1NVAA

Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
380
Chain Sequence
PTKISILGRESIIADFGLWRNYVAKDLISDCSSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPSPRLLIYNRPPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAETILKAVRREVTPGEHRFEGTEEILKARILASARHKAYVVSAGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMFNMALDPKKKIVLLSAIGTPYETRASVVANEDIRVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE SYNTHASE
publication title Ligand-induced Conformational Changes and a Mechanism for Domain Closure in Aspergillus nidulans Dehydroquinate Synthase
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Lyase
total genus 135
structure length 380
sequence length 389
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1nvaA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nvaA01
1NVFA 3CE9A 2D2XA 1DQSA 3IV7A 3QBDA 1XAGA 1TA9A 1NVAA 3CLHA 1NVDA 3OWOA 1KQ3A 1OJ7A 3ZDRA 1JPUA 1RRMA 1UJNA 3RF7A 1JQ5A 3HL0A 4QGSA 5HVNA 1VLJA 4RFLA 4FR2A 5BR4A 2BL4A 4MCAA 4RGVA 1XAHA 1NRXA 2BI4A 1JQAA 3BFJA 1XALA 4RGQA 1SG6A 1XAJA 3JZDA 1NVEA 2GRUA 3W5SA 4P53A 3OKFA 3OX4A 1NR5A 3QBEA 3UHJA 5FB3A 5K8CA 5EKSA 1NUAA 1NVBA 3ZOKA 1VHDA 1O2DA 1XAIA
chains in the Genus database with same CATH superfamily
3KETA 1RPZA 1Z5WA 5F2EA 2W6MA 2HW8A 1NQ5A 2QAGB 3AB7A 3ZDRA 4U8GA 3RC9A 3ESRA 2UZAA 4W5WA 1NW7A 1JECA 2C5AA 3BBPA 4B6OA 1YUMA 3BJEA 5JJBA 3KXKA 2P6OA 2X5JO 1EWYA 5MN6A 1JDBC 1JIUA 3JWIA 3IRVA 1VIAA 3RUDA 3LPMA 2BP7B 1L5MA 1II9A 2G76A 1A9TA 2DU8A 1A97A 2KB0A 2XDAA 3JR7A 4BN0A 4C5CA 3TMYA 3ZJ4A 1NM5A 2W2MA 2R86A 3A9TA 3H4MA 1JHMA 1QCYA 1BDBA 4LZPA 2C9DA 2J0VA 1T24A 3K9WA 3QHAA 2CD9A 4HB2A 3A1NA 4JP2A 3U17A 4DR4B 1FQOA 4L4UA 1LBQA 4F3KA 2XQFA 5EUCA 4E3ZA 2Z9CA 3ZI7A 4FFBA 1HLDA 1DLIA 3CQ9A 3FYTA 3E9MA 3AI3A 3HN7A 4YXWD 1THGA 2FEXA 2UVPB 4JEUA 4WECA 5FEMA 3W8NA 4YMHA 5K0JA 1ZD1A 5AIAA 3UYKA 5CH5A 3RJ5A 4DLWA 2VQDA 1J9EA 3AKYA 4FMCF 4JXJA 4ZAXA 2C7OA 1I6MA 1NAHA 3DD5A 3NHMA 4KO8A 2EDCA 1E2BA 1B2RA 1TJ5A 4M1EA 2W4IA 1HT0A 1RRPA 1FNBA 3JD1A 1P3DA 3NEJA 2IPLA 5A4MS 2ZYIA 3BDVA 2GYVA 3L0PA 4ESEA 2BFEA 1TZKA 3BWEA 1E5QA 3KYDB 2O2DA 3AP3A 4DCTA 4FFPA 2FFBA 2J9ZB 1W1IA 1LNZA 4OLFA 4CIYA 1KQPA 1N8SA 4ZHSA 5I8PA 4H7JA 1A7UA 5DCUA 1NN5A 2HMUA 4YMLA 3ETCA 1OFVA 1C4OA 1QQTA 3OHSX 2UZ3A 3OOSA 2ATXA 3B6EA 3PNSA 2O57A 4OK6A 4X1KB 5KNDD 1GXSA 3R2JA 2GN0A 4NAVA 4YP6A 2I1WA 5HJ5A 2C5SA 5A0VA 2NYVA 1ZI8A 5JATA 2Q5JA 4D7AA 3VHQA 3UM9A 3AJDA 3N5CA 4IGEA 3G1UA 1WQ1R 5COBA 1G8FA 1ZKMA 1PFQA 2EOAA 2F17A 1RRKA 3ADPA 4CM8A 3B2QA 4I1UA 1L7PA 4JA2A 4XOIA 121PA 3LLUA 3HXKA 1UBRS 3LWNA 4WRRA 5A6SA 3IEVA 1L4YA 3CUUA 3BXOA 5E6UB 3PE3A 3B5JA 1PJ3A 3NI2A 5DJ5A 1B15A 3C3JA 3QV1A 1UPTA 3PDHA 5EIHA 1SGWA 1A76A 1FB5A 2CCGA 1L7NA 4BNLA 2HYIC 4P4LA 4R8RA 2J31A 2CUKA 1KYIA 1CS0B 3NLLA 1GZUA 3L46A 1WEHA 4S2EA 1CIJA 3EIQA 1RZRA 621PA 1J39A 3PI6A 4B8ZA 2F4VB 3L79A 4JASB 2BKAA 1EUCB 2BW0A 4IDPA 4IJ6A 1RI4A 2QV0A 2EWWA 1CZRA 2BEUA 3I64A 3N07A 5K3BA 1W59A 1Q15A 4ZDWA 3UC5A 4PIPA 2Y0PA 4MV5A 1CNEA 3AUSA 1NUUA 3AEUB 3PLNA 4R1LA 2QTHA 1EGMB 4YFVA 5BSKA 3MJSA 1AK1A 5DHRA 3FHJA 3VC7A 1LPPA 4A6DA 5AOBA 2ZCJA 2VYND 3OKCA 1AS2A 2JNWA 5FCDA 4OYHA 5AI9A 4BNXA 4HGNA 3W90A 4BJ1A 2WJWA 4LQ4A 4AS3A 5CX1B 4XDYA 2FFHA 4C7OB 2ZB3A 1K6EA 1KAGA 1R5NA 2APJA 2VR1A 3LFUA 4HDKB 4W5JA 5B2ZA 1CB7A 1CUIA 1ZIPA 2GERA 4OKIA 3G8CA 3TW6A 3HK2A 4CM7A 2B5WA 2Z56A 5CLLA 4HJXA 4CT0A 4IH9A 4Z7OB 4ZYZA 3ZZ1A 1KOJA 4YMWA 3UWPA 5CA0F 5LU8A 4ND2A 1VPWA 4M9UA 1F3LA 1E79A 1H8HA 1JPJA 4ISBA 5E3IA 3WBBA 4FMPA 4WA7A 4D41A 9ABPA 4FM9A 1E6UA 1T8TA 3KOUA 3H9GA 2Z1NA 1OIVA 1XGKA 2G9RA 1NASA 4YH1A 2HHJA 2I1VB 1ZR2A 3L04A 1Y8ZA 4KN6A 2NQTA 3MAAC 2CHFA 1NVWQ 1T1GA 4LDJA 4MO9A 5IPFA 3LT0A 4X7PA 5AUQA 5T64A 5CBPA 4UU8A 5HJ2A 4M0FA 1B0UA 4DDHA 2IYPA 4EPWA 4BKPA 2GN4A 3EYWA 1Y89A 2H4JA 4PR0A 1V43A 1P0PA 1TVMA 4BBPA 2OHFA 3A6DA 3DZ8A 3CUYA 2I34A 2YS6A 4OA5A 1WOYA 3SIWA 1XFDA 4KK3A 4J49A 4UOZA 1QRSA 4RELA 4RWEA 3O5AA 3OT5A 2FF5A 2KJQA 4LFCB 2E55A 1HSZA 4OHBA 1RI3A 1UZMA 4IEIA 3VYWA 3OA2A 2YJZA 4MKZA 4AB1A 1KDPA 4DJAA 4A36A 2O8CB 3SQNA 4JVLA 5JS6A 2W2OA 2MR6A 5DBFA 4FLMA 3ZVRA 1IG3A 1GIAA 2B8TA 5L53A 2QTNA 1HV8A 5AKZA 5K0NA 1DL5A 4L15A 4NZOA 1IWBB 1JIJA 5KVCA 1U2GA 2R00C 3OM8A 4OU4A 3GRVA 1JR4A 5SYAA 1JLLA 3N05A 3UO8B 5IK2D 3GNQA 2HLDA 5MDHA 5AK3A 4N8DA 1DFHA 4DRXB 5EJ8A 3RKSA 3UANA 1Q1ZA 4TV8B 3WKEA 3ZBTA 4EGJA 2QRMA 1V96A 4PN3A 1UQTA 5LOVB 1HBJA 2LCQA 4PN7A 1B8PA 3JWPA 3UMBA 1QPZA 1IBMB 3WL7A 2PWBA 2PJZA 4AJJA 4KQEA 4RU1A 1A82A 2RGAA 5K3OA 1KAOA 1SOUA 5SYMA 1USVA 1SFRA 1LXCA 2X5NA 1XDDA 4PSUA 3DKPA 3H9CA 3WLFA 3HXQA 4TMWA 1TAUA 4I9HA 2IY8A 1XO1A 1I80A 2QTTA 3P32A 1N1EA 4V24A 3F0TA 3U3JA 3V48A 3V8BA 4E6PA 4F06A 3U13A 4MV0A 1GARA 2HADA 1CXZA 2OLKA 2QT0A 2ZETA 4GX2A 4DLYA 1FTQA 4M0CA 4EEKA 5M5BA 1N5JA 2J07A 1NY6A 2QVYX 3N86A 3VU8A 5DGIA 3SFZA 2P2NA 4AS2A 4P4UA 3ML1A 4QGAA 4YJFA 3C7TA 3IXLA 3QVLA 2Z43A 4G9EA 2Q29A 3K0AB 3E3OA 1ZVKA 1XRJA 1M1NA 2ZYWX 1XDWA 2IHVA 3RC7A 1A9PA 1KO7A 4CKBA 4DY6A 1PVOA 5BSHA 3RLIA 1RIIA 3DV0B 4IXNA 2Q7XA 4YN3A 5JJ5A 4PTZA 1J9ZA 3E3MA 2ILVA 3DZDA 1Z0KA 1L4FA 