1EIWA

Solution structure of hypothetical protein mth538 from methanobacterium thermoautotrophicum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
VTAEIRLYITEGEVEDYRVFLERLEQSGLEWRPATPEDADAVIVLAGLWGTRRDEILGAVDLARKSSKPIITVRPYGLENVPPELEAVSSEVVGWNPHCIRDALEDALDVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based functional classification of hypothetical protein MTH538 from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics
molecule keywords HYPOTHETICAL PROTEIN MTH538
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein MTH538 1eiwA00
1EIWA
chains in the Genus database with same CATH superfamily
2WAAA 4RTRA 5HKLA 1P2TA 5KJ6A 2BP7B 2P6NA 3JD1A 3DZFA 1S6YA 3P4XA 2W48A 4PG5A 4BB6A 3MS7A 3C7KA 5ALVA 2R5FA 2AHRA 2RSLA 2OV2A 2X6TA 4FZVA 4HN9A 1UM9B 4L7QA 1XZIA 1X7DA 2DM6A 2ZYVX 4FCCA 2DU8A 4LJLA 5K0ZA 2NUPA 1X1RA 4QASA 4ZAWA 4RJ2A 3IHKA 2IFTA 3ZD8A 4M89A 3GW8A 3DOEA 4IL5A 2KSQA 4N12A 4E11A 2ZE6A 4MVJA 3AILA 4S2EA 3V32A 3VYVA 3HJCA 3FLMA 4EA7A 1XX6A 2E4YA 3UIEA 1BFUA 4XJTA 4UMEA 5DHUA 1JWLA 4J0FA 1D3AA 2ISQA 2Z56A 2NG1A 3I1YA 4KXLA 4DNOA 2J67A 2YN4A 1NLZA 1Z82A 1KDOA 4MB2A 2AIRA 4CODB 5B6IA 3I5YA 2IS4A 4NFHA 2X0IA 2B30A 3R5KA 4FBMA 3QVXA 3K35A 2E5FA 5HP4A 1I2CA 1X86B 4WCFA 2GXSA 1EEHA 5EE3A 2E89A 5IHPA 3KXIA 1ZOOA 3E22B 4HYEA 3KTAB 4M9QA 1YFKA 2VSYA 1X1EA 2Q2VA 1NNUA 2ZJ6A 1OFIA 2W0MA 2JD2A 1WUJS 3AK4A 4QYIA 4WUVA 4PTLA 5AK4A 4OYRA 5HGJA 4N8SA 1CJSA 2CNLA 3DHVA 3CKKA 4HAOA 4RADA 3M6LA 5HCUA 5T3UA 4BX8A 3T5GA 4DZZA 3ANTA 1W73A 1AA9A 3DDZX 2DQSA 3SICE 4CYMA 3NMUF 4JKOA 1U9IA 4G56A 4XOIA 3B8HA 3L79A 1WZUA 4GWKA 1ISRA 3KAQA 2C5LA 1NVXQ 5HK9A 1R6AA 1H6DA 1EA7A 4QA9A 2Z3VA 1QBKC 4L5YA 1XOIA 2R8RA 4CEIB 1LW7A 4P22A 3N3AC 4BV2A 3VKVA 2AZ4A 3BH6A 3IAM1 1SKUA 3SKYA 2GKSA 3ZJ5A 4N8DA 3L07A 3DZIA 3ZIUA 2E9SA 4I5FA 4BCDA 4HGZA 4Y1RB 1ZGCA 2PGNA 2P9QA 4M1EA 4OBBA 3Q9UA 4CQMD 1YACA 2HKIA 1T1RA 3RS2A 2PA0A 4WD3A 4EX7A 3NS7A 4RVSA 1X8JA 1JSCA 4Q1DA 1Z06A 2IBMA 4YONB 4W9MC 1J99A 4HAZA 3SFZA 4W1QA 4FGSA 5E4YA 2DTXA 2RHWA 2NO4A 4YUXA 3DQPA 4O2RA 1X92A 2XUIA 1AV7A 4RPJA 3C6XA 2J3EA 1T36A 4MROA 2Q0XA 5EL0A 4EL0A 3Q8MA 5DTMA 2CCJA 3WA7A 3EGWA 2PUTA 1A72A 2IYRA 3REQB 1J06A 3A4TA 1IXRC 1J7JA 3TOZA 3P9IA 1OKKD 3DTTA 3AI3A 4BEJA 4XUGB 4NAVA 4OQPA 1R6VA 4M98A 4WZ6A 2A5LA 5CAEA 1UJBA 5IUJC 4F91B 1BXRA 3K9CA 5T8KA 3O3OB 5A7HA 3OPMA 4UBIA 5DISB 3W9YA 2PZBA 2N46A 2NU6A 1NVVR 4I5GA 4L95C 2Z5FA 5DCUA 4KYVA 5LBIA 1GGFA 2I4TA 4HB0A 4Q7EA 5EKXA 2AEFA 2X8LA 3COSA 4KWTA 5C8YF 3AP2A 3H2JA 2NO6A 4PZEA 3CG4A 3GFRA 3WS7A 3C24A 1ESZA 2XWJI 2HF7A 1RFLA 4QATA 3N2KB 4UHCA 3G2PA 5J59A 2I3DA 1CUCA 1D9XA 2VJKA 3V4OA 1B0AA 5JCZA 1I4OA 1UBMS 3NV9A 1ZHFA 1Y1QA 4NU8X 3EOBI 1BXRB 3LF1A 1MORA 3SIWA 3A6JA 2XWSA 4KYIB 2ECPA 2JA2A 3I2GA 4CETA 1Y5MA 5EI5A 1M8GA 1MW9X 2AUTA 3LVFO 2VNKA 5AK5A 4YC7A 2RGCA 4CF5A 4DIBA 3R9XA 1UP6A 4YGYA 5ALJA 1KF0A 1KMNA 2JFFA 5AW9A 1AE1A 1AZSC 4B3IA 1E3MA 5HIIA 3ROGA 5KX5F 3VZRA 2EBFX 4JSYA 5DMXA 3ZJVA 1YAJA 3D3NA 5FH9A 5CVEA 1T8SA 2FK7A 2NIPA 2ZUDA 3INRA 4HDOB 2VLIA 4HDKB 4DG5A 3VVLA 1SXJB 1M0EA 2BONA 1VXOA 2VQSA 3D1VA 3D1JA 4QJ4A 4AN0A 4JNKA 2Y68A 2ZIGA 2DPXA 3OD1A 5TT1A 3RBXA 4I3HA 4YMLA 5KWEA 1UEIA 121PA 3L7BA 1EJ0A 3OQHA 3HS3A 1NG1A 1YI1A 1J20A 4B3TB 4MV4A 5EJ2A 1CNEA 5B58T 2OG2A 2F1KA 3IS3A 4O2BF 3AM3A 1UXJA 1B8OA 1CU1A 4J1SA 3PI7A 4PPFA 3RODA 4J29A 4D8UA 3ZWBA 1PEKE 1I2ZA 5KSYA 4WE3A 3ESRA 4EY7A 2P4QA 2AD5A 2XR1A 4KQFA 2FN4A 1U7UA 2B37A 3GGSA 4O8ZA 3AL3A 1QFYA 4U9UA 1EDOA 1CNMA 1W75A 2DFDA 3VVBA 4EF6A 1VFNA 2JH8A 3L6RA 2W8BA 4OBWA 3O6VA 3AGQA 4MVJD 4KR7A 1FDVA 2AKYA 1C5KA 4QQKA 4AVYA 4EHBA 3BVPA 1RD4A 2ZYWX 1WXQA 3FF4A 4WUTA 1FA9A 1L7AA 1Q16A 1N6RA 1EFLA 1HYBA 3LC2O 5FQNA 4YMWA 4EPVA 5BN4A 3L82B 6REQB 1F3OA 2UZ3A 3L77A 2BFFA 1X7ZA 2Z9BA 1HRKA 3FVRA 1QHSA 4QSMA 5JJBA 5A3RA 1QGUB 5SZJA 4TKZA 1WCV1 2VDPB 5KHLB 1C7JA 1I7PA 1U2QA 3JQ7B 1CYEA 1KY2A 3EC2A 1U11A 3QFFA 4I0WB 1Z12A 1D5CA 3C4JA 3H8SA 3QV2A 3GJ5A 1XYVA 3MWKA 4NE7A 2RC6A 3FSGD 4B7AA 5K03A 2ZS8A 2ZRJA 3D3WA 3I12A 3LH5A 2WW8A 4HXYA 5KSOA 5BNFA 1Z0KA 2WLTA 3OCVA 3LUCA 6REQA 3KTFA 4BO7A 2B3TA 2GASA 2QW8A 5K8JB 1PJLA 5DX1A 1XRMA 5I9IA 4C7KA 1O96B 5CA0F 6PFKA 1DAHA 4BYMA 2Q49A 1A98A 1G21B 2QGFA 4FI3C 1PGJA 4ITVA 4NFSA 4Z7NB 5JAOA 2VJQA 3C8ZA 3WKDA 4UVHA 4C2BA 5EQJB 4FFVA 1U5AA 1MABA 3UVEA 2E0IA 2XHZA 4O2AF 3VNVA 2DZDA 4OB6A 1H5NA 1FUEA 4O4HB 2VWPA 1YRQA 3OMXA 3D7RA 3F5SA 5K09A 3KQWA 1KYIA 1QH0A 2H4HA 4IMRA 4CIAA 1PNRA 1JJAA 2VH1A 2EAUA 4M0UA 2YV3A 4F46A 4V1CI 5FOTA 2B99A 2I71A 4RORA 5LXTF 5KYWA 1B16A 2PMKA 4B80A 4JIGA 1SQFA 3K6RA 1FB5A 3DTNA 2ZRFA 1U3UA 2OV8A 3DF9A 4I1OA 1JR4A 3AI2A 4IFIA 5JMWA 3KU1A 1VJ5A 2V0NA 3QMVA 4R6WA 3OCJA 4XD7A 5JTUA 2AQHA 3VA7A 3P9KA 3NBXX 1BC5A 3HSSA 1N2CA 3GEIA 1IN8A 2VH5R 2F43A 1XPRA 4TZ0A 3ADKA 1AIPA 1UBFA 1H2XA 4BNKA 2AE2A 4BKOA 3TCNA 1JHZA 2RGNA 4IW3B 5TB5A 4R1OA 2WD7A 2HQSA 1BXGA 4OXNA 4EEKA 1MR3F 4DR3B 2HK6A 2QSYA 2I2CA 5I8PA 4ZC1A 4XGNA 1ZOPA 1V7QA 3L7IA 1U7HA 2XW6A 2ENWA 2IRWA 1GSOA 3L0CA 4LISA 3VKWA 1ST2A 3VOBA 5JXGA 3ZGZA 2IJGX 1D4FA 1TLLA 3KZVA 1EFVB 3G2QA 1Z5VA 