4IV8A

Crystal structure of n-methyl transferase from plasmodium knowlesi complexed with s-adenosyl methionine
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
245
structure length
245
Chain Sequence
GIKAYEFIFGEDYISSGGIVATTKILSDIYLEPNSKVLDIGSGLGGGCKYINEKYDAHVYGVDICEKMIAIAKLRNKDKSKVEFEAMDILKKDFPECTFDMIYSRDAILHLPYADKKKLFEKCYKWLKPNGILLITDYCADKIENWDEEFKAYINKRKYTLIPIQDYGDLIKSCNFQNVQAKDISDYWLELLQMELNKLEEKKDEFLKLYPTDEYNSLKDGWTRKIKDTKRHLQKWGYFKAQKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoethanolamine N-methyltransferase,putative
publication title Phosphoethanolamine N-methyl transferase is a Malarial drug target.
rcsb
source organism Plasmodium knowlesi
total genus 90
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 2.1.1.103: Phosphoethanolamine N-methyltransferase.
pdb deposition date 2013-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4iv8A00
2P3QA 3EGVA 4X41A 4FT4A 3VYWA 2P35A 3AXTA 4C4AA 4QTTB 3JWGA 3I9FA 5HIJA 3G8BA 3KQOA 1JSXA 4HGYA 4PIPA 4KRGA 4RYLA 3DMHA 3M70A 4R8SA 3HCFA 5FULA 2YXLA 2PX2A 1RI5A 3BXOA 1WXXA 3CJRA 1MJFA 2XYQA 3Q7EA 1R18A 5FA8A 3OZTA 4EMSA 4MQ4A 1JG2A 1JQDA 4PIMA 1D2GA 2YR0A 5DM4A 3HCAA 2GA9A 3DH0A 4EKIA 4AUKA 2ERCA 5HIMA 2JJQA 1JG3A 3LDFA 1KPIA 1VE3A 2ZWVA 2VDVE 3R0QA 2BH2A 3FTEA 1P39A 4R6WA 1FP2A 4RVDA 5DLYA 4HRAA 4FGZA 2UZ4A 1DCTA 2ORED 3NTVA 4LWPA 2CWWA 1P1BA 3EVDA 4BLVA 2PXAA 4GOND 1L1EA 2EFJA 4OQDA 5HOQA 5K05A 3EEOA 2AR0A 5FHQA 3SX0A 4RVGA 5MHTA 4KIGA 4M37A 2P7IA 3HEMA 3LCUA 5D1HA 1QYRA 5DXAA 4KIFA 5FHRA 2DULA 3EPPA 5EQJB 3UJBA 3G2PA 3HCBA 4PYJA 4IWNA 5CCXA 2C7RA 3GRYA 3OU7A 4ER5A 3O4FA 2O05A 2QYOA 2JH9A 3FPEA 3TM5A 3BWCA 3FUXA 4UOEA 1SQFA 2YVLA 5EEGA 5GOZA 1FJXA 1NBHA 3HCDA 3RIEA 4PNEA 4F86A 5K8VA 3P9KA 5T67A 4RTMA 1RJGA 1F38A 3TFWA 4QVGA 2WA1A 3AWIA 3BZBA 3TKAA 3R6TA 3K6RA 3EMBA 5F2OA 5HZMA 1NW3A 3A26A 1R8XA 3SXJA 3KQQA 4KDRA 5ICGA 4X60A 4GOLD 4KWCA 3REOA 2OPBA 4P7GA 3P9IA 5BW5A 4RTKA 3OZSA 5KQSA 3HVHA 3PVCA 4YUXA 4WVLA 3CCFA 5E9WA 5ICEA 2XYRA 1NV9A 2P3OA 4EK9A 2P7HA 5FCDA 3GNLA 3SR4A 5HIIA 5E1DA 3KR0A 4DM3A 2R3SA 5GIOE 1VBFA 5E9QA 4RTOA 2FPOA 1RJFA 3T7RA 3VC1A 1EIZA 3QV2A 1DUSA 4R05A 2G1PA 4YV1A 5CUQA 1AQIA 3B7PA 4H0NA 5E1MA 3FTCA 4PGGA 5EG5A 2JHPA 1JG1A 3UJCA 1QZZA 3CVOA 4IV8A 3QOWA 4CWAA 2AZTA 2AOTA 1SVUA 2ZIGA 2Z6AA 2IBSA 1NT2A 3JWJA 3A25A 3IYLW 2QM3A 4YUWA 5ICFA 5KS2A 3DR5A 3TRKA 2C7QA 4DKJA 3BKXA 5CIYA 3AJDA 3ANXA 3THRA 1UFKA 3GRVA 5FTWA 4KW7A 5DX8A 2I6GA 1L9KA 1YZHA 1WXWA 3I58A 4EQZA 5FWAA 2ESRA 2E5WA 5EMKA 3DTNA 3IEIA 1I4WA 5CVDA 5G02A 3E8SA 3UA4A 4U7TB 4E30A 5CD1A 2C7PA 3MTEA 1RI3A 4E2WA 2HWKA 2IDKA 3MB5A 2AOXA 5CM2Z 4R6XA 5D1NA 1VLMA 1FPQA 1DL5A 1SQGA 3KPUA 2P8JA 3KKZA 3QOXA 1FBNA 2OO3A 2V74B 2ZZMA 5EOVA 2CMGA 1QAQA 1UIRA 2VS1A 2XBMA 4C03A 1JQEA 4E70A 3UJAA 1XTPA 5LR6A 1QANA 1XJ5A 4XCXA 1I9GA 3NVMB 3P97A 3BWMA 3DUWA 3LGAA 5B1SA 2C7OA 2OB1A 4GOOD 3G5TA 5E8RA 2AN4A 4OA5A 4PONA 3DXXA 5IKMA 5EHGA 4RTJA 3PT9A 4GQBA 1NW6A 4E33A 1X1BA 1X1CA 4CXMA 9MHTA 5K0CA 2PWYA 2G70A 4YV2A 4RTPA 2UYOA 3LBFA 2EJUA 3HVJA 1Q0TA 2B78A 3DMGA 3P2IA 5HFJA 1O54A 1TW3A 3GU3A 3M33A 3O7WA 4BP1A 3ME5A 4YMGA 5KYGA 3BGVA 4XUCA 1ZQ9A 5EPEA 4U7PB 5IH3A 4RTNA 3GO4A 4PYOA 4RTQA 1NBIA 1WY7A 3HNRA 2PWPA 5LQNA 1L3BA 2ZULA 3C3PA 4YMHA 2GLUA 4LECA 4RSRA 1EG2A 3PFHA 5F2NA 4PGHA 1D2HA 2GPYA 4X61A 3OFJA 2R6ZA 3DLIA 1X1DA 3CGGA 2FK8A 1VP3A 4YUYA 3D2LA 5K0FA 1VP9A 1WS6A 1EAMA 2OZVA 4AZTA 5EKXA 3GCZA 1KYZA 2K4MA 2PBFA 1RI1A 3EVGA 5E1OA 5EZQA 1G8AA 1YFLA 3GRUA 1NW7A 3FRIA 2OXTA 1BC5A 4IV0A 2OYRA 2P41A 2AOVA 2BM8A 3BWBA 4O29A 3IHTA 2VP3A 4M7RA 5EHIA 2PY6A 5LQJA 4MWZA 2EJTA 2BR4A 2QRVA 3I64A 2NP6A 4FP9A 2UYQA 5LQKA 2YQZA 2UYCA 4Z2YA 3GIWA 3EGIA 4BLUA 4DCGA 3KPWA 2VZ9A 4KDCA 1H1DA 3G89A 1ZGJA 1OR8A 3CJQA 2Z6QA 1KPHA 2AOTB 2NXCA 3P9NA 3G2MA 5T6BA 3UFBA 3C3YA 4RX1A 2PKWA 5EVJA 2BM9A 5FADA 3FRHA 2JHCA 4XUEA 5GP1A 2XYVA 1KYWA 1PJZA 5FA5A 3VC2A 2PVCA 4QDJA 3KU1A 4ZTBA 1U2ZA 4PYKA 4DA4A 1L3CA 2ZSUA 3FPJA 3LCVB 1AQJA 4AX8A 1MHTA 3UJ7A 5JR3A 1M6EX 5CCBA 2Q41A 2AVNA 2PLWA 3KQYA 3M6VA 5FQNA 5EMMA 2IH4A 5EIWA 1SKMA 3KQTA 4C07A 2FYTA 3G2QA 4FS8A 3R24A 1G8SA 2NXJA 4QQKA 3FYCA 3EVAA 5DWQA 1RI2A 1SUSA 3KPVA 3UJ9A 4HTFA 3KQMA 4Y2HA 4F84A 1WG8A 2YUIA 3A7DA 3HA5A 3UJ6A 1BHJA 2VDWA 10MHA 2NP7A 1YF3A 1YUBA 1XCLA 4ISCA 3BKWA 3HA7A 2WA2A 3G7UA 3GWZA 3WSTA 4YUVA 4PYQA 2N47A 1EJ6A 3NW9A 4M38A 5GWXA 3JWIA 3GRRA 4OBWA 3ERCA 3LX6A 4QPNA 4MIKA 4CTKA 4OX9Y 5EGSA 2OKCA 3KQPA 1WZNA 4CKBA 5GIPE 3C6MA 4LWOA 1O9GA 1RI4A 2AOUB 5FWDA 1KR5A 1NV8A 2QY6A 2PX5A 3RODA 3TR6A 4HG2A 1KP9A 2CL5A 3HTXA 1ORHA 2IIPA 2ZFUA 3SSNA 5K09A 3EMDA 1PRYA 4FSDA 4RTRA 3DMFA 1YFJA 2B25A 3LDUA 1TW2A 5HIKA 1XVAA 3AY0A 2Z6UA 3R3HA 1T43A 1M6YA 3B5IA 1L3IA 3A27A 4KVZA 1VPTA 2BR5A 5K0LA 4DMGA 3B3JA 4IKPA 5LQAA 1BKYA 1R00A 3GDHA 1KIAA 2IPXA 2PXXA 4JXJA 4OBXA 2B2CA 3HCCA 3UBTA 3MGGA 3FPGA 4G56A 4C08A 2IDJA 3KR2A 3L8DA 3UJDA 2ZVJA 4PYNA 2IP2A 3B3FA 3E05A 3V97A 2FCAA 1SUIA 4GC9A 2QRVB 4RTSA 3ER8A 4K6MA 1YB2A 2IH2A 4X63A 1FP1D 4EKGA 3NDIA 3CBGA 4MTLA 4ER0A 2BR3A 4EVIA 2AVDA 2ZZNA 4HH4A 3MCZA 5C0OE 4GUAA 3FUUA 5HILA 2I9KA 4PCAA 1JR4A 