1EIWA

Solution structure of hypothetical protein mth538 from methanobacterium thermoautotrophicum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
b'VTAEIRLYITEGEVEDYRVFLERLEQSGLEWRPATPEDADAVIVLAGLWGTRRDEILGAVDLARKSSKPIITVRPYGLENVPPELEAVSSEVVGWNPHCIRDALEDALDVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MTH538
molecule tags Structural genomics
source organism Methanothermobacter thermautotrophicus
publication title Structure-based functional classification of hypothetical protein MTH538 from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein MTH538 1eiwA00
1EIWA
chains in the Genus database with same CATH superfamily
4BZWA 2XDWA 3UAZA 4HADA 1RXIA 5DNCA 1F2UA 1ZWLA 4C06A 6YASA 1ONSA 1ZW1A 4WXMA 2Q7DA 5JZVA 2P9GA 1PR3A 2RSLA 4NBNA 4M49A 2ZCVA 3FH0A 1XTTA 1JZTA 5MF6A 3NIDB 2XWQA 1LNSA 3V32A 5DTJA 4NE2A 4QHSA 5IT0A 2C3UA 2Z1DA 2A0XA 4KMMA 4EPYA 1ZJ6A 1GLVA 1AKYA 1T2CA 3G8DA 3M82A 1N36B 3TOVA 2CCJA 4LJSA 3ZU4A 3ITKA 2CFCA 2HTEA 4JGGA 2FPGB 2CFOA 1WZNA 1IRIA 2JAQA 4P4UA 3BFXA 2BLNA 4TS9A 3TSZA 2CSXA 1K7YA 5E1BA 4L50A 3LMKA 4ZARA 4OOEA 2XWBF 3P4XA 5TT1A 5A5GA 1HDIA 3GRYA 1DKLA 2DYKA 1U28A 1NV9A 1CDOA 4LWQA 3U4CA 5LMCA 3LBIA 5JZSA 2H3EA 3AWIA 3MF4A 1G20E 2CXPA 3HY6A 4HGNA 4YHBA 4OQZA 5ESRA 2HA4A 5FTJA 5BT9A 4QWWA 3HJCA 2AEJA 4C0BA 2PD4A 1OTHA 1K8RA 5I7SA 4E5SA 1W0KD 1N6IA 1GKKA 1OAOA 3D5QA 3KQOA 3NYQA 1LW6E 1W85A 4OU5A 3SC4A 1K6XA 2XKAA 2BTQB 4BTEA 4RIEA 5U9CA 4K1XA 4RPKA 3V1TC 3IPCA 3K5IA 1Z7WA 3IXLA 4DRXB 5BXQC 3FUUA 1X39A 3P2KA 4PQEA 2PUJA 4LW8A 3W5CA 4KVZA 1XZCA 3RIHA 2OQVA 1KAEA 4K9KA 4PGAA 1Q1ZA 4YRBA 5JDIC 3R4VA 4Y2UA 3QFFA 3MELA 2BBWA 4BC1A 3MMPA 3QJ5A 4PCVA 1ISMA 3EN0A 3H84A 1NLZA 3OBBA 1U0NA 2VYFA 3JVUA 5HYVA 4L8GA 1XG5A 1Y8RA 4RACA 1ACJA 4RY0A 1L1FA 3WY9A 1NATA 2CHVA 2A0YA 3RRYA 5ALVA 4IKEA 2ZUFA 3O8DA 4EEXA 1KDPA 2CBXA 2X76A 5DDIP 2HMWA 3PQ2A 4JEUA 3J81A 3R9WA 3KALA 4DSUA 1TTTA 2BGKA 5E4JA 2JEYA 3EIHA 3L04A 2QAJA 2WMOB 3E5HA 5CDHA 5AVQA 4TYYA 3L79A 4I19A 5AP9A 3DL7A 1BJTA 1XU9A 2ID9A 3ESDA 4G89A 4DV0B 2D7DA 3V2HA 2WWTA 4B1FA 4ZK2A 4UMEA 5CB8A 1BXKA 4BNMA 1XZBA 1D9XA 2C8KA 4MQ6A 4KPUA 3DL0A 5CX1A 1T4BA 1S2DA 3TW8B 4JJEA 3S28A 3UMJA 4UFPA 5KX5B 3B5EA 4J7AA 5AK5A 4H7EA 2HA5A 4A15A 2Y27A 1VECA 1SCJA 3COYA 4IQ8A 4L8WB 1HT0A 2BF7A 4QO7A 4WERA 5DULA 1CQZA 4BL5A 5JAZA 1P8JA 2Q5JA 2PX8A 3A6ZA 1BN7A 3HBJA 3F3SA 4ZMBA 2VP3A 1IMJA 2YXLA 4Z3OA 1B8PA 1V71A 3UTCA 1SVLA 2ZDGA 1R0RE 4ZCIA 4BTVA 1MC1A 1ZNQO 4B3JA 2X2EA 3KYDB 1JIIA 1FFDA 3Q8LA 1R6VA 1ADCA 1GR0A 1L4UA 2D2EA 4WVFA 1GTMA 4JA2A 2PK3A 4C21A 4X5OA 3DEKA 5A2GA 3DULA 5ADHA 2JLQA 1GLGA 2JGJA 3T7KA 2Q49A 4WA8A 4HUTA 1QHXA 2ZJYA 2NT4A 1MG5A 2Z2YA 4Y2QA 2OGSA 3MTJA 3NGXA 4UM9D 2RAUA 5DBEX 1IBLB 2PUEA 4HAXA 3ZK7A 1P3Y1 4YAEA 3SJZA 4WEOA 1YB4A 1G9SA 2IKQA 4AIRA 3IT0A 2ZJ3A 1N9GA 2A9FA 2VDVE 3QHAA 2DRIA 2V7QA 4P38A 4D0LB 1SRQA 4DMUB 4R81A 4ZQFA 2C9ZA 1US8A 3AEYA 2O2JA 1P5FA 4FMDF 4ZQCB 5UKDA 3UQZA 1IOWA 1RYHA 1ZOIA 4WAUA 2M6KA 4CW7A 2DR2A 3RG2A 1H69A 1NTOA 4EPVA 2WJ4A 1SBQA 3K1TA 3PEFA 1L4GA 3A1EA 2QR5A 3O94A 4FILA 2HKIA 821PA 3HKCB 2ZBEA 1I1OA 2I1QA 3QOWA 4R16A 4EQ6B 4XW2A 2A0UA 5CJ2A 2AR0A 2Q5HA 4OHZA 5ALUA 1XHFA 4BMSA 5GGYA 1LV8A 1V41E 2OBYA 1GT91 3TLGA 3DCJA 4OGFA 1CJCA 3O2JA 3V4VB 3NR2A 3ZDYB 2QQEA 3ESBA 3LECA 5B36A 3SKVA 1EFUA 3C3XA 1DADA 4TRMA 4ZJUA 1CNEA 1PW7A 3DTYA 3F7OA 1Q74A 1Y6ZA 3EAGA 4NJMB 5KYUA 4D6YA 2XUOA 3I9V6 1P2BA 2GI4A 1QGUA 1ZM3A 3OOYA 4KVFA 2C7PA 2B0CA 3RSFA 3DNPA 1NUQA 3TD9A 2FSFA 3L8EA 1J0XO 2KWIA 3LYLA 1W87A 1VPWA 1JEAA 1YIAA 3LPDA 3TNDA 4DRZA 1MEJA 3JYQA 1GZDA 3H5VA 2QR3A 5FX2A 3G9QA 1VG9B 3HDHA 4J0QA 2Y1WA 1ID8A 2NM0A 1H23A 3C7KA 2WM8A 1J8VA 1A4UA 1QMPA 1F7UA 1ZIOA 3AUTA 3QE4A 2FZLA 4IZIA 3DV0A 3TAUA 4OIMA 2OZVA 3EFOA 5DN9A 2IEAA 1A5AB 3OM8A 1H94A 1RM5A 3OPXA 3WHPA 2B8TA 1EVLA 3II6X 2HK9A 2QPLA 1E66A 1EDBA 1VE7A 3BTUA 1VYVA 3QKWA 3AHIA 3ECCA 2IHKA 3DKRA 4N5DA 4RUKA 3Q87B 4Z9YA 3S2IA 3SYNA 3ZXSA 5ED0A 4LZLA 2CLKB 3IBYA 4XFKA 3SKXA 1RI5A 3Q85A 4EGSA 3ZHVA 2YXNA 2BP7B 2CNOA 4YJ2A 2H4XA 3N05A 4HVLA 2WFZA 3ZD6A 4DLNA 4A5OA 1QVVA 1U4SA 1W35A 2R6FA 2XUGA 3EA4A 5AQ1A 2GCOA 1YVUA 4IZOA 4WY8A 5AXCA 4CKXA 5KQRA 1NU8A 1PUJA 4ZI7A 4IIGA 4QUDA 4F3TA 3ZD9A 1A7KA 3GQBB 4BP9A 2HB6A 1EX1A 1B15A 2I8AA 3H1GA 2I8CA 2X23A 2BBOA 3EARA 4FHCA 5DTRA 1OT3A 1H93A 3EQ8A 3OLYA 4KOAA 3RWBA 3VYSB 5SYMA 1CWUA 2CLFB 2GPAA 3AEXA 1EP9A 4NICA 3LUGA 3P5BA 4OB8A 5CK4A 5FI3A 4DZRA 4DQKA 2AC2A 4ESEA 3OX3A 2P30A 5B3JC 3LKDA 2BLLA 3SYTA 1XMJA 1Y7TA 2OFOA 1QORA 3SMQA 3CZ9A 5JY6A 2REQA 4KTTE 3U3MA 2F9FA 1AQIA 2GX6A 2HWKA 3HBMA 1ZRHA 4LZPA 4MUEA 3S4YA 4N41A 2Q41A 3T7CA 5I5EA 1E4YA 1FY2A 1OCEA 1TCVA 2AXNA 4ZV9A 5IW8A 1P39A 2GJSA 3DF9A 2JEOA 2QE7A 3KYCB 2C82A 3FYUB 2Z5LA 1ZUIA 2XMRA 4RY8A 2XZLA 3D7KA 1BD4A 3WL4A 3EMVA 4EQ6A 3IE2A 3HGQA 3CCCA 2GN6A 5EOVA 1RKQA 3V7FA 2VZ0A 1UMBB 2QL9A 4DBLC 1X1TA 3DG9A 4OXNA 1P5RA 2XKBA 1PZNA 1IHUA 1XZPA 4Q3OA 3T1NA 4CQMB 3C14C 4D3FA 4GHWA 4UTOA 4QUKA 2XZPA 3DTVB 1P2GA 1ZM4A 1M6YA 1XEFA 2XMQA 3HFSA 2PUTA 1FRVA 5CT9A 4Z0HO 2ZRGA 1XCLA 3H13A 3OCVA 2PXXA 4PTYA 2QDKA 3RPEA 2RGDA 