4IV8A

Crystal structure of n-methyl transferase from plasmodium knowlesi complexed with s-adenosyl methionine
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
245
structure length
245
Chain Sequence
GIKAYEFIFGEDYISSGGIVATTKILSDIYLEPNSKVLDIGSGLGGGCKYINEKYDAHVYGVDICEKMIAIAKLRNKDKSKVEFEAMDILKKDFPECTFDMIYSRDAILHLPYADKKKLFEKCYKWLKPNGILLITDYCADKIENWDEEFKAYINKRKYTLIPIQDYGDLIKSCNFQNVQAKDISDYWLELLQMELNKLEEKKDEFLKLYPTDEYNSLKDGWTRKIKDTKRHLQKWGYFKAQKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoethanolamine N-methyltransferase,putative
publication title Phosphoethanolamine N-methyl transferase is a Malarial drug target.
rcsb
source organism Plasmodium knowlesi
molecule tags Transferase
total genus 90
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 2.1.1.103: Phosphoethanolamine N-methyltransferase.
pdb deposition date 2013-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iv8A00
3SSMA 3HVKA 4RV9A 2Z6UA 3EGVA 1VBFA 1O9GA 4FGZA 2ZZMA 3UJBA 2V7EA 4DF3A 1WXWA 2I62A 4X1OA 5KS2A 3BWCA 2CL5A 1YUBA 2EG5A 3MCZA 3QV2A 3PX3A 3F4KA 4DCMA 3Q7EA 1YB2A 3TOSA 3BUSA 5K0BA 2Z6QA 5CVEA 2HR1A 3IHTA 3E7PA 4RVHA 3CCFA 5DPMA 1DL5A 3R9XB 3LHDA 4Y2HA 3EVEA 5EHIA 1L9KA 4FT2A 1IY9A 2O05A 4GEKA 4KW7A 3ORHA 4FP9A 3DXZA 4XUCA 5FUBA 2H11A 3TRKA 4C06A 3TM4A 3U81A 2VP3A 3FTCA 4YV0A 2PJDA 4CKCA 5FULA 5BW5A 3NVKI 4MTLA 2G8NA 2NP6A 1XDSA 2AN5A 5EHGA 4HC4A 4FSDA 4MWZA 1T43A 2ZIFA 3BKXA 2IFTA 5EIFA 5EPEA 2ZWAA 1JSZA 3GRRA 3M70A 4RVGA 4OQDA 2IBSA 2AOXA 5BP7A 5HIMA 5U4XA 2YXLA 5GP1A 1Q0SA 3MAGA 2P3QA 5EZSA 3D2LA 5DLYA 3UJ8A 3HCFA 2ZBQA 4BLUA 3KQOA 1YFJA 1MHTA 2BR5A 1XDUA 5C1IA 1UIRA 3GRVA 2PX5A 1AQIA 3I5UA 1P39A 3EVCA 2O06A 3M4XA 3G2MA 3ELWA 3MTEA 4L7VA 4GUAA 3NJRA 5T64A 5KQSA 3PTAA 2I7CA 3HP7A 2WA2A 3OE5A 4RTRA 4HGYA 1BKYA 1WXXA 2XYQA 2R3SA 4ER0A 3KR0A 1JQ3A 2DPMA 4PCLA 2BR4A 5CIYA 5ERGB 5EIWA 5E1MA 4PYJA 1G6Q1 5DSTA 2F8LA 4CKEA 3THSA 3FPGA 5LQJA 2XVAA 2YTZA 3P9KA 1KPGA 1JTFA 4FS8A 3GCZA 3CJTA 3R3HA 2O0LA 1FBNA 4LWPA 5DSXA 1HMYA 3AJDA 1NW6A 1EAMA 1N7IA 3G2QA 4PYOA 3KQQA 1D2HA 3EEOA 1H1DA 3LCVB 3MTIA 2VZ9A 4GC9A 2AZTA 5EKUA 5DM1A 1R8XA 3RODA 2QRVA 3CBGA 3X0DA 5ICEA 3PB3A 3SXJA 2PXXA 1IM8A 2VDUE 5C0OE 4DCGA 3HM2A 4R6WA 4GOLD 5D1NA 3G8AA 3EVAA 4QTTB 3CVOA 3T0IA 3EVDA 5GM2A 5KQRA 4JXJA 5CUQA 3DMGA 2ZFUA 1V39A 3UJDA 2XYVA 3LBYA 3A26A 1ZG3A 4X41A 3G2PA 2XYRA 5E8RA 2UZ4A 4PYIA 2ZULA 4RVDA 5EMJA 4YUWA 4R6XA 2AR0A 4YV1A 4GOMD 3FRIA 4E33A 2C7QA 1I9GA 3A25A 5B1SA 4YUZA 4KVZA 3SVZA 3TPZA 3PX2A 2P8JA 1TW3A 4P7JA 4X60A 4BLWA 2IDJA 2PX2A 2PWPA 5K0JA 5LQKA 2GB4A 2IBTA 2HMYB 2Z6AA 3UJ6A 5LQNA 1JR4A 5CVDA 3JWIA 4ER3A 1SUSA 3PLAE 1R6AA 2PT6A 2ZWVA 5DT2A 4MIKA 2ORED 1KHHA 3FYCA 3UBTA 2C7RA 5E2BA 3I53A 1G38A 4GOOD 2PGXA 3KKZA 1JSXA 4NECA 1NV9A 3KPUA 4PGGA 3BWYA 5CVUA 2P3OA 4PYMA 5FQOA 2UYCA 3P2IA 1RI3A 3OPNA 1M0EA 3TMAA 3DOUA 1XVAA 2ZTHA 2PKWA 2LD4A 3ANXA 2P40A 1IXKA 5E9JA 3GRYA 1RJFA 1N7JA 4M7RA 1XXLA 3DULA 3ERCA 3CJQA 2OKCA 3ELYA 5DTQA 1RI2A 9MHTA 3EPPA 1INLA 2PXCA 1AV6A 5F2OA 3HCAA 2O57A 2B9EA 4AUKA 1UWVA 3I9FA 4CTJA 3MB5A 2FHPA 1EG2A 1VP9A 1L3IA 1G8AA 2AS0A 3NWBA 1XJ5A 4QTUB 4WXHA 5IH3A 5HOQA 3ER9A 2OZVA 2ZBRA 3DMFA 3HEMA 3AY0A 1WG8A 2GS9A 2BM8A 2Q41A 3SSOA 5ICCA 2BZGA 3RIEA 3KPWA 3I58A 2CKDA 3KR1A 3P9CA 4OBWA 3PS9A 4YMGA 2PWYA 3GU3A 3WSTA 4RTPA 2YR0A 4R05A 4E2ZA 3AXTA 1X1CA 2DULA 4XCXA 2IPXA 3SR4A 3KQVA 5LQAA 4F84A 1SUIA 5EEGA 4UOEA 2FK7A 4DM3A 3KQTA 4YV2A 5K05A 2NNWB 2CMGA 4RX1A 4C05A 1FPQA 1L3BA 2AOUB 4P58A 3HVJA 1N2XA 1R00A 4PCAA 3FPJA 4V0RA 1VE3A 4KWCA 3SMQA 4G56A 1VQ1A 4A6DA 3V97A 3AXSA 3B5IA 5HFJA 1M6EX 1BC5A 2O07A 3NDIA 5LSAA 1NW3A 3FTFA 1P1BA 4RTLA 1AF7A 1BOOA 1D2GA 3OZRA 4PIPA 4RTJA 3VC1A 5EKXA 3VSEA 4POOA 3LDUA 4CXMA 2IH2A 4KRGA 1QANA 3R24A 1VP3A 1NW7A 3R0QA 3EMDA 3FTDA 4OA5A 4RWZA 1ORHA 3VC2A 4MHTA 5EVJA 1KPHA 3P71T 4IV0A 2IIPA 3FYDA 2PLWA 4C4AA 4RTNA 4EVIA 3FRHA 5HIJA 4ER7A 3LPMA 1EIZA 2YQZA 2R6ZA 5E9QA 5LR6A 1DCTA 1ORIA 2B3TA 1G8SA 5DM4A 2VS1A 3BT7A 4RTMA 4ZTBA 2HWKA 3LX6A 5ICGA 1ZQ9A 3LCUA 4XUEA 2IP2A 4Z2YA 3GDHA 1B42A 3DXXA 1JQDA 1NBHA 3EEYA 1HNNA 4ATNA 3BKWA 4KIFA 2EJUA 2JH8A 4HH4A 4EK9A 1RJEA 3FUTA 3NWEA 3EGEA 4QDKA 3I64A 4C07A 2PX8A 3A7EA 3FPHA 5E1BA 2EJTA 1SKMA 4RTSA 3G5TA 3G7UA 2CWWA 2NXNA 2ONYA 2B2CA 3A7DA 3LCCA 4FSXA 2NXJA 1R8YA 4BP3A 3S68A 3LDGA 5GIOE 4DA4A 1QZZA 1FP2A 5HEKA 4A6EA 4ER5A 2PBFA 4X61A 5EOVA 3MQ2A 5CD1A 4IWNA 2OY0A 3DXYA 3HCBA 3BGVA 3OU7A 4HSGA 5FTWA 4E2WA 5E9WA 3KQPA 1X1DA 1KP9A 4HGZA 1JG4A 1OR8A 2B78A 1JG3A 4BP1A 3NDJA 3DUWA 1NW5A 1VIDA 1QAOA 2ZCJA 3UZUA 3P9NA 4GC5A 1X1AA 3SX0A 4DQ0A 4RTOA 3G89A 3MGGA 5FA5A 3K6RA 3EVFA 4GQBA 3KPYA 4P7KA 3A4TA 3EMBA 4PWYA 5H02A 2YUIA 3V8VA 3FTEA 3TLJA 4HTFB 2H00A 5E8JA 2HTEA 3UJCA 1JG1A 4M36A 5K0LA 1KXZA 1TW2A 1SQFA 3LKZA 2I9KA 4E30A 2FRXA 5EG5A 2PY6A 3OZTA 2WK1A 4RVFA 2B25A 5EMKA 4DMGA 5K0GA 4OX9Y 3LKDA 2IGTA 3E05A 3G8BA 3KU1A 3BZBA 2CMHA 3G2OA 1TPYA 1RI4A 3M6WA 1ZGJA 1P1CA 2AOWA 3GRZA 1G60A 4FR0A 3EVBA 3G88A 5BW4A 3HA5A 5DXJA 7MHTA 4PGHA 4C03A 2BH2A 4Y30A 4YUVA 3IEIA 3UJAA 3LGAA 1RI1A 3AWIA 2OB1A 3HCCA 4GOND 3MCTA 1KYWA 3OU2A 4P7FA 4PYNA 4XUDA 5FHRA 