1NVAA

Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
380
Chain Sequence
PTKISILGRESIIADFGLWRNYVAKDLISDCSSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPSPRLLIYNRPPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAETILKAVRREVTPGEHRFEGTEEILKARILASARHKAYVVSAGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMFNMALDPKKKIVLLSAIGTPYETRASVVANEDIRVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-induced Conformational Changes and a Mechanism for Domain Closure in Aspergillus nidulans Dehydroquinate Synthase
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE SYNTHASE
total genus 135
structure length 380
sequence length 389
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1nvaA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nvaA01
3W5SA 3HL0A 3OKFA 1O2DA 1VLJA 2GRUA 4QGSA 1NVEA 1UJNA 1XAGA 1NVDA 5HVNA 5FB3A 1XALA 1SG6A 3IV7A 3CE9A 3QBDA 4P53A 1NVAA 1XAJA 1NRXA 2D2XA 1NVFA 1JQAA 3JZDA 1XAHA 4FR2A 5EKSA 1XAIA 1NR5A 1DQSA 2BL4A 4MCAA 4RGVA 3ZOKA 1KQ3A 1NVBA 1OJ7A 1NUAA 3OWOA 2BI4A 3UHJA 1JPUA 3OX4A 4RFLA 1TA9A 1VHDA 1RRMA 1JQ5A 3RF7A 3ZDRA 5BR4A 5K8CA 3CLHA 4RGQA 3BFJA 3QBEA
chains in the Genus database with same CATH superfamily
1I5EA 3H11B 1WRBA 1GPNA 3Q3GE 3ICPA 4U2KA 4Z51A 4FYHA 4MUJA 3VC2A 5JRZA 2H92A 5BR7A 4HMPA 3O90A 2VQSA 1L7EA 3VU9A 1I1NA 2X1LA 3TVDA 4Z4EA 1F60A 1PLKA 2FG5A 2QLFA 3HA5A 4OGWA 1ORTA 1UPTA 4D7AA 3DZGA 2F9MA 3D6JA 4M7OA 3SC6A 3U09A 6LDHA 4RF4A 1IQ0A 3FB4A 1SCQA 4CV1A 4PQRA 3ZDDA 1X13A 3AUFA 1S02A 1JLKA 4GX2A 1XMIA 3OCCA 1E63A 2ZB2A 4MVJP 3EIUA 2FEPA 2HQBA 2O3JA 4F04A 1EFPA 1P5FA 4UBOA 3DE6X 4F1KA 4UHJA 2XNHA 3CKMA 5GJWC 4UMFA 5K3AA 4FKBA 4NESA 5TQVA 3DE3X 5EZ6B 4M99A 5ESXA 3WB0A 2PLAA 3P2OA 2REQB 2CVPA 3QYPA 2PE5A 4NICA 4EPRA 2I6XA 4EA7A 1LC0A 4PIMA 3TE7A 3U9TA 5IK2D 1Q6ZA 1NE2A 1XJCA 5ENVA 2DFLA 2HMWA 4FN5A 5TPWA 4ZU6X 1F1BA 1WA5A 3T8YA 4J9VA 3UT5A 2WIKA 3R5HA 3VH3A 2HBZA 5KBYA 4KREA 2VNKA 2AN4A 4AF6A 4QKQA 1D2GA 3VHXB 2C82A 2RGBA 3DAPA 3DMDA 1M0SA 4TXJA 1NJ8A 4H0CA 4OHYA 1ISHA 1X1DA 3ETNA 4AUEA 3DDWA 5EIOA 3LA6A 1WCIB 4ZHSA 3ORFA 4TX1A 1N4AA 4PZUA 3P9KA 3ECSA 4DMHA 1CJKC 1OIVA 4HB2A 3WB2A 1DKNA 2NM0A 1HT3A 2EARA 3P9QA 3I9V1 4MPRA 3SF8B 3D6MA 4E5NA 3O8OB 4BVJA 4TOIA 1AY0A 4QTXA 4HXYA 1P2BA 1R66A 1ZIXA 3HP1A 4PEVA 4I55B 4R1LA 5IMSA 1BW9A 1QZUA 1AQUA 2NYUA 1SOAA 2O2GA 3G6WA 4HRAA 4Y6RA 3UJ8A 3VGPA 4EGSA 1D4FA 2BEJA 5DTQA 2PV7A 1ST2A 1W96A 3R6DA 1Y6FA 5JY1A 3DMGA 3EG9A 4KYIB 3RH0A 3COPA 4IP0A 2H16A 5SICE 2PV0A 1RJGA 1SUPA 4WLNA 2QTLA 1NJ5A 4UPDA 5ALJA 2GJ8A 3SHWA 3TI9A 5KOYA 1GTSA 3EAFA 3IEIA 1M67A 4PZYA 2VF4X 3T7JA 3FDZA 4R8RA 5AM0A 2R8XA 4BKUA 4D96A 1P7VA 1WMSA 2ONYA 4FSHA 3ND5A 3AIOA 3OM8A 5AR1A 1N2XA 5FEUA 5I9LA 1ZI9A 2P7IA 2IBMA 2YHUA 4ADSG 4Z1MD 1RQPA 5EE0A 2QAJA 1T91A 2QP9X 5B7QA 5FWYB 2NMVA 5KDLA 4C06A 2ZM6B 3KVRA 1AMUA 2IYNA 3CHYA 1YIOA 2ZSKA 2QTNA 3A31A 4LDNA 3BMOB 3WQHA 4RK0A 5DNCA 5LDHA 1TYEB 4WOJA 1I7NA 3HSYA 5EXPA 5BSUA 1ILWA 5KJEA 2FPMA 3ZHZA 1QG4A 4JLKA 4LVOA 4DG9A 1CUEA 1BFKA 3M70A 2ZB3A 4YMIA 1NIPA 5EIFA 5AK5A 2A0YA 1DT5A 2QSJA 2VQ6A 4GZMA 3HLKA 4OYLA 2V9PA 3M4NA 5JCJD 2VP5A 1MO2A 3ROQA 3FDXA 2B8WA 2QRPA 3CR7A 2HRQA 3IP7A 5CFNA 1L7NA 2ZRCA 4JYPA 2EFJA 4JBHA 1N25A 2RCYA 4HVCA 2DLCX 1KZYC 1OYVA 2P9YA 4M89A 4WKNA 5DBEX 4B6FA 4DLSA 1I1OA 2QX4A 1C1DA 1HTBA 2E5FA 4C6TA 4PS1A 2HF2A 5CXXA 4PN7A 5IDWA 1MC4A 5JADA 5BSMA 5AD1A 2YOGA 2LKDA 2EEZA 4X45A 1UZNA 1E1KA 2CL6X 4COOA 1Z16A 1G1AA 3DDOA 3A6GA 4YV1A 1GZ7A 5JY6A 4ZEWA 4JBWA 4KIFA 3PFGA 1GQQA 2HYIC 3B6ZA 3E2MA 1FXSA 3TR5A 3AJRA 4MUBA 1YDMA 2OZLB 4PBRA 5AIAA 4WIAA 3WAKA 1LS6A 2XUIA 3TQSA 4AJ9A 4EHAA 3SY8A 4G5GA 4ETIA 4BAZA 2GLXA 4DV2B 4JB2A 2Z2KA 3P71T 4EAQA 4BYGA 4TMZA 2B35A 1PNQA 1T0IA 3B9PA 1F0NA 5KAPA 1UC8A 4EUHA 2DXIA 1AKEA 1NVWQ 4NH4A 2C57A 4C30A 3I37X 3N2EA 5AHOA 1CQPA 4RL4A 3LHSA 2RAVA 3CURA 1XDZA 2WZQA 1RYZA 3S2EA 3DZCA 4FINA 4ZALA 4C4SA 2A7QA 3W5CA 4XUCA 3TLBA 3KETA 2NZWA 1U5BA 3A1FA 3DS8A 5GJVC 3WIDA 3FPAA 4TZKA 3ZVKA 2XITA 3IQXA 4RVGA 3Q8KA 2P3LA 4NFSA 3MQ4A 3OIFA 5DM60 3GXOA 5K8CA 2HK7A 4S05A 5IULC 1GPDG 3H8WA 1MXHA 1L9KA 1XL0A 2QT0A 3H7AA 3NC4A 3PXEA 4I3FA 3QE3A 2YCBA 3NHZA 3IKLA 3DZ8A 1QFJA 4GOOD 5BQPA 1E99A 1JIVA 1D5CA 1ESCA 1EQAA 4OX9Y 3RSGA 4FILA 1IMOA 3GUYA 1O54A 4MUAA 2PY6A 3LUAA 1Z2CA 3URMA 1UODA 4DIKA 4ZA2A 1QF6A 1S1CA 1RP7A 3WX0A 4IQGA 5JJKA 1X7YA 1RKBA 4OUDA 4CNBA 1LEHA 2BTQB 3T5MA 4DLUA 2P90A 2QRNA 4DMRA 2CSXA 1NVBA 1VA4A 3MGBA 4UNSA 3L46A 2ODTX 2OC9A 3RFUA 1O94D 1T0JB 5BRAA 5JNSA 5K0ZA 1O6FA 4G9EA 2D5LA 1B00A 4MCHA 3KKPA 3GRAA 4XB2A 2AN1A 4KI0A 1W5BA 3WZMA 3A1DA 2DLNA 3WG9A 3FOCA 3KTFA 3GWZA 3OX3A 1NXSA 4X63A 4KKVA 4R71A 4I3HA 2W6JA 3EEOA 4B9EA 3E9CA 2OBXA 3DJYA 1L4YA 3QVKA 5ETJA 4BWVA 2JD2A 4QDTA 3GF4A 4QGHA 4URWR 1XZNA 1H5NA 1VXRA 2ONJA 4PIPA 1G8MA 1XT6A 4FU0A 3OT5A 1L4KA 3THSA 1DXQA 1QANA 4ZKEA 4CF5A 5CFLA 4YWHA 1KJIA 3WA6A 2R47A 1YMUA 1TXGA 1S3GA 1GCUA 5TGDA 4BO1A 1JSXA 4O2AA 4DL9A 3SP1A 5EC8A 3U0VA 1U5AA 3LLSA 1RABA 2CKDA 4Q21A 3WLSA 4O4HB 2IYYA 2V7QA 3BMOA 4OGFA 5JNRA 3SVLA 3D6HA 3G2PA 4C14A 5ES4B 3EQ2A 3CF2A 5U4XA 