2HJVA

Structure of the second domain (residues 207-368) of the bacillus subtilis yxin protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
TTRNIEHAVIQVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase dbpA
publication title Structure of the second domain of the Bacillus subtilis DEAD-box RNA helicase YxiN.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2006-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hjvA00
2H5EA 2W0SA 5JJIA 5DH9A 421PA 4AKIA 1UBFA 2EW1A 4KI0A 1H8HD 3CF6R 2O0KA 4O2RA 4PC6A 4US1R 1JXMA 1FP6A 2HEIA 4RZ2A 5F3WB 2CCJA 1T8TA 4QXAA 2DFKB 4OYHA 4TMKA 1E2KA 1WE2A 3OEHD 2RGCA 5DSZA 4RFSA 1VYTA 1MRNA 3EXAA 4TLCA 3C14C 2VSOA 2QPTA 4Q4JA 1Z6GA 2QI9C 1GRRA 2OZEA 4B3CA 1ANKA 1E2HA 2FF7A 1Z6XA 2AWNA 3RLFA 2FN4A 2IWHA 1P2UA 1N6IA 4JJZA 4Q4HA 2EFDB 4A0RA 4J0QA 2ZAOA 4LJ7A 4NONA 4CVNA 3ZVNA 5FFMA 2WPDA 1DPFA 4G0NA 2BCJQ 4GOJA 3U61B 2WAXA 2GETA 2VP5A 3AM1A 4NP6A 3WBKA 1P60A 1Z0KA 3C8UA 4LBZA 1YZNA 1H8ED 3BC1A 3AGQA 1E99A 1M8PA 1QZXA 5G41A 4G5OA 2WWFA 3E70C 1EK0A 1IXZA 4ABYA 3TAUA 1QVRA 2XZLA 4PR0A 3P32A 4AC9A 1TU4A 3NKVA 1ZD8A 1K6MA 3HWSA 4RFSB 2VP4A 4FMCF 4U00A 2V1UA 1FQKA 1N2CE 4QOSA 5JHGB 5FBWB 4GPTA 4Q4JB 3TW4A 1CRPA 1DS6A 3K0CA 1NBMA 4M1OA 4CGZA 1D2MA 1X1RA 2OAP1 1NIJA 3W8NA 2P6NA 1B23P 2PZFA 3JVUA 3QBTA 1PLKA 3WHKA 4RZUA 4NZYA 4Q4HB 3HPQA 1L2TA 2DYKA 3A8TA 4HLUC 2FE4A 3RRZA 3OFND 4KODA 1XWIA 3QE0A 2PX3A 1Z0FA 3CPHA 3A4MA 2DWPA 3IUYA 4QG7A 3LX5A 2ZU6A 2CVHA 4LUCA 4PC3A 4Q9JA 5BW8A 3BD9A 2K5UA 3KXKA 2FPLA 2FPKA 3U3OA 4URUR 4LV8B 3ZS8A 4Q9HA 1Z0JA 3U3MA 1OFUX 4FCVA 2CL0X 4LYJA 2DWQA 4M1YA 1KYIA 2JEOA 2NOAA 3EASA 3TE6A 4BLSA 1EX6A 1Z0IA 3LO5A 4WA7A 5JI2E 5GJCA 2YWHA 4Q21A 4RKFA 2A5YB 2R6CA 3M1IA 4ZKEA 1D2NA 3C7KA 4YDSA 1CU1A 4PPQA 2YNMA 2GVDC 4GMXA 5FPYA 3R9IA 3DM9B 1EG7A 1EFRA 4YXWA 1KHTA 4HAUA 3CH5A 4LSGA 1DOAA 3AF4A 4DCVA 1N6LA 3KQLA 1GFIA 4AD8A 3GJ6A 5EZ5A 2C2HA 2HYIC 1WDTA 2P2LA 3ZJYA 1QG2A 3D3QA 4C0JA 3FWYA 2ZS7A 3LA6A 3W34A 3N2IA 3LV8A 2RGEA 4XSGA 3VR3A 4PSAA 4DZZA 1Q12A 4AG6A 2F9LA 121PA 2ORIA 3BE4A 3TR5A 4M8NE 5FBQB 1S8FA 4QL3A 2AK2A 5JJLA 4URXR 5EUQB 1Z5ZA 5KDOA 5KSPA 1L8QA 4DSTA 4OBEA 2B8WA 3GJ3A 2GJ9A 2ZYTX 1SULA 2R6FA 2EQBA 4RD4A 3VMFA 2XITA 4XWOA 2J41A 2P5TB 4XVRA 1D8TA 1QHXA 1KGDA 2BMDA 3ND8A 4NYMQ 4IFEA 4TTPA 3RRYA 3L0SA 2GTPA 4A9AA 4H1VA 3UG7A 2F43A 3W3ZB 1QDEA 1XD8A 4LHVA 2G88A 2H92A 3EW9A 2OXRA 4F4IA 1GSIA 3T12A 1W0KA 3RHFA 5L3VA 2VP2A 2AFIE 3WYFA 3QI2A 3QVUA 1IHUA 3K70D 1HT2E 3AVWA 5KHOC 1ZUIA 3FFBA 5GJWC 2XB4A 3PEVA 2ZYUX 4UNRA 1VCIA 3SU8A 1RPZA 4ZCIA 3FMOB 2R44A 5KNCA 4PZYA 4U02A 3NDPA 5KU1A 1VCNA 4F4JA 2VEDA 2W6IA 1ZJ6A 3BH0A 1NSFA 3MRSA 4CEJA 5IT5A 1N5JA 5TVKA 3BORA 3AKYA 2BC9A 5EE1A 4G5SA 3S1AA 1DARA 1CP2A 1ESNA 4KBFA 1L4YA 2J59A 1P2TA 4DVGA 2BBOA 2R62A 3IIMA 2A3RA 3TMKA 1HTWA 2IUUA 3U3RA 3BFXA 2F43B 5D3QA 1I2MA 2N1BA 3VFDA 2ZUBA 1HUQA 3KJIA 2UKDA 5FI0B 4C0SA 1VG1A 4W5WA 5E95A 1T3LA 2H16A 2QSZA 5FBRB 3HJNA 1DO0A 1KDRA 3Q5DA 1NY6A 2ODEA 3T1QA 3UMFA 2WAYA 3C15C 4B33A 2GILA 2O52A 1HEIA 1TAGA 3EZ2A 4CEJB 4AY2A 3LRPA 3KKNA 3THWA 2WVJA 1XP8A 2C9CA 1R8SA 4I1UA 3S1AB 1P3JA 4OKSA 5H8WA 2QAGC 3UMRA 2ZJOA 4ZCLA 1Z63A 4LHYA 5BN3A 5K8IA 4JL6A 5G53C 4DLRA 3CR7A 1NBMD 3FHCB 4L9SA 1EWRA 5JHHB 2IS2A 2AL7A 2R65A 1XEXA 3VKHA 5CJ2A 4RD2A 5C4MA 4MYHA 1IXSB 1KKLA 3BB4A 2HF9A 4FMDB 4HSEA 3IO5A 3EPLA 3GJ7A 4ZPXA 4GL2A 3HDTA 1LV7A 4NCHA 4C30A 2OCAA 3ZZ0A 3W6NA 3U2QA 3WP1B 1P2SA 2IHYA 2IUSA 3SOPA 2XTNA 2MSDB 3KJEA 2D4HA 4BLOA 3EZFA 1Q1BA 3AVOA 3PVSA 3K70C 2J5XA 4M1TA 4HB0A 1UM8A 1IN4A 2W2TA 3PENA 4G3XA 1W36C 1O3YA 4UJ5A 3Q85A 1DG1G 2Q21A 4JLBA 3THWB 4TSFA 2KBEA 1WF3A 1NMZA 4Q7MB 1YR6A 5A0FA 2F1HA 4XIGS 3PEYA 3WXMA 2J0SA 2C99A 1D2EA 3A1VA 3ASYA 3ZIAA 3P4YA 3ICQB 3Q9LA 2Y8EA 1II8A 4B6FA 5L3RA 5JWHA 3F0TA 4B44A 4PPFA 5C1BA 1U0LA 1XEXB 4F93B 5BYKA 2J45A 3GJXC 4JVNA 2CNWA 4LBYA 1Z83A 3I61A 1P9WA 5JWOA 1EFRD 1XEFA 4YXWD 4FD2A 1KAGA 1KO5A 4OL0A 4ZI2A 2GZAA 3QOFA 4ZO4A 5H70A 3SYLA 5JCZA 4TYNA 5CDFE 2W2VA 2V8OA 3CB4A 2MSCB 2MMGA 1ZU4A 2FZ4A 4O0MA 3Q3JB 1R0ZA 2F7SA 1EFTA 3I72A 5AUNB 4JBXA 3DVLA 2Z5FA 3EPKA 1E1QA 1EFUA 3IHLA 4MGZR 2OE2A 1E2FA 4TYQA 4A8JA 2IYRA 2JLUA 1E0JA 4Z1MA 1YR7A 4DUGA 1GUAA 1X8LA 2ERYA 3CKLA 2ZRAA 3MJRA 2RHDA 3QKTA 1II8B 1OIXA 2XAUA 2JGNA 3DZDA 4HB2A 1VIAA 4FINA 4KLNA 4CT4B 4BZXA 1G7CA 1DAFA 4JLKA 1SQ5A 5FUWA 3RRMA 4L9WA 3EAQA 3LBIA 5B58C 1DTSA 2ZSDA 3TRFA 1UKZA 1LF0A 1JXOA 1GNQA 3H2YA 4Q19A 2GF0A 2GBLA 4M0LA 4QNRA 3JZMA 3VR6A 2BBSA 3CX7A 1FTSA 2FU5C 2HCJB 2GCOA 4XH9B 3J81k 2JJ2A 4PQFA 1W0KD 3TGPA 1WBBA 1KO8A 4C2UA 2F6RA 2IK8A 4LC1A 3L43A 1G8GA 1P9RA 3QKSA 4URZR 1R6BX 3BH7A 1GOTA 2FG5A 3MCAA 1G3RA 4JLVA 5FL7A 2H18A 3MWYW 4A8JB 2FFAA 4TL7A 4ASUA 1E79A 5EJEA 2W6ID 4KYUA 2H7VA 4WXRA 5EZ6B 1E0AA 3BB1A 2OLKA 4B34A 1OJLA 1HQYE 3KFXA 3OIYA 3B9PA 4CYMA 4UXHA 2WJYA 3TR0A 3NBZC 3ETLA 3MG9A 1KI7A 3D8BA 4LCBA 1ZM9A 3NG1A 3P4XA 2ZRLA 2RGXA 2VP6A 3A58B 4P3YA 4Q48A 2J0UA 1UDXA 4URYR 1M1YE 2D3WA 2GCOB 1TU3A 2GNOA 3NWJA 2F3TA 3RS3A 1ODFA 5JSZA 4KU4A 1N0UA 2ODBA 2YHSA 3UK6A 2W00A 4QBIA 3QKSB 2GXAA 1IY0A 