3DULA 3FUVA 3LCCA 5CVJA 1B42A 2IBTA 3MERA 1O9HA 4ATNA 5T64A 5DM2A 4A6DA 1N7JA 3KQWA 3T7SA 4OA8A 3ID6C 4RVHA 2F8LA 3C6KA 3F4KA 3HVIA 3BGIA 3P2KA 2JH8A 2GAFA 2HMYB 3BGDA 3EVEA 4PWYA 4Y30A 7MHTA 1JSZA 2OBFA 2O07A 3BT7A 4E32A 3GGDA 2HTEA 2PSSA 3M4XA 3HVKA 1HMYA 2IH5A 3X0DA 4C05A 2GS9A 2ZIEA 4FSXA 3KPJA 4LG1A 2PV0A 4PYIA 2UYHA 2ZBRA 2ZZKA 3E7PA 3LKDA 3R9XB 4HTFB 4NECA 1IM8A 4E31A 2EG5A 1AF7A 2A14A 1G55A 4FT2A 2ZCJA 2PX8A 3Q87B 3FZGA 4HGZA 2EX4A 1ZGAA 2YXEA 4BP3A 5GINE 2P40A 1N7IA 1AV6A 3PS9A 3ELUA 3PFGA 3FPHA 5DX1A 5E9JA 3H2BA 3UWPA 2CKDA 4X1OA 3EGEA 4P7FA 2P3LA 5DM0A 2O0LA 3NMUF 4RV9A 5C1IA 2H00A 3VSEA 1KXZA 3DXZA 2ONZA 1G60A 3M6XA 1X19A 3FYDA 5CVVA 2OB2A 2YTZA 2ZBPA 3TOSA 4B17A 3S68A 2H1RA 3FTFA 2IFTA 2ZW9A 4R8RA 4FZVA 1G6Q1 3DP7A 5DM1A 1R8YA 3THSA 2ZBQA 2G72A 3SSOA 3O31A 4YUZA 4GC5A 3RW9A 2B3TA 2PGXA 3SMQA 2AOWA 3C0KA 4P58A 5DX0A 4ER7A 1XDZA 3ELYA 3KHKA 3LDGA 3PX2A 1R74A 3OE4A 1JG4A 1RJEA 4XUDA 3LECA 3I5UA 5K0EA 4RVFA 3U81A 2QE6A 2IGTA 2FRXA 3M6WA 3PTAA 3OU6A 2GH1A 3FPFA 4GF5A 4M36A 2NYUA 3DXYA 3UA3A 5H02A 5BXYA 5DTMA 4DQ0A 1VQ1A 5DSXA 1N2XA 3B89A 2GB4A 5EMJA 2VDUE 5E1BA 3P8ZA 2PT9A 1QAOA 2I62A 3K0BA 4C04A 2OY0A 1X1AA 3G5LA 5EMLA 1KPGA 4ER3A 4QTUB 3KPYA 2HR1A 2O57A 3KR9A 1BOOA 2YXDA 3FUWA 3LPMA 4POOA 4MHTA 3V8VA 5CVEA 4GBED 4F85A 3SSMA 3SGLA 2FHPA 5EIFA 5FUBA 3UZUA 4FR0A 4HSGA 3FTDA 5DTQA 5DTRA 1IXKA 1XXLA 3JWHA 3I53A 3MCTA 2NNWB 4WXHA 5F2KA 2XVMA 5K01A 5K0JA 3M6UA 2FK7A 5EKUA 3OU2A 3NWBA 4BY9E 4V0QA 1D2CA 3DOUA 1TPYA 1YZ3A 5DRTA 5GM1A 5LQCA 5LQRA 3G88A 1M0EA 1QAMA 1XDUA 3NWEA 3GJYA 5EC8A 5E2BA 2ZWAA 4GEKA 4QDKA 1Z3CA 3E23A 3TKYA 2AN5A 4DZRA 5KQRA 1IY9A 2PX4A 1VL5A 1Q0SA 3EVCA 5K03A 3P71T 3G8AA 4CKEA 4PYLA 5EEHA 3OFKA 4GOMD 2G71A 5E8JA 3IV6A 1ZKDA 5ICCA 5U4XA 4DF3A 2JHAA 3GRZA 4C06A 3FUTA 3A7EA 3HA3A 2BZGA 3UJ8A 2PXCA 5K0NA 3HCEA 4A6EA 1UWVA 1G38A 1RJDA 1P91A 2YX1A 3LSTA 2JG3A 2DPMA 2NXNA 1NW5A 2I7CA 4L7VA 1EJ0A 4CKCA 3PLAE 3HM2A 1NE2A 5JUWA 5HEKA 1JTFA 5CVUA 1F3LA 2ADMA 3CJTA 3P2EA 1I1NA 2KW5A 2XVAA 1ZG3A 5DRYA 4P7KA 2ZIFA 3SM3A 3TQSA 1XCJA 3EEYA 5BP7A 4PINA 2Y1WA 3LL7A 2G8NA 5DPMA 3TMAA 1SG9A 4ER6A 3GXOA 3TPZA 4RWZA 2H11A 1XDSA 3LBYA 1JQ3A 3ER9A 5BW4A 1EQAA 4E2YA 5DSTA 2NXEA 2Y1XA 3EVBA 4AZVA 5LSAA 3PX3A 4PCLA 3TM4A 5K0BA 4AZWA 3BUSA 1ORIA 5M5BA 1JTEA 5ERGB 4OQEA 2PJDA 3KQVA 5FQOA 1V39A 5KVAA 4E2ZA 2ZLBA 5EZSA 4YV0A 3P9CA 2ZTHA 3LHDA 3SVZA 1KHHA 5DXJA 3PB3A 4CTJA 1R6AA 1VIDA 1NKVA 2HNKA 4P7JA 1HNNA 3NJRA 2P1DA 3AXSA 4QPPA 4QQNA 4QVKA 2AS0A 3ELDA 3HP7A 5GM2A 3CC8A 3T0IA 3EVFA 3NVKI 5P8WA 2PT6A 3MHTA 3KR1A 4BLWA 5K0GA 1ZHFA 3LKZA 3OPNA 2WK1A 5DT2A 5C9ZA 3KQSA 2ONYA 3CKKA 3MAGA 8MHTA 3ORHA 2HV9A 1INLA 4RTLA 1P1CA 4PYMA 3OZRA 4DCMA 4E2XA 5LQUA 2V7EA 1NW8A 3OCJA 3EVZA 2AOUA 3T7TA 3BWYA 3OE5A 4AZSA 1Y8CA 3MQ2A 2LD4A 4HC4A 2CMHA 3ELWA 3TLJA 3DLCA 2AN3A 3G2OA 3A4TA 3NDJA 5E2AA 3MTIA 4V0RA 3B3GA 2O06A 2B9EA
chains in the Genus database with same CATH superfamily
4D0LB 1Q1NA 1Z7EA 1N0IA 4EJSC 4C4AA 4QTTB 1CR1A 1GIAA 5BV2P 1M33A 1GAWA 1GPMA 2B9VA 2R85A 3WLKX 5HQTA 2C5AA 4YDSA 4XRGA 1RI5A 3N8IA 4JP5A 4L74A 1G18A 1UWLA 4H0CA 4YONB 5IH7A 2IW1A 3ND7A 5CM9C 4Y3UA 2K2QB 2YR0A 5AK4A 2AC2A 2LIVA 4U02A 3K6SA 1SAYA 1WBBA 3DGEC 1P33A 4NHOA 4Y6GB 5TRTA 1JHPA 3IV9A 3U0VA 3UJPA 3ASZA 3CLRD 4BEJA 1LRKA 3M3HA 1IC6A 1AM4D 2CYBA 3LLSA 4GVPA 4GBJA 2J3JA 2ZK7A 5B4TA 3EWNA 2AK2A 4R6WA 1FP2A 2ZUCA 3WQSB 1R9GA 1Z4QA 5I9LA 4QOEA 3IDOA 4ZOEA 4BC0A 4TRNA 1QFJA 3PQ4A 2CVPA 4MO2A 2ZUVA 1V47A 4WLNA 3BE8A 3FSGA 3I2IA 2R44A 1JA0A 2A7QA 2BFWA 2TYSB 3QXCA 1NYQA 3DZJA 3QU4A 1ESDA 4HLUA 1D4ZA 4ON9A 1VE5A 4HCJA 3OBIA 4BVJA 3Q6IA 4RV5A 1ZGGA 3FW1A 3ITNA 4LXHA 2FG6C 2PX0A 2QR5A 1KAQA 2BFNA 2WICA 5DNEA 4U63A 3V4PB 3MCVA 5LWQA 1VKJA 3M4ZA 1ZIPA 1CZLA 2FFJA 1NBHA 3JSAA 1K6JA 3FLEA 5DBOA 3CNLA 721PA 2A5LA 4AZ0B 1EP2B 2V5AA 3RRXA 1SEVA 5B53A 1F3OA 1MV5A 2G0NA 1SCQA 2RBKA 1UMBA 1BS9A 4XZ3A 3OY2A 2XJ9A 2FCRA 3AR4A 1KVTA 2HA2A 2UU9B 3IEPA 4AWXA 4JP1A 2BKLA 2ZDGA 3UK6A 5KQSA 1NRIA 4TL9A 3DLPX 3R09A 2QV7A 4CFZA 3AHIA 5C37A 5LMZA 5IM5A 1XZLA 1E0AA 3DCYA 3R0IA 3WYDA 5GIOE 2BFPA 4BQIA 2CLMB 3DR3A 2M9MA 2CLHB 2FWMX 4NMWA 2D62A 5FBHA 5C3MA 3I1YA 4HBGA 4B75A 2E82A 4YWHA 4H0NA 3W2TA 4FN5A 4ZOCA 5AXBA 2A9KA 3ORYA 4OI0A 1JG1A 1L7DA 2GJ8A 2Z4TA 3BTUA 4P84A 4Y9TA 3UJCA 3RVMA 3H9JA 4BECA 3R3ZA 5DH9A 2GBLC 3JWJA 1DO8A 1JDTA 2EDCA 2OESA 4GR9A 4P54A 5DCUA 1B6SA 4YI3A 4CMKA 1NG1A 4ZCPA 2C7QA 1SRRA 2ODNA 3L7OA 4RXMA 4W1QA 3L8ZA 5FTLA 2XD9A 4LA4A 2PSFA 5CVTA 4UE6A 3PUXA 2QTAA 1MJNA 5CX1B 4JJ4A 1A5AB 1VG8A 1YZHA 3DTVD 3INTA 3C3EA 4PLGA 2XV1A 1EVZA 5HR5A 2GHRA 1X86B 3MTEA 4WKOA 4ZT5A 1O97D 3G5AA 3IUNA 3BJEA 3E5HA 3DDNA 2IKSA 3LRTA 3P0IA 1ZVVA 5KTKA 3DTVB 1G8KA 4UPEA 1BWPA 3FVVA 4TXJA 3SC2B 2GASA 5I4IA 2GYUA 2B0CA 4C03A 2R1UA 2VKQA 2WYUA 3H4TA 4I4IA 1X1QA 4MS3A 4TMZA 2PDAA 4XR9A 2XGSA 4YJGA 3R5KA 3TUIC 3QPAA 1Y6GA 2ZRMA 3NVMB 1NM5C 4HWRA 1HO3A 4HNSA 1G3IA 2Q7OE 4K46A 3F7TA 1CDOA 4J0EA 4RCVA 1W76A 1OF1A 2W37A 2FP3A 1P18A 1XZDA 2I67A 3QFCA 4WZZA 4X1YB 4X8LA 3RYHA 3SIPA 4AG3A 4RTJA 4EABA 2XCIA 1AKNA 3D9QX 9MHTA 1ODTC 4XDGA 4FVTA 2GETA 5IG2A 2EKQA 1RM3A 