3G5LA 2ZSFA 1CRQA 1WAMA 3HCOA 1BHSA 1P1RA 4DMLA 2ZI6A 3KKOA 1T5TA 4MKGA 3TNFA 2D1RA 3A6LA 4Q4AB 3T1OA 5BSVA 2JEYA 4HTAA 2C4VA 4Q1FA 4XIIA 3WO0A 3OOWA 3KJXA 3T06B 3SXUB 5B1HA 3GUVA 4AJ9A 4DG8A 1G2PA 5B5SA 2JFFA 2OOSA 3IQFA 5MGBA 4ND4A 4U9UA 1MVNA 3E2IA 1T4DA 3WWPA 4CDNA 3EZ9A 4KUGA 5SY9A 3QBDA 4OHCA 3P96A 3GCXA 2OXEA 4LUCA 1BX3A 3OSUA 1NRWA 1BNCA 1PQWA 1XTJA 2D8AA 4IIBA 4LJYA 3EFOA 4A10A 3LPCA 4CM4B 2XE7A 3PQDA 4DV1B 5FUYA 1CULC 4UTXA 4WAUA 3UTCA 1IG0A 5EPOA 1N1DA 4WJKB 1ZH6A 4UPEA 2G28A 2V7XA 1T0JB 2WJ6A 4M83A 1JSRA 1OX4B 4GDMA 4IV8A 4QPNA 1N2CE 3IFSA 4ZC8A 4E03A 3VNQA 3JQ8A 1YZHA 4GXNA 1KGDA 2H2FA 4LEIA 4PICA 2UV8A 1EDDA 3ZWXA 1JZSA 3BCHA 5HS6A 5I45A 4D8XA 1YZTA 2FPUA 3LUBA 1S4QA 3G5AA 2KPOA 3E53A 3TM4A 1XZIA 2ZW9A 4YRIA 4N41A 4Z7JA 1Z2AA 4MS3A 4P86A 5ERGB 1JLMA 2RHWA 3BHNA 1Q95A 1TI7A 3D2AA 4Z5XA 4HQFA 5AW7A 4E5VA 3AO0B 4I1SA 4BUJA 1WPRA 1T2NA 3EXHC 3OP4A 4L0QA 2WYUA 3DOOA 3EUEA 4I4IA 5EHNA 4BNFA 2O2GA 2X1VA 2ZYVX 2PGLA 4KQIA 2WWYA 3ASYA 2ZBRA 3TJRA 2X0KA 2ZGVA 3OTWA 4LWPA 1PYOA 2BFFB 2BGTA 3ASVA 3PUVA 5D00A 4XQ9A 4BLTA 1DIHA 2VBIA 4F21A 3ZJUA 5KX5F 4EY3A 3HKDA 4A8JB 3M81A 4O2AF 5G4LA 4BQRA 3LTEA 4XYBA 4A5OA 3A2NA 2CXUA 5FWYA 2JJMA 5IG2A 4XYLA 1VC2A 2PU5A 3KAJA 4KIUA 3MB5A 2FV8A 4KUEA 4QPPA 2W2KB 1L5NA 1U8YA 5JVDF 3CW8X 3QVOA 4H1WA 4NYJQ 5E1MA 3OBIA 3NANA 4DLNA 3GQVA 1U0OC 3PR3A 3GLFE 4F4HA 3WRXA 2CL7X 1VE3A 2ZU6A 5CT6A 3VR1A 1FP2A 4IHQA 3LQ4A 1HDXA 3PUKA 4Q4JB 4QFDA 2RCNA 2W9XA 5A4JA 4R7GA 5D5QA 4MVJI 1XVAA 3KL2A 2BEWA 2MDTA 5IM4A 3Q7SA 3NTRA 3PUHA 1C9EA 4D0NA 2IUUA 3F2VA 2QWXA 4IDOA 1KYXA 4MUYA 5DTIA 1XEXA 5JQWA 3OIYA 3M6AA 1R6DA 4GUDA 7GPBA 3RRJA 5DCLA 2CXXA 3FTNA 4EJ0A 5I3ZA 3FTQA 3V34A 2SICE 3BBLA 3LM8A 4EUEA 2JIQA 2YMMA 1F6WA 4XYEA 2I03A 4P4SA 3DOHA 5ADVA 1M6HA 4M6WA 3Q3CA 2GJSA 2WSSA 3RVOA 5CLHA 1YFJA 4LOHA 4ZI2A 1AQJA 2RHGB 1A0OA 2VHEA 3B1KA 4UC0A 1KEPA 3ABRB 1U7DA 3CNOA 1XEWY 2IXTA 1RLUA 1NNSA 5BUSA 4LDRA 3DWGA 1QYIA 1ZIOA 2V74B 3OY7A 5BN4A 3ITNA 2FX3A 4E46A 5FI5A 4TSFD 2PM8A 3M3DA 2D2XA 4JUDX 2ZIAA 3DOFA 4XI9A 4YRLA 4BYMA 2Q1SA 3MEQA 1ZHOA 3OD1A 3TVTA 3W6UA 4RV4A 1P2SA 1FS6A 4TOIA 5FF9A 4BLUA 4D1YA 1IVSA 4DCVA 3L5OA 3F7OA 1QHGA 2OV1A 5KMGB 2LWIA 2V5VA 4LOJA 2BGRA 4HLUA 3L3BA 5I9NA 4II2A 3G6KA 5EGSA 1QIFA 1V9LA 5F5NA 1Z37A 2G9UA 5FUBA 2F7SA 3MTIA 2HQOA 4Q7LA 4FU0A 4RJJA 3DAFA 1SH7A 2Y2VA 2ZB2A 1MORA 1RM5A 3QLVA 1D1QA 3WBFA 3IDFA 3PFWO 1VG8A 4NNJA 4BLWA 1A7AA 4Z3KA 5CXQA 3G3EA 2XUDA 3QXHA 3WJAA 1U80A 2BDTA 3AUKA 3RV3A 1E7RA 2B9VA 2XUOA 3RRXA 3WXMA 2CFOA 2DHEA 4TKVA 1NG9A 1SQ6A 1PD0A 4NNOA 2ZI7A 4ZCMA 1JX6A 3PC2A 2HCBA 4H7DA 3FRIA 2QIPA 2NXEA 4QL3A 5HE9A 3T61A 3TQQA 2QNBA 2XUZA 3JVEA 2QUZA 5LOVA 3RUAA 3DKKA 2V6IA 4RPHA 2BMFA 3HCPA 5EJ7A 4D9KA 3HYRA 3GG2A 2VQ6A 2GRUA 4D8UA 1DJPA 3ZWYA 2NYUA 1A4IA 3MILA 4IIVA 4P08A 1FDTA 3KSMA 4KYTA 4OKNA 1KVSA 4NCNA 1O94A 2HJSA 5JAIA 1ZD4A 4WMLA 1EVEA 2FW1A 3AB8A 3DFKA 3MSXA 5AJZA 2GK7A 1T3HA 1NI5A 1NU8A 2G67A 2EX1A 2YVLA 3AUJB 2JFUA 1P81A 4OIFA 4U7JA 1L7QA 5IKEA 3QE3A 4Z3DA 5IYZA 3AVQA 1FVHA 3G2OA 2PFGA 5K3EA 2CXRA 3SDBA 1CY0A 2OFOA 1I2AA 3STUA 2ZTUA 2ROQA 4Q9NA 4LY9A 4HRVA 2VTBB 4ZHQF 5IARA 2CF6A 1XQWA 3QLJA 1US8B 4I9GA 4TMVA 4C43A 4CNBA 1FJGB 3M83A 4MAMA 3R3YA 1M1YA 8ADHA 4TVOA 2E6KA 5LUAA 1VLZA 4WUTA 4GOND 4EDHA 1BMQA 2C3PA 2OV3A 5HFAA 2RGNC 2YWFA 5HBGA 2B7BA 3LBFA 1S8FA 4Q19A 2B6NA 5IJ9A 2QT9A 3EUWA 4WN9B 4Y6LA 2C8KA 4PZAA 5DHFA 1F38A 3EUFA 3TKLA 3W6NA 3ENZA 2W6JA 4BNGA 1DAEA 1E8DA 3IMKA 3WMRA 1RQXA 3GL9A 5IT9A 2X0NA 2Q5EA 1SXJB 1Y9AA 4FIZA 3A9VA 4QTZA 1JJ7A 1BX0A 2QY9A 3BHJA 2ZR8A 3IQGX 2PKYX 1EM8A 3MWKA 2WAMA 2O1XA 1R0SA 4PGFA 4QTYA 3KKEA 2C9ZA 3ZWBA 3GMDA 2R7LA 4HRXA 4IKOA 4AZWA 1WXXA 1KH3A 4IOKA 5FV7A 2JJ8A 3KQHA 5K3FB 2IEYA 2WM3A 4UAGA 1BVYF 2C04A 3QE0A 4ZRDA 3G9TA 5CEFA 1WP9A 2C92A 1TCAA 3RYFA 5B12A 2O54A 5J2TB 3WGKA 4IM7A 1TUBB 4DLTA 3ES9A 1IATA 1K08A 2NU6A 1HZJA 2WNHA 4NX2A 5LM3A 4P82A 5C8VA 3DL0A 2AZMA 1W96A 3V7FA 2AR7A 4AKSA 2WI8A 3C7KA 1V8BA 4AX8A 1Z83A 3GXOA 3II6X 1JQ5A 2W4MA 1KH2A 4I5GA 1B14A 2KBFA 2IW1A 4ZCIA 5JSQA 2C07A 2D06A 3RSFA 1LK5A 1KDRA 1YCGA 2BZSA 1UCFA 4HNGA 5KOIA 2QLMA 4HX5A 4CR7A 3PRJA 5ITWA 3H11A 2O2CA 4YRAA 1MIOB 5G1OA 3QH4A 5ILQA 4W8GA 3F7NA 3RT9A 1UBTS 1H0SA 2BTOA 3UHJA 1RKBA 5IJ0B 1WU8A 3OVMA 4M1WA 4QTXA 5FPYA 3ZWPA 5UKDA 5LQRA 2G1UA 1NF9A 1XJ5A 3QELB 5LDHA 3NXKA 4EMUA 2QMEA 3CVXA 2PBFA 4K0RA 3ANSA 2BTQA 5FTLA 1PTJA 4F7DA 3QJ5A 3ZIUA 4V0SA 4MWDA 3CR8A 3WK4A 1JA0A 4QQNA 5I01A 3BB3A 3MGCA 1NHGA 1QQ6A 1FNMA 5JRZA 1N32B 4U7WA 1KQNA 3NDJA 3KWFA 5JJCA 3W05A 5L3SB 3B9RA 4BB9A 3IAHA 3RADC 5JSFA 3CW9A 5C1OA 3BFJA 3I1IA 2YXDA 3EASA 1PDWA 3MLAA 5DI9A 2PUHA 5I7AA 1RRCA 3VOBA 5TS2A 4UFPA 3U44B 5BMVA 2DBQA 4CEIB 4ZCRA 1UBGA 3WGLA 3HJAA 2BDEA 1LVHA 3LPLA 2G70A 5ALYA 2ZP1A 2D5BA 2GYWA 5C80A 1QP0A 4DMGA 1K98A 2C5EA 4O2BF 4S1OA 4IGKA 3AKCA 3L7CA 1SBZA 5LXTF 2NN3C 4E2XA 5C37A 5CLJA 2ONCA 4PXYA 2TRSB 4QLAA 1BW9B 1SXJD 3R7SA 5COAA 5DM60 1Z17A 2OBYA 4TKUA 1UT6A 5BT8A 4HQ6A 4E4RA 3S2SA 4X44A 3PJGA 3C2QA 4I4TB 4CFZA 3LCCA 4NS4A 2ZT5A 5CA0A 4IDCA 4OQYA 1J2YA 1TVEA 4PSDA 2CXQA 2QI9F 3MGKA 4BDSA 1Z7BA 