2RKOA 1KI2A 2FFBA 2ZRNA 3FKSA 3I8XA 5LDDC 2NMVA 4WZ6A 3U7HB 4QBHA 3WNDA 3K0FA 2C9OA 4A36A 1NBME 4CRWB 4RCYA 1A7JA 2GJKA 4M1WA 1I4TD 2MMCA 2KI5A 4D0GA 2OCBA 3FE2A 3QKUA 1NI3A 4EFMA 1Q1EA 4QC2A 4OI4A 2IYQA 2OUKA 1NVWQ 1YKSA 4JBYA 4BASA 1OFIA 4O2LA 1M34E 1S1MA 1ZIPA 4NYJQ 4WOPA 3SJZA 3FKQA 3SR0A 4DHEA 4EPYA 1TQ2A 1X8JA 1ZC3A 4MQBA 1G18A 4DCSA 2WJJA 1ZCAA 2G6BA 1S3SA 2OBMA 2J0UB 4JS0A 4HLUA 3CZQA 1E0KA 4R2IA 3KXIA 2PCLA 2A7QA 1NG1A 2Q6TA 1SHZA 5JSZB 2N46A 2UVQA 4B48A 3LVRE 1LTQA 1XRJA 3W3AA 4ESHA 2WSSA 5HZHA 2D74A 1PUIA 4G5QA 1XTJA 4NU0A 2A5DA 3BFVA 3QXXA 3CRVA 3LQQA 1H8HA 2ZPTX 3K0FB 2FH5B 1V43A 2Z6VA 2IEZA 5D3MA 3AP3A 2EFGA 1XMIA 1OXVA 1CJMA 4QJ5A 1VTKA 1Z2CA 4YQFA 2PLFA 4LC0A 3TAHA 1R7RA 4TSFD 3BJIC 2ATVA 4HZIA 3RABA 3VX3A 4BFYA 1G19A 5FUYA 2C95A 2X2FA 3ZIAD 3OEHA 5CIQA 3T15A 5CB8A 3P20A 5ELXA 5B57C 1KJYA 3V4RA 2NZJA 5DI9A 3KQUA 521PA 1IY1A 4PC2A 4FI3C 1ZUHA 4ARZA 5KSYA 2CNWD 4M53A 4HYYA 1G8FA 3W5IA 4TZ6A 1GAJA 1VG8A 5JRJA 5J4HA 3AF0A 1MO5A 2IS4A 3CWZA 2QT0A 4HB3A 1BYIA 3T61A 1TF7A 4IDHA 2IA5A 5JBQA 4C2TA 3CNLA 1KSJA 3ZVRA 2NO1A 3AUYA 4XTCS 2OFOA 1G3QA 3Q7QA 1KI6A 2Q9CA 4RD1A 3FYHA 3CF2A 3OHMA 5D3MB 5EP3A 4L4UA 3MLEA 3O8CA 2PT7A 4A2WA 4JYBA 1E2LA 2WWHA 4IOLA 5GJBA 1FP7A 3W5JA 1E1QD 2BKUA 4NTZA 4BGDA 1KZ7B 3NTUA 4IOMA 2WWGA 1IN8A 3LH5A 4NYIQ 3W8RA 5B64A 2QP4A 1NKSA 3R20A 1J8YF 2WKQA 3H84A 2VRWA 4FMCB 4GFDA 2ATXA 2JDIA 2P6UA 3TUZC 2ZTSA 4FXPA 3QPWA 3BK7A 4URWR 3BOSA 2WWIA 1HV8A 2QUZA 3A4NA 4CF7A 4F7WA 4ARZB 3PUVA 4QM7A 1Z2AA 3L0PA 5G40A 3EPJA 3GPLA 3QKRA 2CDNA 5DE3A 1ZD1A 2BMFA 2ZI7A 3DZ8A 2EFEB 3LD9A 1ZRHA 2CVFA 4L15A 1KK1A 2BM1A 4TYWA 5EP2A 1QF9A 1OXXK 1KI6B 4V0NA 4M1KA 2IXGA 3IGFA 4WW0A 4EKDA 1Y63A 4AURA 2QP9X 3AGPA 1CIPA 1A2BA 4US2R 3U4QA 4ACAA 5FL7D 1NLYA 1R8QA 2ZI5A 4FW9A 1XPRA 2VP9A 2ZS8A 4ASUD 4RCZA 1E79D 1PLLA 2IUTA 3WMGA 1OB5A 1II0A 3E1SA 5DIFA 3GJ5A 3F5FA 5K8UA 5GVSA 2ZM5A 3IILA 4OK5A 1ZINA 1RE0A 3EA5A 4QGAA 3JVVA 1Z22A 5HR5A 1PV4A 1DAEA 1J8MF 1HE1C 1N25A 3BXZA 3QKRB 2JAQA 2AX4A 4DLZA 3U7FB 1OFHA 1NF3A 1N5LA 1OXUA 4XVQA 4B2PA 1Z6TA 4TQUS 4IDQA 2XEXA 4RVCA 3QPVA 2FJUA 4A0HA 3B5JA 1Z29A 2ZJBA 4NBSA 1M7BA 1M2OB 4BFZA 2PBRA 3CPJB 2F55A 4W7SA 1NVVQ 2D62A 1Z6YA 4P32A 4AI6A 4KYIB 4LYFA 4DLYA 3FKSD 3U4QB 2XB2A 4CDGA 4HAWA 3WP0A 2ZRDA 4D0LB 1R0WA 1G3MA 3CM0A 2JJ1A 2IX3A 3V4FA 1Z6AA 2ZE7A 3WNBA 2QAGA 4B3XA 2GJAA 1RYFA 3K1JA 3RDPA 3ONWA 1G3UA 1RRGA 2AXNA 5CDFA 1XNJA 3SJCA 3UWKA 3FMIA 4UKDA 2I4IA 4IDNA 1D9ZA 4V03A 1XCGB 4B71A 1PVOA 4B3BA 4D6PA 2O0HA 1R5BA 3EG5A 1JJVA 2IEYA 2OBLA 3JZAA 4R2HA 2GK6A 3PUZA 4HAZA 3UMSA 1GM5A 4P4UA 1EFHA 4C0BA 4W5JA 2GXSA 221PA 2ECKA 3LXRA 3CW2A 2KJQA 2REBA 3QNUA 4B2IA 5FR2A 1Z28A 1ZU5A 1CJTC 3NBYC 1XJ0A 1KKMA 1W5TA 2C77A 3RC3A 3SDZA 1XTKA 3TQCA 1VHTA 4DCUA 3SI7A 2WSSD 5JCPA 5JJKA 2YOHA 1YZGA 1G16A 3U6KA 1YZLA 3AVPA 1RRPA 3RWMB 2OAQ1 3SZRA 1OXSC 1KDTA 4XSHA 3K8YA 2ZI4A 4HZUA 5EE5B 2QAGB 4HLDA 1TTTA 3A37A 1RRFA 4KXFB 5M04A 2QROA 2DPXA 3QEJA 1LS1A 1BO6A 4DBLC 5EXPA 2F1RA 4Q9LA 3KXLA 1ZAKA 1J7KA 1E2PA 1AN0A 1XB2A 1P5ZB 2FOLA 1Q22A 3BRWD 1XPUA 2RB4A 1F2TA 1U2RA 3KKPA 5LB4A 4DDUA 4BZQA 4ESVA 4ON9A 3IO3A 2R8RA 3AKCA 3EZ9A 4GMDA 3A1WA 3B7GA 1G1MA 4A0FA 1JPNA 3PUWA 3RNLA 4M9XA 1T4GA 3Q72A 3PR1A 1NN3A 1Q0UA 4OHVA 2GEUA 4XTRA 1AJEA 2B8TA 3MAAC 4EIWA 4KITB 3K70B 4C0KA 1W36B 2PL3A 5FBVB 4ZKDA 2A78A 3TW8B 1I4DD 3AVXA 2YC4C 1T9HA 1YU9A 2LKCA 2OXCA 4HZUB 4LK2A 2AD1A 3GP8A 4LBWA 3QQ5A 5TDHA 4KFRA 1AKYA 4JKIA 3VR4A 1R10A 3ADCA 2OBNA 4D82A 1MT0A 3DL0A 3RS0A 4G1UC 4R7ZA 1GNPA 2QPOA 4L5BA 4IXMA 1P62B 1E2JA 2JDID 4Z54A 1NMYA 1F2TB 5FTNA 5AJYA 3SYKA 4TLDA 4C0HA 2A2ZA 1W2HA 4O25A 4BFVA 3ZZUA 2R6AA 4DDTA 1AS2A 4W9MC 4HATA 1QBKC 1ZVQA 5H68A 3KUDA 1ESMA 2O8DA 5CM8B 3TIFA 4RZ3A 1GVNB 1ZM3A 3I62A 2B21A 1OB2A 1PUJA 1E69A 3RAPR 4N0DA 3LVQE 4ZCMA 3VNUA 3HU1A 3ADDA 4OQXA 3FTQA 1YRAA 3OAAA 4M4SA 2QE7D 5BWMA 5HPYB 2OESA 3ICEA 1E98A 1XU4A 1A1VA 5BN4A 2WWXA 2QGNA 3EC2A 1N6OA 2C04A 3UIEA 2QEQA 4JSYA 4Q1DA 1LF5A 1QHGA 3CWQA 2YINC 1QHYA 4Q02A 1WB9A 3R9WA 1AGRA 2CXXA 3THOA 1JAHA 3CZPA 2LWIA 5FTMA 2O8CA 5FUXA 4B2LA 2VF7A 3X1DA 1CKEA 3IEVA 5EXXA 1UBCA 1AIPA 2RGBA 3AP2A 1CEEA 5DYGA 4MKFA 4PHGA 1NG9A 2O8DB 4LI0A 2FGKA 2CBZA 1RKBA 4DLTA 2CE2X 4IEIA 4RD0A 1T0HB 1DBSA 1LFDB 4EJSC 4Q9IA 3HPRA 4FIDA 4P4TA 1FNNA 3CUEF 5FTLA 1SGWA 4GZMA 4NL4H 2GKSA 4R9UC 2NO9A 3T1VA 4YMWA 4B76A 1XCMA 2VHTA 4Q1FA 4AKHA 1QHNA 3I8SA 2OSBA 3DKPA 3GLFA 3REFA 2JJ1D 1KSFX 2BEKA 2XZOA 1KSGA 4PXAA 3BAFA 721PA 2CE7A 2FFQA 1Z0AA 2RGNC 2IYLD 4NCKA 4WVFA 3NHBA 3D31A 5SZHB 1QHIA 4MKGA 2DFLA 3TSOA 1XTQA 4MGKR 1HY3A 1MR3F 2QQEA 1NIPA 4CIDA 2O8CB 2JJ8A 5JI3E 2CEAA 1E9EA 4IVRA 4IOJA 2VBCA 4KVAA 4Q7JB 2ZSEA 4BE7B 4PTLA 1T6NA 2VA8A 1FMJA 3NH6A 2FA9A 4S35A 1FQJA 1COWA 3BERA 3FHOA 2YKGA 3EZ7A 1KAOA 2RCNA 1E9BA 3DDCA 4OQNA 3QIAA 1XZQA 2BHRA 5LPNA 3L8YA 1W36D 1LW7A 2W83A 1Q44A 3KQHA 3GLFB 4XVUA 2YWEA 1OH7A 4V0LA 4KJZA 2QTFA 2QT1A 3BFKA 4B32A 4E07A 1MV5A 1I4LD 2O8FA 4IJMA 4RD6A 1R0XA 4QJ3A 1OIVA 1P75A 2V55B 2ZANA 3KJGA 4TZ0A 3WHLA 2V4ZA 3GCGA 5AK0A 2V7QA 1M7HA 3GD7A 1G4AE 5IK2A 2OHFA 3RANA 