2VAWA 4JITA 1NYRA 2GASA 1Z37A 3OLXA 4S3MA 1C1XA 4QLBA 5MFPA 4B3TB 1GIAA 2JGMA 5C4GB 2C7GA 5DP1A 1M1NB 4JUAA 4GNKA 4I1UA 5AVOA 4Y6PA 3GP8A 1M2NA 1JX6A 1L5SA 1JPVA 2O06A 3AF5A 4HDRB 2R4QA 2UZ4A 4DF3A 1PDVA 4ZCRA 5CCBA 1HT1E 3MNFA 3NYWA 1RKVA 3D2CA 3GJ6A 3TJRA 1PBTA 2UYOA 4ZOLB 2CMDA 3REFA 1NQUA 3ORSA 4MYCA 2WUWE 3WYAA 2EQAA 4LZJA 4P4NA 3LT5A 5LZ8A 3AB8A 3VO8A 1KO8A 2EKZA 3GX1A 5AK3A 1RYBA 2BPOA 3DOEA 3WXBA 4DC1A 2VYCA 1JGTA 1UC9A 3B70A 3WK5A 2A30A 3QLUA 3IIEA 1QIKA 3K9LA 4WOJA 1YI1A 4H4DA 5GINE 1QHFA 2NTVA 3AVTA 4QPDA 5SYAA 4KCGA 2IU3A 5DM60 5B30A 1LQTA 2L42A 3FJYA 2BKVA 3L1VA 1R0SA 1HDEA 2GETA 1RAFA 2ONZA 2V7BA 4GPIB 5EXTA 4BX0A 1DIHA 3K4QA 1JIUA 4YV2A 1DBIA 1QYIA 4D9JA 1CZHA 1I0LA 1WF3A 1P0FA 2ZR7A 3HV2A 3ILSA 4Q3NA 4JYZA 2FN7A 2OM6A 3CX3A 4U9UA 1NDHA 4TRNA 2VYQA 4E5UA 3U4QA 1G21A 1C9NA 2MSLA 1XP8A 4ZAFA 1ZHOA 4PLHA 1FDUA 5LJLA 1X7YA 4FNOA 3TSOA 1U3VA 2YXDA 5F2KA 1I2CA 3GJ4A 5KYYB 5DYGA 3T7JA 3V4OA 1K8XB 1C7EA 2F3SA 3RROA 3O5AA 4D8WA 3FTEA 1QP4A 3CE6A 1XA3A 2XCTB 2JLSA 2Q8PA 3WLIA 1DRVA 2GJ8A 1DUIA 1QZXA 2WABA 1E2QA 3BJMA 4RYLA 4ZANA 3TQTA 2ZB8A 2OPBA 5K8JB 1XTKA 3PNKA 5D01A 3RU9A 3FFXA 4D4MA 5BWCA 4AS1A 2DC1A 4AW9A 1GZ3A 3IEKA 1I4EB 2JH8A 5EJGA 2IKSA 3OLWA 1VYTA 2RD2A 5E1OA 3DT6A 5KNBA 2WFMA 4J0FA 2GZSA 4D57A 2V1XA 4ZCLA 3CURA 2R7MA 5IMBA 2PG3A 1KI8A 1NR7A 4OKSA 5KOYA 3NONA 3NTQA 1IQUA 3PCTA 2R62A 4LTDA 2VEDA 2D13A 2P27A 3GZNA 3ZHTA 3X2SA 2BFDB 1PBNA 2OAEA 1NW6A 2ZCUA 3AVQA 1W46A 3IEPA 1LCIA 4F4FA 3BJZA 2ZM6B 2OBMA 4EPWA 3SPXA 1P7ZA 1ZN9A 2DVMA 1QQTA 2FZCA 4P7GA 2PT6A 3R9IA 4LBVA 121PA 2VCYA 1F1JA 2G67A 1FFEA 2Y6UA 4OTZA 4MYRA 3HUTA 3P94A 1VPTA 1XCPA 2JAOA 2CBZA 3VO1A 4G0QA 5C1DA 3RCBA 4UD2A 1X2BA 2O8DA 4TGLA 3X1WA 3JQAB 2PMFA 1H1DA 3RNOA 4A8JA 4AY6A 3UHPA 3FNQA 2QUBA 2HF7A 3A6GA 2UVPA 1U65A 4YONB 3RSGA 5BSVA 3H9JA 3BWDD 3UF0A 1ILWA 1K7XB 4XIIA 1PFWA 4PQYA 4O1HA 5A0FA 4H1HA 4Q4HA 1C7JA 1GSIA 1XZMA 4QPNA 5DLDA 2JAXA 1N6LA 2XYQA 3O3OB 3GGCA 1Q0SA 3HEBA 2HDHA 5C7YA 2Z6QA 1BEEA 4FBLA 4IIEA 4ER7A 2BTQA 1F8YA 2CFRA 4FNMA 1UBTS 4M54A 5DYYA 3WS7A 1X7YB 5BW5A 1J9GA 2BM0A 3IBCA 3KS9A 4JLOA 1CQPA 2B1GA 3SX0A 2ZUVA 3AF1A 1LU9A 1U11A 1LKZA 1T35A 2FYTA 2E4XA 1TPZA 3TDMA 4ESHA 1JMKC 4RCZA 1WMAA 5A4MS 2I62A 4TXHA 1MEOA 4TM7A 3WJAA 4KHZA 5G4KB 4MEBA 3RGGA 3L7KA 5L4SA 5IS2A 1XRRA 2OYRA 3ZWMA 1GZUA 5M3BA 1FYXA 4DOMA 1I5OA 3A7DA 3Q3IA 3VSDA 4EDFA 2MYUA 2PUAA 3ISTA 4RY2A 3LX5A 1G7SA 2VH1A 4FGKA 1BEUB 4NZYA 4OQYA 4RSHA 4FWTA 5JNLA 1IXZA 4MPRA 2X4GA 1QHHA 3LUCA 2Q3CA 4Q5IA 3VFDA 4DM7A 3OZUA 3EVEA 4RZ3A 3W1VA 6CHYA 3QE2A 2YMPA 3D8TA 2I7DA 4MS3B 3FZNA 2V0CA 1JR2A 4QQFA 1Z35A 3OLVA 3TW0A 1IWOA 1ML4A 3W8NA 2AI3A 3PD0A 3ZWYA 1TECE 4IO1A 4NTZA 1E3JA 1FCJA 2BEWA 5B5SA 1RD4A 5L51A 3RS0A 5I4KA 1L5GB 2HIMA 3CLRD 4LF9B 1DWOA 4HN2A 4BVFA 1M7GA 3ETCA 2QPAA 5CFPA 2NXCA 2DQZA 2PY6A 2P78A 1G4UR 1IN7A 3QU9A 4AM8A 1PJ3A 5AW5A 1ND5A 2C96A 3BULA 4HYEA 5CHYA 1ECGA 2WOJA 1FUYB 2GO1A 4X61A 5B53A 5K8VA 3A9SA 1M3SA 4YLEA 4DLTA 2HMSA 1UK6A 3D4BA 1IHXA 3GEHA 4HAWA 4HB2A 1XCOA 3E7XA 3FDFA 2H1CA 3KYDA 3MRTA 3ET4A 1X1EA 2XGGA 4RJTA 1XTRA 4O08A 3T4EA 3B9PA 2AMLA 2I99A 2YN0A 2GA9A 3EGWA 3PS9A 4ZO9A 5IC6A 2R1TA 2PU5A 4C0XA 4E2XA 3HCCA 2YRFA 4QBHA 2DLCX 1ZVMA 4B75A 1G2IA 3SZ3A 2GK7A 3H9CA 1GNTA 1VSTA 2B37A 2VF5X 4MYTA 1G3MA 1O9BA 2IE0A 4GNRA 3ZV4A 2VQEB 1O57A 1HYQA 2OAGA 3HFGA 4DW8A 3BMNA 1NA5A 1XZIA 2QN9A 1N9GB 1W49A 3SQMA 4IEEA 3ZS9A 3QA3E 1A27A 4NHEA 3K0AB 4LY3A 4YTEA 1US8B 3Q6NA 2CK3D 3LWDA 4PWZA 4Q6BA 3G85A 4HJRA 3SCZA 2P2LA 5JYCA 1O95C 1RYNA 2BEUA 1LRKA 4AY5A 1ZJJA 1LV7A 3KDAA 4EZEA 1PR5A 1UWLA 4ESOA 2D00A 2P6OA 3O7WA 4C1NA 2G9UA 2LVBA 3GJTA 2J31A 1Y37A 1JQJC 2ORVA 3O3NB 4ETWA 1NR5A 2YQ4A 2Z3ZA 1D9ZA 1U3DA 5ALWA 5CT4A 4XXHA 3UC9A 2BFFB 2VTEA 1IONA 2G1JA 3K09C 1OGJA 3F5SA 3FNRA 4KXNA 5DMXA 3DOIA 3UTDA 4EKIA 1JSCA 3GUZA 2QF7A 1N92A 3KD2A 2OE2A 1BVHA 2C84A 1A9RA 1EHIA 3R6DA 4GLLA 1XKQA 4EHKA 1ZK3A 2IZ5A 2CYAA 3IMGA 5KOJB 3HYTA 5KYNA 4C2AA 1ZMXA 2JGLA 3QKUA 1JPUA 2Q1XA 3D6UA 2IYLD 2DHRA 1JWBB 1E0AA 4YVFA 4CFYA 4JDUA 4TMYA 3AXTA 5FOTA 5F7XA 4UUQA 3L8ZA 4TSRA 5CA0A 5CCDA 2VP0A 4FCCA 4CLXA 5JALA 2JZNA 2ZDHA 2BBTA 1EZ4A 4UTVA 3EEIA 5HKOA 1M1YA 2ASVA 1RIIA 2HMAA 1K7CA 5EUBA 5BP7A 2PLAA 3PFGA 4S04A 4K9SA 4O4HF 3W0LB 4GX2A 4ZPJA 3SLGA 3TMYA 1E2MA 5EUCA 4B5KA 3C97A 2QRZA 3BEDA 5E7QA 2QV7A 2FPPB 4O3MA 2PKQP 3H2JA 4RLHA 5DASA 1N5IA 4WKNA 1Z2PX 3OA2A 3X3HA 1E1RA 1JUDA 3EC7A 4BB6A 1MH1A 3UICA 2HF9A 3R8CA 4J6EA 3W3AD 3ZDFA 2YFQA 3V00A 2C57A 3COSA 4L51A 4PCUA 3AOEA 4D43A 1R9GA 4WESB 3DP7A 4P34A 4KNYA 4XIFA 2A14A 1YR9A 2FRVA 3OJLA 1RW4A 3S8MA 2JLUA 1G2OA 4QD3A 1O94D 4XWOA 5BSFA 1G5FA 2V9CA 3HWRA 1VLZA 1JDBB 5DSTA 2R3SA 1F8GA 4WW0A 3A06A 3U61B 2DHQA 3CRRA 4I9FA 4EZIA 1NIPA 3T61A 1EAYA 1PWYE 3C5CA 5LBIA 2WLTA 3AIKA 5JJIA 1H1LB 4ZU1X 2ZRJA 4ZKDA 1TIKA 4K9DA 2EOAA 1OFVA 2DLDA 3HA5A 4RK4A 1PNQA 3SHVA 4RJJA 5C1BA 3QF4B 4HTAA 2I71A 5CGZA 2DE0X 2W43A 3J81k 2NIPA 3OOWA 2OM2A 1J25A 1RWBA 3MAGA 4MKXA 5EKUA 1RRFA 4I9HA 2P3LA 2WD7A 3K9FC 3BS4A 3L7MA 4O4JB 4TQAA 4CKCA 2O8CB 1WUTA 3K8OE 2VRWA 3NDRA 1H5NA 4YBRA 4BVGA 