3GAZA 1PT5A 4RF2A 3RVRA 3WI7A 4RQUA 5E9QA 1A95A 1YB7A 3R7AA 1N2GA 3UAXA 1HDYA 4EG5A 1P7VA 2ZUVA 5AFSA 1T43A 3G5MA 5HZHA 4F72A 1DIGA 1ZK1A 1FSPA 3BCUA 1DVRA 2A4MA 2H0AA 3KSUA 3SC3A 3WZLA 3U6KA 5C31A 1FP4B 3O31A 3PHHA 2XEDA 4YJ2A 4JVNA 1N0WA 1NGSA 4AMGA 1LK7A 4H31A 1NMZA 1E66A 4UNPA 1CYDA 3WO1A 2P35A 4YDQA 1BN6A 4QODA 4RY8A 2JCGA 1J9GA 1NF3A 4R0MA 3HBLA 4P1ZA 1V1MB 2BUBA 5K8IA 1Q17A 5AW2A 1L8OA 3G82C 2C8VA 3NBKA 4AJOA 4EY7A 2HSJA 1W5FA 2E5FA 5L45A 3BRSA 3LBYA 1NBOA 2EDAA 4D3FA 2Z3ZA 3BWXA 2WSBA 1O9BA 1ZEMA 1FDRA 4RZ2A 1N2BA 2C1XA 3DEJA 4E5KA 2GBFA 3I04M 4PYOA 5I9TA 5IZCC 3F5SA 2C84A 3FGPA 1X87A 4KLCA 5THKA 2D1FA 1Q3KA 5JTTA 1UODA 1G21B 1Y6ZA 2NVUA 3MUFA 5SZJA 4MIKA 4UUQA 4N4AA 1VJ1A 5IUKC 4AJKA 1U28C 3OQJA 2QE6A 4MK4A 3V32A 4CTNA 4EL0A 5IJ0A 2B8NA 1TUEA 4C4RA 4EHHA 3A3PA 4J16C 1A2QA 2LUOA 2W6IA 3U0VA 3JTMA 3LX5A 1NX6A 1DKPA 2MR5A 5K8LA 3L4SO 4MQLA 3ZU6A 2GWHA 3FUTA 2GYUA 1MF7A 1X8KA 1UBMS 2OENG 2PQ0A 1L4MA 3B70A 2WIGA 5DN6A 4QOHA 2GHTA 4KR6A 1BOFA 1C2TA 5CW2A 4IDDA 4XFDA 1D2RA 2FXVA 1F7UA 2XUKA 1WBBA 1ZJ4A 5ALXA 1VZ3A 3VR6A 4LXQA 3CF2A 4BRZA 4P0PB 4HH3C 3SYKA 2HMAA 2JGRA 1WRBA 1JSXA 1DAPA 4XR9A 4CCSA 5JEDA 5HGXA 2O06A 4UUAA 4EKNB 3DP9A 2QIOA 4CLOB 5CD9A 3OPQA 1U2RA 2G08A 1A7KA 4WW0A 3PJRA 2I6SA 1U7PA 3OFVA 4MVJG 3A1DA 3GRRA 2AQIA 1H6BA 3QRWA 3RHZA 1CR4A 1T6BY 3SICE 2C2YA 4ZYTA 3EG9A 1LLCA 3UBTA 2FG7C 1FDIA 4AJEA 1T2DA 2YN0A 3QIAA 4XGKA 4OQFA 4XE5A 1XRSB 1GZDA 1YKSA 4H3SA 3TLJA 3K6SB 2MMGA 5JQGB 1MB0A 4FS8A 3KKZA 5CDFA 4E33A 1F12A 2GF2A 2HXYA 4IFIA 3HYCA 3MD9A 3TK1A 4B3GA 1PGJA 3KR9A 3QOYA 1IHDA 3I04A 4DWOA 1H3NA 4GH5A 3TZCA 2XOEA 3TVYA 1RCUA 1YC2A 3CVOA 1VIVA 4IAOA 3K8QA 3ABZA 1KI6B 4KG7A 3GJXC 4Q3OA 4B3BA 4X6YA 1J8MF 4DY4A 3NDRA 1TB4A 3FR8A 3OJXA 1IULA 4H18A 2FRVA 2Y0EA 3KCQA 4Z1MD 3W6ZA 3CUVA 3ROEA 1N1GA 4MYDA 4C7KA 5LA6A 5AW1A 1I24A 2EFEB 5FJJA 2HUPA 4ZVMA 4UM5A 2LW7A 3RJZA 5B3LA 4KU4A 1WXEA 2F1HA 4BNKA 3E9CA 3RROA 4YJGB 1GD1O 4ETMA 5I7RA 1K0FA 3LC0A 1IH8A 3LDAA 3PRYA 3K35A 4M8NE 4YLGA 5F73A 3ST7A 3VC2A 5IZ4A 1NFRA 2PBRA 3ANTA 3THXA 3UHOA 1FXWA 4J6FA 1W29A 2AD5A 3MK31 4G3XA 5LQNA 3NC4A 4IDQA 2Z3WA 2H65A 1JU4A 3RIMA 3SU8A 3NOQA 3R5XA 1C9YA 3BCRA 4LG1A 5AXAA 2GN9A 4DIEA 4JJKA 2VCEA 1PR2A 1SIUA 2OCIA 3OQIB 1CIPA 4CQJA 4JI2B 3ANNA 4RZIA 2C4KA 4KRFA 3VHXB 3FJOA 3EQZA 2GJ4A 1U11A 4GPEA 1WU7A 1U7XA 2A35A 4WVLA 1N7JA 4ZZ3A 3V4RA 2C82A 3ASUA 4M7WA 3COZA 3HYLA 3IQDB 5CVDA 5D1NA 3RDPA 2AA3A 2CE2X 4Z4FA 3QLTA 1LH0A 3G0BA 2EKLA 4I5IA 1VYHA 4C6SA 4P93A 2HUNA 5HQ3A 1ZNYA 3WRWA 5GP1A 3NKVA 5AIBA 3TOZA 1BGXT 3IUQA 4URUR 3BFXA 3DOCA 5JS7A 2X7XA 2XF8A 4GBMA 4MGZR 1Z47A 3M6MD 1WMBA 3LSYA 1PGQA 3GOHA 2ETVA 3G0IA 1BD3A 4PYMA 1J21A 1E2FA 1YRAA 4Y2XA 4K1LA 5EMLA 4FDUA 4LFBB 1E5DA 1JHXA 2ZUDA 1VGQA 2QRJA 4OH1A 5ALOA 1QUEA 1Q1BA 2FH5B 4QUKA 5J59A 4FILA 2VF7A 2AZDA 1KIAA 2OECA 2Q5QA 3KPWA 3QBVA 1VI5A 3BGOS 4J4BA 4EECA 4MR8A 5EMNA 3TIXB 3WHPA 1ZOIA 2FX2A 3M4NA 2DM6A 4V2IA 4FT4A 1SIWA 3UAZA 3BQNB 1DZ3A 3S7ZA 1XUOA 3GP8A 3GLVA 3JWGA 3W6OA 1JKJA 1QTNA 4KP7A 1M0TA 4LQLA 4MYTA 4YXFA 1AD2A 4O2AA 4D96A 2EU8A 2VPPA 5K4AA 1Z0FA 2I4MA 4WCFC 5CYFA 5ES3A 5HKOA 4DARA 4DCCA 3DF7A 4FEAA 3R3UA 2VPWA 1JIXA 2XA2A 4IO0A 3RYIA 1RBQA 2RH9B 3JQEA 5F1KA 5IU6A 2DRIA 4IIXA 2CL0X 3VO1A 1KSHA 1GNVA 2NTNA 1G5IA 2ZT6A 2HI0A 1N2CA 4FB5A 1L3IA 1Q0TA 4JBYA 2HMVA 2E87A 3D7SA 1JNYA 5F21A 4C9BA 2JJQA 1SM4A 2BKEA 5K0CA 4EK9A 3K8YA 3EY4A 2ZJ7A 3N0VA 2BFCB 3REGA 2H54A 4LF5B 2FSPA 4UQOA 4WKNA 2W43A 1MO2A 3ROXA 3F8WA 2BKUA 5TGTA 4IMIB 2D13A 5JARA 1EUDA 4Y2HA 5DBGA 4OHYA 4KXVA 4YJHB 4PO9A 2I80A 4O25A 4HO1X 3F3YA 3GEPA 4RGYA 3T5GA 4C4SA 3ONEA 1GR0A 2FETA 3FLBA 4QGHA 5DHSA 5DN9A 1TNDA 1AKVA 1AM4D 1C9JA 2C29D 1Q19A 3E15A 1ISHA 1GZ5A 3P9YA 4XFJA 3ZIDA 2DR2A 3OX3A 3JZDA 4TXMA 2UYQA 2YW9A 1TYZA 3MS7A 4LRWA 2PUCA 1I5OA 4CMHA 4COKA 1EA5A 2CJFA 1F2VA 1SVNA 2FMXA 3GLIE 3MVEA 3O9ZA 2J0UB 1Q0PA 3LO5A 5TE9A 1U0NA 2Y1OA 3SYTA 4HQNA 5HK8A 2JATA 1FFDA 2BD0A 1QHIA 1MO4A 1T36A 5K3SA 1MOZA 4B6EA 1RWNA 4UE2A 4HHEA 2DB3A 4WPGA 1SU8A 2IOQA 3ZE2B 3EPHA 1GU0A 4UOEA 1DG1G 4KWEA 4BO6A 1P60A 4QREA 2O52A 1R4MA 3X1DA 4PAQA 3GLFA 1OB2A 3DMHA 3TNYA 5IDQA 3E7FA 3ZDDA 1NNI1 3I8XA 3ZY2A 2GD0A 4HAOA 1C1XB 3WXBA 2FSUA 4UAUA 1XV5A 3EOAI 1C3JA 3AFNA 4CE6A 4JJEA 4I55F 5EFZA 1Z6AA 2PGNA 1O6CA 3BAZA 2VSXA 1DDOA 1Q1EA 2GJ8A 3JYPA 4IEEA 1W8IA 5I9SA 2Z2YA 1Z0JA 3CNHA 4ZYVA 2X2OA 4RHTA 5FR2A 3X1KA 1N6IA 4PWYA 3RVPA 1JWBB 3TDMA 2P5TB 3DA8A 1J8FA 2A5JA 1AOXA 2UZ0A 1NVDA 3ZDBA 3IIEA 3NIDB 3ZGLA 5BY2A 1EXNA 2L17A 1AKUA 1YS7A 1TQ4A 2B1QA 5ALNA 1K9SA 5EHIA 3L6BA 4P80A 4ARBA 2M6RA 4EB6A 3EPPA 1EGAA 4M46A 3HWRA 2PIAA 3EA0A 1JG1A 2ZVQX 3TQRA 3V8EA 1T8SA 4KOAA 4DPLA 1YTUA 4DR5B 5CEJA 2GAIA 1LJLA 3N8KA 1QGUA 1KP2A 3AF3A 1XNQB 3RHFA 3DE3X 4OBEA 1PS8A 4OXRA 1M76A 2QD4A 1M5TA 2XRZA 1FVFA 1QX4A 1ZA1A 3RC8A 1VIDA 2ZYHA 2Q5FA 4U02A 4ZI7A 2C0PA 1K89A 3FUVA 3OWXA 4EPXA 2H2IA 4X84A 1GKLA 2KS6A 3GJQA 1U4OA 1CU1A 3L1KA 3FW1A 2RBGA 2FZGA 4J0CA 4IVPA 1U31A 4BWYA 5F9FA 3RG8A 3DTVD 1QONA 5CFNA 4QYSA 3C24A 4E07A 3S8YA 1U0JA 2HPZA 2EJTA 1DCMA 5IT4A 3KQPA 2IOFA 4HWGA 4BL5A 1DUSA 1RKUA 1VKRA 2OBLA 