1EIWA

Solution structure of hypothetical protein mth538 from methanobacterium thermoautotrophicum
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
111
structure length
111
Chain Sequence
VTAEIRLYITEGEVEDYRVFLERLEQSGLEWRPATPEDADAVIVLAGLWGTRRDEILGAVDLARKSSKPIITVRPYGLENVPPELEAVSSEVVGWNPHCIRDALEDALDVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords HYPOTHETICAL PROTEIN MTH538
publication title Structure-based functional classification of hypothetical protein MTH538 from Methanobacterium thermoautotrophicum.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 21
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Hypothetical protein MTH538 1eiwA00
1EIWA
chains in the Genus database with same CATH superfamily
1UKCA 2DEUA 4NOMA 5EKXA 3TLGA 4D43A 4DJTA 2QUHA 1KYTA 5T8KC 3L7BA 4ZWNA 4GPD1 1MN6A 4F97A 2BLLA 1KZ4A 2HA3A 3G3EA 4Q3LA 5FA8A 2CXTA 3GAZA 4QVGA 5JH7B 4ZOLB 2ZI4A 3HDHA 1JS1X 1M9NA 1CYDA 1W1IA 1YU6A 3MT8A 4G3XA 4WDQA 2Y0PA 3EGVA 3AR4A 1SXQA 4XM0A 1D9XA 2HSJA 2IEIA 1WXHA 4XVHA 3A36A 2GEJA 4B76A 1CV2A 2YTZA 2H16A 1UMDB 1O1YA 4ZZ3A 4UCFA 4JQZA 4HSEA 2NUTA 2NO0A 3ERCA 3EEBA 1KOFA 1W8DA 2VK1A 5CD1A 2AFRA 2IU4A 1LLFA 2QLTA 3WWPA 1DEOA 2JATA 1BYIA 3DFFA 3ZGNA 2ERXA 3RSQA 1NJ2A 4Y2PA 1XWFA 4FGSA 2PFGA 2JIDA 4HDQB 4JNKA 4MCIA 1W5EA 5IJXA 3L4BA 1EMDA 5JSFA 1TVKA 1K3UB 3GZJA 2GD0A 3U5TA 1G3UA 1PK7A 3HUTA 3BX1A 4ZYTA 4BNJA 4OD0A 2NTEA 3CGGA 4DLBA 4NABA 3RRJA 4IIVA 3A1EA 3GUCA 1USWA 5TGTA 2ADOA 3W5VA 5C8XA 1LA2A 1SVOA 2POCA 4DLKA 4F1KA 3RUEA 1HX7A 2ZAGA 5CDFE 2GJ8A 1KMNA 3L93A 3C7CB 1AQ6A 1K5GA 3N2NA 1VHLA 3EQZA 1HLGA 2CLMB 1QYCA 1ZY2A 3ETGA 1GKLA 3IP7A 2QXUA 4ENQA 5AI6A 3PQ2A 3I9MA 4FJ0A 3LKVA 1CUAA 3ZNNA 4XD7A 4E4RA 2F8TA 2XTZA 3QHAA 1YQDA 3DT9A 3JQ9A 3UKJA 5KTPA 1RI5A 9MHTA 5A4MS 1RWMA 1O95D 2HJ9A 4D3FA 4XVUA 5ALYA 5K9ZA 1TLTA 1LI4A 3A9WA 3EW7A 4J07A 1D1QA 3H9EO 5F64A 2VPWA 4V0KA 3ZQJA 1SCBA 3DKKA 5GV7A 3VV2A 1AZSC 2OP0A 3FCUB 4U0JA 5LU8A 4WXRA 1PZEA 1XX6A 3K32A 4XPIB 4IILA 4L28A 3UATA 3W90A 1TF2A 4G5OA 3FFTA 2NPFA 1JHRA 1QPZA 1XDDA 5DYTA 4UNIA 2R8EA 1PN3A 1ODTC 1BRTA 3DJFA 2Y76A 4KK4A 3S0JA 4M49A 4PZEA 2QENA 3SX4A 2X5KO 3UK1A 4B7XA 3T95A 4CEJA 2GYUA 2I55A 3AF4A 2EBFX 2OMEA 3HR8A 1KHTA 3ESAA 3L0BA 4OK5A 4Z4EA 1L5RA 2E2WA 2XWJI 4IIYA 1WY5A 4L7QA 4G25A 3EWNA 3W5UA 2HHAA 2NQ2C 4CLRA 2IYZA 1TB4A 5BWMA 5KSZA 4O3MA 1N3IA 1T2CA 1Q0QA 2J6BA 3WDMA 1CD5A 1V25A 3AY6A 5HRUA 3IBYA 3GJRA 1RM0A 1X1AA 1ZVMA 5EYPA 2XB4A 3E82A 1XZDA 5ALFA 2W6JD 1U1CA 4NPHA 5IP5A 3VYVA 2Q9AA 4KUEA 4B6PA 1J2EA 4M86A 2J08A 1J1IA 3GJXC 3WXMA 5CB4A 3QKSA 1OA1A 2GTIA 3IEPA 2ZR7A 4IGIA 3EEOA 2PANA 3KS9A 2QRQA 3VDRA 3MBOA 1TF5A 1R0WA 2AJ8A 4GX0A 4UNSA 3NJ8A 1G18A 4TQUS 4PYNA 5BRAA 3PNVA 1JDBC 4PQFA 4M9CA 5KQSA 3JQ8B 2AVDA 3DMTC 1TDJA 5JZSA 1DAFA 2UYOA 4K9RA 4HPWA 4CM4A 1SBHA 4IUDS 4M88A 1F7UA 1LKZA 3QVWA 4MV7A 1R9MA 1M6VB 2VXYA 3FDZB 4NDAA 1XC7A 3T4UA 4N8SA 4M1MA 4FZ5A 5K8JB 3GLGB 1N0HA 1E2QA 4LC9A 5F1KA 5TGZA 1O03A 3EY4A 2O20A 5FV7A 1ZBDA 2O3QA 1E4OA 1P0CA 4MV3A 4RD0A 3PD1A 4YJHA 3HB7A 3O93A 4E5UA 2DVMA 3BCRA 3GGGA 1PUJA 2REQB 2FPLA 5DXAA 1NKSA 3FB1A 2R68A 3O2QB 2VPPA 1SUDA 2X0DA 1ZD8A 3T5MA 3UXEA 3THOA 4KGDA 4K3VA 3VR3D 4YJ2A 3BFKA 2Y71A 1LVGA 5E95A 1WBJB 1IDOA 3N07A 1M5UA 2YIVX 5LQKA 4EUEA 2EF0A 1HYGA 3ICOA 3KEOA 4ZXPA 5AW8A 5JJIA 2WWIA 2ZYUX 3LQFA 1H3NA 1TKBA 3HSYA 1XF9A 4RJLA 4W5JA 4FS3A 4OVKA 3DVLA 4FOTA 4MRRA 4NRDA 5AK3A 5IZ4A 2DQZA 4G0PA 2VLBA 1JHUA 1T9CA 4KAXA 4D8VA 2PUWA 4ZVQA 2BUBA 4W4TA 1QLHA 5E6SB 3CG0A 3GGOA 4Y2QA 3L1UA 2BELA 4HNRA 2QP3A 3HGQA 1REQA 3ZXXA 2NUAB 3ZV6A 4FCWA 1GCIA 3UXYA 4TT8A 1N0UA 3S2SA 4Y6GB 2GO7A 3PQFA 1H3FA 1Y9JA 5KBYA 1WEKA 1UQTA 3WL3A 1D5WA 3CX8A 3IEIA 3VTZA 3O6VA 3VBEA 5I3CA 4XYBA 2IW3A 4D56A 1E5QA 3BWCA 3RO7A 5J9FA 3VJLA 3TL3A 2IH4A 3H6GA 3HRIA 1ZW6A 4YP9A 4N48A 1HURA 1FP6A 2QLMA 2WU3A 3L79A 2ATIA 2V58A 4HFRA 4NJEA 2NU8B 3UPUA 2H3HA 5BMVA 5C8DA 4LYFA 2BZGA 4PG7A 4PC2A 4EJ0A 1VIVA 1Y8AA 4I08A 2JBHA 1P5HA 1PX0A 5L3VA 2H54A 2Z5FA 5ERXA 1N6HA 2F90A 4EYSA 3CH4B 2FUEA 3WL7A 2EJCA 1H6AA 3LCCA 4AG6A 2DXIA 2FSHA 3TI7A 3U19A 4K8RB 4FWBA 2X42A 4QJ3A 3DVAA 3F46A 4IWXA 3TL2A 4LY6A 4EFLA 4M0EA 4KNYA 3LYUA 5KTMA 2DWCA 1E7YA 3B78A 4F38A 2P4EA 4RA9B 1ICEA 3E9ZA 3L07A 3LBHA 4UU0A 2EX1A 4C2BA 1QIHA 2IYQA 2BR4A 3BRCA 3C5HA 4J16A 1SVMA 1ZEJA 2SCUA 3NEPX 1PJSA 1U2ZA 3O8DA 3WL8A 1JWLA 1Q19A 4KN8A 3VR2A 4DQDA 3EAQA 4XYEA 3GCDA 4GPIB 4R01A 1XXHE 5FLKA 3JRXA 2O5EA 5JSHA 4XAQA 2FWNA 4CMIA 2FEMA 4BNFA 3ORHA 3U7QB 4TWBA 5I01A 5JYEA 2OFPA 2RGXA 3LOPA 4G5YA 4Y2JA 4NE9A 1ZPDA 2W7TA 4D1YA 5I7FA 1SUEA 4OXQA 4GZ6A 4JVNA 2XRZA 4DLVA 2IHUA 4KIWA 1TC1A 4OQZA 3AM3A 3WGOA 5KU7A 4OEHA 4DOMA 2IS1A 1JQLB 3DHEA 3RS9A 1WOYA 1SIOA 4FOLA 5AK4A 2R4TA 4MAMA 1X7WB 4CGYA 1GYPA 2GXSA 3USCS 2V5AA 4REQB 1X9GA 4GMXA 2NNWB 4LA4A 4V03A 3CWCA 3LX8A 4XWGA 2ZSAA 2XAUA 3PKIA 5EIOA 3QFHA 5EP2A 3EG9B 1C5KA 4BTVA 3IVCA 3KQQA 1NVMB 2DWOA 2O2GA 3E23A 3D3WB 1D2AA 3L4KA 5GJBA 5DMHA 2D3WA 1QHIA 3HUFA 3ZV4A 4E1VA 1G55A 1JIXA 5EXSA 1GZUA 3O95A 5EJMA 3R9IA 4F6RB 2NSJA 3LPMA 4AZTA 2O8NA 2CFRA 2FPMA 3FROA 1CUFA 2Z98A 5M29A 