4N3NA 1XMIA 2C95A 4B75A 3A4NA 4TLAA 5D3MB 3PEVA 5LD2B 5G40A 3ECCA 1WA5A 5LBIA 4AG6A 3B1WA 1YVDA 2OLJA 3BS4A 5HCIA 4DEXA 4OJQA 4DJTA 2VF8A 4FCWA 1KI8A 1JBKA 3A36A 3LY5A 3ZS9A 3AEZA 4B73A 2D4HA 2OE2A 2BC9A 2ONKA 4MQBA 1BYUA 2A5JA 3PEUA 3QF4A 3U2QA 4WOPA 2UVQA 5B30A 2F43B 1N6OA 1KZGB 2L0XA 2VYFA 4TT3D 1SXJD 4D4KA 2AXPA 4QJ3A 1RJ9A 5JEDA 3VR2A 1E1RA 3MRSA 4KCGA 4HAXA 4B3FX 2ZSDA 2RGEA 1XZQA 2JAQA 1FW6A 3QQ5A 4KODA 2ZAMA 1JI0A 3GLGE 3RC8A 2HXSA 2LKDA 1E2JA 3N70A 3QI2A 3HR7A 2REXB 1ETUA 3CPHA 4OQFA 4OQXA 1DAIA 1CIPA 5H8WA 4GDFA 1Q44A 1IBRA 2FJUA 3Q5DA 3DOEA 3K9GA 4DLYA 2QY9A 1D9XA 2FE4A 3D8BA 4LRWA 4C0BA 3ICEA 1KTVA 2WKRA 4M4SA 5DI9A 5L3SB 2QBYA 4BLRA 3WYGA 1HTWA 3LX8A 1OT3A 3KJIA 4XD7D 2VHQA 3CPJB 1U8AA 2ZRGA 3OIYA 2Q6TA 4EFLA 2EYQA 2JLXA 2FDCA 2GJ8A 2NPFA 5C18A 4RD3A 4FWTA 2G0NA 2IS4A 4V0NA 1GAJA 1M1YE 2WZQA 4XJXA 2A78A 5JHGB 5DO9A 2VSOA 2ZRNA 1OH5A 4B32A 1ZNZA 3T15A 4A0HA 3B9PA 2QQ0A 2W0SA 3I4LA 2OBNA 4OHWA 1U2RA 5EXTA 2GCNA 4Z51A 3M0EA 4JLAA 2VHUA 5DI3B 1TEVA 3IHLA 1X8LA 1XTQA 2IYQA 1NNEA 1EX6A 3EPKA 1LFDB 1ZD9A 2ZI3A 2IS6A 3NBXX 3F5FA 1HT1E 4PO9A 3W6OA 1LV7A 5L3QB 1Z28A 2GBLC 3SQWA 2AKAB 2QRZA 4PSAA 4Z1MD 4JKYA 1T6NA 2D3WA 5CM9C 2J59A 2O8DB 2W6IA 2KI5A 1KO1A 2VRWA 4OI4A 4US1R 4A2QA 4I1OA 3P20A 4F4CA 4JLBA 4ZDKA 1M7BA 2ZANA 2Q9AA 3PFIA 3VTKA 5HZKA 3TAHA 1E2HA 2PX0A 4QM7A 2VIIA 3MWKA 4I99A 4QL3A 5JRJA 3PJRA 2JASA 2NO6A 5CLQA 4AYTA 3SN6A 2J9RA 3F3YA 4LOAA 5CJ2A 2IXFA 4D0NA 1XF9A 1XRJA 2C78A 4TL7A 1S1CA 1KKLA 2IF0A 4FMCF 2BWJA 1TF7A 2FMXA 5KUTA 4JIMA 3ASZA 3D6TB 2PT7A 2O8EA 2BBTA 1AQYA 1MO3A 1ZYUA 2QAGC 2VP4A 3CRQA 5AJZA 2A3RA 3KXKA 3NDPA 1TAGA 2JLSA 5HE8A 5K8LA 4M1MA 1DOAA 4MH0R 2ZU6A 4AKHA 4TWZA 5FL7A 1P7CA 1R5OA 5CK5A 1FQKA 3PITA 1S3GA 2AXNA 2BMFA 2OHFA 1SZPA 2CLSA 2Z6VA 4LUCA 1PLKA 2C9OA 3CWZA 1NMXA 1JQLB 2HDNB 3MJRA 5GJBA 1TQDA 1SXJB 3DHWC 1ZM2A 1TNDA 3ND9A 5CB6A 4E03A 4S35A 1OH8A 3IQWA 4XSGA 3GPLA 2YOGA 3GCGA 3TJZA 4C7OA 3RWOA 1RRFA 4A6PA 2QMOA 2IT1A 1MABB 2JCSA 1Z07A 3FKSA 5KSPA 4ZKEA 1M8PA 3WYFA 2QZ4A 2GTPA 4Q03A 4B3GA 5JECA 4M22A 1UJ2A 1VG0B 1YRAA 2TMKA 1EG7A 3KKQA 4PC3A 3WMEA 3P1JA 2J7KA 2OV2A 2XB2A 3NKVA 4TT3A 5EXXA 4A2PA 5BYKA 2E9SA 3QPVA 1G3MA 2ZITA 4PSKA 1NL3A 3PEWA 1SXJA 2VP5A 3I72A 2P5TB 5CJPA 4DUGD 1XWIA 1NLZA 5C4GB 1NI3A 4XSHA 2ZRMA 2HCBA 3LW8A 4QHTA 4TTQA 1ZBDA 2IYRA 4TQAA 4G3XA 1MABA 2ZQ5A 1PLLA 4P4SB 4YONB 4A8JB 3PUZA 1ZU4A 4UJ3A 5FBLB 1WF3A 2AWNA 1P4SA 2WWHA 1AJEA 3BB3A 3UXMA 4B34A 2QSYA 4DIEA 1TX4B 1SVSA 1SHZA 2FSGA 4KFRA 3ASYA 4B3XA 1P60A 3U3MA 4QXAA 2J0VA 4MDFA 4ARZB 1E9CA 1OXSC 3W90A 1EWRA 2P6UA 2R65A 2ORVA 2YOFA 4GOJA 4FCTA 4XD7A 1MO4A 5EZ6B 1D6JA 2C99A 1Q1ZA 2A5YB 3QXHA 1Z63A 3TE6A 2KE5A 3WP1B 4LY6A 1FUUA 1Z2CA 1LTQA 3PIRA 2WWIA 2J0SA 1XB2A 1P72A 4MYHA 4P4SA 3AVXA 3FPAA 2Z5FA 3NXSA 1EWQA 1IN8A 3GLHB 4X8MA 4A0GA 2HUPA 4RCZA 1ZC4A 5KNCA 1ZD8A 3EC1A 3OIWA 5E95A 3NIBA 2O8FB 5DHFA 5TY0A 4ARZA 5B58C 1FZQA 4FMCB 4KYUA 3LV8A 5HTKA 4JJKA 1UBCA 3GQBA 3EAQA 2A2ZA 1S2MA 1QHGA 1QHYA 1HE1C 4MYCA 2AK2A 1KZ7B 3I61A 1BS1A 2QL6A 2QMEA 2R62A 4KSCA 3U4QA 3I32A 4LV5B 2QT0A 4TLDA 4ZKDA 4Q01A 5B2ZA 4Z1MA 3GLHA 1NLFA 3KFVA 1FMJA 1QHNA 4LYJA 4EIWA 4LJ4A 3RDPA 4IHQA 1FTSA 4Q1DA 5HE9A 2KBFA 4DVGA 2NO7A 4NCKA 1WMSA 2CBZA 2G6BA 3DMDA 1I2MA 3EARA 3T12A 2CMKA 1XXHB 2G1KA 3CF0A 1E9BA 3KX2A 2JLVA 1G20E 3NEYA 3IIKA 3VNVA 1IN7A 3NH9A 4HLCA 3U44B 4CEHA 1CJVC 3AV0B 3R9XA 1R0XA 1ZM3A 3VMFA 2ZRLA 1UPTA 3GEEA 4HB2A 2NZ8A 3QG5A 2ZJ5A 3CW2A 1F48A 1CJKC 2CEAA 4RD2A 1IHUA 4PXAA 1HT2E 4G5OA 5EZ5A 1TU3A 