2HV9A 4PYQA 2ZLBA 5D1HA 2N47A 3VYWA 5DRTA 3H2BA 1FP1D 5HZMA 3P97A 5GINE 5EQJB 3OFJA 3PT9A 4WVLA 3DLCA 3B7PA 5FWAA 2OYRA 4ER6A 1NKVA 4QVGA 3DP7A 3IYLW 1WZNA 4E31A 2FPOA 3KR9A 5LQCA 4PNEA 5F2KA 1ZHFA 3TM5A 1VPTA 5DM2A 5K03A 2ZVJA 3DLIA 3ELUA 3G5LA 5DTRA 2BR3A 4FT4A 2P35A 5JR3A 4KIGA 3BGIA 2GAFA 3M33A 3UFBA 2QY6A 2EFJA 3T7SA 1UFKA 5K0EA 5EMLA 1Q0TA 2E5WA 3BWMA 3NVMB 3KHKA 5E1OA 1JQEA 1MJFA 2ZIEA 3EGIA 3M6VA 3KPJA 3BGDA 3P9IA 3SGLA 4IKPA 4AZSA 4HG2A 1YZHA 3EVGA 1YFLA 4F85A 3THRA 5KYGA 2P7IA 1AQJA 5KVAA 2PSSA 2AOVA 3KQWA 5HIKA 5K0CA 3BXOA 1L3CA 3KR2A 4ISCA 4R8SA 5DWQA 4RSRA 3CKKA 4GBED 2FYTA 5JUWA 3CGGA 3MERA 1QYRA 5GOZA 3TQSA 2OB2A 3DH0A 3JWGA 3REOA 3A27A 3P8ZA 4C08A 4LWOA 5MHTA 3UA4A 3T7RA 3GWZA 4E2XA 4YUYA 1NV8A 3OFKA 3ME5A 5P8WA 3GGDA 3DR5A 4K6MA 5CCBA 4U7PB 1O9HA 2P41A 8MHTA 4PONA 3E8SA 3LSTA 5DRYA 4EKIA 4HRAA 5FQNA 2A14A 5IKMA 1KR5A 5FWDA 4CWAA 2I6GA 5BXYA 1WY7A 3BWBA 2JG3A 1G55A 1M6YA 4GF5A 4PINA 5EC8A 3TKAA 2OBFA 2IDKA 2P3LA 1XCJA 2UYOA 5T6BA 2PX4A 3GJYA 5K8VA 2OPBA 5K0NA 4R8RA 3FUUA 3UJ9A 5K09A 5EEHA 1X1BA 2P1DA 1RI5A 3HCEA 5K0FA 4BY9E 4LG1A 3ID6C 3DMHA 1XCLA 2QRVB 2AN3A 3B3GA 4AZVA 1Y8CA 5GWXA 3GRUA 2ZSUA 4DKJA 5DX8A 5E2AA 1F3LA 4AX8A 3O4FA 3QOWA 1PJZA 5LQRA 2UYHA 2UYQA 1SQGA 2ERCA 3TR6A 3DTNA 1ZGAA 2JHAA 2OO3A 2PV0A 3PFHA 2YX1A 3PVCA 1SG9A 2YVLA 5DX1A 4AZWA 4EQZA 5FHQA 2G70A 3SM3A 3LECA 3OZSA 1RJDA 1U2ZA 4QDJA 4V0QA 5ICFA 4E32A 2C7PA 5T67A 3FPFA 1F38A 3UJ7A 3UWPA 4QQNA 3K0BA 3T7TA 1DUSA 2IH4A 3C3PA 5M5BA 2Y1WA 2XVMA 4O29A 2IH5A 2ZZNA 5C9ZA 4P7GA 2NP7A 3ER8A 5F2NA 2ZIGA 4KDRA 3IV6A 3FUWA 2AOUA 3PFGA 3R6TA 4YUXA 1EJ6A 3KQMA 1JG2A 5G02A 10MHA 4CKBA 5EMMA 5LQUA 1ZKDA 2H1RA 3GIWA 5HIIA 4PYKA 3UA3A 1I1NA 3C6MA 2YXEA 5EZQA 3C3YA 3JWHA 2FCAA 1X19A 4IV8A 1PRYA 1NBIA 4RTQA 3LBFA 2AVNA 2NXCA 3HNRA 3NW9A 4EMSA 3OCJA 4H0NA 1EQAA 1FJXA 2YXDA 3FZGA 5CCXA 5FA8A 3NMUF 3JWJA 2QE6A 3MHTA 4F86A 2Y1XA 3HA7A 5E1DA 2ONZA 3LL7A 4M37A 2PVCA 3GNLA 3SSNA 5HILA 1NW8A 2AOTB 3Q87B 2NXEA 1R18A 4X63A 3FPEA 3B3FA 1EJ0A 5GM1A 1XTPA 2FK8A 3ELDA 5GIPE 4KDCA 5DM0A 1WS6A 1YZ3A 3OE4A 3O31A 4DZRA 2C7OA 2KW5A 3B89A 4PYLA 2ADMA 2K4MA 3CC8A 1KIAA 4OBXA 5CVVA 3C0KA 2JHPA 3KQSA 1O54A 2HNKA 2ZBPA 3NTVA 4M38A 5DTMA 5CM2Z 4RYLA 2NYUA 4RTKA 1P91A 3OU6A 3P2EA 4U7TB 1VL5A 2ZZKA 3HVHA 2JJQA 1R74A 4MQ4A 5EGSA 1NT2A 4CTKA 3QOXA 2VDVE 5CVJA 4LECA 2G1PA 3HTXA 3M6XA 1I4WA 5DXAA 3TKYA 5DX0A 4E70A 3O7WA 1XDZA 4QPPA 2GH1A 4B17A 1BHJA 2XBMA 2GA9A 1RJGA 2GLUA 4FZVA 1Z3CA 4PIMA 5K01A 4QVKA 1D2CA 3CJRA 2OXTA 3RW9A 1QAMA 1JTEA 3FUVA 1QAQA 3L8DA 3HVIA 1KYZA 2JH9A 2VDWA 4BLVA 3TFWA 1YF3A 4E2YA 2QM3A 3HA3A 3B3JA 4QPNA 4C04A 2G71A 4EKGA 2JHCA 2EX4A 1L1EA 5FADA 4HTFA 3P2KA 3HCDA 2G72A 3KPVA 1NE2A 2QYOA 3GO4A 1VLMA 2AVDA 3EVZA 3KQYA 4OQEA 4QQKA 4OA8A 5FCDA 4AZTA 2PT9A 2PXAA 3FUXA 4YMHA 1SVUA 3GXOA 3LDFA 2P7HA 2WA1A 2BM9A 2ZW9A 2GPYA 3C6KA 1KPIA 2AN4A 3M6UA 2ESRA 2AOTA 2V74B 3E23A
chains in the Genus database with same CATH superfamily
3AT1A 3QBEA 4NYMR 4QG7A 4L8FA 4RV9A 4BN4A 4KQIA 4FMPA 4CT0A 4F92B 5AJYA 3KOOA 4OFWA 3PJEA 4NZNA 5FRDA 1DWOA 4X1OA 3THOA 3ZNPA 1LVGA 1FBTA 2F90A 2Y77A 1R3UA 1RWQA 1GQSA 3L02A 4BMPB 4ZJPA 2XCRB 4MMZB 3VSCA 4L78A 3EW7A 1C4OA 1O96A 3JR3A 4L4SA 2FLVA 5FD8A 4V0ME 5JDCA 1O89A 2A4KA 3EFHA 3OZIA 4I4IA 1ZOPA 3M49A 4XB6B 4XRRA 3HZRA 4XGQA 5DYYA 1YOVB 4N0QA 3GLSA 5DASA 1QIJA 2VQSA 1QDEA 3K96A 2ZJAA 5FUBA 3FCEA 2IY8A 5KQPA 4RDIA 4CL3A 2YJGA 1NYRA 1YH3A 3U81A 2R97A 3ZUPA 3O1LA 1E9DA 3IUNA 3E3AA 1HL7A 2JCGA 1M75A 3AF5A 3LTEA 5REQA 3UMFA 1U0EA 4D5EA 4Q3DA 1Q5PA 4BRUA 3OESA 3PU6A 5CAEB 1NU8A 2VRCA 3KWLA 4G5OA 2VDPB 3FZQA 4Z49A 2W71A 3V55A 4YCCA 3LUGA 3ABQB 3TW6A 3OE1A 4J7UA 4W5JA 2ZBQA 3PXEA 5BNWA 3KJFA 2ASVA 1PGJA 4TKUA 2BFBA 2MINA 1N1GA 4QSMA 1AZSC 5GMOA 4G4SP 4MKZA 3HSYA 1TEZA 4D9MA 1P0PA 4CMEC 2G09A 2XHZA 3DOJA 1EINA 3BMNB 3L7DA 1KMQA 4QDUA 1NU6A 5KMGA 3D2AA 1V6CA 4QICA 4UUNA 2PNFA 3S70A 4P22A 1E5QA 3F4LA 1ML3A 3GD7A 3UC9A 3VZCA 2HC9A 3CWQA 3ZTTA 1I51A 2QAGC 3C3CA 4BKRA 1LSUA 1CK4A 4DMRA 3WNQA 1G2PA 2XVAA 3Q72A 1E5TA 2CF6A 3WGKA 2EZ9A 1JTFA 3KBOA 4NFHA 3R6WA 4HRYA 2NVWA 3HY6A 1CVLA 3V46A 1OWOA 4KIWA 4LC9A 3G2QA 4RA6B 5DBFA 3JWPA 4P0QB 3KAPA 2ZUSA 3CR7A 5J59A 2MTBA 3OZUA 4HZUB 1R0RE 1THMA 1KMHA 1SXJD 3BCSA 5A5DA 3GCGA 1HEUA 2ODEA 2I7TA 4JP5A 4DAOA 3ZZUA 1WCXA 5IBCA 1PVVA 5ITZB 2Q6OA 1TLLA 3REQA 3K8QA 2QTVB 1KJQA 4F9TA 5GM2A 1FC0A 1Y8QA 3IBGA 5AQ1A 5AW0A 1NUSA 1RRMA 1X7YB 3BVPA 4I4LA 4PWZA 1EIWA 3LBYA 4ZV9A 4QO8A 1E3DA 5LVAA 2ZJYA 2ET6A 4I8DA 2OHJA 1QFXA 4OQYA 1D4FA 3BPSA 3EPLA 1UPBA 4AM8A 4BMZA 4C5AA 2FPPA 5CJJA 1W1WA 3GBSA 4KVZA 2RGAA 4RDXA 1C30A 5IBRA 4YQFA 1JU3A 1UL1X 4QWWA 1K5DA 1NI3A 1W0CA 4X60A 4ZQIA 4E5PA 4W7IA 2ANBA 4EB3A 4UUPA 4AUEA 3H0KA 3QW2A 2OXRA 2W4MA 2I1LA 3PRKE 4J6FA 4OJQA 3ANTA 3DT6A 4WBNB 1R6AA 3T9FA 2GZ3A 1LPNA 3HFGA 4EHAA 1NRIA 1XHLA 4TS9A 4ARZA 4GBMA 3K6SB 1Y7HA 1AKNA 3EZ6A 3PF9A 5IM4A 3Q9SA 3WFZA 2DB3A 4AP6A 3I62A 4NECA 1RU3A 2R87A 2RGNC 1OI2A 2WE8A 4YBZA 3P4YA 4G8DA 1P62B 1Y0BA 4ZI7F 1Z83A 3RIYA 1CS0A 3IAEA 4MS3B 2QSZA 3IJEB 4WZAA 5CVUA 4ILKA 2QLMA 1PSDA 2AHRA 3A2NA 4F2WA 2W2PA 1IY1A 1RPAA 3TBFA 