4AJ9A 3GLSA 3ND6A 1FK8A 2ZI9A 3BERA 4YMSA 1TT5B 2G77B 2Q3JA 3CRMA 2ADMA 3LYLA 3D02A 1YB5A 1I3CA 1OWLA 5DEIA 3LFTA 1FUIA 4INZA 1KMMA 4IV0A 5I7AA 4C14A 4BX0A 4ZJUA 3AJAA 3TVDA 3LPDA 4PLHA 2JIRA 2Z8ZA 5DIFA 4QGSA 3PUXA 3R9WA 1BVHA 4X00A 4AD8A 1XP8A 2CLFB 4ZJPA 2QVCA 3E2PA 5D3KA 3DDZX 2H00A 1OPRA 3NHBA 2AXEA 3QE0A 4CU2A 3S8YA 5D2CA 2ZIUB 3EZXA 1KAHA 3KX2A 3OJWA 1A5AB 1DXHA 3LRTA 2WJPA 4X7BA 5HX7A 1SUWA 3TQRA 4RJJA 3OZXA 1IYZA 2WQZA 3ZNPA 1GAJA 2ZYIA 1JG1A 3KC2A 2W2KA 4Q4AA 4QSHA 3W2HA 4N5DA 3F96A 1VG8A 1GKIA 5A04A 1N7JA 2BGNA 3C43A 1M66A 4G9BA 1OH6A 2BFEB 1Q7EA 3B7GA 4G84A 2PKQO 1DG3A 1NP6A 5KCZA 3B2NA 2QQFA 3LSYA 3C4VA 2PKRA 1N2EA 2IELA 3ODPA 4M89A 5TEVA 3CR8A 4UBOA 3OTQA 3TK1A 1RZUA 2FDCA 2ZTVA 5AOVA 2ZITA 1Y98A 1B0UA 1YGPA 4HY3A 4X1KA 1R4NB 4Z3OA 3AYXB 3ZDEA 4ECAA 3DTTA 5MN6A 3HYLA 4XQ0A 1WXIA 5P8WA 4YI3A 4B3RB 1YONA 1A7AA 2JLCA 2EZ8A 3E0QA 4OHVA 4ZU6X 5K0TA 1Y5MA 4WBNA 1H8EA 4B7ZA 2RBEA 1PYDA 2BCGY 1Z9BA 1CULC 3FVVA 3H04A 5CP8A 2PJUA 1PR0A 1UK8A 3KHUA 3OKPA 4IDEA 6NULA 2UVPB 4HKTA 3BOSA 3MJHA 1K2VN 5CTAA 3QE3A 3TXAA 2XUZA 1PQYA 2DT5A 5JCJA 4HP8A 4LJRA 4MAFA 1AKTA 4LXTA 2OYRA 1RLUA 3GCWA 3B6JA 2XKJE 5K6AC 5FBWB 1YASA 1HLFA 2I7CA 3I45A 4ZVTA 4Q24A 3SC4A 2O8BA 4BRWA 3L0ZA 1RVDA 1CZNA 4CM9A 1QVZA 4IHAA 3KSRA 1IOZA 4YP7A 5TV2A 3ZTTA 4MQ4A 1CVRA 1OZHA 4I5FA 4QLBA 4YP5A 2ZXEA 3CXUA 1AQLA 2AX4A 4W5OA 1H8HA 2B9VA 3SDZA 3NBAA 4DLLA 4CG2A 4FGKA 4R0NA 1KAGA 4ODIA 1A98A 2JZNA 5CU7A 3JD4A 1EVEA 2YN2A 4Z0NA 5B6JA 2PAFA 2EP8A 4KR0A 1WW8A 4FCCA 4ZJYA 2OXFA 1U2GC 3OTWA 2R9VA 3Q3EA 1FSSA 3CCFA 1ZJ6A 4NTZA 4WWHA 4XFDA 2Q5OA 3UJDA 4YRSA 2O8DA 2C2YA 1V5FA 3T6KA 4L73A 1IN5A 5KQLA 4ZYXA 5EZYB 3D8SA 2W98A 3G2HA 1FPMA 4MVJM 4RPHA 4DIUA 4GQAA 3FOZA 3ZK9A 2WFAA 2YQ4A 3P7MA 4NQRA 1ULHA 3CNQS 3K70B 3CLTD 4LDRA 4QYXA 3LI2A 1EX6A 1XEFA 3JU3A 5CT6A 1TNDA 1BCRA 2QDXA 2IXEA 2QM0A 3H2KA 3PQDA 1YJCA 2CMKA 3EMVA 3MGAA 4C88A 5A5DA 1XKXA 2GVDC 4NBWA 2OAEA 3LU1A 4MYHA 3EVTA 1P8JA 2CHVA 1EH5A 1Z25A 1N7GA 3CNNA 3INYA 4XARA 5IMSA 5SZIA 2GZ2A 3Q85A 4U5XA 3BC1A 4MPRA 1M2OB 4MJ3A 2WICA 1GGKA 4ES6A 4EHHA 2DR3A 2QX9A 4Z3KA 2OCYC 3NYIA 2XSZD 3QF4B 1G17A 1JSZA 5ALEA 4XGIA 4PG6A 2OYSA 3K6SA 3PT5A 1YXMA 2QR5A 1ML3A 1QFMA 4DZTA 3OU2A 4ZOBA 1PJ2A 2V4MA 1L6RA 1JE1A 2QSZA 2X15A 3JRNA 3A26A 1IUKA 4LXIA 4RKRA 2VKTA 5EA2A 3VSEA 5KYVA 4C6TA 2IPAB 2JLRA 3ETLA 1YE5A 1M2NA 3ENQA 3HXMA 3BQNB 1QQAA 1XTJA 3KQSA 1CEYA 5I9SA 1Z0FA 2EC5A 1XTSA 4D9BA 5CITA 1TLLA 4U1RA 2QVBA 4MZDA 3HBFA 1DFHA 1NXVA 2ZW9A 3GLGE 5EIAA 4P0PB 2FJ0A 1LQTA 3S28A 3ZHQA 4PBSA 5JZVA 4C0WA 4W1RA 1EVZA 3I42A 4OLBA 3RFXA 2HEGA 1JF8A 1T3GA 3EDMA 1MO3A 4J9VA 3ESZA 3NOXA 4TWAA 1R0LA 4DWVA 5JD4A 5LXTB 1L7AA 2AUNA 2Z8YA 5K3CA 3RODA 4LDQA 4RF3A 4YHBA 4KQ6A 2O23A 3S2IA 1U80A 1MRZA 3WLIA 2OZLB 4WMLA 1SC9A 1K8XB 5KYUA 2NZXA 1Z6TA 2R79A 3A04A 3JZFA 1NE2A 3ILVA 5HTKA 4R3UC 1M1YB 3U7HB 5FAKA 4QX6A 3QLEA 3CKYA 1DKNA 1O9HA 3GBVA 5H3HA 3OFKA 4DQ0A 2VBFA 5FIUA 2NT4A 4D9GA 1SU7A 3B5IA 4C3UA 2LBPA 1JQEA 3SM3A 3BMNA 4BX8A 1B00A 2YRXA 2ZE8A 4RK4A 2UYCA 1C7ZA 1I33A 5IT9A 3TDNA 4IVNA 1K6MA 2JIZD 2D1RA 5JDCA 2VJAA 2ZKIA 2H1OA 1RBZA 4M0FA 3DWEX 1JDJA 2ERCA 5J2TF 2CZGA 5H7XA 4WLVA 5KJCA 4IMIB 4MMXB 2AN4A 3KZNA 2G1AA 4M1OA 1NASA 3EISA 1KVQA 2I4MA 2GBIA 2PVSA 2QAGC 3KKQA 4JY7A 4C76A 3SBEA 4CKCA 2A59A 1U2PA 5A7HA 1ICIA 1OFIA 1R2QA 4PQYA 4KWEA 3F1KA 4BVFA 2VYQA 1E3QA 4MQUA 4DYVA 2FF7A 4R5MA 3N2GA 3BDIA 4FNAA 3BK2A 3IJRA 4I9HA 2AIRA 3UJ3X 2E4ZA 2XECA 3PGLA 1Y3CE 3VZPA 4K9OA 1AY0A 5KWEA 4QG7A 1B8UA 2G4LA 4NBKA 1J23A 2DHQA 2OZVA 1BWPA 2LDXA 4S1VA 1A5TA 4TRMA 4LBVA 3UG7A 4D9HA 2P7IA 4DCCA 1CEQA 2V7EA 3PLAE 2J85A 3FB4A 3E84A 1YUMA 2O2SA 1RHUA 2N0SA 3EXAA 3H05A 3P71T 3QV2A 4WEOA 4WRRA 4XQGA 1FSPA 3GUYA 1CXZA 1IHDA 2OTCA 5FBLB 2WBLC 3OLCX 4U8GA 4RENA 3WK7A 2REBA 4BO8A 1JHXA 2ZWPA 1EGAA 1UANA 1PGQA 1U4OA 1L7VC 4LXQA 2XOKA 2QL6A 4WOJA 4M9XA 1T9AA 4Y9UA 3V3KA 3SS8A 1S3FA 2QLBA 3NW9A 2RGEA 4QLAA 1PFQA 5DPMA 3CH7A 4RVSA 4HB4A 1VLZA 2D1FA 2AOUB 3ED5A 1CB0A 2SICE 4EUHA 2ZJ8A 2WJ6A 4DRXB 3A6JA 5BSUA 2A9QA 3HB1A 2H9YA 2BM1A 4LXYA 2EEZA 1TA0A 3RK1A 1IQUA 1PHRA 4F04A 4DCPA 4ARAA 4CCWA 2GXAA 4ARUA 2AR7A 4QA9A 4YFVA 5G2OA 1II0A 4GZ5A 3HZZA 2O1XA 4RKQA 4MIYA 3ZBUA 4MW7A 2YY6A 1ID1A 1MOPA 2J31A 3FIJA 3M49A 4MV4A 4PLCA 4X1YB 5TNXA 3TTVA 1GPNA 2F62A 5A5EA 2HU8A 5L95A 2R1VA 5JCXA 1O2DA 3CB2A 1F2TA 5F12A 3RS7A 1SC4A 4QFBA 3EEYA 1JXMA 2ECFA 4WZAA 1RRGA 2Z95A 5KU1A 3T8YA 1SVIA 3B2QA 3RU9A 2IEAA 2ZVPX 3BCSA 3MOIA 3P0IA 4XIFA 4EMBA 1E3EA 3NM4A 5D7NA 3FPAA 4Q16A 2HQSA 4B3IA 4TV9F 2YFYA 4ARBA 1VBFA 3AERB 5JFOA 3CZ4A 4OBBA 1KNQA 1TIBA 2APJA 2CNKA 2C3PA 2HLDA 4YJKA 1PFGA 3F74A 2O3UA 3NC1C 1GSAA 5ALWA 4BPRA 3GCGA 4N54A 4TLCA 3UVEA 4PNHA 1X19A 1WMFA 1ML4A 3KVYA 2B3DA 2WQ6A 4C01A 1XNHA 2CE7A 3GEIA 1G3IA 5JU6A 1SVUA 4PPQA 4PAWA 1OFUX 1L5OA 2YWFA 3WGTA 4C7OB 5JSZA 2PMFA 2DKFA 4AURA 3O38A 1GCGA 2NXCA 3MS2A 2F3TA 4FI3C 2RG1A 2R62A 4YIHA 3NC0C 1DMRA 1IHXA 2LWIA 2QS9A 3H5TA 1OIWA 3ZDAA 3PYLA 2O07A 5EL0A 3T12A 4M9SA 3MIZA 3DMFA 3F67A 3V4ZA 3U3ZA 1CP2A 1KDYA 3O75A 5IPFA 3I04A 1LF5A 2B69A 3L0DA 3IR7A 1V5IA 3U80A 1O5OA 