4M37A 3PHBE 3TWOA 5A4KA 1UPBA 1K8ZB 1L7RA 2FLWA 5JY1A 2IPOA 3E15A 4LN1A 1JDBB 4DIMA 3WSTA 1V48A 2VPQA 4L02A 3UW3A 1DV2A 2RB4A 1W87A 2C82A 3AR3A 4G9BA 4IFEA 5AHXA 9GPBA 1ULZA 3HNRA 2Z8ZA 3OHSX 4H7IA 5KVCA 5CDHA 2WM9B 4EHKA 4ON9A 4LC1A 3HCEA 1R37A 1EVKA 3JRNA 4KQIA 5SY9A 2B21A 4ZVKA 5D6OA 4X5OA 5JD5A 5HJ7A 3MCZA 4ZICA 4HXGA 4CI9A 5JAUA 3CVXA 4BUCA 2VQFB 3LVBA 4YMIA 5AOVA 1VMEA 4AUMA 4ZTUB 2QD4A 1TD9A 2Y6UA 3G8BA 4FOLA 4YWJA 5BUZA 4K9LA 3VM6A 4TVBA 1EM6A 3K9LA 5DFAA 4CEHA 2HSGA 2YHUA 3LZDA 5DH9A 2A9OA 4RQBA 1BA3A 1TJYA 2WJAA 5DI3B 1GQFA 2PTHA 4ZHSA 1UR5A 1XMPA 4IF6A 4J7XA 4Q15A 2B1IA 4IZHA 1B3RA 3N9IA 4IIUA 5TQJA 3ISJA 2NZ2A 2REOA 4LSZA 1PFKA 3NCTA 4EO7A 5JIBA 2ZSKA 4MO9A 5E6SB 5EWJB 4UXHA 5I7SA 4XDYA 5CMLA 3V9PA 1U1DA 4P32A 1R3UA 2QPOA 2KI5A 3M4YA 3PGVA 1SC1A 4QFCA 3QIVA 1UBOS 9LDBA 3OZTA 4P83A 2HPAA 2VAXA 3LJKA 1DMSA 3CPHA 4YJ3A 2V59A 3PR3A 1NBHA 2ASVA 2JEOA 3KJIA 3M5WA 1QB8A 4EHNA 4EYKA 4KO3S 4RH0A 2QIPA 3CBGA 3RS9A 1RMTA 5GOTA 1TRKA 1N1EA 3KJZA 1V3VA 3FKSA 4Y1GA 5CIWA 3CZ4A 3ADPA 4QOIA 1KIMA 5KC9A 2H4JA 3FFAA 4R2XA 1PUXA 3BIOA 3IRVA 2UYQA 4MZXA 3W2FA 5K8LA 3ZHBA 4KAXA 1AXEA 1F9EA 1Q1BA 1A8IA 1P77A 5TR9A 1E3WA 2Q1UA 1G4UR 3DT6A 2MYUA 4HMPA 2PRYA 4O8CA 4PC2A 4DR5B 4M8IA 2JGEA 2TS1A 1IM8A 5LWHA 1GO2A 4DAOA 2BFNA 3PGMA 4ZAXA 3ZCTA 4A2PA 1UC9A 1YQTA 2QQGA 2P9EA 3QPVA 1C8KA 4H4EA 3ZX5A 4ZI7F 1PNTA 3IH5A 3IAAA 5THQA 2Y0BA 2ZRLA 3K0CC 5KBYA 3FRIA 2C4KA 2OM6A 5AICA 4MUAA 3BIJA 1JE0A 3GLIE 2XUDA 3Q6NA 5IARA 2HPVA 5CH8A 1Q3KA 4ZYYA 3UENA 4HYQA 2YUTA 3RAGA 3B9PA 3U31A 3VC3A 1HK7A 1YVRA 1VCHA 3RR2A 3DG9A 4K9NA 2DB3A 2J5QA 1U0FA 3Q3IA 5C3UA 3TTYA 4I4IA 4DA7A 3SC2A 4XARA 2B4YA 1TZCA 2IUFA 1SBNE 1PTJC 4R8LA 4WFIA 4AECA 5B36A 3GZJA 5BMVA 3U37A 4X90A 4MKXA 4RXUA 2XXJA 5FB3A 1Y6FA 2JGIA 2VP2A 4Y6PA 4LOJA 4WDQA 3WE7A 4ERNA 2JFWA 2XEXA 4S35A 5C8ZA 4D57A 1NXTA 4GG1A 1JU9A 1PZHA 3GDFA 3LYHA 4LXGA 4UM9B 1U4NA 5B7QA 4IKPA 3WKCA 2XGMA 2G17A 4FYYA 5JEDA 4OK3A 3D6HA 3LUPA 1YO6A 1BX3A 1GLGA 2BZ1A 1CNFA 1VKZA 2A9RA 3KTDA 3NAMA 4FIDA 4MGEA 5LBUA 3M6WA 1OFUX 3CZAA 1HQYE 2WWHA 1QQ5A 3O2JA 4K88A 3SKVA 1FSFA 1KO4A 3VNQA 4B84A 5CH5A 2FPRA 2P7IA 2A5DA 4WBXC 5AXAA 3L6DA 2HYIC 3ONNA 4RPKA 4E15A 3WXBA 2B94A 4AMGA 1KP2A 2DQZA 3WOVA 5H9WA 1QO7A 1UPUA 5HBGA 4L4UA 3HXQA 1ODTC 2B4AA 4X20A 4IKEA 2IUSA 1R88A 4M0MA 4B8WA 1NVUQ 5SZKB 2H59A 4GLLA 5IDQA 2M6SA 3U26A 1UK9A 2VPXA 4AJ1A 4MUKA 3C3BA 3CZ9A 1M6YA 1PFUA 5HZKA 5B3JC 2EKBA 1XBTA 5CBKA 3VJMA 3KSBC 2BDUA 1VMDA 3I4FA 4IAOA 4FOSA 1OYVA 1RRKA 1Q14A 1Q0PA 1ZCFA 2CLIB 2XJ9A 3DVAA 3CNBA 3VPFA 3IQZA 2V7XA 3RADC 5JNUA 5IMSA 1AK2A 1QK4A 2I6XA 3NIFB 1H93A 2H7YA 3EW9A 4FZJA 1JYEA 3PNMA 3B89A 3GH1A 2CFIA 1EFDN 2HL6A 1M34A 2R6ZA 4FEYA 5ERXA 4DVJA 3IAS1 3MRTA 1II8B 4G4GA 2AJBA 1ZJZA 3ZY4A 1K4KA 4MW0A 5LQUA 4HEHA 3LYUA 1Z5NA 5IM4A 1R8SA 1XQYA 3V7NA 1QYXA 3ZHSA 1FFEA 5HKBA 4N3GA 4RM3A 4K05A 4Q0MA 5A9SA 1M2JA 3TW8A 1E8MA 2ZWMA 2VSQA 1QTIA 4EL5A 4OBEA 3AO0B 5T64A 1UDBA 4RMNA 3HUUA 2PQMA 4C5AA 3O3MB 3OZGA 3KZMA 2HRQA 3G59A 3A9UA 3SZGA 2J48A 3PUIA 3TAHA 1V11B 5BSHA 2C7QA 2ZJ0A 5DHSA 2CV1A 4MXDA 1I36A 4D9JA 3E8XA 1D09A 5GAJA 1ECBA 5BR4A 3O47A 2C5HA 5GJBA 1UBEA 4Y2HA 1EFVA 2O4CA 2FH5B 3WADA 5JDIA 4ZAZA 2QRNA 5AVXA 4BLTA 4PZLA 1P2BA 3ZG6A 4BC0A 3RW9A 5DK4A 1P0IA 1EGVB 1FE8A 1V45E 5FFNA 3NDPA 4GM1A 1YRAA 1NKSA 3ELYA 5D3MB 3QWFA 3KNZA 1PAUA 2J3LA 4H1WA 2NYUA 3I72A 4W7IA 2Z6QA 1AN9A 1ZAKA 3HJBA 4H3VA 3ND5A 5AVUA 3AONB 2IPMA 3OPYA 5JQGA 1RKVA 4TSFA 2FMUA 1XALA 3TFWA 3UJ6A 2AEEA 4TRJA 1I5OA 4ZPJA 5IC5A 3COPA 1JRLA 2ZIAA 2FP3A 1G5RA 3N2GA 4AKHA 1ZITA 3K53A 3ZWNA 4WLUA 1DWUA 1ABBA 4F0JA 3WAJA 1Z7GA 4CNQA 1DJQA 2HSDA 4JBWA 1AUPA 1M1UA 2BZSA 2CV0A 5JHHB 3KUXA 4DF3A 1DTWA 4DUGD 3MB5A 4D4GA 1C9DB 2WNSA 5IW8A 3TM4A 2I9KA 5ALOA 2GF0A 2WTAA 4O2AA 4QULA 1V96A 3DOIA 5FIUA 5FUXA 1Y8AA 4TZ6A 4Q1FA 4MI6A 2XVYA 3H11B 3PXGA 4CMHA 3ORYA 3CRQA 3EXAA 4BEBA 1CEXA 4JSTA 3IUMA 4OI2A 3VNRA 1INLA 2P7HA 2A1TS 3PPWA 5JWHA 2WQ7A 5K01A 2QMQA 4OHRA 3K9QO 5LWQA 1NF8A 4K9DA 4NZ9A 4JP3A 4PX2A 3MJ4A 5DP2A 4ZVUA 4G4SP 3KLPX 1WS6A 4OSOA 3UATA 3VR2A 1UK7A 3OJOA 1RJGA 1JEJA 1G0OA 1QPZA 1I8TA 2F1HA 4Q9JA 2WPDA 3DZHA 3WNQA 4PSDA 1N8SA 4EKEA 1YQ9A 2H5LA 4JI0B 3AVTA 1GGKA 1O6FA 4JC0A 4OLAA 4WLNA 2IXTA 2PKRA 3M49A 4ZI2A 1CHDA 3I34X 1I4TD 1F17A 1WP9A 4MI9A 4A82A 5CYGA 2GFHA 3T1NA 2WWVD 1FYDA 1HE8B 1X3SA 5EJ5A 2EJTA 3EIXA 4YROA 1ZN8A 2YQ5A 4NJEA 1XVIA 4PINA 5E2BA 3JTMA 5AUPB 2QQFA 3LT2A 4NYJR 4IHJA 2PTGA 5E4TA 6NULA 1JIUA 2GAOA 4DYHA 4JEMA 3DHYA 3ZCXA 1ZJ6A 5KOIA 2P8SA 1E18A 4EB8A 2F00A 4ITRC 2GNAA 3O8QA 3PZBA 1BWQA 2HNAA 3G49A 1TCVA 5TQ2A 4LI0A 3L7NA 2H7CA 2UDPA 3GZTB 2CL0X 5CX1B 4DCMA 4F56A 1JG4A 2QL6A 3OFND 1H22A 4MV5A 4Y9RA 4GOMD 1M7BA 2W8BB 1YONA 2HNKA 1WBJB 1T5BA 2C54A 2VHZA 4WESB 5DNVA 4BAUA 4ERXA 3BA6A 2R8PA 5FEMA 2FPOA 4Y6QA 4CCYB 3HBLA 5DNDA 1JHAA 4G8BA 5JYCA 3EZ7A 3UT0A 1OPRA 1G8HA 1LI7A 3ROMA 2I55A 3WK6A 1O6GA 5EPOA 1CUWA 1ACJA 4HZUA 4WAUA 1V8DA 3RVQA 3UJCA 2ZSFA 4HWOA 4R83A 1D2GA 2Y2UA 4IOLA 1RTKA 5EKTA 2R66A 3N8IA 4OV6B 3JQ7A 1XP5A 4YEDA 3QPCA 2JL1A 1P0CA 4PYLA 2PLFA 1NX9A 3OZXA 1W44A 