4HZIA 3ANXA 3EXIB 4FOTA 1K63A 4YAEA 4AZ0A 6GPBA 2DFVA 2A6PA 2RIPA 1BROA 1QB7A 3T94A 3U61B 4LF7B 1RWBA 2IYUA 3VQTA 4X20B 4KBGA 1AHPA 4UBMA 2QR3A 4XYEA 3SLKA 2UXBB 4JJEA 2R8BA 4M1YA 3I2KA 1DAGA 1ZD4A 1ZGCA 2JIPA 3AKYA 1NI5A 3AERA 2H17A 1KZ7B 2JJ2A 3AW9A 3I9FA 3TBHA 5AVYA 3MCWA 3IESA 5AJVB 2Y1CA 3AH8A 4R71A 1KU0A 1P4JA 4LMPA 4OAOA 1A0OA 1HWYA 3Q0EA 3JD3A 3KSBC 2XD9A 2GFQA 3TIVA 3R23A 4NF2A 2WYIA 4TMFA 3VTKA 3KPWA 4M21A 3OCXA 3RVOA 1TZ2A 3DG9A 3NYRA 2XOXA 1YULA 3WSTA 4BEVA 1DBSA 3NWOA 3P19A 3RIXA 1GAEO 5JZVA 4YREA 5NLLA 2H9AA 2I55A 1DBPA 4HYTA 2H4YA 2W2XA 4EPRA 5SY4A 1JLSA 2BKUA 5ECDA 4BB9A 1Y63A 3E1KA 2EFHB 2JLXA 3O93A 1VGRA 2Q5CA 4D6XA 4WZAE 4OJNA 4V0RA 5FBVB 2K7FA 1T0BA 3D64A 5KSPA 4GXNA 3W5SA 2RFLA 3UT0A 3AXSA 5HFJA 4DV1B 1OAOA 3D54D 1U8UA 1RW4A 3R6LA 3T7JA 3CLRC 1VJRA 3TXYA 3FTQA 3ILSA 3W5IA 1VC2A 2ZKIA 4IDNA 4ZOLA 3VZRA 2RHDA 3V1UA 1DPFA 1K7SN 3HYSA 4KPGA 5TB5A 3H3FA 4YPVA 4LW8A 4YCNA 4MDYA 4LF6B 3AEUA 4OA5A 1WPRA 4QXAA 5EVJA 4MEJA 4TKMA 4FDTA 3HYCA 1YC5A 2RSLA 4BPBA 4ADSG 1SOAA 3QYFA 2HJWA 3WLNA 4LJRA 3JALA 1HY3A 2WU0A 3MWYW 2I7XA 4XEHA 2X2PA 1P4SA 4OXYA 4RXUA 5EP4A 3JAMA 3KJIA 1ORIA 1V9SA 2QPTA 3I1IA 4XI9A 4ZCSA 4DSUA 1XQ9A 2CLOB 4IL5A 5EJAA 4BWFB 1P77A 1VZ2A 5EJ5A 1V8OA 5AK6A 2G6BA 1GNQA 3GFBA 1W5EA 4JJGA 4CF7A 3OLQA 5JZ9A 3QF7A 5CT9A 1JVBA 2ZJ0A 5SYAA 3ZC3A 1TM4E 3B1XA 4BP9A 3GWGA 2ORYA 3BB1A 2VHCA 4KQWA 2JLSA 3COVA 2Z5GA 4EK9A 2OAP1 4HDNA 3IA7A 1ZH0A 4QFMA 1NF3A 1JTVA 3I64A 1VJTA 4ZMSA 2Y99A 5E1BA 2QJTA 1BRMA 2J9FB 4I5IA 2O2DA 4F4DA 1EM8A 1YOVA 1VJCA 3G7UA 5TEWA 4DWJA 2N1BA 2E4YA 4EEXA 4KHPB 3A9WA 5FV4A 4URUR 3U4MA 2OFFA 1I3OA 3VNRA 2O2HA 2W8ZA 2P79A 4MW4A 3HLKA 4A6EA 4JJ6A 1BVRA 2YWXA 2QBYA 2ZRPA 4UFPA 1ZI9A 1KEKA 1W581 3ZIDA 5AQEA 2VAVA 4ENRA 5J2TF 3EC7A 3QVSA 4CL8A 3W3AA 3WL8A 2C3YA 1KP9A 2FPSA 4O8CA 4D45A 2FG6C 5A03A 2Y0BA 3EWNA 1NW5A 1D1SA 2P5YA 4NONA 5FL7D 3DEKA 5CAEA 1QHGA 5U4XA 3G89A 2JJYA 5HKAA 5EWLB 3UMCA 2Q27A 3VZQA 1U9YA 5BWBA 2V5AA 4EFLA 4TMTA 1S8OA 1ORDA 3B2EA 4WXYB 1MQAA 2OV6A 3SC2A 5CCEA 2FWAA 4YUAA 3MG9A 4E30A 3LPCA 3UTDA 2RHCA 3FOBA 3VH3A 4ZQGA 3BMNA 5IMBA 2FEAA 2BP7B 4M54A 4PG4A 5FWYB 1EZ1A 3GB9A 4FILA 3KBBA 4NS4A 5JCJA 4BNJA 1QZXA 4RVSA 3DOFA 5DCUA 2QL9A 3G9ZA 5LUAA 1RAIA 2X3FA 4FBLA 3HB5X 1PW5A 3MMPA 3LW7A 4P3YA 2UUCB 2XE6A 4U7GA 3UW1A 1KE2A 4YUVA 1KYWA 4N9WA 3F3YA 4B4OA 3BE6A 2QVZX 2GBGA 5CU7A 3FCXA 3C6QA 1A04A 1WXIA 2ZJBA 3OFJA 4PQYA 2DTXA 1AQUA 1YS2X 1XNJA 4HUQB 4RA6A 3ZWNA 4OQ4A 5DLEA 1FTSA 3OOYA 1TCAA 4CMIB 4F1KA 2WAXA 1CDZA 2IIBA 1JB1A 3HDTA 3IYLW 3F7TA 3PYXA 4PG5A 4WMLA 4G5QA 1LQTA 1CY4A 4PLGA 3S40A 4HZUA 1AB6A 3DLIA 2NYVA 4M0EA 3DZ8A 4RIGA 5ITZA 3A04A 1XTSA 5LU9A 2QTVA 4L08A 3KELA 1BDMA 3MGKA 3AGQA 4O4HF 3BWMA 3C41J 3JRNA 1X7YA 4PLYA 1A3CA 1Q77A 2ZIEA 4GU5A 3P9IA 4GLBA 3BGDA 1NBEA 3VJRA 3UJHA 3UYLA 1RQPA 4G0NA 3UGQA 1WSAA 1MQSA 4YCMA 4ESEA 1H94A 4EHHA 3THWB 2C7BA 4X7PA 4LXUA 2SBTA 5ESWA 2AOVA 4REQB 4BPRA 4G1CA 1L3CA 2DQZA 1V1JA 2GCIA 2VYVA 4JUCA 5JUWA 4JBWA 2M6LA 3G49A 4C5BA 1ZONA 2BCJQ 4PTZA 2P27A 1W6UA 4K2AA 4WBNA 2X0KA 3DUFA 1SCJA 2RBEA 1LJLA 3TRJA 4HBGA 3U49A 2WJ4A 1KO4A 2SKDA 4CL0A 4FONA 3K6SA 1H2EA 1V9CA 2VP4A 1CYEA 2IYPA 3QOYA 5KOYA 1KDOA 1T25A 5B3JC 3OFKA 4UD2A 5AUOB 4LI0A 5FJJA 3VBEA 3RUPA 5CCBA 3UANA 3II6X 3VVCA 1N6OA 2NPOA 5TXGA 2OHXA 1OSNA 2VJYA 1NI4B 1YGYA 2Y0EA 4MV6A 4Q1DA 3VO1A 3S2SA 1HDXA 4CWAA 4OJTA 1OVGA 2GXQA 4JBGA 5DGTA 2JBHA 3R44A 3EXIA 1PR6A 4O2AF 4BJ1A 1QRAA 1XE3A 1EVLA 1A76A 3V7NA 5T6BA 1VL1A 1JKXA 2ZIZA 4JXZA 4JT8A 4QOFA 3AVOA 1MG5A 4G41A 4NE9A 2G28A 2P1DA 3U37A 1F7VA 5JD5A 3LP6A 4Y2XA 3R3SA 3AUAA 3KD3A 4HNQA 5A0FA 4BFVA 2G1JA 1QHFA 1X0XA 4LTNA 1ZRMA 3EIFA 5CLQA 1QRSA 3KUCA 1LLFA 1QH1B 2ERCA 2QD5A 1TGVA 2O52A 3AYXB 5K8IA 1PVOA 2C2YA 1YQXA 1RDFA 3QVLA 3QXXA 1SUWA 4U6NA 5DH9A 3X1MA 2R79A 3I0ZA 4N1AA 1BDIA 3LBHA 1CR2A 4W8HA 3CW9A 1NJ5A 3BCHA 4RQTA 1SCDA 1PT9A 1XZ8A 2D2EA 3SOPA 5EQDA 5GZ6A 3UCFA 5KNDH 5LQSA 4KDRA 4MMYB 2C04A 5CFLA 3ZOKA 3TAUA 5BQOA 4TWRA 2V8OA 1L8XA 1TT5B 3TLZA 2HA4A 4CDGA 4A2PA 3ED1A 2OTCA 2HOQA 5HR5A 4BE7B 1HTTA 1T24A 5BVGB 3GGPA 5GV7A 5EMMA 2QAJA 2C00A 5B30A 2WUFA 1CQIB 2ZWMA 1BWRA 3QUQA 4X93A 1TVKA 3C3YA 3GHHA 4G5YA 1HE1C 5BNFA 1JS1X 4IV8A 1WOYA 1UODA 4G3XA 3LBFA 3HNRA 2JLYA 2BSQA 4BATA 1WMSA 4LC1A 2TECE 2F1HA 4M9SA 1H2ZA 4OU5A 4RGBA 1GGHA 4D3YA 2QE6A 1AXEA 2GFIA 4IKOA 1PEKE 1ZN8A 4UHDA 1KYYA 1EDBA 3HZOA 4NCIA 3W06A 5JJLA 3HPRA 1Z6TA 4IBOA 2R47A 3FOCA 1T0IA 1TFUA 1YRBA 3R3YA 3F7MA 3H83A 2F1KA 4OL0A 2CYCA 4PAWA 1QVRA 3QEBZ 1ONBA 3FFAA 3DDNA 2P30A 3FPEA 3OF3A 1EJ0A 3ESAA 1FRZA 1TKBA 1YR2A 4H7JA 5AKJA 3RU7A 5ALVA 1Y7LA 3TSOA 1H22A 5B2FA 3DVQX 3B53X 4IILA 2G0NA 1L5LA 4DZRA 3FAKA 4FC7A 2VA9A 2KW5A 2NO7A 2ADMA 3SFZA 1CJVC 2CLDX 3ELBA 2G07A 5BN3A 1DAEA 3KQSA 1AN0A 2J9FA 5EUCA 1H23A 1IEXA 1OAAA 2VFAA 5DTMA 3SS9X 5LP1A 5AI5A 1UBEA 5CM2Z 2NYUA 3M6LA 4XH9B 5AJXA 1OX4A 4JJIA 2OBYA 3ZV4A 3DKKA 1DBQA 2ZUBA 4W8GA 4NYIQ 3WNVA 2ZIXB 3UB2A 2V7GA 4NH0A 2DWOA 4DA7A 2QI9F 3H18A 4KZKA 1BHJA 4GYKA 4QSHA 1NOKA 1XVUA 1K9VF 3TK1A 3FW1A 5FB3A 3V8MA 1DJPA 5TMDA 1T9CA 2PZKA 5AOCA 4CCSA 3H3JA 2KYRA 3VX3A 4NBVA 1VIMA 1VI2A 3DEYX 