3X1ZA 1ZAKA 3A8TA 4NL4H 2XTMA 3RLFA 2C5LA 1Q21A 2AFIE 3CO5A 2RGNC 1YR7A 5FTKA 3CR7A 3A37A 1XEWX 5SZHB 1Z0FA 4US0R 1CF4A 3LBHA 4RFVA 1F2TA 4K46A 1Z6YA 3THXB 1RVDA 4EUNA 5EJEA 1FL9A 4OL0A 2GKSA 3CX6A 1QRAA 4CEIB 4I1UA 4FMDF 1ZRHA 3DM9B 2J87A 3HYTA 4ZDIA 4IJMA 1NY5A 4TL8A 3B1XA 4LJ8A 2JJ1A 2O52A 3MCAA 4NONA 5AWFC 1E79A 3IPYA 4RZUA 5DLQC 5FH9A 4GP6A 1JR3D 3QXJA 4EQ6A 5KPDA 3S1AB 5L8VA 1JJVA 2PZFA 1L7VC 1VG8A 3KXLA 2V4ZA 5H1YA 3SJAA 3I62A 1AS0A 1YZLA 3KQHA 5JJLA 2A5FA 4NYMQ 3AF3A 1UBGA 3ZVMA 4IEIA 4URZR 4TYYA 4PC1A 1GUAA 2OO7A 5F9FA 3NDBB 5SZJA 4DUGA 5CITA 2CHGA 1R5NA 4Z8YA 3SHWA 1II8B 1Z0IA 2ZJ8A 3GFTA 4FIDA 4TYPA 4B6EA 4DCVA 4DLVA 4WZ6A 4BFZA 1D2MA 2GJKA 2VSXA 4R2HA 2W2VA 4OK6A 3T61A 3W3AA 3IBGA 3EA5A 2ZE5A 4OQMA 5FPYA 3S1AA 5FOXA 2FFHA 1UF9A 1XTJA 1W47A 2RMKA 4IFEA 1KAOA 4JJZA 5LDDC 3O8CA 4LSGA 1XPRA 1GM5A 3K0FB 2OFOA 4HAWA 1W4BA 4YLGA 3RS5A 1E69A 5CIQA 2RAPA 3SI7A 2FFBA 4XIGS 3SOPA 3T35A 3GJ3A 2P0EA 4TMVA 1GZSA 1KK3A 3GFPA 4DT1A 3EZ2A 3V9PA 1ZNYA 4Q4AB 1NN5A 2FGJA 2BBWA 4ZV4A 3QSYA 3UMFA 1PJRA 1N2CE 1R0YA 3U6KA 1ODFA 5F98A 1AIPA 2ZRBA 1A82A 3TKLA 1JXOA 4P0TA 2JA1A 1SQ5A 5E7JA 1H8HD 3SDZA 4DDVA 1GNPA 2ZI7A 1R0ZA 3K0FA 1E1QD 5FPTA 4HEJA 3O8RA 1BIFA 4RD4A 1TQ2A 3MFYA 1K8RA 1G6OA 1G16A 2P67A 4I4LA 4LC1A 1R0WA 2IYSA 2D2FA 4NH0A 4EDHA 4P4TA 2CCKA 2D06A 2WTUA 2IC5A 4C0HA 4UXIA 4HB0A 5AUNB 3QKSA 1P5ZB 3EZ6A 3HR8A 4CT4B 3BB1A 4KSBA 2V7QD 3K09C 2AFHE 2PZEA 2N1BA 2BMJA 2W6JD 2O8CA 1XTRA 3LQQA 5EP3A 4CW7A 1XPUA 3KUDA 2PLRA 1Z6XA 3MSXA 4DCTA 3LW7A 2Z4SA 1VYTA 4N0EA 1C9KA 4MITA 3M6AA 2FZ4A 3OFND 4FMDB 1AKEA 1LB1B 1W2HA 2G83A 2DBYA 3RS2A 4PHFA 1KO7A 4XVUA 4Q21A 4FINA 3EWAA 4JYBA 5CDFA 4B33A 2KSQA 5GJWC 1E96A 1RFLA 2F3RA 4N0DA 4E22A 2Q0HA 1VPLA 1N6LA 4IDHA 1G19A 1DELA 1T9HA 3ND8A 2GJAA 4A2WA 1E9AA 2ORIA 3DO6A 5J4HA 4FI3C 4BQSA 1K6MA 1FX0B 1G291 3TSWA 2DFKB 5GJCA 3LD9A 1NBME 4IDNA 1ZINA 4HAUA 3PEYA 3BRWD 1NIJA 3SE0A 4IEEA 4ASUD 3I73A 3W6NA 4MRSA 1Q1QA 1UKEA 2OBMA 1KJWA 2VA8A 4C0QC 1I4DD 1FP7A 3EX7C 4E5UA 4B3CA 3FMFA 1XX6A 1B23P 2IWRA 4EFMA 2AKYA 4MGZR 4NU0A 2BOVA 4CYMA 2NOAA 1ZUIA 4FCVA 4ACBA 4EPTA 5JI3E 1M7HA 5J40A 4HB3A 3LH5A 4ZCMA 2MSCB 3P26A 5TMPA 1G7CA 1G6HA 1FX0A 3P27A 4YDHB 2IYXA 2GHIA 1SVKA 3CKLA 221PA 1GILA 4HLUA 3U3RA 4HATA 4U5XA 2J3EA 1JR3A 1BKDR 1KOFA 4Z8XA 3VR5A 2EVWX 1NIPA 4OKSA 1T5IA 3VR3A 4H9GA 3RS7A 2JDID 2FG5A 2FSIA 2QGNA 2ZM5A 3AVWA 1S9HA 5JJKA 3VX4A 5HZHA 3R9WA 1NVVR 1E99A 2D2EA 1R8QA 1V43A 3LBIA 4F7WA 2QROA 4QGAA 3GP8A 4CVNA 3AF1A 2QU8A 5KTYA 1NVXQ 1YR9A 5IK2D 2ZEJA 4TQUS 1YZUA 2G3YA 2FGKA 3VKWA 4D81A 2GZHA 2IF2A 2KB0A 2RH5A 4BFYA 1Z3IX 3LXXA 3R7WA 1S96A 1P2UA 2GAOA 1E0SA 1I4TD 4Q4LA 4PHGA 4Q9IA 4TLCA 1XTKA 3VAAA 2IL1A 1X1SA 4ZDWA 5A4JA 2ZIAA 2ZYTX 3K0CC 4NCHA 1OHHA 1GTVA 2W00A 2ZETA 1E98A 2OAQ1 2MSEB 2ZJYA 4AK9A 1E9EA 2KWIA 1S4QA 3GLIE 2WWYA 2ZI9A 3CF2A 1DBSA 3GFOA 2OSBA 3QJYA 2YV5A 2XSZD 3TGPA 1CP2A 3QXXA 5DHAA 2ZRHA 2BV3A 5BYJA 1Q12A 2VSFA 2XNDD 1T5LA 3FKQA 4AY2A 1ZM7A 4HAYA 1KI6A 3P32A 1H8HA 2ZVPX 3PENA 3A1SA 2YWEA 3A1UA 1OJLA 1R7RA 3THYA 4EFNA 2ZYWX 5FUYA 2CE7A 2ZS9A 4CEJA 1ESMA 3SHFA 1E1QA 5ANRB 1AGRA 1EGAA 2BMDA 2C03A 2WVJA 3PV0A 4TQ9A 3TBKA 2BKEA 3VHXA 2NTYC 4PZLA 1K5GA 1CKEA 3PUVA 3JZMA 3QVVA 4R9UC 3MG9A 2AR7A 1P73A 4M1SA 2J46A 4YMSA 5GVSA 3UG6A 4NTZA 1G7TA 2OESA 3REGA 2QPAA 2CHQA 2C77A 2V7QA 3A1WA 3D31A 5FR1A 2W6JA 4DRZA 1WXQA 1KDTA 4Q1FA 2QENA 3THWB 5FOSA 1KK2A 2AD1A 3ADDA 5LPNA 2GETA 3FWYA 1E2LA 4TZ6A 1QHHB 1XD2A 1TADA 3W6PA 2ANBA 1E9FA 4ZCIA 4JBXA 2HXYA 4GBMA 2IUSA 