1Q7GA 4YI5A 1XPUA 1FFCA 1HYEA 1I4LD 1UDRA 4FB4A 4KW7A 1ZHHA 2WU3A 2W4QA 4I1IA 4ENPA 1VTKA 3E9DA 4US1R 4D4LA 4I8IA 1XVUA 1W0JD 5JQWA 2X0KA 3U3ZA 2X1VA 3MWEB 1XZAA 1AJEA 2HJRA 3QWAA 4LGCA 1OY1A 3G68A 3N2IA 3GPCA 2DCUA 4ND3A 1OXTA 3B9QA 3VTAA 4RCVA 1L7QA 4B2IA 4C29A 2QTWB 2BCGY 4B3SB 4R4JA 1MB4A 2BFEA 2R60A 3PYXA 4MITA 3CNEA 5ALGA 4CCSA 5A3QA 3OZTA 3ZHZA 4NXMB 2B1QA 2HY7A 2O07A 2Q9AA 1EUZA 1FVXA 1N2IA 1WW8A 1Z5ZA 1SBTA 3M1LA 4UVHA 5KCMA 5CB0A 5LOVB 3LFUA 2ID7A 1YQQA 3BTOA 1KDVA 1OXMA 3G8YA 2VCEA 2PMWB 2VAPA 1E5DA 2VTBB 2O2IA 3OZXA 3W6UA 1CJSA 1R0YA 3GVHA 3JZAA 3KT6A 5U4XA 5BSEA 3DBOB 3QPBA 2IXGA 1M1NA 1ZVQA 4LHVA 2YZ2A 5JECA 1BFUA 3QKSB 3HPRA 3F4KA 3K2IA 4NQZA 1A9SA 3U5ZB 5BMOA 1AH2A 5G0TA 2ZE6A 3KOXA 4FOTA 4DV3B 2VJYA 3MD9A 3OT4A 3H2IA 1PTKA 2B5OA 3MJRA 5DXFA 2F1RA 5H16A 2VDPB 1FP4A 3FRHA 4ZN6A 4DB4A 1NBAA 1AKNA 4BYMA 5KWVA 3RYTC 3A9UA 1S89A 4DTIA 1CUXA 4A26A 1I3CA 1KWKA 3IBSA 2XYRA 1W1IA 2O2HA 4MYHA 2QM0A 1GZ4A 2B25A 2O3RA 2YV5A 3BBPA 1IB6A 3CCFA 1BHSA 2Z5VA 3K20A 3OESA 5CNJA 4BO0A 5L7TA 1XZGA 2REBA 4G4IA 1GGFA 3PLNA 4JJAA 4NESA 4TTTS 1WQ1R 5IN4A 1QF7A 3NPAA 3EB9A 4B4WA 2JLXA 1L4KA 3OPNA 5KVCA 5F9MA 4CV0A 2AXPA 2DULA 2I4NA 4L0CA 4Y2RA 4DNFA 1CVIA 1RAHA 3NBFA 4DUYB 2ZJAA 1EM6A 2BI8A 2IYSA 2H8KA 3DVLA 4TTJA 1T1JA 3D4IA 5AKKA 1CUHA 2HX1A 2W7TA 4QBTA 2CL5A 3LUBA 3PGVA 2PUBA 5IMSA 1W48A 4AJIA 1KP2A 4BLSA 5KAMA 2QBYB 2YWDA 2HRDA 2L0XA 3O3MB 1VPLA 1ISJA 2J59A 1PWHA 2ONCA 2I3ZA 4LJ5A 3TLKA 2NPOA 1D2CA 1R1DA 5FLYA 1TZMA 3SX4A 3EYWA 4ON9A 1GYPA 3NRJA 3M5PA 3QVKA 2B8EA 3T3PB 3PGLA 3GVCA 1U7PA 3LC0A 2H00A 1KK2A 3E9NA 4NDZA 5K3SA 4B9EA 2I4LA 1RXWA 1PG2A 1Y7LA 1Z2OX 3KJZA 4OI2A 4WNAB 4D3ZA 1WSWA 1NSTA 4QTTB 1V7CA 1XN4A 4ZODA 1UANA 4NMWA 4FGWA 1P8AA 4X93A 2PVCA 1CQJB 3KTDA 4L4UA 3OQ6A 4NLLA 4LS3A 1WOYA 4AMVA 1RHRA 1DWUA 2B94A 4RK5A 4RJ2A 4ER5A 1XNQB 3W7VA 4JCOA 3ZWDA 4WLNA 1VHJA 1F5NA 1GPH1 4J6FA 2FPGA 2JGAA 4S1NA 3H6KA 1S3SA 2H2AA 2GRAA 3GUVA 1F06A 1QHEA 4ER3A 3AY6A 4YRPA 2WJIA 1NQ5A 3DH0A 1V4VA 5L3QB 5J2UB 4P4GA 2RAVA 4UEQA 1KBZA 2WJVA 2XE6A 3F8WA 4TPKA 2Q1SA 3RHZA 2YC4C 3GP3A 1LC0A 3M1IA 1QGED 3OOHA 4EG0A 1AMOA 2HO4A 3R3WA 4FW8A 4D0GA 2XDYA 3CVOA 1BE6A 1VP9A 4C9BA 4F45A 3B7PA 3CLUC 3DJFA 3LFTA 1JDZA 4YWJA 4BLOA 3CZQA 3PCRB 4QDJA 2OILA 2DEUA 2W2KA 3ZH9B 3Q3HA 4ZD6A 1VRCA 3K6SA 4AX8A 2C9OA 1EWTA 3BG5A 4ZTZB 3NMUF 3B82A 4LV8B 3U9LA 3UOGA 3O9VA 4BKOA 2XHEA 2GCOB 1NYTA 3QPCA 1A7AA 1VJGA 1WUKS 1CSEE 2HJSA 4WZBB 4PO3X 1LLDA 5KNDA 4W4TA 1TM3E 4H77A 3MWKA 4FMCF 4LISA 4E09A 2VH5R 3MS4A 1VA4A 3DTTA 3LVRE 4G1BA 4HEA6 3W4IA 1PQPA 2GM3A 1LUAA 3ZIAA 1RXSA 2G0TA 3FPSA 3O6VA 1I8TA 2QPTA 4TT8A 3ZCXA 3CLRC 2BELA 4JSRA 1QSGA 2C2BA 4I46A 2MIIA 5CK5A 4LKOA 1JT9A 1RI1A 2RAPA 1RLMA 5TB5A 2B5VA 3WNCA 2AMJA 2FUEA 4GOJA 4IGIA 2XOKD 3KQUA 3TX2A 2X9LA 3AETB 5JROA 4GP6A 1IZ0A 1P45A 1QDEA 3C3DA 3FVQA 3NUZA 3VZRA 3R5KA 4RPCA 4QUGA 4HRVA 1IXRC 2Q27A 3WMEA 4DA4A 1YFZA 3D4LA 3LXXA 5KX5A 1ZAYA 2P9CA 4N49A 2A67A 4EKYA 2HFKA 4RNDB 1TM1E 4EG3A 2ZAIA 1G5HA 1UP7A 5IASA 2B1RA 1C9KA 3KM0A 3FYUA 3TE7A 4JR1A 1T91A 3BCUA 1OVMA 3ER9A 1JLLA 3PQDA 4M1TA 2FFAA 5T4HA 1WOMA 2CYCA 4G4JA 4RTMA 1NU6A 1JHQA 2XVYA 3A10A 3JYHA 2V7WA 1GHTA 3X44A 2GAOA 3UFXB 4DT1B 4HNVA 6AT1A 2J48A 2WG1A 4QA9A 4D7AA 1SO8A 1M5UA 1PJSA 3C5WP 3PJFA 3H2KA 4YJGA 1UJMA 1KJYA 5AKHA 2AI2A 5CTAA 2H1FA 4DY6A 4O2AF 1YS2X 2A9OA 4GQBA 1DDIA 4EKGA 5IU6A 1GFZA 1X1AA 3MT7A 3K6JA 5LD2B 1E1MA 4BNFA 4X1OA 4DGSA 3H9UA 3OOSA 5H3LA 3T1OA 5A62A 5LU8A 4MR7A 1SUWA 5LNK6 3CF4G 1Y7PA 4LOIA 1WCIA 3AFGA 2V54A 1ZH4A 1GVHA 2ZRMA 2GTHA 3C15C 3KVVA 1P9LA 3FOCA 3NGMA 2XA9A 4R9NA 3REGA 1V0JA 2BCJQ 3P27A 4P7KA 4UD6A 1YASA 4GG1A 4MNTA 1EJ0A 2X5NA 4HKTA 5K1ZA 4COKA 4X66B 2PQ2A 4MQEA 1V5GA 1X80A 2F00A 4HD8A 5DGXA 5ALTA 3S5JA 4ARZB 4BNVA 3LYAA 1UADA 4R71A 1Y7HA 2B2XA 2UKDA 2R6HA 4CQLB 3CGGA 4KGDA 1FLNA 2QLLA 3EA0A 3PQ6A 1AUOA 1I4OA 4JP3A 3E8XA 3ABRB 1SIUA 1U9IC 2IX9A 3U44A 1CJUC 2YXBA 2WR8A 5HKLA 3BL8A 3ETNA 4DV6B 5AW4A 4KYTA 4KXWA 4D8TA 5BMVF 3K9HA 4F7DA 4P2GA 3CKYA 2IVZA 1J1UA 2O8EA 3AF3A 1QPZA 5E6RA 1GAWA 4HC4A 2RIPA 3WLHA 4BLPA 2JFQA 4JASB 2MTBA 3RIYA 2WPNA 1DHTA 4EHAA 3DEYX 1QYWA 2ERXA 3MJFA 1OWNA 1XA4A 4I4CA 4DWVA 1DG1G 2VVTA 1EK0A 4PV7A 2Y0DA 4IUDS 4LXXA 1H3NA 1L0BA 3KOOA 1WNTA 1GQSA 3OFVA 3OD5A 3MTDA 2CV1A 1U4NA 3BQMB 3FLEA 4IVPA 4MVWA 2Q0QA 4GPD1 5JWOA 3SR4A 2AKEA 3CPSA 1K7EB 1KC1A 1KGSA 1Q1NA 2R6AA 4RGQA 4RZQA 5FBLB 3VTKA 3ZUGA 3KVYA 2OGWA 4RYDA 4ZXPA 1GXSA 1RXCA 1XEWY 2C58A 1JB1A 1QRUA 2R8RA 4QJ5A 3IODA 1JYEA 1Y8QA 4C3UA 5BR8B 4XRRA 1MTZA 1J20A 5T3UA 2R8OA 1A3CA 1BS1A 1LPPA 1SHTX 2NU9A 5I7OA 4RFVA 3HBNA 5JVDB 4CR8A 1OTXA 2FFQA 5BN5A 1SIWA 3NM6B 3SIXA 3I9KA 3IT1A 3OPYB 4IDHA 1U3UA 2WHPA 3KUCA 2WZQA 3AFHA 4JLSA 4C3VA 2ORIA 3EZGA 2NAPA 2PRKA 3RVLA 1I2BA 2PBLA 2JLAA 1I7DA 5LQJA 4IDGA 1V2GA 3CZ4A 5CIYA 1V8BA 4FC6A 4PYRA 1YVPA 4OGKA 4LJ7A 4CM9D 2FP3A 1K8ZB 4TMZA 1TQDA 3HZHA 2SICE 1FLVA 3DC7A 3EGDB 4LMBA 3T5TA 3CT6A 3ZE1B 4C7MA 5H9VA 3LUAA 2J6IA 3PCXA 4EPTA 1C4KA 5AJZA 2J3QA 2QTTA 3DPUA 2J5QA 3A0UA 3G02A 3A6KA 4BO3A 1W7AA 4RDHA 1PNVA 2ACKA 3KTOA 3DUWA 2E2WA 1COWA 