3G2KA 5H82A 1XELA 3T7AA 4IEFB 4B3FX 4YRKA 5IZ4A 3B3JA 3IP8A 3CLKA 1SR8A 2BL4A 3A6LA 1N9GB 2B83A 5EWLA 3OWOA 1HI9A 1YIAA 3M1IA 1EK5A 2Y1EA 3OUTA 1V5GA 4S1OA 5CX1B 1VJDA 3KPVA 4C6TB 1E59A 4OQEA 3VAAA 5DP2A 2GD6A 3AEZA 5FI0B 1WXGA 3D1VA 4OI0A 2HMAA 3RM3A 1RZVA 3L8EA 2XDAA 2ZI3A 2ERYA 1WUYA 5CTJA 2SICE 1FMTA 4CF3A 4Y2YA 2BP7A 3EA5A 5GADl 3H0EA 3D81A 4R9RA 1KFKB 4MWEA 4DBLC 2B37A 4Z4IA 3WWDA 5HDQA 1WXWA 4EZEA 1MNQA 3AU9A 2G1AA 3I1JA 3OM1A 4PXAA 3TNDA 4DRXA 3DV0B 3NCHA 5BSHA 4M3NA 3TB4A 3FLBA 5H9VA 3DEIA 1C3JA 1SUFA 4R2MA 4ARUA 2UVPA 4GMKA 1EGVB 4BNWA 3TOSA 1HFJA 3F74A 2C2WA 1ZJ5A 5DIFA 4DVGA 3T1TA 3OP1A 4H7EA 4HUQA 1K86A 2VF5X 4O2BF 4CMIA 4HNVA 5B7GA 2GEKA 5LLDA 4BGEA 4XQ0A 3N8NA 1E2JA 1WB4A 4G4JA 4RH1A 3PUIA 3U26A 1ENPA 3N87A 3SVTA 3O95A 1LDMA 3AUTA 4QLBA 1NNI1 1L8OA 1GUZA 3WLFA 2CDBA 5HMMA 4Z4CA 3W78A 4DJAA 3PC3A 2E49A 1UWKA 3CG4A 4X8LA 3UG7A 4CMKA 2V7BA 1S7GA 1U5AA 2RKWA 3I2YX 2JAQA 3N0VA 3I6ZA 2ZIFA 4Y6PA 4B9EA 4N48A 4IDFA 1VKOA 1A5AB 3KZXA 2D0IA 1O6FA 4YN3A 1WJGA 2IEYA 5GP1A 1SQ6A 1WZIA 2X6QA 3FB1A 3OIYA 3UJ8A 3VFDA 5H5JA 1KFJB 1E2MA 4K9NA 4K6OA 3THWA 2FCRA 4KNYA 3CPEA 4GYYA 1QHXA 4REQA 4CQMB 1II0A 3E7XA 4DARA 3G2MA 3C1TA 5ULLA 1CJKC 4CEHB 2IEGA 4ANFA 2G76A 2FEKA 2PWAA 4X3CA 1JFFB 3E9MA 4AZ3B 3PGLA 3NHFA 1UPXA 3A3PA 3KLMX 4XYBA 4B73A 3KETA 4TWBA 2BR4A 2COKA 1RZ3A 2PMBA 4G5XA 5TT1A 3UK6A 4NAUA 1QFJA 4DKXA 3F6SA 1EUZA 5DSTA 1X7GA 1DKPA 1ZM2A 2H5JA 5AH0A 5JLAA 4DLNA 4WXEA 1N5MA 1ENOA 1NI4A 2ZB8A 3BJZA 3PC6A 3A6HA 4HEA6 2XSZD 4OHCA 4IS3A 1W4ZA 1V7PC 4EI9A 2AJLI 3UW3A 2E9SA 3KS9A 5EESA 2GKSA 4E0BA 4PZDA 1P6UA 2ZTVA 2J3DA 1XK7A 4J7AA 4EMTA 1Z5GA 4JQSA 4KDFA 2BKLA 1R2QA 3KYDA 1BZYA 1Y4SA 3MJHA 1G6KA 3OPYB 3W6ZA 4R31A 1IIBA 3OAAD 3U7FB 2VSNA 1EDZA 2A9PA 2GSDA 2Q3HA 1DARA 3GVPA 3VPHA 4IGIA 1ISHA 3EVDA 3FOZA 2D2FA 1W4CA 2R6CA 3LFUA 3QBDA 2Q3FA 2XNDD 4NG5A 4ZO8A 3NWJA 1UANA 2PBLA 4LDPA 2W2NA 2J08A 5LPNA 3D3WB 3KZ1E 4Q34A 5L53A 1USVA 3UHJA 4CM6A 5JVDF 4XW2A 4UM5A 1D09A 5CFPA 2V4MA 4L3OA 1VCOA 5LOVB 1T6BY 1TW3A 1EI9A 1VLQA 2P9CA 4NQZA 4BO0A 5JALA 1CUDA 1TT5A 3IV9A 4CYMA 4E22A 1TUBA 3IC5A 1O5IA 2LTAA 4GM1A 3CF6R 1TTQB 3ZYCA 3L7JA 5BVGA 1NLYA 4PLFA 4JSRA 1ADFA 5CGQB 3VYTB 5E7QA 1QTIA 2A9KA 4OLAA 3KT0A 2B61A 1N0WA 1P74A 2J3EA 3AP2A 1PT6A 3V4LA 3CNLA 4CV1A 2ZQYA 3HR7A 3QUAA 1N2IA 5CJ2A 1THZA 4KQ9A 4BQRA 4DIBA 1XU9A 1ZQ1A 2P9GA 3LC7O 2JH3A 2D59A 3PSHA 4UDYX 5AVVA 2CUTA 3PK0A 1XPRA 3RYIA 5IEJA 3PE4A 5BVHB 1I3LA 4H6WA 5JI3E 1I7SB 2IS1A 1A1SA 1IBCA 4DBVO 2V65A 5K9ZA 1MU0A 2X23A 1ECPA 5C3UA 1AV6A 3HWRA 3DT9A 1MC8A 3OO0A 4LMBA 1DXOA 4AUKA 3TINA 1XL0A 3V33A 1V2GA 3K4QA 4EW1A 5AXCA 1U9IC 1XJ5A 4WXHA 4Y2QA 1QCDA 1X92A 5D86A 1KZHA 3K4HA 1E1QD 1A9YA 2FSUA 2G5GX 2X76A 4B6FA 2GARA 5LB2A 3RIEA 4B2YA 1O0SA 3MD9A 1V8FA 1NF2A 4NMMA 3AEKB 2FWNA 4ZO7A 4BO2A 2QX9A 1NLMA 4NAVA 5FLKA 1XTJA 3ND6A 3HYNA 4NARA 2YR0A 2IITA 2GJ8A 2K2QB 4DWWA 4DIOA 2F8MA 1UBOS 2ZBGA 4LHXA 2XWQA 3KQTA 4DM3A 4BCDA 1ZMOA 5B36A 4B8ZA 2A4MA 5EGNA 4G97A 1LF5A 2YYZA 4Y9TA 1P5RA 4GMDA 5IASA 2PMDA 3QMPA 1VE3A 4G0UA 2ZIXA 4I1UA 1EDOA 1IN5A 4GQIA 4NBUA 3NEAA 3V97A 2DP4E 1BC5A 2O07A 4JYCA 1NW3A 4WIAA 1MXHA 3PXDA 3OA2A 4DSOA 2Y6VA 4HNUA 3I4LA 3G79A 2H1FA 4CLEA 2QUKA 3GC6A 3GJ7A 1NVMB 4HEA1 3D5TA 2NUTB 1I24A 1W4RA 2ZAMA 3K5WA 5BSFA 5CDYA 1T3ZA 2BH9A 1N9GA 4QC2A 1N2GA 5CX1A 1E9VA 3TLXA 3FPSA 4XGIA 1IOLA 5GV8A 2Z3ZA 1DCKA 4KBFA 4C6TA 4MROA 1Y9DA 4J1SA 1OXVA 3WMWA 1R0WA 4RL4A 1YK1A 4N8EA 3IOCA 5KI6A 3PX7A 1USWA 5GJBA 5LR6A 2FR1A 3ST7A 1QO7A 3BTSA 2HI0A 2NYAA 1ULUA 3KE9A 2UZ3A 4OH1A 2HK8A 5ICGA 4CGYA 5J4KA 1ZQ9A 2M1XA 4QJ5A 4OHRA 3R5KA 2QUAA 2C20A 4ZA2A 3L6CA 5ELMA 5C7IO 1C0KA 5AM5A 4I1IA 2D1FA 1AKTA 1DWUA 3RAJA 4W5QA 3SS7X 2QQEA 4Q9AA 3TE6A 2QAGB 2Q6IA 2AQIA 3EIXA 4ND5A 4OHYA 3MIZA 3DQQA 3CLSC 1E60A 3NV9A 4M8LA 3OZGA 4MV9A 4TS4A 2G04A 5COQA 1FRFS 4QU9A 1PVDA 4I5DA 3I05A 2C7VA 1NVTA 4CKWB 3TG8A 1Q83A 3PEEA 2D5IA 4BXOB 3QENA 3DL7A 5D7BA 2VWHA 1TD1A 2V03A 2Q4DA 3N6VA 4K2HA 3TPCA 2P9TA 1XZFA 3PUKA 1CRPA 3B6JA 4NBLA 3DV9A 2PBFA 1GYPA 2VUSA 3NR2A 2JGKA 2A1TS 3GLGB 1CF2O 4IJWA 3BGVA 4YA6A 4E2WA 2EVWX 3K9FC 2HUPA 1X1DA 1JHUA 1IZ0A 4UXHA 3GCDA 3GJ6A 4R7TA 4TRRA 4CF5A 3A6KA 1TUEA 1LFDB 2EATA 2CT8A 4HVCA 3G2IA 4LV5B 4HXYA 3X1XA 2ACKA 4Y8VA 1ZINA 3DMYA 3R5FA 1E6CA 1LZKA 1GTZA 1JZSA 2OQRA 5T4EA 3V8VA 1QQAA 4MHOA 4C2TA 1EK6A 5AK3A 5IUJC 4ME6A 4GS5A 1LQ2A 5EIBC 1LU9A 2ANCA 2GCOA 2WFMA 4DNXA 2FFBA 2EJCA 4D4JA 3DAYA 4NYJR 5GGYA 3K9WA 2DR2A 1T10A 3IELA 1FS4A 4ALJA 1JH9A 2B4RO 5DM60 1L5HA 3U40A 4K0RA 1I13A 2BYTA 1JFFA 3G8BA 3GP8A 3QMWA 2AUTA 3RS9A 1GL3A 3CTMA 2GJSA 2GAIA 1ZGJA 4XDHA 2AOWA 1JKFA 4FR0A 4IEIA 2AD5A 5IDXA 3QXGA 4N18A 1QZUA 3TXAA 2QE7A 3AWIA 2ATXA 4PYNA 2RGEA 3S29A 1ZM4A 2E1PA 1MOSA 4YJHB 4OHZA 3DYVA 1X38A 3AB3A 4BNKA 1GPJA 5KU1A 3C24A 4WKCA 4YRNA 4AP5A 2QD2A 1WCV1 1H4TA 5DNAA 1NUAA 2WWYA 5DYNA 4QBTA 4R1SA 3ZHYA 1TO6A 1Z34A 3OPYA 4JB2A 4U02A 5AWFC 2PJRA 2WKRA 1TA4A 3O9VA 4QPCA 4DT1B 2JIOA 4IX9A 4Q01A 5BSUA 4XPIB 3HKCB 1OI7A 3UFBA 3KIPA 2WIAA 4D2IA 3IRVA 3DTVB 1DS6A 2JFQA 3PWSA 5K0EA 2HHHB 1MG0A 1MJFA 1SEVA 2QHXA 1CR0A 3WP1B 1V41E 3GGGA 3KFLA 2QTCA 4CUJA 5K6AA 