1WMSA 4S0XA 3P26A 4KFTA 4MCAA 1F8GA 4F38A 4LHVA 8ADHA 4OLJA 3ZEAA 3ORQA 2FGJA 4Z4CA 3LTNC 5I7UA 2JW5A 1NP7A 2WRZA 5FPYA 1VRVA 3AUFA 4KXWA 1D2AA 4P83A 4HKTA 1EG2A 5IRCD 2JIRA 2W11A 5F3RA 2UXDB 2A0WA 4GE3A 4U7FA 4WD3A 1P74A 4RADA 3PKZA 4NICA 3DLIA 1AF4A 1J5PA 4YUYA 2HCBA 5GZ3A 2BGRA 2HJVA 3BREA 2C59A 4ZHQF 4QQFA 3TSYA 1BNCA 5GGYA 2GFIA 3BBLA 3BWEA 2JGJA 2I55A 2W6QA 3O9VA 5IJXA 3UKJA 5LD2C 1R5BA 5JDCA 1GPH1 2FEOA 2J41A 1DARA 2Y1OA 4N7BA 4C5AA 2I8AA 4ZYVA 3FYHA 1WDKA 3NG1A 3U44A 3L5OA 2PUGA 1IB6A 3AP2A 4TXMA 1Y9JA 4B3MB 2WJPA 3PG5A 2CSXA 4Q1FA 1E2UA 2VJNA 3DQPA 2RCYA 2IYNA 2ZUDA 3EC7A 1ABEA 3HZHA 3U31A 1U1DA 4KUHA 5DGIA 2YJGA 5ULLA 5JZMA 1OR8A 3MOGA 3G2MA 1IN1A 4RGQA 2GSWA 2VNKA 2B30A 4W9NA 4QJBA 4PSDA 4J9VA 2EGUA 1X3LA 3DVQX 1E9BA 2AL7A 1GNSA 3ESQA 1HSOA 4YREA 3AIOA 1PO7A 4BVBA 4E5SA 5IULC 1BWQA 1K63A 1TD1A 2DH5A 1M1NA 2J9ZB 2VYQA 3OM8A 4GI1A 1VJTA 4QX6A 4AX8A 4F3RA 3EXIB 4NV3A 2CJWB 4BMOB 1MEOA 3WMFA 3FRJA 3NONA 2XB9A 2IH4A 5EIWA 4YRIA 2YJNA 3WYAA 3ND6A 4L8GA 4M7WA 2OMEA 3EVAA 3IBFA 4ZO8A 2VNJA 2QAJA 2ZAGA 8GPBA 3FOEC 5AW1A 2OV4A 2OBLA 3A2NA 4IDOA 3I0NA 1UDAA 1YASA 3LKVA 4HBZA 2IEAA 3HA5A 4DA6A 2MJLA 3QE9Y 4WXRA 4ZARA 1Z5UA 2IQ5A 4PZCA 4BO7A 3ZWOA 4RY8A 4UUPA 1NRWA 4DTIA 3ZDYB 4CF3A 4YMVA 4X1IA 1IQRA 4HDKB 4I6EA 1FYFA 1M2WA 1JLLB 3ESYA 2Q50A 2YZGA 3PGJA 5B58C 1Y81A 4ZMRA 5AW0A 3DA8A 4OBWA 4MR9A 4HLQB 3F67A 1MOPA 4YRFA 1C3OA 2GR9A 4KRYA 1EX6A 1WXHA 4HUQB 4XB2A 2GFHA 4BFZA 2I2DA 4EW3A 5BY2A 1OFVA 4Q19A 1X8JA 2XX3A 1TNDA 3CRW1 3O8BA 4AXXA 3OAAD 1TUBB 3GJZA 4CKBA 3DZHA 5FWDA 2V1UA 1S8NA 3TR6A 4JYCA 3W34A 3A6FA 1HNWB 3PNVA 4WSOA 5TVGA 2KJQA 1NHWA 3ZY2A 4JUFA 4P98A 2DR3A 4D8YA 3DMFA 4FB4A 3FKQA 5COBA 3T94A 3ZH9B 2LTAA 4UASA 1SD5A 4KV9A 5K3FA 2QQEA 1H4TA 3A4YA 5J1TB 3RUAA 3V1MA 3CF4G 3ZGOA 1EVIA 4Z1MD 4ZA2A 1KZ9A 3ZLJA 1XDGA 1Y6ZA 3AVQA 4OB8A 2I4TA 3BSFA 3HABA 2X1LA 2CB0A 2X9VA 1FFXA 3O8OB 5K0LA 1UKVY 1RP7A 1K92A 2QN9A 3GV0A 1Z37A 4KQKA 1VCIA 4ZO4A 1Y1SA 3PXAA 2QQGA 1T9GR 3JQ9C 4IZ6A 5HRUA 2WIGA 4AJ1A 3MCWA 1XXHE 4RHYA 1Q5PA 2PNFA 3A1TA 3KR2A 4I6GA 4WESB 1FSPA 1GU0A 4M21A 1ESMA 2I4LA 3U1VA 4KPUA 1G0NA 3F4BA 2WHRA 2EU8A 3L0IB 4GVXA 3ER8A 1ZA2A 2AIRA 2FVXA 2YCLA 4B7UA 1I13A 1TXGA 1XK7A 5A6SB 2QAGC 3IELA 1YT5A 3IXQA 5EP4A 4ZICA 2XBUA 3NP9A 5EGNA 3QWIA 4QG7A 2WNHA 1K2WA 1B42A 1Z8HA 3X2EA 2XVXA 1XNRB 5T64A 2NSYA 3A2MA 1VB3A 4N49A 4Q9DA 3EARA 4DC9A 4UZEA 3K0AB 5CT8A 2ZE6A 1C9YA 3C6KA 1M6HA 1D4AA 2Q3BA 3RIHA 3JS5A 5DBHX 3EVEA 5IZ4A 1XU9A 1V9LA 1KZ1A 3TZ6A 1C9KA 5L45A 3H8WA 1U2TA 2GUGA 3QW2A 4GMGA 3GGPA 1HMYA 2P67A 5KBYA 4PZLA 4BXOB 3IAM1 3CMCO 2P77A 1FTSA 3NEAA 5D3KA 4B6QA 3SAJA 4RMJA 4DQDA 5HGXA 2BGJA 2J3KA 3KJNA 4HR7A 3I5YA 4V0KA 3WO1A 1XG5A 3RSHA 3LZCA 2B5OA 3CQ9A 3WGHA 5LQDA 1HURA 1Z5VA 5KQLA 3BJZA 1R4MA 2PTHA 2RH8A 2P3LA 4LY3A 3CN9A 3BG5A 2W8BA 4ZVKA 4EA6A 3SNHA 2RARA 3PGXA 3EZ2A 4EVIA 4YPFA 4OHZA 1W4RA 2BI4A 1AQUA 1KAEA 1ZK1A 3TX6A 5IKPA 1PAUA 5HZGA 5ECGC 2FPGA 4EI9A 1P1HA 2AJLI 1HUQA 5DM1A 5BN3B 3SSOA 1HYBA 3SFTA 1TMKA 2CMKA 4QTYA 2ZUEA 1H2EA 3GUYA 2BONA 3QY9A 1IPEA 2VF7A 1PZGA 4G0XA 3DV2A 1YZYA 2MHCA 2Q3CA 1U0FA 2PYDA 4KUGA 1MR3F 5TMPA 3FGZA 4GMHA 3PTAA 3EMKA 2GH1A 3IAHA 3OU6A 4ZVNA 3QLUA 3RHZA 3WBJA 2JASA 1QPGA 4I4TB 2ZE8A 1DO2A 4N0EA 2V6IA 2H29A 2VH2A 2JBWA 2FR1A 2R7MA 4OFXA 2AJBA 4KQHA 4L16A 4ER3A 2IYYA 3RSFA 1XF1A 3PUIA 5KYTA 2OORA 1FYDA 1BOOA 2AG1A 2G5GX 3HKEB 3PXDA 2XIJA 1YS1X 4QXOA 3PDIB 1JHRA 3JY6A 2YDXA 4QUHA 4WI1A 3W90A 1RRCA 2OYCA 1AUPA 3GELA 1E1KA 3CRVA 3AUJB 1EUDB 4HDNB 1YMUA 2PRKA 3D6NB 4WCDA 3IHWA 5FL3A 2C2ZA 4HH3C 2BBSA 5A4FS 4NTZA 1Y3CE 2X3YA 4D74A 2X5OA 5AHOA 1PJBA 1KYTA 4KAFA 4JJEA 3H8SA 4OP2A 3MT8A 4QFMA 3OMWA 4QT4A 3HI6A 4KE7A 2AEFA 2EJBA 2J46A 2R6GA 1QM5A 1Z7WA 2PO7A 2W7TA 4UNRA 2V1XA 3TSZA 1IY9A 1GY8A 2AX4A 2R65A 3UFXA 3CX6A 4YRNA 4JLKA 3WLFA 2J9FB 3JVVA 1Q7CA 1MFZA 4URZR 3ZHVA 2O8EB 5EEHA 3OQ1A 2O0JA 3ZBUA 4Q3CA 5E8JA 3HV2A 4BNDA 1GVNB 2EIXA 4WLOA 1J9EA 2Q1UA 1QG4A 3EUEA 2W9XA 3IT0A 3O93A 3GL9A 4O33A 5B12A 1MJGM 1M76A 4C3VA 4DF3A 5BW8A 1Y1TA 2EKLA 2XOKD 3FUTA 3IA7A 1E20A 4E5MA 4MAFA 4KXLA 1QQ7A 2IYVA 2QTCA 3UJ8A 4BTEA 3BGWA 1UWVA 2C5SA 1YS2X 2YL2A 2J30A 2IEDA 2V7PA 1N2JA 2QVYX 1XLVA 2AFHE 2I7CA 2X1VA 2JJ2D 3LT0A 1O5OA 4HGQA 4U6QA 5HG0A 3FD8A 1QP4A 4ABYA 2HAEA 3FYUB 4MW7A 2I2CA 2V65A 5T8KC 4FFSA 3HKCA 5CVUA 4DABA 4EG3A 1QFXA 2A58A 4CL8A 3J7TA 1U0NA 3IAUA 2OL4A 1TTTA 1CQPA 2ONKA 2IOYA 4HH0A 5KC8A 2Y1WA 4FI3C 3FCXA 4Y2TA 4BKQA 3U16A 4CEJB 2OBMA 3D6VA 3EDOA 3DO5A 2O8DA 1GPJA 3LPCA 4QASA 2BEUA 2ZEJA 1QU3A 3L0DA 1QOPB 1EQAA 1TFRA 3QVWA 2OAP1 5AM4A 4EG0A 3R5XA 2ZB4A 3GA0A 5FUWA 2X4LA 2BEVA 3RC3A 4C7BA 4BCDA 1KSJA 4LIPD 3E0XA 2QMUA 4O4JA 1ACMA 121PA 2JVJA 2FWIA 3L1VA 1F2UB 5ERGB 1PQPA 4YPOA 4KNYA 4S2EA 2IZ0A 5EHQA 2P9YA 4FHGA 4L9WA 5EZSA 4BFYA 1QRSA 3AL0C 3KAKA 1EWTA 3JXEA 1KZ6A 2IGBA 2O3RA 1CCWA 2EZ8A 5ALJA 4DAOA 2WW8A 3FOCA 4K9QA 1MIHA 4NCNA 2PNJA 3N6RA 3HXMA 1USKA 2YIMA 4R1OA 3GJQA 4EHAA 2J08A 1S6YA 5G1PA 3PIIA 1JZQA 1G21A 1DBVO 1XHEA 2VSOA 4WADA 3QFSA 3IH5A 3D8RA 3OZRA 5FBQB 4DCMA 5JWHA 5EZYA 4L73A 4XQCA 4N0MA 3ZVLA 2KQUA 5HK8A 5UKDA 2HF9A 4ITUA 4FW8A 1EFVB 1HFWA 