4J0HA 2B92A 1DC7A 2BFDB 4L6AA 3F2VA 2EZUA 4KQGA 2PVPA 2ANBA 4NEHB 4RDXA 4M86A 4D0NA 1GN8A 2JAHA 2BC9A 4PTZA 1CVLA 1P2TA 2PGIA 4DARA 4UUQA 4A8JB 1EVZA 2HREA 4FGZA 3WK9A 1GZ6A 4NCXA 2Y0CA 3ZE1B 4HYYA 4QDUA 2ADOA 3I45A 1L5GB 3ZXIA 2UU9B 2LBPA 3ESQA 3H65A 5T6BA 1W87A 1W94A 4MR8A 3WK8A 1LNZA 2JEZA 1HDOA 2PEZA 4A91A 3S5UA 1DJOA 2JAUA 3AVWA 1R9NA 4HYEA 2ZWOA 1VHJA 1G6KA 2QP4A 2ONKA 3EXHC 1ZXLA 3JVDA 1RHQA 1PG0A 2A0WA 1T2EA 2PR7A 2IOFK 3L8MA 1N32B 1PKXA 2UYCA 1FQJA 2N0SA 3DEKA 4M7RA 4JYCA 4B6EA 3BRCA 2BKUA 3JAWB 4GFDA 1Y6ZA 2CHVA 1OBVA 1V26A 1Z6QA 1JMVA 3Q5DA 4X95A 3WLMA 1II8A 1SQSA 5JZ9A 3THRA 3RJZA 3PIRA 3U5TA 2PBLA 1JAYA 4QC2A 3AEQB 1TK2A 2QZ9A 2ZIEA 3CO0S 4G9GA 4DCCA 4RJTA 5CD1A 2UZ4A 2XUFA 2FQXA 4HV4A 1ZGZA 2F3RA 4XVQA 5BYAA 2RK4A 5M5BA 2DETA 1OFGA 2GXAA 4WWHA 1RAHA 2ZEJA 3WB9A 1Z8NA 3O4HA 4EM6A 4F6RB 3U4QA 3B1JA 1V8FA 3RARA 1UPAA 4O4LB 2WYHA 3E84A 2H3HA 1JILA 3B6KA 5J4KA 4B4KA 5E9WA 1SKAA 3RBAA 3AFGA 3T7KA 2Q5FA 1XFAA 2D5CA 3VJKA 4IFTA 2ZQZA 2ZRMA 1KWKA 3T1HB 4BEBA 1BA3A 3G8BA 1EYZA 5KTMA 5JXWA 1RCUA 3B1FA 4MR8B 2PQ2A 1W52X 3F97A 2JRCA 3NB0A 2CCGA 4UOEA 4KAFA 5A9SB 1NW5A 3E58A 4HDKA 3DOOA 3A1EA 3JYHA 4ZAGA 3CLKA 5BWNA 2PWYA 3H0CA 2BBOA 1DEHA 4PPYA 1JU4A 1RWXA 4RMHA 5IAJA 5HGXA 4I19A 1UINA 2YIMA 4KXVA 2C2GA 4CGYA 1J25A 1N2OA 2Q4RA 3UJBA 4J1SA 4LPSA 5EZQA 3U9LA 3KQPA 2ZSEA 1N77A 3UJ7A 1H3EA 4LRWA 3WQQA 3WBBA 2N3ZA 4BMXA 2Q1XA 1HBJA 2WIBA 2GRJA 4C7OA 2W00A 4XSVA 2ECPA 2ZZKA 3PEUA 4P54A 5DLDA 1LDBA 3SQDA 5K4HA 1RBZA 3UMJA 2DR2A 4M0MA 3VO9A 3QF7A 4NFYA 3H2SA 1ESNA 4O2BB 3V8NA 5A6SA 4QOGA 2GN4A 3QEJA 2EP5A 1HE3A 5DEIA 3MJTA 1TUEA 3P96A 1FDRA 4M0FA 5C7LO 2PBRA 4JP3A 4LHVA 1NLYA 2G72A 3FYHA 2AG5A 3BTOA 5EEGA 2QLLA 3ILXA 1MOPA 1UUFA 2ZTUA 3F7OA 4ND8B 1EFUA 4ITVA 4D9EA 3OFSA 2NUTA 4GPBA 4IUBS 3H8SA 1XZLA 3N2ZB 4IPTA 2H1SA 1KHTA 1Z88A 4X54A 4A1OA 1OU4A 4AJKA 5IUNC 3ESRA 4ISBA 4ICIA 3W77A 2GS9A 5IZ4A 1J97A 4W82A 1UJ4A 5BNZA 2M98A 2J7PD 4E1AA 2VH2A 5EEHA 1I4LD 4KXLA 4C2TA 3M2TA 1LBQA 3AR2A 3IALA 4PLWA 5IF9A 1XRPA 4FYPA 1IN4A 3RRMA 2JAQA 5D7BA 2XNDD 3MN1A 4KCGA 1YS7A 3ZE7A 3KOXA 1PWHA 4YO8A 4NE9A 1ZJ4A 3ZE8A 1YUBA 2V8OA 2CK3D 2HK8A 2RGNC 4L73A 4OQEA 1CUBA 2JEYA 4MV4A 4XXHA 3JRNA 2VSXA 3OZWA 2FSIA 2NZ8A 1WZNA 2NO1A 4YRQA 4BZQA 2WPNA 4INJA 1MABA 1UWCA 1QSGA 1G21A 5GAJA 1M1YA 4WNYA 1PL6A 1Q50A 2XLBA 3QLEA 3NYQA 5F5NA 2A5LA 5BNTA 2XMRA 2B1RA 2ZDGA 1JECA 3DEAA 3F5QA 1ZUNA 3KVOA 4QUAA 4W5RA 4HN9A 1F4VA 1XYGA 4JT2A 4AN1A 2ZT5A 1FSPA 4G4GA 3K73O 5ALNA 1YQEA 1WU8A 4BQIA 1ZOLA 2ID4A 2W2OA 5C51B 3EEIA 4N82A 3VR4A 4D0LB 4OL0A 1H0SA 2C58A 1YZ3A 3TOVA 2PD4A 3BDVA 3NH9A 3ZH9B 1G3RA 1L5YA 1YA4A 1HDGO 1YNOA 4FUQA 3UAYA 4YXFA 5FWYA 4YJGB 1FMJA 3QEOA 1E2DA 1QU2A 4NP6A 2OCBA 3E0QA 3OOWA 3DC7A 4XWWA 2C7RA 2LCIA 1YT5A 1DDGA 2ICAA 1QFSA 4KI7A 4PGMA 4U5QA 1LSSA 5J40A 3TJZA 7ABPA 1MG5A 4A6PA 3Q5EA 1L1FA 3AH8A 4OQNA 4OX9B 4IDFA 4MHSA 1K9SA 2I33A 5SZHB 5F78A 3G7SA 3RANA 1XVTA 4MW2A 4E4TA 4EEKA 1UJ5A 3PGMA 3G0DA 2H65A 3W8NA 3QX8A 2YY5A 2FP3A 3H16A 3NRJA 3TFWA 4ASUD 3IIIA 1ZOSA 2WAOA 16PKA 1G5QA 1Q7EA 3M4YA 4TLLB 1NKVA 1ZONA 2B8JA 3W9BA 3HXQA 3RJ5A 1ABBA 1XQ9A 3GNLA 2XYVA 3KKNA 4C3UA 4Z8XA 4ZCTA 4DDTA 5IUJC 1JG3A 3PYMA 3EF3A 2JPDA 2QEQA 2GWRA 4X1OA 2BKAA 1PT7A 3IT1A 1XEXB 2BFCB 3F6PA 5FI5A 3U4CA 3PITA 4GH5A 4NCAA 2WF7A 4OV6B 4FOOA 3TZHA 3STHA 4DIMA 2WE7A 1RAGA 4QGAA 3AR6A 2WJWA 4D8VA 2BFWA 5DT9A 2D1QA 4XPIA 5HIIA 3O21A 2ABWA 1JQ3A 2D3TA 4FS3A 4MCAA 1ILEA 1VQ1A 5LWHA 4QREA 1X9IA 1CG6A 3DEYX 2F3QA 3IBCA 2FFQA 1C9JA 5FI1B 2OCKA 3RIYA 2LPMA 3U9SA 3I9V6 3A10A 3NHMA 4JBYA 4ALLA 4BDSA 5IJWA 1NJ1A 1PIWA 4X6UA 1ODCA 1YASA 4XVRA 1SN7A 1K3UB 1OE0A 2AQIA 1KZ6A 1RPTA 1OD6A 1IZ9A 2ZUBA 1VPVA 1R6DA 3IAUA 4J9UE 4P6VF 1UP6A 4IXTA 5EI5A 2MCFA 3WIUA 3DMTC 5FB3A 1YK1A 3SEZA 5AVZA 2Y92A 4A0GA 2J33A 4I2NA 4QVGA 4A10A 1DO2A 1E9FA 1ZI8A 2XCTB 5F98A 1FDOA 2O2ZA 5TF4A 2QUJA 1KOJA 3OM9A 1GG9A 2ID9A 2XWJI 4MWGA 2EBWA 5AMXA 1I9GA 1B0PA 4YRTA 3SM9A 2VYNA 2DKFA 1M74A 1ZVMA 1Y98A 1F3OA 1MRNA 4L8VA 3UNXA 4D6XA 1DL5A 1YQ9A 1SD5A 1WDMA 3CH6A 3LRPA 4NYMR 1P4HA 3WBKA 1GO2A 1WV0A 2JF0A 4PZEA 5JQGF 1VJGA 2QD4A 5H4GA 3ZY6A 4N0EA 1ZMOA 3UUWA 3M9WA 4U3JA 4HDMA 4Y0VA 4LYDA 1OX4B 5U1PA 1RIIA 2Z3ZA 5A5DA 5E95A 3PC4A 1LNQA 2JZCA 2YWXA 4Q4JB 2X76A 4GGOA 3EARA 4UZFA 1FFAA 3RRNA 1SXJC 1YE8A 5HGJA 1LJ8A 2IV2X 2ONCA 5KYVA 3GLVA 3BK2A 1GJRA 2OT3B 1YKSA 1LZLA 2CNDA 4AJJA 3VM6A 1YO6A 2H1WA 2YWHA 3WVNA 4GXNA 3Q8WA 5FPPA 1GR0A 5KTTA 3DLHA 1RAEA 3U4GA 5A62A 5TMPA 3RVNA 4BNNA 2VVTA 1KY5A 2BDEA 3HADA 3ZC3A 5DYNA 3GUVA 3PE4A 5GZ1A 3LHKA 1MTZA 4J7UA 2EKPA 4MWZA 5B4VA 4LX0A 1E1RA 4J03A 3N3AC 5EN4A 4G5QA 2OV6A 3R3SA 3TLAA 3B70A 1RKVA 2ZJ5A 4BEJA 2C7GA 1RWVA 1SA0A 4DZRA 3I4LA 1QE5A 1WQ4A 2IEGA 3EASA 1PGJA 2PGJA 4QDKA 1GRRA 2M9MA 2E1RA 2R7NA 2OCLA 2O8BA 4DNFA 2IXGA 2GPAA 1NHWA 5L3SB 4ACAA 3BT7A 1JIUA 2QBYA 2IS4A 3I5XA 3A1VA 2P9BA 1R4MB 1RM4A 1THTA 3I28A 1XCMA 2RD2A 3RRFA 1X77A 4QSMA 5BY2A 1BXKA 2ZTLA 4IUYA 2FDRA 2J9RA 3PQ8A 2EERA 3ZDRA 2QZSA 3VV2A 1OSNA 3A8TA 3UV6A 1VOTA 5AW7A 1FMLA 4XQCA 5JYDA 2RHBA 2FX3A 2O07A 3JQBA 4KODA 1XDDA 3AZPA 1U3WA 1QJ4A 4HGZA 3ZW9A 