3T3NA 4LJSA 4MUEA 4X9XA 3D3WA 3KTOA 4LBWA 5F3DA 1DC4A 3SQLA 2VP0A 3U4CA 3KDSE 4LCBA 1YBVA 1RZRA 1OBVA 1PKXA 4BNYA 1S3IA 5LOVA 2J67A 3SXPA 5KBYA 3KR2A 4WKBA 3EFEA 4YDQA 3UJPA 2Y4NA 3B1WA 3HVUA 5IULC 4KV9A 3JQGB 4XSGA 2JFUA 1ONNA 2ZJ6A 5F35A 2CZQA 4EWLA 3DE1X 1T5IA 3WQQA 2A94A 2W6IA 4M9RA 4UKDA 3PFNA 3JQ6A 5L7YA 3W2EA 3FIUA 4A0QA 3M6MD 4FFVA 5C34B 2WZQA 3WLJA 1UK9A 5LBIA 1GPDG 1BMDA 5JO9A 5HE9A 4Z8YA 5KKNB 5JAOA 5KOHB 1HLDA 2ZPAA 1A88A 1Y1LA 2X15A 3AP1A 3Q8MA 5HCNA 2H18A 5LZ5A 3JPWA 4X7MA 3FNFA 4MP8A 2JG3A 5BVHA 4V0NA 1QF6A 2IDKA 2C57A 1D9ZA 2R60A 2W2MA 2UYOA 2Y93A 2W6QA 4BAUA 4XTRA 2PEYA 4GX0A 1GRCA 4PZ9A 2PA3A 2NVOA 2ZB7A 5HIAA 2RG1A 1WZ2A 2P9FA 3JARA 3N5CA 4K6GA 1XNGA 5A5VA 4DKJA 2A88A 3W2TA 1CNMA 3KB6A 4LJ9A 1PJZA 4K46A 4WECA 1OLSB 1ZZGA 4BZWA 1MRSA 4ZVQA 1FU8A 2WJZB 2IGBA 2WAMA 2DT8A 3F8TA 2XT0A 4PZCA 4HO1X 4V0QA 5LKRA 1C4WA 1EG7A 1M8GA 5IVPA 2C59A 4KG7A 4FYHA 2NQ2C 5E2IA 3UWPA 4ILEA 3URMA 1EFCA 2VAMA 1IHUA 2YZ7A 3BFVA 1YJAA 3BB3A 4N41A 4BFCA 5B2ZA 2NTJA 1QKJA 1COWD 3QM1A 3CXRA 1MBZA 4KXVA 3W1VA 2QM0A 4UAUA 4O4LB 3OQ1A 3C4VA 1G8YA 2R62A 2YJ3A 5EPOA 2HJGA 2PRZA 1PL0A 5FI1B 7ABPA 4IVRA 1R64A 4DQVA 4M1EA 1UP4A 2IYEA 4JENA 3EG5A 3DEJA 2JIRA 1SUDA 1JILA 3GCWA 5ALPA 2HWUA 3SKYA 5GAJA 1QIHA 1SU6A 4PE5B 3OD1A 4C0AC 1U0OC 4BQNA 1YRHA 2FWIA 2OA0A 2FSVA 1TFRA 2DCUA 2GERA 1EE9A 2GDJA 2J4CA 4QOJA 4RC9A 2ZDHA 4XWAA 4RK6A 5CCXA 3JSXA 3PE3A 1W8DA 4EW6A 1UDXA 3GLUA 2OAEA 4H7IA 1NR1A 4D9GA 2ONZA 4IJQA 1SELA 4EIWA 1GPAA 4PEVA 1EBFA 5IYZB 3EB9A 3EBLA 1RRFA 1R9NA 1XQVA 3TR5A 3A6FA 3GNLA 4CMEA 1EFVB 1JQBA 3ECSA 5DGHA 1RC1A 3V4OA 2F9LA 2H3EA 2Q9UA 1JIIA 1G21B 4KR7A 5FF9A 2O1WA 2HO4A 4X6YA 1W2HA 1L4NA 1JDNA 3D7KA 3MLBA 1XZIA 2GT1A 2FMKA 5EI5A 3H4TA 3DFZA 3H2GA 1U2SA 2D4AA 3GT7A 3SBDA 3R3VA 3C45A 4QRHA 3ZHCA 1R50A 1WXQA 2HCFA 2I22A 4Z9XA 1LQUA 2JHPA 2FEWB 3V9PA 2FVXA 1ENYA 2HF9A 1B14A 4WY8A 5KTMA 4U7TB 4MS1B 2X0RA 3A37A 3ZDQA 3T3OA 1U7WA 5KVCA 1AV7A 2ILTA 4RZ3A 2X0DA 1VHLA 3C5VA 4N3AA 2JS7A 1F5NA 4RHUA 3JVUA 1YZYA 4ZODA 3WRWA 2BKEA 2J5KA 1B23P 1XJQA 5JNLA 4FFBB 4FEGA 4QPPA 5I8WA 3LK7A 4QPDA 3GLGA 4EY6A 2GA9A 3CVXA 1RJGA 5JHHB 2R7MA 2GLUA 3DZIA 4QVKA 2AN1A 3RW9A 4I66A 2ZR9A 5KIAA 3T9EA 4XWGA 5ECYA 1YRYE 2HRCA 5KAMA 2ATCA 2CNKA 1FUEA 2JGAA 2ZSDA 1SVMA 3DM5A 5C8YB 1QGUB 1L1EA 5EJMA 2X0NA 5JNRA 1LA2A 4MZXA 1FEZA 3P2KA 1ZR4A 5SZIA 2GN2A 5L4SA 4QQKA 1L4YA 1OH6A 1B73A 3IT0A 2NO9A 4HXEB 4OA8A 5KPDA 1M8JA 3HXTA 2EL7A 3RS2A 1M1UA 2ZIWB 1N3LA 2WNSA 4EHBA 1IQUA 3VKWA 1EEXB 5JS6A 2H1VA 2HT1A 4OGWA 2ESRA 1QB8A 3CEJA 4MR8B 4MYRA 2H9YA 4KWTA 1L7XA 2AC2A 2VSXA 2V6IA 3EGVA 4PXYA 1FNDA 1N1MA 1CQWA 3HB7A 3ZW9A 4LYGA 5AW2A 4YRDA 3SIPA 1RAGA 2I62A 4G5HA 4W5RA 4Q7KA 4OGKA 2C8KA 3PSAA 2IU6A 1QIGA 1AQLA 3HN2A 1UMKA 1O1YA 2R8RA 2RGNA 1M2GA 1PP4A 3TL3A 1P1HA 2NACA 3EGWA 3AQIA 3L4JA 1GDHA 1DADA 2PKYX 3CHYA 1SCAA 3FLAA 4WOBA 3GLGE 3DL4A 3SQXA 1UKYA 1WXDA 5F76A 1O0BA 2FN9A 1R4AA 5I4IA 1ZNZA 2D62A 5DPMA 1FMCA 4WY5A 5TMEA 3TGPA 4PC6A 1I2MA 2VQ6A 2R85A 4CI0B 3FCUB 4Z4FA 3LKBA 2AZ4A 1YMQA 4A8HA 4JMPA 3L0DA 3FYSA 4PFQA 5ELLA 4LMAA 3VR0A 1YVPA 3M4JA 2X58A 6Q21A 4BJ5A 1MA0A 5I9MA 2P2NA 4XPIA 3HKCA 4J2HA 1XN1A 4FYKA 1R0YA 4N54A 1ADBA 1AKWA 2VPIA 4FDAA 1RRVA 4MTLA 5BW6B 3AKDA 4QEKA 3GJ0A 2V55B 1WZCA 3F6RA 2IFTA 2JJ8A 3RVNA 3VR6H 4D56A 4DDHA 1G8FA 4A7PA 4YHHB 4DJJA 1LLUA 1FQJA 2P3QA 1E3TA 5EZSA 1U1FA 1NQXA 4Y6OA 3W5JA 1QMGA 5CA0B 1U1GA 1C14A 3AIIA 3DB1A 3P52A 3L01A 1RHJA 3E3OA 4K3UA 4JBHA 3T15A 3WGYA 4AMBA 2HDHA 4DA6A 4CTMA 2JB9A 1A96A 2J3QA 3H6HA 3G1UA 3HXOA 2B5VA 1CZLA 1FYXA 1R5NA 2R00C 3FDXA 1MX5A 2AC7A 2V9ZA 3JQGA 2A0UA 3LT0A 3MTEA 1ZEJA 4KOAA 4RKWA 1T13A 4FBGA 4H4DA 4JJKA 1GRQA 4FFDA 1LWNA 4H2DA 5LZ8A 3R3UA 1C3OA 1Y8AA 3T9DA 3AU8A 3VYRB 2IYWA 3CX3A 2CE7A 4EF6A 4IDCA 2GVNA 2H63A 4X3PA 3BDVA 3CRQA 3F5MA 1T3LA 3P26A 3W90A 1ABFA 4HFMA 5BMVF 1F4VA 2ZE5A 1VLLA 3W8NA 3K9BA 4DCNA 5KOHA 1GKUB 4IDAA 4HLUA 1RC8A 2Z9BA 4X66B 5C3MA 4QGBA 1E9AA 4TQUS 1KE1A 4AMUA 4JLVA 3PC7A 1A4XA 1T3GA 4GR4A 3R7BA 3UPUA 4KQGA 1NW6A 1N7IA 3E8XA 4JS0A 3VYUB 1NF8A 3QVUA 1BNCA 4EW2A 1EBBA 1T0JB 4G63A 4Q05A 5CFZA 1UC4B 5DSZA 1LI5A 5L3VA 1E92A 1NNEA 3V8PA 5A9TA 4YCAA 4LFCB 4JDPA 3V4PB 2PXXA 4ZTZB 3NAZA 4DCGA 2F64A 5J2UB 1J4AA 3VJKA 1CY8A 1J0EA 1OLSA 2P6NA 2ZWOA 3G8AA 3LOUA 3N1UA 1FNSA 1I4EB 5CH8A 4M0LA 5KQRA 5CUQA 4MYTA 4J3FA 4JB3A 5IFLA 2J33A 4KACA 4TZ0A 3S3TA 4JIMA 5CA1F 3FR8A 4UBKA 3G9QA 4YIHA 2XB6A 1CIPA 3ETGA 3F5DA 5IDQA 2XMPA 2NZYA 2AMYA 4GOMD 4BMXA 2C7QA 2L69A 3HUUA 3RKUA 3VR1A 5M2QA 1M9NA 1L5WA 2F2TA 2ZXFA 2P5SA 4BNTA 5D5HA 4DHWA 4I6GA 5LQKA 2ZUDA 1SUAA 4RHEA 4XCQA 4O4LA 4YRIA 2Q1SA 4D4LA 3N0TA 4DV2B 1ZU5A 2VEDA 1ID1A 3E5RA 4QFDA 2JEYA 3FKJA 1GGVA 3VH1A 4PS0A 3DFKA 3I53A 4W5TA 2GPBA 2PGXA 4NBSA 4C2UA 3U4HA 3AFOA 4LZPA 1K8ZB 3TLGB 1QG6A 3GRCA 3N2NA 2WFAA 2NXWA 1UEXC 3AP3A 5D3MB 2FQYA 4GR9A 4P31A 3R7LA 1WNFA 3NHPA 2UAGA 5DEOA 2ZSKA 2CNBA 2WF6A 1ZHHA 2XQIA 3RPEA 2BFEB 2ZRJA 4FN5A 1O5OA 1TLFA 2PFGA 5JS8A 3DP9A 2WAAA 4CIYA 3FETA 1XTQA 2OKCA 3L4EA 1NBMA 4BUCA 3VU0A 1SVLA 2Z2ZA 1Y8RB 4AMVA 5IVHA 1UBJS 4MQEB 4LCEA 2RK3A 3AR8A 3SLRA 5IYZA 4EMUA 1V45E 2X4GA 3BXPA 4A23A 5C81A 