2V7GA 2YXPX 1Y6QA 3RVKA 4AFNA 4GGOA 1XOIA 4FGZA 2CL5A 2CVOA 2MSNA 1T3TA 1GUAA 1IRXA 3IKTA 2WJJA 2WC1A 1NVVR 1WV1A 3LW8A 4F71A 3J80A 1LPMA 2R47A 3FB1A 3TI7A 1CS4C 1OZFA 1WUTA 2WOJA 3FKSA 4JVMA 4EGSA 5BP7A 3EXG2 5CUQA 2BH2A 2QTRA 5F77A 5JNVA 3DKRA 2IS4A 1NLFA 4MP3A 2O07A 1GCGA 1K8ZB 1R6XA 2EYUA 2O7RA 1I9CA 3BA1A 5IF9A 1ZN9A 2ODTX 2HSGA 4HQKA 4MHTA 1FRZA 1MN6A 4GYKA 2ISCA 3P9KA 5CT9A 4X93A 1L9XA 2BZ0A 2ASVA 1H6DA 1PLLA 2IYSA 3IS3A 3R5HA 4U0KA 4XR4A 4K6GA 2ZJZA 4ZCLA 5CM9C 1NJ8A 4EUHA 1YFZA 1G98A 1SCAA 2DE0X 2SBTA 3E9QA 3RT1A 2UUPA 5E2IA 3UOGA 1D6SA 4BWGA 3PJDA 4YCMA 4RETA 2VF2A 1TIBA 2DKNA 3BWYA 3VM6A 3VYVA 3D3JA 3GV0A 2CLHB 4N1AA 1LDNA 3IA7A 4NAUA 2LIPA 3Q0IA 5HRUA 1OQAA 4FW9A 3IR6A 2AIRA 4N6NA 4EG4A 3EULA 5G0TA 4AG3A 1JFFA 1B1AA 5DHQA 5FYQA 2PZKA 4Q6WA 4DHEA 1DV1A 5FOUA 2QVBA 4YMTA 3IKLA 3DWIA 3DD1A 2CFRA 3WGGA 1GPMA 1KMHA 2H6EA 2BGUA 4TYPA 3WB1A 3PEWA 2YHIA 2QQ5A 3MS2A 3CNNA 2R4TA 2P9TA 1AE1A 1AG9A 4S12A 3V00A 1IIBA 4BNWA 1JR3A 1RKVA 3N6VA 1R16A 5KOYA 2ODWA 4HDNB 3SX2A 1M2JA 3ZHOA 1FDWA 2NXNA 3BDAA 3GLHA 1WDTA 4KNYA 3FCEA 4PS1A 4E14A 2W83A 4CM9A 2F62A 1CY2A 2R8PA 3CLRC 3VNRA 3V42A 5B64A 2O8DA 1JEQA 4C0BA 3I1YA 1RLOA 1M2KA 1P4SA 2BE7A 2E6UX 2WF8A 3LQ2A 4G56A 4GEKA 4OB7A 3IUMA 2YZNA 4RCZA 4RVNA 4ND8A 1G4HA 1OC4A 6AT1A 5I7UA 3WGQA 3ZD9A 1KH1A 1YRQA 5CD1A 3WGJA 3KLMX 4II3A 1WVGA 2HIHA 2XYPA 3VZDA 4CMCA 2H1WA 5AKJA 3T9CA 3QX7A 1DUVG 3HBFA 1N0IA 5D01A 4L6IA 2JJ2A 2ZULA 4RK1A 1JFTA 3R6DA 3CLTD 3KDSE 1P3Y1 4FW8A 4W63A 4YUAA 1C1HA 2UAGA 3CKMA 4ZAYA 3SEQA 1OX6A 4L22A 1B7GO 1YC5A 4DOMA 1T9BA 5EHXA 4NHOA 2J6HA 4U39A 1RTKA 4RJTA 2XA9A 1I4WA 1P62B 2PRYA 1ZX1A 3R6WA 5HWSA 5J4YA 4O3MA 3GN1A 2KE5A 4JI4B 1GL6A 1KKLA 4BJ5A 1TF7A 4ZJPA 1L4UA 5E4JA 2UUBB 2IX3A 2PJRA 5BT9A 4D57A 1R8JA 1SOWA 5BNIA 4I81A 3IPXA 1RABA 1QHXA 1T5HX 3UGJA 3L7MA 2QPOA 1QP8A 1RM3A 3RIHA 3BB4A 4M2LA 1O3YA 4DMFA 3ZD8A 2BUAA 5EIAA 3TI9A 1PGPA 2WV9A 1VL1A 4O2BA 1C3EA 1ELOA 1ZWKA 3DZKA 3TLKA 1T4GA 3GA0A 1DZIA 5LXTA 4UVIA 1WEKA 2D1SA 3OE7D 4ZCTA 3H7IA 1E7QA 3MGGA 2JS7A 3KZKA 4AN4A 1K66A 2FLVA 1DJOA 4GKVA 4JB0A 2PZJA 1V7CA 3OLYA 4NAHA 3JQ7A 1UMBA 1U2ZA 1C7EA 2WUGA 2H31A 3WLOA 3AFIA 3D0KA 3FSGD 3GBSA 2GCPA 1VBFA 3IP8A 2R4UA 1H9BA 3R6LA 4MJ3A 4N5DA 2OHGA 1NC3A 1RPJA 4KRYA 2HQRA 3FDXA 4QDTA 4B2IA 2Q4BA 3NR2A 2FWAA 4QQFA 4KWHA 1LPSA 4KMRA 8MHTA 3FN4A 1X6VA 3FGZA 2D3TA 3HKEB 3MOSA 3HY4A 4OAOA 5E2BA 4YRPA 1NA5A 4BUZA 3PGJA 1NQOA 1RKQA 2WMDA 2YRXA 4C78A 4F6RA 3IXQA 1M73E 4GP7A 4OJQA 4YY3B 4OGLA 3DPIA 5BR4A 1EFVB 1EI9A 1VHLA 4HDCA 2P90A 2JW5A 4KQXA 2GBGA 4HGZA 3UKJA 3DCNA 2PX0A 2RK6A 3C8ZA 2VJLA 2P41A 3A4YA 4FYKA 5TS3A 3UJAA 2Q8PA 3DE6X 1KJ9A 2BM1A 3TJMA 4IG9A 1IY8A 2QL6A 4O4IB 3STXA 4LE1A 3K71B 1RXSA 2QQ0A 4YRGA 5JH7A 3U7EB 4JELA 3ED5A 1E63A 1P8JA 1EFCA 1RWVA 1XQVA 1X9HA 2IGBA 2Z57A 1G4AE 2G8LA 2Y1EA 1LKZA 3T9BA 1YQWA 1L7RA 3R6GA 4QOIA 1V3VA 5IJXA 1E8NA 1K7XB 1O5OA 2VKTA 2BEVB 2D1YA 3SK0A 3ICVA 3MFYA 1C0IA 3N3AC 5FNZA 1GADO 1I2ZA 3BTOA 4G36A 2XQVA 4L4ZA 2P2LA 5E7IA 4GC5A 3Q11A 3AQ4A 2QPAA 1EE2A 3HL4A 5EYPA 2OXIA 3HCWA 4OLBA 2O8EA 1H2AS 5FBZA 5ALJA 3X3HA 3UFXB 1DKQA 1XHLA 4FGKA 3U0BA 1M2NA 2GM9A 3VFDA 3WBKA 1G6OA 3AF6A 3L4BA 2K6GA 2FG5A 3BRQA 3PA8A 3T7KA 3WICA 4ECEA 5AVXA 4HMQA 5CDTA 3LPAA 1GSIA 3KLNA 1E9CA 3ZZNA 1W88A 4H2DA 4MKXA 3RSHA 2FEPA 3QVWA 1NE2A 4NMMA 2AUMA 2PUVA 2PQ6A 3S2YA 1E5VA 1FUUA 4RNDB 4XRGA 5DHTA 5A2QA 4FMDF 2RHTA 2OY0A 4RE6A 3FTDA 5GJVC 1GKUB 4ENSA 3ELWA 3IUJA 5C5DA 5KNBA 1IY1A 1P1JA 1RDFA 1I14A 3G8YA 3KG2A 3L7YA 4CEJB 4J3JA 2NO7A 1U1EA 2WIDA 3JQBC 4B0PA 5HUQA 1PWZA 2OUIA 1XA0A 3KHKA 4LKRA 2WZDA 3LQKA 4LMAA 2RHDA 3MMZA 1QVVA 1E58A 1XTSA 2W0MA 2F67A 4OHVA 2PFKA 2NG1A 3T1QA 3AVVA 4HLDA 5LBIA 5DCWA 3EA4A 2VEOA 2E82A 2PEZA 2YINC 7ADHA 2ZT7A 2OXRA 3AFGA 1WUYA 3P2KA 3ZE9A 1HURA 4O63O 5DASA 4ZPJA 3GPIA 5KZMB 3CPHA 1CYEA 3N58A 4M55A 3D3KA 2Y67A 5IH7A 1JG6A 3F6PA 2C3UA 5HPYB 2E4AA 2O2SA 4YJDA 4MVXA 1JDNA 3DDUA 4BEVA 4IRMA 4LF7B 3BJIC 2IBSA 1IJBA 2GJ9A 4WEQA 2IYVA 3LCRA 1GNPA 4FDTA 5IMBA 4CUZA 1UJ5A 2I33A 3DB1A 2R5WA 3A70A 4LGVA 2DXIA 2PWYA 3H0EA 4MV8A 3NTXA 1ZY2A 4EBBA 3WDLA 2DJIA 3W4KA 4LFAB 1Q0UA 1E18A 2M32A 3QYPA 4BZQA 1VCNA 3F90A 2IH4A 1G0NA 1YE5A 4BMOB 4M88A 1ZH2A 5JH7B 3IL2A 4XJXA 1E4VA 3GZNA 2XNCA 4MINA 5G1NA 1N9GA 4QQKA 1ADJA 1YQDA 4ZAFA 1OZHA 2QY6A 4XWOA 3PWSA 5F3DA 5AQ1A 4F4CA 5LD2B 3E5RA 1KSGA 4DG9A 2X3YA 3FNEA 1FJHA 3A1FA 3WV5A 5AVZA 1RYHA 4NBUA 2Y1GA 3NH9A 5BOSB 1O9GA 5BXYA 3UXYA 1DIRA 2FPXA 2HD4A 2WJIA 3ANYB 3FB4A 3KJGA 2Y9MB 3QLEA 1I3NA 1HZZC 2TECE 3F6BX 3PFIA 4YAOA 1TVKA 2AJTA 2Y1KA 1OREA 4MAAA 4BTEA 2IZZA 2NZUG 4NBRA 3LY5A 3ONFA 4KXUA 1K97A 2XUIA 3PF9A 3Q3VA 2ISSD 3F5QA 1QFMA 2FU5C 3IGFA 1RPNA 3PYMA 2X2PA 4G0ZA 1NVFA 2CZCA 2GVZC 3RYHA 1Z39A 4PGGA 4JLKA 1PFKA 4E5YA 2G1JA 2WHQA 3QE9Y 1IZ9A 1K7FB 3PITA 3OEWA 2BRUA 1DRKA 3TZBA 3ZX4A 1E77A 4DR2B 2QRPA 3EZ7A 1YOBA 4UBOA 2DY1A 5FHRA 2JCVA 4IHJB 4NJEA 2QRNA 1W1WA 2WHEA 3L07A 5IKMA 1V8ZA 4RMGA 3H3FA 1T3LA 3CRVA 1QVRA 3HS3A 2ACKA 3IAEA 3B36A 3QPWA 1GPYA 1NBME 3HO8A 4L5IA 4ZOBA 4PNEA 1VP3A 4GQIA 2HJ9A 3VGJA 3C14C 4DSNA 4GZ3A 3LFHA 3BGIA 3OTQA 3OCYA 