1BU5A 2V3WA 2ZAGA 2MSNA 3AESB 2CHGA 2I76A 4BFXA 4JYBA 3EAQA 3QKSA 4IDGA 1RR6A 1Y81A 1E9BA 1QIMA 1YRBA 2QI9F 4AYTA 3E4DA 1CUBA 2QSZA 3HCDA 3L05A 5AW0A 3LQ4A 1RM4A 5JI2E 1QIGA 1T4BA 2PH3A 1C2TA 2O5EA 1UWKA 3L49A 1PP4A 2O23A 1PU2A 3BFPA 3HKCB 1XI2A 2ZKLA 3QVUA 1H2ZA 2OZLB 3R2JA 4I2VA 5KSZA 2NXJA 3CF2A 5LLDA 4JCOA 3ST7A 2HF9A 4ZV9A 4BGVA 5KNCA 2BH2A 3GLKA 4Q3KA 2FMHA 2JFUA 4G84A 4KO8A 4Q47A 4P2GA 5TS2A 4W5QA 1FBTA 3WYNA 1JMYA 2DT5A 1GPBA 1UKAA 2ETXA 4MPDA 4PSUA 2D3WA 3KYCB 4KQCA 2YZMA 3ECCA 1OXMA 4CU2A 1R18A 2WTUA 1HDGO 3ROQA 1JPNA 3EGVA 3F9CA 2DHCA 5DNYB 4RLHA 3JPWA 1EUCB 2P5UA 3WMXA 5AVQA 3QE9Y 3B1ZA 4PHHA 2RKOA 3SVLA 3TECE 1BMQA 4LQ4A 4BP8A 1B43A 1BJRE 1Y82A 2GN4A 3HA5A 4U2CA 2Y1GA 1TCCA 1ENOA 3SLKA 5BP7A 3NGLA 3GPLA 1PS8A 3DE2X 1R4MA 1C30B 1PW7A 1RQLA 3OO0A 4MYHA 4RD1A 4X60A 1R4NB 4PPGA 3WKEA 4YXFA 4MCJA 2QN9A 3H8JA 3BJRA 2W37A 2YYZA 4BBPA 2WWIA 2W2KB 1KEVA 3L8DA 3VYWA 4IDHA 1AO0A 2CXTA 5I4KA 4G65A 4PX9A 4G8CA 1UXHA 4GYKA 4B48A 1GOTA 5COAA 1W6UA 3CVOA 2IYSA 4TV9F 4AY6A 2HNBA 4HX5A 2J5KA 1RHUA 1ZUNA 2CJYA 2VP3A 3F98A 4BEWA 2ISSD 2XQGA 3DW3X 3LP8A 4O3FA 1II9A 3QKWA 4KREA 1LCIA 1ZGJA 2FN8A 2C96A 2F1JA 2IU4A 1HKHA 2RGXA 2D0DA 2V7EA 3I9KA 4HF7A 5LDGA 4JYAB 3EC7A 1A7JA 3NW9A 4AQYB 4NBNA 4OO3A 2NSDA 3K9BA 2ASEA 3Q7IA 3CONA 2O2GA 5FBVB 3CE6A 3MFQA 4G1FA 4JKIA 3HBAA 3NBQA 3KHKA 1JIIA 4WZAB 4BV3A 1B15A 5JBNA 3HU2A 5G4KB 4TTAA 3ZQJA 1IQ0A 1XMXA 4W5RA 2V74B 3V9AA 3CJRA 3H2IA 2REBA 4LSGA 3GFOA 1TVKA 1U3VA 4JBYA 3JZDA 4B4VA 1Y8QB 2P0EA 3W34A 3BEDA 3DEJA 4AY5A 5CEFA 3K0AB 1X74A 2C95A 2QVZX 3MT9A 1FF9A 1PWEA 2GYWA 4L5BA 2RK3A 3R77A 3ZI7A 4A8TA 4YP5A 1JHOA 1VPVA 1BYIA 1WSWA 1IUNA 1VQ1A 3M6AA 1BWSA 2HA5A 4BNDA 5JFTA 2XGJA 1F4PA 2JZNA 3RYFB 1JPJA 1P9OA 3IP1A 3W7BA 4JP5A 2C04A 3T7TA 2WZQA 4IH9A 2PX6A 1D7OA 4A0SA 5C1DA 4EPXA 3B2EA 1Z08A 3DVRX 3A1WA 3E4CA 3NOOA 1XZ8A 1NZJA 1YRLA 5FLKA 5TPZA 1WXEA 1B6TA 1YA8A 1NPYA 2PH5A 3BCSA 3FHTA 3GGGA 3PUWA 2GLUA 4E12A 3CLHA 1GUAA 3GBVA 3UPTA 2DECA 3IBSA 4D4HA 3FRJA 1J97A 5CM8B 3LIPA 1B4DA 5AT1A 3DL7A 3KT8A 4IQ8A 1E58A 3LG2A 4J2TA 3A6DA 3SFTA 4R3WA 4MLZA 4EKIA 1ULTA 4Q4AA 4EYGA 5EXTA 4CLRA 4HC4A 4WLEA 4PQEA 5DHQA 4JX8A 4L4ZA 1UC8A 2LNDA 2NZ8A 2JARA 3DEHA 3OLZA 1JIVA 3RBVA 5C9ZA 3PXEA 1G9XA 4I1VA 3TIXB 3ZK8A 1PG2A 2XYPA 2DFLA 2P40A 3AF5A 5KVAA 1XIVA 1EG7A 2VP9A 1CUGA 2F7SA 1DG3A 3D4NA 3QPWA 3U1VA 4A0FA 1AY0A 3WRWA 1A71A 1K5GA 1TTQB 2E4XA 5I3CA 2EGHA 1YJAA 3FOAA 3KJHA 4P54A 1Z0DA 1HH4A 1I51A 1OY1A 1ZICA 4DIOA 1CUSA 4YRNA 1HE5A 1AXGA 2Q9CA 3AV0B 3B78A 1JQ5A 2A30A 1ESNA 3VR6H 2XLBA 2EF1A 5C4IA 4UHDA 1AS2A 5ERYA 4Y0AA 3H9UA 4OHOA 2P62A 4K9QA 2QD3A 1RM5A 3LT0A 4NHEA 2AI3A 3TL3A 4BFUA 4ZTZB 3UICA 2RONA 3I52A 1QCDA 1UOPA 1QG0A 3OLYA 4GQBA 1D2CA 4IDEA 4RCYA 3SF8B 3SHWA 3VHXA 3VPCA 3ZOZA 3PCTA 5CTAA 3WLNA 2C9DA 4EB0A 1K75A 1XD8A 4YK7A 1QSGA 2B6HA 1P74A 1LDNA 2XVXA 2YVAA 3E3AA 3E82A 2YVUA 4JLKA 4QHSA 5F64A 5ITVA 5BSTA 4PS1A 2VHWA 4YR7A 1QS0B 1RADA 2BLLA 1UKZA 1YHYA 3A1FA 3WWYA 3J80A 3AG6A 5F98A 5A0FA 3NNSA 5I5EA 4YDHB 1OX4A 3JATB 3PQ8A 4DLTA 1W1UA 2CLKB 4QFMA 1T2DA 1Z6GA 3AR6A 2A78A 2XCTB 3GYGA 4JS0A 4DABA 3UOAB 2OFWA 5ERGB 2PV0A 3ROPA 2X9QA 2OHHA 1KR5A 3OIVA 1Y3AA 2ZQ5A 2R5WA 2YRXA 5F9FA 2PG3A 2QD5A 2HO5A 4RX1A 4R5HA 3I0ZA 2C2KA 1Y4UA 4HKTA 3U4AA 3TB4A 1QHFA 1OILA 1T9BA 4Q3BA 4E1VA 3G9QA 2JI7A 3CM0A 4QDJA 1UKVY 2JGDB 2EKPA 3NIBA 1A77A 1M2WA 2OP0A 1P1BA 1JXQA 1R16A 1YFJA 5GGYA 1Y4ZA 3PNPA 3DHNA 2EATA 5IT5A 2Q3HA 4DEXA 3PG5A 1JIQA 1LSSA 1HT3A 3HO6A 1N34B 4JI4B 3LP5A 1JEEA 5E0OA 1SBTA 4EF5A 5D3ZA 5E8RA 4B44A 2C4HA 1TJPB 3L5KA 2HSZA 5CW2A 3EG9B 4JJ8A 3IBFA 4JP1A 2EARA 2VYCA 3DLPX 4C9BA 4ZHQB 4BB5A 2Z1NA 5C1PA 3K16A 5T67A 4BFZA 2FEKA 3TDKA 3FVTA 2FWRA 1KO7A 3PLNA 3W4KA 1EVQA 1T3GA 3SBOA 1P9LA 3QWBA 1Z0UA 5DV9A 3D8BA 4OHPA 1AKWA 2WE8A 3TGLA 1J8FA 2DBVO 1FFWA 1TZJA 1RXSA 1AB5A 4XQGA 5AOCA 3SD7A 4A73A 2IIVA 1CQJA 4HXEB 4DDTA 3C6BA 3B1FA 3MS4A 4C0QC 2JEYA 2YV5A 3O2QB 1IHDA 2CMKA 2IHNA 2OYSA 3VQTA 5C80A 2ZWAA 3VH3A 1BDHA 1D6SA 3FJOA 3ZU5A 1DTSA 1SUSA 2FEOA 2LXNA 4MYRA 3TPCA 3GRPA 3GUZA 2VHJA 3EGIA 1A4IA 2NQTA 3I9V6 5KQSA 1A50B 1UZNA 3K20A 5DYYA 2QMZA 4DCTA 4MV7A 3Q9NA 3EVZA 1SHTX 3MMSA 1T5SA 2IPXA 4J9UE 4KN5A 2QV7A 1NSYA 3AERB 2OMEA 3BCRA 3CURA 2GTIA 3DTVA 4KGXA 3T94A 1BOOA 5LD2B 1LVUA 3ETGA 4CM4A 2X3UA 2VYVA 2RBEA 1TEXA 2NNLD 4BFLA 4Y8VA 1SXPA 2COUA 3AIKA 3DKPA 4D9BA 1FVXA 5L3VA 2DHRA 3A1SA 5PGMA 4TKLA 2HDOA 3P9RA 5E95A 1ONNA 3R8XA 4M1TA 3ZHCA 1KPGA 2C4WA 3KFLA 2ZEJA 3PK0A 3TTWA 4PLFA 4BDSA 4EY6A 3A9WA 2I4RA 5AOAA 4CG2A 2CUKA 3IOYA 2J3QA 2DY0A 4BFYA 1S0UA 2DQ4A 1UPXA 3U1BA 3PDIB 1RLTA 2R65A 4Q16A 4X71A 2JH9A 2B82A 4FMDB 2FRDA 3T6KA 2JAXA 3OZRA 4LWQA 1O94D 3W1WA 2IH4A 4BJ1A 2WWTA 3K0HA 2VJPA 4GOOD 3SHFA 1QTRA 5KTMA 2A58A 5I9BA 4PBTA 4AF6A 2H9AA 1CERA 1WD5A 4HX2A 3ES9A 1HTTA 1H3EA 3WJ7A 3WA6A 4CMGA 3KUUA 2BFDB 3R3WA 1WKCA 1NDHA 3FETA 2CHUA 3WYAA 3HLTA 1N3YA 3FWYA 3LCCA 4JT9A 1GYPA 3TL2A 3ZWMA 5CDFA 4L72A 5DHRA 1TZ2A 2HIGA 4FFMA 3KVOA 4NQZA 5E7QA 3S40A 4EW1A 1PS0A 4MQ4A 2QG9A 1QVVA 4ND8B 4JOSA 4EW6A 2X8BA 3JQ8B 1AG9A 1FQKA 2ZB4A 4LNUB 3RS7A 3UOGA 