2B8EA 3AVPA 4HUQA 1CB7A 2R6ZA 1QUEA 2V1XA 2ZJFA 5DASA 4P80A 1VL0A 4OXXA 3TLEA 4G85A 4J7AA 4CWAA 2RBKA 2FSPA 4HMQA 3WADA 3ZN2A 2Q8NA 3SYNA 4JT4A 1IOLA 4YONB 2HHJA 4JB2A 3QNWA 4MYRA 4FJ2A 1NVUQ 2CHEA 1V9CA 3L8MA 1LDBA 5D85A 2I2FA 3S2YA 3VC7A 2O7VA 5A0VA 3F7NA 3A9VA 4J43A 2H1SA 4R1MA 4DJDC 5B7NA 3KFLA 3AI1A 4JL6A 1JR3D 3CUUA 3KYDB 1CUXA 1V7PC 4HFMA 4RIHA 3WNZA 5ELXA 1QFSA 1EZ4A 2QYSA 4FMBB 2FPIB 4GKVA 1IJFA 3AZQA 3VHXB 5KX5B 5LVAA 2ZP1A 2HU2A 1KJIA 3ZE1B 2V7QA 1UPUA 3I2FA 4NEHB 2OXIA 1YBAA 4IX9A 5EIFA 1E7SA 2WWVD 4WZBA 5ENVA 2IW1A 3DZFA 1WTAA 2BEUB 4HTFA 3GBPA 2I4NA 1UKAA 2IK8A 3GVXA 2OQRA 4A03A 1IQ0A 1SG6A 4QUEA 4WI1A 4EHFA 1W44A 3VZRA 5B4TA 4A8JB 4Q1BA 3EF1A 4PVCA 3SR4A 1AD2A 3RS3A 1DC7A 4A4DA 3OF3A 5HGXA 2IDZA 4X63A 3GGPA 3OPXA 2X4LA 4X3CA 1GSIA 4FBLA 4AFNA 2QUZA 3TRJA 4TZKA 3SN6A 4YECA 4ZI2A 4CF5A 4L15A 3VPCA 2K2WA 3S4YA 4EKNB 2WE8A 4YRRA 4F0JA 4RE5A 3L7OA 1RRVA 2XDYA 3R7WB 3DEYX 3PX7A 4E4TA 1Z5GA 2C42A 2M6RA 3CEAA 5KO2A 2P9ZA 1I8TA 4I1YA 1UXKA 5FADA 4OKIA 1FSGA 2JFFA 5C18A 4KLNA 3OZCA 2QAGB 2B5OA 4AX4A 1VE5A 1VPEA 3LBAA 4B40A 1KJJA 3FPBA 2D2FA 1EIZA 2JZOA 3AI2A 5ER9A 3ZBTA 4C6RA 4CMGA 4EGAA 1O4WA 3I1IA 4OGKA 3KQYA 2W2MA 3UCFA 1E92A 1VL2A 1ZN2A 1AGYA 2PT7A 1NJSA 2MYUA 1QIFA 2EFJA 5BSWA 5KYYA 2C54A 1ZHFA 3P5BA 2JA1A 2G9ZA 5FFFA 2GJAA 1ZD2P 2UZ0A 2WM2A 4UEOA 4ZGGA 2HHHB 4JXXA 4TGLA 5EEGA 5HS6A 3ST7A 5DCWA 1VL5A 5G0VA 4E2WA 3D6TB 1Z13A 2JVIA 3DFKA 5DGXA 5ALTA 4QECA 1AZLA 1TA4A 3WFIA 5CB0A 3ZS8A 1XUOA 1SA0A 4RANA 4Q9JA 1IBLB 1J5PA 5CVVA 2W6MA 5LP6B 4BMNA 1FMFA 3WHIA 1VTKA 1YF3A 1YA6A 3OZFA 3WQSB 1GFZA 1ORTA 4XUEA 1MUUA 4GYJA 1A9SA 1O94D 4R2MA 4UVGA 4EBFA 1A88A 4Y2XA 1CIVA 1VMAA 1F2UA 1ANKA 1TM1E 3KT8A 4IJMA 4IW3B 2R7MA 3OIUA 4KXQA 2V1UA 4IHJB 2QW0X 4GG1A 4GWGA 4LUCA 3RTEA 5JXIA 1FDSA 2LVBA 2ZEJA 1PR9A 4WT7A 3IOYA 1U4SA 1EHYA 4UM5A 4M6WA 4BN5A 2G5CA 4CIYA 3WYCA 4ZEXA 4Z86A 3DBOB 3PHCA 4BQNA 2ZPAA 3IVAA 2Z56A 5LOVB 3U4DA 1P9OA 4HH1A 2YR0A 4TN1A 3ZGXA 4F6LA 1GZ3A 2QYHA 3F0TA 5L3SA 1AMOA 4NE7A 4JX9A 3ELDA 3WMWA 3JX9A 1KZ1A 3X1XA 1U3FA 2VOEA 3QVSA 2C83A 1I3MA 4X97A 5AVKA 1J21A 1DV1A 3RLFA 2D6FA 3H8WA 3LECA 1XTQA 1MX3A 3C3BA 3MQ4A 3O3CA 3PUJA 2EHJA 4I50F 3ENKA 3VU9B 4AX8A 4F2GA 4H7IA 2Z6AA 1M0EA 1KYWA 1NN3A 1S2OA 1EFCA 5ADVA 3NDJA 2W43A 4DLYA 1I5EA 3EZ9A 3VO1A 3OZEA 2WT8A 4MLPA 3RS8A 1ZCAA 1LBSA 5DHQA 1LS6A 3EWIA 3RC3A 1XZMA 2IOFA 3D8HA 1KDRA 3M1LA 1X8KA 1W93A 2YHIA 4QDJA 2V6IA 4KH0A 4L9SA 3OPYI 4KNWA 3T3IA 1N1GA 2NO9A 1EWYA 1QGYA 2EFCB 3FSEA 3MJSA 5D3QA 3TOXA 5FF9A 1M1YE 4FKZA 4NULA 3BGWA 1SWVA 4J1SA 3KSDO 4L9RA 4MARA 1GG2A 3IRUA 2HL6A 1GQOA 1I2AA 1O6BA 3UANA 1P81A 3EXG1 4FE7A 1PK8A 1SUPA 4EGSA 4WFJA 2J3KA 3GFSA 4ZP1A 3SZGA 4U63A 3PDWA 4Y9TA 3I5AA 5EHQA 4UUPA 1ZGZA 1EVLA 2IGBA 2GPNA 3PNMA 3H42B 3OOJA 2GWHA 1YOVA 1A2KC 2TMGA 2I3BA 3QMMA 1ODKA 1Z73A 3MRTA 5GWXA 4RK7A 3LV8A 2NUBA 3ABRB 4HWSA 4CNQA 1L2TA 1U8YA 3AU9A 4YDQA 4TL9A 2Y67A 3JASA 3BH7A 4RV4A 1IEVA 1XVAA 2ZJYA 4LCEA 3FKQA 1BVRA 3COVA 3L7MA 4JQCA 2EG5A 4P3NA 1EZ1A 1QH8B 1Z6AA 3M5DA 5DM2A 2GPTA 3SBOA 1J56A 4R8RA 3OPNA 3DD5A 4G23A 4D8YA 2EWVA 1YB4A 2FOXA 4I1RA 2H2FA 3AHJA 3QHQA 4KXXA 5FTJA 5LA6F 3BTOA 4I36A 3HZOA 1XQYA 3PJGA 5EJ6A 4MEBA 1VCHA 3JQ7A 3T3MB 2X4GA 1WBDA 1T9DA 2HQ1A 2F1JA 5GOZA 2WJ3A 2XVYA 3U60B 1VJCA 2PVCA 2Q8QA 2RH4A 3LK6A 4KMRA 1IM2A 1HUQA 1I5RA 2PR7A 3ONVA 4JI8B 1SFRA 3VVCA 4A0FA 1XLUA 3F5DA 5BWNA 1Q1QA 1G2IA 2W6OA 4FFMA 3EAGA 4IDGA 4O2RA 4CQLB 3GAFA 1OILA 2HF2A 2G06A 3EUWA 3F6YA 3TMYA 5KSWB 2HMWA 4R69A 3HR7A 1I3KA 4RADA 1MVLA 4WN3A 5KYWA 1PNOA 3UW1A 1J2UA 3GRCA 3MWEA 3HFRA 1Z0SA 3JQFC 2E82A 2EX0A 3V7WA 2IBMA 1DBSA 4GMGA 4LSMA 3MJEA 4NYJQ 2C2GA 5DHUA 1AURA 1MZVA 3GC6A 4N0MA 4JBNA 4LX8A 2VAVA 3THRA 3T94A 2JI8A 3CA8A 3FGZA 3KKPA 3MCUA 4GOJA 1RAIA 3KQOA 3FMVA 2XCLA 4F7DA 3D8UA 1A7JA 3LUBA 4I55F 3TNLA 1EDDA 2CKMA 3RYFB 3HABA 4BLQA 4BO0A 4YRCA 3DDHA 1XBTA 3K73O 1Z0DA 5B1YA 2IQ5A 2ZRAA 1HNZB 3GFOA 4KPYA 3AH8A 1TQ6A 1ONNA 1D1SA 5DRTA 2HV8A 1HE5A 1UM9A 1XEWY 2FOIA 1O6ZA 2IE8A 4QDTA 4L0CA 3CR7A 3E4DA 1RIIA 5F5XA 2WP8J 4D82A 3EQ6A 1GZHB 2YV3A 1XDBA 2R97A 1J0BA 2O7NA 1L7NA 1DIRA 1A9ZA 3B1KA 1NRXA 4ZCSA 1KZ9A 2BE7A 2WOJA 1FMJA 1RRMA 4IINA 1RZRD 3CPHA 3FFXA 3SC3A 2F9FA 4BNLA 1J5XA 1DQPA 1E3WB 4BJ1A 3FUWA 4UUQA 3W7VA 2O1WA 5IXYA 3HBAA 2GK3A 1H2BA 2X6TA 3LT0A 4PTLA 3EPRA 2IS4A 1Q14A 3NWBA 1S3IA 5SV2A 3T3DA 3TSZA 4ASUA 4YRAA 4RGQA 3O7MA 1IFXA 2HO5A 3O9ZA 3RYCA 3E2IA 3PZBA 4X7RA 4JLWA 3AEQB 4ID3A 1PIWA 5AVVA 1Z6YA 1YC2A 1ZGCA 2IZ7A 1K68A 1QH1A 3MWYW 4YY3B 4P3XA 2K2QB 2W0MA 1CCWA 1E0JA 1KJQA 3H84A 3PFHA 4HRXA 3IIMA 4QQKA 4TLDA 4A6XA 2EFYA 1C3VA 3ITEA 3A6GA 4RCVA 1CY6A 1LLUA 1G5RA 1Y6JA 2G6BA 5FOWA 2NXWA 1R5OA 3I12A 1W9HA 3A6LA 4ZOQI 3L8FA 3ICQB 3BTVA 4QASA 4MX8A 3R0ZA 4OQMA 2B1QA 3AINA 3G23A 3GFFA 1NUQA 1QYXA 5IM5A 5DI3B 1JPVA 1Z62A 3N0TA 1BX1A 3WGKA 2BLNA 1O6CA 4LQLA 3WB0A 3U7JA 1UXOA 3OURA 2CVPA 2N1MA 4BLVA 3L6CA 3TLBA 3NCTA 1JHMA 1Q22A 1Z8FA 1RWBA 1HDRA 3KZXA 3DC7A 1ZGHA 4Q7LA 4G2NA 4PLVA 1H2XA 4GZ3A 1GDHA 1EXDA 1ZIPA 2H0AA 2CWDA 2XWSA 2IZZA 3OIWA 3H9JA 1UXIA 2NGRA 4HNGA 2A7XA 2F8MA 4P58A 1GTMA 1GITA 2DLDA 