1GDDA 2EL9A 3FCUB 5ICGA 3DO8A 3EC1A 3HFJA 3BFVA 3EZGA 3HDHA 1KQGA 2ZJ8A 2EYQA 2P7HA 1J42A 3DMNA 1LLDA 1Y5RA 4JLSA 3AEQB 5AMXA 3UTDA 4KQJA 1CNFA 3CB4A 2Y99A 3HPRA 1KZ1A 3S99A 4D4JA 1E1CB 1Y3FE 2ZWOA 2MYPA 1GTMA 3C6BA 2GEBA 1ID1A 4NIMA 3THRA 3HVIA 2EFJA 3I05A 1NATA 3OOYA 4QGGA 1Q2XA 3FYUB 4TM7A 1JJFA 3UEOA 1P39A 1PEYA 4AWXA 1LBTA 1F2UA 3TLGB 2QN1A 4NEQA 4BO8A 3OJCA 1GPAA 1DQZA 4MPPA 1POWA 4MQFB 3T7EA 3FUCA 2VF4X 2F9FA 4BLOA 1IPEA 2RHBA 3HDTA 5JSUA 5TF0A 4UOQA 5KJ6A 3S8MA 1E6WA 1OYWA 2P6NA 2XLCA 4QT4A 2N42A 2EKZA 2EERA 1R8SA 2GO1A 3PHCA 1PD1A 3B6IA 4G63A 2Y76A 1STOA 3G17A 2KI5A 3AKDA 1R0WA 3GGCA 3LZ6A 1UKCA 1X86B 5AKHA 1FMJA 4BO0A 1JAYA 4S1PA 3Q9NA 1OH7A 2QTZA 1XQYA 5IXJA 3T7JA 1U8TA 1A72A 2O8NA 1V4BA 5ISMA 3OZXA 3L7BA 3ROQA 2YV4A 4KLNA 4GRAA 2C00A 3NS7A 4FHEA 1ZGGA 1XYYA 2ZE8A 4GOKA 5L40A 4FOPA 1RU3A 2OCXA 3AMVA 4R68A 5JUWA 1M9NA 3OHMA 1DWQA 1N8TA 2O2YA 2K7ZA 4KV7A 1AV6A 1U0BB 2QRKA 2XKJE 3EARA 5HCNA 4F1WA 4B74A 1LCIA 3TLEA 3AETA 2HH9A 3RVQA 5ELXA 4PW0A 4AY6A 2QXUA 4PSCA 3T3PB 4K87A 3VVBA 3Q3JB 3CF6R 3ANMA 3S6JA 1OWPA 5JZSA 2OCDA 4OLJA 4DVJA 2PD6A 2N0SA 2XZTA 3R0QA 4PFKA 3WKCA 1RLJA 3BFKA 3SNKA 2ZRKA 3VPXA 1QHHA 2FPSA 2AE2A 4G5GA 4US1R 3ADBA 1XLTC 4NZ9A 3LYAA 3N2GA 3R7BA 3JARA 2AJCA 3G79A 4FNGA 2R1TB 3TAUA 5BNZA 3NHKA 4MUEA 1D2EA 2GHIA 2VP5A 3TZ6A 3UB3A 1PE0A 5ER9A 1G20A 2JLAA 3TW0A 3TCKA 1P7ZA 5FA8A 4IXWA 1KDVA 2HJWA 1PSZA 4B2YA 2RHOA 1DC8A 4PAGA 4CXMA 2M2IA 1T2VA 1EG2A 2GLUA 2RMKA 3ADOA 1MZVA 3W3AA 4MPDA 5CRIA 3DE2X 5LQAA 1BS9A 3QUSA 2IL1A 4BS9A 3MUNA 5DBOA 2HQSA 2QU7A 2FOXA 2MYUA 2QM8A 2DWPA 3G2JA 1XTVA 3PGA1 3NHBA 4ZVQA 3ZCVA 3PENA 2XNSA 1U8FO 3O9VA 3OQOA 1YRYE 1FXSA 2QQGA 4GLLA 4RLQA 1P73A 4BO7A 3OTHA 5K2MA 1CZKA 1NONA 1Y34E 1ZGJA 1SIBE 3WAKA 3DVLA 3MWJA 3ETHA 4IZHA 4KQKA 1OTXA 4EOGA 2CSUA 3VKWA 2RCYA 1Y37A 3NUGA 3ZJYA 1KU0A 3W5JA 3U3RA 3B82A 4YA6A 1EVIA 1VCIA 1BQ4A 2RGNA 3KKMA 4YAEA 3N8IA 3WKAA 4UTZA 5BW6B 1SU4A 3HYNA 2PKXA 4J9UE 5GM2A 9LDBA 5KYYA 2GYYA 1Y8RA 1YMVA 2R8OA 1CRWG 1DC7A 1DC6A 1CJVC 2NUTB 4QDKA 4X6UA 3IUEA 3QKIA 3ROFA 4WLEA 2XBMA 3OZFA 2WNIA 2JH8A 1TZ2A 3K09C 2I3AA 4L3OA 1Z9BA 2QAGC 4LWQA 3LQ1A 2REXB 4LVOA 3BN3A 1W0KA 1DBSA 2J48A 3IJ5A 4PLWA 3GJSA 2FPWA 1LC3A 2ZRGA 4B85A 1XTBA 3EGDB 3KCNA 3C97A 1IDN1 4PX5A 4RL4A 3Q7PA 3HGQA 4JOQA 4M22A 4XLZA 5I9LA 1D7AA 5FA5A 4G8BA 5E1OA 4AW9A 3SFVA 4DCMA 4XD2A 1K8RA 1T15A 4ZYLA 2SHKA 1HOTA 4QLBA 4GECA 4RA9B 4HVAA 4CMIB 4Y6SA 2IYNA 3QF4B 2Q9CA 3KDPA 1SCQA 3G49A 1UINA 1O08A 2XW6A 3AILA 5CB0A 2B5VA 3ITEA 4GKJB 2TSYB 1Z3CA 1WHTA 2XXJA 3KALA 1M6NA 1LNQA 4GXTA 2H9YA 1GGNA 3W8FA 4UE6A 2A9OA 1D9XA 4HEA1 4Z2YA 3RFUA 3IDOA 4JC0A 1WTCA 3K0FA 2HO5A 1IHOA 1SUWA 4PLFA 2FA9A 3TTWA 1A8QA 2PUTA 3A25A 4JQOA 1CJBA 1ECBA 4KWIA 5HCIA 1ONSA 1SU7A 3E3NA 1A5BB 3A6GA 3MWGA 4OAPA 2AOUA 2AUTA 3VI4B 2POQX 3FF1A 4WOJA 1VCMA 3I2YX 5T8KA 1MRZA 3MJFA 3GGDA 2E5LB 3VKVA 1OROA 1J1IA 4NS1A 3G7NA 3OKFA 2BSXA 1WCIB 1UFQA 3D64A 3LVRE 2XUPA 1YZYA 2Y3IA 4OG2A 2ZAIA 2WKRA 4U5QA 3BG5A 2QJRA 4YP7A 5JANA 3V4LA 2WZCA 1S2NA 5JDIA 2OXCA 3F5MA 1REQB 4YO7A 3E4CA 3B3FA 4JJ7A 4R1OA 2JKYA 3PQEA 1JQEA 1R9NA 4OQPA 2PYDA 1ZNZA 3T7TA 1O0BA 2F1RA 3JAWB 3VA7A 2KYRA 3RLFA 3OEHA 4FFMA 4R41A 2AOTA 3PEVA 1L5HA 3NV9A 1AGRA 2P91A 5HXAA 1MHPA 2AFIE 5H82A 2CVFA 3KV1A 2J08A 5DLPA 4XQCA 2VXBA 3DQQA 3PE4A 1NURA 3IPCA 4R83A 2BIFA 5CIYA 5GQSA 2A0XA 4QYIB 4DGSA 4G01B 5K3AA 3C43A 4NABA 2JPDA 3H17A 3RIYA 3DBLB 1ZC4A 5EZYF 1QIGA 2FQYA 3LY9A 3ZCQA 5CITA 1NLMA 1XDGA 1S8OA 2FTKE 4K9SA 3UICA 4TYNA 1JT9A 3GY0A 5BYJA 3RSCA 3RK4A 1ZUHA 3E22A 2ZQYA 2ZRFA 2YNMD 2IE8A 1CUEA 3K5IA 4G0VA 1ZMXA 2QQEA 2HA0A 3QENA 4MW7A 3L6RA 4N8SA 3DXFA 3EXFA 2QX4A 1C3OA 4NESA 2I4NA 4MW6A 1MO6A 5EP1A 5EJ4A 2EQAA 4RKYA 3RSQA 1JMVA 1UBEA 3E0XA 4UPVA 4PTYA 1PT9A 4DLPA 1QP4A 3NBFA 4PPGA 4KQGA 5CHEA 4LKOA 4MKHA 1WY5A 2F1OA 4QWMA 1NAIA 2G40A 3GEMA 1SQFA 4HL6A 4LNHA 2MINB 3HA7A 4V0LA 3TKYA 4KFSA 2IHZA 3RS2A 1GQ2A 2YWEA 3PUZA 4CMAA 2J85A 3CZQA 1P6XA 2BGMA 5EIOA 5JZ9A 1JR6A 3R09A 1TK3A 4DHWA 1F9EA 2PTGA 3EDCA 4DW8A 4HCJA 2EJWA 2XXAA 3WA6A 1YS1X 3L0SA 3Q2OA 4Y2GA 3VR4A 4AJPA 7ABPA 4MVJM 5MFZA 2ZRJA 3ZE1B 1TIKA 2IEGA 1H5QA 5TVKA 4HGQA 1DELA 4IYJA 3IVCA 3JQAB 1BG6A 4GGPA 4NHEA 3NKFA 1IJEA 4RIGA 2F8TA 2R6GA 4OQDA 3OAAD 5DSZA 4DPMA 5EJ5A 1B23P 3O1LA 3MJTA 3T5DA 3UGKA 1VJGA 4PC2A 4ZEMA 1L8AA 4BTLA 2WTAA 4UEKA 5H59A 3E7WA 3PWTA 4G23A 2P4UA 3F1KA 2B3DA 1X42A 2A7QA 1VRVA 2IXFA 1HDIA 2GMWA 2XMCA 2BJHA 3H83A 5DLDA 3V2GA 3V1TC 1UR5A 1PS9A 4U2FA 1FL9A 2A1UB 5DH9A 4EFLA 4OV6B 1L5SA 2FP4B 1UM9A 2X8AA 1JYSA 4MKIA 3QY0A 4OB6A 4MUHA 1H1TA 2NXWA 3NM5A 4KDCA 1DSSG 4QELA 1TA0A 2QN8A 1JI3A 1OMOA 1Y3DE 3BICA 3OZCA 4LC0A 4DCSA 4F9FA 1VGVA 1FTSA 2UYHA 1RVDA 1Y8AA 1C1YA 1QUFA 2WWFA 2WVGA 1PT6A 4PHFA 2C59A 3LLSA 2ZSDA 4B47A 4BGIA 3EZFA 4Z51A 3E7PA 2FW9A 2BGGA 3I53A 1J97A 3H5WA 3N3BC 3RTDA 3KSDO 3RSZA 2OB1A 4WT7A 1WULS 4F5EA 1QHSA 3LMKA 4QJ3A 4QBIA 1GPWB 2V59A 4KO1S 3RUEA 4CTMA 1SRQA 3NONA 5JAUA 4AG5A 2JK0A 1JHZA 2REQA 3IAUA 1N3YA 4D45A 2BOVA 1LV8A 3DEFA 2EHJA 4ZT4A 1XLUA 4LV6A 2GXSA 2IY9A 5B1SA 1OJLA 5GY7A 4WOCA 3KYCB 2X0EA 3PFKA 2IZ6A 3KEMA 