1NVAA

Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
380
Chain Sequence
PTKISILGRESIIADFGLWRNYVAKDLISDCSSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPSPRLLIYNRPPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAETILKAVRREVTPGEHRFEGTEEILKARILASARHKAYVVSAGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMFNMALDPKKKIVLLSAIGTPYETRASVVANEDIRVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE SYNTHASE
publication title Ligand-induced Conformational Changes and a Mechanism for Domain Closure in Aspergillus nidulans Dehydroquinate Synthase
pubmed doi rcsb
source organism Emericella nidulans
total genus 135
structure length 380
sequence length 389
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1nvaA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nvaA01
3OKFA 3RF7A 5EKSA 3IV7A 1O2DA 4RGQA 1JQ5A 4P53A 3CLHA 5FB3A 5HVNA 1SG6A 1NUAA 3HL0A 3ZOKA 3ZDRA 1RRMA 3CE9A 3QBDA 1VLJA 1JPUA 4RFLA 4QGSA 3JZDA 1JQAA 1NRXA 1NVAA 1VHDA 3OX4A 3UHJA 1NVEA 3QBEA 1NVBA 2D2XA 2BI4A 1NVFA 1OJ7A 5BR4A 1DQSA 1NVDA 1XALA 1TA9A 4FR2A 1NR5A 1XAHA 3BFJA 1UJNA 1XAJA 1KQ3A 4MCAA 1XAGA 4RGVA 5K8CA 2GRUA 3OWOA 1XAIA 3W5SA 2BL4A
chains in the Genus database with same CATH superfamily
3WNQA 4WNIA 5DM1A 1PJ2A 1SO8A 3CXUA 2YBDA 2DPGA 1RDFA 2ZWAA 1TYEB 1JI0A 4MRMB 3KUUA 1E9AA 3SDSA 4N48A 3T7TA 3RYFB 2PX0A 4L22A 2Y1GA 1E3QA 1EG2A 1OX5A 2FFHA 3BXFA 1S2MA 3I58A 5J59A 3SQOA 1YIAA 4O4JB 1IIBA 3CR3C 3NHKA 1I0ZA 5HZKA 4BMDA 2O54A 1C3LA 3MTEA 3RSLA 4MA4A 2FSSA 2YN2A 4TT8A 1SA0B 3TOXA 3R8CA 3WNCA 2ZPTX 1U7ZA 1ZN9A 3T7EA 5FUMA 4OXYA 4YXWA 3T6KA 3VZQA 1L5YA 2XKAA 4RW0A 1CSEE 1E2FA 1L7XA 4LXHA 5EJIA 1CZKA 4D3SA 5LKAA 3D4NA 3OM1A 3AL3A 2ZU6A 4PR0A 5F1YA 1FPMA 1FUIA 2JD2A 2BBSA 1U11A 2X0DA 1RPNA 1XEFA 1JFSA 5A0FA 1U99A 4E2ZA 4RQAA 1OLOA 1Z6YA 1Y80A 4JT8A 2DMRA 2GPYA 2B7LA 3LFUA 1AHPA 4OU5A 2WVHA 5ESDA 2J5BA 4RF3A 4LHXA 3R75A 1EK1A 1IVSA 2VNKA 1QP7A 2IYYA 1R64A 4LXIA 5E1MA 2Q6LA 1TKRA 2VDNB 2CZCA 2XTJA 3M5CA 1CEXA 1BRTA 3RFCA 1DJOA 1R6DA 2KLBA 3UN1A 2GF0A 4K8RB 5CUQA 1O4VA 3NV7A 4H18A 1B42A 4DNPA 2BRUC 3GNSA 4CR7A 2OCLA 5FJIA 1L4YA 4OHRA 1ZJ6A 4EY7A 1JMYA 1G5TA 2HOQA 1ODFA 1O95A 1EMDA 1W87A 2R48A 3MRXA 3OJFA 3PE4A 4EZIA 4X20A 1GTSA 