2DU8A 3GF4A 4LYGA 1WIWA 3K0HA 1HI9A 1VA5A 3Q3IA 4J4BA 3AG5A 4DWWA 4I4TA 2QN6A 1EWTA 2OGUA 2VHCA 3JALB 4KE8A 5AHWA 4DCMA 5KREA 1FZTA 4EUKA 1JB1A 3EDOA 2F1IA 4L4XA 4B9EA 1UH5A 4LHEA 1BWSA 4KQXA 3U44B 3KWFA 5K09A 5FPHA 4QVIA 1Q0RA 1PR1A 2VJNA 3R5SA 1KMHB 1T8TA 1VSQA 4UTZA 1O8CA 4KLCA 4LXUA 4B2IA 5AK6A 4IUYA 1WHSA 2AG5A 3EC2A 3GNSA 2CFOA 2P1RA 5CH8A 3ZLBA 5ALGA 1M0WA 1W6UA 2YJ6A 3B2EA 2AOTA 5JSKA 5IWCA 2BSXA 2BKLA 5EJGA 5CDFA 4PIVA 1A76A 1KQOA 4CM5A 4EY8A 1D7OA 3OJCA 1E9CA 2FGJA 4GI5A 4F3RA 3WV4A 3D7MA 4KO2S 4FWTA 2FMHA 2LCIA 4DKJA 4JFAA 3P0FA 5H82A 3GRPA 2OL4A 1F4LA 1I3OA 5DBGA 2W9XA 3TIFA 5TQ2B 3U37A 2XD9A 1E1LA 4AJIA 3M89A 3QSGA 3T9CA 2BGGA 1T8WA 1E6LA 1TADA 2DJIA 1CQIA 3NP7A 4O8CA 1ZM7A 4NONA 3QKRB 1AZWA 3GRUA 3KKMA 1SCNE 3E8XA 1MA3A 3HKBA 4LI3X 3B38A 2DUMA 4RHCA 1T2AA 5K0JA 2XMPA 1DXYA 2YMLA 2IYNA 1SUIA 3JQCA 4LGMA 3VHQA 1DKUA 3FTQA 1I13A 4PTYA 5EZSA 4G89A 2DPXA 2J09A 2ZJ7A 4OSOA 3V4SA 1ND5A 3LC7O 1G5QA 1J42A 1KI6B 1JSRA 1EXWA 1L4MA 1Y5IA 2OMKA 2H1HA 3H7AA 4M0MA 2IHBA 2VRNA 3K2IA 2AZXA 1JA9A 2I2CA 5JNLA 2CXQA 1N5DA 1WZEA 3ZHBA 1UOEA 1QWOA 2FDRA 1TAQA 1M2GA 1ZMRA 4LZNA 4N7BA 4OK6A 4OY3A 2YFHA 1ZD9A 4LNHA 3UGKA 3ZZMA 5AO9A 4EQZA 1XU4A 2ZSDA 3GVHA 2UVDA 1GXSB 3ROPA 2FVXA 2DTEA 2WPDA 3IBGA 3L40A 1DXQA 3OETA 1E6KA 2GNPA 4D8UA 4EG7A 3EODA 1ESZA 2VYNA 2WMDA 4RH3A 3RRYA 2IH5A 7REQB 4O1HA 2PMBA 3BJMA 4OXKA 1PFVA 1L5NA 2ISQA 1DAKA 2Q9UA 5HKOA 4EF5A 1QB8A 3PT9A 2J7PD 1FUEA 2D5IA 2J67A 2QZJA 3LE8A 4Q3NA 5JNUA 3MINB 3O8OB 1BE6A 1XHEA 1WW2A 4I1IA 5AKEA 2YX1A 3AY0A 3KT3A 3QWFA 3AVXA 3RM3A 3HJAA 3U0VA 3BF8A 1WU7A 3GA5A 1E1RA 3B9QA 3H5VA 3NBZC 4E07A 3DCJA 5KPJA 1YNSA 1E2PA 3AKEA 2OGZA 3IHWA 3AUYA 4LXXA 2QY9A 3M2TA 1TEHA 1UBRS 3BGOS 4EVSA 3CLRD 4IOKA 5H3CA 2C2WA 5FFNA 1QDEA 1NN5A 5ALKA 1MV5A 5B37A 2ZBQA 4L22A 2GQ0A 1VLMA 5CNKA 1SKQA 2BGKA 4LJYA 5CUQA 1N2OA 1H9BA 3C1TA 3V4OA 1J39A 3IUMA 2CYAA 3THWB 2UYYA 3R23A 4ZQHA 4PHFA 1G1MA 2CHUA 2V7GA 4G5HA 2QVZX 4BE9A 1DRKA 2BI4A 3FVQA 2ATCA 3DTNA 1RXUA 1G3MA 5G02A 5DYIA 4A6PA 1S89A 2C2BA 2HF8A 1NBAA 2FUCA 4IIJB 3PLRA 4RMHA 4TQ9A 4BCCA 4LDAA 4M9UA 1XCMA 3PXDA 1G8GA 3FW1A 2IEDA 3THYA 1CQXA 1IWOA 1LH0A 1R3UA 2PD4A 4I6EA 4LJ6A 1TTTA 3B48A 2VQEB 1Y3FE 4YRMA 4BE4A 1M2EA 1WDMA 5BR4A 3BKXA 3PF9A 3I73A 3MRXA 4IIFA 3RT9A 3ZNQA 2WUVA 1ISFA 5HOQA 3GP8A 1A9TA 5JAQA 4B4WA 4JLNA 3ANMA 2D1SA 2QT9A 2BEWA 4WFKA 2D0OB 1TI7A 2OVBA 2Y1WA 3T9BA 8AT1A 1Z17A 3C3JA 1W5AA 2ETVA 3LY5A 6LDHA 5HF5A 3TX6A 1C9EA 2QIOA 2WHXA 3AW9A 3L8GA 4BNZA 2PPVA 4UDNA 4TL6A 2WVHA 2K6GA 3KIPA 4Z1OA 3E0XA 3EIUA 5KDOA 4FQ5A 3HKEB 1C3EA 4OQXA 5JO9A 1NQ5A 4JKIA 2VYVA 4I14A 2PYDA 3I9LA 2QTVA 2QMOA 3ZWWA 4DDKA 2VDWB 2G72A 1UPTA 3QU4A 3AVVA 2WILA 1B6RA 3IUSA 1A96A 2CY0A 5JPCA 4KSCA 1U8XX 2GAIA 3RH0A 3L8EA 1JIVA 2RGYA 4EFNA 5B7QA 3RFVA 2PUDA 2QRKA 1PW7A 3OICA 2HA7A 1C8BA 1H5UA 4POAA 2XXJA 2WJVA 1DB3A 1GQ2A 1Y4SA 1RT9A 2ZJ4A 3A25A 3PHLA 3Q5GA 4JUFA 1HDYA 5F21A 3BH6A 4U2EA 3REFA 3SHOA 3IUNA 3L1HA 4KN6A 3QJYA 2YVUA 1W7AA 2FFBA 2ZUWA 1P72A 3IODA 4L76A 1M5RA 1NOJA 1IN4A 1DJLA 2PGIA 3OEWA 4UD6A 3LLUA 3S5JA 1PEKE 2QRPA 5B30A 3WWYA 5HR5A 2PUBA 4ALNA 1FTWA 4F2PA 4L8YA 1EP9A 3NNDA 4PZ9A 1XMQB 2DRIA 1ZR2A 2CXXA 4RLHA 1IU9A 2RI0A 5AUOB 1V48A 1G8FA 1PKXA 2MMCA 2HCTA 4P5DA 1WUHS 4IQ8A 3HA2A 4JLUA 3IT2A 4KO8A 4Q3KA 3BXPA 4RJIA 5ER6A 3ZVRA 2GHRA 3RRNA 5CEJA 3PCTA 1RDFA 2VSNA 5ESWA 1P5ZB 3IURA 1EVKA 4MVWA 1XR3A 2ISSD 4UDYX 1T29A 3H1EA 4BN0A 1BDHA 1XXHA 3I92A 1KP9A 1L5QA 3IVXA 3NT2A 1GPYA 5DGHA 1D2GA 2DSNA 1R0KA 5EQDA 3DMGA 3ZWKA 2XYRA 4XWAA 1N0VC 4DV4B 2VP9A 4WLOA 3GGDA 3VC3A 2WHQA 4BMXA 1K3FA 3P96A 3IMCA 3IT0A 2FQ1A 2MMGA 2GASA 1Y5RA 4GLOA 4NK4A 2SECE 4HAIA 1BOFA 5E3IA 4N5MA 1L7BA 2BR5A 3BZUA 2I29A 1HXHA 2FJPA 4J94A 5EIWA 4JLBA 3RBZA 2QX4A 3PWSA 3QKTA 3LL7A 4LVUA 3VSDA 4CIVA 4G4SP 3IH5A 3IUPA 1FNNA 4CT0A 3KLNA 5JCOA 1T2NA 1ZKDA 2JK1A 4NV1A 2VT7A 3KJZA 4MUJA 3BSWA 1OW3B 4CLOA 3DYVA 1NXSA 4TMVA 2G40A 2YW9A 3PTLA 4BKMA 1NSYA 4URWR 2BGJA 1P6QA 1BHQ1 2AN3A 2GAFA 4WBSA 1Q77A 2NO7A 4ZZ0A 1KQGA 2JLVA 1N33B 4KQJA 1B8PA 3SHVA 4KQWA 3UAOA 5LB2A 5GIOE 4YO7A 2BL4A 4HV4A 3RJ5A 2FZ5A 5JAUA 2ZIXA 5A4DA 3TYXA 4N0QA 2OUIA 4YWHA 2CD7A 1JUDA 2QVLA 3IC5A 4I1UA 2IY8A 2VATA 4WHMA 2QR2A 2VPTA 3VNVA 4B35A 5BRNA 3KXLA 2FUKA 1KVTA 4GOLD 5DX0A 4WN9B 2NYVA 1MFPA 2EJBA 4D9CA 3DE4X 1LDMA 2ZIAA 1KU6A 3HGMA 4L51A 4PLZA 4X8LA 5KC8A 3G49A 4DWOA 2IBSA 2C4TA 1EQAA 1OV6A 4DC1A 1IY9A 2AG1A 4LE1A 4MINA 3CINA 3VSCA 1EXVA 1MV8A 3WKCA 1P5JA 1JVBA 3PUZA 5KKNB 4ZDKA 5FR1A 2OQVA 5B57C 2O8CA 2CSUA 1EI9A 3CWZA 1U7DA 3HPRA 3VYSB 3WLAA 1XKQA 3EUEA 3SZLA 3LS2A 4PAOA 2GSWA 1N8TA 2PLFA 4PNPA 4K46A 4PN7A 2JFHA 3MMPA 2VO1A 4A2PA 1XRSB 1U99A 4WOBA 5JH7A 1WZNA 3E4CA 4TUYF 4UZEA 4ZOLA 4YP6A 2M6KA 3ZWAA 2QU7A 2XY4A 5ETJA 4DV7B 1TZCA 3QTBA 2KBEA 4GF5A 3B1VA 4O4LA 1P4RA 1MNAA 3PFCA 2DLNA 2WIDA 5FAXA 3ZGYA 4NCAA 2HU7A 3UH1A 1E61A 1Z5UA 2XH8A 5B55A 1M1NA 3TXXA 2HMYB 1RSZA 4PSUA 2XXBA 3BFXA 1FFEA 5ECWA 1KVUA 2PVPA 2WWWA 3NV9A 4F21A 2UXBB 2AH5A 1OX4B 4Y2YA 3THSA 2HRZA 3CSSA 1WPRA 2WIAA 1NVTA 4ZRNA 3OM8A 5KCMA 1HT2E 1WB9A 3DBHB 3QFRA 3D0QA 1ILWA 2RC6A 1JMVA 1OIXA 