2P78A 3L0ZA 2Q99A 5B37A 2HBQA 4MS1B 4H9GA 5LLTA 4WKCA 1YVEI 5LFAA 3MWEB 1XAJA 3B20A 4IMPA 2W4QA 2PT5A 3OOEA 1EX7A 2QKYA 4GOMD 3WMXA 3KUDA 1CQIA 2CLMB 1WDLA 2A67A 3FNFA 1A7JA 1VKOA 3LY7A 5LZ9A 3VISA 1ZW1A 4X1YB 5U4QA 4XPIB 2WJZB 1XLVA 1COZA 1QHNA 2YIDA 3CLUC 3PTAA 4IRXA 3AF0A 4O5AA 4D9JA 2GSDA 2C9OA 1OLOA 3O1JC 4PO1A 3I30X 4ZOCA 2AL7A 4R1QA 4P84A 3ROMA 2MJLA 1T34A 1EJ2A 1DAKA 2NNWB 1KWKA 3B9BA 4RKWA 1SUPA 5I7SA 1O7JA 4COOA 1JJAA 1CF9A 2YV2A 3FCAA 1TZBA 3HDQA 3K1AB 4UATA 4LOIA 2O9JA 3J7TA 2O8FB 2CHGA 4Z0PA 4BXOB 1C50A 2XWBF 2Z2IA 3F6EX 4DYVA 2QUBA 2P68A 2VI5A 4NZZA 4PBRA 3JASB 2AFHE 4LXIA 2Q6LA 5T6BA 4Z8YA 5DVZA 4EG8A 1Z2DA 3WHLA 1M6WA 2PR7A 3STTA 3FYSA 1E9BA 1V5FA 4J94A 3SBOA 1R4AA 2PMDA 4LOAA 1NXSA 3VJLA 4NOMA 4CTJA 4XUEA 2WHYA 4M8KA 2VHYA 3W5VA 3FMOB 1I4LD 4MO2A 4N0MA 3RRBA 2J9FB 2NO4A 4MVWA 1VB5A 4UNIA 2O2EA 4U0JA 3AESB 2QP3A 2P9ZA 2Q8NA 1QG2A 3HACA 2GRAA 3WKBA 4FYYA 2COEA 1SPXA 2FPIB 1QIDA 4RPKA 3RGGA 4OI1A 5DGXA 3KAPA 3WOHA 2JGIA 3EGXA 5EHZA 4ZK2A 2WLSA 4JKIA 2V1XA 3I2FA 4C0WA 2Y93A 4ZPXA 3B6ZA 3GP5A 1BMFA 3OLWA 1SBCA 2C5GA 5KAPA 1M75A 1DI0A 3LLCA 4ZJYA 3LQRA 4TZ6A 2RBEA 2VPIA 4C08A 2H4FA 3L7IA 4S05A 2VC2B 1ES9A 1SNYA 3RANA 4XM0A 3FOBA 1PVDA 2VDWA 3ZY6A 3UAYA 4H08A 3ETEA 4L76A 1WP4A 4YONB 2JZOA 5LIRA 4HPJB 2VFAA 3MGAA 1HGXA 2SKEA 4X45A 4A1FA 4V39A 4LF9B 2GXUA 1RYFA 4IIEA 3VOTA 1J00A 4FI3C 1XNGA 2H17A 4FR0A 3O4JA 3ORSA 4EX6A 1LF5A 2DWQA 1CUZA 2OP1A 4OUKX 1Z8HA 2P75A 4G8JA 4ZDJA 2WG1A 3SQOA 4OQXA 5DDIP 1VE6A 2JARA 1Z5GA 3BXFA 5F64A 2X0FA 4FOSA 1P2BA 4D74A 4DXAA 2Q3JA 5C1PA 3BIXA 3TOCA 5EP4A 4S04A 4RDHA 3G0CA 1LY1A 3PZBA 3I9FA 1NKTA 4LZLA 4MXDA 4XYGA 4AZ3B 3GRPA 2G7ZA 3AIIA 4OP2A 2GN6A 5T4HA 3V9AA 1IQ0A 3FY4A 1B00A 2VUIB 5JEEA 1UBCA 1N6NA 2WLTA 5JWOA 4XX0B 2P65A 4UBKA 1B16A 2WWWA 3UAWA 3P71T 5EWLA 5FULA 4DQVA 3TNLA 1B8VA 1ML3A 4X20B 4D8TA 5GJBA 3BB1A 4EYGA 1WBDA 1SCNE 2A9JA 1QV9A 2R44A 5IDYA 1F60A 1LQTA 5K8UA 4NL4H 4RIFA 4TRNA 1TCVA 3HNOA 1ZGHA 1IQUA 2Q46A 3KQQA 5B4VA 1LQ2A 2HL6A 3IAXA 5EXTA 2TMDA 1DC3A 3KZVA 4JWTA 4AXXA 5CFMA 2C99A 2C31A 1LLQA 4RMIA 3QU7A 3ZYZA 1W5AA 2R1UA 2R8EA 3U19A 1XZGA 1KZ6A 4LVNA 3WNDA 1EYZA 1KOFA 2C5BA 1QYRA 1R9MA 3B53X 3BZUA 3G0OA 3NPMA 4FEEA 4UULA 2ZXUA 5CDHA 1YA6A 4KE6A 4J7CA 5A3VA 5BVGA 3FVVA 5JC1A 1G8SA 4QGFA 1PNTA 4Y1EA 3K70C 5KDLA 2HNAA 2ZWMA 3B60A 1GZ4A 1O6FA 4Q1CA 4JI6B 4RGQA 4V0ME 3FTPA 1HF3A 1K5DA 4H0FA 3ZDYB 4BU0A 4PBTA 3PLRA 1CZNA 1JG7A 1JHOA 2W0SA 4JKOA 1R7RA 2I71A 2P2SA 1B0AA 4EARA 5JBQA 5IVKA 4QNRA 4EO4A 4Y98A 1MMFB 3HFRA 1JVNA 4AP6A 4U1RA 3QWAA 3TQHA 3AVUA 2FRXA 3T3HA 4TL9A 2FWRA 4REOA 4FZJA 2KQUA 3ZE6A 2OB2A 2ZT8A 1S2DA 3C5EA 3NHRA 4CIWA 2BDUA 3JZIA 4F9EA 2H1CA 2CVHA 3A36A 4GPIB 4NE2A 3IP9A 1U2SA 4DPKA 2IIPA 2YCLA 3UV6A 4L9WA 4NVRA 4WL0A 5ENZA 1XCBA 2F6RA 4GBGA 4XVHA 2WD7A 2GCIA 3EAQA 1YR8A 1R5OA 1QDLB 4B4OA 5EG5A 6CHYA 1I7DA 4Y1RB 1ABEA 13PKA 2G4VA 1QNLA 1ZUNB 5GIOE 3VR2A 1R0LA 4WWHA 2J9GA 1X8LA 3ENNA 1NDQA 3A9CA 4BQPA 1HE3A 1CUYA 2GLXA 1JALA 3LL4A 4BX0A 1USGA 4P32A 2XD4A 4M86A 1QE5A 1ZSVA 4AJ2A 1H2HA 3MTDA 2XOXA 4DDWA 1SXIA 4B45A 2W6ID 2X19A 4QGBA 3GPBA 1CUDA 3RSOA 1M8JA 2C2GA 2ZSAA 3B3AA 3P0EA 3DVQX 4GZMA 4EM6A 9LDTA 3RU3A 2DF8A 2FRDA 2RDMA 4W5RA 3V8RA 2BLNA 2QMQA 1LSOA 3EVTA 4MR9A 4YMSA 3UZUA 4CFYA 4HDMA 2E85A 4N18A 1Y6FA 1RJFA 2PKCA 4M49A 2PAAA 3KZOA 3VR6D 4WDQA 5D5PA 4PVDA 4NY1A 5K0GA 821PA 1WQ3A 1TM2A 2X77A 5EHGA 1TKCA 2ZAGA 1PZMA 3AJEA 4PYKA 6GPBA 3OPVA 2V6FA 1BC5A 1WDMA 5A6VA 2I54A 2QRHA 2EEZA 2J9YB 1D2NA 3PEFA 4ID9A 4TTIA 3U4GA 4EB8A 5LWHA 1UBFA 2V0NA 1PJSA 3O8QB 3OHPA 1YMQA 2LKCA 2IDMA 4PLTA 1EFHA 4QVIA 2EZTA 3FCCA 2H11A 3SZ3A 2YKGA 5EIBD 1E1YA 5CVCA 1G59A 1L8XA 4M1ZA 3L9XA 3VYUB 1XJQA 1ZISA 1VMIA 1QIHA 2P2CA 1XF1A 2V3CC 1B76A 1KVTA 4F6CA 1Z73A 4H6VA 4P0QB 3MXOA 2D5CA 2YZ7A 4LXXA 4M9ZA 3JQ9C 1QKJA 4NQRA 3EY9A 3IMCA 4ZOEA 2CT8A 4CUKA 1Z7YA 2GM5A 4CKCB 4D0SA 4YRCA 3ZR4B 3PYXA 1CQJA 2MSEB 5B4TA 3FYHA 1AQYA 3LKBA 5ITZB 4BE7B 5HS4A 2F3QA 1W5TA 2VBCA 3RVDA 1V1RA 1C1DB 2L18A 3BQMB 1A1SA 1E69A 1USKA 1JXAA 1Y7IA 3N8HA 3O8DA 1RXYA 3DNMA 5DHAA 5ALHA 1S0UA 3P7MA 2PSDA 1TDJA 1C0EA 3A32A 1GG8A 1TK2A 1OLUB 2FVXA 3UWSA 1NVUQ 2PSFA 2QEQA 1W2GA 3SE0A 2V6GA 4O0LA 1EWVA 1SB9A 3C5VA 4D0LB 1KJNA 2FUEA 1EPUA 5FL7D 4C4XA 3EPKA 2CV0A 3L7OA 5JY6A 1A9XB 3KTFA 5T4EA 2V7TA 3GC6A 4JT9A 4XIFA 4KREA 1TF5A 1N4DA 1YZVA 3HKBB 4CF5A 4Q47A 4XASA 4CF4A 4RORA 4HB4A 1SVUA 1A9ZA 4M0MA 3QEMA 3LYUA 3NDBB 3GJRA 2VRBA 1R1DA 2NVOA 5DOVA 3WDSA 2DP4E 1B6RA 2C1EA 4HZGA 4IJVA 3O0TA 3LG2A 4RHXA 1V6SA 1MC8A 1W47A 2JLBA 2Z4TA 4U5XA 4XYMA 3G8BA 1Z4IA 4JIMA 3HXPA 4BAZA 4CPDA 2WU1A 3O7WA 2GCNA 4L6AA 5FFFA 3IQWA 4Z6KA 1ORRA 1K6IA 5TVGA 1ATZA 2HLNA 1TK9A 4CZ2A 4LPKA 2Y1DA 4PHGA 4LBWA 3KXDA 4WJZA 5FLEX 1O95D 4QRHA 2IX9A 4RWZA 4E15A 1JMYA 3ESAA 1IU9A 2IS6A 5C52B 1QE3A 2BFWA 4JL8A 4NXNB 1SR8A 2LTAA 2WG2A 4JUBA 1A8IA 3KAQA 5B1IA 3OO0A 3M6UA 4NMHA 1RCFA 2D2FA 4MRSA 4PYLA 2IYQA 2A0WA 5DT9A 4CVNA 1C7JA 3KJHA 2Q2NA 1FS4A 5FWAA 3HEAA 3TSAA 4UUMA 2Z6AA 1YZNA 3H9QA 4UQLA 1U9IA 3TQSA 1YBVA 1U7HA 3AHHA 1QM5A 5AM5A 1YE8A 3THSA 5CA1A 4I3HA 2OXFA 3JRWA 3N7TA 1RRFA 2VXYA 3ZWVA 