1O58A 1N2JA 1X7XB 1XP5A 1JI0A 2OBMA 4G1BA 4P53A 4RTJA 3OZ7A 1VZ3A 2IYOA 1LY1A 1PS8A 1E5DA 3R7DA 3FCXA 2V4MA 5ADHA 2LWIA 3ZBTA 2XE4A 4KR6A 4RZSA 1GOTA 1HOXA 1YUMA 4FR0A 4MQUA 4R6XA 2CSUA 4IJUA 3B5EA 3RYIB 2Q1TA 4ZANA 3V55A 3W7VA 3EH2A 4C4PA 3I32A 3HXTA 2J0UA 4OFBA 2WUEA 4FFSA 4UBJA 3D7RA 5CB4B 4M1ZA 2VBIA 3FCOA 3GGSA 1KE2A 1AGRA 2JFWA 2O52A 3FETA 4EG5A 1MP0A 4EGQA 2PH7A 2BVNA 3Q1KA 2HLNA 5EXXA 3DQQA 1X39A 2WUDA 1EUCA 2MINA 3MLEA 1MD9A 3C7KA 3A4NA 1Q7TA 5JJ5A 1XEWX 1OT3A 1XTUA 3T1YB 1WB9A 2IF2A 3IEXA 2XA9A 3AIMA 3VA7A 3HUDA 2ONZA 4H7EA 1U0NA 1PGQA 5ELXA 1T2VA 1ZM3A 3MNFA 2WPDD 4DBLC 2GO7A 1SKYE 3HO1A 1U2QA 2KS6A 1I36A 3MLAA 4L8YA 2AFHE 3A06A 2PZLA 3ES9A 4FCWA 4BFZA 5AW6A 3LVBA 3FPEA 4NK4A 1DRWA 5ER6A 1FXWA 3TW4A 1VG0B 4REMA 1CIJA 4H0NA 1GRNA 4WOCA 4ENQA 4XWAA 5CIYA 3E27A 1I1HA 2QLBA 4MS3B 3WGTA 1WSWA 2QN3A 3WE7A 4BNHA 1G55A 4W8GA 4D9NA 4V3CA 1UXIA 1F48A 3KYCB 1ZJ5A 3H5NA 4JOBA 3SZRA 4TV9F 3R0JA 3RHSA 4E94A 2YXDA 1USUA 3R2JA 1X9HA 2WSMA 3CZRA 4UVIA 2BKLA 2VHTA 3O3MB 3QKRB 3UJDA 4D9KA 4D82A 4IRMA 2JDIA 5IBQA 1KAOA 4JFAA 3JZDA 4QWMA 1DAPA 3L0CA 1QORA 2AF4C 3HBFA 1T1GA 1QP8A 4Z9YA 3AI1A 5I4BA 1A9OA 3R3XA 2F48A 6Q21A 3RTAA 3QKRA 1O9GA 2QY9A 3FYUC 1P9LA 1L3IA 3MERA 4UBMA 3WGOA 5HQ3A 1RHJA 2J3KA 4UNQA 3MFQA 1COWD 1L3BA 5IW8A 3W04A 2GWHA 1EB8A 1YSCA 4MZXA 4C5BA 3HRHA 2A5YB 4I9FA 2UDPA 2C4WA 1B8UA 1JDJA 4MQFA 2GETA 1EG7A 2B7LA 4YRRA 2BTOA 1SC9A 1GPLA 1W6RA 3TJRA 1VSTA 3EC1A 3ZCVA 3ZGYA 5FWNA 1ZR2A 2P77A 1OXMA 3K9BA 1TF7A 3C6YA 2B78A 4Q4AB 1KAGA 5DT2A 1YQTA 2Q41A 1YUNA 1RU3A 1Y9DA 4HYQA 2AOWA 3HDQA 3VTFA 3HY3A 4CTOA 5IBPA 8GPBA 2WU4A 3LPNA 3MC1A 2CL0X 4UUPA 3PNBA 3HCRA 1A4XA 1UK9A 1Y1QA 2IU4A 3NOQA 1U63A 3YASA 3MM4A 3IOBA 1GCGA 4OH1A 4YUAA 2XNSA 4GE0A 4A3SA 4B4OA 3TD2A 1DUSA 2O9JA 1KIAA 2ATCA 4MR9B 1NVMB 4ACBA 3OZIA 1YI1A 2E9SA 2GN6A 2WJ4A 3AYZB 2OBNA 4IQFA 3TZCA 4J7AA 1HURA 4AWBA 4D1YA 1W93A 5LIPA 1E2MA 1EDBA 2IT1A 4RLSA 1EXMA 1HO3A 3D6VA 3UAWA 1QO0A 3AERA 1W4AA 1QYXA 4FSDA 3QUQA 4QRHA 3RVRA 4Q1AA 2ZR9A 4R7GA 2EATA 3K15A 1I4EB 3BB4A 2B5VA 3CH4B 4UM9D 3R7WA 5FWXB 1UDXA 2AEEA 3AWDA 3GCWA 3NAGA 1JKMA 4GYYA 2REQA 4TMKA 1WTAA 4BBPA 3C1OA 5ALXA 1AKRA 3I52A 4MX8A 3SD7A 5IYZB 1DQNA 1RZUA 3MWJA 4Y2GA 4UOZA 2PM8A 2CBGA 3H4TA 1TZKA 1NBEA 3U7QA 1XLWA 2IODA 4P2BA 1H4SA 2CXHA 2X5XA 2QT9A 1OZAA 4Y8VA 3DE7X 3IXQA 1JVBA 1MLDA 3GZNA 1JUDA 4GRIA 4J94A 3KEGA 3L6CA 4GIBA 5JPIA 4L9WA 1Z68A 3N2IA 3GLFB 1KFBB 4J76A 2ZUVA 1EKXA 3OT1A 3VUFA 3D0OA 2ZETA 3DBLA 1OH8A 2NPOA 1Z9BA 1IL0A 1KI1A 3EGWA 3KQNA 4TM8A 1RPZA 3FPLA 3EVZA 1SVNA 1H8HD 4K8OA 4RLQA 5FOTA 1IJKA 4EFKA 1UMKA 2BZSA 4H3VA 3F67A 3ZZNA 3DV0A 1O6CA 1USWA 4ZO6A 4ZT7A 4BEVA 1DAIA 1D2EA 3F5MA 3TZBA 3UWOA 2WU3A 4I9UA 5K3SA 3ZBPA 3I5YA 3FUCA 1NW9B 4EOGA 1L7AA 2C8JA 2J5KA 4C0SA 1RSZA 3FUTA 4N41A 3I6QA 2BMJA 1W47A 2IV7A 5C2JB 4HH3C 1XZIA 3CYFA 1VL2A 3U4AA 1V48A 3TRIA 4FM9A 3AB8A 2QRQA 4E7PA 1K6EA 4TKUB 1XJ0A 3SNKA 2CVOA 1P9OA 3Q3IA 1X87A 4IJ5A 3QK7A 1YRLA 3WHLA 1TAGA 1XPUA 2IYPA 3HRIA 4M0LA 1IBKB 4PZCA 4R2KA 4BQOA 3ZWCA 1S3SA 1V11A 2F1IA 3B82A 4DXAA 4DE5A 4YDQA 4MARA 3R4CA 4TLEA 3KVYA 3FDFA 4O25A 1RHKA 1K6IA 2XGGA 5EJ9A 2I6GA 4NJEB 3P0HA 1YR9A 4M1TA 3Q0TA 4FBLA 3NHJA 1YGPA 3B1KA 3FJYA 5EZ5A 3T3IA 3B36A 1CQJB 3LO8A 4EJSC 4ZDIA 4RD0A 5J2TB 2VSYA 1QHYA 1IMJA 3E9NA 1R0KA 1G8HA 5DLYA 4AIRA 1Y4SA 4BC0A 3NNSA 5EQDA 4QJ5A 4DB2A 4UCWA 2LE0A 2HIMA 4GW3A 4TL7A 2EU8A 4OFXA 2YXPX 3BE4A 2OCXA 2R8ZA 2W0SA 3P0FA 2Y4NA 4CF3A 5J58A 1K7XB 1UT8A 5K20A 2XBMA 1VE9A 2CE2X 2GK3A 3DMPA 3QYJA 3WYAA 5AVQA 1E59A 1IBCA 2IGBA 1OQAA 3ZK8A 4EL0A 4FONA 5DSTA 1TO2E 2P4QA 4MEJA 2PUTA 2A9QA 1EFKA 1SK8A 2RHGB 3G8AA 3H9JA 3CX6A 3G1TA 3P94A 3Q87B 4PGHA 2I6TA 5ULLA 1AXEA 2WQZA 4U7HA 1G64A 3R5SA 1X0VA 2HO5A 2FXVA 4NHOA 2AG0A 1P7CA 4N9QA 2QVLA 4GF5A 5D3ZA 5GGYA 2NZVG 4ZAVA 4BWGA 4MLCA 2QMEA 4OF4A 2BMAA 5F35A 4E0BA 2Q2WA 1JJFA 3TIIA 4DMLA 5EXEA 1E9VA 4QM7A 1JR2A 1GNPA 1E2NA 2D54A 1H85A 1OKKD 2OGTA 4GLFA 4MRNA 3EULA 4EP1A 5KYXA 1QGAA 1I6MA 1N7JA 4Q48A 4M1OA 1P0MA 3SDBA 4GZLA 4Q3AA 2ZIAA 4N54A 4MI6A 1EG2A 3VU3A 5MFPA 1RMQA 1DCMA 2D2IA 5DDIP 4BX0A 4RH1A 1C9MA 3BX1A 4AY4A 3D54D 3P97A 3KTAB 1VIMA 4KH0A 4UTVA 1H2WA 2AUNA 5I7WA 3HZOA 2ZI6A 2RC5A 2AI2A 3EIWA 3L4BA 4GX5A 1JLRA 4EUNA 4OXRA 1TQ2A 3D59A 5EE1A 1GL7A 4BFSA 3DE2X 1R5OA 1YZYA 1NUPA 4B7UA 3Q8XB 1YZQA 1KXJA 2VLIA 1VLHA 4FE7A 4KW7A 4V03A 4B3GA 4F8YA 2JVKA 3THXA 1EFDN 3KT8A 4FOTA 5DGTA 2E3JA 1D0SA 3IERA 2IDJA 4I08A 4LJ9A 1QMPA 3AVQA 4NSNA 4NYMQ 4BCDA 2WTBA 3DOHA 4Q1VA 4DB4A 4D6YA 3L0YA 1G41A 2WF9A 5L40A 2Y0DA 5F7XA 2QYTA 3QBDA 2GJKA 4BUZA 3COVA 3K8OE 2D6FA 3P9SA 2XHEA 2YWGA 3KCNA 3A1SA 1UEJA 2NV2B 3A3YA 1LBSA 2VDNB 4Y9RA 4MH0R 1IZZA 1Y7TA 4NJEA 5AI5A 4ALNA 4HOYA 2G07A 2JGMA 4ZJYA 3FBWA 2ZRLA 4V0ME 3TLCA 2OD2A 3L6DA 4AS3A 3D8TA 2UVPA 1W25A 2X1MA 3PC2A 3KVNA 1AG9A 3RUCA 3IA2A 2BHNA 2FMTA 2ZIVB 2ZWPA 4NYIR 3JQFA 3NS7A 3TGWA 1Q1ZA 5JI3E 3PR1A 2ZYRA 4A8TA 3R9IA 3ZI4A 4BY9E 3KD2A 4H1HA 1AGXA 2NV0A 1E1QD 3OZFA 1FE8A 1NXXA 2Z83A 3E2PA 3GAMA 5FTWA 1VJ1A 4NZPA 3MTQA 4QYIB 2JJ2A 1T8YA 1G8JA 1JH8A 5AKHA 1XRQA 1Y6QA 3QA3E 2C31A 1WXEA 2A0KA 2WHQA 