5KC9A 4MARA 3PNBA 3RBVA 1TCUA 3GUZA 1Y4UA 4X6XA 2HO5A 5ALFA 2XD4A 1XD2B 3UC5A 5K45A 2ISCA 3LQ1A 3T9CA 1NVKA 4DMHA 3FVVA 3MT9A 3U56A 1YRQA 3AVQA 1OI3A 3KR1A 1YAHA 4IH4A 2X8WA 4Q66C 4E08A 5DBGA 2O3UA 3FCSB 1RHKA 2R751 1TAQA 2ZJ7A 4ZVOA 2AR7A 1WW3A 4LJYA 5IJ0A 5I47A 4JYMA 3SR4A 4BFZA 2DWCA 1ZOIA 3FSGD 1S3FA 1GNSA 3BRCA 1F51E 1M0SA 4KMSA 4NBRA 3IEKA 2JGFA 2UZAA 3AUFA 1PYGA 3ADCA 4IWYA 5ALDA 2VF7A 3BRQA 1IOVA 5LYYA 1DOHA 1Z5UA 4RHFA 4A6DA 2GN0A 4DB4A 2XODA 1J5EB 2PUHA 4ZI3A 3OQIA 1TF5A 1UKVY 4IH9A 2XOKA 3I76A 2FI1A 4JLNA 4RWEA 1QG2A 4RK5A 1HE4A 4YPFA 1NBME 5TE9A 1I30A 1OKKD 4O3FA 3RRMA 4CXMA 4UNSA 1X7XA 5TV2A 4ZVRA 3BGWA 2IUTA 3ZQUA 3EAQA 4NCNA 5AIBA 1ORHA 2VBGA 1XJ0A 5C8YA 3SYMA 1QGUA 3W7VA 3UAXA 3PXAA 1KPHA 1IVNA 2VRCD 3HU5A 3KQHA 1A9SA 1JHXA 2PS1A 4Q02A 3TSWA 1OXBB 3WWEA 4BFWA 6YASA 4C7OB 1EFAA 3RD5A 3UY4A 1ECJA 5DW3A 2KM1A 1TNDA 1SQ0A 2JKYA 1SBTA 5E7MA 3D8UA 4PM4A 4CIDA 4C6RA 5IT4A 3LX6A 3ZZ1A 4ENQA 1IVSA 2FZWA 2VEOA 2VHTA 4K87A 4W9MC 2PS3A 2VUHB 3CRRA 3G02A 3L7MA 3S1AA 3G13A 2BFPA 2BGMA 5KX5B 4ZK6A 2D1TA 2YRXA 5B3JA 4DSNA 1IUOA 1DAPA 2YHBA 1MT3A 4RV5A 3EBOA 3WGHA 2OWDA 1GUDA 4CRWB 2QN3A 4H9GA 1Z0AA 4OMUA 4TMKA 5HTOA 1GQFA 5JSZA 2G82A 2J9RA 5KTRA 3JQFC 4UVIA 3LCCA 3KSAC 3Q7RA 1P0FA 1R8YA 3Q3GE 1N3BA 4G4GA 4YBRA 4I8XA 4FCTA 2GTIA 1SXPA 1OXKB 4LVNA 3AY7A 3MQ2A 1OHHD 3WBFA 1RHRA 4C7MA 4B3SB 3OU7A 1IG3A 1U0NA 1JW9B 5JCZA 3I5XA 3KQPA 5EWJA 3ABSB 5KQMA 3MYRA 4DYHA 1JG3A 5GJCA 1FX1A 1Q0HA 2JI9A 3ZXSA 1ND6A 3NEYA 2ZTSA 2C2ZA 3WDSA 4WKGA 1QP8A 1RABA 1BOFA 3H17A 2GR9A 3JV7A 3QOFA 5KU7A 4UMFA 1XFAA 1HR0B 3QEMB 4C7JA 5FKJA 1OY1A 3RI3A 2H00A 1BKSB 1J0CA 1T6NA 3G2HA 4AN0A 2BLNA 3MT7A 3UJCA 1JSLA 3CEHA 1C9KA 1V6SA 5T6MA 2H3HA 4OREX 1V16B 3PV0A 1FF9A 4RVFA 1BWQA 2B25A 1KI6B 2QA5A 2NT4A 4XM1A 1W0JD 2QW0X 2WUWE 2PUGA 4MB0A 3S4YA 1CUZA 5A6SB 1X77A 4RK7A 1J70A 1KYTA 1NKTA 2W83A 3PPYA 4TRJA 5EL0A 4UU7A 2Z1MA 2BGWA 1FB5A 1FL9A 3HA5A 4KLRA 2Q9CA 7MHTA 2PG3A 2JRLA 3VHRA 3FF1A 5B57C 2QR5A 2E5LB 3X2SA 1WU7A 1V47A 2GNPA 4JC0A 2AYXA 4WCFC 4PYQA 2C61A 2F3UA 1MIOB 3R5TA 4RIEA 2AWNA 2DKOA 3T7EA 2CL6X 3HMQA 4OATA 2NZUG 1QQTA 3INGA 4ZANA 5G1NA 5IH7A 3UBMA 1O94D 2WJWA 3GZNA 1ODKA 2UU9B 3H42B 5LQCA 2VDOB 4U2CA 3V2IA 1EXDA 3ZI0A 4DC1A 1VBMA 4B32A 2EKQA 3I30X 3KKMA 5JR3A 4AY2A 5AIAA 4NYMQ 5J2UA 5ADUS 1PWZA 3DWEX 2GM5A 1R9JA 3PEYA 3I45A 3RTDA 4B48A 5L3SB 3BTUA 4N5DA 4UXIA 3TKLA 4BTEA 3M6VA 3FZYA 3ZJTA 3GUVA 1NVUQ 1A77A 4PZ0A 5K4AA 1PL6A 4DBZA 4GGPA 3QFRA 4HGPA 1M2OB 3OSUA 2JGNA 1PD0A 4Q7JB 2IWHA 3TCKA 2VVTA 2YZGA 3UOWA 4ARBA 4ONEA 3DZBA 1KZ9A 1XJWA 2YUTA 3L07A 5KNDD 5HFAA 1ZPDA 4UNIA 4CCYB 2W00A 2I76A 4UDNA 5H4GA 3NEPX 4AICA 2CHQA 1IUPA 1U80A 4OGFA 3W8RA 5FX2A 3UA4A 3PQ6A 2HRQA 3O74A 1WSBA 2B1JA 3RSLA 1UBRS 1FS5A 4RESA 3EWIA 3MJDA 4H08A 4TTQA 5KYYB 4W5OA 2GXAA 4IIBA 1CUXA 1OTYA 5D3MA 2XBUA 2TYSB 4ML3A 5BR7A 2ZWIA 2AIRA 2Z4SA 1WY7A 3W6NA 3VVBA 3E22B 1MDBA 1P7ZA 1RBZA 1RR6A 4IDHA 5F4BA 1QHNA 3WNZA 2D2IA 2BFEA 2B94A 4NKRA 3B6EA 2WKPA 4WLOA 2P3LA 1ABEA 4QXQA 4ZVTA 4QOSA 3UAWA 3H19A 1VKNA 2A9QA 5U1PA 4PLZA 3OEHA 4J0DA 3FOWA 1QK5A 4HZGA 3ZY4A 3HK2A 2JGLA 4MQEA 3ZWKA 1PR0A 4OYYA 2XOEA 1ZIPA 4IRUB 4WAUA 4WOPA 4DUGD 2VL7A 3V3KA 3DZGA 4O8ZA 4A0HA 1N78A 3B9PA 4IHJF 3QOWA 2RK6A 2WG0A 3ORSA 2UYQA 3R75A 3RJ5A 4D3ZA 3T5BA 1KBOA 3DBOB 3PICA 1SBIA 1E1YA 4R7ZA 5F1KA 4UNRA 2YVLA 3JYOA 5DX1A 1RQRA 5FTJA 4UOZA 4Q3AA 4E32A 3HADA 3R4CA 3FPFA 1S6YA 4G0OA 2MMCA 3C3PA 5IP5A 3T95A 4S3MA 3C7KA 1ZLYA 4WWHA 5EXEA 4B3CA 4ZCRA 4L75A 2FY8A 1MFZA 1E8NA 1Y98A 2NAPA 3EDMA 3FUWA 3ASZA 1TMYA 1C8LA 2OK8A 4X65B 2ECKA 5COAA 3K32A 5AVZA 4U5XA 3PI7A 3TO5A 3QU4A 1L7RA 4MEBA 4JLOA 1H0SA 3U0VA 1IZ9A 1E5XA 1NUTA 2XE4A 5LNK6 2H1RA 3GIWA 4KODA 4MW5A 5FNVB 2WEKA 4BQIA 4HAZA 3GIDA 2JANA 3BC1A 3ZY3A 2H07A 1EK1A 3UWMA 3WLHA 4DE5A 5JRDS 3QPUA 4Q5IA 4UNPA 2R6JA 3NANA 1RZUA 4X94A 3S2FA 2JCBA 3VC3A 3W0LB 4BVEA 4IDDA 1NBWB 2XKKA 2IHJA 3EZLA 1KSHA 2CUNA 4KQJA 4CM9A 5E7JA 1UAYA 1UDAA 1UJ2A 4QTYA 2HPAA 3MHTA 3D02A 1A8UA 5HP4A 2IOHA 4C7OA 4DBLE 4G4SO 3GA5A 4YAGA 3IBYA 1C9EA 2Y67A 1II8A 2P6OA 6AT1A 4EYSA 1GUYA 2Q5QA 4LRWA 1SZCA 3TQHA 4XX1A 3ET5A 3SSNA 2OGZA 4R40A 5T4HA 4R41A 1JEEA 1EGAA 3OKPA 2IP4A 2VNHA 3B3FA 1PFWA 1NGSA 2RB4A 1ECGA 3L93A 4DQUA 5KX5A 1SIOA 4CMHA 1FDSA 2Y2UA 3GVIA 3Q8XB 4EG7A 4F12A 3ZPXA 2I8AA 4F4IA 2QTHA 2QX7A 3K20A 1K3TA 1I3KA 3EVNA 1OWPA 3L6BA 5HKLA 1KAHA 4UFOA 3NTRA 4W7HA 4UM9D 3NTVA 1QO0A 1V3VA 3LUAA 4DLWA 3UUFA 3P2EA 2ZZKA 4BFYA 3L4KA 3NH6A 3QIVA 4CG2A 1B15A 4B09A 1GN9A 3HTXA 2Q0QA 3C6ZA 4L0CA 3T9BA 2GHTA 4BX2A 1CF4A 4OB7A 4OHBA 3A9SA 4E70A 2W5UA 2QRMA 5EUMA 1IN8A 1XEXA 1ZJWA 2FDRA 2AEMA 3D8RA 3LPDA 1W44A 1UK8A 3C3MA 4JB8A 3RUEA 3E9YA 1ZD2P 1PD1A 5ALJA 1A5SB 2V54A 1XROA 3HVIA 2FR8C 4E2YA 1VLHA 4EUSA 5HRUA 5DF1A 1IC6A 1DDOA 2F9FA 1OC2A 4XASA 4MWCA 4EECA 2FOXA 4JBXA 2QGFA 1XU7A 4IIXA 1TF2A 1VJ1A 3GO4A 1LF0A 2AVDA 4BRSA 3SYRA 2P75A 2BELA 1ZIYA 4RJLA 1V16A 1Z36A 3PGJA 3AR2A 1AJEA 2Y68A 3B1ZA 2ONJA 1LKZA 2X41A 4IMJB 1CTQA 3K70D 5K99A 3HVKA 1MD9A 2PS0A 4OV6B 3V48A 2C9BA 1GRRA 2WG1A 3NOOA 4Y6QA 4DREA 5A6SA 3GRFA 2FSIA 2VXYA 4WESA 3H8WA 1DV1A 2CV0A 1CG6A 4RDCA 