3ZVNA 1VCOA 1D8TA 2F1JA 2JLYA 2X2FA 3R20A 4HUQA 3AB3A 4GOXA 4LYFA 5CK4A 5FR2A 5FUXA 2JLUA 3GLGA 2RCNA 3UWKA 1II9A 2W0MA 1ZNXA 3VR6A 1WP9A 1N6IA 3UATA 4RZ3A 2UZ3A 1U99A 4KYIB 1ZNWA 4PX9A 3ZS8A 2X19A 3CB4A 3QKTA 4MUAA 1CULC 5SZIA 4HLQB 4XTCS 3ZH9B 1COWD 1CU1A 1QBKC 5F3WB 1KY2A 2ZJZA 4ASUA 2B8TA 2IXGA 3QF4B 4UQOA 1NMYA 4DLXA 2DY1A 3EASA 4KITB 1E2GA 2ZRDA 3NC1C 1AZSC 3CRRA 4IXNA 2X2EA 5LD2C 1KK1A 4NHOA 4PC7A 2JJ2D 4M1YA 1EESA 2C2HA 1RJ9B 5DYIA 1OB5A 1JEDA 2HEIA 4JLJA 3SNHA 2MSDB 5IT5A 1U81A 2GA8A 5A5GA 4TMXA 2MMGA 4ILEA 2C9CA 3KZ1E 3QBTA 3ZJYA 1BH2A 3K70D 2IX3A 3LBNA 2ZE6A 1VYVA 3GJ4A 1GKUB 2HJVA 3AVOA 3CH4B 2QUZA 1SVOA 5AUQA 1JXMA 4BZQA 1EFUA 2FOLA 3D7MA 3DKPA 2QBYB 1CRQA 4HI0E 3HU2A 3LO5A 1PZNA 3ADBA 4LC0A 4PPGA 2JGNA 2F1RA 5EE0A 2JDIA 1IOZA 3CZPA 4YQFA 1QF9A 3TRFA 1NN3A 5EE5B 3RSOA 3CNOA 3TLXA 4BLOA 4DDWA 4BFUA 3OZXA 2WAXA 4QHSA 3NTUA 3PUXA 1YZGA 4OI1A 3LNCA 2EFCB 2GF9A 2VF7A 3EIQA 4Q7KA 1O3YA 2HF9A 4O2LA 4JS0A 3N2IA 1YZTA 1OH6A 5IK2A 3H1TA 3HDTA 3UG7A 2WJVA 4KXFB 2WHXA 4DLRA 2R9VA 4TL6A 4UXJA 4JLOA 4D0GA 3T5GA 1U9IA 2VL7A 4RY2A 4R2IA 4W7SA 2BDTA 2VHCA 4NBSA 3IPXA 5FOVA 4OHZA 2GVZC 5KHOC 3D3QA 3IEUA 1Z6TA 1OFTA 4XOIA 2VO1A 2ZI6A 2EFDB 3EXAA 1VG9B 4DZZA 1G3RA 1YRBA 2G1JA 5CLLA 2CE2X 2ZI5A 4DSNA 1JAIA 4L15A 4LV6A 5BXQC 3TIFA 2ONJA 3N2EA 4KFUA 2PZGA 4C0JA 5K8UA 3PR1A 1MT0A 2ZUCA 1RZ3A 3B1VA 2FWRA 1G9XA 3TK1A 2J7PD 4LPSA 4M9XA 2XSZA 2QM7A 4D4MA 5G53C 1EX7A 4O3MA 3AGQA 1WQ1R 2FPLA 4Q47A 2XNDA 1OIWA 2H8KA 2DWQA 2QPTA 3EWSA 4XVQA 2O0KA 5IRCD 5JWRA 3MMPA 1KIMA 1YHNA 4KLNA 4UNSA 1SGWA 3EPLA 2ZJAA 3JVUA 4I81A 1JB1A 3PUWA 1T8UA 1OYYA 2GAAA 2W58A 1UKYA 3CWQA 2RKOA 4OQLA 5J5CA 3UMSA 3W9YA 1KI1A 3T5DA 4V0KA 2O8EB 1J90A 3TR5A 4V0MA 3EZ9A 4LJ6A 4BGDA 4NYIR 3B7GA 4KLZA 4M9QA 1EFHA 2GXUA 4PPFA 1TPZA 1RRCA 1E6CA 4AYXA 1EXMA 3KKPA 3LVRE 3Q5EA 4DLSA 2ZR0A 3BORA 4WBSA 4TMZA 4RFSB 621PA 4D0LB 4AKEA 2OUKA 2PH1A 5EE1A 5TXGA 3MGCA 3RNLA 4KI0A 4C0SA 2D7CA 1LS6A 1OIVA 1VG1A 3CRW1 421PA 2QM8A 1HE8B 4PHHA 2BJVA 5BQ5A 4C7OB 2C04A 3HPRA 2NO9A 4JLNA 4NKRA 1N5JA 2WKPA 2CLCX 4JYCA 3FFBA 2ODEA 4LWZA 2RHDA 5GJVC 4JLPA 3DKVA 3NWJA 2GRJA 4PPNA 1LW7A 1XBTA 4PHTA 3AKCA 4RFSA 1SXJC 4W5JA 4WZBE 3UMRA 2K5UA 5EP2A 2OLKA 1G1MA 2CCGA 4KVGA 4B2LA 4E09A 3GJXC 4DLWA 4TMKA 4L9WA 3IGFA 4AI6A 1GKIA 2NQ2C 3DZDA 1Z0KA 2YC2C 3QBVA 3AVPA 3AVVA 4D25A 1G21E 1NVUQ 2LCFA 1RE0A 4JT2A 3VKHA 1RRGA 2VHJA 4FN5A 3GLFB 2GEUA 1FQJA 5IF9A 4PZZA 1UDWA 5DNYB 4QNMA 4DXAA 5KPJA 2EWVA 2DPXA 1FMLA 1VHTA 2WKQA 3SJCA 3CRMA 4LHZA 2C9YA 4K8OA 1P2VA 2AX4A 2FSHA 3C7KA 3EZFA 1G8YA 5FUVA 4QGHA 2HYDA 4A8JC 3CLVA 5HKKD 2EW1A 2IEYA 2QAGA 4GMXA 4V03A 2PT5A 2XJ4A 3NVAA 3CIOA 3GLFA 3U3KA 4YDSA 2BM0A 4AIIA 3AUXA 5AK0A 5B57C 3EPHA 3BH0A 5AUOB 3WRYC 3CRVA 2ANCA 2RGXA 3B1ZA 4B71A 2DFLA 4P33A 1UDXA 4B74A 1XNJA 2QMUA 2ZVQX 3Q9LA 3H0KA 3QKRA 2W2XA 3SEAA 1NG9A 3OE7D 1P9WA 2XX3A 2ZI4A 3PCRB 3O8BA 4HLDA 3OIVA 2D62A 4IDOA 1ESNA 4HDCA 1VYUA 1OFIA 2H17A 4NCIA 5E7IA 2YKGA 1DG1G 4NYJR 2DHRA 2AWOA 1I2DA 3BGWA 3U7GA 1P6XA 1XCPA 1G8PA 4EPRA 3U4QB 1U98A 4ON9A 4R98A 1KMQA 1NBMD 4PO8A 2FZLA 3T34A 5EE3A 3U3JA 1VTKA 3AM1A 3DEFA 1CXZA 2PLFA 4QJ4A 2PJZA 4KV9A 4NDZA 4QKQA 3W3ZB 1W0KD 2WOOA 3RABA 2J7PA 2XTZA 1MKYA 4GZLA 3KJGA 2QT1A 2FV8A
chains in the Genus database with same CATH superfamily