3KTFA 1FMCA 2JIDA 3P19A 3GFBA 4XRGA 4IDDA 2WWXA 4BO4A 3COPA 3LA6A 3VGJA 3RQIA 2Z3WA 3FFWA 1H1TA 2CWWA 3PNBA 1DJLA 4NECA 3RU9A 4ED9A 1JG7A 2EJUA 4BU0A 3K94A 3HY3A 5BNZA 4BRZA 1KIMA 3K5WA 2L69A 3HXPA 1E99A 3MC1A 1W1IA 3RABA 1C4OA 2G40A 3MRSA 1UK6A 4MW5A 4WZAB 4AJ2A 1EVJA 2PO5A 1I1HA 1MQSA 4RABA 3AF1A 3H9GA 2VCYA 3AF3A 2BCJQ 3DMNA 4X63A 4BX2A 3G68A 3R7BA 2A84A 1A9QA 4I55B 3U19A 1RLUA 4KTVE 2I78A 3FKSD 2QBYA 1QTRA 2NUPB 1SXQA 4HLCA 4OV6B 1NW6A 2P91A 2HF9A 4IH9A 5DP2A 1US8A 3HJRA 3G8DA 2WPDD 4DV1B 1H5NA 5JAIA 4HPJB 5ALQA 1J0AA 1B6TA 3H1FA 5DGHA 3WIUA 3ZGVA 5LL6P 1UWKA 5IKEA 3HN7A 3WFJA 1KHHA 3EQ9A 2FSFA 1S1MA 3WGYA 4F2WA 1CY6A 2J7PD 2VBGA 1A5ZA 2WJJA 4BS9A 5TQVA 2C7OA 5CPBA 5ALJA 2ONJA 4QAJA 8GPBA 2OR3A 4JJAA 1E7SA 4JJEA 3QEOA 2JJMA 5KCZA 5M5BA 4TZ6A 1B0AA 3KYJB 4IF4A 4RHXA 2JH3A 4EDHA 5EYPB 4YMGA 3F67A 3TM5A 3DYVA 3EGIA 5SZJA 1EE1A 1F12A 2ORWA 4OBXA 2RAFA 3DOOA 1XQ9A 4J76A 5KI6A 3OWHA 4UXIA 3EUEA 1W76A 3NVMB 4RFVA 4TQ9A 5KWEA 4XCVA 4LWZA 1Q74A 4GPAA 2OECA 3BQNB 3R3YA 2BT4A 2RH8A 4YRKA 3N5KA 3RBZA 2QPTA 3SBOA 3WMEA 3P20A 1PL0A 1T4CB 2QG4A 2GWHA 2XMBA 5KVVA 1EE9A 3DDSA 2F4NA 3RIYA 5AMXA 1Y7LA 2GBIA 4MUIA 4UNIA 4KRYA 3OTQA 5CNJA 3WICA 2BP7B 3WLQA 4DR6B 3K2QA 3D1LA 1WPQA 4C88A 1E1RA 1QH9A 1L7AA 1C8VB 3LT2A 5KVSA 4JYZA 3FYCA 2O3UA 3AKEA 1FNDA 4UXJA 1V5WA 3RO7A 1M1NA 3INNA 4W5JA 5GJWC 5BN3A 1YKFA 3GUHA 1JJ7A 2HW8A 4MHSA 3NHJA 3WIVA 1PNQA 3FGNA 4G4SO 4LBVA 2LKDA 1H23A 1QWSA 2C88A 2XGMA 4YYZA 4ZEWA 1E2GA 2HNBA 1ATIA 2W2PA 1S9HA 3SC3A 3BB1A 2I8AA 4Q00A 3IL2A 1NUPA 4DLTA 2VJLA 1YQXA 2VYVD 4ZVMA 4KR7A 5GWXA 4WHMA 3L01A 3LDAA 5DHTA 5I7FA 3UAYA 4KHPB 4KNVA 4WDQA 2BF7A 4X41A 2B2NA 2NNLD 1D9ZA 5E6RB 4CMJA 2D1TA 2ZYSA 4CUZA 2J3EA 3M4JA 3WBFA 3RRFA 1CUSA 2R6AA 4BC0A 1OWNA 4MZDA 4CZ2A 1ZJZA 4GEKA 1Y5RA 5AW4A 4BZXA 2VHVA 5FT9A 1HDOA 3JQ8A 1ZKMA 4ZCIA 3GJRA 1KDTA 1NJ8A 1XFAA 4B48A 3RROA 2KJQA 2W98A 5L6LB 1YSCA 3ER9A 1UZMA 3MIZA 3PUIA 2WYOA 4PGGA 4CCWA 1LQ2A 2FGJA 1FNNA 3QIAA 3T3IA 3MQ4A 5EA2A 2PZBA 3UT6A 3IPAA 1CUAA 1FFHA 4C6SA 2YUTA 3S2ZA 4D8YA 1A69A 3QVVA 4J03A 1XZIA 3JW8A 1BD4A 1E1CB 1Q2XA 3R6TA 4BHTA 5ED4A 2WD7B 1KEWA 3L1UA 3I2GA 5BQPA 1NYTA 4P0QB 1LBTA 2A57A 2WHPB 3O21A 4AXBA 5M04A 2ZZNA 2G4LA 3AERA 5E4JA 3UJBA 1UWVA 2XF2A 3LH5A 2GKSA 