2FGKA 3GGPA 3T3EA 1R50A 1EWQA 2GAAA 2D7CA 4UNNA 4G5YA 2V97A 2VDMB 3B7PA 2IFTA 4Z0TA 5KYNA 3S8EA 2FR8A 2PL9A 3ZE7A 4AT1A 1N92A 4OHRA 3ZHZA 1P4GA 2B98A 2HSEA 1KS2A 1A98A 3K96A 5JYDA 4ICIA 1WKVA 4XGIA 4KO4S 4FJ0A 5CK5A 3BIWA 2QVZX 2WF7A 4ZRNA 2IITA 3EXAA 1G60A 3RTAA 1CFJA 2DC1A 1CJKC 2J4DA 2QTVA 3F8TA 3K0EA 1E5TA 3DLTA 1IB6A 4NYJR 2VSOA 4W9RA 2EQBA 2H7VA 2DQSA 1YRHA 3GT0A 3GZJA 2RH4A 5FO1A 3FFTA 5EWJA 5AVVA 5LP6A 4WKBA 1O97D 2XUFA 3JD3A 3PC8C 1JB1A 3FHOA 1KJJA 4YCLA 2WR8A 3MELA 1X38A 2D4HA 3PK0A 4JLWA 1P9LA 4RD4A 3SWWA 3AM1A 2FB9A 2JLRA 3OJEA 1L7OA 2CZQA 1S8AA 2OKCA 3D1JA 1XZFA 4PYNA 5NLLA 1UXJA 3RC1A 2F00A 4IJ5A 4J1TC 3ZVKA 3WLNA 5CDSA 4D8YA 2W58A 2B99A 5C51B 3AXTA 1OF1A 4D26A 3RRZA 2AI3A 3QWHA 2H9IA 2I62A 3N2IA 1TJ4A 1D2MA 3DLBA 2VYVD 3T9FA 2HJVA 1NRJB 2RGGA 1JB9A 1EFUA 1HG1A 1E4YA 1RZVA 1M34E 1UKVY 2WJYA 3CZ9A 3F3SA 1NZDA 2B25A 2QMOA 3L8ZA 4MWEA 2OQVA 5L3QA 3RAEC 4JUIA 4AKIA 4LV5B 4NU8X 1SN7A 4K9QA 3SLRA 4C4ZA 5JSZB 1Y1TA 1EK1A 2JLVA 1QG6A 3E3LA 3SF0A 2JIZA 2NWQA 3W3ZB 3W5SA 2XOKD 1F6DA 5C46F 3OFNA 4X3CA 3TGPA 4YAUA 4TYMA 1G6KA 4KWTA 4NBVA 4PINA 3F5DA 3F71A 5IN4A 3ET5A 2PLRA 1AZLA 2JDID 4OOEA 4X92A 1GCOA 1K6JA 1EB8A 3Q10A 5FLXA 2CJWB 1N5IA 2C9YA 3JWEA 4P81A 4YCDA 2RHLA 4KPGA 1GAJA 1IHUA 3DNPA 5AQEA 5MF6A 4GKKB 1JXMA 2GJKA 3M1AA 3MMNA 4TV8F 5ERXA 3WK5A 4JL5A 4KVFA 5EE3A 4RD3A 3QEAZ 4BNYA 2OQIA 5IUJC 2QQFA 1VMAA 1IN7A 4DDMA 4Q1EA 5KQGA 3JVIA 1X74A 1QLWA 2DQKA 3QMVA 1OPRA 1SBNE 3ELBA 4F97A 2V6BA 4X41A 2ZBEA 3MUOA 2CHEA 4AVYA 1ZD5A 3LUCA 1KNXA 4IP0A 1TT5B 4B48A 1R00A 2G63A 5HG0A 4P7GA 4B8YA 4YPFA 4LRSB 5TQVA 4JCCA 3VBEA 3E48A 4AO7A 4RFLA 3VZBA 3SM9A 2VA9A 1NVXQ 2JBAB 2V7QA 4NPAA 4C7BA 3AHGA 1M0EA 3AZPA 3NBQA 2PV7A 2DFTA 3JYQA 3OE5A 4RLHA 4YP9A 1CE8A 1FVXA 1T0BA 1UIMA 2B7CA 2RGBA 2QRUA 2WUVA 2CDBA 3LHFA 4G25A 4KGDA 5INTA 1RWQA 1A8UA 3Q8LA 4R6XA 1BE8A 3CH5A 5E9WA 3CF4A 4K3UA 5J5AA 4F5WA 2A9VA 3MRXA 1ISMA 3OPYA 1KFKB 2HOQA 4LIPD 4TMYA 2HLPA 3T0GA 2WTXA 3TGLA 1COWD 2WMNB 3PL5A 4I5FA 4HV4A 3WLLA 1ANKA 5FI1B 1X8XA 1VPTA 3L0YA 2IV3A 1H1DA 5BN5B 3RD5A 3KBBA 3ZY5A 2R6AA 4LBZA 4QIHA 2WYWA 1QU2A 1J8QA 2AOXA 4MJXA 3NRCA 1MQ9A 3CRW1 3IC5A 3DKIA 4FYVA 4WNCA 4XUCA 5FBKA 2DLCX 1YRBA 2PMFA 3LBNA 2M6SA 4NU5A 3UH1A 3H2SA 4Z86A 4HZIA 4RSGA 4Q15A 2G9NA 4Z3OA 3KC2A 4DRYA 4RYDA 4X8MA 2PD3A 1OAOA 3CZMA 4PC3A 4B71A 3RFFA 5DI3B 1K7SN 3GIWA 1DTWB 1VA4A 2HDHA 3TPFA 3RJMA 2FMHA 3M1IA 3CGGA 2FW6A 2NO0A 3EMKA 4KOEC 3NT5A 1XF9A 4GRDA 3NGLA 2PKEA 4Y3UA 1IUOA 2WU4A 4D82A 4FI3F 3VZPA 1B6SA 4GI1A 2PZMA 3O2SB 1O5TA 1W1UA 4FOLA 4BB5A 4DR7B 1Z5OA 4H77A 4X91A 2Q6IA 2X9QA 5ED0A 3AJ8A 4Z7NB 1HZZA 1ZOLA 4OFZA 2X7JA 4BASA 3QA9A 3DUFA 1PKXA 3KPYA 4TUYA 1VOTA 2NTEA 5AJWA 3WWYA 1KARA 2J4FA 5JPDA 2PSSA 2XMRA 2WVHA 4RHUA 1NTRA 4LTNA 5AI8A 5KJEA 5DPMA 1V2HE 1U9ZA 4KQ6A 4E1VA 4K40A 1GG5A 4V3CA 1JSZA 3NP9A 1OY1A 3ORHA 3R8XA 4BGUA 4TZ0A 1JR3D 1H66A 3E9NA 1QDEA 2XD9A 3LUGA 2EIXA 3HWWA 4F2HA 3T7RA 4RK6A 2PRKA 1XD2B 2P1ZA 3QPCA 1JPUA 2IXAA 4QJIA 3RT7A 1KAEA 4EHAA 3A2KA 1QZ3A 2F2TA 1CUJA 5B30A 5I6DA 1YZUA 1OHHA 4KK4A 5CJJA 4UUPA 3DBHA 3SC2B 5KTPA 1SXGA 3KU4A 4LQCA 2HX1A 5IX8A 2JFWA 5C53B 3WLKX 2QBYB 2AC4A 4CG0A 2YJTD 3OPYI 4Q12A 2Y71A 4HH4A 3SYNA 3G9QA 3GB9A 3RCBA 2C78A 2I2BA 4ASUD 3GUZA 4PNZA 4I1RA 1Q3TA 5CR9A 4DLKA 4LHSA 5D1HA 2JCXA 1QBKC 3BGDA 3TZKA 1T2AA 1YQ9A 4WZZA 1PL7A 3N8GA 3EAFA 4WY2A 5CK4A 3HP4A 3TTUA 5J1SB 1ISJA 5MHTA 1U4NA 4LDNA 2ZBPA 4Y7DA 2XHZA 3LP5A 4DBLC 1MCZA 4QG3A 6Q21A 1R8YA 1Z8DA 4JENA 1Q57A 2X4LA 1EZ1A 4B9AA 4BFXA 2HDOA 2QLJA 3MCWA 3ORQA 3PHJA 4ZEXA 1JTFA 3OZVA 3O21A 3AIMA 4IF6A 4NCJA 1V5WA 1PJQA 3T7AA 3DKVA 2W6PA 4H7HA 4K2AA 3BVPA 5B58T 4Y9DA 3OT1A 1PVVA 1YR3A 1X7ZB 2CWWA 1UMCA 1E7SA 4HGYA 1UEIA 3G2IA 3LUKA 4DKJA 3TOVA 3L1VA 4HEJA 5EKXA 1VMEA 3QVGB 3FPKA 2VJMB 1J7JA 4QZVA 1NBHA 3BIJA 2AKAB 3DLPX 5DCYA 3ZOKA 2GZ1A 2I8CA 1H42A 1OE0A 3FUUA 3MCZA 4CM3A 2YWBA 3NO4A 1UBUS 1HO3A 1R0XA 1T35A 2PKQP 4I5EA 3UNXA 4MKFA 2YR0A 1ZCZA 2EBHX 3RQIA 1WPQA 4AIIA 5JTUA 1NF8A 1G7TA 1XWWA 1FU7A 2VRNA 3KBOA 1DU4A 1KC3A 4DYHA 1T5SA 3RARA 3FDZA 5A05A 1N5LA 1PTKA 1ZUIA 5KCMA 1F2TA 3QKSB 2WQ6A 2G07A 2QRGA 2J30A 3LRPA 3RFCA 4H4CA 1H3EA 2R4QA 4H4EA 1EA7A 2UVDA 3MTAA 2W2TA 3ZY3A 4YXWA 4C01A 1E2QA 1DC4A 1S5PA 2ADMA 1ENOA 2VWPA 3QBJA 3TXAA 5F3WB 5EWMA 3S1AB 2EG9A 4NV1A 4DXDA 2R6DA 1E9FA 2QX6A 1MU0A 4KFTA 3ZI0A 4JXKA 5H16A 1NFQA 3ELDA 4IQ8A 5KQRA 1NNEA 4LRQA 2GN1A 5CCEA 1UAAA 2GUGA 2PS3A 4BRSA 1M6VB 2QLBA 2Y6VA 3D8SA 1KS9A 2CF5A 1AKWA 1G5PA 4HXYA 1XLTA 3O82A 5A4DA 3WMEA 1GPKA 2CMFA 1TGVA 3EXHB 3K2IA 3F98A 2W37A 3B89A 1BFUA 2H5IA 3EBPA 3E8SA 2Q3BA 2OGWA 1AHIA 4PRLA 1E7YA 2HMSA 4AJIA 4B5KA 4REQA 4NJMB 4OHXA 2DWCA 3G68A 4JFAA 4LS3A 4D4MA 4ZTBA 1OW3B 2ECQA 2PX8A 2J46A 3OCZA 4PZEA 1DDGA 3NP7A 2Q7OE 3RNLA 4BQOA 2OMKA 4HADA 4IZ6A 3T5AA 5REQB 4R8KA 5HGJA 1JTVA 2PX6A 3T4XA 4V03A 5FUQA 2FN8A 2GWRA 5KNDA 4WESB 3M9LA 2H1RA 3PDWA 4OI4A 4FXOA 1DHTA 2PPVA 2X8JA 1DG3A 1E94E 1FRFS 3MMPA 4KL8S 4NH0A 1MH9A 4IDFA 4WE3A 1EAYA 1S2GA 2XQIA 3UK1A 5E95A 1EFRD 2D3WA 5A0FA 3G8DA 5IVPA 3GI1A 2ZIXA 3LQQA 2CMDA 3SAJA 1KO4A 2J0EA 1I4OA 2XUJA 5LCXA 4BBJA 