1UBTS 2JEZA 3FNRA 4E07A 1Z4KA 3IKJA 3NDJA 4AO7A 1Z0IA 5CLFA 5JSQA 1U6IA 1ZHHA 2B9EA 5A3SA 2P3QA 4JDUA 4KODA 2QR3A 1ONNA 5G0TA 2AZ4A 3RSZA 5JS2A 2QUIA 4F2WA 4TUYF 2GLTA 2P0AA 5M34A 1BDIA 5CITA 5INTA 4NXNB 2V0NA 1J56A 1FRFS 2NYAA 2NMVA 3L92A 3NTLA 4PLWA 3L7MA 5CDGA 3FH0A 5JV5A 1IYZA 3OT5A 1H6DA 2CMDA 3K05A 3NORA 4KPGA 1WP4A 3QITA 4NC9A 2QS9A 3NIWA 1UPTA 4XGNA 2QN3A 3BQNB 1QH1B 3GB9A 3HCAA 4B7CA 4PM4A 3KKMA 4ZYTA 3VZBA 4EH1A 1ZR4A 2GAJA 3TAUA 2YYAA 5CA0F 1FYEA 2O1WA 1S4MA 2AR7A 2YY5A 2ZE5A 5EUMA 5CLJA 5IKXA 2GKSA 1W36C 4N41A 2OCAA 1O5IA 1PR9A 3TLAA 5IEBA 5JI2E 3MT9A 2EKDA 4WGGA 1SUEA 4GZ5A 5KHLB 1W2GA 4D4HA 5JAZA 2UAGA 3RC8A 1XD9A 1N1EA 3MNFA 4FFDA 5HF5A 4BKUA 3ACBA 2ZG6A 5FEMA 4QBIA 2MSEB 3QVGB 5HOQA 5L51A 1Z4JA 5FHQA 2D5CA 4C76A 5AVVA 2ZTLA 3QXSA 1WUTA 2WBLC 1G8YA 1U4SA 1MA3A 3U80A 2DULA 2QTGA 2XWPA 1KO4A 1L4HA 3EOBI 4W6QA 2I6QA 2YOHA 5AJWA 4JUBA 2BL4A 2OAQ1 2N1BA 2JRCA 3QP9A 3TD9A 3PDHA 5M29A 3RWBA 2H18A 2V55B 3KSMA 2WABA 3D2BA 1C0LA 3BN3A 1R9NA 5LYJB 1PEAA 1NUTA 2PIDA 4RTMA 3UOGA 3L6RA 2V03A 1JTVA 3K5HA 3LA8A 2H9YA 5KCMA 5LKAA 1G8PA 2QOEA 2EW1A 3BZWA 3R6TA 3SD7A 2R5FA 1T26A 1JE0A 1OFTA 4LJ4A 3WQBA 4CIAA 2P65A 4WNIA 4HVCA 2XZOA 2PUFA 2VT6A 3G0HA 3CXRA 2HLDA 2BCJQ 2CK3A 2DKNA 1GNLA 2O0MA 2VUIB 1DX6A 3E9YA 4OP1A 2QPTA 5BYJA 2OV6A 3WDLA 1RRMA 1NFQA 4TZ6A 1G66A 1JJVA 4A0HA 2ECKA 1XKTA 3WMEA 1KBZA 1MHPA 3LCMA 3RGWS 1T3LA 3TGWA 1AZSC 1USIA 4YP0A 2R8OA 4KPFC 3O9ZA 3VNUA 4DMKA 3SBEA 1UOOA 1YA4A 1PSZA 2VBIA 3AHEA 3MPOA 3KXKA 4RTOA 1Z25A 5GPBA 4G0VA 3I9OA 5KU7A 4ZAZA 1NBAA 2A9OA 1TM7E 5CUQA 1Z18A 4UW9A 1EFPB 4JEUA 4DCCA 1WSBA 3GT0A 4OHFA 1KEPA 2BP7B 1DOAA 5KTSA 3ZLTA 1KMMA 1A9OA 4S05A 2A88A 3QUCA 4Q1BA 1WXIA 3K71B 5BQFA 1T9BA 3CLSD 4KW7A 2BMAA 1MV8A 2RGDA 3C1OA 3JQBC 1DWQA 1CVIA 4C0WA 4RQUA 3RI3A 5FWAA 5G02A 2FZKA 1Y33E 3UA4A 4XYMA 3IDFA 2PD3A 3WQHA 1QXSA 3V46A 2AI2A 2Y1DA 1GPWB 3UWSA 1H0KA 4GM0A 1OA0A 5IUNC 4UDXX 2XW6A 5CM2Z 1SHUX 4I3FA 1DL5A 4X95A 4A2QA 1YVPA 1GAXA 1DB3A 4CM4A 2FEAA 3QOFA 5ALHA 4X93A 3FXAA 3NETA 1GGNA 3LW7A 5TEWA 3QX7A 1QDEA 3B1WA 4RS3A 1GTJ1 4XCXA 4Y2SA 3SC3A 3KIPA 3P97A 3BWMA 5C2JB 2C96A 2WTNA 4AIRA 2I80A 3LE8A 2D1TA 1Y5MA 2KBEA 1AHIA 5K2MA 1WQ1R 3NUGA 3SDZA 1CNFA 1M9NA 4UNPA 4U7GA 4FZ3A 2ET6A 4HEA6 4HGOA 4MLDA 4GU5A 5K0CA 4Q3AA 2WZCA 5EJ5A 3ZKAA 5B6JA 5K6RA 1WCIB 4F7WA 1Q0TA 3KNZA 4KDEA 1E8MA 5HFJA 1P2VA 1MC5A 1EFTA 1OC4A 1R6DA 1SPXA 1ORRA 3IE1A 1BFDA 3VAZA 1P1FA 2RH5A 1PJAA 5EUCA 1UXGA 4RMHA 1PWXA 1ZSVA 4GXTA 3QU7A 4H1VA 1VYHA 2A8YA 3HNRA 1CQIA 2H17A 2IXEA 3RKSA 5H83A 3WGOA 2PUHA 4F5EA 3GROA 3KL4A 4DMUB 3UG6A 1D2HA 3ICPA 4N5IX 1SHKA 2VUUA 3PHJA 4MJLA 1QV6A 4LTNA 4NARA 5AM1A 1VB5A 4YRLA 1OI3A 2JJ8A 5K0FA 3HM9A 4WK2B 3OQNA 1JR2A 4U0KA 1N78A 4EMTA 2PBFA 2JCBA 3EVGA 3OSUA 4H3HB 4QLOA 4HFMA 4BVFA 1O6GA 3B82A 3GRUA 4HD8A 4I4LA 1RT9A 3R5HA 1DC3A 4I7EA 3SEQA 5DYGA 2WAXA 2QVXX 2AWNA 3BWBA 3GLFB 4B84A 2DLCX 4CDGA 1UBNA 2WT8A 3QUSA 1AJEA 1CDDA 2ZRAA 1NUAA 3EXHA 4DCGA 3KPWA 1EGAA 3FCCA 2WHYA 4WW0A 3OM1A 2PM8A 3ROQA 3AB3A 1PZMA 1GADO 3AKCA 2A0FA 5IW8A 1NUQA 4HVAA 5TMDA 1B0AA 2IE8A 1Z45A 2B3DA 1U3UA 1YWGO 2A84A 2ZYSA 3AEXA 3CHYA 5ER6A 2IU0A 5JYBA 2EW8A 4ILEA 1MQAA 5GP1A 2RK4A 4UAJA 3TEFA 1W36D 3OUTA 5EWMA 4P92A 3KU1A 1U2ZA 4KMRA 3IRUA 5IXJA 2Y93A 3M6FA 3ZCUA 2ZANA 1C9NA 3CSSA 1M6EX 3DMPA 2ZI6A 2BM1A 2AG5A 2GRJA 3MTAA 3O47A 3PT5A 4UVHA 4AMUA 4XJTA 2ZB8A 2VZLA 3LGXA 1E92A 1MDBA 2ATIA 2EGHA 2FYTA 1YFZA 2Q5OA 3DZCA 3R24A 3VISA 3PR3A 4YUZA 1EUQA 4JB0A 2ACEA 3NXSA 1MH1A 1W25A 2JD1A 4F4IA 1IBSA 2VDOB 3IOEA 1CUSA 3I9JA 1EGQA 2JFVA 4BZQA 3W7VA 3SU8A 5JFGA 3C5HA 3VR4A 3VVMA 4B83A 1N32B 4ZDIA 1REQA 2F9MA 3D64A 4R5HA 1EEHA 3U3RA 4DR2B 2H08A 2O50A 3FPSA 1XOIA 3KBBA 1P1KA 4R1NA 5CJ2A 4AI6A 3PVZA 3E3AA 3F96A 2KI5A 4MMYB 4NYIR 1T2CA 2C8KA 1N5IA 1YI8A 2OXCA 3LX6A 1M6WA 3GEDA 4PC1A 4CTKA 4CKYA 1KOJA 3WAGA 5EGSA 3K0FA 2REQA 3QJYA 2OHVA 3EASA 4JLPA 1PS9A 4EYGA 3MWKA 4ZV9A 4JR0A 1KR5A 3B13B 2QY6A 1U0BB 3N75A 1HSZA 2RONA 4ACBA 4EJSA 5ED4A 2OE2A 1QH0A 5EE0A 2QWXA 3EMDA 1OBFO 1Y89A 3WOHA 3ROPA 1YFJA 3LLUA 1E2GA 1AZTA 3B53X 3DOCA 2CV0A 1BAPA 2QBYA 1CUAA 2XE7A 4ENVA 1JB9A 2JNWA 2OBBA 1C9DB 4R98A 2IUYA 4TRJA 4XM2A 5BSTA 3IJPA 1KZ7B 3HLTA 4TMWA 4HAUA 3PEYA 2IS6A 4LN1A 2XCUA 3KFXA 4MUKA 1OV6A 1G1MA 2WAMA 4R7ZA 5C1DA 3OSZA 3BB1A 4IY1A 1IHXA 4J6EA 4MWTA 4YUAA 3MGGA 3U6BA 1Q1QA 1G9XA 3AUTA 3F6YA 3ZK8A 4EBFA 1CT9A 3EZGA 1HR0B 1QU2A 1C1DB 3SYMA 4ND7A 5IDYA 1B76A 4NKRA 5BNIA 2A57A 4D25A 4GC9A 2HFKA 1ES9A 4Y7CA 3DJFA 4D41A 3AUAA 4MTLA 3NT2A 1DU4A 2ZYGA 3CNHA 4B32A 4LGCA 1L5GB 4INPA 4F3YA 5ILQA 1O6CA 1USWA 1XZEA 4LXUA 4ATNA 3OOJA 4MVWA 2ZKLA 4UHHA 4WN9A 1AKVA 2CYCA 1BMTA 2QYTA 3P94A 4L08A 3NHKA 3T4UA 1B3BA 2WLSA 3ID6C 1E3LA 1H9AA 4Z8YA 2VHEA 4Y6OA 3F4KA 1O0SA 5A7FA 4MQ5A 1XTTA 1E0SA 1HE1C 1N1DA 4Z54A 4MB6A 1FDOA 3DBVO 3BFPA 3IX7A 4J03A 4WX2B 1J0XO 3JD4A 4P4NA 5CBPB 2CXTA 1V9SA 2OBFA 3JVEA 5F9FA 2ZETA 1U2DC 4LJKA 2NM0A 1CUXA 5DKFA 4Q4JA 3HVRA 1RAHA 2H4YA 1H22A 2J5RA 2M1ZA 3IBTA 2IH5A 4OSOA 3FX2A 3OO0A 5U9CA 4FOTA 1MG0A 4HS9A 3UXYA 1SK8A 2VTKA 3H4VA 4IS2A 4NBTA 4BQEA 2MU1A 3ZE6A 2CFCA 2Z1MA 3HUFA 1J5EB 2Q6TA 1VI2A 