2V5VA 2Q0XA 1JILA 4FEEA 2XXAB 3DM9B 2YNMA 4ZI7F 2I67A 4GX2A 1Y1RA 4RTNA 1L4EA 2JH9A 4TLEA 4BAUA 1W88B 5TLSA 1YCFA 3MJ4A 3GZTB 1P7ZA 2WFMA 3PQEA 3DOOA 4OU4A 4TTAA 3R76A 3PCXA 4HVLA 2X0IA 1QRUA 3HO1A 3ZU6A 3WOVA 3U9LA 1GUDA 1NLMA 1L7EA 3FNHA 2FN7A 1B1CA 4WKGA 4HI0E 5J2TB 5T57A 2R1UA 1FCJA 2K4MA 3C5VA 5B3LA 3KAKA 1V3TA 5HJEA 1E7MA 3UZUA 2XWQA 2Q5QA 3H4IA 2XNCA 4EDFA 1U63A 4BP3A 1SHUX 3RNLA 1B4DA 1Z6QA 2UDPA 3OJXA 4G5FA 3GW8A 4BVAA 2C8LA 4HQNA 1YDGA 2VSXA 1DHRA 5TE9A 2ZWAA 2Q6LA 3FVTA 4AIIA 5K3EA 3TUJC 2WM9B 4XPIA 4H31A 2EQAA 2K87A 4U3JB 1E3JA 3AFOA 4FDAA 1QLWA 1MT3A 4BGUA 3HXPA 3OUTA 4QT0A 1SC6A 4F4CA 3FRJA 1HY3A 2OE2A 3NKLA 5AM4A 1V37A 1I4WA 4GQBA 4JX8A 3H9GA 3UG6A 5EHGA 5A7FA 4BQQA 5H4GA 4M22A 2F8SA 2FAXA 2I76A 4C3ZA 3MWFA 5JMOA 4PZLA 2Z83A 3OQPA 1U9CA 4YRDA 3WGGA 4DXDA 1QBGA 2XYVA 4CODB 5CB6A 4KITB 3IVGA 2R5FA 1WDWB 1TAHA 1U5BB 2A94A 2BMEA 2CJXA 2FCAA 1PE0A 2PTHA 2Q45A 3KALA 3PFGA 4ZVMA 4L8VA 4E1AA 3W2FA 5KWSA 4AMBA 3PSHA 3DR5A 3OQIB 1AF4A 5FKJA 2WTNA 5C8YF 1XAHA 2DTDA 1JHZA 2FTKE 4HXFB 1L7RA 4EBBA 3UFXB 3CZCA 4DIBA 4AYXA 3BK7A 2Q1UA 4OMCA 3R3VA 4WCFA 3VKFA 1NBMA 4ZVNA 4MTCA 5IJWA 4D6XA 2J4DA 4MJXA 1RU3A 2PSDA 5CBPB 2GFIA 3OO1A 2OD9A 3NIBA 2UZ4A 1XTPA 2B1IA 4WK6A 1ZI9A 3JQ8A 4DA0A 1C9YA 1P80A 1WVGA 1EFAA 1F14A 1O6GA 2Y1EA 1I10A 3CX7A 2JHAA 2JB9A 1MT0A 1WXFA 3FOAA 4NAHA 4PXYA 2OY0A 4X85A 1DP4A 3GLGA 2FNAA 3UOGA 4C0BA 1VCNA 3ZE6A 2Q4RA 3CVWA 4JJGA 1VBNA 4K1LA 1XCLA 3TF5A 4GE3A 4AZSA 3D4LA 4TYMA 7ABPA 1MMFB 3DYIA 4IFTA 2REQA 2Y1XA 5BSEA 1ABEA 3KDSE 1FVFA 1LRJA 2R6FA 1OLSB 4RQBA 4U8HA 1EWRA 3JWHA 3KAQA 3WGYA 1K06A 4B3HA 2WMNB 2EU8A 3FKSA 3HCAA 3L82B 4NAUA 5AHKA 1I6LA 1NI4B 4X60A 3S2GA 5AVUA 2PTGA 2PH3A 2F1RA 4MP3A 1XZNA 2ZPTX 3ROZA 3EFEA 1UXHA 4FCVA 2DGDA 1DRJA 2NSYA 2FK7A 3E7FA 3WVNA 1KO7A 2UKDA 4JAVC 3SIWA 5FB3A 1R9NA 2AHRA 4NCHA 4URYR 4CKBB 1XTBA 2DUJA 2I6QA 3OLQA 2NV6A 4YQEA 4IOJA 5A9SA 1EPUA 2ZRQA 1VP9A 4WUVA 5CFMA 4BFSA 1VA4A 1P2DA 1JJBA 2A7QA 3Q8KA 1W4CA 4GGPA 4HL6A 1XYGA 4PRZA 4KQMA 5E6SA 3TBHA 1V95A 2HBRA 3ANNA 3SXPA 1AUVA 5LUBA 3W6UA 3CHYA 3TR6A 4HH4A 1FEZA 2P0AA 3A3PA 1FX1A 4MCHA 4CQJA 1DIOB 2AFHA 3T5AA 1QH0A 2BKVA 4TZTA 4UXHA 1ISGA 1VLHA 1L5MA 3AVOA 3BVPA 3FXAA 1PJBA 1PVDA 3TLXA 5JYCA 3T5BA 2GPSA 1BGWA 4DPMA 1DQNA 3VHLB 1GTJ1 1UOPA 4TS1A 1FDVA 3LTNC 1I0ZA 3TRKA 3SEAA 1L4FA 3CW9A 4YJ2F 1GFSA 2PH1A 1CEEA 1JX6A 4N0DA 2NU8A 3R7SA 4D5GA 1WV1A 4TL8A 5E0OA 3JQEA 1Q84A 1PEAA 2VK8A 1SBNE 2NIPA 3A4IA 5IHXA 1EGHA 2IUYA 1J33A 3GEPA 4BTLA 1C81A 5B5SA 2JD1A 3EGEA 1K7CA 4BHTA 2EW1A 1C8KA 1VE7A 3EN0A 1VSBA 2OBNA 2ZVJA 1SULA 1HKUA 4K5QA 3N2EA 3TOSA 2HUPA 4JASB 4F56A 1VFNA 4H7JA 4B31A 1P1HA 2OLKA 1YZVA 4Y6OA 1C41A 2VP0A 5C31A 5SICE 3UQZA 3KJFA 3DFMA 1P1JA 2ANBA 3I4LA 2QD5A 4C4ZA 3OQOA 2H18A 3Q9SA 3ZWNA 1XIVA 1IWBB 3K09C 1JA1A 3R20A 3OPVA 4O4JF 4AO7A 1YQTA 4NH0A 5ALPA 2CD9A 4HOYA 2BUCA 3CW8X 2VFAA 3OBBA 1U6KA 1KZYC 4XI9A 2WW8A 2QYTA 2P27A 3U7QA 1A77A 4X3OA 4W5NA 4BQPA 3F4LA 3C3EA 3IIIA 4ISBA 1M67A 2R4UA 3DOEA 5G41A 4YA6A 2AJLI 4J0QA 4Z0PA 2PRSA 4BP8A 3A1VA 1C7RA 2NV2B 1Z5PA 2DQYA 2KI5A 4TT3A 3SYLA 2CBGA 1CQJB 3ABQB 4UKDA 3KLPX 3N8HA 5C5IA 2J3MA 1AMNA 1CC1S 1X7WA 2PCLA 1JEYB 1R0BA 4KQKA 3VSAA 2I4IA 4REQA 4EVIA 3HY4A 3OJLA 4NBVA 4NYMQ 1DOZA 4AK9A 2RG7A 3P2YA 5BQ3A 3UENA 1LNQA 3ESRA 3LCRA 2YYYA 4KDCA 4A0SA 3E3OA 3C15C 3N0WA 3D3WA 4IPTA 4Q1DA 4Y2VA 5HW0A 1N8KA 4LY0A 1B0ZA 2DPHA 3ZLTA 1Z34A 2YXDA 3DVRX 5JLJA 3L1KA 1OY1A 2WEKA 3OIDA 4F6RA 3I6QA 3EEQA 4OMFG 2R48A 4JR0A 2Y2UA 4EECA 4QNMA 3PPIA 3UJCA 1JQJC 1YOBA 4XYGA 4FB5A 1D2HA 2R5WA 4IDFA 1S1MA 3HA5A 1C14A 1UR5A 3ONNA 2JAQA 4G8DA 1M8KA 4WNIA 3TTUA 1O08A 1OOEA 3HL4A 3U39A 4BZPA 4BFLA 4IRMA 1E2GA 1FE8A 2XTAA 1JNYA 3WIOA 3IKMB 4HVCA 5SYAA 2PSEA 2YYSA 5HSGA 1UC4B 3EYWA 2WKPA 4EJSC 1BO6A 1QG4A 4EGJA 3ZLJA 5I4CA 3EBPA 1C0KA 3TNJA 2FPPA 3K31A 5DLPA 3ZJYA 3VOBA 2XAAA 4ZAYA 4UAGA 5KNBD 1W9MA 4M53A 3F49S 1J49A 1JHDA 2Q2VA 4WY2A 3TQQA 3PX3A 1TQ4A 2FQXA 3SHTA 1NHWA 1TZBA 3B9RA 3G8YA 4OXRA 4ZT7A 2JLSA 1GGHA 2O2DA 2BFDB 4RD1A 2AD5A 4ZD6A 5FEUA 3EXFB 3TDKA 2OV3A 4HUJA 2Q27A 3EZYA 4I3HA 4L5JA 4DMFA 4E4YA 1CT9A 1GZ4A 1OBFO 2P8JA 3L92A 2YDXA 3ITDA 3WRXA 2B20A 2IF2A 3GV0A 4GBGA 5BW5A 2Y6UA 2BFEA 2YIMA 3HDQA 1KS2A 1OYVA 2HC9A 3IIJA 2I78A 2PHZA 4MVJD 5K3BA 3EW9A 4KGVA 2QKYA 4MVXA 4I50B 4LC0A 4MYUA 5H8WA 1YRBA 3N8KA 4O33A 2OG2A 2ZCUA 4NICA 1L4HA 1R4NA 3OTHA 1MKYA 1YCDA 4IEFB 3G2MA 3IB3A 4RL4A 1D1PA 1AM4D 1G9XA 2WM3A 5HMLA 2B7LA 1RR6A 3LOQA 5DZSA 1GPWB 4FOOA 2QRZA 2EWMA 4KPFC 2VK2A 4MVJI 3MT7A 4RETA 5C8VA 5DN6D 2ZM6B 2YMPA 2CUNA 4LZOA 1W36D 2QLJA 3ZZUA 1F8GA 4F45A 3VSBA 2GTHA 4ECEA 1ZH8A 3PR3A 4FINA 3P94A 3C7DB 4M1KA 1MAUA 1XVTA 1Y80A 2GPBA 3HUDA 2EFHB 5A1TA 1PR5A 1Z7EA 1PZFA 1DC6A 1RWPA 2OV8A 3H3XA 1N5LA 5K3SA 1CY0A 1YRWA 1G5HA 2Y77A 3JYLA 1POWA 3PU6A 3D5EA 3U31A 3UN1A 5CFOA 1OLXB 1F7VA 2H92A 3BBLA 3DUFA 4GYWA 4RLQA 3ZZ1A 5COBA 4XCXA 4DDTA 5K8TA 4JL5A 1DRVA 4QXMA 3JRWA 3LGXA 5B3AA 1QRSA 4YRBA 4WFQA 3IB6A 1UJMA 3DOIA 3TEMA 5KTKA 3GG9A 5WRFA 4UJ5A 3BSSA 1XCPA 4CKWB 2HR1A 3GIDA 4I4LA 2VJPA 1U0FA 5DOZA 3TNDA 4W5QA 2EZTA 4YMLA 3M6XA 3OKAA 