4UTVA 3WIBA 4IOMA 1J07A 3H97A 4MAFA 5JPIA 2O8DA 4DV4B 3CB2A 2P2DA 3QXHA 4F97A 3TQRA 4OAPA 1D1PA 1OLSA 2Q7DA 4ZEXA 2O59A 4C08A 4J0GA 5HFAA 3Q11A 5ALEA 3RWMB 5E6UB 1LZKA 2GI4A 3I9FA 4XKJA 4BC1A 4CUZA 1E7SA 2I80A 3ICPA 3QVMA 1FIUA 1PWZA 3ROZA 2GRUA 2EFDB 4TS9A 1C4KA 5TVGA 1OH7A 2AN9A 5D3KA 1ZN9A 4FQ8A 5HXAA 3ADDA 2MT9A 4NH0A 4BS9A 2P9ZA 3E1SA 4LV5B 2G9QA 1LV8A 1SKQA 3TNDA 3BGSA 1CQIA 2V54A 1Q95A 5GZ6A 3IUJA 3K1YA 5T41A 4CUKA 2ZJYA 3BWCA 1GNSA 4IIDA 4QGAA 1BA2A 2IOFK 3A28A 3C2QA 3D3WB 4LX8A 5DB4A 1SD1A 2HY7A 2XDQB 1I1NA 2R60A 1RZ3A 4RTNA 4UUQA 1EINA 4XIJA 3KPUA 1SIWA 4RDCA 2B1RA 3ZJUA 3SC2B 5A3JA 4QG3A 4XGKA 2AKEA 4JP2A 4JX9A 5A1TA 4X41A 2OBFA 1MIOA 1SCAA 1V8FA 1FP7A 1GFWA 3P2EA 1S89A 2HQRA 3LK7A 5AWFC 3WLQA 2D13A 4JH0A 3LYLA 4GVLA 2P65A 3H04A 3HVUA 1I2AA 2YUIA 1JHYA 1RKUA 3GEDA 3HJUA 2X0KA 4IDBA 1EU1A 3RNOA 3GMSA 2B2CA 4QUAA 2HHHB 2A9KA 3HSYA 3KPWA 2JGKA 3KXDA 1GQQA 1B74A 3F7TA 4CF6A 4EK9A 1EH5A 4W5OA 2VAPA 2VJYA 4X3CA 3EGXA 4D3DA 4E1AA 3U1TA 1R5BA 4CMIB 2H16A 1RHRA 3LBAA 1L3IA 4MWTA 3KQTA 1S7GA 1XN1A 3ZCSA 4EHHA 1REQB 2GK7A 4RJTA 5BSEA 3IKLA 2IZZA 4OM8A 2Q27A 4KG7A 2WK1A 3DEAA 1E9VA 2FEMA 1PJ4A 1EHYA 1HXHA 1Y9ZA 1CQZA 2DUMA 1NVGA 1UBGA 3D7SA 4UUAA 1UXGA 3SX2A 3TX6A 1FDTA 4K8RB 5JVDB 3UPDA 1QZTA 5LP1A 2C00A 1YR8A 2P9HA 3A70A 5DF1A 5K0EA 1F6DA 3KR9A 1OKKA 1Y4SA 1QCZA 3ZH9B 2GZDA 2K6GA 4RHYA 3RYTC 2J6BA 4OSPA 2GA8A 3ZGNA 4E94A 3FYSA 1HYHA 3QA9A 4KGVA 1ZH6A 4YN3A 1VA5A 4RK5A 2QYOA 3HWX1 2AWOA 4JU8A 2RHOA 4B9AA 3OPYB 2VDQB 4TM8A 1YTUA 3UHOA 2UZ1A 1JXAA 3BERA 1VHLA 4ZKEA 3V2UA 4FYVA 1UMDB 1U1FA 2H4YA 5FYQA 2L82A 1CUZA 3PFKA 3G13A 5C4GB 2A5JA 4FYIA 1UWVA 2V8OA 3P2IA 4HSEA 5TPWA 4QU5A 3L2OB 1L7OA 2YOFA 3GRRA 3GN1A 3X1WA 3NVKI 2WRZA 2QTLA 3AUYA 3WLEA 2VNIA 3KYBA 4FSHA 2XQVA 2P6OA 1J8QA 3SE7A 4C0KA 1ORWA 1QOQB 1LZLA 1N5DA 2P6UA 2Q29A 4WPGA 4GFDA 5CG2A 2MJLA 1DC3A 1NUHA 3KPVA 5K1ZA 4RTMA 2EW1A 4DADA 4LF6B 2C3UA 2FWNA 1C30A 1JEDA 3VUEA 1LF0A 1U6IA 3DDSA 4Q3CA 2NU6B 5EMNA 5HKAA 3T7IA 4CHTA 4QUEA 2C61A 3MG9A 4BKQA 3FTCA 5MFZA 4YLGA 4CDMA 5JNRA 3C5WP 2X19A 4N5IX 5EZSA 5TPWB 1QQTA 1NBMD 3D6MA 4HNHA 5K4HA 1VPDA 1KVRA 1MC8A 4HB2A 1H2FA 1X1AA 4FEAA 2DJ5A 4ZU1X 1CIVA 3U0VA 3E9DA 4UAJA 2AK3A 3LC0A 5EAIA 3K9GA 3TRKA 2YS6A 3K0FB 1LUAA 5BO5A 3B2NA 1E1YA 4F06A 2RDMA 4ZI3A 5C5DA 3LBYA 5P8WA 2G1KA 4WXHA 4TKVA 4EFMA 4NC9A 4AZ0A 2A57A 1KI2A 1FJXA 2DPLA 3OU2A 4FGUA 3RVRA 2JLXA 2G06A 3TE6A 3T7SA 1JLRA 2ZE8A 4OAOA 4TUYA 3PZRA 5G2OA 2P68A 4Q1VA 3RVJA 3CCFA 3TBFA 1DIHA 2JAHA 2OCBA 4LJRA 2PSSA 3IUNA 4ML3A 5I7WA 3IELA 4NE9A 3IQHX 3GFSA 1BW9A 2XXAB 2CLOB 1WQ3A 2BSXA 2YVKA 4OGKA 3U4QB 1KU6A 3AUJB 3SMQA 3LWZA 2CMDA 1OHHA 2I7DA 2Q3BA 3I2YX 5EYPA 4JYZA 3E61A 2EFEB 2XD4A 5FBZA 3C14C 5IX8A 1ZVKA 2VTBB 1E2DA 1MRNA 4HCJA 4IPTA 1OH6A 1RPNA 3CMMA 3AVVA 1R6BX 1ICIA 4U8HA 2Q5OA 1WUHS 4FE7A 5J1SB 5AXCA 2PT6A 4Y67A 3OCUA 3UT5A 2VT7A 2A5GA 3BPSA 4IUCS 4TPKA 3ZI0A 5IG2A 3AWDA 3MNFA 3CNLA 3RG2A 3F5DA 1KI9A 4LW8A 4L28A 3CUKA 4F6CA 2FPIA 2J3KA 4R1SA 2I66A 1IPHA 1IFXA 3I83A 2A3RA 2ZJFA 4H60A 3D54D 3WNCA 1IB6A 1JPUA 1X1SA 3WK4A 3B1KA 1S5PA 4PSVA 3KVNA 3DFZA 3RYHA 1DRWA 4V38A 4PNEA 1XNRB 5LPNA 1ISFA 1GUBA 3F7NA 3HO8A 4PIMA 5EWLB 3L0PA 4OU4A 1Q92A 3PIRA 4B3XA 4Q3OA 2V3CC 3D59A 2GN6A 4HEA6 1X42A 2DF8A 3GU3A 3K5IA 4HO1X 5ITWA 1F14A 3W7AA 4C4PA 4DTIA 5L4SA 1ARZA 3GD7A 2Q62A 2BFBB 1S7CA 1W25A 4AUKA 2H1SA 2IGBA 1DC4A 1O5IA 3EDOA 2JGLA 3SKXA 2HTEA 2GSDA 3KKNA 3MOGA 3R5XA 4Y2XA 5G41A 4QAJA 1QGUA 2DPHA 5MGNA 4V3CA 1XYGA 1ACMA 3A26A 4F5DA 4QVKA 3WDKA 5FWXA 5EC8A 2EWWA 4MRMA 3JXEA 5BSRA 4H6WA 4RFSB 4ZAYA 4QUDA 5FORA 1IHOA 3TXXA 5JCOA 4L8GA 5DK6A 1ZXXA 2OENG 4CLRB 3EEOA 1XAIA 4WESA 5DTRA 3DL0A 2WTNA 2ZJOA 1MA0A 3E2MA 4CKWB 4AY4A 4CPDA 4MDFA 2ZUTA 2C4UA 2HWKA 1AF7A 3V1NA 4HGOA 4WX2B 5FDFA 1AQIA 5ESRA 2QJRA 2YN0A 1UINA 2XUAA 3O73A 1YKFA 2ZBGA 3JARB 3DH0A 3VV2A 4KI0A 1FS6A 3GNSA 3HACA 3LCJA 4LGCA 5EE1A 4BO6A 3UUEA 2ILTA 5WRFA 4KE7A 4IVPA 4WOBA 5EP2A 5KAPA 3U17A 2UUOA 3IUQA 4KLZA 1N2BA 1L1FA 1VLLA 3C97A 2Q4DA 1IRIA 1QGAA 2V6BA 4MV6A 1NG9A 3RS4A 5EG5A 3KEGA 2O7SA 3LFUA 1R6DA 2NVWA 4MUEA 5LZ8A 5D6NA 1J9EA 1P2SA 2SECE 3DXYA 2R86A 3AIMA 4CV0A 4CEJA 2GWHA 2OLKA 2OZLA 4IIHA 2WFZA 3ZV7A 3A7DA 5DTIA 3W3ZB 1E2UA 1TZKA 1T2NA 1J9GA 2O8FA 4G5HA 2R3SA 4KACA 4C3OB 4DJJA 1GY8A 2I2BA 1SVOA 1OLOA 4A5SA 4II2A 5E38A 3CUWA 1G7RA 2GCNA 3PPYA 4ZV7A 2PANA 3ZXIA 4LOAA 5FWYA 5FUMA 1GFIA 5HIAA 4M21A 1MVLA 1NQVA 3GJZA 1S01A 2W43A 3DYVA 4KN8A 2IDJA 4LWZA 3UJBA 5BN1A 2I1VB 2VHCA 3MTQA 5HKKA 4NV1A 5FXMA 4B6OA 2X2FA 1ZCBA 1E79D 3R3YA 3D3EA 2RGDA 4OD0A 4DLPA 3U5ZB 3DDUA 3FOCA 4HQ0A 4TRRA 2YWJA 1TO2E 4C14A 1KO1A 3PUYA 1W93A 4TZTA 5SYAA 1APBA 3NTRA 3M2PA 5DGDA 4R71A 4PZDA 1OYYA 3S7ZA 1GGHA 1FFXA 4K1XA 4C29A 1FW8A 3RHTA 1QF9A 2R47A 1ZHHA 1WB9A 1R8JA 2VNSA 3GLTA 4XYBA 2WMDA 4B3RB 5AKHA 1NW5A 1VE7A 3PQ7A 4ZT2A 1JQDA 4DMHA 1ZA1A 3B5JA 1V6SA 2XA1A 5BYBA 2XD9A 5E1OA 3V7YA 3AG5A 5TQVA 3IT2A 5F3WB 3O8QB 3RTAA 1DG9A 1C9YA 1JH9A 2QX6A 1U7XA 3P4YA 2YC2C 3C7CB 3INGA 4J7CA 1YT5A 5HDQA 3IHTA 1DBRA 3CRZA 1YF3A 3AF3A 3VZPA 3VNAA 3G6KA 1V3QE 2XMDA 4MI3A 1VBMA 