2Q4TA 3UOWA 2B1GA 4G0QA 3ZVMA 2ZZMA 1C2TA 1XZFA 1N5JA 2AFHA 1P3DA 1FUIA 3AL3A 3KZVA 4PRKA 4F2HA 4GM0A 2ZAMA 3D81A 4Q7KA 1JLLB 3ZY5A 2GDJA 5JSZA 1Y3AA 3SSNA 3LRTA 5JNWA 1DO8A 3SYLA 1ZM2A 3B8HA 4IIUA 4EZBA 4MW9A 4QECA 5GM2A 3MT0A 1KARA 3P1JA 5ALUA 3S1LA 4U7FA 2ZROA 3ETCA 3HS3A 2EEPA 1OWLA 1SRQA 5IUKC 3U44A 3BD8A 3PYXA 4BNWA 4JP8A 2PBFA 4DYVA 1U2RA 3INRA 4MWBA 2NACA 4BLTA 1YH3A 5EPUA 3VMFA 1SBZA 2BGIA 4ZDWA 4QEZA 1HE1C 1Y3BE 4G1VA 3RC3A 4IS2A 5DX1A 3QFCA 1DC8A 4N3BA 3DCYA 2HZBA 2Z43A 5LQKA 3E3NA 1E62A 4YACA 4O4HA 1Q14A 5DM70 2ZZNA 5CT5A 3AESA 5K0CA 1WV1A 3ZOZA 1MV5A 2V45A 2OQRA 4L85A 1S4MA 4LJ4A 3BDAA 2ZW9A 3AETA 4OBWA 4C3VA 1O5OA 3EOZA 2BT4A 3R41A 4KDFA 1BN6A 1CR0A 4OJTA 1DTSA 1AD2A 2CB9A 3DVSX 4JSRA 3GP5A 2O3TA 1NXOA 4XJVA 1NYLA 4U2DA 2K7ZA 2X0JA 5HKAA 9GPBA 3U40A 3E5HA 3G68A 3KAJA 2HIAA 1WTCA 3OAAA 3K35A 1XZKA 3ONEA 3QFFA 2LVBA 1E6MA 4WQMA 3TW8B 4BAUA 4BC1A 5HIKA 1CS0B 1ORHA 1XALA 1DC3A 1CJMA 1T9AA 1UAGA 5D5PA 4A8HA 3QKUA 1PO7A 4BGDA 2VK2A 1BEEA 2QM7A 1D04A 1JB1A 5FO1A 1K66A 5IX8A 1J49A 1BD3A 2Y6UA 4IW3B 5FR2A 3OZCA 1QCYA 2FK7A 3UB2A 3UWMA 2D4AA 3K1YA 1JJBA 1LFAA 3HB5X 5CXSA 2HW8A 5A9RA 3DUFB 3N8KA 3B6EA 3CZAA 2C4UA 4U2BA 1N0UA 4BX2A 2HPZA 3JVEA 1XCOA 3LO5A 1TOAA 4YK7A 3F0TA 1JHUA 3JQQA 4OA8A 3NBAA 4BZXA 1IXKA 2LXNA 2GK7A 3E15A 1CPYA 3CE9A 1OB2A 3U3ZA 3IULA 4TTSA 4YLEA 5CAEB 5C53B 4ESHA 3EA4A 1PR0A 1ZHHA 4NBTA 1W9HA 2I4IA 4WESB 1PU2A 2X4LA 1G5TA 3HEBA 1KY2A 4PTLA 5DWVA 3RU7A 1XVUA 2FOXA 2FZKA 2OHOA 4JLJA 4KZPA 3FVWA 1X42A 3FDJA 3THYB 1E9EA 1JEEA 2C9DA 1YQUA 4WV3A 2VDJA 4EQZA 2HPVA 4GMDA 4GLJA 2XLCA 4UE2A 3WRYC 3GWGA 2NUPB 4JJEA 1EVLA 1UKYA 4KVGA 4QXPA 4RJIA 1YRAA 1UJ2A 2UUCB 4MGIR 1C8KA 1P4SA 1PV1A 4ENSA 4GR4A 1VM6A 5FPKA 4YJ3F 1ZPDA 2C5FA 4EDFA 2G5TA 4EK9A 4QUIA 3KEQA 2OO3A 4L3WA 3HU3A 4LXHA 5F3DA 1V16A 1EVKA 1SUIA 1DE0A 1Q1QA 1TVKB 1TPYA 1YDEA 2QIOA 2AN9A 4IKEA 4P9NA 2COEA 3K0AB 4M8LA 2PKXA 2R25B 5CW1A 2O2IA 3UCXA 5LZ4A 1ZD8A 3OEHA 3Q15C 2GUGA 3KEFA 5I9BA 2P9ZA 1NG1A 1NVVQ 3LXXA 3NFYA 1Y34E 4RA9A 5K03A 3AR4A 4E88A 3KL2A 4Q0MA 3DF9A 4Q3KA 3SOPA 1JHRA 3QVJA 3QVSA 4OOEA 5LLDA 4G63A 1WBDA 1BA2A 1ZESA 5DIZA 3C3DA 1T1IA 4LXUA 1BYIA 4RZHA 1AQIA 5DGIA 1Z0IA 1I9CA 5ESWA 4BLRA 2BMFA 4ALJA 3V4SA 4R4JA 5I9IA 1M6HA 2X1HA 2EIXA 2YMMA 3L2OB 4I1IA 5FPTA 5MN4A 5EIBC 3B2EA 1E7SA 2PD3A 3ZWKA 4EJ6A 5D6OA 4H4DA 4RNDB 4CWAA 1XAHA 4NBKA 3D5QA 3KE8A 4E5DA 1E2EA 1ZNQO 3JYNA 3CVVA 4CEIB 5IABA 3R7WB 4CBVA 2XMDA 1HZZA 3L82B 3SSMA 2YHAA 3WYCA 1F6WA 3C3XA 3ZWMA 4ER6A 4YLYA 4S0XA 1B43A 1YFKA 3C3PA 4TMYA 4QUGA 4YAWA 3KO8A 3UJHA 4AKSA 3KSBC 3KDPA 1F5NA 1KEPA 2GD6A 3H2HA 3I9JA 2Q4EA 1DEAA 5I3CA 2Q1WA 2HOQA 4NV3A 1YZLA 2XE7A 2HZ7A 4FWBA 4ABTA 1GGKA 2F3PA 2Q27A 2F00A 1BX1A 1GKUB 4CN8A 1OXBB 5GV8A 1KDTA 3BHNA 3F8SA 4J6EA 4OQMA 5K9ZA 1C5KA 3FYCA 3GJSA 2RAPA 3NETA 4HBGA 4FGWA 4O02B 2F4NA 2PN1A 4TQUS 5H3LA 3LCRA 4BV9A 2I6SA 1BS2A 3DP9A 4XRGA 2XOKD 2YXNA 3DYVA 3BRSA 3U3MA 1NX6A 1UOOA 1E3JA 1UT6A 1ZUNB 2J5QA 3L1HA 4JB8A 4JLDA 3U7IA 1ZIDA 4COKA 1NONA 3TW8A 3FUWA 3OFVA 1BW9B 2HXYA 4GL2A 3PNQA 3UHAA 5EUQB 4KQHA 2A7XA 2FAXA 3F47A 2AHOA 1JQBA 3QVXA 2MOKA 4OQLA 4JI1B 1K8YB 1YD7A 2CYCA 1T4BA 2GPYA 4HX2A 4MI1A 1M66A 3RIHA 4IV5A 3V8MA 4AROA 1ZJWA 1FLVA 3ECCA 3OIDA 3TRKA 2NTNA 1C30B 2QUKA 3PNMA 3KOWA 4KMSA 4X1KB 4YMUA 1MT0A 2DTXA 2XMGA 2Z8XA 5AI0A 1JNXX 5HTOA 4FDUA 4XYLA 4G0UA 3NM4A 5BV2P 1Z0UA 3BL6A 2AQ8A 1C29B 5JBQA 1JW9B 3KUCA 1E2PA 1W85B 1ZG3A 3PXBA 1IPEA 3VR6A 3H05A 3STXA 3QU2A 3JYOA 2PJRA 1B42A 3LY9A 3KXPA 2YXEA 3AEKA 3QEMB 1WL8A 4LC0A 3KK0A 1XF1A 2QJTA 4HUQB 4NU6A 5L4LA 1IBMB 1CUJA 1FLDA 2EFGA 1CQWA 3CZ5A 4JUBA 4Y0NA 3RM3A 1XXHA 4XDGA 5FLXA 2YFYA 1JQDA 3ICCA 3PDWA 1AF7A 3U37A 2CK3A 2L0XA 3AI2A 3SVTA 2QTBA 3EGEA 4N01A 3X2SA 4OKNA 1GQSA 3V1TC 4HKTA 1C0IA 4TVBA 4RZIA 1XQWA 4CIAA 1JALA 3TLJA 1PQPA 3P0IA 2J5RA 4KWIA 2VQFB 1SHJA 4ILKA 4D4MA 2AFHB 2WABA 4NE2A 5IS2A 1TPZA 5AVWA 3AU9A 1T1JA 4X7RA 2ZRDA 5AHKA 5IARA 3WZLA 5LIRA 1Z6YA 4QJBA 3IE1A 1O8CA 3CF4A 4CKXA 4UU7A 3E7WA 3RRZA 4LHXA 1KIMA 2ZG6A 4NE7A 4YALA 3IVRA 2JD0A 4K7JA 3JQDA 2TECE 5TPZD 4IZOA 2VQDA 3E5MA 3QG1A 1MF7A 2P0YA 1M8KA 2D3WA 2OFFA 1DZIA 3WK5A 2VJNA 2HL6A 3WSWA 1NVTA 5JQGA 621PA 2QI9C 1HDZA 2PKEA 1AK1A 4U00A 2YMQA 4NZOA 4MYRA 4TT8A 3T41A 3REFA 1HETA 3FKSD 2VG8A 1GP2A 2BV3A 4K88A 4HXGA 5J2UB 4XE5A 5EMHA 3JWJA 4G5YA 3BHJA 2V98A 2WSBA 5B6PA 1IC6A 2HNBA 2VRWA 4H1VA 4L5YA 3VR3D 4KXXA 4DZTA 3N1UA 1NVKA 4BQPA 4LOHA 1GUZA 5ES3A 3AG6A 4L9RA 4OQPA 4P4GA 4RFSB 1WQ3A 4S1TA 5FPQA 3PKJA 3W8RA 3TL6A 4C04A 4FK8A 3Q88A 1O97D 2XCOA 2PSJA 3OLWA 3LBNA 1SC6A 3N7UA 1NVXQ 1JJVA 3NW9A 3OECA 4CCSA 1GDTA 3Q1LA 1UMCA 5D1HA 4WNAB 3ELWA 1PWEA 3INTA 2AW3A 4BBJA 2IY9A 1PEKE 2L19A 1P3JA 1VIYA 4M6WB 2XJ4A 3CEMA 3VSDA 1BWSA 1N2HA 2XUJA 3VX3A 4BUCA 4D44A 1V71A 2Z5GA 3FTQA 3KLOA 3KQYA 4PSUA 4FGSA 5ICMA 2LIVA 2C0CA 4MW5A 4ILEA 1PVOA 3THOA 3SYRA 4DN6A 1VMEA 2FF7A 1WVGA 1EJ2A 2N42A 3JAWA 4L4XA 5AUPB 2XZLA 4KO3S 1ZU5A 2Z2YA 1U8UA 2P4UA 1WKVA 3M6WA 3S2FA 1X74A 4IR7A 3L43A 4Z9BA 4Z7NB 2BTEA 5G1NA 3ZI0A 3K70B 1JR3A 2ISCA 1VLZA 1MFPA 1UC4B 1D2NA 1QGOA 2W71A 3IB3A 3K8YA 1EP3B 