1Z45A 5KS2A 1M5UA 5IAAA 3O8CA 4KO3S 5C31A 3QV2A 3T7IA 1UPAA 1XWWA 2GVZC 4G1VA 3KC2A 5C4GB 4BX0A 1C7JA 3UK1A 1MIOA 3V1TC 5HOEA 5JD6A 1EGHA 3JQRA 4NXNB 2FZEA 4EVQA 2X5KO 2QX6A 2JA2A 2VCHA 2RHLA 1TU4A 1AQ6A 1GFWA 3SYTA 2VZ0A 3WMFA 3SIXA 1T8WA 1ZI8A 1U8FO 3E4CA 4GSYA 1JQ5A 2VHWA 3RU3A 3CTPA 4XUCA 3QKWA 1BH2A 4YGXB 3TM4A 1Z33A 3I9NA 5K0ZA 2I4NA 4QRIA 1W73A 3MWEB 4D92A 2WIBA 1Z5NA 2A5JA 4NQRA 4JUDX 3MMNA 2J5XA 4ALMA 2DE0X 3AJAA 1U9IA 3DZHA 3FM9A 5L3SA 2W90A 3KXIA 1C3EA 5EPEA 1RRCA 1SIBE 2WIJA 1I7LA 4ZEWA 4JA2A 4PPFA 1Q7CA 3LIIA 4I4NA 2BKVA 2YXLA 3B5EA 3E27A 1PJCA 3LD9A 3LHSA 4J0HA 3R0ZA 4LSZA 1AF4A 2YBDA 1M2OA 2FQ1A 1MLDA 1UIRA 2O3QA 4TL8A 4OP2A 4F11A 3K1ZA 4PZEA 5ALEA 5G4LA 2AF4C 5AVTA 3PKIA 1YI8A 4Q3KA 1TYBE 4ZAFA 3HDYA 4CCYA 3ORFA 1BEEA 4Q00A 5CXSA 4DMLA 3O82A 2JFZA 2TSYB 5A0TA 1ORRA 4OSEA 4Q3OA 3U1BA 3KR0A 3T99A 2O9JA 2JD1A 3I83A 4INJA 4TLAA 1D6JA 2V7QA 1DWPA 1F60A 1I3CA 3GH3A 4N5IX 1S2NA 4N0EA 3I1YA 3B60A 1YCGA 1NVEA 2KE5A 3E22A 3CNQS 1RM0A 1OXXK 4ZEXA 2GZMA 3OPMA 1UWCA 2L19A 4RJJA 1FBNA 2VSYA 4LWPA 2X8LA 3KB2A 2VXCA 1I7NA 1ISGA 1QRRA 4HXFB 4EO7A 1GPWB 1Q2XA 2CDCA 2YV2A 3B85A 3JVEA 3ZHSA 2A33A 1BFDA 3LHFA 2HGZA 4GO1A 4NNPA 1PV1A 1QJCA 3R4VA 5JNSA 3H86A 3T3IA 1XMVA 3I6IA 2LCQA 1TM2A 2X3YA 3HV0A 4B81A 5KHOC 1KP2A 1NRWA 1SD2A 4WK6A 2AT1A 3CSUA 2CNDA 3L0YA 3RYTC 4CZ2A 4ZI7A 1TECE 4KQ6A 3EZ2A 1ZH2A 3JWEA 3EVAA 1UFQA 4XVHA 3U7RA 1G5TA 2QX4A 4E46A 1E9RA 3NNNA 3DCYA 4WLVA 4IUBS 1WUJS 4X41A 2RARA 4JI5B 5L8VA 4KWHA 1RYYA 1PQWA 5EMJA 4H3SA 3IO3A 3H1BA 3WIVA 4E1AA 3GGCA 1E2DA 4L8LA 3VPCA 5C8DA 1E6WA 3U3XA 4OQNA 1DDGA 4Z7JA 3BXHA 4NZPA 2Z5LA 5FTLA 1XVIA 1TUGA 2IDJA 4EHJA 2E4VA 3LAWA 1XTRA 3SMVA 1BCRB 1E9BA 4OLFA 1JBEA 2HF7A 1JDUA 4S1PA 2JLBA 3EZGA 2YJ6A 1S2IA 2CJXA 4IM7A 4C7BA 3B82A 3HC7A 3DGEC 3BFJA 5FNVA 2IZ6A 4GOOD 1NHGA 4MLZA 1B00A 1JSXA 2A9JA 4D7AA 4YALA 3UATA 1JWAB 1T6ZA 1JECA 1YRLA 4LGMA 4TKVB 1DC5A 1DKNA 5KDOA 3HHEA 3HWSA 3B7WA 3N6XA 1N2CA 4BFSA 2QMYA 4HWRA 3LMKA 1L7OA 5CPBA 2HSDA 3SAJA 4YRGA 3RLFA 1M0EA 2BGTA 2ZE8A 2XWBF 5HUQA 3SX2A 1RBYA 2PL5A 4CHGA 3ZBUA 1CUEA 2AK2A 2XRMA 3KJQA 1G3IA 4IMRA 2JLZA 1KDTA 1FFEA 4ZEVA 5I01A 2WM8A 5SZKB 3FH0A 1F1BA 1TZJA 2JEOA 1AK9A 3ZH9B 3KJNA 5DCLA 5FPPA 1JJFA 1R0ZA 3NM6B 1GPYA 4X91A 2H2HA 3H7AA 1Z16A 1E1DA 1Y3AA 2WYHA 4N5MA 1T9DA 1NTOA 1RFLA 3F7OA 1AHIA 5E9AA 1OF1A 2YHAA 2WQZA 4OBWA 4R8LA 1KFBB 1DC6A 1K6EA 3PNSA 4R9VA 1NXQA 2XCLA 4B3MB 3JD2A 3IHKA 2J3IA 4J3JA 1ZAKA 3IULA 1NAIA 1RSZA 3SJAA 2AOUB 2RC6A 9GPBA 1VMDA 1JJIA 2AMLA 3BWDD 1VHJA 1N2CE 1ZJZA 3CX4A 1U63A 2ZBFA 4YCDA 1Q57A 2IU3A 1ZYUA 4NS1A 3HUFA 1BDHA 3KHSA 4IOMA 2YVAA 4MMXB 4F04A 3ZWAA 1UIMA 1LK5A 1IE3A 3OZRA 1UZAA 3ILHA 4EGFA 3RIMA 3F46A 3C8DA 4ZJYA 4EELA 3VR4A 5CLLA 1NBAA 4KRGA 1TADA 3ADOA 4P82A 3R0QA 2CVOA 1T9BA 2FMHA 1KXJA 2GWHA 3L84A 2NZ2A 1E4YA 4MCAA 5EE0A 5G3ZA 3RJZA 3S2UA 2WBLC 3WBBA 1PK8A 6ABPA 1AGNA 1YHNA 4B8WA 3OF5A 2IIPA 2OHFA 2R6HA 4MKRA 4LZZA 1VGVA 5LWHA 3CZ4A 2FUG6 3TVYA 5J2TA 1U0RA 2ZAIA 3DHYA 2E37A 4LUCA 2W2QA 1GAWA 4XGKA 2P6UA 3CRNA 1WX1A 2Z1NA 4KKVA 4DA9A 4A6PA 2ZYWX 1XZBA 3NBKA 4NY1A 2D3TA 2BCGY 3ODGA 5M29A 3DC2A 4RQBA 1ZNYA 3GDHA 1P7WA 1Z06A 3S27A 4DN6A 3ZHOA 4ZAVA 1YZLA 3BKWA 5F98A 1JDPA 3OC0A 3PNKA 2GFHA 4J1NA 2IUSA 5BR4A 1UXJA 3WBJA 2LE0A 3PHGA 1BJKA 5FV7A 4IXTA 4M1ZA 2JD0A 3OZBA 4C07A 4OLBA 4M8SA 4NX2A 4DDWA 3G5TA 2BGIA 1T9GR 3UVEA 1U7XA 1T9KA 3A7DA 4HLCA 4JNKA 4RAQA 4BP3A 5L7TA 2A84A 2GEUA 2OHVA 5GIOE 1DEOA 1QZZA 3HXLA 5FL3A 4DLSA 1RLTA 4YJDA 4NU0A 5C4MA 5DULA 1MV8A 2RHOA 3DGFC 3ONEA 3WLMA 1LSOA 1ISJA 4ZEOA 3ZZTA 3MWEA 2FDCA 4KIJA 5C8VA 1FVOA 2GD0A 4AXXA 4O2RA 4TV8B 2ZRMA 2PR7A 3L8FA 3M82A 4HWKA 4V0OA 3FNHA 3WMEA 1CRQA 1ML4A 2PL3A 2H4FA 5GQSA 1V6AA 3ZXXA 3CH7A 1AGXA 4ER3A 4LVOA 1YS9A 3A4TA 2H4JA 1Y42X 2AE2A 2H31A 1HE3A 3FDZA 1YJCA 4H0FA 5EQFA 3SZ3A 1QBGA 2DSTA 3I34X 3JQEA 5KJFA 2J4DA 1CHDA 1K8RA 2OCIA 1Z4KA 1JWBB 1B8PA 3FNQA 4BGIA 2KB0A 4WX2B 4M83A 1AQNA 1OXSC 2WV7A 3L8YA 1SBHA 4L9WA 2M6SA 3WMRA 3WGGA 4O4HA 3ZX5A 4EYOA 1W9MA 2BHSA 1ULAA 2G1UA 4L5YA 3TBKA 2H2AA 5EJ4A 1B43A 4JGGA 4KQEA 2ZUTA 5ALQA 3G88A 1UFOA 2X4LA 4B9AA 1P4RA 2ZCUA 3HL0A 4YJFB 5LQAA 1AM4D 1G19A 4KO1S 4W5WA 4WI1A 4J3NA 3GDWA 4HMPA 3LGAA 1C0EA 2J85A 2MYNA 4ZXFA 4A1FA 3BE4A 3OT1A 4XUDA 4DIMA 3ECAA 4B79A 1PL7A 3JSAA 4RQUA 1R7RA 3B51X 3GAMA 4CNBA 4C9BA 1USGA 2ZCVA 3IVRA 2O5EA 2VHVA 5K3DA 4HF7A 1M2WA 2ZYUX 3STXA 5JRZA 2Z04A 3VKGA 1WOMA 4X6UA 1DFGA 1GL7A 1PGQA 1TIBA 1VL2A 2GRAA 2JIZD 3GV0A 3KR9A 5TQVA 5J4VA 1H3NA 1Q44A 2JBWA 2AEEA 5L3QA 2MT9A 3M5WA 4Y9UA 3RSQA 3BF8A 2XCTB 5KOJA 2XNHA 5C5CA 1VPEA 3VKHA 2IYNA 3H9BA 4V02A 3BTVA 4Z8XA 4FUTA 1GA6A 1MV5A 1SG0A 3UAVA 2QPAA 1ZOOA 4Q7QA 4ZARA 1JAXA 4RJKA 3MCUA 4F3CA 2IEZA 1GPMA 2VA8A 3S2GA 3JZFA 1M5TA 2W6PA 5ESDA 5JADA 1RQGA 5L51A 3VPBA 4AS3A 4PAMA 1BCRA 4R2XA 5BNZA 4HUTA 4OXKA 4YECA 4TSKA 3VBCA 3QXSA 2YOHA 1VM6A 2I7DA 3GWZA 2QRPA 3BOSA 2WVGA 1AIPA 5CK4A 2JLUA 1OE0A 4QWMA 5EY5B 1PWEA 1GGMA 1R5JA 1J2TA 2FFAA 3PENA 3BHNA 4LZLA 4O1IA 3ZK7A 4TKVA 1JPJA 2H2WA 3L7CA 4UCFA 3VO2A 3ZLVA 1Y5NA 4DYVA 5LFAA 1AGYA 2AI1A 2IX3A 1U8XX 3A1CA 4FCWA 1AHNA 4M8KA 5JATA 3TL2A 1DUVG 2F8TA 