1G8HA 1SVIA 2QRZA 3KL4A 4KLZA 3K9NA 1ZNWA 2DHRA 4P33A 2NTYC 3GLHA 4ACBA 2Q0HA 3OIVA 1TX4B 2ZE6A 1XMSA 1ZMXA 4C9BA 3EX7C 4K81B 1HURA 3B1WA 2Z43A 4NYMR 3NEYA 5JWRA 5TARA 2PEZA 2JLWA 1JI0A 3UXMA 1KMHA 4JIMA 1ZUNB 3HU2A 5G3YA 3K09C 4P0TA 4UNQA 2NO6A 3MWLA 1E2EA 3OF5A 4IFBA 5FOXA 3TVTA 4C0QC 4HDOB 2IS1A 2ZYVX 4HI0E 1JPJA 3A4LA 2G83A 3SBDA 5K8LA 3FGNA 2O8FB 2P67A 4Q66C 4B6EA 3DO6A 3VHXA 4DSOA 2CCKA 2ZETA 4TN1A 1U9IC 5DLQC 2LCFA 3U7EB 2QMOA 3WYAA 5CITA 1ZNXA 2NG1A 3VTKA 1DAHA 3RS2A 3EARA 4GDFA 2BBTA 1E0SA 2CJWA 3A36A 3KFVA 1SKQA 1ZNZA 1R5OA 2ORVA 1D5CA 4UXJA 4HB4A 1E9AA 1GP2A 1M6NA 1NVXQ 1S9HA 4RY2A 2WM9B 3GLHB 3QXSA 1UFQA 3I32A 4TQAA 2ZRBA 1NY5A 4TT3A 4X8LA 4OI1A 4B3DA 3P26A 1C1YA 4R71A 1AK2A 4DLWA 5IHPA 1G17A 821PA 4PAQA 5B30A 1W44A 1TUIA 3AH8A 4Q1CA 4D80A 4Q47A 2KB0A 4EDHA 1XBTA 3MUFA 1GTVA 3KUCA 1KMHB 4HLCA 2Q3HA 2YZ2A 3LBHA 4CT5A 4BQSA 4DCTA 4JLNA 4KBGA 1G291 3NIBA 4DLSA 3B82A 1CRQA 4TYYA 4BFUA 5BXQC 3OAAD 2OLJA 1EWQA 3I4LA 4PHHA 1OV4A 4HDCA 4P31A 1RIFA 1W0JD 4MDFA 1M7GA 2V1XA 3WNCA 1KSHA 5FR1A 4JVLA 2GHIA 2WOJA 2WZQA 3A1TA 4LJ9A 3UG6A 2CJWB 2P5SA 4DWJA 2J7PD 2BIFA 1YZKA 5DHAA 5JRZA 3VKGA 4MA4A 1Q21A 1JR3A 4BFWA 2EU8A 4D2IA 2X8AA 2WWWA 2NO0A 3B2EA 3BB3A 4PSVA 5P21A 2ZSBA 4K46A 1AZSC 3AV0B 2C5LA 4DDVA 4DLVA 1T91A 4LV5B 3VR5A 3SQWA 4KSBA 1NN1A 2PZGA 3AF3A 5SZKB 5C18A 3U3JA 4TLAA 4BUJA 4BECA 3DM5A 2VHJA 4KHZA 3WRYC 1UDWA 4D0NA 2PZEA 2IT1A 3AF1A 1TF2A 1QHHA 2B7CA 2R9VA 2WJHA 4IOKA 3TKLA 2N42A 3ND9A 2QP3A 4YONB 4PPNA 4F38A 2O0JA 4LWZA 1ZNYA 2ASEA 5L3QA 5TV2A 3R7WA 1P9NA 5EE9A 5CIWA 4LHWA 2GZDA 1TL7C 1E32A 4FCTA 1W47A 1Y3AA 3GJ8A 3PUXA 5KPDA 4AK9A 1KMQA 2BMJA 1U8ZA 1KNQA 2YOGA 3EIEA 4PO8A 2HXYA 1WMSA 4LDJA 3TVDA 1OW3B 5DYIA 2A5FA 3GFTA 1NSTA 4LX0A 4ZDKA 3THXA 4LJYA 1XMVA 4C0AC 2DR3A 1COWD 4IW3B 2QORA 4WZBE 3AVYA 4PC1A 1KOFA 3DEFA 2E9SA 1TUEA 2J87A 1WBDA 4DJTA 1WA5A 3NBFA 3CRW1 4JL8A 1QHHB 2G3YA 4OHWA 2GJSA 3FVQA 1G3IA 2ZRIA 1SHKA 3PCRB 5EE3A 4OHZA 4NCJA 1CXZA 1GIAA 1QHSA 3AP1A 3N2EA 4JVSB 5L3QB 3R7WB 1W48A 4TWZA 1BKDR 1OKKD 4AKEA 1XCPA 1OF1A 2HJGA 3DPUA 4PANA 4PZLA 3AVTA 3VX4A 4HUTA 4LZZA 4IKEA 2OEPA 1Q3TA 1OPXA 1UEJA 2RGGA 2XX3A 3U44A 3O8BA 3SN6A 3WYGA 5IK2D 2V7QD 1OH6A 2QPAA 2QMHA 1NMXA 3PEUA 2WSMA 4LJ8A 1N5KA 1P73A 2V6IA 1XD2A 5FPSA 2XOKA 3ZDQA 1Z0DA 3IEUA 2HDNB 3KKMA 3THXB 4LRWA 4Q4AA 1X8KA 3QVVA 3MJHA 3IBGA 4OI2A 5DN6A 3QXJA 2RGAA 3NHAA 1RYHA 1RW4A 1VHLA 3GQBA 4MITA 3QPUA 2F1IA 5FOSA 3WMEA 2J1LA 3IPXA 1VMAA 4Z8YA 3VHLB 1NNEA 1G9XA 1NKTA 2OG2A 4MYUA 3FOZA 2P6RA 1E3MA 1FL9A 1KIMA 4Q00A 2HCBA 5E7MA 3G5UA 5FTKA 2IBMA 1BS1A 2BV3A 3CNNA 2CMKA 2KSQA 2ZI9A 2JLYA 2G77B 1E6CA 3Q7PA 2YWFA 3U44B 4GNKA 2XJ4A 4A4DA 2CLCX 1OIWA 3FMFA 5HKKD 2ZSFA 2WMOB 1XD2B 4TT3D 1LNZA 1CR1A 4F4CA 4N3NA 4Q4AB 3CIOA 2ZJ2A 1Z08A 4Q18A 4V0OA 4EPRA 4PHFA 3O8RA 2H17A 3U3KA 1VCOA 2AN9A 1JQLB 2QMUA 2P3SA 4P4SA 2FMXA 3KX2A 4EPWA 2ZRFA 1JJ7A 3NH9A 4M21A 5C4GB 2YOFA 4Q5IA 3CONA 2G0TA 3IHWA 3T1OA 1YR8A 4PO1A 4V0KA 1B0UA 4I1VA 1W7AA 4Q9KA 2V6JA 1MH1A 3SJBA 1GRNA 2IHBA 2P0EA 1X1SA 2UZIR 1OLOA 4NE2A 2GA8A 2RH5A 2VLIA 4X8HA 3IDQA 3B1XA 3IIKA 5C2JB 1A2KC 2XSZA 3A6PC 8OHMA 1LVGA 5AWFC 2C9YA 4XOIA 1OT3A 1D9XA 2D06A 2IF2A 4KO8A 4PAMA 1F3OA 2ZRCA 2QTVB 3FPAA 3GFOA 4GOXA 4MUAA 5DNYB 1AM4D 1JR3D 4LV6A 2WIBA 4KFSA 4QNMA 3GJ4A 4M9SA 4C7OA 4JLAA 4NYJR 4H9GA 1HH4A 4HAVA 2PEYA 4EJSA 3T35A 2VH5R 3GLFE 5KPJA 3LX8A 3RSLA 1GZSA 1US8A 3ASZA 4P4SB 3K53A 4Q01A 4BPBA 4YLGA 2FZLA 3K0EA 2XGJA 4M9ZA 3C41J 3T5GA 2PMDA 2GRJA 2JASA 1OHHA 3AVVA 5A5GA 2BDTA 3TBKA 2RGNA 3SHFA 4MRRA 4Q03A 621PA 1T3HA 2ANBA 3ZLJA 2GZHA 2ANCA 2BCGY 1YZQA 3G82C 1DAMA 4YC7A 2ZR7A 3TH5A 3ZVLA 1BMFA 5IDVA 3SYNA 1SVMA 1E2IA 5JECA 2R6DA 3Q5EA 3B13B 1G21E 1AS3A 5FUVA 3IBYA 4C7OB 2VIIA 2D2EA 2QENA 2G0NA 4EJSB 1CBUA 1S4QA 2CL6X 2FEMA 4Q1AA 1ZYUA 1US8B 1BIFA 2I1QA 4Q7LA 2V54A 2VO1A 4TYPA 2Q9BA 5FL3A 1KI1A 2JLZA 1EFCA 1CR0A 1SVWA 2Q3MA 2VSXA 3UANA 4PC7A 1DAKA 1OE0A 4F92B 5JEDA 4JLPA 5FI1B 4D4KA 1U94A 5FBLB 1T8UA 1VYUA 1WP9A 2QE7A 4DKXA 3I92A 1XF9A 2A5GA 1JBKA 4OQFA 4WBSA 3KQNA 2BEJA 3GLHE 2WKPA 3HU3A 4TL8A 1JALA 3CRRA 1E9FA 3LW8A 4KFTA 4NDZA 1XXHE 5LD2C 1XDBA 5ANRB 3C4JA 2ERXA 1HE8B 1N6PA 4LOAA 4NYIR 4TL6A 3R8FA 2PJZA 2ZRKA 3GLGA 1UEIA 3BH6A 1G41A 3VR2A 1E9DA 1WQ1R 3PEWA 1UJ2A 1BH2A 2X2EA 2Z0MA 3DKVA 4NHOA 4E5UA 3EWSA 2EVWX 2PMKA 2BOVA 1Q20A 2WJIA 3TUIC 2XOKD 1Z06A 3NVAA 2XNDA 2HLDD 3PXGA 4EFLA 4U5XA 5GADl 1P72A 1ZM4A 4BWYA 2PJRA 2FEOA 2AKAB 2R2AA 5DN6D 1U8YA 2PX0A 4DIEA 3K09A 5HE9A 1AZTA 4DC9A 2ZXUA 5F98A 1FFHA 3B1ZA 4JBWA 1KJWA 4KSCA 3LFUA 1AA9A 1FNMA 2L0XA 1UAAA 1JEDA 4JYCA 3O47A 4B47A 1VG0B 3ZZTA 1U9IA 2VL7A 3CNOA 2BVNA 5TY0A 1E1RA 5L3SA 4HDQB 2O8EA 2ZUCA 3ZD7A 2E87A 4IHQA 4LHZA 4OQLA 2WKRA 4HAYA 2FSFA 5E7IA 2C8VA 5FTJA 3GLGB 1AQYA 3QBVA 4UJ3A 2C03A 1GWNA 4NH0A 2QMEA 4IVQA 1E2DA 5J5CA 4OK3A 1U99A 3HR8A 5EQTA 1TF5A 2W58A 1RVDA 1G7TA 1CJKC 1U90A 4DXAA 1G5PA 4MRNA 3X1WA 4M22A 1FUUA 3WMFA 4BRUA 2AXPA 5F2EA 1KZGB 1NN0A 1P2VA 1MO4A 2QGZA 2ZRHA 4JSTA 5AJXA 2JLXA 1ONBA 2CLSA 4AWXA 2AWOA 2ONKA 2XNSA 1ZIOA 2IF0A 4EPTA 1GL7A 5E7JA 3H86A 1E4VA 