1H94A 3BMCA 3ESYA 1ZSVA 4KFSA 1CB0A 1OIWA 4MUEA 5CFZA 2HIGA 3DTVB 3N75A 3S5JA 1U0HC 1GPJA 1Z5NA 2EQ5A 1NQOA 2VCYA 1RWMA 3A2LA 2ZBDA 3OE1A 2WP8J 4CM3A 4AKTA 4DLAA 2IEYA 4F93B 2CMGA 4Q3LA 3P52A 1RXUA 2Y1CA 1H05A 3BXPA 3FPKA 4HAOA 3MF4A 3QVMA 4GC5A 4QXQA 2TMDA 2I0FA 2Q3DA 1G2OA 3KU4A 3UJNA 2I55A 4YV2A 1YQWA 4XWYA 1I7DA 4G36A 4R8SA 3D9QX 3HA3A 1SXPA 1TEXA 2YW2A 3MWGA 4P35A 3FSGA 3CT4A 3NOOA 1RQGA 2O2YA 2WG0A 5BWCA 2X0DA 1PD1A 3IBFA 3S8MA 3VH1A 2V7PA 3KWFA 1X14A 1ULAA 4ZYXA 1IOVA 2RHJA 1L7XA 2JHFA 4KAAA 3JWEA 3FPCA 4MVJG 4Y0AA 4XPIB 3KT6A 4HBZA 5C8YF 5AVVA 4XRRA 3RUPA 5CT9A 4JVLA 1P8AA 3RQSA 4RHEA 4GOJA 4UUAA 1CQIA 3MZ0A 2EZ9A 1NQAO 1Y63A 2Z2IA 2HTFA 1B4DA 1I3LA 4WNAA 3GMIA 1GV1A 2JIQA 5TQJA 3B2QA 5LQMA 4GRAA 2GTHA 3AEKB 1OI4A 1U9IC 1ZSNA 1CXZA 4NHEA 2BYTA 3IAM1 3M6AA 3UPUA 3NONA 5CFMA 5IFKA 4LJYA 1JNYA 4WKOA 5B7PA 2DQYA 1E9CA 1P62B 2CGEA 4CI0B 2QDXA 3IMEA 3WLOA 5HUHA 4EG7A 4N6OA 2N75A 2OV1A 1P39A 2ZIXA 3OIGA 5K0GA 4OJNA 4G0PA 5DCLA 2YS6A 1PSDA 1HLPA 1NN3A 1QFZA 2P8JA 1OZFA 3LNTA 2HRZA 4X1KA 3R7AA 5BQ3A 5BXYA 1CZKA 1U8EA 1G5FA 3PQFA 1ZNZA 4JVNA 2JLCA 3GC6A 3RAPR 5CEEA 2Z9BA 2G1PA 1XQYA 2H0QA 2C78A 1YNSA 4X1IB 4LY9A 4OHKA 3AM1A 4FYVA 3PIIA 3M4ZA 3FLMA 4QHYA 4WECA 5DM1A 3UKJA 5DK4A 4TV9B 2PFGA 5FLEX 1KZGB 5DXFA 4ZYUA 4QLAA 1PGPA 3FOWA 1Y3FE 2Q7OE 4OYYA 4H15A 3GVCA 3C98A 4QYMA 3N5KA 5DW0A 3V5NA 1QIEA 1PL7A 2W6JD 2ZYSA 2G9UA 3EFOA 4RTPA 1XO1A 3P19A 1U5BB 1EBBA 2ZJ0A 3IP3A 3TZKA 2A33A 2NU6A 2ZWAA 1BHQ1 3I2FA 1P60A 3F9RA 3KZMA 1A9XB 5CX4A 3DBRA 3PGA1 4YT5A 4HQ0A 5AJVB 1JHYA 5JXIA 1U3UA 2FRXA 3PQCA 4W5OA 1VJCA 4MCJA 1Y7PA 1L5ZA 4HD8A 3PHCA 2R4QA 4BBZA 3HN7A 4MROA 1XEWY 3P0RA 1J9EA 2GF0A 2QOEA 4EW1A 3TKAA 1H6DA 5EMLA 1P4JA 1IG0A 1IHUA 3FSRA 4LZJA 2Q50A 3USES 1XMOB 5HCUA 5C18A 1A88A 1AN0A 3GJ0A 3CVOA 2QMHA 2C1XA 2FEAA 1MX9A 2WW8A 4YREA 2G83A 3KR1A 4KBGA 3D5TA 4JT8A 1QHEA 3VKVA 3WNZA 4CM7A 1JSZA 4YRFA 1VL6A 5J4LA 4KLNA 2WJGA 3T5GA 2HKIA 5DI3B 1CUAA 2YDXA 4JP2A 5B36A 5F3RA 5G0VA 4HO1X 5B6JA 6NULA 2I9PA 3K09A 2GPSA 3NMUF 1R6VA 1UWVA 5KNDA 1CP2A 3M6VA 4LG1A 4KHZA 3PUKA 5K01A 5KYTA 3R3ZA 1U80A 4FGLA 3ZNPA 2YY7A 2CMKA 2IDMA 5FTKA 1HX7A 3I8OA 4D3YA 4HNVA 5FYQA 2P41A 1O77A 1D6NA 1XAIA 2QRVB 4W7HA 3GT0A 4HX5A 4NEQA 2IW3A 3RHZA 1DEKA 3O8QB 4REQB 4BJHB 1ORVA 1J0CA 3Q9LA 1QCCA 4YH1A 1RNLA 1ORRA 1U8FO 5DXJA 4D92A 1S0UA 2BUBA 5KNCA 2X1VA 2BGRA 3R74A 2WSLA 1UM8A 1ZH2A 2MSNA 4RPCA 3AW9A 3QLTA 2QSUA 2Q6IA 2QJRA 2FYTA 2PS3A 3D8RA 1O57A 4JOQA 1AIPA 2RAUA 3ISJA 2V8BA 4UARA 4XUGB 3OMWA 2QYOA 3V48A 3UICA 3KC2A 4B4VA 1P77A 3T1NA 5IT5A 3WK7A 3JSAA 4FI3C 4BECA 3GPLA 2ECKA 4IHJA 3IMKA 4MA5A 4QHSA 1EWVA 2HA2A 4W8OA 3ZCPA 4JLNA 2BBSA 2R6DA 3GAZA 2RHLA 4B7AA 1G17A 3V32A 3RUEA 5EIWA 3JD0A 4BFXA 3SHFA 3VOSA 4CQLB 4NNPA 4WZBA 1TA9A 1IN7A 4UTXA 5CVTA 1E0DA 2PMFA 4QEDA 1NJGA 3IXLA 2ZRAA 1BVUA 3CTMA 2C98A 4J29A 5FTJA 5BXQC 3GZTB 2ZT6A 3NT4A 4M9QA 4NDZA 4D74A 1GKLA 4OFWA 4AC9A 1SOVA 5C5CA 4J0JA 1SIWA 1HQCA 1JKFA 1AQLA 2W8BB 1AJEA 2Q3BA 3K9WA 5JTUA 2R6GA 8MHTA 2CBXA 1NRXA 4IQ4A 4NOJA 3NIGB 4FNOA 3T7TA 2IS6A 2I2BA 3EH1A 2IEBA 2UXCB 2XNCA 3RSFA 2B99A 1MVNA 1DQSA 4KIWA 3HSKA 1G6Q1 5K1ZA 2CHGA 5LZ7A 3ECAA 4K6CA 4HMOA 2JIOA 5TVGA 1EESA 5A0FA 4HNGA 2G8LA 5SZIA 4QX6A 5F73A 1GA1A 3DOEA 2ACWA 3NM6B 5DX8A 4PCVA 3BC1A 2K7FA 5H82A 3MQFA 3TTWA 2IZ5A 2IZZA 3HXPA 3SMVA 2OG2A 4FZ5A 1VIDA 5CH5A 2JK0A 3NUQA 1U2EA 2Q4OA 5HJ7A 3H3FA 3QXJA 3C14C 2GLTA 1PZFA 1HKUA 3JTEA 1GAEO 4TKVA 1L0BA 5TF0A 1JIJA 2OY0A 2VT7A 2HCFA 4WPGA 3U7JA 2C5BA 4RTOA 4AQ7A 1DOHA 3AI3A 3U1TA 4UDNA 4RHYA 2VIIA 4QG3A 4RVOA 3VHQA 1XSEA 4EG0A 1L5RA 4HLUA 3ELBA 4E03A 2WFZA 2AJTA 3IV6A 4JUIA 1BS9A 1IWBB 2O7QA 2XYQA 3SYKA 4E1VA 5EG5A 1A4UA 4I50F 2GRUA 1GXSB 1BXZA 3AHGA 5CYOA 4JL8A 4RM3A 1GDDA 1BDJA 3F6BX 3PT9A 3AOEA 3L07A 4EEXA 1A50B 2YINC 4PG8A 2ZCUA 1W36C 2CCKA 2D2VA 3VDNB 2WD8A 4KX3A 2O3UA 1MJ5A 1XMPA 1JFLA 1PWXA 1FDTA 1QYVA 3MGGA 4UATA 5AXCA 3A6FA 4ARVA 4DWWA 1MJHA 1SUCA 5KWJA 2WA2A 4DYDA 2AKAB 2BGMA 4GSYA 2V54A 1T3ZA 3AMVA 5FWAA 2NSLA 5F64A 2BY4A 4UEJA 1H1DA 4MR7B 4HLNA 3AKYA 3DDZX 3FGPA 2I99A 1T6ZA 3H9BA 1UAAA 5CR9A 4BRSA 3SKYA 3EDCA 1Q84A 3R4VA 421PA 3LZ6A 4IIFA 3BKWA 4TWBA 5CLJA 5MGBA 5A4FS 3GJQA 2IHZA 5CNKA 3FPSA 3EGXB 2JANA 3GEGA 3Q2OA 4DMCA 4BLQA 2HA5A 2FNAA 5HZMA 4PXSA 1Z08A 2QZJA 1CIPA 3N87A 1UBLS 2VUSA 5JNUA 4WUVA 3HYLA 5FTMA 3OX4A 5TDHA 2BDTA 3DFIA 4AWAA 1QH9A 4QU5A 4G2TA 1E4EA 1K8XB 1NNI1 1UQUA 2AI1A 3A26A 1GGVA 3A2NA 3S7ZA 5AW4A 1PS0A 4DMFA 5JS1A 2BBTA 3CNLA 3K0BA 2FPKA 5FBVB 1PTKA 3VPHA 1PJ3A 2CMHA 1RJ9B 2E4VA 1RWWA 2X8JA 3COZA 3LDGA 3PENA 1JVSA 4RYDA 3OICA 3UQYS 4MMZB 4DWOA 5C8ZA 4YJFB 3GPDG 3UKOA 3KELA 5GY7A 1D4OA 2Z95A 3HDJA 3CUWA 4HRXA 2AIRA 1MX3A 4RK6A 1JA1A 2ZPTX 3EBPA 1GZUA 1XK7A 4ZQIA 5CNJA 4LJ5A 2RGWA 3HUUA 1IUPA 5JQWA 1CDEA 4C88A 2VOJA 1SCKA 4BMNA 4QNRA 4B71A 1T9ZA 4CM4B 1Z45A 1DRJA 4E33A 7REQA 4OHMA 1XTBA 2IBTA 3K9LA 4KB5A 1XHLA 1N7HA 2GARA 4I6JA 1YONA 3KFXA 4M9CA 1HL3A 1ZAKA 2IDZA 4HI0E 4NBSA 4ZGGA 4FHCA 1WHSB 2QUHA 3T5TA 4AG6A 3CZCA 3RYFA 1AQNA 1KDZA 1ISSA 3NIDB 3JY6A 3TL3A 1RIFA 4YI3A 3CISA 4YRDA 2GYUA 4FJ0A 1UXHA 1BN7A 1ONPA 