3S1AA 2PMBA 4BP3A 2EX4A 3FDXA 1NXPA 1N7IA 4MVCA 4WV3A 2WWVD 4FMDF 2EJCA 2H1LA 4GP7A 4ZGBA 3GH3A 4AKGA 4M1OA 4X1OA 4BVHA 4AX4A 3ND9A 4CF6A 4CFYA 4FQ8A 2ZI9A 3CR3C 3ZR4B 4WZAA 4IJ5A 3ZXXA 5K6AA 2XB2A 4MV7A 1PSDA 1E2IA 1G60A 3PCRB 4H15A 4WNAB 2OB2A 1U4OA 2YTZA 2A30A 1L5KA 1CS0A 4DB4A 5AW8A 1VBMA 4R8RA 2GBLA 1QOQB 4KQCA 2J6CA 3B2NA 4AJHA 3ZK7A 1BJKA 4DDHA 5AVTA 1DTSA 2ZBQA 3E35A 3OMLA 4M53A 1XL1A 2GXUA 1L5HB 1L7XA 1BTOA 3ZV7A 5LKRA 3C0KA 5DDIP 1ZINA 4XB6B 4MIOA 1DAMA 4A5OA 4UXIA 2CJPA 4MRMA 3IB6A 5JTUA 1P4GA 2G9ZA 2PR7A 3U81A 4HTAA 4BIIA 1WOMA 4KK4A 2W4QA 4MI3A 4TM7A 4DMFA 5HE8A 4JXZA 4IO0A 4WKCA 3E70C 3FMIA 1U8TA 4JWTA 4WXEA 4XCQA 4Q9JA 4C87A 2X5NA 1NDUA 3EDYA 3MEQA 4PAWA 3MMNA 3TRJA 2FMTA 1VFNA 1BE0A 1S3GA 2IC5A 4I1VA 4OXQA 4U1RA 1ZH8A 2RG1A 5EJ7A 4LRTB 1SBZA 5BWBA 4C7OB 3NHJA 1XA0A 3HFGA 1GNPA 2DQYA 3O2NA 4OHKA 1QIFA 4RIFA 4EY7A 2O57A 2B4QA 1I9CA 2B7LA 3RRJA 2VRBA 2J0SA 1FFWA 3R7LA 5JQGF 1TCCA 1O96B 4RA6B 3DMYA 2PH7A 5DULA 3AYZB 5KSPA 3RROA 5BQ3A 1E3WA 3N2GB 1U0EA 3B3AA 1U0GA 3QUQA 3R6DA 2WU8A 4GFDA 2LRHA 1W19A 1PFVA 3B9BA 2I1LA 4UCQA 2Z2JA 2ZJ7A 4U2KA 4EM6A 3V7NA 2VXBA 3MMZA 3R76A 3WP0A 1YSCA 4F3NA 2VK8A 3DG9A 5AICA 1YOVB 2BGUA 3MRVA 3OU2A 5I9MA 3RVDA 5LQCA 4RWEA 2RHCA 3R5TA 2CVHA 1SHJA 3I01A 4CIDA 1PZFA 1QAMA 1FNNA 3GFTA 4MXDA 3U09A 1P4HA 2FPPA 3N5CA 2QT9A 2EKZA 3GMSA 2JIPA 4KIWA 2IYUA 2GF0A 4RPGA 5HNKA 2OLKA 1UBUS 1DG9A 3OFKA 3DE2X 4WWHA 1AMUA 2SICE 4ZHQB 3RU7A 2W2PA 1Q6ZA 2EKPA 1RKUA 3RJ9A 3HEAA 4M8SA 4NVRA 3ZDEA 4LZJA 4M9XA 4WZBA 3HA3A 2CJXA 4GZ3A 2A4KA 2EQBA 4GZ6A 4A6EA 2Z2XA 3HCEA 4DC1A 1BEEA 2WHQA 4GPAA 3NDBB 2QL5A 1NI5A 1EJ2A 4XSHA 3A6DA 4BE4A 3BQMB 5ICMA 5A2GA 1EUCB 3MWEB 4N8SA 1R4NB 5FI5A 5B2FA 4B76A 2H1SA 2QM7A 1T2UA 1ANKA 1T6XA 3H83A 4E7OA 1EDOA 1W6RA 2A1TR 4B2IA 2RAFA 3RVOA 4I5IA 4IRXA 2P6UA 3GDGA 4TTJA 4HUTA 3N7AA 5GJWC 4YXFA 4MPDA 4G07A 1IBLB 1FFDA 3RGGA 4JLVA 2QLBA 4R4JA 2PD4A 3ZVKA 3MSCA 3WZMA 1OU0A 2C2YA 2IYWA 3FSRA 1BROA 3FFBA 1FYWA 3U4IA 4C7VA 1C2TA 3H5WA 1KRHA 5EJFA 4A2PA 1H2AS 4U3JA 4KXXA 1U2PA 4DDUA 3Q72A 3B48A 5JEDA 2AF4C 2OCKA 3JYPA 2HWUA 1VJ5A 1QQ6A 2CNKA 4DDVA 4F6LA 3PC3A 2BJVA 4BNYA 3AP1A 3Q5DA 2J67A 3VU0A 2OV3A 2IOQA 1E2JA 1EVQA 3ILHA 3V2HA 1V37A 4AJ9A 4J3JA 5K4AA 1CK4A 1LTHR 3C15C 3QTBA 4MA5A 4G1UC 1TZJA 2GXSA 4OJQA 4EW2A 3YASA 1GO2A 3E8MA 5HKOA 5JH7A 2I3GA 2X9NA 4HDRA 1K8XB 1HNNA 1PR5A 2AR9A 3VSCA 1E3TA 3L1UA 3B7GA 3QPWA 4H6PA 1PTJC 1RCFA 3NHLA 4FZJA 1KY4A 4CMBA 1RIFA 2WUEA 4IKOA 5KINB 4UTVA 4MLPA 4YCNA 1P1CA 4PYMA 2PA0A 3IDAA 4IHJA 3ZZUA 1Z5PA 4AK9A 1I7LA 4QT0A 1LCIA 3HHPA 1NW8A 1NU8A 5CP8A 3T7TA 2BW0A 3OE5A 1EEXB 2PUBA 4JLOA 3H11A 3DLCA 2AN3A 3BL6A 1OBOA 1T1IA 3ZHCA 1T0JB 2NUPB 5DLEA 1C3OB 1XVIA 1VYUA 5LU9A 3MTIA 4LCBA 4REMA 2QRJA 4YRQA 2FU5C 2NQ2C 1ENZA 4I4NA 1QTIA 1XGKA 3ILSA 3RVJA 3T9AA 3LV8A 1NR5A 1M2VA 4YX9A 5J2TA 4R8VA 2FPIB 2FTKE 4XWOA 2O8FA 2PX2A 3BXOA 3U7GA 4L4XA 4QHSA 3S2ZA 2GN8A 5JHGB 3ZGYA 2JAPA 5BN4B 1ECJA 2YXNA 3JQ9A 5DNDA 4CG1A 5DTIA 4Y9UA 2WF6A 1BXZA 1JYSA 2CVFA 3WWEA 5C8YF 5JCZA 1FFXB 2XY4A 4JLAA 3NLLA 1HT3A 2VI5A 1Q77A 1KZGB 3AHHA 4B3GA 2JFQA 2SKCA 1TYAE 2I54A 3WLNA 3BCRA 1DCTA 2QAGA 1MGOA 1JP7A 1HE8B 1XA4A 4KPUB 3WNZA 1GDTA 2CBGA 1XRPA 2CNWA 3KEFA 2NPOA 4C7MA 4L50A 2OCGA 1QRRA 2PKQP 3MOIA 3QJGA 4XEHA 2WJVA 3WRWA 4A27A 4AO8A 1AHPA 2LBPA 3KJZA 4J0JA 1R5NA 1TLTA 3N3BC 1X6VA 2XZTA 1IHPA 4M37A 4KIFA 4NS4A 3UKOA 4ANFA 2Y68A 3EA4A 3WGNA 1G3QA 1F4LA 3Q3GE 4RESA 2F59A 4ITRC 2IA5A 1T5BA 3L2OB 5GONF 3OWHA 3GLGB 3HBNA 3P27A 1KJQA 1YR6A 1ISRA 1JLHA 1Y8QB 2H48A 3ODPA 3AM5A 4FFBB 4KLAA 5K3SA 4PNEA 3DVRX 4F86A 4RBNA 3U17A 1JXQA 2MMGA 2WPDD 4G5QA 4L76A 3A58B 1BS2A 2G5PA 3I37X 2JVIA 1YL5A 3BMNA 3KAJA 3ITKA 3QJ5A 1NNEA 4M54A 1KNQA 2ACWA 3W9UA 4M3NA 2JBHA 1PJ8A 3W7AA 2V4UA 1L7QA 2Q6LA 3KSZO 1KH2A 2HQRA 3H5LA 2R6JA 4FZ5A 4TGLA 5AVSA 1YDEA 1ILEA 3ZJTA 1PBNA 4CIBA 4YUXA 3ESZA 1C81A 4M2LA 2CXRA 2XUOA 3E22A 4I5GA 4F4CA 1W5FA 4KSBA 1SUDA 1YZQA 2I91A 3V3TA 3EPKA 5ADVA 2P7HA 4DDKA 2B2NA 2WSSA 3HN6A 3HXQA 3SZUA 3FWZA 3NIBA 4RD3A 3OTOB 2F00A 3G5UA 1U3DA 4AJIA 5FOXA 4NCXA 3B9PA 1H4VB 2WSBA 5E6UA 2HDOA 2PL9A 3VC1A 4DT1B 1PQWA 3H04A 3O94A 4HB2A 4C30A 1WXQA 1AQIA 3DKIA 3GOHA 2D54A 1R8JA 3LT5A 1WJGA 2RHBA 2O20A 1EWVA 3BSYA 3M1YA 4IV8A 4IX9A 2SECE 3IUSA 3L79A 2AOTA 4PLYA 4QBFA 2NUAB 2IHKA 2X7HA 1C0PA 2NVBA 3SVLA 3AQ4A 3VNVA 4ZCMA 4B3TB 3Q3EA 4QGBA 5KYKA 4DV6B 3V1YA 1KDVA 1P9WA 3Q3JB 4PSCA 3V33A 4PICA 3KRTA 3UHJA 3ILYA 1A9ZA 1IZ0A 2G1UA 3DKPA 4D45A 2Q1XA 3QKSA 4NV0A 1WDWB 1FXSA 2PGNA 1NAIA 2IUSA 4Y2QA 1MF7A 3EGWA 3I5XA 1TKBA 3OLCX 2M2IA 2A86A 2V74B 3WOVA 2AQKA 1MBZA 2ZJ5A 1QYCA 5ALQA 4IUCS 1JQEA 2NTJA 4CV0A 2G9VA 1J9ZA 2PBLA 1QANA 3W2IA 5LQMA 2PS3A 4KOAA 4ARIA 4W7SA 4KMMA 3KYDB 4YN3A 5ENVA 4TS4A 4JKOA 3G5TA 4KGVA 1RBYA 1O87A 2CLLB 1FCJA 1HDYA 1V11A 1U7HA 3E7WA 4KB5A 3ONEA 4OMUA 1MX5A 2EJUA 4GKAA 4LOJA 4X91A 1UP6A 1P45A 4DA7A 4DIFA 1UFQA 3GU3A 1W4LA 4IYJA 1YRBA 4PCVA 1QLHA 3KC2A 5J2UA 1ISMA 5DJ5A 1TCAA 1US8A 2IU4A 1MO4A 2CHGA 5A3RA 2WSYB 2Y2UA 2PO5A 1JIXA 3IR7A 1E7SA 4KN8A 3C3PA 4LSGA 5JASA 1AA6A 3P9ZA 4MQLA 3DFZA 4RSRA 3T12A 4BQOA 4BBJA 3N86A 3E3OA 3ZOZA 