1JR3E 2D7CA 1VDZA 3N5CA 3ZYCA 1NVVR 5L3SB 1J90A 1F2UA 1Q1ZA 3CLVA 1P7CA 2I1VB 3KZ1E 2D2FA 2O8EB 2HT1A 3EIHA 4QFMA 3V00A 3RRNA 2VHUA 4FN5A 4QHYA 1S0UA 2AR7A 1L7VC 2XSZD 3I73A 4V02A 3B78A 1OYYA 1CF4A 5GVRA 5KNBA 2DCUA 3PIRA 1O87A 4LGMA 3IKJA 2BBWA 4B43A 1GILA 3NXSA 2GDJA 4TMXA 3P27A 1CR4A 2J0VA 2DBYA 3PQCA 5AR1A 2ZITA 2XTZA 1R4AA 2SHKA 3IIJA 4PQYA 2DFNA 2NPIA 3K9LA 5FOWA 5IF9A 2VSFA 4BLQA 3QEOA 2ODWA 3FFAA 1PLJA 3W6OA 3HP1A 1KK3A 5KYKA 4US0R 2QA5A 3EC1A 2XJ9A 4QHSA 1OHHD 5JS7A 4DRZA 2HJVA 3GLIA 2OILA 2E1RA 1Z3IX 1F2UB 1GL9B 3GMTA 4C3ZA 1KNXA 5EUMA 5KTYA 4A0GA 1XEWY 1KY3A 2CK3D 1W2GA 4KFUA 3LDAA 1MOZA 3UWOA 3CH4B 3QJYA 3OIUA 5CLQA 4N1AA 1BMFD 2MSEB 2WIAA 4LBVA 2FPMA 2QM8A 5CK4A 4G01B 5TB5A 2NGRA 2ZYWX 4QKQA 2AD5A 3KKQA 4PX9A 3N70A 1KI3A 4DLXA 4H1UA 3CO5A 4D81A 2BJVA 1N3BA 1SKYE 1BYUA 4TMTA 2NPFA 5E3HA 2GAOA 1X6VA 3CRQA 1NN5A 4GI7A 4UNNA 4V0MA 3W6PA 4UXIA 1PJRA 3FDIA 3GLIB 2C98A 2JIZA 2XZPA 1SXJC 4CEIA 1N6KA 3PV0A 3IQXA 4Q1EA 4DEYA 2BJWA 5JLJA 5KSOA 2Z4RA 4TLBA 1W46A 2GESA 2Q9AA 4D4LA 4FWTA 2J0QA 1S3GA 1JNYA 3PJRA 4JKYA 2H57A 1W0JA 2ZE8A 2YWGA 5FH9A 3SEAA 1UKEA 1XPOA 5IRCD 1KO7A 1NP6A 3NC1C 2J7PA 3B6EA 2W6JA 3C5HA 1G7RA 1J2JA 1JB1A 1Q3HA 1UADA 1KO1A 4IXNA 4QM6A 4ZDIA 4D25A 1CTQA 2Z4SA 3SBEA 5KO2A 3O8DA 3QSYA 4B3GA 1E94E 4IRUB 1NJGA 1YHNA 5A4JA 5F9FA 2XNDD 4RKEA 4XWAA 4JLJA 1K8RA 5J40A 2NQ2C 4BFTA 3QF4A 3TQFA 3X1YA 1DAGA 1NLFA 2QZ4A 4XWKA 3QENA 1EX7A 3LNCA 4CEIB 3AKEA 2FSHA 2YV5A 4BFXA 3D7MA 1FW6A 2KE5A 1R2QA 1PZNA 2IYUA 3DOFA 3NDBB 2EWVA 2QAJA 4JT2A 1MKYA 4TTRA 4QGGA 5HCNA 2H8KA 4OJKA 1F5NA 1KI8A 3NEJA 5AJWA 5C46F 4FCWA 5DGXA 1E1RD 2EWWA 1UF9A 1W4AA 3CBQA 5AJZA 3IPYA 3VR1A 3GFPA 3ZQ6A 5K8TA 1W5SA 1E96A 4ZIRA 4ITRC 3P1JA 3RWOA 1SXJE 1VIYA 1W4RA 1HT1E 4LJ4A 1YE8A 5CB6A 1SVSA 2CL7X 3RS4A 5JFGA 3M0EA 4R98A 3AQ4A 1VYVA 4A1FA 4QJ4A 2VF8A 3SE0A 1XMJA 4TMZA 3I1FA 3FB4A 3KKOA 2B92A 4W5HA 3HR7A 3QF4B 1DAIA 3AUXA 5J4LA 1TMKA 1RRCA 1ELOA 5EXTA 2PCJA 3EWAA 3OEEA 4TL9A 5HE8A 2PLRA 4GZLA 3PFIA 2ZJ8A 4RD3A 1RC8A 3W9YA 4OJQA 3ECCA 1F6BA 4MUBA 1NL3A 4JL5A 5UKDA 1E2MA 4PZZA 3L0IB 2G1KA 4OQMA 1JAIA 2WJGA 4B3FX 1DO2A 1Z47A 1OKKA 2A5JA 3SFZA 4PHTA 1E2NA 4ZIRB 4XJXA 1N6RA 2ZROA 3X1XA 1MRSA 1U0HC 2GXQA 5EE0A 4I1OA 4DLUA 4URVR 4KCGA 1DELA 1IQPA 1LB1B 3CPEA 4B74A 5HZKA 1EGAA 4MYTA 5F9HA 4IDPA 1IM2A 1D6JA 2ODNA 4PPGA 2BKEA 3B8HA 3DMNA 3QF7A 2VHQA 3SHWA 1C4OA 1KDOA 3UKDA 1XXHA 1DADA 3WY9A 2ZAMA 4DDWA 3C16C 3GEHA 3LAWA 4B73A 6Q21A 4G5RA 4EPVA 3K9GA 1FPMA 1II9A 3LW7A 3M4YA 3DOEA 2ZQ5A 1GG2A 4LYHA 5AUQA 4Q1BA 4JMPA 5KOYA 5CM9C 4ZV4A 1WXQA 1XTRA 1QG4A 1Z8FA 4MKHA 1UBEA 2QU8A 1OSNA 1MO3A 4QBFA 4GBMA 3GEEA 1K5DA 5LBIA 2PT5A 5SZJA 3KJHA 1NLZA 1JECA 4HUQA 3TSZA 4AYWA 3U7GA 5CJPA 2ZS9A 1U8AA 3RYTC 2IYVA 5GJVC 2WPDD 2ZRGA 4Q7KA 1JQJC 5FPHA 4EQ6A 4JZKA 4LPSA 1S9DA 3ZH9B 1GKUB 2IYYA 3MFYA 5HKKA 4OI0A 2ZRMA 4WAUA 1VCMA 3ADKA 1T5IA 3AB3A 1XXHB 3QXCA 1FX0A 4MRPA 3RS5A 3F8TA 4GP6A 5DISB 3AKDA 1HQCA 1K5GA 5AJVB 1A4RA 2J9RA 1GNRA 1GKIA 2NIPA 2AHOA 4MGIR 2GAAA 3LY5A 2FGJA 5J47A 2HV8A 1P4SA 2JIZD 3SJAA 1OYWA 4ILEA 4XD7A 4BEJA 3GLGE 4A82A 4DT1A 4HUQB 1ETUA 3TJZA 5KNDA 2HF8A 2IWRA 4A6PA 2ZEJA 3SNHA 1P61B 3CX8A 4M1SA 4BLPA 1N0WA 2BM0A 3AVUA 4EQ6B 4LPKA 4TQ9A 2A9KA 2IYZA 2QY9A 2EFCB 4PAOA 5JEEA 2W6JD 4LYAA 1UKVY 4D4JA 2GCPA 2YYZA 3PG5A 3HYTA 4A2PA 1IN6A 5FOTA 1A82A 5DO9A 4EAQA 1XD9A 2WBLC 1FX0B 3H0KA 4S2EA 1FMLA 1OFTA 1S96A 3MWKA 3SQXA 4I1SA 2FWRA 4AG5A 2JA1A 3I5YA 5FOUA 4OHYA 2ZE5A 3H1TA 2ZJAA 4NCIA 5L8VA 3B1YA 2OCYC 1YVDA 3UPUA 5J4KA 3FMPB 1FUKA 1IY2A 2JCSA 2JLSA 2REXB 2ZR9A 1UPTA 2A30A 1RFLA 2IW3A 4DSUA 4JT4A 1HYQA 1W49A 4E09A 1FOEB 4DT1B 3U60B 1N0VC 5LD2B 3RSOA 4YMVA 3DMDA 4NCNA 1A5TA 4C0LA 4BZPA 4WZAE 2JLVA 1XFAA 5FOVA 3RVBA 3GEIA 1T3SA 2YC2C 4K8OA 1G6OA 4BLTA 4E03A 3QXHA 2IYWA 3A1UA 3R8CA 1XJCA 5TMPA 3BWDD 1N5IA 2QL6A 2FNAA 3LBNA 5AUPB 1G20E 1P6XA 1UBGA 1LS6A 2IXEA 3OE7A 1U81A 3KB1A 4CEHA 3AVQA 3NC0C 2VQSA 1CJUC 2IXFA 2QM7A 3PITA 4I81A 3L8ZA 3B9QA 3MSXA 2FSGA 3D6TB 1IBRA 1HA3A 2QNRA 1EESA 3CF0A 5FPTA 2JLRA 1NRJB 5HCIA 3TLXA 4IDOA 2QN6A 4OHXA 4DIDA 2CLDX 4KAXA 4RFVA 4KV9A 3OEED 1TPZA 1QRAA 2KWIA 1BOFA 2WV9A 1WCV1 4GRAA 1WRBA 2ZU0C 4RSGA 4ZI3A 2CHGA 3K0CC 4JLOA 3VNVA 2VPPA 1NJFA 1TQ6A 3X2SA 4D4MA 4N0EA 3TUJC 4EFNA 5G3ZA 3CR8A 5KSZA 5CYPA 1Q57A 4AKGA 1KJZA 1I2DA 1E4YA 2GCNA 1XEWX 1TNDA 4EUNA 2EFHB 2WMNB 3VQTA 1IXRC 2Z83A 2WWYA 2NO7A 2HUPA 2V3CC 1U98A 4CEHB 2VHCA 1T5LA 2HT6A 1XZPA 3NBXX 4YMSA 2VTKA 2OM2A 3GLIE 1DEKA 4Q4LA 1ZD9A 2DY1A 5DI3A 1EXMA 4BFSA 4GT1A 4BEBA 5FPKA 2XXAA 1AKEA 2HLDA 2DB3A 3E5HA 1XX6A 2ZJZA 1KK2A 1YZTA 1OH5A 3TK1A 1R0YA 2QQ0A 3KB2A 2GEDA 4TMWA 1RJ9A 2JLQA 1CLUA 1XTIA 2OV2A 4MRSA 1DG3A 2WICA 2C96A 2I3BA 2BMEA 1KDPA 2QTHA 2IYXA 2W2XA 4Y0VA 4FMBB 1E2QA 3GJ0A 1CULC 2UZ3A 3U6BA 1SKYB 2X77A 3LWNA 3MD0A 1DE0A 4DB2A 1Q1QA 3KDSE 4A6XA 2X1VA 2G9NA 4A92A 2EYUA 5KUTA 1U0JA 2DFTA 4LY6A 2ZI6A 2FX3A 2GJ8A 3LQRA 2JATA 5H1YA 4V0ME 1J70A 5BYJA 2R6GA 4JLMA 4HLQB 3QY0A 2PH1A 3U5ZB 1V5WA 3RC8A 1S1CA 3EZ6A 5DI3B 1YJ5A 4KVGA 2XXAB 3CRMA 1E9SA 3B85A 1ZP6A 1G5TA 1YZUA 1R5NA 1X86B 