5CYPA 3VR3A 3OSZA 3TKAA 3W9UA 4DLKA 5J4HA 2OBFA 1RRGA 2BHNA 2R6AA 4JQZA 1ZVQA 2FW7A 4F6RB 2A1TR 5ERXA 4KJZA 5K2MA 2H4XA 3GEDA 3WJ1A 3JAWB 4NI5A 3FUUA 3PJRA 1E5DA 2F67A 3HQ4O 4P53A 1LV7A 2WILA 1GVNB 3BD6A 4GLOA 4I4TF 3SFVA 2WB2A 5GWXA 3IOEA 2NV0A 1C8BA 5LP6C 4KPUB 3RVBA 3GT3A 4BMYA 1RPTA 2B4KA 3BB4A 3DQPA 4HATA 2V6FA 4NBWA 1HSZA 2PV0A 1F5SA 1D3AA 2YX1A 3KO8A 3HEBA 5IWCA 4EI7A 1PFQA 4DJDC 3NNSA 2OP1A 1NJ2A 3UMJA 2XXBA 2OSVA 4YAWA 5KYUA 4CT4B 2IH4A 2XVMA 2R8YA 5EE1A 5F2NA 2AZDA 2HSEA 2V6MA 3NIGB 3T3HA 1X2BA 3KB8A 4QULA 4D9NA 5BQFA 4C1NA 2AOUA 3OMWA 3CW2A 3OOJA 5MDHA 4PO3X 1EJ6A 1S1CA 4L7QA 3PHLA 1YQTA 1QDLB 2IEIA 4D8VA 2BE7A 1NLZA 3IIEA 4I50B 3FI9A 2PZBA 2OM6A 3K2IA 4PFJA 3WZ2A 4BN5A 1YNOA 4GBGA 2CBZA 2XNKA 4FNMA 4OYHA 4UHCA 3U31A 3R0XA 1J09A 4RSMA 4EGAA 4UMVA 2YXEA 4W7SA 4ABYA 2FB9A 4HV4A 2WUGA 1X19A 3IPCA 4BCBA 4MQ5A 5FLXA 4IVPA 4DLZA 1SBQA 1KU6A 4GI2A 4DIDA 4RMIA 4H0NA 3U3KA 4HNGA 4ESVA 2TMDA 5FUWA 2O7NA 1G8JA 3NHMA 2OWEA 1E2HA 4HYYA 2J87A 4WFKA 3ZU4A 2RH9B 1CZHA 3BXZA 4HP8A 1XZPA 2B3DA 4U2DA 4UEOA 1JDBC 3FPCA 5JU6A 4CQMD 1DRWA 1AOXA 1NW8A 2H59A 2HLHA 1IAVA 4C78A 1XF9A 2RGWA 2V97A 2XUIA 1GTRA 1X70A 4DADA 5GIPE 2BUAA 3WSVA 4Q9HA 3EXEA 1PBTA 3LY9A 1QS0B 3B89A 1QH8A 2ZJFA 4DLPA 2PKXA 3V7FA 3QKTA 3A6EA 1QZ3A 4C0HA 3CIOA 4ENUA 3ZCPA 5A3JA 3U7GA 1RYFA 2EFEB 4B6PA 4C4XA 4WCFB 4YT8A 1XL1A 4FHDA 4FLMA 1ULBA 4ND2A 3JZAA 3OQHA 5HM8A 4ZYWA 1DTSA 3K15A 1VL5A 1X2EA 3HVHA 4E4RA 4NXMB 4M60A 1FDUA 3ZCUA 1N3YA 3EXG2 1T8UA 5JTUA 3ONWA 1I4WA 1SOMA 1G17A 2H7VA 4AULA 3CVVA 1U3GA 3UV6A 5A5EA 1CP2A 4GFDA 4RFSB 1NYTA 1Z3CA 3AFIA 4KQMA 5A9SB 3ZVRA 2Q2WA 4TV8A 3UYKA 2N1MA 1JTEA 1N1EA 2B5WA 3H99A 3Q6MA 1D2EA 3TPFA 1P1RA 1C8VB 1TPZA 1WKCA 4P2GA 4IDBA 3O26A 4C04A 5JC1A 2ZDQA 3IVMA 4RLHA 3VR6D 2VNKA 2IUYA 5BORA 1GFZA 1MCZA 4NATA 1YAJA 4XGNA 3Q2KA 5CURA 1JG7A 4P5EA 3RT1A 2I99A 3FUXA 4CKZA 3IKMB 1SRRA 2ATVA 3O8DA 1EZZA 3ZVNA 4RIFA 1SOVA 1F2VA 2WU3A 3JQQA 2GPYA 1K8QA 1E0DA 3F6EX 3KLBA 1N92A 3KXKA 3LQRA 2GM3A 1RLOA 3Q9UA 4QUBA 4DIUA 1TZBA 4IF4A 5D3KA 1Q7TA 5CW1A 1Z39A 2XRYA 3DBHB 1NLUA 5HPYB 5FBWB 4YJFA 2C2GA 2EQAA 3ANYB 4L5BA 3BX1A 3OP4A 3BHMA 2ZRKA 3L2OB 5IM4F 2QMOA 2W0MA 4ZQBA 3RRJA 1X39A 2Z95A 1CY0A 3O4VA 5CLIA 3Q7EA 1Q0QA 4I1RA 1CUCA 3KCQA 5AM2A 1UXHA 5KPJA 1IN1A 2EIXA 1W5TA 3TLEA 4KQ2A 1DFIA 4RVHA 5J4LA 1X13A 2AMFA 2BPOA 4G4IA 4DCJA 3R9XB 3GMTA 3TXXA 1ZD9A 3WB9A 3NETA 3IXLA 5IJXA 2IXDA 3AL0C 4GEKA 5H83A 1T5BA 4QXPA 1OYOA 3RYHB 2IEAA 4C06A 4EL5A 1NXWA 4G23A 4HVTA 2GEBA 5BUCA 1JMYA 1FRQA 5DBHX 4BFLA 5KTPA 4D0GA 3KSMA 4XVUA 3ZWCA 2AN5A 4HJXA 1RMYA 3HO1A 2HADA 3FNEA 5CFMA 4LN1A 1T43A 2FGKA 2OM2A 1ZD1A 2G9UA 1WBJB 1KK2A 1ZEMA 3GGOA 4LXHA 4HD8A 4I55B 4LY9A 3CB4A 2DG2A 3LDHA 3N58A 4DYDA 3VA7A 2I2DA 2EKBA 3QBTA 1X74A 1YB6A 1I8TA 3QXCA 4QKQA 3W5CA 3BE5A 3PQ8A 4IHKA 6LDHA 3QMVA 3QXJA 3G2JA 1X1RA 2MSLA 3A6JA 3OLZA 5DHPA 3RVJA 4CKYA 5JROA 1GTJ1 1BKYA 3J7TA 2QX8A 3TNLA 4Q1VA 4CKXA 3TTUA 2HB6A 5CH3A 2I3DA 3S8MA 5CXQA 2C77A 3QKRA 2IIVA 3DE0X 5JVDA 3JASB 1IB6A 2Q07A 3KDPA 2Z56A 1FLVA 3TZQA 3UNXA 5IT9A 2BGJA 5IWAB 5T7BA 4HAIA 1XIVA 2P91A 1R0XA 1VTKA 2JGEA 3DONA 1DKQA 5PNTA 2AFHB 4RZIA 3SIWA 1ADCA 1YO6A 3R2JA 5KYNA 2C9OA 3OJEA 4MHSA 4QD3A 1Z7YA 4NYJQ 3BF7A 3FKSD 3MTBA 1BXZA 1BS9A 3NHSA 4MCIA 1YZVA 3SXJA 3WGUA 4BV8A 1MHPA 1PZGA 2GZDA 3R5JA 4J7XA 4KPUA 2D0DA 2VDMB 4NR0A 4L4RA 5C0OE 5ARBA 1KOLA 1T4MA 3HV2A 4U3JB 8ATCA 4J7CA 3AVXA 2RB5A 4KP7A 3HJFA 4KB5A 5DV9A 3I2HA 4G86A 3CX7A 3T61A 4M76B 1G64A 1KAQA 1Y7TA 4HN4B 2VP5A 4L15A 1A9XA 3DW1X 4DUZB 2PUTA 4K6FA 1SCBA 2BMEA 3HB4X 4YACA 2PX3A 1OFGA 2AI2A 4LY0A 4YDSA 4Q4HA 1O0CA 2C8JA 3ZCRA 1BEZA 3RAFC 2IPOA 1ISRA 1SCUB 1KS9A 1M54A 1SHZA 1DB3A 1VPVA 4FI3F 3GCXA 4HH1A 4WGFA 5JAQA 5CDFA 1T5SA 1Z6PA 3JQFA 4BEBA 1OJLA 1ZY2A 3BXEA 3PGKA 1K7FB 1SCNE 4I50A 1USIA 2OMEA 3QRWA 4Z99A 1WP4A 4BNXA 1KYIA 2GBFA 2Z0MA 3ENQA 3N76A 3CLVA 4NDNE 2J6IA 3RH0A 2X14A 1ODJA 1S01A 2X4IA 4LJLA 4YYEA 4AJ9A 3BWYA 3HA2A 3GFFA 3PFBA 2VJNA 1E6KA 2DY1A 5EE5B 2WKSA 3TMAA 4I6JA 2AJDA 2I67A 1SVIA 2ZTHA 3CQ9A 1O03A 4GUDA 4MVJH 5F73A 4D0NA 1HDYA 4D82A 4GZLA 2H29A 3T12A 9MHTA 1GT6A 1IATA 4QARA 1I2AA 1UP7A 3TLCA 2R9VA 4PG8A 1G4HA 1HOXA 2J59A 4IGEA 4MUHA 3AF1A 3H84A 4KYTA 1V5WA 2QRUA 1L3IA 2PQ2A 1Q50A 2BSAA 2M2IA 4YMTA 4YMIA 4H17A 2JHFA 4Q19A 1TC1A 2NN3C 1J9EA 1WY5A 4DW8A 4D9HA 4LBVA 1JR3D 1EVJA 1BFKA 2GBLA 1U5CA 2GBCA 1E96A 3CB2A 3CFYA 3MS7A 2IY9A 4H77A 5BR8B 1CHNA 1P2TA 4L22A 2PUWA 4EB6B 2F3TA 3K2QA 2I65A 3S1LA 3L7BA 4LVUA 1WCIA 4P34A 1H9BA 1M6HA 2QUHA 2ONCA 5EEGA 4ZVNA 1QFZA 4WCFA 1AHHA 1NY6A 1W5FA 1I5RA 2BBOA 2IYOA 5FTMA 1V7ZA 4IMPA 5B7NA 2IQIA 1RWWA 4OXXA 4C4SA 3GH1A 3MGCA 4J1TC 2FX3A 2P4EA 5D01A 3F6CA 1O77A 5L7WA 1Y81A 1VQ1A 7MDHA 4UVGA 3IAM6 2Q4BA 4MUMA 2XTJA 4OOEA 3RC9A 4K6KA 1D2GA 4ID3A 4RTJA 2PH5A 4LJKA 5A9SA 1VHQA 2J0QA 4AKSA 4C4RA 2HNAA 2ZGVA 3FGOA 4H1UA 3Q5DA 2ZRNA 4J0JA 3U9TA 4LJ6A 3NCTA 1LSJA 1OYVA 1QU3A 1T9ZA 1QYCA 4J75A 3DTVD 1VPDA 4UMDA 2ZAYA 1V5IA 2G0TA 5TPZD 1GNLA 1UMBB 3QTBA 4A26A 4IV0A 2PLWA 5F5NA 4EVIA 3CBQA 1D1QA 4MSUA 3RTBA 2CYAA 4ZMRA 3VR2D 4YCJA 1UP6A 2CMKA 2G17A 3ZKWB 3D1LA 1BXRB 3C1AA 1IHOA 1VHTA