1T6ZA 3LBFA 2R0QC 4MV3A 3P0JA 1U8CB 1U5BA 4RK1A 5FA6A 1HQYE 1O0SA 1CUGA 4W7HA 5B64A 5K0ZA 2YR0A 2JJ8A 2QJOA 5LZ7A 4HPXB 5KMGA 1MU0A 2AB0A 3RYHB 2VJAA 1XFDA 1E2NA 4RZXA 2ZSUA 2C61A 2VK8A 1C0EA 1X1AA 3QHPA 4CMEC 3TOXA 3MAGA 3EULA 1QPZA 4H7EA 3T7SA 2SCUB 4OJTA 4JITA 1D6MA 5F52A 1KDOA 3D0KA 4XD2A 1YZ3A 3JPWA 1RI1A 4NWIA 4X95A 2ZUDA 4Y6GB 4CQNA 2AC2A 3ZJ5A 1QHIA 1T3SA 2PMCA 5FPHA 5F1OA 2QSUA 4LECA 4JI7B 2BRUA 3AL2A 3AM5A 3O9MA 1NWCA 3ROMA 1PJ3A 3RVKA 1HSZA 2QTVB 4CI0B 1MJGA 2LZ0A 4EGJA 1DSSG 2CWWA 3N2GB 3ZXXA 4A27A 1F2TB 1GGKA 3CO0S 5G4KA 1IHDA 1Q3TA 2H4XA 4Q16A 1Y9AA 4D4JA 4WI1A 3DZJA 1TOAA 2QWXA 1TO1E 3OZRA 3NU1A 1L8OA 2FFAA 2OAP1 4BAUA 4F5YA 3HXMA 1YIDA 5E6RA 2IUTA 1QDUA 1U2TA 2CBXA 2M6SA 2NU7B 3IHTA 3P9ZA 3AH8A 4I36A 4KMSA 4L9AA 4JVSB 4Q4HB 4ZT2A 3BRSA 2NZWA 3OFSA 2V7XA 1CDZA 3ZU4A 1XRSB 3RSSA 1TQ6A 3DV0A 3O74A 3VVCA 6CHYA 2HK7A 1YNSA 1DAGA 2IY9A 3V34A 4CLXA 2XDWA 1Z2EA 5GADl 5I7HA 1BROA 3O8DA 4HZUB 1B8NA 1TTPB 2ZIFA 3VQTA 2DKNA 2FW8A 1T1IA 1U0RA 1H93A 4G5QA 2PXCA 2EKPA 3PKZA 2X1MA 5JPIA 2OXRA 4G4IA 3G02A 1E7RA 3RVLA 3TI9A 4LHVA 4CTKA 4DA0A 4MKIA 3N2ZB 4MW6A 3R8CA 5BNZA 4C22A 4DBVO 2ZSEA 3DH0A 4FR0A 1UPAA 1Y3CE 2V55B 3A05A 4KUHA 4UQPA 1SMKA 2ZE8A 4J6EA 5GGYA 2YN2A 4DNXA 5EMHA 3WV5A 4URXR 5KYYA 5AJHA 1XN4A 1E1LA 1PL6A 2IV2X 4Q1CA 5LLTA 3OT4A 1TKRA 2HAEA 4Y9DA 2JGEA 4BTEA 4DMCA 2HCJB 3TTVA 4JOSA 1J8YF 3BMOA 4FNMA 1DRKA 1IHXA 1U02A 2C96A 2J0UA 3NZEA 2HBQA 3NH6A 4LJ5A 3U40A 3W7AA 4MPRA 4DE5A 3KWMA 5ELXA 4Y2GA 3RS8A 1YA6A 4BVHA 2VAPA 2EWWA 2Q6LA 3EIEA 2N42A 5E9QA 3ZHSA 4GOOD 2FXVA 2BN4A 3U5ZB 3AM4A 4DDUA 1DG9A 4TRMA 5EPOA 5KWEA 4R7TA 1E1NA 1YC5A 2WV7A 3M1YA 3NOVA 4F6RA 3DHNA 4D9NA 3OZWA 4Y6PA 1Z18A 4ENWA 2QP9X 2I33A 4JJEA 4G9BA 1A5SB 2Q4DA 4L16A 1C4WA 1K3UB 3F97A 2WSSD 4HDNB 3IT0A 3M3DA 5DNUA 3EHDA 1PGOA 1PR3A 2LPMA 2XR1A 4XQ9A 3S2EA 1RC0A 1QIMA 4JC8A 3LLVA 1PTJA 2FN9A 2JH8A 1ETHA 4QXMA 2WKSA 1VE7A 4RK0A 4D0RA 2A9KA 3DVRX 4EJSA 2VT6A 1LX6A 1YJAA 1Z2PX 2LKCA 2V7WA 3O1HB 4NOKA 3QLVC 2OCKA 3NM6B 4Y30A 5C8YA 4RIFA 2JHFA 4G09A 3RUPA 4QTZA 3AF2A 1AGPA 2ZSFA 1TUBA 2A0KA 3HFJA 1NG1A 3WY9A 3I6QA 5KSZA 3IAS1 4JK3A 3HXTA 1NC3A 2O2ZA 2LD4A 4LDQA 2GF2A 3FFAA 1PYDA 1K0FA 2RBGA 3QKSB 5ALTA 2GWHA 1TUEA 3B9RA 3EGOA 1L0BA 3M6IA 4WD3A 4WEQA 4M37A 1L7NA 4WXRA 4H15A 5DOVA 5DVZA 5F1KA 3ZWMA 4JT9A 1YR8A 2R1TB 2VBFA 3WLFA 1NVWQ 4YRKA 2O8CB 1GTRA 1TJ4A 4CM7A 1AGXA 3TR0A 1K97A 3PA6A 5C80A 2XXAA 5LQDA 5JCJD 1NP7A 5JCPA 2O5EA 1NQ5A 3MMZA 1CEEA 5CCBA 5INTA 1ZD4A 2L69A 2ZYAA 4JEUA 1ISJA 5BN3B 5JJIA 3C3PA 2G71A 3DVQX 5JYEA 3PGLA 4X6XA 5K8TA 4GXTA 1UKBA 3DAHA 2BFPA 5EIFA 5FBWB 4UNRA 2Y4NA 4KGDA 3SKXA 4JODA 1W96A 1Q7GA 4FD3A 3IA2A 4JHXA 3ROPA 1Q83A 4L5JA 5K03A 4TV9B 3V1LA 4Z5XA 2XYGA 1FQWA 3PUHA 4HQOA 1CLUA 1LSOA 1N25A 3ZK9A 2XE7A 4PAOA 1N1EA 2PE5A 3CCBA 3LLMA 2O20A 2OG2A 5DBFA 4CCSA 3F73A 3Q7PA 2ZAGA 3N58A 4F2DA 4FHDA 1QRDA 1ZU5A 2WSMA 3L4BC 1QKIA 4NZZA 1W48A 1CETA 1EUCB 4UUNA 3T7IA 4EGFA 3TMKA 8AT1A 4ER5A 1PG0A 3ZWOA 1GT6A 3H2KA 4UQLA 3PNKA 2OPHA 5CW1A 5IKEA 4J7UA 2XNKA 3DLPX 3TIGA 3CXUA 4HX9A 2DWUA 1JG7A 2RI1A 3EISA 1L5SA 5E6UA 1E5QA 2XRMA 3KBOA 1YI8A 1GR0A 4R1PA 5EIHA 3VPGA 4HDOB 3GK3A 2RGDA 3B6EA 3D7SA 4D1YA 2H59A 5TLSA 2R25B 4Q3BA 4Q4JA 4MR9B 3ZOZA 5CA0B 3E5NA 1ISGA 2NQ8A 3IVXA 3TG8A 3DG9A 1OYWA 3FB1A 1YASA 5IVDA 4CG2A 3KYCB 3JQAB 4GRAA 3WSTA 1XZAA 5E4YA 4AAYA 2UAGA 4H60A 4NYIQ 5REQA 4BU1A 1EXVA 4Y6LA 3QWAA 5HEKA 5TPZA 3JQEA 3NTOA 5TQVA 2QX4A 1XOIA 3SNKA 1AV7A 1P33A 3OFVA 4G4SP 5FHRA 3AL3A 3S2ZA 4AP9A 2QMYA 3QVOA 3T3PB 4DS3A 4PIMA 3N5KA 3TTYA 4PQRA 4D9JA 2VXOA 1E2KA 3L49A 3LRPA 3VNRA 3WSWA 1WKCA 3FG9A 1QGZA 1GQQA 3BXHA 1RHQA 4D99A 2R6AA 4CE6A 4LMRA 4O6VA 2IK8A 5BSRA 2IWHA 2YL2A 2CT8A 1ZFNA 3H5TA 1M10A 2GEJA 3W2GA 