2GEVA 3V9PA 1IAQA 2WJVA 1TQDA 4AYTA 2REOA 4EPXA 1G4UR 2F3RA 3ZVMA 5LB2A 4MH0R 3ADBA 1G8PA 2ZIAA 2YJTD 2IL1A 1RJ9B 1E9RA 4M2LA 1SZPA 1CJVC 1SXJA 5J4VA 5CYOA 2ZRJA 4GP7A 1FTNA 4LJ6A 4D26A 2BWJA 1ZBDA 2O8BA 4JLDA 5EXSA 4HAXA 4MYCA 3T1TA 2DWOA 3FHTA 5CLLA 1IJFA 4XD7D 1TEVA 3OIWA 4JVMA 3L2OB 3WBJA 3PUYA 1G64A 1MABA 4A2QA 3LLMA 3UATA 2CCGA 2F9MA 2VYFA 3KTAA 3ZS9A 3G0HA 4RZXA 4FMDF 3I5XA 4MDEA 3HYRA 4WIAA 4DSNA 2XTMA 2IYSA 3X1ZA 1S2MA 1IN5A 3T06B 4NMMA 1SVOA 4DEXA 2GVZC 1W1WA 2ZUDA 3RS7A 5B2ZA 3L0OA 3AF2A 1G8YA 1VG9B 3BBPA 4B35A 2KBFA 2OFXA 3IQWA 4PSKA 4QGFA 4PQRA 2CHVA 3QUSA 4HEJA 1SXJB 2YVUA 4UNPA 5HTKA 3BGWA 4GOKA 1KTVA 1TQ4A 4POAA 3I3SR 3LLUA 1XTSA 2AFHE 2O8BB 4BRWA 3AEZA 3OZXA 3LXXA 2ORWA 2HXSA 3BS4A 1H65A 4X8OA 4O3MA 1OXTA 2RGDA 3SS8A 4II7A 4RJLA 1MABB 2QRNA 4Z8XA 2NZ8A 4CZ2A 2J46A 2W0MA 1G7SA 3KTAB 4MKIA 3SC3A 2CK3A 1OH8A 4UNSA 3T5DA 5E4FA 1E2GA 1UKYA 1TEXA 4Z51A 5JS8A 2IS6A 4M1MA 1YRBA 2HYDA 2V9PA 1X3SA 5EP4A 4ZDWA 4QBGB 4LJAA 4QRHA 1XJQA 2WOOA 4B75A 4ERNA 1N6NA 2OFWA 1J99A 3VKWA 2FDCA 2OT3B 2F1JA 3K0AA 3OE7D 1CS4C 1H8EA 1E9CA 1KI4A 1N6HA 2GK7A 5SZIA 1L4UA 3ZQJA 5EP1A 3MWJA 5KDLA 3WRXC 1G5RA 1ZCBA 2AKYA 3QG5A 5KDDA 4Z1MD 4DUGD 3CX6A 3MGCA 3ZGXA 3TNFA 2C78A 3W90A 4MGYR 3E2IA 4QGHA 4NPHA 4DB4A 2QBYA 4IEEA 4YMTA 4YDHB 2ZVPX 2QG6A 1IONA 4E22A 5BN5A 4BLRA 1MO6A 2Q3FA 2X19A 3MMPA 4MRVA 1FZQA 4L16A 2FV8A 4LHXA 2D7DA 3DHWC 1SVLA 3OFNA 4QHTA 2B6HA 4LJ5A 2G1JA 1F48A 2JJ2D 2WHXA 4I99A 1GRQA 1KI9A 4X8MA 1JR6A 1G6HA 3C5CA 1M74A 2P65A 3K0AB 1DVRA 2RMKA 3A1SA 4TMVA 4F91B 2LKDA 4TTQA 1IOZA 4UQOA 4GSYA 4L8GA 4ZDJA 2AK3A 3BIFA 4AIIA 4A15A 1GDDA 1AGPA 2TMKA 3SFVA 3R9XA 2ZVQX 1KO4A 3OESA 1GITA 2J3EA 3M6AA 1W4BA 2RAPA 2ZJYA 1GL6A 2CHQA 2QBYB 2ZRPA 3K9HA 4PO9A 2O5VA 3B1VA 3KQKA 2WTUA 4M9QA 3Q8XB 1VPLA 3REGA 2B7BA 3K0SA 2ZSAA 1YQTA 5J4YA 2FSIA 1JEEA 1LY1A 2RHMA 1SVKA 3VU9A 2ONJA 2GWHA 5JMTA 4PFSA 4DCNA 5TXGA 2GF9A 1AQUA 5DHFA 1Z07A 2H1LA 2VP0A 1TADA 2J7KA 1QVAA 2ZREA 3THYA 1KK0A 3T34A 2IYTA 1NVUQ 3F3YA 3L82B 1W4CA 3B60A 1ZW6A 1C9KA 3EPHA 3EIQA 1IN7A 2QSYA 3VAAA 2ZR0A 1VKJA 4FWIB 1ZM2A 5CK5A 4C4PA 5AUOB 3H4MA 4AYXA 1ZM7A 1GKYA 1RZ3A 3QG1A 2EYQA 4A8JC 3TSWA 4G5GA 4JJKA 2ZI3A 1SXJD 4IVPA 2IC5A 5BQ5A 4Y0AA 4NKRA 5JZVA 4CW7A 1AS0A 4YMUA 4I4LA 1T0JB 4U7DA 2GXUA 4TLEA 4WXPA 1CR2A 1IJEA 3ZD6A 1KY2A 2OO7A 3VU9B 1ZC4A 1F60A 2FFHA 2ZJ5A 2GBLC 3EA0A 4OK6A 2OCPA 3THYB 1VECA 1YR9A
chains in the Genus database with same CATH superfamily
2H5EA 2W0SA 2PGAA 4NR0A 2AVDA 5JVDA 5JY1A 5JJIA 3GZNA 5EIBC 3RQIA 2DH6A 3KBBA 4V0SA 4Z0NA 4KI0A 4EYKA 2UU9B 2NZVG 4BNKA 1Q5PA 4HPWA 1JXMA 5KKCA 3W4JA 4B7AA 3VUFA 3UGJA 4R2KA 2BP7B 4IIFA 5F3WB 1OX4B 4K9LA 2R0QC 4QQRA 3PUIA 2M2IA 5T67A 4TMKA 4K2AA 1MC8A 4X00A 1BNCA 4WK2B 2R2GA 2CXHA 2PSHA 2ZBFA 3C1OA 5IUKC 3B38A 1U8FO 4CQLA 4IIBA 5HBRA 5A04A 5JS1A 3C87A 3NYQA 3EXAA 2YWDA 1EHIA 2QOEA 4Q4JA 1YO6A 2Z08A 1Z6GA 1RXCA 2H07A 1NRWA 1SU8A 2OZEA 3OT5A 5AVZA 4EB6A 4NVRA 3AHHA 1Z6XA 3AU8A 3E84A 2MWMA 3RLFA 2E4ZA 1MC5A 2ORYA 5DCUA 2IWHA 2WNIA 3G23A 4CDMA 5B6IA 3IAEA 3O73A 4JJZA 3N53A 3W5DA 2E4YA 3LQ1A 4J0QA 2ZAOA 4LJ7A 5HQ3B 4MVYA 1XLUA 3IAS1 1JDNA 3M9WA 2PV0A 3FXAA 5E1OA 5KQSA 4GOJA 1MX5A 3GRVA 1SCNE 3Q3IA 1P60A 4KDCA 4YHHB 1MHTA 1JLRA 2CJYA 3L6EA 4P0QB 4OIMA 3E7FA 1YZNA 3P2MA 5TQ2A 3EBPA 1KPIA 4EBBA 1QZXA 5AM2A 1RHUA 1W1UA 4FHZA 2W6PA 1XLVA 2WWFA 5I8WA 2H1WA 3T3NA 1RLJA 1GPAA 3A6GA 2PWAA 4RABA 4S1VA 1KZYC 5AICA 5BRJA 5C37A 4EMBA 5DP2A 1RI3A 5EMHA 4JJFA 3NHZA 4KN5A 4O1HA 1E20A 2AEMA 4FFBA 4H18A 3ZU5A 4OTZA 5CNMA 4RFSB 4DCMA 3NTRA 4PTYA 1AUXA 3B70A 1ITZA 2PKQO 1UMBA 3CEMA 4GPTA 2LD4A 5TE9A 4U9UA 4BU1A 3O4HA 2ZGVA 4JXKA 1SOWA 2C2XA 2YASA 3EIUA 4QLBA 1QSGA 4MUFA 4CGZA 1HYBA 4FBLA 4LKRA 2P6NA 3RNOA 1B23P 3DXFA 1B0ZA 3JVUA 1K1EA 5JAQA 3U7QB 1PLKA 6REQB 3WHKA 4F06A 5MDHA 1SHUX 4YV0A 4NZYA 1L2TA 2R79A 3RRZA 4EELA 2FE4A 3OFND 3K73O 5I5GA 4WOBA 4GQBA 3QE0A 2HLHA 4JBGA 3C8HA 2P9BA 3BWCA 5U4XA 3A4MA 2XTAA 3TRIA 1NXOA 4QG7A 3HDJA 5K0JA 1ECJA 3DDUA 2CUTA 3KL2A 1QJ4A 1L4EA 3NVDA 3OCVA 1WKBA 2ZU6A 1VSQA 3ZY5A 5A9SA 3S1SA 2AQIA 4LUCA 1JHDA 4PC3A 4Q9JA 2ZVJA 4CHGA 2QY6A 4ARCA 2XLCA 1M1YB 4J7CA 4QUIA 4MI6A 2MINA 4RKQA 4X44A 1IVSA 4ER0A 4DR2B 5IXJA 3ZKWA 1X7ZA 4UZSA 2CFRA 4NMHA 4URUR 2PU7A 2HZBA 4Y9SA 1Z25A 1AQ6A 2H11A 5K5EA 1MO2A 1TJNA 3FOBA 2CL0X 4FCVA 1VMIA 3ESRA 4RHUA 5AJHA 4ER5A 2II6A 1L4LA 3KZXA 2FR1A 5ITVA 3TQIA 4WA7A 5JI2E 3NUZA 4Q21A 1FSFA 4RKFA 1JEOA 4OQ4A 3RKRA 1D2NA 2VOJA 2MIIA 3HZZA 3C7KA 4F12A 2XVZA 3JQEA 5F3DA 3ZDYB 4MR9A 1WOMA 1YTLA 4X1OA 3QVJA 3MTJA 3F46A 4YXWA 4UAGA 5MGBA 4JX9A 2VT7A 1DOAA 1ST3A 3LP5A 5EVJA 1N6LA 5EHQA 3URKA 4DCVA 1YQEA 1M34B 4JUFA 5DNWA 2ZTMA 3T0FA 3A6FA 5IVPA 3FOWA 4J49A 4WV3A 3SE7A 2HYIC 5D00A 2P2LA 3T6KA 5KQLA 4LHEA 4C0JA 3D3QA 3KS9A 5IAOA 1N8SA 2ZS7A 1DBPA 4MUYA 5CH8A 3L8FA 4DR4B 3N2IA 2YMMA 5KKAA 2RGEA 4XSGA 1TM5E 4PSAA 4MUXA 4W8HA 3OY2A 3B12A 4MMXB 3T5BA 1LTHR 2Q3CA 3TLKA 4BO3A 3CQ9A 3HH8A 4MV4A 5CBKA 5FBQB 2EKBA 3MT9A 2FKNA 4QL3A 4XVCA 1Q95A 1E5QA 2EX4A 4URXR 3K0BA 1O5OA 3JV7A 3PGVA 3BD6A 5AMXA 1SKAA 5EUQB 5GY7A 3KWMA 