1ZXLA 3LWNA 3OURA 1TQDA 4QZVA 1JDZA 3CGGA 2FK8A 3GP8A 3GLTA 3TUZC 3CUWA 4DQLA 5LUBA 2XAUA 3AUSA 3EEBA 1RXWA 4CNBA 4N3CA 4XVCA 5IJZA 2X3FA 2K4MA 2JI7A 4G1VA 4GT1A 1OBCA 1LY1A 4YJFB 2X0NA 1RYEA 3H3FA 4N3AA 4OPMA 4UEKA 3VYTB 5T8KA 2HIAA 4E11A 5KWVA 4O29A 3PPVA 1N5KA 1T8RA 5KOJA 4P35A 1RR6A 2R8PA 3SG0A 2H4HA 1EWKA 2RK6A 3ULKA 2NP6A 1LSOA 1JIKA 2FW6A 5H5JA 4DMCA 4L5JA 1XFDA 4RULA 4UD6A 5FRDA 2F48A 1IJEA 3BXGA 3PFIA 1C50A 1XHFA 4HAZA 1G20A 4MQ6A 4X7MA 4ZAWA 2D06A 2YFHA 5CNKA 3IUBA 3HSYA 4M22A 4LOLA 3B5JA 3WA7A 1E7RA 2B2XA 2PKWA 1IOLA 3IPLA 2G5TA 3EN0A 5EVJA 5CEFA 4QARA 4XUEA 4PX5A 3B8EA 5I5EA 4FKMA 4AY4A 2ZJFA 3EF0A 4ZJYA 2Y4OA 5CFLA 1X92A 2D0IA 1L3CA 1RFGE 1AXRA 1EFLA 4Y18A 3ZKWB 3KALA 1RYMA 2B0JA 2PLWA 4JZYA 5BWCA 1X1TA 1MC8A 1PJ4A 4OJMX 1ZUNA 3UWOA 4ECEA 2AQHA 3T7EA 4YJKA 3QIAA 3HVUA 1PZXA 2XEDA 3L8FA 1NXWA 2ZUBA 5T4FA 1Z2OX 3SYRA 3FWKA 2BFFA 2HI0A 2XKBA 2YN4A 1D0IA 4PPGA 4IDDA 1KYQA 4CM6A 1Y3IA 4EFMA 5B5SA 1NJGA 2ZRNA 1OWNA 1GGKA 2WJAA 3G2HA 5IBRA 1JEJA 2B35A 4E5VA 2NP7A 1BN7A 5JXWA 3WR5A 2QMOA 4S24A 1QH8B 4L75A 1JHYA 2WA2A 2YJ3A 3PJEA 3TDMA 5EJ8A 3F1LA 4JIGA 3UEOA 1E5XA 1L1QA 4MUMA 1XWIA 3S81A 5FWYB 1KR2A 3D81A 2AC7A 1BQ3A 3LGSA 1F60A 4QPNA 2W42A 1YQXA 5JIBA 1N2HA 2BLNA 2D7CA 3ASYA 3GFQA 3L0OA 2WILA 4PTZA 1J8QA 4XM0A 5G53C 1HM5A 3HN7A 3M34A 3QPBA 3TG2A 1H2BA 5A9SA 3P9YA 2VP9A 4TUYB 2Q4BA 1NV8A 2P2CA 2Q8PA 3H1BA 3FOFC 3KKPA 1G19A 1PLLA 1BEUB 3CIFA 2G06A 3UXHA 5SZHB 2JZNA 3ZBPA 3BTSA 2VHYA 4PXYA 5KOYA 4ZXFA 4PSKA 5CNJA 4RK4A 3LXRA 2Z6UA 1C7IA 3R3HA 4BNLA 3OJ0A 1PQ4A 1QTRA 4ENPA 4PRKA 1VPTA 2DHQA 4QJIA 5KC9A 5CA0B 4I1YA 4PXAA 4XYBA 4YP1A 4TLBA 4ZN6A 4A3SA 5CDHA 5CB6A 4BZWA 4YECA 3GDFA 5BORA 2IHYA 2A9FA 3H6GA 2FJUA 4LISA 1G21E 3ZE0B 3GD5A 1PVDA 1IXYA 2FWPA 4QU9A 1TT7A 4Y2PA 3V97A 3FHTA 1OWPA 3PX7A 4H1HA 3L05A 3NDRA 3TQCA 1NLUA 1G41A 3C8ZA 1QVZA 4XQ0A 5FYQA 4ER0A 1SUCA 2BR3A 5IYZF 4Y6SA 4ZVMA 1J2EA 5C0OE 1C3VA 1ABFA 2PMCA 3FUUA 3NHYA 3RS7A 1UM9A 4C1NA 1VTKA 5LMCA 2FSUA 2P9GA 4MQEA 4XB1A 4NWIA 4PS1A 3K70D 1GAEO 2Q7DA 5I6DA 1FDSA 3Q6MA 4MUEA 4CM9D 3T7SA 3G7SA 3TXAA 4FD2A 3GGSA 3T7IA 1TRHA 1JDSA 1Z15A 4IIVA 2DFKB 4UDNA 4HJXA 4KK3A 1WB5A 4PWYA 4OXNA 5F3DA 4MWDA 2J3MA 3AEYA 2NUTA 5L4NA 2J3EA 1XYYA 3BT7A 5EWJA 1XEXA 2C4UA 1WLSA 2ETXA 2H52A 4QVIA 2JLQA 2RAVA 3E81A 2PXHA 2Y67A 4O25A 2JJ1A 3UGKA 2OV1A 2J5XA 1CQJB 3RS5A 2FN7A 1Z2NX 1JEDA 1UK9A 2O2DA 2R8XA 2YWEA 2EG5A 4MVXA 4NYMR 4V0ME 1AXEA 3UCFA 1JFVA 3MC1A 1ZU5A 4DPKA 2BDEA 3NTQA 5LIPA 5MFPA 2DFNA 2ZR0A 4ZVOA 2FE4A 3T3GA 1SUPA 3AR2A 3DPUA 4MIEA 4MYDA 4DADA 5I45A 3UMJA 5AM3A 3L9XA 3BS4A 3ZJVA 1VE1A 2PKEA 4TMFA 2O7SA 1TLFA 3S68A 4YY3B 1O95C 4IIUA 1YB5A 2RHHA 3C3JA 1A4RA 3NYQA 3T0FA 1R12A 3VO2A 3MRTA 4O4LA 2BBOA 1IY0A 4RXUA 5JYDA 4GWGA 3RAGA 1A69A 3GPCA 3JQBA 4EFKA 7YASA 3KETA 4GPBA 2XMPA 1IQPA 3PC6A 1EP3B 2AMJA 2WTAA 3QG5A 4XAQA 3HDGA 5K20A 4G01B 1T5DX 5C7IO 3KOWA 4YMIA 1A9QA 5EJMA 2R00A 3DXYA 2YIDA 2QGFA 3RNOA 1GGVA 4UQLA 1G7CA 5ETJA 4URFA 3V1TC 5HF8A 2BFCA 3EGDA 5DE3A 1W0KD 3JARB 4C0JA 1XTRA 1AVTA 1FNSA 1WB4A 2YMPA 4V1CI 5JMOA 2W2LA 1YZTA 1PT5A 1KBQA 2CGEA 4CM4B 1CEEA 2D1FA 4KQWA 3CLVA 1GPAA 1GPUA 3FOWA 5LNK1 2GYVA 5BSEA 4JQSA 5I7OA 2HCJB 5ERYA 3UMCA 3PA6A 4G1CA 1MAWA 2QG9A 2TECE 2DAPA 3D7MA 2WU4A 4NU5A 2V7BA 3NM4A 5BMVF 2OVBA 1N6PA 4MQUA 4NENA 4ZTUB 2O8BB 3B85A 3GGJA 4OL9A 3ZCPA 4WOKA 1QX3A 1T6ZA 4G8DA 1WVIA 3IS3A 1SU6A 2PMWB 4FYWA 3PD0A 4EUHA 4PAQA 1XK6A 3GT3A 1RYNA 2VP6A 1OWOA 3ENQA 3U5TA 2BT4A 4KGDA 3UOWA 1QHYA 5CT6A 3JAWB 1KFJB 4RHEA 2KWIA 4RCYA 3EXFB 1FXUA 1ZJJA 2C95A 5C31A 3T3IA 3X44A 1V48A 2Q4RA 1UPAA 3QF4A 1L2TA 4C89A 3FSEA 3AR8A 4D3YA 4QO7A 4D6XA 2HA7A 2VJAA 1DBQA 1RAEA 2VYVD 1WVGA 4DWWA 4KHZA 2HHCA 4OQPA 4E94A 4LY6A 5HDQA 5K0NA 4CCYB 2G82A 3LQRA 4R16A 1X7WA 1EWYA 4BASA 4D3ZA 1BWSA 1S7GA 2PGJA 3D43A 2HQBA 1ZZEA 3TOVA 5D2CA 1PF7E 3E4CA 4XM1A 5E4TA 4I55A 4Z7JA 5KYNA 2VWPA 4UTOA 1XZNA 5BUQA 3O1LA 1YMVA 3COPA 1BFKA 4G5FA 5JJCA 4ID9A 4R2HA 1X7HA 3GJ5A 4HDAA 4UATA 1T5IA 1G8HA 1GZ3A 3F6SA 1H5NA 2QP3A 3EISA 3KX2A 4L9AA 3SM3A 1DAIA 5A06A 1S8OA 2BF7A 2PH5A 3L18A 4QU8A 3W4JA 1Z36A 3M2TA 1YCFA 3GLIB 1TCUA 3EH2A 3P0RA 3WG9A 1JALA 2EL9A 4GX0A 5EXTA 4XFDA 5JT1A 4AMZA 5AVJA 1AA9A 3ONNA 4DLKA 1P4JA 3L3BA 1CQZA 5BT8A 2NXEA 2WYHA 5LSAA 1IWPB 1WEKA 3PRHA 4OJNA 5C1OA 2BUAA 4MH0R 5JD5A 5K4HA 1OQAA 2WM3A 3BUSA 1ORIA 4JI0B 1SZPA 1JTEA 4F2DA 1U98A 3VR6D 3ADBA 1SJ9A 2C5FA 3DXFA 1LDEA 1WSAA 3K9WA 2DWQA 3I23A 4O1IA 3JR3A 4PC7A 1HLFA 2VCYA 5EPOA 1HGXA 1USVA 1DZIA 3ZDDA 2XXBA 3PF8A 1ZXBA 3LT2A 3F74A 2W22A 3TBHA 3N07A 1UJNA 2E4AA 1Y8RB 3ELDA 4HNUA 1XEAA 5LXTF 1FS6A 5LVAA 4WFQA 3H18A 3T0GA 1LV8A 1UP7A 1W2WB 1NF9A 4HZUA 1B16A 2ONYA 3HJUA 4KACA 2KLHA 2BDTA 3IBCA 1T2FA 4UU7A 3SF8B 1BJRE 2XGMA 2Y6VA 4M4SA 2V6MA 4IJMA 3IB3A 3AUKA 1Q2XA 2PBZA 3VJMA 4DCTA 1JRLA 2VJDA 3FTEA 3L93A 1GXSB 4FC6A 4RK6A 1NLMA 2ZPUA 3A3OA 4HC4A 4EG4A 5B3JC 3DEYX 3T5MA 4HDSA 4KNWA 4ZOLA 3N53A 3OPYI 1DXOA 4OM8A 4RK0A 2G0TA 2R8YA 2REQB 2QD2A 3BRWD 5D1HA 3WL8A 5AUPB 4LJRA 1WBJB 4GRIA 1KYXA 1J99A 4TROA 1R16A 3BPSA 1NVAA 2FY8A 1P19A 1GTL1 3QPCA 4NBNA 4TZKA 1OMOA 4RYLA 2FPLA 3HRIA 3M70A 3T3OA 3AETB 