4UJ3A 2BELA 2GUGA 4MARA 5FPHA 1ZG3A 2XT0A 2VDOB 3LGXA 4GH5A 3GB9A 4KTTE 5EFOA 3ONWA 2WSLA 4GNKA 3ZD7A 2PZMA 4Q34A 1L4YA 5TARA 1RAAA 5IXJA 1G59A 3GZNB 3AHFA 4Z5XA 3O91A 3G0DA 4Y1RA 1IE3A 1QDEA 1QV9A 5DYNA 4WOPA 3ZCVA 2GX6A 3OPQA 4KQ6A 1XDUA 5JSYA 2Q4TA 3B70A 5FTKA 2BV3A 2Q4OA 1ZD5A 1NRJB 4FGKA 4OB8A 3TLGB 1UQRA 4ND1A 4E13A 1GL6A 1PNVA 4DRYA 1JR6A 1Z36A 4YQFA 4LY9A 1E4VA 2POQX 3M6XA 4O4IF 4V0NA 5KCMA 5KWIA 1PV1A 2C07A 4BO9A 5ELXA 3K73O 3QOFA 3WBFA 3DKVA 4BP9A 4X00A 3HV2A 4OP3A 4CKZA 1BROA 3NEYA 3LRXA 4CEIA 4RNDB 2ZIFA 4D9KA 1KRWA 4BE4A 5IABA 2QZJA 2VSFA 3NRJA 3AM5A 3TM5A 4LSMA 1L5LA 5H7XA 1IMJA 3CF0A 2O8BB 1Y9EA 1H6BA 3GLHA 1YL7A 3T4PA 1XQVA 4DQKA 2NU7A 4UOZA 1Q11A 1XEWX 4RKRA 2A4MA 3OWOA 3Q0EA 2YIMA 3EVGA 4EECA 1QQAA 2AN4A 2WT8A 3MAAC 1ZEJA 3PA8A 4I4LA 4XQ0A 4BIIA 3VU9A 3D7NA 3WLMA 5H1YA 3DGEC 1KO8A 3T52A 3VHXB 4U39A 3G82C 5U9CA 3H2HA 4BQPA 1JECA 3H6GA 2V0GA 1VJDA 3JY6A 4OXXA 1QH8A 1XD2A 4Y1FA 1P4GA 4F45A 3QSYA 1POXA 2WU0A 1CQJB 1N33B 3QLJA 2GK3A 1EMDA 3OPYI 1SXGA 4AUNA 3H9CA 4Z4QA 2JI4A 2OFOA 1Q17A 7AT1A 2G9ZA 5KTOA 3SHVA 2I1WA 4EDHA 4KBYA 1E0SA 2GD1O 5BN4B 1X80B 2OD2A 3UK7A 1EK1A 2XI4A 1R0ZA 3E2IA 5G0UA 4Q7JB 1XDBA 3QVJA 4C20A 2BGRA 3DOJA 2C4NA 1FNNA 3JV7A 3KQVA 1C0KA 1NQWA 2WWGA 2Q3EA 2O06A 4TXLA 4BMOB 3KYIB 2H1CA 1N7JA 5FNVB 1HT0A 2MMCA 4DV3B 1QP7A 2QWXA 2XCOA 3OJCA 1OXVA 1VECA 2OESA 3L3BA 3MWGA 4QOGA 3SVZA 2GAFA 1L4LA 4CCYA 4M7RA 4CMAA 3KXLA 4P7FA 3IP6A 3AH8A 4YCAA 4NMMA 5MDHA 4NBWA 2D3TA 1ICEA 1QMGA 4Q4DA 2OXTA 5FTNA 4MWOA 2OGTA 3IHLA 2Q5QA 3OCXA 1XVTA 3QBTA 5AM4A 3W8NA 2EFGA 1G2IA 1OU0A 1CS0B 1OAKA 2NWQA 1OFHA 5M3BA 1VLJA 1YC5A 1SA0B 4KAFA 1AKQA 2AQ8A 4LHXA 4K9OA 3VNSA 4LOIA 1GTRA 4ZP1A 3T7DA 1OV6A 5LP6B 4KBGA 1GTL1 3HFRA 1E0JA 3DB1A 2GK4A 4H6VA 1JEAA 1ADJA 1J8YF 2FA9A 3N53A 4HEA1 1DAGA 5F1OA 3RG8A 2I2FA 4BVGA 4HS4A 3GLGB 3W5HA 2X8AA 4FWIB 1OH5A 4KIUA 2V6FA 1QIJA 3PD0A 4QGSA 5L7WA 5EERA 2C5FA 4LI3X 1TQDA 2AHOA 1GUYA 1G1AA 2PBFA 1QX4A 2R6FA 3C3AA 3NRCA 1XO1A 4XSHA 1VG9B 1DWQA 1WZIA 2FFAA 3EH2A 2DCMA 2YZGA 2SKCA 4UMFA 2HPHA 2X0NA 3G0IA 3L1HA 3M1LA 2A94A 4UCFA 5DASA 4BKRA 3UUGA 4G9GA 3HXKA 3ENWA 2OSBA 1VSUA 1BSVA 5KPDA 3LMKA 2XNDD 4W6ZA 3G7NA 3ZR4B 4KP7A 4D80A 3B5EA 3W8EA 2E18A 3KWJA 4CG3A 1AC5A 3HR7A 4UHBA 1RXVA 2GPWA 4ADSG 1TM1E 4QDOA 3DBHB 3SVTA 4JLDA 2I6UA 1C80A 5DYTA 2F17A 1A5ZA 2NV0A 2C57A 4AM8A 1KYZA 1E89A 4JLUA 4PHCA 4V0MA 4UVIA 3ZWAA 4DJFC 2V96A 2I67A 3L18A 3T4XA 4E03A 4XWWA 3UMVA 2PS1A 1EFPA 2Q5LA 4DEVA 1H1LB 1U6KA 1VDZA 4JXJA 4QU9A 1J24A 5D1HA 1XMIA 1MCZA 2HD4A 3M5CA 4JCCA 5IK2A 1BDIA 1QRTA 3D5EA 3GPCA 4NFYA 2NO7A 2Q1XA 2W7TA 4QOSA 3WWZA 3AVWA 4NNOA 1LQUA 4MB6A 1AKRA 3BORA 3I6MA 2D0PB 4N7RA 3UFXA 4AO8A 1XMQB 4URUR 1N9GA 1E62A 3IP7A 4QUGA 3O4HA 3X1XA 1F4LA 1DCKA 2QTFA 1XF1A 4RZIA 4NWIA 2H5IA 1XV5A 4QIHA 5BVGB 3GLGE 1AS3A 3CZMA 4CM8A 821PA 3T3NA 2Y0DA 2CJFA 4WEOA 2H65A 2QBYB 1FRVA 4ZVPA 4OGFA 3LOQA 3NIWA 4MWGA 3N6RA 5DLPA 3OC0A 2EX4A 4BNUA 4LG1A 3WAGA 5EA2A 2QE6A 4RTPA 3O90A 3WZ2A 1NXQA 3SQMA 4FHGA 1K8RA 1V2GA 2ZWOA 4OHXA 3MQFA 4BQNA 4Z7OB 4RF4A 3RC7A 1G3QA 1XGKA 5KMGB 3GLHB 5C35A 1QE5A 4AJHA 1RWMA 1KPHA 1ZIYA 3H8WA 2CUTA 1JHDA 2C2MA 2VYFA 2OHIA 3GFVA 1E9DA 3EBOA 1FXSA 3LO5A 4OHMA 4R69A 3RIYA 3VYRB 2WQ6A 2BTQB 3Q1KA 4B4DA 2HFJA 3F73A 2OGUA 3RASA 1YZUA 2QW1A 4MA0A 5BOVA 1PVDA 3TJZA 3R0JA 4QJBA 1T2UA 1Z5PA 1TYDE 1TYEB 1T0UA 3MCAA 1L1RA 1QLWA 1K7XB 2DOKA 4DC0A 1CIJA 1FMTA 4ARUA 3IAEA 2YMQA 1QQBA 2WYIA 4BV9A 1WD7A 1KTVA 2PMWB 1J5PA 2I8LA 3Q88A 3RV4A 1YNOA 5ALYA 4Q9DA 5BOSB 3PGLA 2VSNA 1G8KA 4DDWA 4ETIA 1E7YA 4O4HF 3T15A 1HF3A 1XE3A 3TR0A 1CPYA 1RBYA 4E14A 4ZYTA 4M7WA 3PWZA 4KRFA 1P5JA 1OX4B 3JATA 4BE9A 1Z28A 1CJMA 2WIJA 1QO0A 2AMJA 3IKVA 5DZSA 1OXKB 5FL7A 2XH8A 3RYCA 2QP3A 3I5UA 1KI6B 3R4VA 2NAFA 1QF7A 3IXMA 3DWFA 1P9NA 3L0IB 1QBGA 4W8HA 5FI3A 3UJ3X 4DSAA 4NFLA 3HH8A 3ISVA 3E9CA 1PGQA 3SBEA 3PUHA 3R6TA 3NKVA 3B6EA 4QELA 3TW6A 1J0DA 4MRPA 4C04A 1EEXB 3TLZA 1NQUA 1TF5A 3HKEA 2HCJB 3ZIDA 4ZO9A 2BJVA 1YU9A 1DE0A 2M32A 3IHWA 1LVGA 2HRZA 3DNFA 1T9CA 3F78A 3RTBA 1QU3A 4L9AA 4BO4A 2QGZA 4PXYA 3CVVA 1W0CA 1P5ZB 3QELB 5L7TA 4MV8A 5FA8A 3EUWA 3GARA 5AK6A 1G21E 1SRRA 5EE0A 2BEJA 4JK3A 4DQLA 1V7CA 3KL2A 3EBLA 4UUBA 5H81A 5NULA 4AG5A 4DMKA 3CLUD 4F6RA 5DT9A 2C97A 2XCLA 2NYVA 4U6QA 1XU7A 1ISHA 2H1HA 1ZMOA 2YY5A 1T6YA 4Q01A 5AFSA 1TTPB 3N2NA 1YR7A 2JC3A 2RARA 3GQBB 4OOEA 4P86A 3ZGLA 5D87A 2P78A 2O1WA 2J3DA 3F6BX 3UOWA 5K3FB 1A9PA 2XT9A 1VC2A 5E1DA 5AKKA 1JHVA 2HIHA 2PPVA 3BGWA 2X9NA 3LQYA 4IINA 1CUHA 1L6RA 4OQXA 4Z49A 2EJWA 4RTQA 3H4MA 1K8YB 4G5OA 3NBMA 4Y9UA 3DP7A 1C7QA 3GVXA 1Q44A 4K1LA 4OA5A 3BK2A 5KOHB 4GDFA 3QYFA 4WLOA 4C6TA 1NZFA 2OGSA 1W2GA 1ND6A 4OQ4A 5IAOA 4PQRA 1T6ZA 2HBZA 1E7MA 2BLNA 2DULA 1JLMA 1XXHA 3LPNA 3QX3A 3ANMA 2ADFA 1Z33A 3HJRA 2CDRA 2WD7B 4Q03A 3K8YA 3V80A 1Q15A 4FD2A 1IN7A 4X64B 2QG4A 3L7OA 1V7ZA 2FX5A 3IT0A 3QKSB 1IIBA 3CCCA 1H66A 2LV8A 3BXOA 2AFHA 2KX7A 2Z57A 4BO3A 2Q7XA 4OQFA 3OIUA 4FFRA 3BE4A 2ZBUA 2AYZA 4D79A 1CT9A 1FSGA 2IYQA 5CIQA 1ST3A 1N8KA 4BU1A 4C0SA 1HYQA 4DARA 1VMKA 1PDOA 4ZALA 3GUHA 4JL8A 1RQ2A 3IILA 2UYCA 