4YB8A 1ZW1A 4IIXA 3WO0A 2QRQA 1SULA 2OHVA 4JNCA 3WJ7A 2DXIA 3L49A 4P2GA 2FWIA 1DQRA 1EH5A 3LUAA 1EA7A 4XVRA 4F4FA 1D8TA 1QHXA 1VL5A 2YHIB 3ND8A 4NYMQ 3EVZA 2XDYA 2P2YA 2WIFA 3HKDB 4JJGA 5HRAA 2HBRA 3CWCA 3FIJA 4H1VA 5FNVA 4A9AA 3L06A 1SD1A 2JG3A 1KRHA 1QFSA 3BAZA 4QDKA 4DBZA 2Q1WA 1CUEA 3UY4A 3EW9A 3CVOA 4HRAA 2GN6A 1QUEA 2AFIE 1A8SA 3M3DA 1ZOOA 3WYFA 4RKYA 1XTBA 2DPMA 5D3KA 1ZUIA 2YV2A 4YP1A 1J0CA 2NU8B 1ZGJA 3U37A 5K8JB 5AHKA 1QRUA 3D8NA 3UJ6A 1RPZA 4S1TA 3FMOB 5GOZA 2JK1A 4HH4A 3VDXA 1TM7E 4R1SA 4XI9A 2EBWA 1TZCA 2A9JA 1VCNA 4YRIA 2I9PA 3E6AA 4DR3B 3BH0A 3RO7A 1NSFA 4D8WA 4ZFNA 1WR8A 3L9XA 1B1AA 3BORA 1PS0A 1ZZEA 5EE1A 2OWEA 3S1AA 3OLZA 1DARA 1PK7A 1ESNA 3Q10A 1RMQA 2QUHA 3U4DA 3ZWAA 4I5EA 2BBOA 3NHLA 4L7VA 2OO3A 4KQKA 1FBNA 2PS3A 3HUUA 3LXUX 2PK3A 3HM2A 4P38A 3TI9A 3GJRA 4WJLA 3SC2B 3FI0A 5H5JA 3BL8A 2TMYA 4UHBA 1Q2XA 1GA6A 3OWHA 5DGCA 5K3FB 3HDHA 2PTHA 2HD4A 1HUQA 2PKEA 3L8CA 5A0TA 5JNSA 1PR2A 3T7SA 2BH9A 4W5WA 3V1TC 5A5FA 4J07A 4IGEA 4FB5A 2W6ZA 2H16A 2QSZA 5H59A 5KOHA 5C7IO 3ORSA 1ZLYA 1THMA 1JRLA 4GE0A 4MUEA 1ODTC 2ODEA 2IY7A 1DC5A 3O9VA 3CEAA 4ME6A 2EXXA 1E5XA 1S8AA 2O52A 1XO1A 3SVLA 4YYEA 4X3CA 1TAGA 1K2VN 5EESA 4UEQA 3WVNA 1H2BA 5FDFA 4J90A 1PZMA 4JSRA 1FYDA 4RMJA 2PS0A 3MBIA 3QBEA 5SYAA 2PG3A 1R8SA 1JX6A 3RI3A 4B4UA 4OKSA 4EMUA 4W63A 3B3FA 1TM2A 4MLCA 1JG7A 4OB8A 5C5CA 2QW0X 3LOPA 3N0RA 4JL6A 1VP9A 2W70A 4QT0A 4MI3A 1AZWA 4XARA 1A96A 4PXSA 2IS2A 5HEKA 2FG7C 4EW2A 3HO1A 2Q1UA 2H48A 3ZCXA 5CJ2A 4RD2A 4M6WB 3BB4A 1KKLA 1U2GA 3RREA 4FMDB 2VPYA 4CFZA 4EOGA 4NCHA 5JW6A 3MOSA 1JDUA 1RCUA 2XBUA 3DCJA 4PX3A 1ZD4A 1I0ZA 4C30A 1FJXA 2V9CA 3OBBA 4Q3BA 3LUFA 3U2QA 1E3WA 4HLNA 3WP1B 3EXFB 2D7JA 2EZUA 3KG2A 1JFSA 4D9KA 2C9ZA 3SOPA 2CMHA 3KJEA 1IOLA 2D4HA 4BLOA 1ODJA 4KN6A 3PVSA 3S2EA 3DV2A 4BYMA 2BKLA 2E4XA 1VFPA 2W2TA 3PENA 4G3XA 4PLZA 2OYCA 1F38A 1N2OA 1PJBA 4IDGA 3LUCA 3RH0A 4YMLA 3E9QA 1J9GA 4CNBA 1DG1G 1C8LA 3EDQA 2O2EA 3HFSA 4N0QA 4PN3A 3H4TA 2ZJ0A 4DLKA 3H75A 3A4VA 4M0UA 1DX6A 1YR6A 4ZYUA 3PEYA 3WXMA 1EZZA 3AOEA 4G8CA 2PAAA 3ZYZA 2AOTA 4EJ0A 3I53A 4DMLA 4B44A 2OCKA 3H04A 3IRUA 2C3YA 1T1JA 4AQ7A 3TZHA 1NNUA 4F93B 2OFPA 2QX8A 1TM1E 4JVNA 4LBYA 3ZVKA 2ZB2A 4C4ZA 1XEFA 4FD2A 4MIKA 1YB1A 3QUAA 1GT91 1CERA 1KAGA 1KO5A 3ZCQA 4BGEA 1GUDA 4RF5A 2GZAA 5K1ZA 5H02A 1Q7BA 2AN5A 4DE5A 4TYNA 4KQ6A 3A6EA 2PMWB 1R88A 3TL2A 5CDFE 1U80A 2QQFA 2X86A 2HWUA 4TPKA 5COBA 2EERA 4DJDC 2P0YA 5HZMA 2QNIA 1GGVA 2YW9A 3QVSA 4CV2A 5A7FA 1QV7A 2F7SA 4XZ3A 1F0YA 1EFTA 3CF4G 5JZMA 1Z4KA 4AJ2A 3DVLA 4QUAA 2WNSA 5KYVA 1EFUA 3IHLA 4QNNA 5ISMA 4MGZR 4YAOA 4QFBA 3JQFC 1MMFB 2I6TA 3BKWA 3HXKA 2UZ0A 2JKYA 2JLUA 1E0JA 1PFKA 4DUGA 4U8HA 3V8RA 3C3AA 4QATA 2HAEA 1X8LA 2ERYA 3CKLA 1A76A 2PUWA 4P4LA 1OIXA 3UT5A 1YJ8A 4L72A 2ATCA 3OQIB 5CFNA 1UT6A 2XECA 2YXBA 3LYAA 5CVDA 5FUWA 1U28C 2R00C 3KOMA 3QLJA 4L9WA 4BNDA 5EJ6A 4BHTA 4TS4A 2HSWA 2P9EA 4CPDA 2N0SA 1I51A 3HGTA 3MXTA 4U2DA 4C5AA 1CHNA 2I7XA 3PYMA 4Q19A 1ABFA 4F3TA 1E7YA 5A6SB 3CX7A 4RHYA 1ZESA 1XTZA 3U81A 3LSYA 4JC8A 4X20A 4NZ9A 1T34A 3S68A 4U2EA 1R8XA 4PQFA 4MPTA 2WINI 5TR9A 1IDOA 1WVIA 3A9TA 3PPXA 2IK8A 3QFSA 4LVCA 2VWHA 4LC1A 1UFOA 2FCAA 4BN0A 3QKSA 4FGJA 4FFMA 2O57A 3JRNA 3I0MA 4IZHA 2FB9A 3WLTA 1ZAYA 2FG5A 3MCAA 3DDHA 3FCEA 1KYWA 4X6UA 5JMPA 4BQFA 5KNCD 1EFDN 5JE8A 2DJIA 4X54A 1N3LA 4PLTA 3C7AA 1LI4A 3DMRA 4DN6A 1XLWA 1F8XA 2W6ID 3OA2A 3RU3A 1OZFA 4E51A 3U13A 4PZDA 1NUUA 2PGJA 4KYUA 4QU8A 5EOVA 1QOZA 5I9TA 2QR3A 1OJLA 1U0GA 3AY0A 1JHUA 3ZDFA 5F51A 1VIMA 3NBZC 4A7PA 3LT4A 2XIJA 1ZM9A 3OY7A 1JJAA 2VZEA 1UXIA 5ICFA 2RG1A 3NG1A 5GQSA 2AJBA 2X6RA 2VP6A 3N2LA 2QXTA 3MPOA 4P3YA 2G4VA 4KACA 4Q48A 5LKRA 3KE8A 2VT3A 1RAFA 2FWJA 2RI1A 4JENA 1OJ7A 2D3WA 2GCOB 3D3KA 2GNOA 3NWJA 3V7WA 2X0IA 3PRKE 5E3IA 9ATCA 3M4XA 3N8NA 3T52A 5KYUB 3PQEA 4OQZA 5AW5A 4DRXB 5JU6A 3MIIA 2XA1A 2XCUA 5JXWA 4F45A 1NF9A 3GQVA 3QWFA 4E11A 2GPTA 2RKOA 2ZB4A 1KI2A 3V4LA 2ZRNA 2XQJA 2ZB8A 4L07A 4LK3A 2YDYA 4WZ6A 4WK6A 2DU8A 4GBGA 1JHRA 3K0FA 4A36A 3BM5A 5LLSA 4DWOA 3OOEA 3O4RA 4LCJA 4RCYA 1P2DA 3WAKA 3DUFB 2OBBA 4J0DA 2P4SA 3BMCA 4H15A 2QJRA 3OQPA 2AUTA 2XMGA 2Q46A 3BWMA 3QKUA 1NI3A 1Z37A 2ZWAA 5K6TA 1XQXA 1Y6GA 4U9IS 4LDZA 1Q6ZA 3M9LA 3H2KA 5ERYA 3Q2KA 5CNKA 3T7AA 1IEWA 4S1OA 2B98A 2FEXA 4C76A 2EJTA 3FKQA 1OI3A 3DKIA 4IJUA 2ZIXB 2FQ1A 1CQJB 1G18A 4FGKA 5LUAA 4GSLA 1GG8A 2J0UB 4HLUA 4M7PA 2D2IA 1DKPA 3A04A 1OLXA 1XCBA 3JAMA 3N8DA 1QPGA 4XB1A 2GNAA 3HCEA 3JAKB 8LDHA 3A05A 5JSZB 2CV2A 3A1CA 3UKJA 1MNAA 4ENUA 2DERA 3DZHA 1XRJA 2BZ1A 3SIXA 4YUYA 1SXQA 5BV8A 2WSSA 1SQ0A 3H3FA 4UHKA 4GKVA 5T8KA 1KEEB 1J20A 3OZGA 2D74A 1KVQA 1ZRNA 3NU1A 4HDAA 1XTJA 4YLYA 4GDMA 5DEIA 1NBAA 3QXXA 4H60A 1R18A 2FH5B 5MN4A 5D3MA 2VJMB 3AP3A 3B36A 4QEKA 2WD7B 4P80A 3FDZA 2YIVX 4RHEA 1OXVA 1TZJA 3SLGA 4BTEA 1PKEA 1TUGA 2DQYA 2E7ZA 4KQEA 1T2CA 3R6DA 3P0FA 5E4JA 2YW2A 2YWCA 3WGOA 4D9MA 1DSSG 2VPQA 3BJIC 3BCRA 3QU2A 5I9MA 4E7OA 1M3SA 1VPDA 5TVGA 1GU1A 4YRTA 3E0QA 3ZIAD 1Z38A 3REQA 2A14A 2ZIWB 5CB8A 3E4CA 3P20A 3PQ4A 5ELXA 1KJYA 2JIOA 3UWSA 4N7RA 4EHFA 3KQUA 3TLGB 4FI3C 1ZUHA 1JZTA 