4C21A 5HUHA 3BD9A 3HUUA 4LPKA 3CG0A 3TL2A 3H42B 1IHYA 3TS1A 2P7HA 2CHFA 4DA9A 1GZUA 4BDTA 4YIHA 3PNMA 2E7ZA 4GYYA 1ZIOA 2AI2A 2NTNA 1NP6A 2OXCA 4QTXA 5AI8A 1AV6A 4KU4A 2OGUA 3KYDA 4WK4B 4E12A 2Q3MA 2WAAA 4FUQA 5JNTA 1MQSA 3HXKA 2HYIC 3AHDA 2UXBB 3LHKA 4D57A 3L3BA 3FVQA 4BKMA 2X4IA 5ESDA 2VNJA 3LYUA 4YXWA 2ISQA 3V2IA 2NXJA 2B2CA 4ZO6A 4GWLA 5DF1A 4CEJB 3ZDAA 2I6XA 1G41A 3LPLA 3TO5A 4ER0A 4MRMA 3WFIA 2AQIA 3G2LA 3ESZA 2H54A 1VIVA 1XZBA 2X58A 3UEOA 2EQBA 3B5EA 3JZAA 2FDRA 6REQA 2BYTA 1J1UA 1UADA 1XKQA 5A0VA 1QK4A 5FWYA 1KP2A 2IOQA 2ODBA 5T4EA 1N2BA 3GFRA 3HDJA 5EYPB 4K0KB 1SCNE 1EFPA 1JKXA 3REFA 6YASA 2CJWA 2WABA 3N0WA 1JWBB 5FI0B 4NCAA 4PONA 4NBTA 3TDNA 2QTCA 4AX8A 1V4VA 4CU2A 1G18A 4MIOA 4CLRB 3E1SA 4NU8X 2W8ZA 4JLKA 5EZSA 3STVA 4ZAVA 3AUKA 3DL0A 4L4SA 1TU4A 1PRYA 2PUJA 1Z0SA 3ZBPA 3TRKA 2VHVA 1JQAA 3BXXA 3OF5A 1L7MA 1K7XB 1WCIB 5ABPA 3HKCA 1I4LD 1M34B 1QVRA 3OZIA 4YR9A 2XMCA 3PHJA 1DE0A 2FSPA 4G8CA 1IYZA 5IJ0A 4Q1BA 4PE5B 3HHEA 4J1TA 3THRA 3CX8A 3FNBA 1CQPA 4UPVA 3BXZA 4DGSA 1F12A 2RHMA 1E6KA 1WCWA 1J2JA 1NDQA 1ZUNA 2PGOA 3EA0A 4ZREA 2GZDA 3QLUC 4ZI2A 3GRPA 3KWLA 5FOTA 2EOAA 1QLJA 2VDUE 3A4MA 4WDRA 4DRYA 1XD8A 2IHBA 4PNHA 3UJPA 1WABA 3QFHA 1YRWA 1CY0A 4ZV7A 1OIXA 5JDIA 4DC0A 2Z43A 1XG5A 1BMQA 1OILA 1CQZA 1F5NA 1O94C 1VCIA 4DFDA 1ZR4A 1ESEA 1LI5A 5ALMA 1EA7A 2VSNA 3ZWAA 4QOGA 4N12A 4AJJA 3K8QA 3I5YA 1NRWA 1XD2B 1OFUA 2J41A 2QORA 2XVZA 2WJGA 4H0NA 5CURA 5EJGA 2HCFA 2W70A 2CLEB 4B3SB 2QA5A 5I8WA 1X2EA 1XTUA 2H5IA 3BBPA 3C5WP 1TQ8A 1KO4A 2VNAA 1U90A 2FW0A 2NIPA 1TRKA 3DSRA 1SY7A 1KI4A 1VLQA 3EJWA 1MG5A 4OMCA 2Z2YA 4WOJA 3DJFA 1LPOA 2EFHB 4E5SA 3GLKA 4JVLA 3PC2A 1KJYA 1UK6A 3QJ5A 1E9VA 3V4FA 1W46A 5JSZA 1E3MA 1M72A 1SA0A 1SU8A 2K4MA 1BQEA 2OGZA 3DTNA 4EFDA 4ZJZA 4U0KA 4R2WA 4EY8A 1AU9A 4I5DA 1AN9A 2BEVA 1LDYA 4JLVA 3WNDA 1TMKA 1QPBA 1WUJS 3RYFA 2OQIA 3ICEA 4MRNA 5JFGA 2E85A 4GPTA 1MG0A 2VZ9A 2AMJA 2EKQA 2NVUB 3ROQA 1YONA 4G0UA 4HAZA 1FDOA 3GVPA 1M0EA 2P40A 4WEOA 4W5RA 2PZBA 4TXNA 1BS9A 4BZPA 1EJ2A 1HLDA 1IN4A 4K0RA 3I0ZA 2C2WA 4F4HA 3UPTA 4DA6A 1JAZA 1LBIA 4DNQA 2HXGA 4RORA 3RD5A 3DT8A 1VECA 1TQ4A 3CZ9A 2V65A 1A9XA 2AQ8A 4YEDA 1LQUA 4TZTA 1Y6GA 4B1FA 2NZYA 1N0HA 3B38A 4INOA 4RHFA 1QQAA 3L5OA 4DAOA 1KJIA 2A0WA 2H1WA 1DVRA 3LUKA 4KAXA 3U81A 5IC4A 2G07A 4ESEA 1JMYA 4FMBB 3RRMA 2G9QA 3ZDQA 3T5AA 1D2EA 2J6CA 2LE0A 5K01A 4U8GA 3W5HA 2CCJA 3LAWA 3LWNA 4OEHA 3GJ5A 4UMEA 3M9XA 1GFIA 2HSEA 4EOGA 3FBTA 2J09A 3CBQA 1VDMA 4IVQA 3MTEA 3K6RA 2I2XB 1TPYA 3VH1A 1RXSA 3G1UA 4LJ9A 2QL5A 2VPYA 5I3ZA 4ZRDA 2RBEA 4OHPA 4C7KA 1FP4B 4AYWA 2ST1A 2GAIA 1RKUA 2PV7A 1UODA 4GF5A 3KV3O 4HYYA 4MINA 4WY2A 2WZBA 4ZVUA 2IY7A 1DRUA 1ONPA 4H08A 3GRYA 3UHPA 4BLQA 3PKIA 1TMYA 4ML3A 2GLTA 4B3RB 4F4IA 3GNTA 1KPGA 4MRVA 4C78A 3A14A 3CONA 3JSXA 1GOTA 2AL7A 4FK8A 2XOKA 4HKTA 2TYSB 4ZVTA 5BR7A 3G1TA 5IG2A 3R0XA 3OTHA 4LOLA 1R2QA 2AF3C 4X3OA 2B35A 2GFHA 2M98A 2XXBA 1SWVA 3RAPR 2W6MA 3KUCA 4GL2A 4JBNA 2QI9C 3OEEA 4WCFA 5CFLA 1PS0A 3FKSD 1XCGB 2LUOA 2CN1A 2FWMX 1WLYA 4HX2A 4IJWA 3ROKA 1Z6QA 3ONWA 2QW8A 1GO2A 3DXYA 2PSHA 1EFKA 4E2ZA 4X54A 4G5YA 4D4LA 4MTLA 2AYYA 1TO2E 3ORFA 3EEYA 3BWBA 4HEHA 4UDNA 4DSOA 3WMFA 4J16A 4CNBA 3HKDB 3WFJA 3AU9A 3I04A 4ODIA 4F4JA 4GKJB 5ALUA 2Q3FA 4A91A 4TROA 2R1VA 3IAAA 3KB1A 1RJFA 5FX2A 5ITVA 5A04A 2DSTA 1E89A 4OJYA 5LJLA 1Q16A 4MVJH 2WOJA 3DDSA 5J2UB 4KHPB 1UQTA 3BD8A 5YASA 3L18A 3GH3A 2IA5A 4DPKA 2D5CA 1HE2A 4W5TA 4Q1AA 1PHRA 4O1MA 4BZWA 4BXOA 3FPGA 3TQSA 3ZLJA 3IDOA 3WLSA 3PXCX 3WA6A 4C6RA 1WNTA 4NMMA 