1WXXA 2RHGB 5KHOC 3BB3A 1UFQA 4MUXA 4WLVA 2DU8A 5EQDA 4JB2A 4LDPA 2JA2A 1M2JA 3NIFB 4LMPA 3TLCA 2P75A 1RAEA 1TW2A 2C59A 1A5ZA 4LKRA 5TMBA 2F17A 2L2QA 3R75A 3GPLA 1JFLA 1E2UA 1G8GA 2QU8A 5CDFE 1B1AA 3QTTA 3VGPA 4MQ5A 4O3FA 1DV2A 2W6JD 4RNCA 4YQZA 4PC3A 3LDAA 2JLRA 3LUPA 4ZO4A 5KI6A 1NJ8A 1H5UA 2C5FA 2D5IA 3CO5A 2UZ1A 4NOJA 3WDMA 1BC5A 1YQ9A 2KX7A 3K9QO 5I7EA 2VDWB 5LWHA 3A28A 1BXRB 2ZTLA 4UBIA 3ZBTA 4RKFA 2UUAB 1LF5A 1B8VA 2QTFA 3R3ZA 5HSGA 3MTGA 4KO4S 2QLTA 4OJNA 4X94A 1CR4A 1UEJA 3RM3A 5IULC 1GNSA 1HQYE 3MS7A 1CBUA 2YY6A 4LUCA 1LK0A 3EBLA 2FG7C 2VAXA 2XE7A 3O4GA 4MV1A 4X8OA 2H17A 3Q7SA 1Z15A 5JANA 3VZBA 1RZRA 3AL2A 2ZBFA 2GHTA 3PSHA 2F8TA 1KP9A 5LQKA 1XQWA 2Q21A 3FG9A 5JARA 3NO4A 3W04A 1DOHA 4Q15A 5A2QA 5A5VA 2EHJA 5DEIA 4FFMA 1J22A 3RASA 1TZ2A 1Z3IX 3C8MA 3U31A 2C3OA 2OZLA 4K40A 4M21A 4RHFA 1LS1A 1AHNA 1DO2A 1ZNZA 4Z54A 5SY6A 2P2ZA 4U3JB 1ZU5A 2GRJA 4H7KA 5TARA 3L46A 1C9MA 2GKSA 2I5PO 3CNLA 1H8EA 4AN4A 3A1FA 3QIAA 4FTWA 1OILA 1PV2A 1MT0A 5IJWA 5KWSA 2Z95A 1O03A 4RA9B 3EW9A 5EHXA 2BZGA 5H9WA 1E1QA 3FGNA 3QUQA 2ID4A 1K6EA 1GZVA 1TQHA 2PFSA 5HTKA 1P6UA 3R4CA 3F3MA 3L1UA 1ESCA 1O95A 3ZGLA 3MILA 2QRQA 3OI7A 4E15A 3RC8A 4Q66C 5AHRA 1NBMA 4DA7A 2C2YA 5BN5B 3IAM6 3W3AA 4KBGA 2EFGA 3W9SA 1YOVB 4BV9A 2DR0A 3SEQA 3IJPA 5IKEA 5JBIA 4LXTA 5K8CA 3DA8A 3NEYA 2H0QA 4UHHA 1HGXA 1U7OA 3KXIA 3CVYA 4W1SA 1SC9A 5ARDA 5C5EA 4AZSA 2WJ6A 4ALIA 1FDRA 1ULTA 4MP8A 1R6TA 1CFJA 1LZKA 4CEIA 1Z26A 1LX7A 1JJIA 3V4PB 2FV8A 4V0ME 4QPPA 1P7CA 1GEGA 5CFMA 1RWWA 1SB9A 2H3HA 2PPLA 4ND8A 3H18A 5D84A 4CUKA 1ACLA 1U94A 5KUTA 8MHTA 1IHDA 1KI6B 5HBGA 4IJ5A 1OPXA 1OZGA 2E4ZA 4JL6A 1CV2A 5IBRA 3GL9A 1J5PA 5ALIA 1K6IA 5DW3A 3SS9X 2VF8A 3AEKA 2VIIA 2A2ZA 2C0CA 3K15A 1L7NA 3KAQA 2Q4EA 3QKIA 4RENA 3PPYA 2XRZA 2JRCA 1KMNA 2IDKA 4HR7A 1YRLA 2WD8A 4RIGA 2SNIE 5FA8A 1YNOA 3MEQA 4LWPA 5EFZA 2HMYB 4RK7A 1UQTA 4G0NA 4M0PA 5D2CA 3HYNA 3RFTA 2CJYA 1L5YA 1QONA 1V3QE 4M22A 5JSKA 3IAFA 1M1YB 4D74A 2ZXFA 2DTXA 2GNPA 1ZGAA 1EVYA 1BCSB 1GTL1 1L3CA 1PGQA 3OF5A 4HDNB 5CJPA 3U0VA 2I33A 5KX5F 5JTUA 3QZUA 4H2DA 1TA9A 1SA0A 2NO1A 2J0VA 4O4HB 4WNYA 4KQ6A 4RH0A 5EWJA 1XI2A 1PX0A 3LZDA 3L1JA 3OH8A 4LQCA 4P3KA 2G70A 1K68A 3QTBA 5JJCA 3G7SA 4E70A 5JSHA 1FU8A 2D6FA 1RMQA 3RS7A 1XJWA 1CY8A 1JSZA 3B36A 1T5SA 2OVBA 2DY0A 3IP3A 1C1XB 3SR3A 3WIOA 5JTTA 5M34A 1RU3A 3RS3A 2WJJA 4A5SA 4MCAA 2PSJA 1DKNA 4QODA 4QUEA 4A8JB 4MOWA 3F1KA 4C03A 5BV8A 1WB6A 4V1CA 3CMCO 5A4IS 5DX0A 2GWHA 3BN3A 3L7IA 2FGKA 3BIFA 1VMEA 5L3QA 4UHDA 6GPBA 1BKYA 1FQJA 3VTFA 3TWOA 4LXGA 2FSVA 3C2QA 1U2ZA 3VYWA 3W6PA 4GS5A 4JKYA 1TUBB 4PYQA 2RHWA 2I2CA 3L02A 3WMFA 1UBNA 4PPYA 1ZJWA 3E3LA 4A2CA 1E5XA 1IEXA 1UIRA 2JBAA 3L92A 4PSVA 3TXYA 1ZL0A 1IY1A 4Y6OA 2A88A 1F9EA 1L7DA 4F21A 1HDZA 2QT1A 2WSIA 4OQNA 3Q1LA 3AT1A 1L6IA 4PCLA 4ZPXA 2V58A 2V98A 1NVBA 4JOBA 5ER9A 1U2RA 3CNQS 4DA0A 3DLHA 1KYZA 1OHHD 3ABIA 1V26A 4HTFB 4R1PA 2IU6A 2VHZA 4C89A 1MX9A 3IIMA 3RVRA 1FSPA 1XF9A 2ZSIA 4RETA 3PNBA 4DIDA 5D5PA 1LQ2A 1TIPA 5EIXA 1NJ1A 1OYOA 1ZJ4A 4YDQA 5KYVA 4EA6A 2NTNA 2I80A 4TYNA 4F2WA 2ODNA 2JFOA 3GWGA 3VOTA 3U4AA 4IX1A 2ZIWB 1WMEA 3WWPA 1OH7A 4XGQA 4E6PA 5CA1A 3CCBA 4J0JA 1P7YA 4OB6A 3S2ZA 5ISMA 3OTIA 2QAGB 4NP6A 2XADA 1DQRA 4Q05A 1RPTA 1VIVA 4UBOA 3QXCA 3I9OA 3ACBA 3FGZA 2YW2A 4U7HA 2C4TA 4D4HA 2K87A 4LY0A 2XCUA 1D04A 1YZ3A 1ANKA 4PVDA 4AT1A 1GZ5A 2LIVA 1ODTC 4IZHA 3EVGA 3HXQA 3MINA 4LF5B 1DAIA 2XZTA 4CCYA 2E89A 1SFRA 4DDTA 2EKPA 4JBGA 2IK8A 1A97A 2XIJA 4KRGA 2H7CA 4EG8A 1ZD9A 3DBRB 1U0JA 1EFAA 1KQNA 1I80A 2QSYA 4KZPA 3GJSA 1C8KA 2GCEA 1N34B 1G1AA 1N2OA 1SR8A 1WIWA 3CUSA 2XB2A 2OOSA 2P6UA 1A72A 3KJFA 4XD7A 3R3XA 1ISGA 1M6VB 4QFCA 4HLDA 2Z4TA 5A4AA 2XEXA 1W76A 3AR3A 3WZMA 4M7OA 4CIAA 3LF2A 4RMJA 3Q8WA 1GRQA 2H18A 4G0XA 1BDJA 5HF8A 2HYIC 3EULA 4YJGB 5A9SB 2R1TB 4CZ2A 3ZQUA 3PHCA 2PNJA 4GLFA 5BSGA 2RE8A 4AZ0A 4FLMA 4FYXA 3QOXA 1S3GA 1T2UA 3CNOA 3EQ7A 3IV7A 1BWSA 4NABA 2OVFA 4ZEVA 5L3SB 4DBLE 5KO2A 3FF1A 3O0DA 1T5OA 1C3LA 3QRWA 5EIBC 2HBRA 3X1JA 3HY3A 4YRJA 1KI4A 2TS1A 2X4DA 3JWGA 5TC4A 2OG2A 4J3NA 3R23A 1HDYA 3ZWWA 3DVAB 4N03A 3E18A 4HLNA 4J76A 4PONA 3UKJA 5E7MA 1J0EA 2FAXA 3KWJA 1KVUA 1UDWA 4N5HX 2X6TA 2WHQA 4YCCA 3B52X 5KYKA 3ICEA 3UUGA 1Q11A 3CO0S 3E48A 2RARA 2AR7A 4MICA 5CFQA 5JJLA 2A5LA 3PV0A 4JOQA 3I2YX 4K9MA 3KKMA 4RPHA 1DDGA 4AIIA 4UAVA 4LOJA 4J75A 2A7QA 2E0IA 1QK5A 3GNQA 5BY2A 1U7UA 1NONA 2MYNA 1M2VA 4ZJZA 1YBAA 5K0ZA 5JMPA 1MUUA 3HWX1 4PPFA 2AFIA 5PNTA 3SVLA 4L1KA 1FYVA 3AJ9A 3LKVA 4PFQA 4KIUA 5G3YA 1ONBA 3PBKA 4MDHA 4P3PA 2ZI7A 3EIQA 4PXYA 4JSYA 3RANA 3WGGA 2QYSA 2A33A 2WB2A 3NHRA 3TRFA 1JMYA 4HV4A 3HM9A 3K3PA 2OENG 2XUFA 3KYCA 4QXMA 1CUWA 2OC4A 3NHWA 3QUTA 2GBLA 1RNLA 1TB4A 4BS9A 1CQXA 1JQEA 1XDUA 2JHAA 3V1UA 1NVMB 4WOKA 5JS6A 2OFPA 3U3XA 4CKBA 1HKUA 4XOUA 1QS0B 4DIKA 5CB4B 5CLLA 1BRTA 2VUIB 1YDGA 4LA4A 3ELWA 3P0RA 2V55B 1KBOA 1OLXB 1FL9A 1N6NA 3EC1A 2X5JO 2WA2A 2WT4A 7AT1A 1C9EA 1AK1A 1AA9A 1J0DA 3P0FA 4BBJA 1RVV1 1VG1A 2GBPA 4D02A 1NMQA 1ZP6A 3IEIA 2C20A 3C98A 2FY8A 3VKWA 3KQHA 1E96A 4JR0A 3ZZ1A 4FJ1A 4UNIA 4WJKB 1RYZA 1TRHA 4C30A 1FLDA 2PRIA 5H3CA 1U7ZA 