3FF1A 4UM7A 2GXQA 2F48A 3JATA 3JYQA 2B6HA 2RGGA 2WRZA 1OZGA 4DLWA 3SJZA 2V0CA 5JT1A 2JBWA 5EWMB 3UMMA 4NF2A 4NMLA 1P1IA 3NG1A 3Q8XB 1U8CB 1II8B 3V46A 4B45A 1OWOA 5JNSA 3OCJA 4MPPA 4E14A 1VIMA 3OZBA 4AG3A 3PQ3A 1SKBA 1S2MA 2GZRA 3IAEA 2WIKA 4GNRA 2Z2XA 5LA6B 1TW2A 1QE3A 4BNHA 3I9JA 5EZYA 2KB0A 4XPZA 3LQKA 5BN3B 1HRDA 4W5RA 2O48X 3VX3A 2ID4A 4BASA 2RHTA 3E18A 2V8OA 3C98A 2VJCA 2RHMA 5TPWA 2VHQA 4JYAB 1CNEA 1KJNA 3TGPA 4NOKA 5CM9C 1WW3A 3Q3HA 2YOHA 3OOSA 2PMEA 1RACA 1R8XA 1FOEB 3BGDA 2VHJA 2YZ2A 2Q6IA 3DYBA 4KX3A 2WV7A 3W78A 3QVTA 5KKAA 3CS3A 1WSAA 1ND6A 3LP8A 2XCQA 1D6NA 2ZBFA 4GIBA 1MXFA 5AVSA 3HB9A 1NOIA 3OX2A 4PF1A 1QJ4A 5FPQA 3W2IA 3R6TA 2AMJA 3QF4A 2PLNA 2G88A 4Z3DA 3ZIUA 3CW2A 2J33A 3BIXA 4HLQB 1Y3HA 3N87A 5HKLA 5KVAA 1QOZA 3TL6A 4OOEA 4I5DA 1PVVA 1Z56C 4MQ5A 3T7SA 2V9PA 3OI7A 1L4LA 4ALLA 2I6TA 1T9GS 2HWWA 4DNQA 4L57A 2CXOA 4ENTA 1SZJG 1WULS 3LP5A 4DTIA 2QSJA 1LBEA 1PG5A 1QH9A 1ZD1A 2GI4A 4TRRA 3BWVA 4BQIA 4GOXA 5TJ9A 1HFKA 1FA9A 5JS6A 4JMLA 4YIKA 2A57A 3C87A 3FIUA 4QRIA 3ESDA 5F3RA 2YN0A 4M9ZA 2OXTA 2QL5A 2ECKA 1E7QA 5LXTA 3E5HA 1HE4A 1NFRA 1KFEB 1BEUB 1NT2A 2B34A 1XJWA 2OZLA 1WR8A 1QC5B 3CURA 4D44A 4R81A 3MMXA 4MQEA 1IM8A 3AFGA 4Z8XA 1RRPA 3FCSB 4LCJA 3LSTA 3DXZA 5IU6A 4UXJA 4EY6A 1Z7YA 3HSSA 1F20A 5CD9A 1TUBB 4RDXA 1VPTA 2O2ZA 3DAFA 4CDRA 4LX0A 4KRYA 2I6FA 1UIMA 2PEYA 1MAHA 4ZAFA 1IVNA 3AL0C 1D4AA 1D6SA 2C1XA 3AM5A 3CUYA 3LUGA 4FQ8A 1DEHA 3BCUA 3BWBA 4M8LA 1DFGA 4G5SA 3W1EA 3E5RA 1OH7A 1E2UA 3AR9A 3HJCA 1BKSB 2TSYB 4PZUA 3BA1A 4XWKA 4BNUA 1R6UA 4FHEA 3TIIA 4BS9A 1U7HA 2BFCB 1XD9A 2VN8A 4E5YA 3AZPA 4L4RA 4MA5A 4N7MA 4J3FA 1ZH0A 1G5TA 2V6BA 1G5PA 4KMSA 1N6OA 3X3HA 2WV9A 3ZV7A 3ZCUA 2HRBA 2DKNA 4MHTA 2BF4A 4CVNA 1KPGA 1PJZA 1Q44A 5IK2D 2WB2A 4MOWA 1R6TA 1J0DA 5I7OA 4ZQIA 4GVLA 4JYMA 5BUQA 2PWBA 5C1DA 2F1HA 3NP9A 2ZUEA 2QU8A 2VF4X 1DX6A 4L78A 4G5XA 5LBIA 1XFAA 4F8JA 3PK0A 1TUGA 3M3HA 2PKCA 1ZBQA 3S7ZA 1PQWA 5AXDA 5K8UA 1XMPA 2BDUA 4RQTA 4RZ3A 3E8MA 3GA7A 4RCYA 2W2LA 2EVWX 3JSXA 3PFIA 1FTSA 2FSUA 4MV9A 4C4XA 5B6PA 2O2HA 2ZGVA 1G3RA 3Q72A 5AI8A 3L0OA 2P7HA 4G0QA 3CLSD 1RJ9A 3L6OO 4QPNA 3F9CA 4V1CI 3Q9NA 2BP7A 5K3OA 4YTEA 3QP9A 1V11A 4GNKA 4LJLA 4NBRA 1WVMA 1P2BA 2PS9A 3X2FA 3CCBA 1GNTA 3ZGZA 3WGMA 1C7EA 2W6ZA 4JV5B 3SS9X 2AOUA 1JHAA 3TCXB 4DRXA 4MI3A 2NVWA 1T26A 2HZ7A 1DEXA 1LK0A 4LCBA 3N0VA 4RK1A 1H2ZA 1NVVQ 3B7WA 3DFZA 3PF8A 1O5TA 4TMXA 1MLDA 4F8EA 1YQWA 4INAA 2ENUA 5THKA 1FTQA 5EJ4A 3ELUA 1M2FA 4YH1A 4XB2A 3TLCA 2AFIB 1ULZA 4X1YA 1NKTA 3A28A 2ICAA 2QE7A 4ENVA 5D5PA 4ZCMA 1YO6A 2JAUA 5G1NA 2PX6A 1NBOA 2F8LA 4WIAA 3CLUC 3QU2A 1C3XA 1Q0PA 5DI9A 5BURA 3RADC 5E2IA 1BS1A 2W22A 4N6NA 3WGIA 2C9ZA 1FP4A 3ICCA 3GUVA 5IUNC 3HVJA 2I9PA 4RQUA 5G40A 1X1CA 5B53A 1FTGA 1OBHA 3AERA 1RKQA 4GE0A 2DP4E 1E0KA 1I7NA 2FG7C 2ZWVA 3OECA 1WLSA 3HLYA 4P92A 4PCAA 1H22A 3RHZA 3A6HA 1JI3A 2QTNA 4ZQFA 2R6GA 4LZZA 2G6TA 3VVLA 2PG3A 5GJWC 3SI7A 2FUNB 3RI3A 4LF7B 1Q0LA 4MXDA 3QEMB 2D8AA 2C3OA 1W0JD 4IGKA 1TEVA 3R74A 3TIXB 1XYVA 3MMNA 5FUWA 3LRPA 3S2FA 3CF2A 5LCXA 2ODNA 4MW2A 4RPLA 4NOLA 4WLUA 2G5TA 5AK5A 4PC3A 5ALXA 4CLEA 4OBWA 1ZOOA 4H9GA 3WTCA 1F1BA 3KXPA 2BMVA 2VH5R 3D4BA 4X84A 1V8PA 3SR3A 2JIOA 5BPFA 4Q00A 3PWKA 4ENPA 1WQ3A 4YUXA 1I6KA 3AHIA 4BFUA 1NIPA 1RPNA 1Z2AA 1J2TA 1L6IA 2FWIA 4XR4A 3R2JA 4KTTE 4R8KA 2VHXA 3PGXA 2VZEA 3LVBA 1M1ZA 1MO6A 1K92A 3MAGA 1SXJD 2G1JA 4QBTA 3VPHA 1ESMA 1ZMXA 3EARA 3GDHA 2C9BA 1U94A 1F48A 4P93A 3VI4B 2I6SA 3C6BA 3JPYA 4XDYA 3I4FA 1ZC3A 2HWKA 3HXKA 3HWX1 1SM4A 1THGA 5BQOA 3ZGVA 5IT0A 4YWJA 2BI7A 5C51B 2O6LA 1HOTA 1ADJA 5KQMA 2PFSA 2ZBRA 1DC5A 3LIIA 1S8NA 4NV3A 5F1OA 5FBHA 2WFZA 4ZVLA 3JD3A 5L3ZA 4JBHA 3KYDA 2FSSA 1GAWA 2OT3B 3F7TA 5COAA 4GH5A 5G1PA 4YUWA 4QTZA 1WUIS 1DU4A 2FPIA 1ZIDA 2A5YB 3AOEC 1B6GA 3CISA 4MR9B 5ADUS 3AKCA 3MHPA 5KX5A 2WNHA 1U31A 5K6TA 3KKEA 5IVDA 2ZJZA 3EYAA 3PXGA 1ISHA 2A33A 1JHYA 2H4HA 1LU9A 2H85A 2OCLA 3QXSA 5ES3A 1FFDA 5CNMA 1U4NA 1P4HA 4YUAA 1VG1A 5C7IO 4EKYA 1GJRA 1SIBE 2DY1A 4IVQA 3TH5A 4QDUA 2H6EA 3BIJA 4A8JA 4JI7B 1UZAA 3B36A 5TS2A 3F6RA 2QTCA 2ZT8A 5DGDA 1U5CA 2ECQA 5DWVA 2EIXA 2F2TA 4DV6B 2AL7A 4NV0A 2A4KA 3BAFA 5CW2A 3FPFA 2ZYAA 1GQYA 4UU8A 4PPNA 1ZS9A 2QPAA 5B36A 2D5BA 3C14C 2Z1MA 5BV8A 3N3BC 4GECA 5G0TA 3HL0A 3LUJA 2I8LA 3P19A 3VTKA 1U8TA 2DQKA 2RMKA 5DULA 5AT1A 3ZKAA 2XMRA 5EIHA 1W48A 5TMEA 2BFOA 3OCVA 1K75A 1UK7A 3M7IA 4K3UA 1C30B 2QAGA 1Z28A 1BJRE 2OWDA 5F2NA 6ABPA 1EP1B 3DB1A 1K8QA 1T8SA 4RXTA 1RHRA 1YR9A 4MH0R 2FFHA 2YFKA 4MEAA 2JZCA 4BGEA 3PDCA 4GPZA 1JAYA 3O82A 2BY4A 4MPDA 5KPDA 5NLLA 2HV9A 3JWJA 5HBGA 4UVIA 4OI4A 1K7EB 1YZNA 3DE6X 4TROA 2JJ2A 2V97A 3RHTA 4TTVA 4R84A 5KNBH 1G19A 3N6RA 1ZM9A 4HJXA 2IOQA 5B2FA 4QGHA 4OX9Y 4S0XA 3BTSA 3PGJA 2WSSA 4JLMA 1JEDA 1I1OA 3HVIA 3VKUA 3IP6A 2WY2D 1XPJA 3AR3A 3H5OA 3FMPB 3L4BC 1YR8A 2JAOA 2M6LA 5JYDA 4DHEA 3UQYS 4IH9A 5LP6A 4W9NC 4XQ9A 4OI1A 1NJ1A 2BFWA 3AM1A 3B1JA 5AXCA 3SNKA 4M87A 5HUQA 2X3FA 1HF3A 2QQ5A 1E1NA 1ZAKA 3QI2A 4AN4A 3EGWA 1BW9B 5DNDA 2HA2A 4MVJH 1P91A 1BFUA 2M98A 2PU7A 3KT0A 5LNK6 1X7XB 3AVUA 1DG9A 1UKYA 4OU5A 3W1WA 3WIDA 3HJHA 1MB4A 3F5FA 3KFVA 1E6MA 2CLIB 