3P9ZA 4M1EA 2ODEA 2DE0X 4CJXA 7GPBA 5K4GA 1RADA 2VS1A 4X6YA 4OHXA 4ZZ1A 3RVDA 1ZOIA 3WAJA 4F6RA 5DYWA 3P4XA 2CVFA 1GTG1 3DFFA 4YCNA 3OLQA 5CTJA 4O4IF 3KL4A 1NQ5A 4QRIA 1SWWA 1GUFA 2ZU0C 4FNMA 3PI6A 1VI6A 3ZD9A 4XX0A 2EDAA 5HJEA 3QFRA 5JJBA 3NRCA 3DOCA 1FP7A 1R27A 2DTEA 1EQ2A 1WQ1R 2QGNA 3FFAA 4WXMA 1ZR4A 1U4OA 4MV6A 2X2PA 4LBYA 3RLIA 3W4KA 4DLBA 3L7OA 2PKWA 4CTKA 1RWKA 2O1EA 1LPMA 4KQIA 3U7EB 1ZNXA 1XQVA 3V4FA 3WMRA 3WWEA 1KOGA 1YIDA 3NYWA 4D81A 1XZCA 3HBAA 1WDWB 4ZDJA 4E5UA 3RYIA 3LP6A 1DFIA 1CZNA 2G17A 2ODBA 2TSYB 4V2UA 5A7HA 5IJXA 2IH2A 3RYCA 2J0SA 2NVOA 1LX6A 1ZL2A 3TX2A 1BCSB 3L7BA 2XQFA 4P7KA 3M9XA 3EXG1 4ZVSA 3UT6A 3GJ3A 5BUCA 1EBFA 4PYQA 1ZC3A 5EZSA 5F4ZA 4PFQA 4X84A 4UULA 1MGPA 4CU2A 1DJQA 3RGGA 2FZCA 4ZMBA 3KKMA 4BXOB 1JHQA 4IXDA 2G76A 2ZWIA 3VYTB 2PXAA 2ZUCA 2V4UA 3JQBC 2WMDA 1YR1A 2JGNA 5J2TF 4BO6A 4J0KA 1OPRA 2I62A 3TRJA 1JG4A 1LV7A 2DZDA 2VPYA 3MAAC 4K9OA 4ZO8A 2E21A 2J3MA 1BOOA 3FLAA 4IIHA 1O6BA 4CKEA 1YI8A 3KB8A 1JG2A 2WIGA 1RLJA 3KAQA 2V6GA 2PAFA 3I42A 1L8AA 3BREA 4HRVA 1PJCA 1Z5VA 3OZTA 5KC9A 5KX5A 3ZDFA 3OF3A 2NO9A 3ZTYA 2ZKIA 3DKPA 2BEKA 3P2MA 3SM3A 4IG9A 3OVMA 3HCAA 4M0UA 3AUKA 2X7HA 5U4QA 4LPKA 4NZNA 1Y80A 2QMQA 1E5LA 1T3TA 1TKRA 4KE8A 3GLTA 2C2YA 2PZGA 3FYUA 5FUYA 3D6AA 3IELA 5G02A 3UENA 5C32A 4I1PA 1G63A 4N0MA 1WMEA 4IOLA 5JRDS 1OYWA 3QBEA 1XKQA 2DSNA 2AMFA 1OI2A 1RYHA 3N8HA 2Z56A 1M2VA 3MB5A 3O9MA 5BOVA 3VPGA 5CG1A 2HT1A 1JGTA 3X0DA 3CNQS 3W5VA 1LB1B 1XU4A 2REOA 1VA5A 2ZYWX 4LZZA 2ZI4A 5BN1A 4YRCA 2XX3A 4JVMA 2D4HA 2F2TA 2JFZA 3SIXA 4FEGA 3REGA 3U17A 2GBCA 1BX3A 2QTVA 4ZRMA 3VOTA 3CT6A 1JVNA 1PG5A 1PFYA 1ZU4A 3QKWA 3WTCA 4BBAA 3GDOA 3BFPA 2B2NA 2CWWA 2CJXA 2VH1A 3HZHA 4RJ2A 3W7AA 2XF2A 1M8GA 4FCCA 4HFNA 4TUYA 1H3FA 2WF5A 2ZATA 4H7KA 3VPAA 3DV0B 2H17A 5IC4A 3O6VA 4NJMB 4UD2A 1V7ZA 4YDSA 1GITA 1A97A 2B4KA 3PWZA 1Y4AE 3I1JA 4M0PA 4PAOA 2QVGA 3WRYA 1D2CA 5K8UA 1BXGA 1V8BA 5BT8A 1N7IA 3HCEA 3UAXA 1SXGA 1P7YA 3BE8A 3VUEA 3HUEA 2BI7A 3N2KB 3GCZA 1DOAA 5FAXA 1FRQA 3KOOA 2QD3A 2WSSD 4KPUB 1ZWKA 5K3EA 3AY6A 3W5IA 3MS7A 3OPYI 5JT1A 1DXYA 1HE8B 1FRFS 4UDYX 1WXWA 3ETJA 1HGXA 2HNKA 4FFDA 3LVQE 1IOWA 1LTHR 1FQWA 3NLLA 3OQNA 4F3YA 1WXQA 4MB0A 1TB4A 5CH3A 4C43A 5KTRA 4HAZA 3T52A 1P5JA 3I72A 2PJZA 3FLEA 2O57A 3SBDA 3DGEC 3B85A 3H04A 4A5SA 1KH3A 3I2GA 1FQOA 2BCGY 3GRCA 4D9BA 2H11A 1LSJA 2R1VA 2XD4A 1BD4A 2F7SA 3EDYA 5LBUA 4YCLA 3IEUA 1EUDB 3IUMA 4IXMA 4NCHA 4O4HF 3B7GA 3D0KA 5A05A 1UP4A 1QHHB 3VAAA 1JEJA 1NXWA 3NP7A 5IDVA 1PF7E 1VKNA 1L4FA 5LMCA 1UPUA 2OXCA 3VZPA 3NVKI 4AFNA 2PD6A 1PKEA 5IBCA 1NYRA 2HCJB 4QASA 1T15A 1HTTA 4PZZA 2EP7A 1UKAA 1W1UA 2O4UX 2RB5A 3CXRA 5B6IA 5D7NA 3HACA 4BDTA 3SBEA 3IVMA 1XEXA 2BFCA 3AP1A 4DC9A 3NWJA 1NM5A 2PIDA 5KSWB 1EP9A 1RWNA 1CY4A 1TK3A 4YQFA 1ECLA 2B94A 3O92A 1XU9A 1JQEA 3LBIA 1I2BA 5EP4A 2R6HA 1H9AA 3NKLA 4YQEA 5TS2A 1AKYA 3Q98A 1J90A 4U0KA 2PJDA 2YKGA 1UJCA 5K8JB 1HFEL 3O9ZA 5HF8A 2IPNA 5DN6A 3O1LA 3T3HA 3D3NA 3KZKA 3VPCA 4RGYA 4BGVA 2VAXA 3PRJA 1PCXA 3NXKA 4YAIA 2BKVA 3AJ9A 2IOHA 4LMBA 1Q3KA 1JDVA 2P67A 3F2IA 2FPPA 1GUDA 3ZI7A 1PYOA 3PEWA 4JVSB 2OR3A 1IB0A 4LQLA 4Q7LA 2X5NA 2GCEA 1K2VN 1RBQA 4DCOA 1GM5A 5LD2B 2CFOA 4MJ7A 3DO6A 3OZRA 3G02A 4IDQA 4UDOA 3WR5A 4AP9A 4K81B 1ZCFA 4DQDA 2XNJA 5AH0A 2G3YA 4MB6A 5E6UA 3AO0B 4OK5A 3VO1A 4D99A 5BWMA 1Z6AA 2X58A 1YZNA 5AIBA 2CFTA 4TQAA 3AHDA 4KLAA 1D8AA 5C9ZA 1KSFX 5E3IA 5HILA 3ABIA 4NYJQ 5GZ6A 3MMSA 2H08A 1RLUA 3N2NA 3GCGA 2JJMA 2FWMX 3O1JC 2LZ0A 4OU5A 3THWB 3A11A 2PBZA 3AB7A 3H2YA 4I50B 2P6UA 1X8LA 1QG2A 2CJWB 4TMXA 3C74A 4J0IA 2GLUA 3TM4A 3JVIA 3UGTA 2I2AA 3CF6R 2A9OA 4HQLA 3FR8A 3TSYA 3PFBA 4US2R 1CNEA 4LTNA 4OXQA 1Z06A 2BFEB 5JH7F 2CVZA 1EFVA 2H4YA 1EBUA 4V2IA 5JLAA 3LECA 2PCJA 1KOFA 1X1SA 2UZ1A 3H6KA 4EFNA 1H1LB 4X66B 3DDCA 2X2EA 4OQDA 3B48A 1BMDA 2ZRBA 3RS0A 3R7BA 5CVCA 3JQRA 4JJGA 1ZN2A 3NVMB 1R0RE 1U7PA 4U4AA 3OHSX 3UB3A 1SMKA 3HEAA 4ZVUA 4TN1A 3OJCA 3S8EA 2ZAIA 4HSGA 3JPWA 4PLHA 3T3GA 3HB9A 4A36A 3UTDA 4AF8A 3QY9A 1S1MA 1N0VC 4PAGA 2G28A 3HWSA 4GPAA 4U6SA 3UYKA 1RYYA 3VSCA 1G4AE 4W7SA 2Q0HA 4L78A 2VXYA 5J5AA 4P3OA 3DLCA 5K0NA 3ROFA 2I03A 1EWKA 3KHTA 3N5CA 3IX7A 4EA6A 2ESRA 1RVV1 2BLNA 3KYIB 2F9LA 1KF0A 3LDUA 4UU1A 3X1XA 4HRYA 4DLXA 3ZWBA 1NR1A 4G3XA 2Y0BA 3QHAA 3T5CA 3LUHA 5GADl 4YRAA 3M83A 4TN5A 2VBCA 1BU5A 3TTVA 5EWLA 2EFYA 2YMPA 1SC4A 1IAVA 4YCCA 3QSGA 1TYZA 5IJ0A 4WFKA 5AUQA 3RSCA 1WAMA 2H2GA 4BFUA 3KOUA 3L5OA 1FUYB 2P9EA 3H2IA 4NG4A 2YZNA 3ODGA 3L7NA 4TQGA 1QAOA 1EVQA 4IZ6A 1IHXA 2HMYB 3VGJA 1Q22A 2FDXA 3LXRA 5IH7A 3LCJA 4EQ6B 1LI5A 3LP8A 4Z86A 3ZW7A 3S2GA 5LU9A 4JI4B 3TD9A 2WUGA 3ESAA 2WVJA 1SPBS 3PPXA 4NS1A 1GZVA 3WGVA 4ZV9A 2IEAA 4A0RA 2IXTA 1O4WA 3ZV7A 1F2UA 1WE2A 5C7IO 1E1MA 3IRUA 1HE4A 3MILA 1QBGA 3U7QB 2A1UA 3PV0A 5ECDA 4PYJA 1QLJA 1NVAA 1L5VA 3GFGA 1P18A 2V7BA 4O1HA 1MVLA 1POWA 5EJAA 3QU5A 2O8DA 2C5AA 3ND9A 2R96A 5J4VA 5KJFA 5L95A 1SQFA 2BMVA 2I5PO 3M6XA 3SXPA 1EVJA 1ND5A 3STVA 4O3MA 1GEEA 1LF5A 2JKYA 1VSUA 3Q40A 4QHTA 5NLLA 2W6NA 3JASA 4H3HB 4QGFA 2BELA 2GPTA 3TK1A 2W37A 2E0IA 1JJIA 1NF9A 2REBA 4OQZA 2OZPA 1NR7A 2W6CX 2CKMA 2O5VA 1JKJB 1YVRA 3KR2A 