4O59O 3IEVA 3H5NA 3MMZA 4FUTA 1UAGA 1KRWA 2GB4A 1TMKA 4XR4A 4IDBA 1T29A 3A2NA 3LPLA 3NT4A 2GUGA 2Z09A 3FZQA 2QTMA 1F0NA 4YRZA 2BMWA 2PH1A 3VVCA 3SQXA 2H5LA 1KVQA 4MUMA 2BI7A 4Y67A 2ORYA 2BDUA 4IIUA 3EZYA 1J97A 2MSNA 1NPDA 1NV8A 1WS6A 5E6SA 1SCDA 3DE2X 3MSXA 5EAIA 5IJ0A 3O4IA 3NCHA 2C1EA 4ZQIA 3IMKA 2NZUG 3PD1A 1OAOC 1WCYA 5HG0A 4PXAA 3QVTA 4HGPA 3TOZA 1G3UA 3WLRA 4YQFA 1YQTA 2Q5LA 4JX8A 5DXJA 2AW3A 4WZZA 1DEAA 3ZNPA 1DDOA 1FUKA 2XNKA 2ZYGA 4DMFA 1Z22A 1SHZA 5IM5A 1H1TA 3VSEA 2NSHA 1H2BA 1OOEA 3AFNA 3HCFA 4D9EA 1BFKA 3SC6A 1F4VA 3AETA 3U26A 1N2JA 2PJZA 5A4KA 1ARZA 1BX1A 1HC7A 1ZEMA 3QKTA 4X1KA 2WB4A 4IMJB 4TL7A 3BC1A 1O95D 1ZGBA 2X6RA 1DAFA 2X9VA 2HHAA 1YR3A 5TEWA 4MQUA 221PA 3USCS 4TMVA 1WM1A 2LXNA 1ZD1A 4PLPA 3QEBZ 3ZH2A 1J07A 4YV1A 4B48A 1UKZA 3ENWA 1IVNA 3PC6A 4QECA 2IH4A 1M6NA 1ZO8A 4Z2AA 2BGIA 5BQXA 2DFVA 4CMBA 3BDVA 1KJNA 3L77A 4ZQHA 4D5EA 1W8IA 2JIPA 2P5TB 3ACDA 1P9OA 3CUYA 2VPWA 3VNVA 1UEIA 1Z4JA 4NMLA 4E6EA 1ES9A 1QWSA 2QUAA 3VYVA 3BGDA 2HWUA 2ZBRA 3FTDA 1UJ2A 4R8RA 2AG0A 2H2HA 2JD1A 3CF6R 4YGXB 4ZA2A 3TTUA 2ZOSA 3WTBA 4D4GA 1PIWA 5C32A 3PNOA 3ISJA 1M5RA 4S12A 3FZEA 1IBMB 1RXUA 2CD7A 1SZPA 1XKXA 3OZWA 1TOAA 3OG9A 3Q40A 3AEQB 1X3LA 5EG5A 3TEFA 1M67A 3TINA 1FNBA 2IUEA 3VMFA 4JFAA 4EHBA 1Y6GA 3WICA 2Q2OA 3SXPA 2AB0A 2BONA 2EQBA 1S2OA 2C4NA 1IG3A 2EW8A 2BD0A 3GPBA 2B8JA 2FFHA 3F7NA 2ECOA 2HQRA 2LP4Y 5DMHA 3I37X 5LZ5A 1K63A 2EF1A 1IM2A 2YVKA 3UUFA 3VR3D 1YCHA 3TAXA 1GGJA 4LWZA 3V1MA 1OBVA 1KPGA 3W05A 4JL5A 5KVVA 3OZ7A 2NPFA 2AD5A 3PC8A 4YCNA 3T9DA 2PGOA 1VCMA 4JP1A 5M29A 2XAAA 4TMTA 4BFTA 1J6UA 1ABFA 1YZTA 2QZPA 3A25A 4QQ8A 3IQHX 4ZCMA 1TW3A 1EEXB 3AO0B 3EVFA 2CNKA 3FNFA 3GLHA 3DE5X 3IBFA 4QDTA 1Z29A 4B45A 4BKUA 1VKRA 3S81A 2OCYC 5F1OA 2Y0BA 1CEEA 1N4DA 2O0LA 2OG1A 4YAUA 5GIPE 3GFBA 4JVSB 1NP6A 3SXUB 4D4IA 4A2PA 3D7LA 1V16A 1VJ5A 3O1JC 5GJVC 2RHMA 4BZZA 4TS3A 2HUPA 2A5JA 4LXHA 3RVPA 4DA8A 2E4WA 4HEQA 2GBGA 4F6RB 4Q7LA 3HNRA 2H59A 3LE8A 3PFBA 2ZAGA 1W36D 4G0WA 1WEHA 1HEYA 5A4FS 2EEZA 4R7GA 2H52A 4PRZA 2YJGA 5EHZA 5JH7A 3CLSD 3A37A 4E88A 4JP2A 1POWA 2I3GA 3RUPA 1BFDA 1ZH6A 2CDNA 2VJOA 1VPEA 3DWFA 1TT5A 2ZB4A 1V3TA 2Z8ZA 3HU1A 3G17A 3L0SA 4XB2A 4XIYA 4F6LA 2E48A 1IBKB 3QXHA 1PX2A 2BV3A 1J9ZA 3A2LA 2Z2ZA 4E5MA 4JGIA 1FS5A 3EVNA 4R6XA 2JL1A 1E0KA 2FFJA 2ZIVB 3EVTA 3MWEA 3P5SA 3FTQA 1KEUA 5F3RA 4TKMA 1SHKA 4JDPA 2O2ZA 3O1HB 1GQOA 3AONB 1RCTE 2B8NA 2JCXA 4JJKA 5EXXA 4DN6A 1QBKC 1QHHB 3T95A 3FF4A 4NAHA 1L9XA 3QPWA 4P36A 1YOBA 1LVHA 2QN7A 4TM8A 2N3ZA 2WYUA 1QCDA 1X7XA 3BZUA 1T3SA 2HBZA 1J5XA 1LLCA 4DXDA 1KSJA 1NX9A 1ST2A 3EXEB 2CLOB 4K5QA 4TN5A 4DXHA 1L1QA 4LYFA 2GAFA 2NO7A 3BVPA 1X7WB 1XU4A 4W8HA 4K88A 1A5SB 2ZBVA 2IYXA 3PUXA 4L85A 2R44A 4F38A 4CMGA 4E2YA 4URVR 4JK3A 2HRZA 2QNBA 5ICSA 1E3DA 1X7HA 3L1KA 4X8MA 5F52A 5BYJA 2GVDC 1BA2A 4PG8A 2G07A 3CZCA 1PJTA 2JGNA 1E18A 4KWIA 3VUFA 3OTOB 5ALXA 2JLWA 1L7BA 3CWQA 3FW1A 2NNWB 3D2LA 2ZRQA 3K8QA 4KJXA 1XJCA 3SSMA 1KJJA 1HLPA 1Y8RB 1DKMA 2I1VB 3CNHA 3JYNA 3MUOA 3WV5A 3ZNNA 5HF6A 1JFFA 2EEPA 1I0IA 3B1VA 1R0BA 3KZ1E 4UU1A 5E7IA 3IPAA 2POQX 1KL7A 5LDGA 4D26A 1M34B 4LI0A 2WTNA 4YRLA 4IGAA 4TQ9A 1W4BA 5LC1A 2IYEA 3MLEA 2C2OA 2EFCB 4JT4A 1O8CA 2ORWA 2FG6C 4PBSA 2C7OA 3NJRA 1H05A 5JLAA 3X1ZA 3E8MA 2IYWA 3IQXA 4C6TB 1PL0A 2NVOA 4M0DA 4MYDA 2PXHA 4ZT5A 3N2KB 4LZNA 4AYWA 4CM9A 2PMCA 2ZRNA 3L82B 1ZLXA 3QYAA 5AXBA 5HJ5A 1KS9A 3KJNA 3RU7A 4HNGA 3FB1A 3C1OA 3M8KA 4U9IS 3W8EA 1U0FA 1SBHA 2VJKA 2FQYA 3QX3A 4ZALA 3DM9B 5HKKD 5BVGB 1SB8A 5L8VA 5JMOA 3F5QA 1JEOA 1IM5A 4B87A 1V1JA 5JH7F 4Q4DA 5K01A 3JAKB 3TB6A 5KZMB 3MD0A 1AV7A 1LI5A 1ENPA 5D5HA 1NY6A 4IS2A 3GFFA 3NNSA 2XDAA 3E70C 4N8EA 4V2UA 5A7FA 4S0XA 3VBCA 5LU9A 1H0RA 2GUWA 1QTRA 1DS6A 2QU7A 4G4SP 1TYBE 2IYZA 2YWXA 1A7JA 2JJ8A 4HH3C 2HGZA 5EIBD 5EWMB 2GCPA 1NUAA 5GY7A 4TTAA 3W8DA 3CEJA 3KHTA 4MA5A 3RTBA 4ER6A 2NXJA 4RHXA 1KYTA 3BSYA 2Z43A 3Q9UA 3HADA 4WX2B 4WXRA 2UV8A 2NVUB 3I09A 1QYDA 1R8QA 4GM0A 5DOZA 2Q28A 3BRCA 4D9MA 5FR1A 1XROA 3OC6A 5I9BA 1LPSA 1O87A 4K6MA 4H27A 2N0SA 1AY0A 2OOKA 1MJHA 2ATCA 2JAUA 3K8ZA 3BDAA 2VK2A 1M6VA 4W7SA 5TX7A 5B4VA 3HA2A 1M8PA 4RJIA 4G5HA 5KWIA 2DFTA 3W4JA 2VF2A 1JQ3A 2Q7XA 3EGEA 3E5RA 2XUQA 3QFRA 1YTUA 2R79A 3IS3A 3OA0A 3WGYA 3IAEA 2QXYA 4OXIA 1OLSA 2X1HA 3A1CA 1FDVA 1XK6A 6REQA 2WHRA 4UCQA 4CF5A 4FHGA 4XGRA 1QLWA 3IGFA 1J8YF 2HAEA 2P77A 1U1DA 2QB5A 3CLUD 3N8HA 1TU3A 3Q1KA 4OHOA 2OAP1 4RSGA 4ZYVA 5L53A 3BE4A 3IQWA 2G77B 5FDFA 1DC6A 1I3KA 1NBIA 1S2GA 2Q6OA 4WBSA 1GVNB 4MHSA 2ROQA 4QRHA 1EUCA 2OK7A 1LW7A 3BMQB 4J4TA 3TLJA 5DRYA 3OAAA 1N3LA 2V6JA 1ZIPA 4ROTA 3VHXA 1W4LA 3THYA 5G4KA 2D0OB 2FQQA 2Y99A 1UODA 1QRDA 3BD6A 3NOVA 4WOBA 4XCVA 5D8DA 1KZHA 1XMXA 1HR0B 4DJEC 1H3EA 1XRNA 3AY0A 3MGBA 3AFMA 5EZ5A 3WL5A 2J3LA 1LLQA 3BMOB 4EOGA 3FN4A 4GL2A 3IKJA 1VM6A 2LWIA 3AEUA 3G82C 3MJTA 3AKYA 4KXYA 4MIKA 1RJFA 2IZ7A 1JECA 2WFLA 1VMDA 5B58C 2ZBDA 3T8YA 1Q6ZA 4ZT6A 2M2IA 1PWXA 2NSJA 3F6PA 2DECA 3Q7PA 4GX1A 4A6PA 4EJMA 2AFHE 2LRHA 4GI2A 2PS0A 5K8TA 2QORA 4RVSA 3JVVA 4UZSA 1OGIA 4TWRA 4YMTA 5IBQA 1E1CB 1GEEA 4D97A 5L3VA 5CM2Z 3V7NA 2ZCJA 5KYGA 4Q00A 5TPWA 