3I1IA 1XC7A 5EJGA 2FGJA 2EGGA 4MP6A 4GXTA 3G2LA 1S2OA 4R2IA 3RB8A 1REQA 4E07A 3BSYA 1U2GA 4O25A 3UHPA 2C7GA 1C3VA 1W36C 3WX0A 2FW9A 2V58A 3IP8A 4QYWA 1J2EA 3L6BA 5DXJA 4DMRA 4J9VA 3ONDA 2XQIA 5A71A 3EYAA 4CL8A 2KYRA 2Q6KA 4IJUA 5F23A 5K9ZA 1T2AA 4A10A 2WWXA 2PJUA 3BMXA 3F97A 2QZPA 3HXLA 3P0HA 3S1AB 4PAQA 4CR6A 1E6WA 3DDCA 4H7PA 4U5XA 4GPAA 4RV9A 5AJUA 1OVGA 3AB3A 4K6MA 3MOIA 1DOHA 3D7KA 3IR7A 3BXZA 2R6JA 2Z43A 4B4KA 3OFVA 3W2GA 2WE7A 4CG1A 3NTOA 4OEHA 1WBBA 2IBTA 2VJMA 1XZCA 3DSRA 1OGIA 2WNHA 1CR4A 1S4QA 4BNWA 2UUBB 1TPYA 4MVJE 5K0NA 1CUUA 1XCGB 3KKEA 2RBGA 1N8NA 3ZKWB 3IXQA 4DLBA 5EEGA 3VKGA 5IAJA 3LWNA 1C7ZA 1KEWA 1LPSA 1SHLA 2ZDQA 3LKZA 3UUFA 1B93A 3DBLB 4WY2A 4YP7A 3K4PA 1XNHA 4FGJA 4EFDA 4KFTA 1BU8A 4R8VA 1WABA 1OBFO 3R0XA 4XPZA 5FAXA 5LIRA 3ETNA 4KDRA 3BMQB 1ZRHA 1O95C 4BTVA 1QYVA 4G1EB 3VHLB 1IXSB 2WKWA 3EZNA 4XCXA 4F3KA 2WJYA 2PO7A 5FFFA 3TH5A 3QVSA 4B2IA 1JU4A 1UJCA 4F4DA 4CCSA 1C3XA 4GI2A 5F77A 3SXUB 1VCNA 5A9SB 1D1SA 1XTVA 1YHZA 4PG4A 4KRYA 2VK1A 5CVUA 5KYXA 2CVOA 4DCOA 1DCMA 1WKBA 4CKBA 2ZRIA 1A88A 1XLVA 4YJDA 5K2MA 2BFPA 2H5JA 2CNOA 4HAWA 4Y9SA 5F76A 3IVMA 3CF4A 4HNRA 4JUIA 4HGNA 1L5HB 5TPZD 2I2XB 2JFXA 3BULA 3UXMA 1E1QD 5IZ4A 1I4EB 2HPZA 1Z4QA 4YAGA 5TMEA 2ZCUA 4AN4A 1DTWB 4FT4A 4E0BA 1LBSA 4KO1S 1TFRA 3RUEA 3ZHVA 2IYWA 1E2MA 1KYXA 1X13A 2W6MA 3AJEA 2F90A 5JSHA 3DV0B 1U9YA 3UCXA 2GAJA 4DE5A 2WU3A 1TKAA 3Q5GA 4KJZA 2WIGA 2AG6A 4GZLA 4P5EA 1A8SA 4B3FX 2V3VA 3AY7A 4LDPA 3BWEA 1CY4A 5KTYA 3KTAA 4LVNA 5GOZA 3PE6A 4YJ2A 3F7OA 4F85A 3TTUA 4EKYA 2O2DA 3EIHA 2WBLC 1YCFA 3ZHUA 5AJWA 2XOXA 1MC1A 2P3LA 4G5YA 5EMJA 5SY4A 2OKCA 4IUDS 1L4GA 3EMBA 4PHFA 3UC9A 3PJFA 3V7WA 3RRJA 4E4RA 4HDRA 1Z6TA 4S1PA 2ADOA 2BHNA 1IM2A 3DMPA 5HRUA 1CEQA 4ZQBA 4NBVA 1U94A 4UTRA 4B3BA 1QV7A 2OZEA 2X40A 5EPEA 3UA4A 2JG3A 1RCFA 1I9CA 2EEZA 4YVFA 1LK0A 1NX6A 2Y1OA 4LE1A 2AXQA 2QZSA 3AB7A 4B6GA 3RUPA 3C5CA 4INJA 3IMFA 2NTJA 2PCLA 3LVRE 2QMUA 3KHSA 1D4AA 3SQLA 1HDZA 1CUYA 1JI0A 1GYRA 3QU5A 3VR4H 1QR2A 2CZGA 4JJFA 4URYR 3RCBA 3WDMA 5M29A 2Y1KA 5T7BA 1RABA 4IS3A 2JAQA 4EVQA 5AVTA 2R8ZA 1JU3A 4JC8A 1VJ1A 4IS2A 4DCGA 3PIIA 4HMQA 2LIPA 5CX1A 2V6IA 3UXEA 4S24A 3T7KA 1FEZA 1M6NA 2DERA 3I9OA 2Z04A 4G07A 3V34A 1COWA 1YXMA 4FFNA 3LCVB 4QPCA 3VZQA 3DYIA 1TQHA 1TA4A 1TX4B 1CDOA 3HRKA 3UPUA 2WAMA 2Y9MB 4YQZA 1ESDA 1QUEA 2ZDHA 3NJ4A 4L9RA 3HE3A 1Z4PX 4R8RA 1QHNA 4D02A 2Z4RA 4EKGA 2QUBA 1LPPA 3H9BA 3ND6A 4YMHA 3UMBA 1M2OB 3D64A 3LLVA 3MBIA 4ZZ2A 2YQ4A 3JQBA 3KWMA 1CE8A 4XWOA 2JLBA 2WWWA 4DPKA 2CMGA 2V7QD 5KQPA 1B14A 3WTCA 2JD1A 2XTAA 4TTQA 3LBNA 1FMJA 3MJFA 2WDZA 4AWBA 5BV8A 1HEIA 1QWOA 1L5ZA 5B58C 1C29B 2I1LA 5JWOA 5B4VA 4CIYA 3AP3A 3EBPA 1B7GO 3PS9A 1QOPB 4FDTA 1PJAA 5EMMA 3TRIA 2ORVA 4E4YA 5JJCA 3LC1O 5JARA 2UZ0A 1Q3TA 2ZVJA 3N2ZB 3HNOA 1U8AA 4KXNA 2DKOA 1XJ0A 3WHIA 2E5LB 2Z6UA 2Q4BA 2XB6A 1YVEI 2PVPA 3QQ5A 4B82A 3WLRA 1ZBQA 1PX0A 1RSZA 4M8LA 4W8GA 3NIDB 1G3RA 4N3CA 4YRGA 1CZOA 1RYFA 1Y8ZA 1IAVA 2F1IA 2ODQA 2ZBQA 2C0QA 4EKDA 1F2UB 1PKXA 4PCUA 1FU7A 5LNK6 4TYNA 2XZDA 2AC2A 2HEIA 1GL9B 4PZ0A 2OV6A 1XZPA 2R68A 2BFCB 1E9EA 3CLSC 5JANA 4PQGA 1P7PA 3CBQA 5FLEX 3A36A 2Z2YA 4JC5A 1EUQA 1KEEA 4DIUA 2R2GA 1U3FA 5AJHA 3RD5A 1XRPA 3D5QA 4HVTA 1D8TA 1MBZA 1QHIA 1PL7A 3HL0A 4DRXA 3NHZA 1KE2A 4UOEA 3HFGA 2EQAA 4NOKA 3A25A 1OD6A 3P9XA 1SK8A 2G5PA 4HR7A 3PYLA 1G60A 1YS1X 4M60A 1PJTA 3BQNB 4M0PA 1U8TA 2NO1A 3RWBA 3VR5D 3RRMA 1FU4A 4NK5A 3RTEA 5FI5A 2Y05A 3D6NB 4MUXA 3U7FB 5JXJA 2AFHE 2JLQA 2CZQA 3ESDA 1BH2A 3K2IA 3HM9A 2XZLA 3QUCA 5HNKA 4K9KA 3OHMA 4YJ3F 3ZLVA 1E98A 3MHPA 3SI7A 4BVFA 1ZWKA 2CWDA 1YD7A 2FZKA 3H7AA 1XHEA 3K09A 1E5XA 4FNMA 3CMCO 3RC3A 1Q12A 2WT9A 4YPVA 5IS2A 2RHJA 2A9FA 1SUFA 3E9NA 1Z35A 2AOXA 3PWTA 4DXDA 5LQMA 2YYSA 5T8KC 3TEMA 1XEFA 3EFOA 1P6UA 1L2TA 1M2VB 2ZQYA 3BJEA 1XVAA 3PPVA 3F7MA 5CVDA 1ZQ1A 3O3NB 4EGQA 5KPJA 1QGYA 2BVNA 3USCS 3ZY5A 1Q0LA 4LY3A 4Y2QA 1HEUA 1FC0A 2D1QA 2X4IA 3VR3A 5M2QA 1PJBA 2FPIB 2XMQA 4BHTA 5KDOA 3OKAA 1MO4A 4X8MA 2C7VA 2N1MA 2WOOA 4IDDA 5DWDA 5JRDS 1ECGA 2WB4A 2NO0A 4RZSA 2Z30A 3MWYW 1K92A 4MLCA 1ZDMA 3LO8A 4LGMA 4EHLA 3OZUA 4Y18A 5TMBA 2WUDA 1C9KA 1ADFA 1RBZA 1VKJA 2J3JA 5A3SA 1R0BA 2GEVA 1L7MA 3GFBA 3LL4A 3N76A 3HSKA 2DWCA 2DWOA 8ATCA 1NW8A 3ZY2A 1NBEA 4B5LA 1H23A 1XRJA 3O03A 1Z4MA 2DFNA 2FU5C 1P7VA 1DO8A 3A9RA 4H7EA 4CM3A 1RI1A 1MUUA 1O5OA 2HXYA 2ZG6A 3KZKA 3LUAA 4RHEA 3U7IA 1IZ8A 2B78A 5JISA 2JNWA 3FTQA 5DOZA 1YFZA 2BGKA 3G3EA 3KZOA 4S2UA 3L0YA 1V95A 2P3SA 1RLMA 4GYYA 5DLQC 1QRAA 1I4LD 3WYEA 4RL6A 1V5FA 2HV8A 2WUWE 3WJ1A 3ZHXA 1OC2A 2EW8A 5TIIA 1KBZA 3FDIA 4AYWA 4HNAA 3Q3HA 3LHSA 2CKMA 3VR4A 2X2EA 3RE1A 4CIVA 3QI2A 2VNAA 4YUVA 4L8LA 2JZOA 4PYRA 4RW0A 4NE2A 4TT8A 4P5DA 4MQFB 4NOMA 1YE3A 4W8OA 2QU7A 4NBLA 5AIAA 3O3CA 2OPHA 2GKGA 2QJTA 1KAMA 1E3IA 1P39A 4IO0A 2ZWPA 4PFSA 2XT6A 3U4HA 5I51A 1I3CA 3LA8A 4OGWA 5CFRA 4CRWB 3W5BA 1YC2A 1J4AA 2JI9A 4LOKA 5J2TB 4MR9B 2C2YA 3BF7A 2O7QA 2KW5A 2RHHA 1IEQA 1KZYC 1OA0A 3DT8A 3EMDA 4K9PA 4XR4A 3BH0A 3CRMA 3R41A 5DCWA 2B8JA 1A2OA 3LPLA 3GG9A 3OE4A 2PL3A 2YRWA 4WH0A 4DM7A 3DFMA 3O38A 5HILA 3BRWD 2IUUA 4V1CB 3NBAA 