2R00A 1F0YA 3O26A 1K6JA 2O19A 5I3ZA 3AV0B 4CT4B 1FEZA 1FYVA 2GZ1A 2WKWA 2XHZA 2AFRA 3BCRA 4Q05A 5K3FA 2E48A 4B3DA 5D5QA 1P4RA 5TMEA 4HXEB 4IY1A 4KPEC 4FQ5A 3W4IA 1AXGA 1GNRA 4L3OA 4HH0A 1MORA 3RTEA 3PQ4A 2AOTB 2FN9A 2IVZA 1ID1A 1RE1A 3HY4A 4PZAA 4PSDA 2CHEA 5DXAA 4KIJA 3ZHBA 4AQYB 5A0TA 4PCAA 3C48A 2BF7A 4WCDA 3COJA 1WSBA 1ESEA 3T7RA 1MBZA 2OHFA 2Z5LA 4DIBA 1Z0DA 3EEFA 3GFSA 2BH9A 1YKGA 2Z57A 3FWZA 3NHAA 5G0WA 4OVKA 5K3FB 3PTAA 3BKXA 4YQYA 1HYBA 2C97A 2CUZA 1RVDA 2H8KA 1PFVA 1RAAA 4CCAA 4B6PA 4L7VA 3FFXA 5A4JA 1H2AS 4WZAB 4AYWA 2OD7A 2XGSA 1JN0A 1ZLXA 1FA9A 2JGLA 2CY0A 1XTVA 2OXIA 3JASB 4OU4A 2WIJA 1QIKA 4ZODA 2QF7A 4LVUA 4RU1A 3HL4A 1QHGA 2JBAB 1HDIA 2ZIFA 4RDIA 4XJXA 5I4IA 5K5EA 4KFTA 1WNFA 3K96A 4YRLA 2V3VA 5B3JA 2WWXA 2OBBA 4FLEA 3OE5A 2J3DA 2O2DA 4PBSA 4UOQA 3VH2A 3TQCA 4I1SA 3H5TA 1PDWA 2F1OA 4CLRB 2WVHA 2OYCA 4WADA 2X40A 3QTBA 2IGTA 5CTAA 1DELA 3HYNA 2W6PA 1XA0A 2R44A 2VDKB 1OC2A 4MIKA 4G23A 4Y18A 4LHEA 2ZREA 3DDSA 1LQTA 3MXOA 4DFDA 1UJNA 2H5EA 3O2NA 1PR2A 3FMGA 3MJEA 3QG5A 4Q34A 4YVFA 4AZTA 3V33A 4HDRB 1K5HA 2H4ZA 2Z98A 3ZHUA 1CBUA 3WWZA 2VF2A 4LS3A 4MQ4A 1KIFA 4Q4LA 1QVRA 4F4IA 4RA6B 3HDGA 4LHSA 2ZJFA 4ARIA 1V5WA 1Q0SA 5EYPB 3AZOA 3GU3A 2QAGA 2GJSA 1RI5A 3ABQB 2O8EA 3DO8A 1FUKA 2DBQA 3OMXA 4B74A 2B9EA 3F90A 4IKOA 1PL8A 2QW0X 1E7RA 3PGXA 4KDCA 1HSZA 1S2LA 3BS4A 5CGQB 3ZIAA 4RH0A 1THGA 2KW5A 2VYVA 4PLZA 5CH8A 4D8WA 1QC5B 1G8FA 1G8KA 2HK9A 1EFTA 3HB0A 4K6FA 4NRDA 2QZZA 1FP4B 4FLMA 1X7WB 2OL4A 2H1RA 3SJCA 5MFZA 3LQFA 4FX2A 1S8OA 5KQLA 4UFOA 2C42A 3HKBB 1NG9A 3PEYA 3RJ9A 5F9HA 3KX2A 4QRDA 3UHPA 3MOSA 1J20A 2H2AA 5F7OA 4P3XA 5EWJB 3V3KA 4MQEA 3T4PA 3Q7EA 4I6EA 1I8TA 2J5XA 4LYGA 3BDIA 2OZVA 4HWGA 1YS9A 2OCIA 1SZJG 2FW6A 3ASYA 3DHVA 2P2DA 4CLEA 4LE2A 3AL0C 2R87A 1SU8A 1BYUA 1O6ZA 3EF1A 3CCFA 4G4SP 2CXTA 4M36A 5T6MA 2Z3WA 3TKYA 1Z25A 4F2GA 3A6PC 2A5JA 2C2BA 3F96A 3UTCA 2IVFA 1SCNE 4YASA 3QWHA 4OQFA 5FL7D 2H5IA 3W2EA 1X9GA 4WCFA 2PUDA 4P38A 3I83A 4G37A 3WYBA 5FOVA 1YHNA 1R88A 4KTTE 1D0IA 1DNPA 3FGNA 4FFBA 1D6MA 3UKDA 2YBDA 3IIEA 5LQAA 1IEXA 1NBOA 2JLBA 1T8WA 2J4CA 3C87A 3L3BA 1EM8B 3GJ4A 3ONDA 2ZUEA 2GCGA 2BFEA 3E9EA 1J00A 5HMLA 1GZ3A 1FDSA 5JCPA 3TBFA 5BWLA 2O2EA 1WP4A 1IUOA 3KOZA 1FTQA 3W90A 4CKWA 1JEYB 2RHHA 3UMFA 4G5HA 5D87A 2HU2A 2QTGA 5JTTA 4BN4A 2JDID 3B89A 3GR6A 2W2MA 4I50A 5KCMA 5B5SA 3AY3A 3FF1A 1E94E 1K27A 1KPHA 1L5MA 2BPOA 2BAGA 4MMYB 4QDZA 4TYWA 1PDVA 3UHOA 3JQ7B 2NWQA 1TFRA 2CVHA 1DS6A 2V74B 1SZDA 3ACCA 3N2GB 3FSGD 4Z3OA 5IKXA 1M2NA 2J0EA 2ZRKA 2GF2A 2Y6VA 3G9UA 4UU0A 5JD6A 4X8HA 2XZDA 2X6RA 2F17A 1W0KD 3TIXB 4FFVA 5ITSA 3SDZA 4EUEA 2VYCA 3TPFA 1I7SB 1C1DB 3BN3A 1GGEA 3JD1A 4R31A 3UH0A 4C6TB 1HFKA 1N4DA 3QFSA 4YJKA 1IHYA 1LGYA 3H75A 4TYMA 3G7NA 5DHAA 4ZJUA 2YC4C 4RC9A 4HP8A 3W3ZB 1XI2A 2PKCA 2A1TS 1B3RA 2VR1A 2XUQA 4H59A 2IZ6A 3KSRA 4JC4A 5FT9A 3O4IA 4EO7A 4CF6A 1DKQA 2H5LA 2OO7A 3GFOA 4N18A 3QJGA 5BRNA 5SYNA 3HBLA 4IJVA 1YQDA 1A9SA 5G41A 5IKEA 4YA6A 5EIAA 1VKHA 3FKJA 1JZQA 1UK7A 2Z09A 3MGKA 5CDFE 4RKYA 4C5AA 5TLSA 4S1WA 1V9LA 4PC6A 3N39C 4BB6A 2EHJA 2BGJA 3LY5A 4FEYA 4QFBA 1QDLB 5AVUA 1PFKA 1E58A 2NSJA 2NU8B 1KORA 3WIVA 1P2VA 3EX7C 1CLUA 3EHDA 1VBFA 2XR1A 4XVUA 1FTSA 3BSWA 1RXVA 3AVYA 2O4CA 3PF8A 1UM9B 3P8ZA 1NP7A 2GT1A 5C0OE 1JG1A 2JRLA 3EF0A 4PSKA 2PUFA 2DHRA 2FPWA 1Z5GA 5TSDA 3DAYA 3W6UA 4MSUA 4WD3A 2C4MA 2WWRA 3IQIX 1LUAA 4J49A 1NSTA 2HMAA 4Y6SA 4C4YA 1H93A 5GONB 1V5FA 1E6CA 2NZYA 4HQ6A 4DR2B 1NASA 1NNLA 4RFSA 3EGIA 1X1QA 3P4UA 4JMLA 3CUUA 4PICA 2XTMA 3UK2A 2ID8A 4EHBA 4HPJB 4LDRA 3L0OA 5CIQA 4LFAB 4WVFA 1R10A 3DFKA 1BQ3A 4RH3A 4QARA 4WKBA 3B2NA 4OHRA 3S1SA 4EGFA 1UPXA 3A0RB 2FOLA 4Q19A 1EXWA 4ZARA 5KS2A 2I7VA 1UBTS 1Z7GA 2W6OA 5REQA 1NY5A 1QIGA 1YJ5A 2Z9CA 5KVAA 1L7MA 2ZSIA 1R6UA 4IIYA 1XLTA 4RM2A 3SIWA 3AJEA 3OCVA 4GKBA 1AQ6A 2Y1WA 2B0JA 4GMGA 2FUKA 5KU7A 1TQ8A 4FB5A 4XGQA 4LMRA 3CEAA 3H1TA 4IYRA 4J0QA 2XA1A 4IEFB 2HQOA 4YMSA 5FV4A 4F2PA 5IWCA 2DY0A 2RHMA 3IBSA 4KXWA 3L0PA 4Y2TA 1GFWA 4V0SA 1W6UA 3G17A 4KH1A 1QR6A 4FFMA 3PZRA 4AF7A 1P0PA 1H2FA 3EPLA 3ASZA 2YS7A 3BGOS 3T9EA 4DV7B 2XUKA 5BW4A 4KACA 5LXTF 1F20A 1P7WA 1WCYA 1XJWA 2J07A 2OHIA 5BWBA 1B6SA 3C5WP 1XWIA 3I39X 2P40A 5LBTA 3AR5A 1Q0RA 3G85A 1XD8A 1H2ZA 1BJTA 4L9SA 3AM3A 4MQ5A 4QVKA 5EGNA 1O1YA 3FSJX 5IVDA 1XXHB 5CPFA 2OBLA 5JQGB 5DTMA 2INGX 2VAVA 4OMCA 1SO8A 4UJ5A 2NQ2C 4B3FX 3NHUA 2C9OA 2WYOA 2C54A 2D00A 3KT3A 3DVRX 2JARA 4G2NA 1G8SA 3V8PA 2J48A 3E23A 3RG8A 1N1GA 1NUUA 1VE7A 4AUNA 4WDRA 1IJBA 1Q7CA 1S2IA 3T1OA 5FFNA 1L8OA 5A3SA 5B57C 2P9CA 3AQIA 5B3JC 4F7DA 4NMMA 3PUWA 1UP7A 2JIPA 5EMMA 3PHJA 4O29A 4H6XA 4H1WA 4URHA 3TGLA 1BH2A 4L0DA 1QRDA 5L3RA 3PXXA 3CLTD 4E2WA 1TCUA 3G2HA 1QVZA 3PX2A 4C7BA 4K5QA 5DI3A 4XKJA 1IN8A 3KQWA 4CV2A 2MSWA 3FY4A 1OFTA 4DLLA 1M2WA 2IU3A 4JCCA 1BVRA 3M6IA 4MGYR 1WDLA 4LQCA 4RJJA 4W5WA 2IYAA 3AEUB 2WWWA 3HBJA 4JR0A 1WP9A 5FV7A 3JR3A 5CCXA 3R3UA 3R6WA 2Y4OA 3TSZA 5JSHA 2A88A 3O03A 1J99A 2RB4A 2HAEA 1ECGA 3ESDA 3R6GA 4KEAA 3ZE9A 1P0FA 1DKPA 3GT4A 4DCTA 4K9DA 4H9GA 2NUTB 1P2GA 2P0AA 2BGKA 4ZKDA 3AHCA 3MT9A 3QNWA 2C0QA 3O31A 2I34A 4C9BA 1ZXBA 2W6ID 3PDJA 