2QI9F 1UKVY 2ZWPA 4JC4A 4CI9A 3JATB 1N0HA 1DFGA 3RS2A 1K97A 1QMGA 2PZMA 2V5VA 3HR4A 4LC1A 2J9GA 1G66A 1NKVA 3D7RA 3EPPA 3OHMA 3O8NA 4MTCA 3U7RA 3X43A 1YONA 4XOIA 4XX1A 3KQSA 3SVZA 2VRCD 2WU1A 3C87A 4C4XA 5JXHA 1G8YA 2ZT7A 3SMVA 1BW9B 4MVXA 3T0IA 3CIFA 3H8JA 3LIIA 2Q9UA 4N47A 4IHQA 4F8EA 3GI1A 2V8BA 1REQB 5GM2A 2IWHA 1P31A 3SF8B 5A3JA 5B6JA 1A04A 3SC2A 1ZG3A 1P91A 3ZGNA 1EBFA 1FS4A 3K92A 1T8WA 1T1SA 2I54A 2VLBA 3C43A 3DF7A 4W9MC 4DABA 4W1QA 2HEIA 3BYZA 4F1WA 2FPKA 2YWBA 3O90A 1AB5A 4EH1A 5JFTA 1T5DX 2H2IA 1Q1GA 1OI3A 5B3LA 4CFSA 4OAPA 3BMCB 3GLIE 2FX3A 3PGXA 2FHSA 4CI0B 3N07A 4YCBA 3PFKA 5I51A 2P6NA 4KRFA 2CVHA 4P9NA 4K0KB 1NMEA 2OCIA 3K72B 2ERCA 4PO1A 3F97A 1NVDA 3NDIA 3EGXA 4EAAA 1L7MA 1BA3A 1V9CA 1TQ8A 3M6VA 4CRWB 3S2EA 1YSCA 2GHQA 4Q03A 4EBBA 1Z83A 2EG9A 1EHCA 2P0AA 3PQ3A 2GBCA 5HE8A 3UK2A 1QHYA 3S2UA 5IYZB 1HZZA 1Z6PA 1J2UA 3LA6A 1FNDA 1EIZA 3KR1A 1RWMA 4E3ZA 1OXUA 5C3MA 1GUAA 3KVNA 3BIOA 4LSZA 3C3PA 4EHLA 2DHCA 4O1IA 3KFXA 8LDHA 2CDAA 1CY1A 1J8MF 4MMXB 2PMBA 2NO4A 1Z7YA 3EZNA 2LPMA 1EUCB 3ENZA 4AF6A 2FWPA 5CDSA 4MV6A 3X2EA 1C0PA 2NZYA 5KTMA 3DW3X 1ZH2A 1QK4A 2IEZA 5D3KA 1IUNA 1YO6A 3KYBA 2D5BA 1RI2A 3FPKA 5FB3A 3VKUA 4RSRA 4KXFB 1UPUA 2D74A 4CR6A 4E4YA 1IVYA 5C1PA 3M4JA 3VOSA 1Z63A 3JZIA 3HTXA 1NDQA 3VR5D 3U3JA 4DM3A 1U2DC 4PHCA 2YFYA 1E2FA 1F17A 2JLCA 1TAGA 2QBYA 2AKAB 1I3MA 4GR4A 3TOCA 3H8VA 2QSUA 1F0PA 3HCAA 3NP7A 4QVKA 4F84A 5JSQA 3FYUC 4TSFD 5LP6A 1C1YA 2HC9A 1N5KA 1L8QA 1QFJA 4EHDA 2CEKA 3VR3A 3IMCA 3SP1A 2DFDA 1P61B 1R4MA 4BFUA 3WWYA 1J2EA 1UBHS 4N7JA 2C4HA 3UMCA 4A3SA 3BJIC 4QEDA 1H6BA 1LI7A 1YS1X 4RPLA 3VR4A 2ZPUA 4DG9A 1FK8A 3VHQA 5EMMA 3GEPA 4L75A 4M7PA 1J70A 1TEHA 4MUHA 1BX3A 1O6FA 2EVWX 3KEMA 4IMRA 1ACMA 4P4SB 3G1UA 5DHUA 2FSPA 3KR9A 5TY0A 2HJ9A 2ZXEA 1SVIA 1CQIB 2RDMA 1FOEB 5JCPA 1GAJA 3PNLA 1NI4A 4MI1A 1QCCA 4LDRA 5FLXA 2W9XA 3RQSA 4EFLA 2P1RA 4TT3A 1MD9A 2B34A 3AVPA 3O8OB 3WFJA 4XYLA 1TPYA 2QX9A 4UXHA 2HIAA 2ZT6A 5CNIA 2QZZA 3I6YA 4J2HA 4WZAB 2XTZA 4Q9HA 3HKBB 3I6ZA 3K09A 1UDXA 3KKNA 3N58A 1FVHA 4OIFA 5HJEA 5CD1A 1CQWA 2JFBA 4AKEA 1OU0A 3PFWO 1U2GA 4MQBA 4EJFA 2C99A 2GNOA 5JE8A 3QLVA 3OTQA 1L5HB 3ETLA 1JQBA 1O0BA 4I9GA 3TRJA 4EEZA 3R3JA 3E9RA 2HWWA 3GARA 1MQAA 3GLHB 1JKJA 2JJ2A 4ETMA 4F3NA 1UDBA 1AGXA 1SQSA 4FT2A 4K86A 4CMEA 5IJZA 1YDHA 1SUEA 3QEAZ 3W2TA 1PYDA 4TLBA 4NCKA 4OBEA 2WE8A 1W581 1R50A 4PEVA 3BA1A 4ZI5A 4J7UA 3IURA 2AQ8A 1R8YA 1NBHA 2H31A 3SD7A 5FWXB 1GNRA 1F8XA 5JOQA 4O4LB 1N25A 1QB8A 3LQRA 2MJLA 3SX2A 3T7TA 5JMTA 1GUDA 4KBFA 4PYJA 5K03A 3DZDA 1YA6A 5K0BA 2EGUA 3L0YA 3P1JA 5FLEX 3G9XA 4R1TA 4GOXA 4PX5A 1OYWA 1ODJA 5FRDA 5HS4A 4GE3A 5LP6B 3L18A 4GI7A 4JBIA 5HZHA 4D9FA 1JFVA 1KHHA 4KYVA 3ROMA 1RHKA 3VDQA 3LY5A 5JUWA 4ZU3A 2VR1A 1GPMA 1PR2A 4P0PB 3CSUA 1PHRA 3N8GA 4NNPA 4EFKA 3HN2A 1PEAA 2VJAA 4MGKR 3V55A 1JIVA 3TGLA 2CZQA 3L8MA 1DMRA 4XUGB 2QR2A 2CVFA 3EEQA 5AUQA 2JH9A 2A78A 3M6WA 4QARA 4PZYA 4E46A 2BP7A 1V6AA 4YJ2B 1CQIA 4Z4HA 3D5EA 1U0TA 2J45A 3AZOA 4HFNA 2CJFA 2JFVA 2ODPA 3PEUA 2D5LA 4N0QA 5ITSA 2JZCA 5C35A 3AVUA 2IOQA 1JPJA 5AW6A 4BO5A 3V8VA 1GQRA 3S1AA 2N46A 1Q0ZA 4Y2PA 4L22A 4DADA 4KYIB 4Q01A 3K70D 5EWLB 2J87A 3IOYA 3ND5A 4MQEB 1Y1LA 3RDPA 4IL5A 3ZWNA 2EKQA 5BR1A 3TIIA 1Q0QA 4BMOB 4FW9A 3V5NA 1FE8A 3P45A 1DUVG 2ZJ1A 4WXYB 4RF2A 1QV9A 2CUTA 1E6CA 2WIFA 1S3FA 2VA8A 4MR7B 4BRWA 4EA8A 2Z3WA 1E2GA 1A88A 4JJ8A 3ZCSA 2B69A 1O0SA 5CYGA 3AGPA 3EXAA 1VBFA 2G17A 1D4ZA 2HIHA 2QGNA 4HFMA 4WDRA 1U3TA 1SEVA 3KNZA 3VO9A 4ZVTA 3HEAA 3PEVA 1HQCA 1PE0A 1T1IA 1XNJA 3PC7A 1ZXBA 2B82A 5GQSA 4AP5A 1HXHA 4DG8A 2GVZC 4COOA 3TPZA 4FHEA 3FNHA 5EZSA 3WYFA 1IOLA 4URZR 1RBZA 2QRUA 1OJ7A 2C8VA 4OQDA 3GMIA 1R6AA 2UYHA 3B12A 4R3WA 3C3EA 1AHIA 2D2VA 3EOBI 2D06A 5G53C 3FI0A 4FE3A 1ECPA 1K0UA 4DLRA 3ETEA 1Y5RA 1Z5GA 1B1CA 1SUCA 1G5TA 3K0HA 4WE3A 4EITA 2W6ID 3REQA 2OD9A 5EGNA 4R1NA 3KSRA 1DIGA 3EVZA 3O8QA 1S9DA 4XLZA 3ZOKA 3D4PA 3FMVA 3PE3A 1Y8ZA 1DX4A 3I01M 3QVGA 5DM1A 3NHFA 5AUPB 3NLLA 1XVLA 3TW4A 2ZSUA 5FBQB 3W5HA 1NZFA 2RH8A 3PEWA 3WDSA 2CUKA 2WUVA 1MZPA 1ATIA 2V6BA 2OYSA 1KNXA 4UVDA 5HIMA 3PT9A 2VSXA 4RTRA 2AV6A 1BDHA 2ACEA 5ABPA 1XZ8A 3WNDA 4UNRA 5BPHA 3IBTA 4YLYA 2VYNA 3ITNA 4EW2A 1R00A 1WSBA 2HHJA 4LVOA 5IWAB 4I14A 2VZ8A 3V33A 3H2ZA 3SFTA 5I9SA 1K6JA 2YS7A 2F4NA 4JNCA 2OMKA 3O8RA 5C5CA 4IHAA 3AI1A 1O2DA 3O9MA 3KOYA 2XJ9A 2RBKA 3QKRA 4XQCA 2OZEA 4CG2A 5IXJA 4BBAA 4MRVA 4JA0A 3GY0A 3OP4A 3T7RA 4UKDA 4G3XA 4N0DA 2O3QA 4NJEA 3BF8A 5JU6A 4DRXA 3KSUA 1VMIA 3BTVA 1CDDA 2E37A 4EM6A 3COVA 2YHUA 3D1JA 4P3XA 5B1SA 1TTHA 5ALKA 1II9A 2YWGA 1H42A 4KU4A 4FKBA 1ZOSA 2YRXA 5D51S 5FULA 5AVZA 1KSGA 1O4WA 3DYIA 4BJ3A 4GMKA 3WHLA 5LP1A 5EIOA 4EG7A 4YO8A 3ICCA 2IP1A 4QHTA 5HK9A 1QCZA 2X8JB 3CZMA 3K2QA 2WT9A 3LXUX 3STVA 3D2AA 2EJCA 3EJWA 3KEGA 4O33A 2XF2A 5EIWA 5IN5A 2MCFA 5H68A 3RRXA 3T4UA 4JQYA 4ZAYA 5CVEA 4D96A 3BB1A 4L7QA 5BV0A 5IHXA 1GTSA 3IOMA 3MT9A 2CNNA 2WRZA 3IQIX 3UCXA 4A0HA 5FBKA 2G9RA 2CZGA 2BUBA 1R5OA 2QVCA 2ZTVA 3KVRA 3R0XA 4ND2A 2W6IA 4TWJA 1SEPA 1NVWQ 5T57A 2HK7A 5EERA 2ZRCA 4AWAA 4PVCA 3ZTTA 1ZGGA 5FNVF 3KV3O 1ELOA 4ASUD 4X7BA 3DE7X 