2QRMA 4LMAA 4KYVA 1QMGA 1R18A 5IBPA 2I6UA 2UVPA 1RAGA 1JQDA 3G1UA 4HUJA 5BWOA 2SKDA 2Z5VA 4R2XA 5EE5B 1R0RE 2QE7A 4DLVA 4OQXA 5ED0A 5SY4A 5FOWA 1O95D 2TMKA 1FTGA 1IAQA 2Y1LA 5LU8A 3AF0A 2V7WA 4U2CA 1M74A 4EKIA 5CDUA 3OZXA 2ZAIA 3SQMA 4N8DA 3LX5A 1SKUA 2C7VA 4PZAA 5L6MB 1KQNA 1RIIA 2QLNA 4D3FA 1UEIA 1F0PA 4MTCA 5ADHA 3JU3A 3S1LA 2ZYRA 4Y9DA 2YV5A 1ZITA 4YEDA 3H9GA 4A8HA 4URVR 5DYWA 1VI6A 4YFYA 4E5NA 3AEKA 3N8GA 1RQRA 4C6TA 4JHLA 1QTQA 2HGZA 2DWPA 1NSTA 2B5VA 5AK3A 2BI8A 1D04A 4FNGA 1GLNA 4B31A 1B14A 5FHRA 5B7NA 3EEFA 4OAPA 4BNKA 3ZXSA 1RAFA 3LPNA 4ALNA 1CVRA 5ALWA 2VP0A 3E9EA 3GRYA 4UAUA 2YV3A 2O05A 3FPEA 3I6QA 4Q5IA 3DVAB 3N2KA 5E6RA 3TM5A 3TOXA 4BMVA 1SQFA 2IL1A 1U2DA 2VHCA 2W0MA 3GLKA 1DUVG 2V9CA 4IDPA 3VR6H 2PAAA 1ZCAA 2P2SA 2B1GA 1J1ZA 1Z2CA 3TFWA 1OLUA 1MRZA 1OLXB 2HSDA 3H5IA 3PDJA 3EMBA 1DIAA 3HH8A 2I4IA 3GA5A 1HOTA 1R8XA 3W5AA 5L3ZA 4F12A 5AESA 3R8FA 3P1JA 2YBDA 3STTA 4PNHA 1YVRA 4ERXA 5BUZA 1JAHA 2PJZA 2XI4A 4HWKA 4BN4A 4RMGA 2JGIA 4EAQA 1T0PA 3CCFA 3VU8A 4EMUA 3DBHA 5KPJA 1V7CA 2KM1A 4EK9A 4M88A 1IN5A 2G80A 2V9PA 5DCLA 5AH0A 1Z0JA 5HIIA 4BNXA 5JVDA 2V6GA 3B36A 2DRIA 4NZZA 1P7VA 1R37A 3E7FA 3DYIA 5JNWA 2XAAA 3WDMA 2GVZC 3QMWA 4LJ7A 3OICA 1JECA 1JIQA 3P7MA 4YV1A 1SCKA 1G2OA 4Z7NB 5E1MA 5F73A 4J43A 4CWAA 4HATA 1OB5A 3HL0A 3D5TA 3DZKA 1QCZA 1ZJZA 3ZXUB 4CW7A 3C5EA 2Q27A 1IFXA 2IBSA 1WV0A 5B2ZA 2PU7A 2QAIA 4G4JA 3TRDA 3C6XA 1A2OA 4HDMB 4OGGA 3ZC3A 3CVYA 1GQFA 2XCLA 3JYLA 5CX4A 4L4UA 5FLEX 1BIFA 3QBDA 1N5DA 4NAUA 1XQWA 2D1RA 5KO2A 3IO5A 1G5TA 1NN1A 2OMKA 2Z4RA 4MWGA 5A3VA 3H5AA 3VYRB 1BVHA 1T1JA 3KDAA 3NRJA 1I6WA 1S3FA 3PSHA 3RJZA 4JP8A 5CM8B 1I7SB 1RAAA 2IDKA 1X7ZB 2WPNA 4UZFA 1C5KA 1KFCB 1FLDA 2HXGA 1TK9A 4ZAVA 2AKEA 1S5PA 4FU0A 1YQDA 1E3JA 1QAQA 1UIRA 1DBIA 3MTBA 4L07A 4LX0A 1VSQA 3RANA 2FZ5A 5JQGB 1F7UA 2E87A 1O08A 2YMMA 2RHGB 2R1TB 2PZAA 1Z4PX 1U8XX 1N6LA 4WZAE 4MR8B 1RM4A 3MQFA 3EIUA 3WSVA 4YNBA 3LGAA 1UK8A 4H27A 5E8RA 5IZCC 3VJRA 4IVNA 3LVBA 3MXOA 3X1JA 4EB8A 1B0PA 1U0LA 5D87A 1PLKA 5CYFA 1VKZA 4JYPA 2R2GA 4CL2A 5JZSA 5JI3E 1I80A 3O3CA 3DWIA 4J29A 4NBKA 4D0GA 4DOMA 2QRZA 3S2IA 1XTQA 3DMGA 1PR3A 3B38A 4KQJA 3CUEF 4YMGA 3TRFA 4JEMA 5DMXA 2XDQA 1ZQ9A 5JYEA 3GJ4A 1FUUA 1X8XA 1S1CA 2BHLA 4B1FA 5C5EA 4CM3A 7GPBA 1I10A 4J1SA 3ZXYA 5IWCA 1RQ7A 4D9KA 3ZX5A 4E2FA 2A9JA 1N92A 1V6AA 1YQGA 2ZRDA 5CU7A 4HXEB 5LBTA 3VU1A 1M34A 1YZGA 1CZHA 2RDMA 5SY9A 2WP8J 2Y76A 3LXUX 4P2BA 4UHFA 3ZUPA 1P3Y1 3U1BA 2RCNA 1M2KA 2FETA 3AH8A 5EMNA 3LIIA 3WYEA 2OD9A 1OSNA 2P69A 3GPIA 4EPVA 4GKJB 2DB3A 1WOYA 1EHYA 1YONA 3FRIA 2FSIA 3M6AA 4TX1A 3THWA 3D0OA 2V58A 4E08A 4ZYZA 3BK1A 1SA0B 1L7MA 2F1OA 3L0YA 2GJAA 9LDBA 2XITA 1FLVA 5JHHB 1CZKA 3T3EA 3M5WA 2BMEA 4UTXA 4YRSA 1O9BA 3RJMA 3ESCA 4LBZA 1UBFA 2WZDA 2V54A 1I4DD 3K2QA 3E9DA 2VK1A 4IVRA 3C98A 4KDCA 4YDRA 1H1DA 3IDQA 5BOSB 3HDHA 4U00A 3CJQA 5AJXA 5E6SA 1PJSA 4M0DA 1H8HD 1FNDA 5M3BA 1Z0UA 2Q5CA 3HJNA 2BM9A 5A04A 2WVJA 2F1KA 1J33A 3GLHA 4II2A 2XCRB 2SBTA 1PJZA 2DUWA 4MUFA 1ECBA 1V4NA 1E1RA 4E09A 5D7NA 2C94A 1Z33A 1IQUA 1DFGA 1SUAA 4EMBA 4Q7MB 1PJ3A 1QYWA 2P11A 2E7ZA 2I4OA 4PSUA 4WZBE 4TTRA 5FT9A 4B3FX 5B4VA 4DSAA 2EBUA 1CKEA 1SC6A 3ISJA 5ALPA 4MYRA 3LVQE 4M0CA 4JBIA 2C7GA 5JAIA 2PQMA 4HLCA 2IE0A 3DNMA 4HTFA 5JH7B 2YMLA 4RUKA 4HDRB 3PUYA 2HJGA 4IQ0A 4C0XA 1GGJA 1N9KA 4G24A 3FPAA 4A8JC 4I66A 1Z6GA 2MR5A 4TTIA 5K2OA 1OD6A 3TIIA 1VHQA 3BE6A 5TR9A 1DEKA 1W30A 3AG5A 3BF8A 1F8XA 4AJ2A 1W87A 5D01A 5EFZA 2V9ZA 1QRTA 2H1HA 5K0TA 4GR4A 3GLSA 4H7IA 3C16C 1VMDA 5F2EA 4I9HA 3MBOA 4GLJA 3WLPA 5CDFA 3D2AA 3M9XA 1BCRB 3N39C 3OIGA 4LWOA 2BPOA 2YNMC 3VV2A 4M8LA 3BIOA 5L3SA 5SZKB 3DAFA 4JGBA 1XTSA 3INGA 3DDUA 4B6SA 5CPFA 3NOOA 1UEJA 2R6HA 4DUZB 2OM6A 2X23A 2G63A 2ODTX 1WHSA 3ITDA 4JLWA 5HIKA 1F4VA 1X7YA 3IEKA 4BUZA 1SOAA 2BTQB 2FVYA 2WU3A 3TX2A 3KXLA 1T43A 5C8YB 1TX4B 4KYUA 4WCFC 1MVNA 2PS1A 4MW6A 6PFKA 1KA9H 1Z2PX 3GZTB 4I50F 1QGYA 2FF5A 4X71A 1JAIA 1IZYA 3GDHA 4JXJA 4FE3A 1QB7A 1W4AA 4X6YA 3IURA 3VI3B 4BRZA 3R40A 4HNAA 3QY0A 3L8DA 4JOSA 3KKLA 1A50B 1ORDA 2IY9A 4PYNA 4A16A 2E4UA 1EFHA 2QL7A 4N6NA 2NO5A 1P3JA 3PHBE 4MKFA 2WE7A 1AC5A 1A2BA 2CYAA 1DC4A 5EI5A 1DAGA 2EQAA 4Q3KA 5AUQA 5ITSA 1B8OA 2DLNA 3HGQA 1H85A 1DDOA 3WLTA 3U19A 1MX1A 2F7SA 2X0RA 2VZ8A 3RC1A 2IXDA 1XMXA 3V1UA 3AOGA 2X8WA 3RDPA 1ODSA 3S8YA 3UYKA 1AGXA 5GONB 2QG6A 1GA1A 1GPKA 1SU7A 3CCBA 4DSOA 3WL7A 3ZD8A 1UL1X 1Y37A 3AV3A 3DOEA 3F9IA 1LDYA 5FPKA 1NULA 1SXJC 3NGXA 5KDDA 1KS2A 1J7KA 1V35A 2FF7A 3FKJA 3ZV5A 1OI4A 5C7YA 1IDOA 1T5HX 1JSZA 5FWXB 1DKNA 2WVGA 1ULZA 5KIAA 2WJ4A 2H54A 1X8LA 3CINA 2PSSA 3PKIA 2WC1A 1RWQA 3I05A 1P7ZA 3UMBA 2ZRFA 3FCSB 5B55A 2JGFA 4EVRA 4N01A 3U3KA 6REQB 4PYIA 2UYHA 4I2VA 3BB3A 5FPQA 3M9LA 3VPXA 4JYZA 1JWLA 1L5OA 4IRMA 4YT5A 3T1TA 1E1MA 4ASUD 4UE3S 3Q87B 2DUJA 3DPIA 1TMGE 2R5WA 4EO7A 1OU4A 1E5QA 2DY1A 4OAQA 2ZYTX 2D1QA 1AXGA 3ZD6A 4QRIA 5DX1A 3E22B 1C30B 1K0UA 2BCGY 2O1SA 5J5AA 5LP6F 3D7RA 2RGUA 2X14A 4U8HA 2Q21A 4M1KA 4ZEWA 1PL6A 1YI1A 3K9NA 3ECCA 3L46A 1YKFA 3F47A 4L02A 3SSAA 5M04A 1OHHD 3D8NA 1GQSA 3R3SA 1GPLA 4UUBA 3EBPA 1KF0A 4TKVA 1J9GA 3A6KA 3MHPA 4JLNA 1KFBB 5C3UA 3O3NB 2B3TA 