4QREA 3HABA 4RK5A 3BEDA 5H5JA 3GUYA 1JHDA 3C39A 2FQYA 3ETGA 2CVZA 2F43A 1NQWA 1NQTA 2WNSA 4YRRA 3RYTC 1XCMA 3ZI7A 1RM0A 1F5SA 4LTNA 3U1VA 1UXJA 1BMFD 4OFXA 1XQYA 1W8IA 3CZ5A 4G4SO 4KBYA 5BWCA 1OBCA 2QRQA 1NVFA 2O3SA 3LFTA 1TVCA 2X5OA 3URMA 4BMNA 2WJ6A 3TZLA 1YS7A 1AN0A 4Z4IA 5KQMA 3QENA 5GJBA 4NSNA 3AEYA 1XR3A 4L8YA 3VPDA 2H4ZA 1S9DA 2WJPA 3PNYA 3JR3A 1TCBA 5DHRA 3RASA 2XQJA 4TKZA 4OHKA 4MYSA 5ESRA 4ZK6A 1P8JA 1A4RA 4NMWA 5AKYA 2GNAA 1S3FA 4JBGA 3HBAA 1Z7GA 3IP5A 4WESA 4ZALA 1KDYA 1XP8A 1YJ8A 3DTYA 4P53A 5AVVA 1KYQA 1WBDA 3PE3A 3X1KA 4E1BA 1J07A 4GFDA 4G89A 4HDQB 4AI6A 3ANNA 1O2DA 4G23A 2YJZA 4LWPA 1BQ3A 2YWHA 2QN7A 1OH7A 1SQ0A 3A11A 1Y1TA 4LDZA 2Q5IA 1SEVA 3U26A 1SM4A 3HACA 3FFTA 3PNQA 1HT3A 1WW8A 2L19A 1P61B 3B51X 3P2MA 4PR3A 4X84A 4XDGA 1ZY2A 4ESHA 1X7YA 3LGSA 4P3YA 2DERA 1K5HA 3QE0A 4QUBA 4B76A 3L02A 3EH2A 3OM8A 4PR0A 3AUJB 1R64A 2DR3A 3N0VA 2OFXA 4Y6SA 4DJ5X 1IONA 1U7ZA 2IPXA 3L8YA 3JQBA 4FHEA 2PBLA 2VXYA 1VGVA 5BO5A 4IDQA 2JHPA 3B9QA 4B7AA 4E4YA 5IH7A 1U0GA 1JKFA 4FBGA 4B3IA 1SKAA 3RJZA 4RADA 1NI4A 1WXIA 3GA5A 3U4HA 3TOSA 1XSEA 3K8YA 2RK4A 3W04A 3K70B 4H1VA 5A2GA 2N47A 5L3QA 3N5CA 1N3LA 4NS1A 1JB9A 1KJ8A 2R4QA 3NOQA 3O5AA 1BH6A 3QKUA 4YDRA 1PT8A 4NMXB 3T7EA 3GPDG 1RPJA 3MWEA 3MRTA 4BVLA 1K5DA 2C07A 3LT1A 4UCXA 2JBAB 2WF5A 3EIOA 3CMMA 1OLUB 3ICWA 3MUEA 1KKMA 1G8FA 2NTVA 2O0HA 1PFVA 4HNQA 4M1WA 4PLTA 4TVKA 3WBFA 2I4OA 3A1FA 1RKBA 1Y4DE 3O8QA 2I9PA 1C30A 3FVTA 3W8NA 3BDIA 4KPUB 4BWGA 2IU6A 5JY6A 2CSXA 2CL7X 4Q93A 4L5IA 4MI1A 4ZU1X 2XZPA 1VIYA 3DNFA 5D2CA 1CR2A 1EK1A 3KFXA 2AUTA 2IXEA 1TO6A 1P62B 3H5AA 4RVHA 3IQFA 3QKRB 4E07A 4QRIA 1UZMA 1WBBA 4AKIA 3U7FB 1AOXA 1WUIS 4MUNA 1T4MA 4I4NA 1YTUA 1YMVA 2C97A 3SU8A 2F7SA 3TOVA 4EPWA 1LWNA 1E79D 4RJIA 5DLPA 3PXDA 2ECPA 3TOZA 3TZCA 3B36A 2JFPA 1ZM4A 2HSJA 1WB6A 2O3QA 3GJ8A 1A5AB 3JQ6A 2QD4A 4V0ME 4GPBA 1BMTA 4AJ2A 5JXIA 1HURA 3W7BA 4ZIRA 5CCDA 2W98A 2EERA 4DIMA 3IEVA 2D13A 2P3QA 2EKBA 2XIQA 4XSVA 1CQIB 5JLJA 1M74A 3QNUA 4RKRA 1GJRA 3WLHA 1SKMA 3IIJA 1TAUA 1C41A 1FYWA 1WIWA 1SD1A 4Q1EA 1Z7BA 2Q3HA 1O77A 4Q5IA 1XLUA 1G20A 4MKHA 2UZ1B 2XYPA 4DUPA 3M6XA 1W49A 1QOQB 1G2PA 4Q6WA 1NVVQ 5CX1A 4QU0A 4R81A 5DBOA 2YS6A 4OLBA 5E8JA 1GL9B 2FEMA 1IUOA 4Y0NA 2LCQA 3S2FA 2QX7A 4D3SA 3DDUA 4Q00A 4PX5A 1US8A 3QKWA 4UTZA 1XJ0A 5KMGB 2X6QA 1ZAYA 2YINC 4R9RA 1RLOA 2Q45A 3DQPA 3U3OA 1QO9A 2VG8A 6Q21A 1LRJA 1MV8A 1XAHA 2WJIA 4A8HA 1RXEA 2YYAA 3PK0A 5EXSA 2O0LA 4O08A 3UMBA 4LHSA 4NPHA 3ZNNA 5LP6C 5A3QA 3WLEA 5K7SA 3IB6A 3B48A 1JU4A 5DEOA 1QSGA 2V1XA 4J76A 2DH5A 2C3OA 3UBMA 1Q50A 3CGGA 4JUBA 1SD5A 5JDCC 3R75A 1N78A 2EBUA 1PKEA 2PO7A 2VQ3A 5L3RA 3QELB 3AR8A 1XU7A 4Q37A 4QUIA 3T3HA 4EA7A 1M83A 1XI2A 1D9ZA 3INYA 3MS7A 5JH7B 2A9FA 5CCXA 4QSMA 4RYDA 4IXTA 2COEA 2ZWIA 3HY4A 1QB7A 2WT8A 4AL4A 3E5HA 3HJGA 4A8JA 4Q3OA 3COJA 1TFUA 4LJ7A 5H70A 3W2FA 5JXHA 4X65B 3HZHA 4YAIA 1M5UA 2QIOA 3DF7A 1V48A 5E6RB 4CF5A 4DYVA 4PRKA 4E7PA 4TPKA 3IQGX 5CDSA 1X7WA 1UIRA 1FUEA 3UNXA 2OT3B 2PH3A 1XZLA 4CCWA 1CNMA 3CNBA 4ZI5A 1L3IA 2WG1A 2IW3A 4HVTA 3ED1A 4WBNA 3K1AB 3ESAA 4ZGBA 4ME6A 5CPBA 4AZVA 2YWGA 4HGZA 4DDTA 1BCSA 3IIMA 4FHFA 5LQSA 3ZWKA 1LLFA 1QQ7A 4ITRC 3UXHA 10MHA 1TZBA 1UK9A 4B9AA 1BKSB 2XB4A 1IM2A 1M2EA 1RSZA 2F48A 3V4PB 2GPAA 4B3DA 5KC8A 1RP7A 1TLFA 2B6HA 3R6GA 4EW1A 1N4AA 2CNLA 1N57A 3C3KA 3ZYCA 4E5NA 2PZMA 2F3TA 1V11A 3OX3A 2FA9A 1RHRA 1QO0A 2ZPTX 4M0KA 3F6PA 2IYOA 2E87A 2WE8A 5KYYB 3KJQA 3VSDA 3U7HB 2Y66A 2O1EA 4NK5A 5EUBA 4IV8A 2PZJA 4UUPA 2ZS7A 2A30A 3IV7A 2FR8A 3C8UA 3RSHA 