5FV4A 1VLVA 4PHHA 3W2FA 1X7ZB 1ULBA 3E2IA 3LPCA 2G40A 3S1SA 2OESA 1N2CE 1RYYA 2JCBA 2PLFA 5TVKA 2H4JA 4LCBA 4D9IA 3QVUA 5EMHA 1ESDA 3KSZO 4V0QA 2AVDA 1Q15A 1O9GA 2D0DA 1ZMRA 2JPDA 2FW9A 2PZLA 2Q7OE 4ZYWA 1M0WA 1QHIA 2HD4A 1SZCA 1ZD2P 4H9GA 4FMPA 1JW9B 2COKA 5CRIA 4ZP1A 4F9TA 2P0YA 5TV2A 1E3WB 3QXGA 4KE9A 2OCAA 1Q19A 3MCAA 5EC8A 4EA7A 1XQ9A 5ARCA 4DKXA 3MN1A 4I4IA 3D3WA 2SKCA 1COZA 1YH3A 3H4MA 1RR6A 2FQ1A 3M6UA 2Q5IA 5P8WA 5IT5A 1OI7A 4MEAA 2VDMB 4INJA 3PGMA 1F14A 1Y89A 2OHGA 1JEDA 3G1WA 1M72A 1HYHA 4R68A 5HEKA 5D7NA 1UINA 1CF2O 3RKUA 3F2VA 1VIYA 3UOAB 4NPHA 1T2DA 3PUZA 5KTYA 1H3FA 4BFSA 4DUPA 3L05A 3O95A 4TUYA 3VNSA 5FPKA 4ADSG 4WNIA 5ERGB 3WJ2A 2Z5FA 4DC9A 4P82A 2AEFA 4N3BA 2YJTD 2HO5A 4FSHA 4KOEC 4Q47A 5HM6A 4AJJA 3IIIA 3WAKA 1EQUA 1IVSA 5DN6A 4E07A 2YR0A 1LX6A 3FZYA 3FNEA 2CLSA 4FCTA 2GK3A 3KLNA 3UH0A 2NADA 4NZZA 5AHKA 2Q2VA 5CXQA 5T4BA 4CKEB 1JR3E 3LRPA 2BGLA 3N87A 1WBBA 3R7BA 3VR6D 2HXGA 4NCBA 4Y6SA 3VXKA 4YPOA 1P75A 3H42B 1DEXA 1FFBA 3WB0A 2X4LA 4TZ0A 3N2EA 3WLAA 5F76A 2PVSA 2GEFA 4C5BA 4DLAA 3CXRA 2Z58A 1KYVA 1VKNA 2BVNA 3AM4A 5I8WA 4CXMA 1NHWA 1S2MA 4HN9A 1KFCB 3BHJA 1C1DB 4HN4B 1Q7CA 3LF1A 4M1QA 4G07A 4UHCA 4DAEA 1Q92A 2XB9A 3PRJA 2C88A 4CT0A 1KMHA 2V45A 3PRYA 5ETJA 3U39A 3K6SB 2O6HA 4I55F 4WIAA 3IQGX 5BUSA 4GZMA 1I6WA 1BXGB 3QX8A 1TAQA 4UVEA 3L7NA 4I50B 5GTDA 1ORHA 1KH2A 1VG8A 2BFOA 2XOXA 3H86A 1DBRA 3EMKA 1XZJA 4NE7A 3OIDA 3WK7A 5HQ3B 4OM7A 1TM5E 3NVAA 2GJ4A 5BOVA 4LYJA 1O4VA 2QIPA 3LLSA 2JVJA 4NG4A 1NQAO 1MOZA 2ENUA 2WTXA 3GYGA 1LSJA 2J08A 3CUTA 3ORQA 4NSNA 1D09A 4RW0A 2C9DA 1R88A 1L7XA 3OZGA 3VNAA 3G7NA 2C2WA 3JASA 4RORA 3X1KA 4OYYA 1NMXA 3WP0A 2FMHA 4YJDA 2PVPA 2ZG6A 4BO1A 2HM7A 3F7TA 2QUKA 2V1UA 2WM3A 3H1FA 3WAJA 2V6IA 4K6FA 4L6IA 1VI2A 3DLAA 2I6GA 3ZGVA 3T6KA 1HDOA 1PTJA 4Y9DA 3QIVA 4P08A 5IUNC 1A9QA 3Q12A 1P4GA 3GDGA 3KSDO 5AH0A 3HL4A 4P58A 2ZJBA 1PCXA 4S05A 1RZUA 4M7WA 5DX8A 1KEEA 1I1NA 2YJ6A 1K4MA 3L7JA 2QRNA 3AFIA 3M6LA 4L0QA 4TWAA 5CURA 4JI4B 5EJ2A 1EFVA 3PNMA 3QKSA 3DONA 4TV8F 1P17A 2C5SA 3G2IA 3K2BA 2X0EA 4TLLB 1KWGA 1W4AA 1DQSA 3G8BA 1OAKA 4HTFA 1JU9A 4GLOA 5JRJA 3OFND 2Z04A 2A94A 4P93A 1JZQA 2QMUA 1T4GA 4JYCA 3TL6A 4O2AB 5DI3A 1XTQA 1RM0A 4OSOA 2XA1A 1NULA 2CYBA 2R47A 4OMCA 4LQ4A 1XYGA 3NG1A 4KKXB 3CW8X 2AR9A 3HCOA 4IBOA 4BATA 3M6AA 1TGYA 2Y67A 3LVFO 4W8OA 5JYDA 3MMSA 1TZJA 3FY4A 3UK0A 3WJ7A 4KLCA 2GK4A 2QSZA 2YOFA 3AIMA 3F71A 3MGKA 3VX3A 3H1BA 5BV7A 4HL6A 3VU3A 1D5CA 3CNNA 3D3QA 2JARA 3LCMA 1EX9A 2P68A 3OFSA 4QYTA 3U7QB 1Z8FA 2XX3A 4NBUA 4UMFA 3TXXA 5IPFA 1V35A 1T0UA 3PQ7A 1F8FA 1YB1A 2EW2A 4LBZA 4LRYA 3DS8A 3I9MA 2IDJA 4MLZA 2OCXA 3B2QA 2BFPA 1ESMA 1YJBA 2DLNA 3DAYA 3SE0A 2VBIA 3TZHA 3ZVRA 1SKMA 1QZTA 3TNFA 2HR1A 1FBTA 2N1BA 4UTPA 1SOVA 2OHIA 3HHPA 5G1PA 2Z8YM 1MABB 4ARBA 1D7AA 3L9WA 4M1YA 4N12A 1CUAA 4B74A 4AI6A 1EFLA 4CL8A 2BHNA 1IBRA 3IV9A 3UJDA 4LZOA 4L2IA 4OQQA 1ORTA 1P44A 3KZMA 4XFJA 2JF0A 4QU8A 3UUEA 2FVYA 3OWOA 3VMMA 2W48A 2RI0A 3EBOA 4BO8A 2PX5A 4HGOA 3IKMB 4KLNA 3TNYA 3A05A 2JD2A 1VYUA 2Y3IA 1AM4D 2YZ7A 3B8EA 3FMGA 3PFNA 5JR3A 4KMRA 2RGYA 1GV1A 5F3DA 1OPRA 2ZS9A 2OV1A 3X1DA 3GRCA 4NDNE 1PS0A 3ONWA 3D8HA 4IX9A 3RAJA 3Q5EA 2IPMA 3GH1A 3PXCX 2Z4RA 2B1IA 1L4NA 5DCLA 1SCUB 2XAUA 1PK8A 2I7TA 2WYIA 5IKPA 4H7DA 4XVRA 1YE3A 2UVDA 2P0EA 3CIOA 4GQAA 4MHOA 4QFDA 5C81A 4KN9S 2GFQA 1Q7RA 3KQLA 1P4SA 1D8TA 3FRJA 4NATA 5ALRA 1A8IA 3WA7A 3SQWA 2M1XA 4I6JA 4WOPA 5BSWA 4DPKA 1GN9A 2RKOA 4NYJQ 1Y1SA 1BDBA 5DNEA 5JZ9A 5ES4B 3PKZA 3B5IA 2C78A 4J0GA 3QFCA 2XCSB 3HMQA 1TI7A 5EESA 1QIJA 2C5HA 4YMGA 5E8RA 2UUCB 5ESXA 2AF3C 2ZSJA 2DETA 2A9RA 1QH1A 2CXSA 4V0RA 1NUTA 4IXMA 3UMBA 4QICA 5JYBA 4L57A 4YRAA 5I7UA 1SBZA 2PO5A 4MV5A 1TJ3A 3ILYA 1P5ZB 1TADA 3FPGA 4FDUA 3ZPXA 4IMIB 3EY9A 3KXLA 3WKCA 3O8CA 3BB4A 3T35A 2VJQA 2W58A 3DT9A 3LCJA 4A7PA 1S8FA 3TEMA 2PV0A 3BXOA 1W47A 2WPDD 1LC3A 1N8SA 3R40A 4HGZA 4AFNA 2QG4A 4DLSA 3KXPA 4R8MA 3HLTA 3H97A 3DLTA 4IH4A 1AUQA 1KZ1A 3BERA 4Y1FA 4HSEA 5DI3B 3UJ3X 3EZ2A 4IH1A 1JT2A 1NSFA 4CMKA 3BWCA 4RU1A 4QG7A 1RAIA 4JP8A 4Q3BA 5I6DA 1DGQA 5FA5A 1SKUA 1ONNA 5B3KA 2UYCA 1EWRA 1TUGA 5HBRA 4F6RA 4AJKA 2PL3A 1DU4A 4WVLA 1AMUA 4E13A 2C3YA 3KCQA 2CKMA 3TGPA 4X6XA 4QPCA 4K26A 4HJXA 2ZE8A 1G4AE 5FAXA 4OQPA 4HDKB 1M76A 5EE1A 1BCSA 1QOPB 2F3RA 1QGZA 4HDNA 1DOAA 3R09A 2Q29A 2UUPA 1X1DA 1YQDA 4JJZA 1GPDG 4BNDB 1TT5B 3KU4A 5EA2A 3WGHA 2V7GA 5JNTA 2FDCA 4Y2HA 5THKA 3E3OA 3MG9A 3RVKA 2FSGA 1Y3DE 5JZBA 3K0SA 1AZTA 3CRNA 1KOFA 3OOEA 3NJ4A 1UXHA 3TE6A 3HV0A 4ZWNA 2RBEA 3DFKA 2G1AA 3IH5A 3AWDA 3S7TA 3WTCA 1E4VA 1HMPA 3ZHBA 5IF3A 2PX0A 2C5EA 3FHOA 4MRMA 4WCFC 1BIFA 4WY2A 4BVBA 4G8JA 3V1NA 3ZDDA 1P60A 4HLUA 3FMFA 3PSAA 3GF4A 3N2LA 4GW3A 5IF9A 1HT3A 1N57A 4XQEA 1YI0A 3C48A 4YYZA 4C2BA 1DINA 5YASA 4BWFB 1DB3A 3PB3A 4ZAVA 4CQNA 4LQDA 1T43A 5JW6A 2I9PA 2OGZA 2IITA 4J3FA 3QOYA 3TNLA 1Y9JA 1ADBA 5K7SA 1FNMA 2HLDA 3H11A 4PPQA 1UL1X 2H6EA 1X9GA 3VYUB 3WRXA 4UOEA 3HJFA 1QM5A 3QW2A 3OF2A 2GCIA 3MCTA 3WWEA 1JLHA 3QHPA 4QYWA 1FU4A 5L3ZA 2DTDA 1XJQA 4NBLA 5JAOA 4DR6B 1QO9A 2NXNA 5BNFA 4EJSA 3IYLW 1SVUA 1DBWA 1U1CA 2XUDA 2YTZA 3QPAA 1IE3A 