1IPHA 1SG6A 4FEAA 2M1ZA 4G5XA 1Z0AA 2QMOA 4Q00A 2G67A 4M0KA 1KEUA 1SQGA 2LGJA 4ROSA 5AKZA 2VKQA 4QFDA 1E64A 2WMNB 4WCFC 2OZLA 4R8VA 3GGGA 2BEUA 4F8JA 1YA8A 3AEUA 3F8TA 4Q01A 1SB8A 1ND6A 4YAFA 4DR6B 1Z28A 1D1TA 3CCCA 4R01A 4CQJA 1DUVG 1E2KA 3GLHE 3ONWA 3DL7A 1QH1B 2IWHA 5BMVA 5KPJA 2G63A 2O59A 4X7PA 3BMXA 4FIZA 4GYWA 4Z0HO 4ZI5A 3SN6A 3B12A 4OHVA 3UA3A 2V3WA 3CGGA 1YL6A 3OE7D 4Z4IA 3EVTA 4OMUA 2J59A 4I4TA 2G04A 1W4LA 3SZUA 1TEVA 4ISCA 4WUTA 4XUDA 2R11A 3CY6A 2GGSA 1FIUA 5DJ5A 4LC9A 2O2JA 1JP7A 1KP2A 4X8OA 4WZ6A 1YFJA 5DBGA 1FVOA 4OMDA 1MQSA 5AI4A 5IANA 3VPDA 3IKTA 3PC3A 4I9GA 4B45A 3LPDA 2IPMA 1FMCA 4D41A 2JLYA 3ITKA 3OJLA 4FZ3A 4M8KA 1QAMA 1ZH6A 2VZ8A 3LV8A 1SUWA 2JKVA 1ZOPA 2ZIXB 1GAWA 3WGJA 2YICA 5EQFA 3NDPA 1VMAA 2JJYA 2AG8A 5DX0A 1PEYA 1VIVA 2XRFA 1YZFA 1G38A 3MGAA 3ADCA 3ONNA 4KFUA 2MMGA 4AT1A 1R8QA 1IY0A 2YHBA 4V24A 4D4JA 4AKGA 4QGSA 2WHPB 3K92A 1R64A 1G59A 2L2QA 1X15A 4CV3A 5JRJA 4CUKA 4EECA 3EIQA 4PPGA 4HH1A 3HJTA 5B12A 2EWMA 3HWX1 4HH4A 3T1QA 2CT8A 4OHBA 4LXGA 2DWUA 4EO9A 4GWGA 5IHXA 4NAUA 3RR2A 4CM5A 1II8B 1D9XA 1CF2O 1FBTA 1XZJA 3SPXA 4F4JA 1M7GA 4N03A 4GX0A 4ZAFA 1CUUA 1E32A 1EUQA 3BEOA 4P5DA 1E2FA 1XZDA 3C7AA 5DTJA 2FRVA 3RQIA 1TU3A 3I1IA 2W93A 3NTXA 3ZX5A 1TVEA 4WY2A 2QX9A 1W2HA 4Q1DA 1FNMA 1NMEA 2ZSJA 3MJFA 4KAXA 3KBOA 1AUPA 2OFWA 2NVBA 2O48X 4L2IB 4QUKA 4CF4A 3AKZA 2WM3A 4BKOA 3VR3A 1BKSB 4Y1GA 3EMKA 1K5GA 1JR3D 2FMFA 3LQQA 3RSZA 4EUFA 1U2DC 1JLSA 4YT2A 2AMVA 4MIOA 3AIKA 1B6RA 2HSGA 3RAGA 5E4YA 5BN3B 4NENA 1Q1BA 4AKEA 4C05A 4UQPA 5CCDA 1IATA 4OYRA 2NAFA 3BZUA 2H54A 4XJSA 3SF8A 2GEVA 1ACMA 2YRWA 1JQJC 4FKZA 4TKZA 3O8RA 4MAAA 2BHRA 3FVVA 5KDOA 3OKCA 3M5DA 1GQFA 3GYGA 1JAHA 2BFDA 4HLUC 4EHHA 3OG9A 5CYPA 3KNZA 1GGJA 1JQKA 1O0SA 2VATA 3CZQA 3OEED 2XUHA 4WXYB 1UWKA 4D3ZA 1JA0A 1DBWA 3MJVA 1IN5A 2FSSA 5KAMA 5C1DA 1NVGA 3NR2A 4R2XA 4DJFC 4V39A 1E7QA 4TUYB 3KUKA 2DC1A 4G84A 4L57A 2PKYX 4R6WA 4RHCA 3WGNA 1MAUA 2Z4RA 1ORDA 1GZHB 2BFFB 3EWAA 4K2AA 1R8XA 2YX1A 5AKKA 1FDVA 2AXNA 4L76A 4WEQA 4B46A 5DM2A 3FX2A 1E89A 1Y8ZA 3WV5A 4AZVA 1X7XA 5IEJA 3U39A 1NLFA 3GT3A 1YOVA 3PEVA 1M75A 1P7PA 5IKOA 2HA3A 4ZGBA 4CIDA 2QX6A 5CLGA 4EJ0A 1V5IA 1QV6A 3RSLA 1HYHA 1UKEA 3OESA 5DOZA 2OKGA 4BO0A 4TRRA 1HL7A 3ZHSA 3PDIA 1IWOA 2CB0A 4JL5A 4WL0A 1NMSA 3K9NA 5BSHA 1GNVA 1HLDA 3HMQA 1DBPA 2OWEA 1IB6A 1U28A 1DI0A 3FVQA 2YHSA 4IOJA 4S0ZA 3G79A 1NTOA 1DIRA 1ZICA 3TSAA 3DZDA 3ADPA 3K6SA 1YMQA 3AHFA 1NF3A 1GLNA 3F6YA 4KZKA 4DQXA 4EL5A 1CD5A 3V2GA 4LJSA 5KYYA 1LBIA 3E3OA 1ATZA 2ZRHA 1KAHA 1AZLA 4PFSA 4ZK2A 1CS0A 3IUEA 3AHHA 4BFWA 3UYLA 2QS9A 5K45A 1O7JA 4OM8A 1TC1A 4LXTA 1Z5UA 1P73A 4RGQA 1O96B 2ZS7A 1TCVA 3A1NA 3ZWXA 1VRVA 2RAFA 3DBOB 3WYEA 3FE2A 3PNKA 3RFTA 4TZ0A 5E6SA 3A70A 2XTZA 1KH1A 2XUOA 4NMWA 4G4JA 5H9WA 3VKHA 3OJWA 2WRZA 4EZIA 4EY8A 4CKZA 3IQZA 5C1PA 5CVUA 1V6SA 3AVTA 2NGRA 1ZW1A 3H8VA 4HG2A 4PHGA 4BKMA 3NNDA 1RM5A 2X4IA 3I9FA 3NAQA 1KEKA 3ANNA 2P75A 2XKAA 3WWYA 2ZYUX 2ZXUA 3VJRA 3L01A 4WK4B 2VAMA 1UBEA 2PSDA 3FMFA 2OPHA 4N5HX 3OQJA 4GYKA 1AGYA 2GKOA 3OKAA 3RIGA 3RE1A 3MUNA 5DVZA 2X19A 4HLQB 1IPFA 3GEIA 3Q0EA 3LSTA 1EHYA 4V38A 2G9ZA 3WKBA 3IOMA 5D51S 3ZV5A 1RZ3A 2WTNA 1ULZA 3N0TA 3SS9X 4C2BA 1EFRA 3HCPA 2IIBA 2RH4A 3OQBA 3W34A 2D1YA 3T4XA 2P11A 2VOEA 3OLZA 4JV5B 1VL8A 2OILA 3QQ5A 2PR2A 4PYMA 4LWPA 1CVRA 1PV2A 2OESA 3L8HA 1XB2A 4GQIA 4IGAA 3FF4A 4GZ6A 4TYYA 1ESMA 1W5SA 1OV6A 2QE7D 2VJQA 4KUHA 4D80A 5I7HA 2HJ9A 3IHKA 3OUZA 5ALFA 5JNLA 5F1PA 1HR0B 1LDYA 1HUQA 4YP6A 1VCNA 3OTIA 5CFOA 4QIHA 1U4SA 5AKEA 2JFUA 4I99A 3VSAA 3DEFA 3WMGA 5E8RA 1IVYA 3RIMA 4C22A 4MRRA 1DLJA 2IZ0A 1ZN9A 4R2WA 2ODWA 1QGED 2AT1A 2X9GA 3LBHA 5CX1A 1FX1A 4YB8A 4UTRA 3FD8A 3QPDA 5KREA 3VVBA 3O8NA 4GZ5A 5TMDA 3FTCA 3DP7A 4CCYA 4M1YA 1TUBB 4EMUA 4XQ9A 4GDFA 2R8BA 3KIPA 3ODPA 4OM7A 3BD7A 3OZBA 1AURA 2JGKA 2X2OA 1QYDA 4ZQBA 4BNIA 4MV0A 5CVEA 3AVOA 3QU7A 4MR9A 1US8B 5KJCA 2WYIA 2OZKA 3TQQA 4IFIA 2I8CA 4TVOA 1NF8A 1J0DA 4ZOCA 3JQAB 1U2GA 4DSAA 1BXRB 1XNHA 3EDMA 5I9NA 3IAAA 1ACLA 2A58A 2I2XB 5FUXA 2Q6KA 1IULA 1L3CA 1CP3A 3B3AA 2H1IA 3CVWA 4I6GA 1TT5B 1OT5A 1YVDA 2V5AA 3ZLTA 2C8LA 1O0BA 2NU7B 4YJFA 4KQCA 4UASA 4URXR 2CL7X 4IHKA 2GAIA 4RPKA 2D0IA 1C7RA 3I58A 4BX8A 1RE0A 1WCV1 5JU6A 4TYQA 3W6NA 2AD5A 2R9VA 4F9TA 4TLAA 1BXRA 3X3HA 4JQOA 1JF8A 1M6EX 3BH0A 2G5PA 1WY5A 4BFYA 3KQHA 2TMKA 1V3VA 3QITA 3A27A 1QZZA 1JMYA 4EYOA 2RGRA 1CERA 4LI0A 4JBXA 4AL4A 3R8FA 2F1JA 4MRAA 2GILA 4RO0A 1XCBA 4AO8A 4ZI7F 5E9JA 1CZLA 1XWWA 1T9KA 3JWPA 1K89A 1WXXA 2LR0A 3ML1A 3WP1B 3FDZB 5AICA 1EJBA 2F64A 5A3JA 1NATA 2V6JA 3GELA 4WK2B 1PT6A 1A4RA 1Q0QA 1EWRA 1VL1A 4Y1RB 1NW3A 4Y3UA 1EUZA 1W19A 1O87A 3RS8A 2J9FA 4Q9HA 2NPIA 3UXHA 5KO2A 1KBQA 1AHNA 2XOXA 2IL1A 3CMCO 2I7TA 1RQ2A 3BTUA 4L02A 1WWKA 4CM4A 2P3SA 3B20A 4II7A 4MZDA 4POOA 4JEMA 4D0RA 3G3EA 5BOSB 1T5OA 2G4VA 3Q8MA 2KMLA 10MHA 5AW1A 3GA0A 2XT9A 1ADYA 1NXTA 1P6UA 2OGUA 2WT4A 4KBYA 2IYWA 4YRGA 1BQ4A 3LU1A 4S1VA 1A9ZA 4TUYF 4N48A 5EJ8A 4DUGD 5K0TA 3DWFA 1QGYA 3RVLA 5EMJA 3W5HA 3PL1A 3L02A 3U0BA 5TXGA 3AFHA 2BEVB 4P0QB 3AUXA 1Y6GA 1UDWA 1R74A 1P2DA 9ATCA 1U94A 4TTQA 4BN5A 2NO7A 4BZZA 1DQRA