3P2IA 1KZ4A 4I7EA 3KOMA 1QB7A 4MPTA 1QG0A 3BK7A 4LJKA 4OK3A 1XALA 1OFUX 2PA3A 2XGOA 4UNSA 4V0MA 4BQNA 4RABA 1SOVA 1HQKA 2MHCA 1YCHA 3E82A 3TF5A 5AVUA 2OCKA 5KKCA 1BE0A 3HB9A 1XVTA 5JXGA 1U65A 3GDFA 4ZT5A 3BK1A 3ICQB 3QVVA 3QYAA 3GFRA 3C5HA 3TE6A 3WGIA 3REOA 3T35A 3EQ2A 3E9RA 3VOAA 4F2WA 2YJ6A 3E18A 2Z1DA 4DQUA 3MTGA 3GNSA 1TPYA 2IYUA 1XNHA 1Y7LA 4RBNA 1RLTA 2AHRA 3E5MA 3OZDA 3KJEA 3GJ8A 3I3SR 1ISPA 5TQ2A 4AQDA 1VBMA 2BP7A 2H92A 4G67A 3D6FA 1M6YA 5KEIA 3D1VA 4H1TA 5GVRA 1H4SA 1VHQA 3UCEA 4K9LA 4R01A 4HWOA 5DM4A 2HFKA 1DKRA 4NPHA 5LJLA 4P2GA 1VRCA 3ABSB 3JQGB 3NWEA 2EP8A 1G3RA 4BO9A 1EMDA 1EK5A 3B7GA 1RRGA 3FDFA 2AG8A 4ID3A 4MDHA 3D02A 3CKLA 3NTUA 3VR0A 1XXHB 4KACA 3LHDA 2HIAA 2QJTA 5M3BA 2IH2A 1CF2O 3BWCA 4NULA 3W2FA 3H8SA 4TN5A 4JLPA 1HA3A 1Z28A 2FLWA 3JQDA 3K1ZA 1ZGZA 4WN3A 3PX2A 4E4TA 4FGLA 1HMPA 3O4FA 4ANFA 2QRVA 2A2ZA 1KZ9A 1DIAA 1W52X 4MVJH 5LNK1 1OH5A 4OK5A 3NM6B 5J2TF 3F9IA 4AJHA 1QH1A 1VSTA 1PEDA 1LJUA 3KYDA 1ZL2A 3A2LA 4UM8B 3OIUA 2H3EA 4YQYA 1FRNA 1TE2A 1K2VN 3NHYA 2F1IA 8GPBA 1RJDA 3LBHA 3IMFA 4FE4A 3T4UA 4MRMA 4G0OA 1LEHA 4HQ0A 3DAGA 1A9OA 1OGIA 2XMBA 1BN7A 4FCTA 3JQFA 3F7TA 4N6OA 4YLEA 5CT4A 4YRJA 3UENA 3EEYA 4QU5A 4ZGGA 3EVZA 4JL6A 5TSDA 3SEZA 3I0ZA 3N76A 1W4ZA 2P9EA 2PUFA 4RHFA 1EX1A 2RE8A 2NMVA 1XRQA 3NW9A 1MPTA 1A1VA 4Q1DA 2QTBA 4Z9BA 1S1MA 3HDYA 4YK7A 1U3UA 3H5OA 4R4JA 2X8LA 1QTIA 2O50A 4W7SA 4Q4DA 3KFLA 4UTRA 1R3UA 2A3RA 3MW8A 4IVNA 2CHUA 4ZU1X 2R751 1L5KA 1R37A 5AVSA 5A5GA 3WB9A 2DZDA 4IBOA 1I94B 4PPNA 4JI8B 4UXIA 2Q5IA 5BR8B 1M0WA 4R9UC 5IK2A 2V4ZA 3K1YA 1ZNWA 3CNLA 1EVKA 1G291 1Q12A 1ZLYA 1DNPA 3FR7A 2FWNA 3GJYA 3AOEC 3QEOA 4NCKA 4NV0A 2ZRMA 4I99A 4PCVA 2JG3A 2AN3A 1XZHA 2BFNA 2C94A 2PO5A 3KQMA 1UZNA 5E0KB 5K0FA 4X62B 2PZGA 2XF2A 4LX8A 1LI7A 3UJ9A 3WMWA 1J8DA 3FE2A 4B3DA 3E27A 1SHJA 3U4MA 2R1VA 3AKEA 2Z6UA 4DR3B 1B41A 1MGPA 4ZVTA 4TQAA 3I83A 2RC5A 1TFRA 1X8JA 4HATA 3HBNA 2I2CA 4RPLA 1NV8A 2OO5A 2R60A 1LA2A 3ZHSA 2ESRA 1W46A 3KOYA 4MUMA 3ERCA 1RJEA 1RQNA 3IE0A 4QARA 4A7PA 2YYYA 4B83A 1K7YA 2DUUA 2HHLA 1FSZA 5GJCA 1Z4JA 2HYDA 3P0IA 4EMBA 5CX1A 3SZLA 4F9TA 3UB2A 1ZAKA 4C7OA 2JH9A 2YJGA 3OEEA 4O1IA 3SHQA 4BNHA 1T5LA 4D4IA 2WP0A 3WR5A 1J06A 5C8YB 1H5NA 1K3TA 2PVCA 3NMUF 3AUUA 1E2PA 4I4TF 3DMRA 1KGSA 1H2XA 4G09A 4D9NA 1P2GA 2F48A 3DLIA 1F5SA 2GZ2A 1JQJC 3NIGB 1WSDA 3BSSA 4CCWA 2ZWVA 2J3JA 5JYBA 2NT3A 3EBOA 4J0HA 4A8TA 4F3YA 3TRFA 4N48A 2BEUB 1EHCA 2CLIB 4GYYA 5T8KC 1YGPA 1WSBA 4FZVA 4HAUA 3E5HA 5B53A 4HFNA 1XTIA 1GTG1 4EEXA 1DO2A 1C8KA 3ICOA 4EHLA 5IXYA 5GOZA 2VT3A 5C5EA 2JFGA 1ZLXA 2VO1A 4BV9A 5J43A 2YDYA 1LDGA 4JQYA 5AJXA 1L5QA 2VP6A 4RTKA 2DPXA 2W8BB 4A03A 3LS2A 2K2WA 1KBQA 4OJTA 1MA3A 3H18A 4TYQA 3ZUGA 2QSJA 3PXBA 3TFQA 2UYOA 5I5GA 4A91A 2VP4A 2C83A 3FZEA 4TLEA 1YQXA 1YS9A 3U44A 1PS0A 5DX8A 2VKQA 1OGYA 2P9BA 2QXYA 5IAEA 2DBVO 3L82B 1I5RA 1CJCA 1B6TA 4N12A 4FS3A 3TO5A 1CUVA 2DBZA 4YUWA 2MSKA 2G5CA 1QE0A 4LI0A 4HEHA 4HKTA 3K0SA 2NAFA 4RH1A 5HZKA 5K4GA 3W8EA 3IV7A 1G8AA 3T7DA 3HVJA 4MYCA 1EUZA 1ECFA 2XBUA 2PQMA 2GBPA 5EIFA 1ZH0A 4X64B 4AM8A 5CB4B 3G89A 3KZMA 5KNCA 2B9EA 2NACA 4EVIA 3K0BA 5EKDA 1IMJA 1RZ3A 4GI2A 1F9AA 2AJ8A 2GAJA 3AF5A 4IRUB 4KHZA 4YRBA 5BW5A 3WYDA 2OORA 4MUIA 2AOVA 4DNOA 5CBPB 1KPHA 5JU6A 3CF4G 1SQSA 3DCIA 4L02A 1Y6GA 3ESXA 2AMVA 3DFMA 3H2ZA 1T9HA 5EIEA 1KAMA 2Z98A 3PTZA 4MWTA 2J5QA 4TV8A 1UFRA 3A06A 1NR1A 2P6MA 1U0LA 1PZFA 5MN4A 3M82A 2QL9A 4JP1A 1W87A 3R7FA 1LBHA 1PR0A 1XBTA 1AHNA 2N1BA 2XB9A 2H57A 4B80A 3LXMA 4WBNB 2OMEA 4N01A 4PX9A 3K4QA 3Q6NA 5IC4A 2PKRA 3KELA 2YZGA 3ZWKA 1UJMA 4JT4A 4ECAA 1YO6A 2UU9B 2PRIA 5IVHA 2V54A 1TA9A 3BHMA 1TZMA 1IN5A 2EBFX 1C9MA 4U6NA 4M7OA 1SCKA 3F4KA 5BR7A 2VAVA 3TB6A 4RADA 1MV8A 5IEBA 3O8CA 2QMYA 1H4QA 1GJRA 4UHHA 3R0XA 1S3GA 1RXWA 1Y3CE 1ZR4A 2WF6A 3QKRB 5JNLA 4UEWA 2E18A 1NE7A 2OCGA 1M34A 2L19A 3I9LA 4Y6GB 1KDZA 1R5JA 2EBWA 3SQDA 4DJTA 3A7DA 4ZYYA 4FN5A 4NI5A 2B82A 3TSCA 1Z2OX 1T1SA 1SY7A 1WB9A 2HR1A 4GBJA 1JAIA 2I7DA 3G0DA 4FDAA 4QJ4A 2G4CA 2YC4C 4KCGA 1L4NA 1JLLB 5TGDA 1L5OA 2ZUWA 1NNLA 4L0CA 4W8OA 1PFYA 3OIVA 5CB6A 4JGGA 4UM7A 3N75A 5JQGF 4AJLA 1NKVA 4EO9A 2MSDB 2ZAOA 4UEQA 4FR5A 4LOLA 4YAJA 1QF6A 4BEJA 2A84A 3DV0A 1EDZA 2C77A 4EVSA 3O8RA 3ETDA 4DWJA 4X60A 5KTOA 1FYWA 5IWAB 1CZUA 2IPMA 2Q45A 3HGMA 4XM2A 2BWJA 2E89A 3D81A 2B4AA 1Q14A 4TKMA 2E4XA 5SV2A 3TZQA 3BD9A 1SMKA 4Q4AA 3TXYA 3PGXA 3V46A 3C15C 4DA9A 2IWRA 4L8GA 1QGOA 3GBPA 2PXAA 3A6JA 3IBTA 4QBFA 2IPOA 3ME5A 5BSTA 1JN0A 1VG9B 5FUWA 1MJ5A 2E4VA 4DE5A 3TBFA 2QGZA 5E6RB 3TOXA 1C3LA 5JCZA 4B81A 3E5NA 3SSMA 3ZNPA 3U40A 4A73A 3HY6A 4WZAE 4POAA 3PFHA 4CIVA 3L84A 3VVLA 3T1HB 9GPBA 1ZA2A 2CNLA 4YJFB 4EYEA 3H8VA 2I8LA 3I42A 4UDOA 4CM4A 1TM3E 4Z8XA 4J03A 2VDNB 2YWRA 4RACA 1M1NB 1SVWA 2BEJA 1HDCA 4J0FA 1JG3A 1HFKA 4KYVA 1KI8A 1OYYA 1WDWB 2R25B 3S4YA 1Q16A 3DE7X 1T25A 3MT9A 1WUJS 5TMEA 1CUAA 2XGSA 2Q1TA 2P67A 2FQQA 1WXFA 2ID7A 3R0JA 3BE4A 4GLBA 1JSCA 1DFGA 2ZROA 3QFTA 1L8QA 2CLEB 3OURA 4M0DA 4XWTA 4D25A 4O02B 1USUA 5A5EA 3ADCA 3PC6A 2JGEA 3WNVA 1GLGA 1I6KA 1X0XA 2JK1A 1P1IA 3OEHD 4R3NA 5BR1A 3KQTA 5IP5A 4BIIA 5JI2E 3ND7A 1UJCA 3BAFA 2DLNA 3IAM1