1D2GA 1U7TA 3LCUA 3RJZA 1CDZA 2HZ7A 3CRMA 3QWBA 1P6XA 2F3PA 2V9PA 4C43A 5JQGF 4ARIA 3OE7D 4HB0A 1E98A 1OXSC 1NF2A 3E27A 3SNHA 3G8AA 3E1KA 1L7RA 1V6SA 4QJBA 5E0KB 4NBRA 1AZLA 4G8CA 1WB9A 3P2IA 4JBXA 3H2HA 3P96A 5K6AC 1FC0A 1Y5MA 1PKXA 1WHSA 3JW8A 4RDIA 4X3OA 3U4MA 5E6SB 1HETA 3W90A 2DFLA 3BA6A 2F8MA 2Q5FA 3RBVA 3UWDA 1CY0A 1ENYA 3WXMA 1R0KA 3X0DA 1JDBC 3ZCTA 5JQGB 4KPYA 4TROA 3AW9A 4DJFC 5IG2A 1CEXA 1ECLA 4NV3A 3ZYCA 4TRRA 2W37A 3WNVA 2P67A 3H0CA 2G76A 3VKHA 3HJHA 1L5HA 1MLDA 4BE7B 5AI8A 3DGEC 4PFKA 4YROA 5EJEA 3GN2A 4P98A 4HGQA 1B3BA 4WKPA 5EE5B 3I12A 3QEMA 4M0KA 2WWYA 3KQYA 2I91A 1SG6A 2BHSA 2G4LA 2XNDA 2ZRFA 3E22A 3K1YA 5FYQA 1R7RA 5JAMA 2YYZA 4JQCA 1P4JA 4NAUA 1N7IA 4IDFA 2WAYA 2ZEJA 4V39A 5E2AA 2QLJA 5GIOE 3FLAA 4QYSA 1GFSA 2YUIA 3ORYA 1XIVA 3PLAE 1I2AA 3P52A 3ADOA 4M88A 5DRTA 2Y1KA 3OPQA 3W5AA 2QI9C 3FPCA 4AQYB 3QVMA 3VA7A 3L0PA 4Z86A 1V1MA 1H4QA 4JMLA 4KL8S 2I1WA 2OD7A 3HI4A 3I0ZA 1RLTA 4KAAA 5ALZA 3JQFA 3OLCX 2ONJA 2QTZA 2YJ3A 4GOKA 3GB9A 2JFHA 4NBWA 2AF4C 1VHQA 1MDFA 2ASEA 2PEYA 3SJ7A 5LDHA 4AKIA 4N8DA 4XIGS 2P40A 1CF9A 3ASZA 4R7TA 2EU8A 2K4MA 3S68A 2VTVA 3Q9NA 3WLPA 1ZN2A 4NCJA 3N7TA 1Q50A 2J9RA 4X20B 1P9NA 5DM0A 4D5GA 1GL3A 1WLSA 4U7TB 1WO8A 3FTPA 3B1XA 4I2VA 3HCPA 5DTEA 1CUGA 3I2IA 4I4TF 4H4CA 1B16A 3F6CA 2APJA 3NBMA 4MW6A 2UXCB 5F9FA 2QROA 1NR1A 3H1TA 2WIBA 3QVXA 2FWNA 1KGDA 3CY6A 3PTZA 3A6DA 3ESCA 4B6EA 4KK4A 3DVAA 1E79D 1J33A 3G5UA 5GV7A 1UBMS 3IHWA 2FR0A 1EDDA 2QUIA 3ML1A 1OKKA 13PKA 1H85A 3C1UA 1HI9A 4TXNA 3EPJA 3OC0A 1QZ3A 3M4XA 2YHBA 1NJ6A 2R1ZA 5DSZA 5J4VA 3DDNA 5JQGA 3DZ8A 2H48A 1TVCA 4U2DA 1Y1PA 5F73A 2JAPA 5JPCA 4S1VA 4RHTA 4TVOA 4A2WA 5IKMA 1PK9A 1VE3A 2WG2A 5FUXA 1R10A 2GZHA 2VDQB 3I28A 1R4ZA 3SYRA 1NASA 5ALQA 2R1VA 2BL4A 1ESZA 1U98A 2X8BA 3W78A 4EECA 1D03A 4CWAA 2UXBB 4AURA 4MTLA 2A0WA 3KQPA 3BMXA 4LHSA 5AM1A 5HILA 4OL9A 5JG7A 3S1LA 2JIDA 4FVTA 5DGDA 3FPBA 3PI6A 3E03A 2EKLA 4I5GA 4JVLA 1GAXA 2WSLA 3M1AA 4PF1A 5I7RA 3HJGA 4JEMA 1ZESA 3VU0A 2DBYA 1JF8A 5C18A 1B3RA 2WDZA 3O4HA 1O6GA 1L6RA 1C0KA 1PVDA 1SWVA 4O1MA 2J7KA 2OGTA 2QS9A 1U9YA 4BX2A 2FEKA 5BYKA 4REQB 2BH2A 1UBJS 1UJCA 1M1YE 4EI7A 1Y7IA 1X2EA 1R37A 5FNVA 5KEIA 3EDOA 3TQRA 4F9EA 2F2TA 1IHPA 2P79A 3FKSD 4B47A 2IUTA 5CX1B 1G42A 5BPFA 3COJA 4WZBE 2V6FA 4A03A 5EQTA 4PO9A 4Q93A 1JMVA 1VE5A 1XDGA 1FSFA 3VR5A 1QJCA 2FSIA 4PPNA 2ZPTX 1IDOA 1T24A 3BFKA 4QJ4A 3K0CC 2GDZA 3AINA 4FGJA 4L3VA 3WO1A 5I3CA 3NPMA 1IY8A 3IRVA 1EP2B 1PVVA 4IAOA 3LX4A 5DCWA 4ZVSA 2ZUTA 4DILA 5BWLA 4H3HB 2AI1A 3KSAC 1V1MB 2ZWMA 3OQNA 5LNK1 1I51A 5LDDC 3OQIB 1JJFA 3I72A 3ZDBA 5A02A 4MV4A 1Y48E 4REMA 2R68A 1E9BA 2J09A 4YAWA 5J9FA 3VDMA 1BVUA 3LOPA 3DT8A 2ZJOA 1CY7A 3DWEX 3I92A 4JR2A 1NQTA 4X8LA 2W6CX 3UJBA 3I5XA 2LCIA 2A9KA 4RZIA 4U6QA 4DCCA 5G02A 3UGTA 3BXHA 4E5DA 4WZAA 1NPYA 4JROA 3ZJ5A 3WRVA 1JEYA 3QITA 4OLHA 3WKEA 4ARZA 1ZKMA 3H4TA 4Y2GA 3T15A 3LCCA 3HWWA 1GKUB 4R0NA 4Q1BA 2C9BA 1QQ7A 2MINB 1KYWA 1ZISA 2ECKA 3I3SR 2RB5A 5HRCA 3PT5A 3RW9A 3VR6H 2O1EA 2ECPA 4RIIA 1QWOA 4IM7A 3GJZA 1YR8A 5F2EA 5SZJA 4NPAA 4BMPB 1ZXXA 3JWHA 1FMCA 1XDZA 3FKSA 1YI8A 4UOQA 4CU2A 4W99A 2TECE 1ND6A 1OZHA 4B43A 1S02A 3UJ7A 1IWBB 4EF6A 4EPXA 4QUIA 1U28C 2PRSA 4BMVA 1WZCA 2WMYA 4XEHA 4RKWA 4EARA 5IYZA 3DNFA 3SK0A 3AR8A 2PHZA 1QCYA 1A8QA 4YMSA 3UMFA 1E6MA 3ZQ6A 4GMHA 4R2XA 1W59A 2G0AA 3OO1A 4OF4A 5E4YA 1XWIA 2PS1A 4HUQB 1O58A 4UMVA 1OFTA 4ILEA 3A11A 4ZAGA 8GPBA 1J42A 2OAQ1 3R3VA 1NI5A 4E5KA 2Y1DA 2GPBA 1G8JA 5F7JA 5JY1A 3T3HA 1V11A 3BWVA 4KRYA 4M9CA 5DV9A 5HE9A 5JS8A 3DL2A 3FOFC 2OHOA 2FW1A 2GR9A 4RTOA 2GMWA 4JLBA 1GL7A 2XXAB 5DYIA 3G1TA 3MSCA 4JLMA 4Y6GB 1L5NA 2E5WA 3I9V1 5HK8A 3EPRA 4IHJF 4U8HA 1AGRA 1CUZA 3OUUA 2FDRA 2C83A 1X38A 2ZRDA 2VXBA 1M54A 4PXSA 3N3BC 4WACA 4CFZA 4OJMX 1KRHA 3ZLUA 1U80A 4REQA 4HFRA 2JIZA 1G2PA 1KMCA 1HTBA 5E3JA 1EESA 4KN5A 3PVZA 1E89A 4U6SA 1YRHA 3VC2A 2AW5A 5K0CA 1XEAA 4M46A 1RMTA 3IOEA 2PWYA 1MAAA 1LJUA 1EB8A 4QATA 2HRRA 4LY6A 5B7GA 1ISFA 1DXOA 3N0WA 2FPWA 1Z34A 2X8AA 1OR8A 2NZWA 4A0RA 5HR5A 3H4IA 4IO0A 4AYXA 4DQVA 2DR3A 4BFXA 3A58B 2WIAA 1JAIA 5EJ6A 5J4KA 3KUDA 3COWA 1YRWA 5DT2A 1RRPA 3PXEA 2NMVA 1G7RA 3JD2A 3L6OO 1DT5A 1GD1O 2Y0PA 3ESRA 4MH0R 3F6RA 1QIIA 4R9UC 4IIJB 1H2AS 4V02A 4K1LA 1ZBDA 4U7PB 1QRAA 1C8VB 4L8FA 1XRLA 5ALNA 2DPMA 5CTJA 3S70A 1C0LA 3HVHA 3PFHA 4BN4A 1E1QD 3H5TA 1WA5A 2X7JA 5F7OA 3AUKA 4XJVA 3SM3A 1X87A 5IARA 1HNZB 5F12A 4ZEMA 1L5QA 2BKLA 3NTVA 2R87A 1CUJA 2J4FA 5KNDH 2R5WA 1M34E 2P9ZA 2QJTA 2YIVX 1N7GA 3DEAA 3L7BA 3BMOA 3P19A 2QRGA 4IVNA 5F7ZA 1VIMA 4EQZA 1IC6A 1E99A 3DXXA 1XYVA 1T0JB 4HAIA 4O0MA 4Y9UA 1Y5LA 2PJUA 2UZ1B 2YMQA 3DXYA 4EI9A 3FVRA 1NLFA 5D3MA 1B4DA 1E58A 5B6IA 3OTGA 1E1YA 2Y1EA 1ZCAA 1A82A 1TZCA 4IQ4A 4CHTA 1C1HA 3OMLA 4AXXA 5IYZF 1AGPA 3DV9A 2WWIA 1DWQA 4EL5A 4W1PA 1J23A 1K9VF 4LGYA 2F43B 3NC4A 4DCOA 1N1GA 1D2AA 3FD8A 3PXBA 4D4KA 3TL2A 5IZ4A 1JRLA 3DBRA 4EY7A 1NYQA 1YACA 2BYTA 4LX8A 1O5TA 4AS2A 1A69A 2AE1A 2VRCA 3TEJA 4M37A 1G6OA 4RQTA 1IEVA 1G2QA 1G6Q1 1SUFA 1L2TA 1Y34E 2ST1A 2VHQA 2VYVD 2Y92A 2H4WA 1A96A 4RTJA 2C94A 1F51E 4WEQA 5ESWA 4J0DA 1JBQA 3FVVA 3TRIA 3ONNA