3P9XA 2YICA 2A3NA 3JQ9C 2VRCA 4HX2A 1QX4A 3MS7A 1ECPA 2ZT6A 4LVCA 3IUJA 4F9TA 2AF4C 2N47A 2QUKA 4G0YA 4IY1A 5CH5A 5D7BA 4R1NA 5H80A 2FW8A 1B1AA 3BIFA 5LOVA 3KQNA 1R37A 4NU0A 4FTWA 1Q0UA 3TPZA 2DFPA 1N6PA 2QE7D 3OUUA 4YCMA 1BE1A 1PO7A 5CT9A 2X2EA 2F17A 3HU1A 4R7TA 4U7WA 3KEFA 1OTHA 2FLWA 3OCYA 4FFOA 1ZK1A 3I58A 4BVHA 3DLBA 1UEXC 2X8WA 1GU1A 4DPKA 1GWNA 1N7HA 1L9KA 4TVSA 4Y2TA 5F5NA 3BSYA 2B61A 1KMCA 2I7TA 4LDJA 2D1QA 2EKDA 4AWAA 4WNYA 5TVGA 5FH9A 3NPAA 2W4QA 4ER6A 2J9XB 4B4KA 5FWXB 1F06A 3LA6A 4UMFA 2J0UB 1AN9A 2D0IA 4RHUA 3SIXA 3AUJB 2ZBEA 3O3OB 3H87A 5JBIA 4A5OA 1TQ2A 3O8RA 4AKGA 3IE0A 4HN4B 4Q34A 2JGNA 3CNBA 3EZFA 1SBZA 2E7ZA 3T0FA 3G8AA 3DF9A 1LPOA 2GA9A 4UCQA 1ATIA 3BB1A 3R5HA 4F86A 1R4AA 1A4RA 1S2NA 3I9OA 4HQ0A 4U0KA 3WK4A 4AG5A 2B1RA 4C3OB 2DFKB 4YCSA 3OMXA 5EJ7A 1HLPA 1KK2A 2ORWA 3ZEAA 5LUAA 5LWQA 3UB2A 4HXYA 4G09A 4CMEC 4HXEB 3RFTA 1OXSC 1T13A 5IT4A 1NZDA 2BSQA 2Q2WA 1JAHA 3G6WA 3BJIC 4QO8A 2GLXA 1NR1A 1OJLA 4INPA 1PJCA 4TQAA 4YS6A 5I9BA 1CDEA 4QXPA 3I8XA 2RGNA 1TCBA 4L27A 3KHSA 1OXBB 1AUOA 5CTJA 2JHFA 4B7CA 4AKIA 3MT9A 1A27A 2X58A 1Q92A 4F3NA 3KR0A 4AN1A 3IMEA 3G88A 4CR8A 1JU3A 1V16A 3TQSA 2A1UA 1ZK2A 4GM1A 1QZTA 5G4KB 2WTAA 3P9IA 4P2BA 3WNDA 2C5SA 5C53B 4HNQA 1V7CA 1IULA 3FHTA 1GUYA 4F71A 3ZD7A 1U2EA 4Y1RB 3OF2A 1QH8A 3JTMA 3QUAA 3MLEA 1N6KA 1CVLA 1DIHA 3P0HA 4RVUA 2EAUA 3G0OA 3PFWO 4F5EA 1QDLB 4OYYA 1UINA 3ICVA 1ACMA 3G1UA 4PLYA 1OXVA 2YWJA 3TVYA 2IOYA 2ZZKA 1GPAA 2VSQA 1FLNA 4PY2A 3LQYA 2GEVA 4FT2A 4QT4A 1W4AA 3K6RA 4R31A 1FTYA 4TUYB 3GPDG 4B6EA 4J2TA 1BKYA 1EE2A 3N70A 4JCCA 4MWZA 4NU5A 4UVEA 1JFTA 3WLEA 2GZDA 1CY8A 1NTRA 3I6ZA 1FBNA 2ZYTX 4NK5A 3UV7A 4H60A 2P0YA 2IDKA 5U4QA 5JNTA 3CEPB 1D04A 3AUUA 3KOXA 4OATA 3FI0A 1A4UA 3LLCA 1S6YA 4U2DA 3PTZA 1XNJA 2C2XA 2IT1A 4GSYA 4GC5A 1TVCA 3HCEA 4AY3A 4DBZA 5L4NA 4A0GA 1FQOA 3MWDB 2ZUVA 5B3KA 4RSRA 3LHKA 3T41A 4R2LA 2CFSA 4YR7A 5H83A 3UMYA 1LZLA 4US0R 3TB6A 3AEUA 3LC1O 4AW9A 1KQ3A 1Q1AA 3GJSA 1KYQA 3O1JC 1JQDA 3PWZA 4MAAA 2H1LA 2YCBA 3RTAA 3UK0A 4DJEC 1CF2O 2FUG6 1D4OA 1UZNA 3TLGB 2ATVA 4EO9A 1KP3A 2DOKA 3W8DA 1KDZA 4LYHA 2HHCA 5FYQA 1AVTA 2QMHA 2H11A 4G8BA 4DC9A 4QUAA 3C7KA 5IVIA 2DWUA 3TAHA 2AFIE 2I03A 2QTLA 4AZ3B 1T8PA 1X70A 2PIAA 3HP7A 3U1VA 2ZRBA 4BFXA 1WABA 2EL7A 4IYJA 3MM4A 2GAJA 2VT3A 3FD8A 1KH2A 4Z1MA 1KE1A 4G97A 2IL1A 3WP0A 1N5OX 5JHGB 2WWYA 1Y8RA 1B2LA 3G2KA 4MW4A 1NNUA 3OHPA 3URMA 3ZK7A 1E0SA 2YMMA 2JCBA 4BB6A 1R12A 2H5IA 3VPAA 2IYSA 1LW6E 2FQWA 3B1XA 1Z0JA 3L4SO 2Q4TA 4QOJA 5L4LA 2OV6A 3CC8A 2G09A 3Q15C 5DK6A 2JJYA 3A05A 1MAAA 1WXXA 1KFCB 5DHAA 2FLVA 5F77A 1AXGA 2HAEA 3DW3X 2O2JA 4KDEA 4KXLA 4LTDA 3SJ7A 3AKDA 1E3WA 4JA2A 5EJEA 1OX6A 1XELA 4J16C 4OSEA 4QL3A 3P52A 1G0NA 1GCOA 1TVKB 3D8TA 2Q2OA 1CUVA 4MDFA 1TF7A 2CE2X 1XB2A 1JG6A 2H52A 3QVGB 2B0JA 4M7WA 1UBFA 1NQTA 1TKCA 5C7LO 1V2HE 1SOUA 2VCYA 1QGUB 4B2PA 3NBKA 2VHUA 5CXXA 1VB3A 4AO6A 3Q8MA 3NO4A 3MUOA 2F3SA 4LZLA 1W6RA 2AOVA 1HK7A 1N2GA 3AEQA 2PZJA 3CUKA 2TMKA 3GT4A 3H6HA 3ZE7A 5FUMA 1U0RA 1CHNA 1TVMA 2AEEA 2VRCD 2O2CA 4H1TA 4ZU3A 1ZA1A 4P4GA 3RVDA 3CUWA 1RLOA 3JQ6A 1E94E 1USKA 2R8BA 1OVGA 3IPYA 2MSLA 3GJZA 5CEEA 3NAGA 3OQHA 3MQFA 4YQZA 5C8YB 5AW6A 4K03A 3AM4A 3NGLA 1BD3A 2V7VA 2I1LA 4UTXA 3ZNOA 4L9AA 2B4QA 4LAFA 3UXMA 2HDNB 4EZEA 4BMVA 2VQFB 3FTEA 3SPXA 3X1KA 5DI3A 3KNZA 3KVOA 4PYJA 1SPBS 1T3HA 5F1YA 4JYZA 5BNFA 4WUTA 1MPTA 1QGAA 1SHZA 2YH2A 3BRWD 3K30A 1ZK3A 3EVBA 3L1VA 3LA8A 3OY2A 4LSWA 3T5TA 1XCJA 5K0CA 3PHGA 2WHRA 4D7AA 1ENOA 1H05A 1Y0BA 1IAQA 5EP3A 4D4GA 4Z4GA 3A11A 2OWEA 1D4FA 1SVSA 1G7CA 2EARA 3FAKA 3GZNB 3NYWA 4OGGA 3VPXA 3DAYA 3PR1A 3MQ2A 1EB9A 4KGXA 1DELA 3NHAA 3FOFC 1U04A 2Q1WA 4KYVA 2CL0X 3RYTC 1J8QA 3AV0B 1YGYA 3CX3A 1X7GA 4MRPA 1JIKA 5FBVB 2BCEA 4M0LA 1O54A 4W6ZA 3UMRA 4IGEA 3D5TA 3Q6IA 3FJYA 5CIWA 4OH1A 1LB1B 3OFNA 3ZG6A 3VU3A 5EXEA 1PT5A 1N6LA 3E9CA 3SE0A 2C97A 2H2DA 2VJDA 3A6EA 4GVXA 3IE2A 3WICA 3T1QA 1MC5A 1ADGA 1Z74A 2R5NA 1IATA 2XEDA 3KVVA 3PENA 4K2HA 4PZCA 5IBQA 4YRJA 1QG2A 4QYWA 2R6AA 5DNWA 1Z26A 2DHRA 4JOSA 3H11A 5TC4A 4EYKA 2UXDB 7AT1A 1PT7A 4NFSA 2AMLA 3I9KA 3W8NA 1R0ZA 1MX5A 3LBYA 2PKXA 2WPNA 4KHZA 2XUQA 3A3KA 4DDWA 5DHTA 3C6XA 2YASA 3OZRA 4UOZA 2J41A 3L46A 5SZKB 3X1ZA 2OP1A 1VXRA 1QUFA 1W2GA 3DXFA 2Z09A 1B93A 1GR0A 3QMPA 4I1VA 3UV3A 4CM4B 4P4SB 5I5EA 4QFDA 3L0PA 1XO1A 1VE1A 1Z4LA 2BUAA 2HU5A 1PLLA 1VDZA 2QY6A 1SQ6A 1E2NA 1ISMA 1A72A 1NAIA 1IY8A 2BHNA 4JP5A 1TM4E 2AC2A 3FNIA 4NBNA 5BYBA 3WGZA 1NZJA 3N39C 3QKRA 3ONDA 4TMTA 4P2GA 4DMLA 2V4ZA 1GARA 5CVJA 3L5KA 3PP8A 2YVAA 5JLAA 1XN4A 2CVQA 3TJZA 4Q9LA 4P3KA 4AUNA 3I5MA 3QYAA 1B2RA 4FC6A 1KYXA 3HVUA 4RLFA 5GJVC 4YJ2B 2PWAA 3DL0A 1OH5A 1HFJA 3L02A 4J3JA 4MS4B 2P11A 1EA7A 1I2BA 3ZDRA 2OGSA 4MPTA 4RS3A 1MGOA 3V80A 2FFRA 1HZJA 3DPUA 3KZMA 1T3ZA 3BH0A 4QFMA 4F3CA 1PR4A 4YBZA 1ILEA 1NW5A 1GXSA 4IVRA 1FL9A 3JQBA 4S35A 1LJUA 2GPAA 3VKGA 1GRQA 3GYBA 5JVDF 1MAWA 1SXIA 3O4FA 3RWMB 4BXOA 3FFWA 1DI0A 1DLJA 5FLEX 2IY9A 2WT4A 1Q6YA 3VYTB 3EGXA 3OIGA 2M32A 5TF0A 3X1JA 4EI7A 4D4HA 4YP1A 2OLEA 2FH5B 3RAPR 2RGAA 1DWUA 2RCNA 3G5LA 4PS1A 2XVXA 3T5PA 1QG0A 1TCVA 1GGEA 2ZRMA 1V26A 