3M8KA 3ZS8A 2FWMX 5BRJA 2AFVA 5I7HA 1JEYA 3BIWA 1KEKA 3JQCA 5JS1A 4FE4A 4OUKX 2JZCA 1JFFA 2G1JA 1VE5A 2JIDA 1SJ9A 2YJNA 1JDUA 4G6ZA 3RQSA 3VXKA 4MRSA 1ISPA 4XD7D 2I2AA 1BGXT 2FFQA 1O97C 2KBEA 2VHQA 1Y89A 3ECSA 5DSTA 3ERCA 2F1RA 4W6QA 2X0RA 4YAOA 5I7AA 3W1VA 2VP6A 4LOLA 5AHKA 4BO8A 4DBLC 5JS8A 1EE1A 1KORA 4JJ6A 2W2LD 1HV8A 4JUBA 1HL3A 4BQQA 4XE5A 3PT9A 4DMGA 2BYTA 3LV8A 5CEJA 1N77A 4UAGA 2WKQA 2RI1A 1OGJA 2HJHA 4QNNA 4CWAA 3N07A 3MS2A 5IANA 5LM3A 2HMWA 5KJCA 2O5CA 1ZS9A 3WMEA 4AI6A 4WZBB 3GELA 4MEBA 1SPBS 1Z2OX 2BEUB 5J43A 2H08A 1LVHA 1U65A 3MTDA 4RKWA 3EA0A 1EM8A 4HRXA 3RSGA 1RS0A 4IQ4A 4FYHA 3OFKA 4TKUB 2FP4B 4R7GA 3HEAA 1WMEA 2GJ9A 2VJAA 2ZYSA 1V5GA 3W78A 2UKDA 3EZ2A 3EG9A 3C74A 2Q4RA 2QM8A 4AKGA 3HXTA 1OI3A 1Q6YA 2ZRGA 3AF0A 4KB5A 4OBXA 4PPQA 5AKIA 4CUJA 4YRZA 3KSAC 2HIMA 5LJIA 3MT8A 1JVBA 3R7WA 2CNKA 3RTCA 1EYZA 1Y6QA 1XUOA 3KZXA 4Y0VA 3EK2A 1GRRA 2F4NA 2LKCA 3CTPA 1ECFA 4IV0A 4KTVE 5TLSA 1ZNYA 4GEGA 6AT1A 1FSPA 2QPLA 2C2BA 1VJCA 1YS4A 3EAFA 4ZGGA 4KX5A 2O5VA 4AJJA 5DMHA 4X61A 1T25A 1I9GA 2FI1A 1ZRSA 3JQAD 1FFHA 4UXIA 2HDHA 2JLSA 3SFVA 2C2XA 2QV0A 2QLJA 1P2FA 3KXPA 2EIHA 1N92A 1W581 2D62A 1E1CB 3RNLA 1YVUA 2CBXA 3P9NA 2X8JB 3PIDA 4IIJA 5CNKA 3RWOA 3NHMA 5C34B 4B40A 4L2IB 3I62A 1JKFA 2C2HA 2WZBA 4ABYA 4ZCLA 1N78A 1W5AA 2JASA 4G24A 1BMDA 2VDRB 4IFBA 4TWBA 2RGNC 2Y93A 3U49A 4GT1A 2GESA 3OIGA 4IG9A 4M8KA 1HTBA 4RZQA 4Q9IA 1H2RS 4FFWA 1IH8A 2WAXA 2I7VA 3PKJA 4JN6B 1MQ9A 3WWCA 4RA6A 1XA4A 3R6DA 3C3EA 1E9SA 5DBEX 1U9JA 1XTIA 3L7LA 1CDEA 1P91A 4XVHA 5AI8A 1MFZA 4M1KA 3WLPA 5ADUS 2HSJA 5BN3A 1FQOA 1V16B 5DP1A 4OF4A 3A2NA 3QXCA 2YWCA 3GJ6A 3OSZA 4FWBA 4B46A 4CGYA 3EIWA 4OATA 2OCXA 1J1IA 3JQQA 3HUTA 3O8DA 1BDMA 2KLHA 2QQ5A 3L9WA 4FSXA 5FO0A 4CT5A 3CX4A 3O0DA 1KBQA 3B60A 3QOYA 2O3JA 2AXNA 4WZAE 2VRWA 4F12A 4AJOA 1SZJG 3BRCA 3UBTA 3H83A 3K8OE 3ED1A 4HG2A 3ULKA 1IZ9A 1OLXB 4G3XA 4IHJF 4BNJA 2KWIA 4NCNA 4GKBA 1RJDA 1O9GA 3GAMA 2P2ZA 5D8DA 3MJTA 3TW4A 2HH9A 5EWMB 2TMGA 3JZFA 4FMCF 1GPDG 4FS3A 4B3HA 4MV0A 2UYHA 2PD4A 3O2NA 4TLLB 3N0VA 3EPRA 3PU6A 3VO9A 1NXPA 4IBOA 2EG9A 3JWJA 4RZHA 2MSEB 2B8TA 4Q4JA 5EEHA 3RK0A 3V3KA 4NDAA 3LWDA 4TTTS 4Z0PA 1SNYA 4V1CA 3W9BA 2Z2JA 1FMLA 4G36A 4LJ6A 4MGHA 3ZYCA 1E1MA 1IOZA 1DC5A 1U8FO 2XOKA 1KK2A 3Q5EA 3U4GA 4RK1A 4PPNA 1P2VA 1H2HA 1VI5A 1NP3A 1R00A 4EGSA 3WR5A 2BSAA 4UCWA 3OBIA 1WF3A 2XUQA 1TIBA 3HDGA 5F21A 1CY1A 4FILA 3AUAA 5KKCA 3OZBA 1WHSB 4YCMA 3HR8A 1EDDA 5T6MA 3S3TA 3HYLA 2QTZA 1OLUB 5G02A 3H9EO 5EUBA 2BM9A 1KEZA 3A10A 1SU8A 3MB8A 4RUKA 2VKQA 4NR0A 4NS1A 5EHQA 3ZZNA 5IKPA 1Z0AA 4N3NA 5IAGA 2DWQA 2G8LA 4BWGA 3R9XB 1DAOA 1SH7A 3JW8A 2FQ1A 3TOSA 3VU3A 5BURA 1JFVA 1E6EA 2HCTA 1KWGA 1K7CA 5BNTA 2IXEA 2JJQA 4FT2A 2GFIA 2XKJE 2QXUA 3QG1A 3UA3A 5F4BA 4FU0A 4E1BA 2I8AA 5K6AC 4QYSA 1PW5A 2WYVA 1YULA 3IJ5A 2O2HA 5I48A 4V0SA 3KQSA 2LCFA 1IG0A 3W6OA 4CMCA 3NQ41 4QOJA 4Y2SA 2F62A 3TTVA 3U3RA 3WNVA 3ZDEA 1LRLA 1EFCA 3G85A 1PR6A 3P45A 2QMEA 1WDTA 2WJPA 3HQ4O 1ENZA 1RI4A 4O4JB 1NHWA 5IH3A 3FWPA 4ABTA 3QMWA 2NTYC 1AUXA 4QQRA 4XX0B 1Q7RA 2RE8A 4O2LA 3A1UA 3FYDA 4JITA 4PXSA 4KITB 5KC8A 3EPPA 4X3PA 3BCHA 3DQQA 5KREA 3M4NA 4OMFG 3LU1A 4JLOA 4K6FA 4XYMA 4LZAA 1XF9A 2IQIA 5C18A 2H1VA 2VAWA 2XRYA 4K28A 3R9KA 2D06A 4A2CA 1E0KA 5CB4B 3FI0A 5LYJF 2E6KA 4U7HA 3TZBA 3WK5A 2ID4A 2BCJQ 3GJ0A 4KSCA 3RIXA 1W94A 3PTZA 4DG9A 5FEUA 3IV7A 1FX0A 3R9IA 2PGXA 5CJ2A 4KYTA 3DMYA 5CITA 2Y1CA 2DLCX 4K2AA 3D3KA 1F0NA 4QTYA 3OZFA 3IR6A 1VLMA 1JG2A 3KALA 2HC9A 3K6KA 4UBOA 4CQJA 1LLFA 3E53A 1CFJA 2DBZA 2UZ4A 1GFSA 2HGZA 5IJ9A 3C3XA 4TMVA 1C0IA 2VPYA 3ZWPA 2XUFA 3H8VA 3BWBA 4P58A 4CJXA 5TT0A 8GPBA 1ZM2A 5BSFA 2WJJA 4N0QA 4B7CA 5CDGA 3AUSA 4C05A 1T10A 2W0SA 3TUJC 3L1UA 2HGSA 1E9AA 4G89A 3QPUA 3JAWA 4C7VA 3L7MA 4ZEWA 1BO6A 4P4SB 5EIFA 2G4CA 4INOA 1Y42X 4IH4A 3GUCA 3LGSA 5F7JA 5GJVC 3ROEA 3JQAA 1Z13A 1PL0A 3O82A 2PZEA 5A4FS 4DNQA 2WIDA 1AUOA 3G1UA 2B5OA 3B9BA 4GAEA 4M3NA 1KJJA 5B2FA 1L6IA 2UYGA 1QUFA 5H4GA 4UAVA 2XAAA 4DJ5X 2QGNA 1T5HX 2VCYA 1VYTA 3LCRA 2QHXA 4KPUB 1GDDA 3B3JA 4XVRA 3RRNA 5KSPA 3A3KA 4DWOA 2YNMD 3Q3VA 4CL2A 3N2IA 1HFWA 2Q45A 2RG1A 1PQPA 3Q4GA 5EJIA 1M34B 2OAEA 5JQWA 3OX1A 1DELA 1YA4A 1Q1QA 2HQ1A 4JAVC 4PM4A 1JEOA 4EHDA 1Z22A 1NBOA 2OCPA 1VE9A 2OV1A 4B0OA 4I81A 1SZCA 4TLMB 3ZS9A 4M7PA 4C4ZA 4MHSA 2BEWB 1N5OX 4MNTA 4ND6A 2P9YA 3DQZA 5K6AA 3T0GA 4GZ5A 2IF2A 4KXUA 3T38A 1RWBA 3TYXA 4AJEA 1HDXA 5KTKA 2EFHB 4N76A 3NJRA 3Q7TA 1CVRA 4C4SA 4PGHA 1RQGA 4B31A 4A36A 3T5AA 4UVDA 4B3JA 3FHJA 4LZWA 2FQQA 3H99A 3C3DA 3TLEA 5HF8A 1RTTA 1ORRA 1T5OA 4UBJA 1EJ2A 3R3JA 4L08A 4PW0A 4KR2A 4NCJA 3HWSA 1KGSA 1R10A 1BVRA 1PQ4A 3I01M 1F8UA 5FTJA 3R3UA 3ZC3A 5HS6A 1ZH8A 2BN4A 2HT6A 3O9ZA 2L18A 4JVMA 1NI4B 4NYIQ 1GPNA 1GP2A 4ZYVA 2OEPA 4GR9A 4M46A 1XLTC 4HGPA 3HN6A 3MK31 4KW7A 2IL1A 3NKLA 1U7WA 4Q4LA 2WJ3A 1XDGA 2RH4A 2YICA 2QRZA 5LSAA 2CDNA 2XCIA 3G79A 4LJ4A 4MOWA 1ZCZA 2RGWA 4P7GA 2YWRA 3T3PB 5A5EA 3TG8A 1NONA 2ZAOA 1XZQA 2BFEA 1JR3A 2PS0A 3ADCA 2GA9A 3ORFA 4K03A 1M2GA 3VTFA 2PL5A 1DRJA 3RSSA 3QEMA 3SIXA 4ZAGA 3CZPA 4I5DA 1YDHA 4RO0A 1PR4A 1NXOA 1ZJ5A 2ZPAA 3HKEB 3OJXA 4R16A 