1QWOA 2J0UB 3HNOA 4KPGA 1R0KA 3CF6R 1X7XA 2B83A 1VBFA 4YAOA 4IO1A 1RWNA 3ZVRA 1XQ1A 5HR5A 4JL5A 5A06A 4FFRA 5E1OA 1J21A 1MX3A 3QPWA 5HJ2A 2HL6A 4WXHA 5I8PA 1I30A 2XNHA 2WG0A 3BHJA 4OJNA 1N2CA 5FTMA 3MCVA 3LGXA 5FIUA 4F6RB 3ZBQA 4B82A 5BN4B 3KDAA 1V5IA 3VJMA 1U8TA 1K8ZB 3W8RA 2G1AA 2G76A 4ADSG 1CY8A 2RJNA 4BRUA 3DVLA 4DIKA 3FJ1A 4BFVA 2ESRA 1VLHA 2J0QA 2ZRFA 1ZK0A 1E7SA 4LZLA 4BVKA 1J4AA 4F84A 5JZOA 1WW3A 1BN6A 1TKBA 3L9WA 1SN7A 4OUDA 4RQBA 3THOA 4YT2A 3LUPA 2X77A 3NBYC 3TR6A 2KLBA 3CNNA 3DL4A 3G79A 2I4RA 5IHPA 5A4DA 5FUWA 1KZ6A 3GRKA 1XDBA 2CKMA 5JWHA 1M1NA 2OD7A 1Z8FA 1T1JA 3EW9A 1GU1A 2AQHA 1TUBB 4N03A 4EMUA 1K68A 2IPLA 3BSSA 4EY7A 3R5HA 1P75A 2JIOA 3EMDA 1RYNA 4L8VA 5H59A 5A5DA 3C7CB 3QVGA 3A9VA 1J2YA 1QE0A 2RKWA 3L9XA 4JMLA 5BR4A 5IWAB 1AQUA 4UAVA 5FLYA 4C0XA 1DCKA 1E9DA 3LVQE 4S1WA 2QJWA 4FMPA 3FWHA 2Q21A 3THXA 4Z49A 3M6MD 1WUKS 2WD7A 2FW7A 2XXAB 2FSVA 4MHOA 1AZTA 1GZHB 1DKQA 1E9RA 1LK0A 2WJ4A 1D0SA 2PSSA 3VR0A 3S28A 4BUZA 3LT0A 2J8ZA 3BTSA 1WDTA 3MD0A 4JB3A 4L76A 1WCV1 2UKDA 2BCGY 1XRMA 2QMHA 3LECA 3FOWA 2GJ4A 4BNKA 4DXHA 1ES9A 1YZKA 2OFPA 5T6MA 1GR1A 1R8SA 1A5TA 2YXPX 1YKSA 3H97A 1BE1A 1ML4A 2H9IA 3V8VA 4UCWA 4OI0A 4GMHA 3L1IA 4ZQFA 4YMTA 3FTQA 4FXPA 4DQVA 1C5KA 4O5OA 4RE5A 1U04A 3AJ9A 2R85A 4CR8A 3PPXA 4J07A 1EP9A 4ZC1A 1L6IA 5ADVA 1JLMA 2JAPA 4FIZA 4X8OA 4Y6QA 3FMOB 4V0RA 1BGVA 2EW2A 1HYBA 2A58A 2ORWA 2XAUA 4MV8A 1NOKA 2LP4Y 1MTZA 3UZUA 3W0LB 2Q5HA 3X1XA 3V8BA 3H6GA 5I51A 5E8RA 1ZA1A 3EIXA 4ZPJA 3STWA 3ZQ6A 1SBYA 2EZUA 3IO3A 5HG0A 1NT2A 2VCEA 1KFEB 5E6UB 3H5OA 2Q7OE 2EX0A 1QXSA 3ZWBA 4RXTA 3ECSA 4U3JA 1XLTC 5UKDA 1XJCA 4WKNA 3TCKA 2XB9A 1ZN7A 1DT5A 4Q4JB 4CQMD 2JIRA 1IJEA 3AP2A 3LK7A 4NQRA 4NVRA 4GG1A 4C29A 1FVXA 4OY3A 5H3LA 1QGUA 1DKOA 3UAOA 3WGIA 1QFMA 2OZLA 2B4YA 2AJTA 4YRDA 5EIBC 5H80A 3RRYA 2PUHA 1WCYA 1FPMA 1JQJC 3F3SA 4GI2A 4NBKA 1GGJA 4IILA 4JL8A 4YMIA 1G5RA 5REQB 3SP1A 5MFZA 1R74A 1T5BA 2VJDA 4M55A 1XTZA 4QOJA 5DISB 2Q3LA 3CSDA 3MNFA 1V7CA 3R7NA 2ODPA 3PDJA 4CKYA 5B2FA 1AUQA 2C4UA 3KXDA 4HZIA 3URKA 1N77A 5DM0A 2X41A 4OSOA 3U61B 4B0PA 5ITZA 4LYGA 5BW4A 4KPFC 3MWLA 4GAEA 4D41A 2ZJOA 4XB1A 4M76B 3HK2A 2Z9CA 1WHTA 1Z2AA 3CR3C 1KI3A 1QLWA 2WPDD 1O0CA 1T43A 3U60B 2QPLA 4HLUC 1TA4A 1GDDA 3K2BA 3P0RA 1GCIA 4UHKA 3J7TA 3UUFA 3VDNB 2HRQA 3QFTA 3HZOA 3LVBA 4YTEA 3H9QA 5ALGA 3KB6A 4LHWA 3OQPA 2EIHA 2YJGA 3WR5A 3AVTA 2ZULA 3IVAA 1EQ2A 1Z22A 2WU4A 1OX5A 4KO1S 2XI4A 4CIAA 4FVTA 2P30A 3EVNA 2OYRA 1BYIA 2WFAA 2O7VA 4RMGA 2GLXA 1PEKE 3PXAA 2JVIA 2R6GA 4MRMB 2Y67A 3MTGA 4RL4A 4GYJA 4OYHA 1ULUA 5DH9A 5CD9A 2R97A 1QG4A 1B6GA 5L7WA 3PFWO 3ZE1B 2G28A 5BWLA 1BEUB 4PAMA 3HJNA 4IDGA 2C29D 1RP1A 1V96A 4NX2A 3JD0A 3ZTWA 2XZLA 1S7CA 3DEKA 1YFKA 4G0WA 2VWPA 4I1IA 4RACA 1W5FA 3U7EB 1UT8A 3EWNA 3IAS6 2Y93A 3L4BA 2PMDA 1EFPB 3NHRA 4EI7A 4H6XA 5CHEA 1SKYE 1M5TA 1OUMA 4MLPA 1I4WA 1SH7A 2HWKA 1PFGA 1A69A 3PBKA 5C8ZA 4FTWA 1HDRA 2J9YB 4R01A 3H5VA 4FBLA 1M0WA 3R44A 5ENZA 4OQZA 3UKJA 3GGGA 2JCBA 4MWCA 4G01B 1NU8A 1ZXBA 4II2A 4C03A 2GM9A 4HWPA 1VL0A 4GDMA 1MV5A 4ZODA 4A5OA 4AN1A 2M2IA 1OMOA 1L4MA 1DTSA 2BFNA 3EC2A 3HKCB 1VP9A 2R4TA 5IAJA 4JBLA 3UWMA 5LU8A 3GDHA 4L08A 1R4MA 2H63A 2QD2A 2XIJA 2Y6UA 3PT9A 2XDAA 2HBRA 3OPYI 2IXBA 3IC5A 4JENA 3RWMB 3CB2A 1A96A 1GY8A 2V8OA 1JILA 2G9NA 2XMQA 1KFCB 3BH6A 3LOUA 1ZUNB 3W7VA 1T8YA 1VGQA 2K2QB 2V3VA 4I6GA 5M3BA 4MQMA 2Z4RA 3QPUA 1NW9B 4O5AA 2IOHA 3LFHA 3BSFA 3VM6A 4FCCA 4XGNA 4DBLE 4L02A 3MJCA 1NX6A 3L46A 1XIVA 2XYVA 1GRRA 1YRYE 2G9UA 3L40A 4N1AA 1QIDA 3VR2A 4O02B 