3ROKA 1LH0A 1XCOA 2DUMA 4IHJF 4QXMA 4HYYA 4H4EA 4ROSA 4F8YA 4FYXA 4ERXA 4UHHA 3CLSD 3MCUA 4BUCA 1NXSA 5A3QA 4WACA 3AF0A 4PCAA 1MO5A 3U4CA 5CB4F 5GMOA 4HB3A 1Q6YA 2QT0A 4REMA 4D9GA 2IS4A 1ATIA 1MLDA 2EX0A 3ZEAA 2Z6QA 2QNBA 3AUYA 3U60B 3BX1A 3KCQA 5CYFA 4J03A 4L08A 3M5WA 3CF2A 4L4UA 1BXRB 3O8CA 3MCTA 4G4IA 4KXYA 4Y18A 3U40A 3FYSA 4LRTB 2BKUA 2B0JA 2QR5A 4C4RA 4Q4CA 1CFZA 3NTUA 2VTBB 4NJOA 3RK1A 1V95A 1X7WA 4YEDA 4ZPJA 3R20A 1J8YF 2XXBA 3Q5GA 1IC6A 1QYCA 2D3TA 4GFDA 1TUBA 2JDIA 2M6SA 2Z8ZA 2ZTSA 3CS3A 3A1FA 4URWR 3TOVA 2CLIB 1SIOA 4ZD6A 5AO9A 2VHEA 3MZ0A 4I6GA 2Y1LA 4F7WA 4ARZB 3EPJA 1QIIA 1NJ5A 3IMGA 4FR0A 3HDGA 3AMVA 5HA5A 1J0EA 2B78A 2PVPA 3N59A 1DDGA 1N2ZA 3C85A 1E6KA 3G2OA 1DMRA 1A4UA 1UAGA 1YRQA 1GPH1 4MW4A 3JX9A 3ZDRA 4RTOA 1PYGA 3UFXA 3LD9A 5JASA 1V39A 4LXQA 4NOLA 2P4UA 4H7DA 1KI6B 3ONDA 3DXXA 4ZOEA 4B3SB 4M1KA 4WASA 3AEUB 4UPEA 4AURA 1CZKA 1OCEA 1WSAA 2QXUA 5IXSA 3AGPA 1L1EA 3ZK8A 2V7EA 1MH9A 4EEZA 4LF5B 4YRRA 4FYKA 5FL7D 1ESCA 3NV7A 1ZMTA 2GD0A 1AMOA 3PL5A 3J81A 4P9NA 2OC9A 5FV7A 4DAOA 1PLLA 4HJXA 1BMTA 1G9TA 1ECPA 1Z7EA 3IDOA 4GPEA 3FFTA 3WMGA 4D3YA 3FCAA 2PM8A 2WYIA 5K20A 2VXBA 3F5FA 2YYSA 3IILA 1FLAA 1ZINA 1UPFA 4NSNA 3EA5A 3GMDA 4H7JA 1IG3A 1TLTA 4DLBA 4ER7A 1EAYA 4FOOA 2PH5A 3QKIA 3OC0A 5HR5A 3QEMA 5H81A 3TZBA 3MINA 1J8MF 1HE1C 1R4MA 3RVMA 3ESDA 1BGXT 2NVOA 1OFHA 4B2PA 5IZCA 2V7UA 2JHPA 1Z2PX 4GMKA 3UHJA 3VH3A 4NICA 3WGLA 1MNQA 4TQUS 1OXKB 2IEDA 4LTNA 5A1TA 4RVCA 4WERA 3SPXA 4X1IB 2VJDA 4A0HA 1OREA 3UGQA 4UC0A 3SQNA 1AD2A 1Z29A 2I3DA 4NLLA 4CM4A 2IELA 1M7BA 2M1XA 5JCJD 1WPXA 4BFZA 1JYFA 3AEXA 2F55A 2NO4A 3RSFA 3NHWA 3A4IA 1Z6YA 4AI6A 4AUMA 2XQGA 4PYKA 3KKZA 4FSDA 4F96A 2ZRDA 5BYAA 1Y8RB 3BGDA 2A0UA 3BZBA 3K3PA 3CM0A 3L1JA 2IX3A 2WJWA 2GKOA 5LZ9A 3ANXA 1JLLB 3ROMA 5BW5A 3WRWA 3NMUF 2RHWA 1XJWA 1EWYA 5CDFA 1RRGA 4EHDA 4ZT7A 3SJCA 4AQYB 4QLAA 1RVV1 4H0CA 3SR4A 1YONA 3DP7A 1RJWA 4IDNA 4V03A 1PVOA 3OQVA 2EZTA 3NEAA 3T4XA 2O0HA 4B3BA 3CT4A 4D6PA 1JJVA 4HV4A 2IEYA 1ECGA 4D9NA 4Q3EA 3VVLA 4R2HA 5L4NA 1SOAA 2XYVA 3GPBA 1WPGA 1YT5A 4HAZA 2WT8A 2D1QA 3DOOA 3F1KA 2O06A 2P90A 4I55A 1PR9A 3BD7A 1QTRA 3PHBE 3O8QA 4MKXA 2WU4A 1PNVA 2ECKA 3ROTA 1SBQA 4BLWA 5HDQA 4RJ2A 4TTVA 5FR2A 2BR5A 2JBHA 1I3CA 3NBYC 1NM5A 1VXOA 3R2JA 4P83A 3W3AD 3SI7A 3T54A 1CC1S 2FR8C 2DR0A 5DYYA 2YOHA 3IIEA 3W8DA 1P8AA 4R1OA 5I7FA 3BDAA 2F3UA 3F7TA 3AVPA 4BO5A 3DEYX 3J7TA 4UEWA 3AL3A 3LKVA 1OXSC 4QA9A 3PX7A 4XSHA 2AW3A 2DFDA 1VGVA 1KH2A 2QAGB 2BGNA 1RRFA 2NU7B 1Y1KE 1V11A 3U1VA 2PZKA 2B35A 4HMPA 1FFEA 1MX1A 1LS1A 3IUNA 1PT6A 3B48A 1SA0A 4E4TA 2F1RA 2YVLA 1BWSA 4DC1A 1YBFA 2CNOA 2Q5QA 1E2PA 1XRPA 2PBFA 2P9TA 4ZTUB 4Q82A 1FS4A 3U49A 4LFBB 2RB4A 5D01A 2Y0CA 5JYCA 4JR2A 1PN3A 4OH1A 3V1LA 1BDHA 4Y30A 4TROA 1AHHA 3A1WA 4LAFA 3QFFA 4A0FA 3K96A 4YRQA 3RNLA 1RABA 5JJBA 3OPXA 4YPFA 1PZEA 1YIOA 4CM8A 4EIWA 2REQA 3MD9A 3T3GA 5A2GA 4KITB 2E5FA 4YI3A 1W36B 2WQ6A 5LWHA 3LHIA 1CUYA 2A78A 1EEXB 4KRFA 4S24A 1JDTA 4NOJA 5F52A 3W4IA 1I5OA 2R751 2EGGA 2VLBA 3Q7RA 2I3AA 2XWSA 2Z58A 4ZQIA 2AD1A 2AMLA 4NWIA 3C39A 2HO4A 1VJCA 3ADCA 4D82A 1YJXA 2RHHA 5K0BA 3DL0A 3UYKA 4OA5A 1SOUA 3DNFA 2CFSA 2C7GA 1W94A 1PVDA 4R7ZA 4K7JA 4PGGA 2XYQA 3PCTA 1O4WA 4IXMA 1P62B 3FWKA 3IYLW 2CN1A 3OWOA 8MHTA 3V8MA 1NMYA 1Z68A 3UM9A 5TS3A 5BVHB 1FE8A 4YAWA 1YRWA 4E94A 1P7VA 2QMYA 1QIFA 2Q28A 5FHRA 1IEQA 4Q4DA 4PLFA 4D4IA 3KEMA 4OM7A 1J5PA 3PHIA 3OU2A 3THYB 4XIJA 4H27A 2XNHA 4GVXA 2YRFA 4YQEA 3W79A 4URFA 1PYDA 4AIRA 2X5OA 2CLKB 4FFPA 5FPQA 1YVPA 2RGUA 5H68A 5L7YA 3IALA 5J23A 4KNVA 3DCNA 3ZWXA 2CBGA 3TVYA 5F5XA 5CM8B 3V7UA 4EITA 3CLRD 3NR2A 2GDZA 4RZ3A 2ZWIA 3FDJA 4GEGA 5AKYA 4AECA 2DQ4A 2WPNA 1YB5A 3KOYA 2EW8A 4PS1A 2QV0A 4NY1A 3U4HA 5M7EA 4CMAA 3T9AA 4OLAA 3GEMA 4PV7A 1XTTA 3DE1X 4QG3A 3OIGA 1KFEB 2OD7A 4M4SA 3V4SA 3UT6A 2EIHA 4HUTA 5HPYB 1UPUA 3ICEA 1J9EA 4PVDA 5BN4A 4YMHA 2J32A 3DMTA 3EC2A 2HW8A 1DFGA 4G2NA 4G0VA 3GP3A 4JSYA 1QHGA 1GUBA 3GDWA 4KTTE 1V1JA 5IJ9A 2EJWA 2C4TA 4MARA 4XFDA 3AF6A 1AGRA 2CXXA 3THOA 4KGZA 2LWIA 1N5RA 1C8VB 5EYPA 4XUGB 2VF7A 4Y67A 5AOCA 3EUWA 4Q6BA 1VL2A 3AP2A 3I1IA 1GDHA 1XRQA 1V9CA 2YV1A 2POCA 3FH0A 3HCAA 5DYGA 5IC6A 4EG7A 5K0EA 1ECCA 2BFFB 3F7NA 2YWBA 3ND5A 4MINA 4PX2A 3FBTA 4IEIA 1HFKA 3D3WB 1Z3CA 3UO8B 3ZE9A 1GGKA 1T0HB 4MCHA 3OLVA 3R3WA 3R77A 3H5LA 4HDRA 1QF6A 3O26A 4KXLA 3CUEF 2VCEA 1D4ZA 1YQDA 4GZMA 5LZ7A 5I9LA 4CLEA 4B76A 5CHYA 5KQGA 3UXEA 1WXWA 1H69A 4F5YA 1QHNA 2O8NA 3JASB 4GG1A 5H9VA 2WF5A 3ESCA 3TO5A 5C8XA 3MFQA 3IESA 4A1OA 2O7RA 1RD4A 1R9MA 2BEKA 1YFZA 3T7TA 1KSGA 3BAFA 3OE1A 1SOVA 5KCZA 3ZH2A 2CE7A 5CT5A 2W8ZA 3TOZA 4NCKA 2AFRA 1ZMRA 4RLFA 1K97A 3JYOA 4LSZA 4ZARA 2XWJI 1DO8A 3G6WA 2GCIA 3MWDB 3QI7A 5C7LO 5CMLA 1AE1A 2QD5A 1EWKA 1QHIA 3FROA 4C4AA 1HY3A 1PG0A 3H3XA 1I1OA 1MB2A 3D8RA 3DMYA 2FPGA 3E8XA 3UAZA 4KP7A 4ZCTA 5CVTA 4OLJA 1T5SA 5DGIA 1NFRA 2A1UA 3MUOA 5HTOA 2E37A 2RH8A 1SWVA 5FWAA 3V32A 4XE5A 5EWMA 4BE7B 3EGIA 4FOSA 4PTLA 2VA8A 3R6WA 1LK0A 2FA9A 3MPUA 3GUYA 2HA5A 3MJSA 1FQJA 4JHLA 2Y1EA 1KZ6A 3AF5A 1V9LA 3H5AA 4DA6A 3FHOA 5AW0A 2DEUA 3ZWCA 4QPNA 4X92A 3NUQA 