1GTG1 2BMVA 3T5TA 3A04A 5BSGA 1ZJWA 1DIOB 3MWLA 4C2TA 3GCWA 1QVRA 2XODA 1HURA 3DDOA 4IDQA 4JOQA 1K9SA 1MGPA 1J90A 1SZDA 2HBRA 2MU1A 5U4XA 3U09A 4JJGA 4RH1A 2E55A 4MEAA 3TZEA 5IT0A 4P34A 4C22A 1G5PA 3EHEA 2BHSA 2QM0A 2PCJA 4OMCA 1Z2DA 521PA 2QJWA 1E6KA 4DQXA 1EIWA 4OP2A 3GLFA 3FPKA 2O2IA 4JQCA 3R7NA 1HLDA 3V8BA 3B7WA 4EABA 3FNHA 4DAEA 1CUXA 5K6TA 1JTVA 3UHAA 3RVSA 1XD9A 3BKXA 4NDNE 3C6ZA 1OBHA 3N7UA 3NFRA 5DVZA 4QDTA 4WXEA 5IKEA 4IDFA 1OZ0A 1GARA 1GKKA 3TGPA 4IXDA 1JDBC 2QTRA 3AEKA 7MHTA 3KJQA 3UJPA 1IUKA 1UMBB 2G04A 2P8JA 2WJZB 1R4ZA 5GJWC 4HLNA 3IB6A 3BK7A 2YCBA 1RRVA 4XIGS 1AGXA 3LXMA 3ICWA 1M10A 3U39A 5K4GA 4F3NA 1LSUA 1ZVMA 2PK3A 3PQFA 3SNHA 1QXSA 4YLEA 5LN1A 2IP2A 2Z9CA 3IV9A 2DSNA 2QL5A 2IYLD 3VOSA 1D4OA 2H1RA 5K8CA 3LI2A 4EVRA 3OO1A 1M2KA 5T3YA 2GBPA 1KI3A 3K5HA 1W46A 2QOEA 3WLTA 4RWEA 2XWBF 4OM7A 1GPYA 1P0PA 2CNBA 3JAKA 4KRGA 1JJ7A 1XQXA 5D2CA 4TWZA 5GONF 3SYRA 1YB4A 4LJ7A 5IVIA 3T5BA 2WV7A 4EZIA 3MCUA 4HK4A 4ZCSA 4FN4A 2UVPB 5C46F 3JQEA 4S1OA 5EN4A 2H31A 2Y99A 3P4UA 3GO4A 5JYBA 4BNYA 4IXNA 1A9QA 2ZBFA 3GT7A 3I05A 3BDAA 3F6RA 3TFOA 5F5XA 1H2WA 4M0LA 1V5WA 3RJ5A 2HU2A 3VGPA 1Y5IA 5CNIA 1EXWA 4F4CA 1P7CA 1JZSA 1P1KA 2JDID 2VRCD 1QF6A 2QI9C 1PGOA 2DUJA 1HDIA 3P0FA 3QXJA 4JMLA 4KQEA 3OTOB 3PEYA 1N57A 3K05A 4KH0A 4UZSA 4ZRDA 4ZODA 4ENRA 5FI0B 5BT8A 4LDAA 2D2VA 3AV3A 4EQ6B 1DCFA 2QMHA 3CWZA 4MS3A 5H9VA 2DPYA 2W2KA 2ZTLA 2A0FA 1A8UA 3P5SA 5DLDA 3T5MA 1TIKA 2J0QA 4G0PA 1JLLA 3TQIA 4R5MA 4Z3KA 1B8VA 3GDGA 1J0CA 1GAWA 4B2YA 1GKIA 2VJNA 3W5DA 1T34A 3UGQA 4MR7B 1FRQA 4MX8A 4JI5B 1LK5A 3STXA 4CQMB 3JYOA 2GN8A 5A02A 1HQCA 3UWPA 2W5UA 3BXGA 4EWLA 1QRUA 2QYSA 4YJGB 2RAUA 1JAIA 3VDXA 5B2EA 3WHKA 5BSWA 1D6MA 1UP7A 2Q5JA 5FV4A 1RDFA 3QUBA 3G0HA 3L7YA 1AXRA 5I9NA 3ER8A 3ZIAA 3Q0TA 2PYZA 3QEJA 5IAEA 2HBQA 2NW6A 1CJKC 3TLMA 3P9SA 3FDZB 4UM7A 4OI4A 1Z3IX 4I19A 3TIVA 4UVEA 2AL7A 1WPQA 1CEYA 2F1OA 1A2BA 4GWLA 3RFCA 1UK8A 4PG8A 4IDNA 5IM5A 4XVCA 3L46A 2L69A 1GPJA 2AVNA 4QQFA 3WLFA 2BKXA 1I6KA 4TXHA 4MYTA 2GF9A 5FPPA 1QYRA 4ETWA 1EP2B 1RBMA 4OH7A 4PCVA 4YJ2B 1TT7A 5K0TA 3RAPR 4W7SA 4X20B 1V47A 2IYYA 2REQA 3FHOA 3HRIA 1GCAA 4H0FA 1WZNA 3AINA 1TIPA 2UV8A 2I4LA 3PC3A 4PZ9A 3RO7A 2ZB2A 1SVIA 4UZFA 5TGDA 3TSCA 4KR3A 4OQZA 2PMCA 3PX2A 4ONEA 4MUYA 4TYYA 1DIGA 2HO4A 3A32A 4WK4B 1TEHA 1U2EA 4MPPA 2CY0A 4QTTB 1WMDA 3T4UA 2QJFA 2XGGA 3N28A 5U4QA 2JGJA 4LE2A 2GM3A 2ZR8A 2CYBA 4L9WA 1OMOA 4RKQA 4DCVA 3D8UA 4EBFA 3P8ZA 1RAHA 3ORQA 1EX1A 3DFIA 2FZCA 2HV9A 1UBHS 5KAMA 4EY8A 2ONCA 4IZOA 4BNMA 5A2GA 2OHXA 4H0CA 1JQJC 2OILA 4V03A 3WSWA 4ID9A 1IXKA 1WY7A 3OLCX 5LYJA 4E08A 3GP8A 2VA8A 5E1BA 2WSIA 1HDOA 5KTRA 2J9YB 4JQYA 2IOFA 3VR5H 3GFPA 1NVEA 1MNAA 1QO9A 2HWYA 3TR6A 1VB5A 1BWRA 1ONBA 4GBJA 4GM0A 5LYYA 3FNGA 2I7XA 3AF6A 2WSBA 5TMPA 8ABPA 3TLAA 2QLMA 3EZ6A 1S1CA 3K0EA 4OYYA 2R6DA 2DUUA 2J5XA 2X5JO 3UEOA 3M3PA 2X1HA 2FRXA 2W6JD 2ZXEA 3DBLA 4Y2TA 3R7BA 2HDWA 3L92A 3JVDA 1WV1A 4AXXA 2BTEA 2NN3C 3AEZA 1IEXA 1NATA 5D5PA 1YVDA 3T9FA 1HC7A 2CF5A 4O1HA 5EOVA 1W4LA 2XUKA 4E5SA 3RUIA 2O3QA 1JL3A 1TB4A 1KKMA 1RW4A 2NO9A 2A2ZA 3TLYA 1SRQA 2H4ZA 3VR4D 5JUWA 1VHQA 1EGHA 3ZXSA 4E5MA 3S2FA 3WOHA 2FUKA 4FEGA 4JDPA 1DU4A 4I5EA 2XKAA 4LECA 4LMRA 3OHPA 3SWWA 1G5IA 2GJKA 5DBIA 4X6UA 1YGYA 2BRUC 2E4AA 1PSDA 2O6HA 3DMTC 1E6MA 4PNHA 4XFJA 1R15A 3LF2A 4LYEA 1U4SA 2XSZD 4YYZA 5CA1F 2AX3A 3L6CA 4JD5A 1THTA 4TLAA 4ZU6X 1BZYA 4D92A 5H3HA 1R8QA 2VXCA 3OOYA 1YB2A 1DKLA 1JT2A 1MXHA 1NKTA 1QVZA 4KODA 4YRLA 3WWOA 4CIDA 5L8VA 1IVSA 3L40A 1B2RA 1M74A 2QL7A 3IAUA 4QDXA 1IBRA 3DOUA 4PSKA 1O57A 1T2VA 1W5BA 5MHTA 2ID7A 3CKMA 1OI7A 3KC2A 4R1TA 5LMZA 3V00A 3ZHQA 4JJ7A 4I2NA 4C7OB 3QOWA 4MDHA 5CDFE 3VH2A 5IKOA 4X84A 3NHBA 4R2JA 5KYNA 1IBLB 3CV3A 2CK3A 2Z2XA 2BE9A 3TOCA 2VUIB 5AK3A 4LK3A 1RJEA 1Z5UA 5CFPA 4KOAA 2PMFA 2PX3A 2HX1A 2ZIZA 4HWKA 4QTZA 3FLEA 1CJUC 3TUIC 4B09A 4C03A 3V1MA 2QTGA 3ABOB 3L4BA 1JA9A 5K3AA 3F4BA 2O54A 3PSHA 3GLFE 5AM3A 3IMEA 4X7PA 1EB8A 1LJLA 1V9LA 1GAEO 3ET5A 3IOBA 3ORRA 4F60A 1U02A 1QE0A 2GNPA 4EFKA 4TN1A 3QU4A 4M0DA 3R24A 1JTEA 1ZC4A 3K2QA 1VOTA 2PX0A 2MYTA 3KZNA 3AKDA 3AU8A 2AFIE 3WJAA 4NMHA 1R0WA 1VJTA 3T3OA 4V0ME 5JD6A 4M1QA 1XTBA 4K26A 3RIEA 5CHEA 3ZDAA 1RWVA 3T61A 3IKMB 8MHTA 3IDSA 4IJWA 4RZ2A 3OTGA 1T29A 2PNJA 3TLJA 3ZLJA 1CSEE 1WSBA 3FNEA 3UWDA 1M8KA 3NC4A 5ICSA 1T0PA 4QQ8A 2JJYA 3AKYA 5GGXA 1Y3BE 3H7IA 4NU0A 4FYWA 2FLVA 3N6XA 4G0ZA 1PT9A 3ZBPA 2JPDA 4NZYA 3O74A 4XLTA 4LYFA 3ZZMA 3HVKA 2XMCA 1GG8A 3DAGA 4LJKA 2C8KA 2EQ5A 3I45A 1L4MA 5F4ZA 4Q6BA 3ZE0B 4G0WA 1KI7A 4YRDA 3FPCA 3DLCA 1RI2A 1NR7A 2Z5LA 4UULA 1F7VA 5CAEB 1QJCA 3AEUA 1Z2CA 4EG4A 2INGX 1H05A 5KWSA 1KJIA 1RI3A 1O0CA 2GEKA 4MVJG 3CNOA 3VI3B 3Q2KA 1CY2A 3PB3A 3WMGA 4E31A 3M9XA 2ZIUB 4RA9B 2D59A 2GEJA 3KEFA 4GW3A 2IGTA 1N2CB 2QE7D 3FF1A 3GCDA 2H7VA 3OFJA 2BFAA 3K1ZA 2Y6VA 3AEYA 3SGLA 4UD6A 2XRZA 2HLDA 1N0UA 2VWQA 2AZMA 3B52X 2VDVE 1EQ2A 4LIPD 4XRRA 3BJZA 2BGNA 2XCSB 1Y1SA 5SV2A 1EBFA 1WHSA 3GDOA 3R44A 5K4AA 4OH1A 4DR7B 3NIGB 1ZU5A 1TL7C 1E2JA 3HGMA 5L95A 1E2FA 2H48A 4RIHA 2ID9A 1BKSB 2XRMA 1I6LA 3T35A 4B35A 3UM9A 1PZMA 3H4TA 3F6PA