2Q4TA 1OX6A 3WRXC 5L53A 1YS4A 3JZFA 4NBWA 4MW5A 4PX3A 4OQPA 4RF3A 3D6HA 3HA7A 1Y0BA 1L5GB 3SBEA 1BE6A 4QYTA 3DFKA 4BCDA 4GWGA 3SVZA 5A4KA 4P5DA 1SXQA 4W5WA 2NU8A 3DGEC 4WNAB 5K8IA 3VZBA 3KC2A 2AG0A 3CPEA 2RD2A 1WXXA 3PVSA 2X9NA 4IIVA 2G5TA 2HA3A 1EVZA 4FILA 1GKLA 1PGNA 3WIDA 4HWRA 2FSFA 4M21A 4G9GA 3A3KA 4BIMA 2K87A 3T7RA 1SA0B 1OXXK 4WLOA 3S3TA 4DQKA 2CNDA 3PR3A 1IOVA 1UFQA 2QW1A 1KGSA 3WNBA 1WD5A 2IDMA 3QE9Y 4DJEC 5G1NA 1X1BA 3UC5A 1KY3A 4YWHA 1V1MA 1BEEA 3QV1A 1E58A 4BVBA 4UKDA 2UUOA 1VLMA 5BW8A 2WF7A 3GO4A 4KVAA 4KP7A 5FOWA 4RLFA 3VHQA 1OV4A 1YZNA 1OVMA 2Z3ZA 1CRLA 2A5DA 2WIAA 4WKGA 3MD9A 2QZZA 2IOFK 3ZV5A 1DFHA 2QT9A 3IAUA 1QP7A 4CF7A 1EHIA 2PZ8A 1ZIYA 4ERXA 3ROTA 3IR6A 3SC2A 4W82A 1A9XB 2H8GA 3FE2A 1KBQA 5LP1A 1YJ5A 3AWDA 1B0ZA 4AZWA 4LNHA 3W5UA 2IYYA 2BR5A 4D74A 4N48A 3MBOA 4QDXA 5FJIA 3L82B 4ZWNA 1ZEMA 3U5TA 3HP1A 2D5IA 1WQ3A 1U94A 2D0PB 2GPJA 5A3VA 3W5IA 4WY5A 4FU0A 1B6TA 3ENQA 3LUAA 1U0NA 2PH7A 2ODNA 4CI9A 1JFVA 2TMDA 3E9ZA 1ZD1A 3DEZA 1YL6A 3IP9A 4EUFA 3JCZA 3OEHA 1C1HA 3CLTC 2V6MA 1D6NA 3I52A 2YRWA 3K0CA 3R40A 5A6SB 1R8YA 5TARA 1G3UA 1NULA 2ZSAA 4ZD6A 3T4UA 2Y1OA 4QPJC 4DA8A 3FDIA 4DTIA 4F2HA 3CUWA 1Z47A 1ZWKA 2WYWA 3K6SA 3DQQA 4HL6A 5LC1A 2GM3A 2G0TA 1G4AE 2FQXA 1QZTA 1CQJA 4GZ3A 2E21A 4ILKA 2WC1A 1OSNA 4BFLA 1RMYA 5GINE 1ISHA 3DBHA 1GQ2A 1GFZA 2VJLA 5DXFA 3HVRA 1W36C 1SR8A 3F78A 3H13A 3PFNA 5BSKA 1Y3FE 1C7QA 3WK4A 1RXVA 3BIFA 1YB7A 4I2VA 3D4IA 3U16A 4JGGA 1E3LA 3FPCA 4FLMA 4MV6A 4WFQA 1DT3A 2NU9A 3KSBC 1R00A 3I6YA 4CG3A 1RYEA 1ACMA 3UCEA 1U3DA 2O05A 3PPVA 2V9PA 1Z4JA 2YOHA 3C3CA 1H1DA 4L8FA 4WCFB 1JQBA 3CNLA 3KXPA 3PQCA 5E0KB 4CR6A 4KO2S 1U5AA 3BIXA 2AKEA 4B09A 4FZJA 3FLEA 4UM9D 3KQNA 3L4EA 1G3QA 1QHHA 1LBHA 1PBNA 3RV4A 1FVOA 1XTPA 2PJUA 2C5SA 3V8MA 3VI4B 4BWYA 2RSLA 4CU5A 1PLJA 3VJKA 3KYIB 4OMUA 1XZMA 4R7ZA 5EUMA 5CA0F 4ALMA 4JKOA 1MOZA 2WT4A 4OK5A 3WGQA 5K0BA 3MJFA 4ZOQI 4GMGA 4EPVA 3I0MA 1U3WA 4O25A 3ETCA 2MJLA 2C4TA 4WA7A 3HYRA 3MWYW 1W30A 1P3JA 2YXEA 3O1IC 1LUAA 2QRVA 3M1AA 4N3NA 4CL8A 1KWGA 2C95A 3U09A 3PEVA 3V4SA 4QAJA 3ECCA 5KYUA 5KYGA 1NXOA 2P11A 3FYUC 3RBAA 2O19A 3A2MA 1LZLA 1OOEA 1LC0A 1YVDA 1E62A 1T1GA 5HCIA 4F5WA 1BFKA 3QK7A 4EG6A 1WDLA 1KI8A 3AQIA 3OBBA 3GVCA 3LY5A 4GC9A 3ZS9A 2CHUA 2BC9A 5K0GA 2AOWA 1ZESA 1I6WA 3DCIA 5T3YA 2R1ZA 1D4OA 3N2KB 2F43B 5EMJA 2O3RA 2VYFA 2QJTA 4LXHA 3D6AA 4L75A 2YWDA 2YY5A 3C6KA 3L41A 4GXQA 5IJ9A 3AHIA 1SXJD 1XVTA 4EB8A 4RTLA 1MDBA 2AXPA 2VRBA 4QJ3A 1WD7A 3T7DA 3KETA 2POCA 4WACA 1C3LA 4B3FX 1V8ZA 2WILA 2IGBA 1E3WB 2RGEA 3IUNA 1XZQA 1PJTA 2JAQA 3MBKA 3QQ5A 4TWRA 4KODA 3T4XA 4D9FA 5JVDA 1FW6A 3H3XA 1QGAA 4G5XA 1C29B 1K08A 1T9CA 3HR7A 4MQFB 2REXB 1E92A 3E5RA 3FI0A 1P91A 2VT3A 2QUJA 1R6TA 3GYBA 4OQXA 4F4DA 1KERA 3L1JA 1RJWA 3VJLA 1G0OA 5I9BA 3RVRA 3CH6A 3O21A 2ZW9A 4X94A 4ND4A 3D4PA 2FE4A 3WICA 4C0BA 3A06A 4PFQA 5IYZF 4R4JA 2INGX 3QMWA 4M4SA 3UB2A 1L3BA 4KI7A 4MW2A 2ZTHA 4Y2HA 1HTWA 2EJTA 5K3EA 4CPDA 1USUA 1JIKA 3KJIA 1RT9A 3ZLTA 2EGHA 1TE2A 1U8AA 2YNMC 4XXHA 3ZLUA 4E7OA 1BWSA 3AY7A 1ST3A 2EYQA 1BZYA 1U2EA 2JLXA 2X5NA 2AMLA 4O2AB 1ML3A 1JDBC 2WZQA 4XJXA 4HDSA 5I4CA 5JHGB 5ER6A 2WE7A 3G8YA 1EHYA 2VSOA 2ZRNA 3BYZA 3DHVA 4HWGA 1X7YB 1ZNZA 4C3OB 5TSDA 5TQJA 1QAMA 2QDXA 4CMBA 1FDVA 2QQ0A 4E2FA 5CLGA 4OHWA 2OBNA 5T8KA 4EAAA 5C5EA 1GA4A 2CXNA 4H7DA 4U5QA 2CFRA 1JNXX 1SCAA 4QBKA 4X00A 1ZDMA 2VHUA 3O7WA 4P5PA 1Z39A 4YJ3F 3ABQB 3JTMA 3CVWA 2O2CA 1WV0A 1V26A 3UKOA 3ZDFA 1LLQA 3NBXX 4MW7A 3F5FA 1K88A 1HT1E 2XXJA 4UULA 3GJQA 1L5QA 2P5YA 3ANY