1AHIA 1TFUA 2CVQA 3VJLA 1NVFA 5IN5A 2EP5A 3GPDG 4IS2A 1GZUA 5FI3A 2FP3A 3BJZA 1Q44A 3OQ1A 4V0LA 5CT4A 4RKWA 1OI7A 4C03A 1QLJA 1XAJA 2QTFA 4YV2A 3PHCA 1JDBB 3VMMA 3DTYA 5IS2A 3TEJA 4QYWA 4DJ5X 5G0SA 4B3IA 1L5HB 4J8PA 2XD9A 3GUZA 4Z9FA 1UQTA 2YN4A 4EVRA 3R3XA 2O8FA 1R0XA 4FC7A 3TCXB 1DFIA 4KR6A 2H9YA 3UUFA 3WYBA 5T57A 2I7DA 2BFDA 2HIHA 2V55B 4EGAA 1FMFA 2XUAA 3CUTA 3H2IA 3R5JA 4U7FA 2BR3A 3GCGA 3TS1A 2V7QA 1TEZA 3L8HA 3KT8A 4L5IA 2QN1A 1F4PA 3T0IA 1A5ZA 4O4LB 3UKOA 2YJZA 3FPSA 3FPFA 3L7YA 4MQ6A 1WQ3A 1TX4B 2HTFA 2ZAYA 1GXSA 3T94A 1Q7RA 4IV8A 1RYEA 4QXPA 2PRZA 4H7HA 1FYWA 4IJWA 1RAAA 3BCSA 4MV9A 3O2QB 5BV0A 4NYMR 2JKVA 3NEYA 3ZLBA 1ND6A 2ID9A 4Q93A 5G0TA 3H2ZA 3U9TA 3L84A 2UUOA 4RA9A 1FDSA 1ZUNB 1U1FA 3IPCA 2C4HA 2AC7A 4KAJA 3MWLA 5FOXA 4RDCA 4C0QC 4BVKA 3CRNA 4NMLA 1XQ6A 1BQ3A 1Z34A 3QW4B 3FIUA 3ZWBA 4CTMA 3KDPA 3FGNA 5JC8A 2FJPA 3ZHVA 1ZMOA 3VHXA 2ZETA 4IDAA 2ODAA 2LCFA 1JH9A 1VXRA 3QOYA 4YK7A 2PD6A 4FZJA 1J1UA 3HYSA 3I2KA 5A5DA 2BBTA 1LUAA 3ABSB 3EHEA 1UZUA 3IP1A 1FFCA 1SKQA 1ZNZA 1FFBA 3I5MA 1R5OA 2ORVA 5CXQA 1O94A 2QLLA 2J6IA 1M6NA 1TEHA 2QXYA 4BBPA 3ITDA 3I32A 3T5AA 1EFVB 1NY5A 4OI1A 3DFMA 3R4CA 3P26A 4DPKA 3CVWA 2NXWA 4JCCA 4J0JA 4DLWA 1G17A 3H0EA 5ARBA 821PA 1UMCB 1M0EA 3HY3A 1TMYA 5B30A 1W44A 5F1YA 4Q47A 5TPZD 2GASA 4S12A 3MUFA 1BRTA 3HVIA 3HEBA 2FUNB 4O2AF 2AI2A 4ILKA 3ELUA 1DEHA 4CT5A 2Z1DA 1V7QA 1XQ9A 4FZ5A 2AOVA 4BQSA 1H66A 4ENTA 2W2OA 1B3RA 4GGPA 4WOJA 3OH8A 1PTKA 3AI3A 1CZOA 1E63A 3RARA 4KPYA 4N5IX 3OAAD 4I8DA 1NVTA 4IKOA 1B6GA 4PHHA 4YNBA 1BQEA 4MJ3A 2EATA 3RS9A 4U8GA 4WNAA 4MDFA 1M2WA 2K2WA 2VJOA 2W2QA 1GG5A 1YKGA 2GHIA 2WOJA 3LUPA 4AW9A 5GPBA 2CJWB 3OX2A 5ALUA 1RWNA 5C8YA 3CZCA 5J5AA 3RUDA 3H5WA 3L4EA 4YO8A 4MA4A 2GT1A 2GFIA 4HNVA 3FCSB 2EU8A 2YQ4A 4D2IA 1W88A 2OV8A 3RSZA 3AI1A 4D9JA 1BHO1 4HR7A 1XL1A 1JPVA 1U2PA 3P0IA 2ECFA 2ZSBA 4K46A 1AUQA 1KC3A 1N2EA 1W75A 1WLSA 2X5JO 4FD3A 3O9MA 4PQGA 5TSDA 1KMMA 3F6PA 4QAJA 3TOXA 1CUDA 2CHUA 3SQWA 4KSBA 1NN1A 5DNEA 3HLKA 2PZGA 5KU7A 3HB4X 4AMUA 5C18A 2FMKA 3F6EX 4K40A 3I23A 4TLAA 4ETNA 2ZXFA 1XCLA 2ZUWA 2VHJA 4MMZB 5C7OO 2XMSA 3FWNA 3WRYC 5DBFA 3TINA 2PZEA 2ZIUB 3HI4A 2JAXA 3KU1A 4XGKA 4C4XA 1EINA 1CUCA 5IXYA 4JB8A 1QHHA 4IOKA 3TKLA 4OCZA 4ZZ1A 3IPRA 3ACCA 4UCQA 5I48A 2JVJA 4QASA 1YL7A 2O0JA 1KQ3A 2J3JA 4RV5A 2FPIB 3KHSA 3F5SA 3EDOA 1H22A 1YHYA 3L0CA 1YQXA 4LHWA 4UBLA 4P2BA 2EBUA 4P98A 1E32A 3U9SA 4AJ4A 1YTUA 2O7NA 1WX1A 4XX1A 3MB8A 1IFXA 4Y1FA 2J3DA 2YOGA 3EIEA 4FNGA 2OUIA 3ZE2B 1HNXB 4ZCRA 1CSEE 1HEUA 1WMSA 2LV8A 3B3AA 1N2XA 4LDJA 4WKCA 3WLKX 1M6HA 5LSAA 3TVDA 4DIBA 3SHTA 3V7NA 3ZCVA 1NSTA 2QLTA 4ZDKA 1XZLA 1QXSA 3K4PA 4C0AC 3PSAA 4GZ3A 4BZZA 1COWD 4R8RA 5EIHA 2ZCJA 3OPYA 3L46A 1EM6A 4PC1A 3HYLA 1AGYA 2BR4A 3DW3X 2Y1OA 4M83A 3WJ2A 2GLUA 1TUEA 1E1LA 1YQ9A 1H5NA 3N75A 1LVUA 1NPDA 2JGRA 3HKCA 2RK4A 3GA0A 5AKHA 2H3EA 4JMLA 4QPZA 1RQPA 3FVQA 4QTUB 1R9NA 2ZRIA 1SHKA 3PCRB 4GD3Q 5EE3A 5TMBA 3PGKA 3TZLA 3N2EA 5L3QB 4FJ2A 1VLHA 4J9UE 4ZRNA 4BO9A 3AX6A 3UA4A 1OF1A 4PANA 1G5HA 4LFAB 1PWXA 3QY9A 1WCIA 3W8FA 2BEWB 3MOIA 1PJZA 4LRYA 1YACA 1E4OA 1OPXA 4FZVA 2NM0A 2B82A 2D5IA 4RIFA 5IK2D 1N36B 3B5IA 1OH6A 3N39C 4GZ6A 2GZMA 3L7JA 4JYPA 2OHIA 1C3JA 1EBUA 1FVFA 2G5PA 3D1LA 4J0EA 1VBMA 3O38A 1ZICA 3BA6A 1N5KA 4O4LF 5FPSA 3ZJVA 1UFVA 1C3OB 1XTPA 3MTGA 1Z0DA 1KPGA 1D2RA 2HDNB 1V16A 1GZDA 3N2GA 4Q4AA 4UHDA 4X93A 4UTVA 3FNBA 1TVKB 1UBOS 3KSUA 3MJHA 4Y6RA 1DV1A 5JCJA 3WQQA 4F6CA 2MTBA 3GMSA 5DN6A 1ZA2A 4F3NA 4EKGA 4Z49A 1UFRA 1VHLA 2GK3A 1L5OA 4MITA 4X63A 1TYDE 1B15A 1ZRMA 4R6XA 4P7BA 5JD3A 4NENA 3W5CA 4L8WB 3CXRA 4ZK6A 1ORRA 3PFKA 1JSRA 2QJOA 2O9JA 2OG2A 3CMCO 5AI6A 2NYRA 1JIKA 5BOSA 3VV2A 2WILA 1E3MA 1MVLA 2JJYA 2P40A 2QHXA 3PDHA 3GOHA 3LRTA 4XQCA 5E7MA 5KCMA 3VO9A 5E1MA 3CZ4A 2BV3A 3DXZA 1CJCA 1CY7A 1HI9A 4S2UA 2XYHA 2ZI9A 1T0BA 2FG6C 3AW9A 4PYRA 3G5LA 2EG9A 1BOOA 2C8KA 4L57A 1B76A 3GELA 2ZWOA 1U9YA 2YWFA 1EVEA 3JD2A 4R16A 3WQRA 1QF7A 2PUEA 1C9MA 4FS8A 2DUNA 4WLNA 4A4DA 3FYUC 5GP1A 5KC8A 2FMUA 2HJSA 4F2WA 2AN1A 3AJDA 2ZBQA 2WMOB 1RKQA 3EXHA 1HEYA 2ZJ6A 4NAUA 1NI5A 1OASA 3LGXA 1SO8A 4Q05A 5JNWA 1EHYA 3EF3A 3ONFA 3OVMA 3PXCX 1SC6A 5CM2Z 2PXAA 4V0OA 4PHFA 2CNBA 1MAWA 4KC0A 3U3KA 1ONNA 5KYGA 5KVVA 5FV4A 2QMUA 2BE7A 2P3SA 3GQBB 4HF7A 4I0WB 5EWLB 2O2HA 2ZWPA 3KLPX 4CMEA 3STTA 3OOSA 4B46A 5BSRA 3S2ZA 4BDSA 3T1OA 2FMIA 2G0TA 3CONA 3IHWA 4A6DA 2XCIA 4FYHA 5FLKA 1U7WA 4QOIA 4V0KA 1YS2X 4JJIA 5ENDA 3WGMA 5HRUA 1GRNA 2IHBA 4KQWA 3ZV5A 3X1KA 1GTMA 3PHGA 4BO4A 3COZA 2YL2A 2OA0A 3JTEA 4IH4A 5SYNA 2GA8A 4X8HA 1UJNA 5EEGA 3IIKA 2Q4DA 3KQSA 2W43A 5HF5A 1A2KC 2XSZA 3A6PC 1ZCFA 2Y1WA 4K6FA 4J43A 2AHRA 5B7PA 1VZ3A 2NSJA 4QIHA 1VMEA 3RC1A 2PN1A 1HLPA 3CXUA 4UUBA 3H65A 1D9XA 2D06A 2DQZA 4PZPA 2QTVB 1H6CA 2QQGA 4DJJA 3GEDA 1NW5A 4YIHA 2G1PA 1AM4D 3W9UA 1U0OC 4LV6A 5BW6B 1KOLA 1TT7A 1PW5A 2D8AA 1Z16A 3TD6A 3L7KA 3I28A 2NYVA 5FD8A 5CDUA 4L74A 4H9GA 3I2IA 3EGDB 1JJIA 2HSEA 5KPJA 1Z0SA 2JFXA 1US8A 1ULHA 3ENVA 1SIBE 4Q01A 4YP5A 1K86A 2QWXA 3JZFA 1CNFA 4BPBA 4ZVPA 1CZRA 3N28A 4RK7A 5JXGA 3T5GA 4I1YA 2GRJA 2JASA 3ZE6A 4MEB