4O0MA 4TKZA 4O4JB 3MINA 3O8OA 1TYZA 1I0LA 1VJRA 1Y4DE 2ZIEA 3NHMA 3ZZTA 2E9SA 3DTVD 2WU1A 4Y1FA 2YQ5A 4IR7A 3NATA 3OZUA 4QXRA 2NXJA 3HEAA 5CVTA 5CFPA 4A27A 4PBTA 4Z1MD 3UT5A 5IAJA 2JI9A 1RXSA 4K87A 3VBCA 4XOIA 1QRTA 2R7LA 1VSTA 1E1CB 1L7MA 2Y99A 3RGGA 3U7RA 1BVUA 1MENA 4C03A 3OQBA 3FTPA 4S2UA 5I6DA 3DO6A 1ZD4A 3G02A 3KM0A 4BMSA 3LPLA 3O47A 1GTG1 3VH1A 5ADWA 13PKA 1RI1A 1LUAA 4ZKEA 3V1TC 2HCJB 1WPQA 3VISA 1CY7A 1TUEA 2NW6A 3RSCA 5T6MA 1HEIA 2F3PA 3ROFA 3Q7QA 4MR7B 3TJRA 4ERXA 2HD4A 3NDBB 3I8SA 2RIPA 5E1OA 2L2QA 1MNQA 4LJ4A 3RSFA 4AB1A 2JCVA 3GGCA 3H9QA 2SCUB 3HNOA 4IIJA 4OGWA 3WG9A 2D5CA 1M74A 1RTKA 5ERGB 4DT1B 4FEAA 3NANA 2FXIA 5HE8A 4BU0A 2MR6A 1T0HB 3RAFC 1WXEA 4QU5A 1ZESA 4UHCA 1ULSA 5K51A 2OQIA 3FSGD 4OAQA 1K4KA 1N9KA 2Q3LA 3QFCA 3ZX5A 2Q1SA 2IITA 2W2PA 4BV2A 5EJ5A 1BMFD 2IZOA 5FTNA 1ZKMA 4C4YA 4FSHA 4KRGA 1MVOA 1YR3A 2BRUA 5CH3A 3DM5A 4N03A 3SFZA 3REOA 4E2YA 2JFNA 4NCBA 1JEJA 4XZ3A 5KJFA 1FXWA 4FUQA 1ZUD1 3DV0B 3A4MA 1BJTA 6GPBA 3HKEA 3ASVA 1H5NA 5AOCA 1COZA 2A5GA 3IDQA 3LYAA 4IGAA 4WK4B 4HDCA 1CR4A 3AX6A 4ZO9A 1P17A 4N01A 2NYUA 4AJOA 4RY9A 5TPZD 1UT5A 1J9GA 2C9CA 1PFWA 3X1WA 3NH9A 1V45E 3TXYA 3CXRA 1OXUA 2AZDA 4I8XA 2WWHA 2BGUA 2OHJA 3SYKA 5CIYA 4CKZA 1SN7A 4G1UC 4MGHA 4UUBA 5AM1A 4DSTA 2OESA 4TLMB 1Q1BA 1CJKC 3ZPXA 1SKAA 3I4CA 3N2YA 1Y8CA 5JDCC 3TQHA 1Y7HA 2DUUA 3CZQA 5JZ9A 3I37X 3VR5D 5BN4B 4CCSA 3CRZA 3C3CA 3KUDA 1UMCB 4EVQA 4RFVA 5KYXB 2HMTA 3EWSA 3D7SA 3MNFA 3N3AC 3GDWA 3QUTA 2O52A 4ZHQF 1FJHA 4Q18A 2DFTA 4DIEA 1LJ8A 1XMIA 2VHZA 3I30X 2WF8A 1O9GA 3PDUA 1JPUA 4YCAA 3UJBA 5CFLA 1IVYA 1F60A 1X1TA 1XJ5A 2LIPA 2MCFA 1FNBA 1N92A 5A5FA 2OOKA 2XMZA 1YL7A 2QTMA 2X7HA 3Q7EA 4QUKA 5K4AA 4BUZA 5F2KA 1YVDA 2QI9F 4UEKA 1G8AA 4Q4AB 1KQFA 3SX2A 4D9KA 1JYFA 3P4XA 5LMCA 4LOJA 3UTDA 4EHLA 1BAPA 4O1IA 5E9AA 1E59A 1JJ7A 3I6IA 4XGQA 3G2JA 4BAZA 1RADA 3GLIB 1FUYB 1E0DA 1F4PA 2XMGA 5LBTA 3DPIA 1PZGA 1WMBA 2CLHB 3WYDA 3ENZA 1OU4A 1WCIA 1UBSB 2P9BA 3HXLA 4CL3A 2XTMA 4JNCA 2HK9A 2Q0SA 3D8BA 1P29A 4BEWA 1JGTA 2YVQA 2ZIVB 3T1NA 4ZTUB 3VTAA 4IO1A 4DMKA 4ND1A 5B1IA 5BT9A 5IASA 3FJ1A 2Q7DA 4IJ6A 4KIGA 4A26A 1DAGA 4DIOA 1UMBB 3PPVA 4I6GA 1U7UA 2XKBA 4HUTA 1LPPA 2B94A 2EX4A 3QG5A 4XCVA 3B20A 2CV1A 1RYFA 4QJ5A 4OMUA 3QLJA 1AV7A 1AUPA 3H4MA 4LMAA 4KUGA 2MSNA 5JJ5A 3EH1A 4AWXA 2P9EA 4Q02A 5KNDD 3MMZA 2Y8EA 1F38A 2R0QC 2CL7X 1WTCA 5BQ5A 1ONOA 5E6UB 1WUTA 2PX2A 3C41J 4WA8A 4WN9A 3ZWYA 1GPBA 3TFWA 1B26A 2C9YA 2FHSA 3MYRA 4PGGA 2ANCA 3FBGA 3QEOA 3EJWA 4U00A 3D4NA 4JLDA 1PZNA 4YO8A 3UYLA 3ETJA 4B3MB 1RM4A 2C57A 5E2BA 2ZR8A 2YN4A 1VMDA 1W1WA 2VDLB 3W3AA 4HAYA 1CRLA 1KTIA 5EE3A 3F4KA 1BS2A 2JLBA 2VNAA 1ECJA 1TW3A 1GTZA 1TTPB 3C45A 4GXNA 5TR9A 1KZHA 2VBCA 5CJ2A 2G83A 1JDUA 2VPIA 3LKZA 3LZCA 1ZITA 4WECA 3TN7A 5AVWA 3IP9A 3ONEA 2ZAOA 1YQUA 4UW9A 4LFBB 2R8RA 1LVHA 1RE0A 1IMJA 1X1BA 5F2OA 4EENA 1LWNA 1E4YA 2ZT7A 4IQ4A 1MQAA 1RRFA 5JC1A 2O3RA 3ZXYA 3S29A 4IKPA 1YE8A 3RRBA 1AKWA 1RBQA 5IKXA 1BOOA 1MRSA 3DOFA 3LO5A 3NTRA 4HQKA 4IMPA 5DV9A 3SOPA 1DDOA 1E20A 3S81A 5CG1A 3SEFA 4LWOA 4JB3A 3C8ZA 2XF2A 4I5GA 1RM5A 1I4DD 1BCRB 4LE2A 4R7GA 3ZDZB 2QLLA 2FW0A 3K1JA 4N5NA 4DXAA 5DU2A 1KI9A 3M6MD 3SFVA 2WJHA 1OX4A 1AS3A 1H4SA 4IXDA 2WKSA 2ZQZA 5EGNA 1DX4A 4TXJA 4IJWA 2C5FA 2QWXA 4BXOB 1NP7A 3LC2O 2D2EA 3SR0A 5DTIA 5LZ4A 1GYQA 3Q2IA 4CDMA 1DUIA 2IIBA 2CB0A 2AYXA 3K6SB 2XXAA 3SQXA 4DB4A 2I22A 3MXOA 4KR2A 3IALA 1K0FA 4N6OA 3STWA 2BFMA 3PEWA 2E5WA 1W88A 3CCCA 1LTKA 4KPEC 4EEXA 3T7JA 3ZDCA 3ML1A 4LPKA 3IEXA 3IPLA 4Y9DA 5A4KA 4Y2HA 4DYDA 4JKOA 4DE5A 2P4QA 4LK2A 3KDAA 3R75A 3FYUB 3TZBA 3FHOA 1M8PA 4URZR 2VZ8A 3DZBA 1OF1A 4O4LF 4R2XA 4Q9KA 5J2TA 4E5MA 1CUUA 3H1GA 4Z5XA 1NQUA 3QXJA 4GMDA 3BKWA 3R0IA 1QIDA 3CM0A 3RQIA 1FFXB 4PR3A 3AUXA 2GMWA 5F4BA 1S2GA 4CT4B 1GP2A 4M1YA 5A6SA 5ABPA 1N5MA 2ZSEA 5LWHA 3AZOA 4JBXA 4TTSA 4A2WA 4HQFA 3M4YA 3SF8A 5JROA 4QOGA 1UP6A 2RGCA 3VNBA 3I0NA 4IDCA 4WK0B 2PGAA 4W8GA 1J7KA 1QKIA 4M8NE 3CH6A 3TTSA 4BMDA 5DHSA 3HO8A 3NHFA 4JJ8A 4QHSA 4OREX 3RV4A 3PC8A 2WF5A 1ZAYA 1C4WA 1XJCA 2H2HA 2IYUA 3NHJA 3OO0A 3QZUA 3UJAA 5KYGA 5DXFA 3HBJA 3MA0A 1V8DA 3DWFA 1MO5A 1MD9A 4ZPJA 3HBMA 2BZ1A 1SEPA 3G1TA 1P2TA 3WK9A 5DYWA 2Q3CA 4GKAA 2WE7A 2DH6A 3KEMA 3NWPA 1AHHA 3UOAB 4WE3A 1VKNA 1OIVA 2C78A 1NUUA 1H4VB 1Z2DA 2WG2A 5ILGA 2B78A 4R71A 2VHVA 3C1OA 3CWQA 3RDPA 4L6CA 5LDDC 4RF2A 4J0CA 4E5KA 1FRVA 1R15A 3WL5A 4MCAA 4YCNA 1CFJA 4TXNA 3OQIA 4M1TA 4XTRA 4QUHA 1AQJA 1T3LA 2MR5A 1J90A 2C61A 3UFXA 3DFIA 3JQRA 3T1HB 1NR5A 1LI7A 4UAJA 4F6CA 5I4KA 1BKDR 2HA5A 4IFEA 1FS6A 5AYVA 1QGOA 2BZSA 4MUGA 4BFTA 4ZVUA 2YOFA 4GXTA 4H6WA 1X1RA 2VNSA 1E0AA 2XW6A 2ZTMA 4AVYA 3NTUA 1WNFA 3T0IA 5KWIA 3IRVA 4B80A 1AJEA 1JBKA 4GPBA 3T06B 3ITKA 3LT4A 4AF7A 3MJFA 4YAOA 5AVQA 2XNDD 3OZWA 3P2MA 1LDYA 3INGA 4MITA 2B4KA 3H2JA 1QVAA 3ASUA 5AKJA 4EKIA 2C3MA 2QJRA 5LQMA 1KI2A 2GZHA 1GNQA 4PIPA 4JVSB 2O2YA 2OV1A 4QBHA 4EYGA 1D2RA 1OLUB 5C1PA 3JCZA 1RCTE 1GR1A 4EPRA 4MP8A 3BE5A 3GRAA 1N7IA 3NWEA 5DB4A 4HGNA 1V35A 3TD9A 4Y30A 5EUMA 3A06A 3VQTA 3VZCA 3U4QB 2CLOB 1QHHB 4EMSA 1G1AA 3SBDA 1IPFA 2ZDGA 2JLYA 2GEDA 1PVOA 2H4XA 2IP2A 1U0SY 1GPJA 4C89A