2GHIA 5DK6A 3ELYA 3DZ8A 1BH2A 4ZTZB 1DIRA 2F1JA 3LQFA 1DSSG 4O2BA 2O7NA 4Z2AA 1DG3A 1FPMA 2P2NA 4HMPA 4KU4A 4RVFA 4B7XA 4TL6A 4O0LA 1Z83A 4TRRA 3UA3A 2GMWA 2VYNA 4DE5A 1K9VF 5ARCA 5H02A 4JJFA 2G40A 4G0UA 1Y1RA 3RCBA 1J0DA 2TMGA 1N2XA 4OV6B 1ADYA 3QUTA 3AONB 3DOJA 2QW1A 1ZUIA 3QV1A 2BFBA 1VSVA 1ZUWA 1II8A 3F9RA 2HC9A 2Q99A 1GPYA 1N5RA 4OQ4A 2VIIA 3JVDA 4QTUB 5ECYA 1GZ6A 3NBKA 3WYNA 2EHDA 3ROKA 3AVOA 1NI4A 1E9RA 2HSGA 5CVEA 1JDNA 3K4QA 1YJ5A 2VR1A 4YAIA 4DPMA 1PX0A 3LHSA 3SEZA 1UAGA 3IRVA 4FR0A 3VOBA 1PYOA 3C6YA 3BHIA 1XXLA 3FKSD 3KJEA 3OVMA 2A2ZA 2WIDA 4N1AA 4TV9A 3BOSA 4EATA 2J0QA 2JFGA 3PE3A 3V8PA 1D6MA 2I1VB 1OAKA 1FVXA 1RRPA 3UICA 3GMTA 4M0LA 2RI6A 4QD3A 4F46A 1VG0B 1MQSA 1YZ3A 4HX9A 4WOPA 3TLCA 1U8CB 1OOEA 2FZ4A 4D9BA 2JDID 4NOLA 1SFRA 1T6YA 3N70A 4N5MA 4NPHA 4PSVA 1HDIA 1R6TA 3ORFA 4CM8B 2I78A 2XMGA 3UC9A 3W2FA 1CYEA 4OK3A 2O3UA 3OCYA 4PHFA 3RRFA 3VUEA 2GTIA 2YZNA 2NU8B 3WKAA 1QQBA 3MF4A 1YU9A 4M1EA 2HIHA 3ZQ4A 3MOSA 4W8GA 2WKRA 2ZIAA 4H7KA 3QNMA 5GJCA 3V8RA 2F8SA 1AOXA 4QJ4A 2P91A 2P6NA 3KVYA 2QU7A 1SBCA 3FZYA 2GBFA 4ML3A 3WBFA 4YCLA 1RP1A 3D4NA 4JU8A 1OV4A 3EQ7A 3MS2A 1TECE 3AKDA 4F45A 4ESVA 1LDMA 1HE4A 3HHEA 1KC3A 3SHQA 3TL2A 4YJ2F 1JTFA 4UEJA 1E6MA 2ADMA 5THQA 3SP1A 4D81A 4KV7A 5KOJB 1NT4A 2ZJYA 4RENA 5T3YA 3V8BA 3TTUA 2F9FA 4KGZA 1PJ2A 1ISGA 4KKVA 5JJLA 4EG5A 4KLCA 3IBYA 4KH0A 1Y42X 5JY1A 1JQ3A 1G20B 1Y80A 3EIEA 3OE7D 4X24A 5IT0A 2RGNC 3RS9A 3DAOA 2G04A 1EHIA 1I5RA 5JSKA 1KRWA 1J0CA 1UDXA 1D6JA 2I29A 2XT6A 1FUEA 2ANBA 1JSRA 4RIEA 3IT1A 2QL6A 4UAGA 3CEHA 3X1DA 3ZHXA 4CR7A 4JJAA 3U7RA 3ZWDA 4BQSA 4F3CA 2ODPA 5D00A 1A7JA 4G3XA 4D9CA 2ZTHA 1FEZA 2FKAA 1R6AA 3TLEA 1NKVA 3KHTA 5JPCA 1MTZA 4AD8A 3NXKA 5B1HA 2ZYDA 1PG2A 1XVTA 4GPZA 4FDMA 4MOWA 3QMPA 3Q4GA 3G82C 4BP9A 1SXJD 5CFQA 1DG1G 3RYIA 4PX2A 2ZJ2A 4IILA 4JYAB 1I7DA 3GJ8A 4RTLA 5CK5A 4JK3A 1JLRA 1F2VA 1MIOA 4FJ1A 2C8JA 1DTWA 3CEJA 1V0JA 2J85A 3DMRA 1HQCA 1U5AA 4H9GA 5EIBC 4BLTA 5K6TA 3PZRA 4MUYA 1M2OA 1E7QA 1TMOA 3M4NA 1UR5A 2AFIB 5K8LA 3ICWA 1TYEB 4XPZA 3W8DA 4F3TA 1TD9A 2C88A 4UXHA 4GBMA 3K2EA 1FF9A 3PXXA 4RK1A 5CTJA 1XD8A 2V7GA 5ELMA 2FEWB 3NP7A 3G8DA 5JG7A 4F4UA 2OCYC 4FKBA 4NPCA 4WOBA 3E03A 4M60A 4FNMA 4MGHA 2I7DA 4HGYA 1BGVA 1DV2A 1YRAA 2N42A 2YXLA 3CJRA 4R0NA 3KL2A 1RQGA 5TF4A 4GI7A 2QLMA 3QE2A 4V3BA 4HADA 1W6UA 2J5QA 3OQHA 3BGOS 2NTNA 1GN8A 2D2XA 2GEDA 2W48A 1B15A 3IMEA 1R66A 4FJ0A 4M9RA 1DEHA 5IM4F 1XBTA 3L49A 3Q85A 4UTRA 4WUTA 3SY8A 1AGNA 4Q9IA 4FK8A 1I4OA 3LDFA 4XWAA 1MO5A 4OB6A 2A3NA 1RYFA 5IYZB 521PA 2J0VA 1Q0ZA 3FY4A 4L5IA 4WEOA 4M8IA 5HCIA 1NIJA 2DUNA 2ZJ6A 2QTRA 1I4LD 1Z22A 3F5DA 4FOPA 1OXKB 2ETVA 4Q4DA 3B6JA 2Z2ZA 3FOAA 4HQ0A 4F6RA 2O52A 2FX3A 3GCGA 2DU8A 3I83A 2Q29A 3DDOA 3CH5A 1C0EA 3VZCA 2ZDHA 3UJBA 1CFJA 2V8OA 1CB0A 5DLPA 1VHLA 2ZR9A 3BCSA 4QOFA 1UAAA 1JDVA 1GPDG 3FDFA 4CF7A 3KJGA 5JCXA 2IYPA 4LJ6A 1FFSA 4UOEA 3CN7A 2YVLA 4KWIA 1M1YB 5CHYA 1ZK2A 3P4UA 2ADFA 4NBWA 1OFUX 1Q84A 4N5DA 3W77A 2Y0CA 3LAWA 1V3QE 3JQ7B 4BX2A 1MABB 1N5OX 2QIPA 2NUTB 3JQQA 4G0ZA 4RO0A 2C0CA 3RVRA 4OHBA 5LYYA 1YR1A 2WHPA 4FEGA 5EWJB 4AUNA 1M2FA 1Z6YA 2JFYA 1P80A 5KAMA 4QECA 4AKTA 2YJZA 5LIRA 4EECA 1RLJA 4GE0A 2OPBA 4OMFG 4JELA 6NULA 4F92B 4M98A 3KZMA 5A5DA 2GVDC 1AD2A 3TLKA 1JI3A 1Z06A 1DKRA 4YLGA 4G5GA 3L6UA 3VO8A 1ZD3A 2J8ZA 1ZY2A 4TQUS 5L3VA 1VBFA 1X94A 4J07A 4CDRA 2X6TA 2GD6A 2PKCA 2C5GA 2AEJA 1N0WA 2P9TA 2PWBA 2X8JB 3DE6X 3MBKA 3NT4A 4L22A 1ZD9A 4UTPA 1ZKMA 1O95A 1W8IA 2NU6B 2I7TA 1MD9A 1CJUC 2PZEA 3VO9A 4PBSA 5A4JA 3WWYA 3F90A 4KO4S 5DIZA 4BX8A 2IZ1A 3WK9A 1HNXB 1PS0A 4MVJH 2FH5B 1G64A 1WZIA 4JA2A 4YJ3F 1A88A 3SXPA 1LX6A 3GG2A 2O2SA 4PO1A 5KS2A 1ACJA 3ITEA 3UV6A 5GMOA 4A0GA 5CIYA 3THRA 2XE4A 5C7OO 5F3WB 4CV2A 1EA7A 4HYEA 2I6GA 4BIMA 2JCXA 3AESA 5DTJA 3DM9B 2LV8A 4LDAA 3PNKA 1CRQA 4U7TB 4QXPA 3ZOKA 3VYUB 4LRYA 1MXFA 2Z04A 1IOVA 1TM4E 2TS1A 1DBSA 4H17A 5LJLA 2OO3A 3H9CA 3G2LA 2CD9A 5IK2D 2GCPA 2ERXA 3FB1A 4E1BA 1YBMA 3KAPA 1VFPA 4EELA 1S01A 3S70A 3CEAA 4WDQA 5FUMA 1M7GA 2VJPA 4GI3A 1U0JA 3R75A 1WMEA 3CKYA 1C3XA 1WXDA 2Z2IA 3AL2A 1UJCA 1D03A 1RPNA 1WMBA 3DHNA 4JBWA 4LFCB 5IUJC 2H9IA 1CY4A 1Z0SA 2PSEA 1UZUA 2PWYA 3EZYA 4IXTA 4MPPA 3DV0A 4I36A 3RE1A 3T5DA 2PYZA 3EGXA 3ORRA 4P08A 3R7WB 1H1LA 3P2IA 1XU4A 3T3DA 4IGKA 3WGQA 2AMVA 3M33A 4L5CA 4UOQA 5BWLA 4KXYA 4ZU1X 1J2YA 1J70A 4P9NA 2R62A 1I0LA 1Y4ZA 4QGGA 1MO2A 2IDMA 3V7YA 2VUSA 2PR2A 1E1QA 2JKYA 3K9LA 4FFRA 1WHTA 2VAVA 4QNNA 1CR4A 2AQ8A 3AC0A 4MS4B 2QUJA 4EYSA 4ALKA 2R6ZA 3RKRA 1NNSA 1JKJB 2ZCVA 1XRRA 5LA6F 3WMWA 1H2ZA 3RAEC 3WL6A 4D4KA 1W35A 1WS6A 5COQA 5KQGA 3NQ41 4HNHA 2FQ1A 2WUFA 3GF4A 3MWGA 1M6NA 1QCYA 2Q3MA 4E1VA 1CRWG 2DLDA 4NJEA 2WG1A 1EXDA 1VPEA 4IV0A 5DB4A 1LPNA 2RHMA 2YRWA 3BMOB 1BX0A 4U7HA 2J4CA 1JH9A 5EXXA 1ID8A 3NWPA 2P4QA 2FXIA 3R44A 4K2HA 1FSZA 1MEEA 2RMKA 3EGIA 4BMCA 3ED1A 4HHEA 3H13A 1G8FA 2DPGA 1G42A 3Q15C 1E9SA 3PQ2A 4RFLA 2G4VA 3CNEA 3G89A 1QFSA 2QSJA 4P3XA 3Q9SA 1IWBB 5T6BA 1T8SA 4IGAA 1ZR2A 3UT5A 2J9YB 2WFAA 5EA2A 4GH5A 3PWTA 5FFNA 1DXQA 4B3SB 1CR6A 1JFFA 1VKHA 1RS0A 2ACKA 1ZOSA 3KEQA 4IVQA 3T38A 3JATA 4NABA 1J4AA 1JHZA 1Y6JA 2FSFA 1E1DA 1EPUA 2RGRA 2C4MA