3KLPX 3C8DA 4KITB 5F35A 3BRSA 4RKQA 5T4FA 2Z2JA 1ULAA 1UAGA 3DZBA 3FNFA 3QA9A 2XLBA 2HHAA 5CT6A 3GMSA 5COAA 4E12A 1B1CA 1GSHA 4KAFA 1ZIOA 3WHIA 3ZV6A 2VJMB 4Q19A 4EECA 4II2A 3O84A 3T4XA 4HLNA 1A9XA 1QS0B 1USKA 4NYMR 4A9AA 3W6OA 3OWOA 1QQ7A 3NRBA 5L51A 1C7ZA 1BFDA 1XA0A 2EW2A 3OQ6A 3ZCVA 2Q9CA 4JYBA 3SNKA 1GQYA 4OXKA 2Y6VA 4IEFB 4EFDA 1LD3A 2WZDA 3KALA 4MDEA 5DM70 2IUUA 3RK1A 1YL6A 2OHFA 2QUKA 3DXXA 4TVOA 3PDWA 2CFRA 2PGNA 2QRQA 4UHBA 4ML3A 4MMXB 1RWXA 4Y0NA 1G0NA 1DQYA 1G64A 4UCFA 3UV3A 1E62A 1RWNA 3N5CA 4BVKA 2GFIA 1I2DA 5IJAA 4Z1OA 3OD5A 3OG9A 5EMHA 3R4CA 1NGSA 3TZBA 1EM8A 1ZNYA 2JIOA 4MIEA 5THQA 5JECA 2RI1A 4WDRA 1VSBA 4ZTUB 2OPHA 4X71A 1PNOA 3PICA 3DEHA 2H2DA 2J9ZB 4AY4A 1UKEA 4U63A 4X66B 3HN6A 2DUJA 3V7WA 2VHZA 3C3XA 3C4VA 3QI2A 1RJ9B 3UHAA 3SN6A 4HEQA 4GKBA 1O1YA 1Q12A 4LOHA 2CLKB 5ESWA 5TGTA 3L7CA 5IBQA 1P2FA 2C5BA 1W36D 4YBRA 1CRWG 3AI7A 4E2YA 1NVGA 5E0KB 3AUYA 3E7WA 2ASEA 4FR0A 2JZNA 4XASA 1U2ZA 4YGYA 3VMMA 1NW3A 1L7OA 2VH5R 4I36A 4QGHA 3ZZTA 3DFZA 1ILEA 1Z26A 1GSAA 5JDIC 3UYKA 3HXMA 2OCIA 5AWFC 2JIQA 4QAQA 3RUFA 4J1QA 3NBMA 4ZREA 3TJZA 2QN6A 4DLVA 1YQEA 1NUTA 2ES4A 4WZ6A 1NXQA 1I6MA 3KQTA 2R7AA 1AGXA 2DSTA 2J08A 3M82A 1R0YA 1XO1A 4ZMRA 3RAFC 1UL1X 1CJBA 3HJGA 2WHRA 4WBNA 2GLUA 1RFLA 1TD1A 4NEHB 2Z1NA 2P1DA 5F5NA 2AJBA 2ZTUA 4G89A 1CF2O 2KPOA 2ZFUA 5WRFA 1LI7A 3FIUA 2DQKA 3TKYA 4XVCA 4IS3A 3H2KA 3PXBA 4KVFA 2NUTA 1Z7EA 4QM6A 4JYMA 2VJDA 5ALWA 1RKVA 3V9PA 1R9GA 3K9NA 4A4DA 3PWZA 1P18A 4IJKA 2ORED 3ULKA 4DPLA 3COJA 2V6GA 1NAIA 3H42B 4JITA 3OBIA 3KOWA 1DC8A 1L5VA 2HU8A 1QQTA 1VHTA 4N18A 3RSCA 5JEDA 1Q91A 3HLTA 4FILA 2VJOA 1Y3HA 3KSAC 4B3RB 1YOBA 5AJUA 4YV0A 2N42A 2X6QA 1RI1A 5HQTA 5KVQA 3I5AA 1KAGA 5HE9A 7YASA 4DA6A 1JTVA 2JIPA 3CVWA 3FJOA 1J49A 1V8PA 1KFCB 2M6KA 3SSAA 1PR3A 1PJZA 2I4RA 2O14A 1ZHFA 3C43A 3EB9A 4BLPA 4XGNA 1CQPA 4WNAA 4YT2A 3GUZA 2EWMA 2GEDA 2WA1A 4GI7A 5IM5A 3T9EA 4DIBA 4B6RA 4JEIA 2TYSB 3O1JC 1LU9A 1V48A 2EG9A 2GETA 2RKWA 3MYRA 4L9WA 1NW8A 3NX4A 3S68A 5FL3A 3TJRA 3VPHA 3KZVA 3ZVLA 2WNHA 4C29A 5A02A 4YHHB 1NJ6A 2IY9A 4C01A 2J5KA 2VFAA 5IYZF 5DYGA 3T99A 4ARBA 2PLRA 1H3FA 4ZWNA 3HVKA 2JIZA 1L1EA 3PUXA 2VC2B 1DELA 2H11A 1B3RA 3UENA 1OYVA 4F04A 5ALVA 4PS1A 2BBWA 1WE2A 3RCBA 1T91A 2BCEA 4N5LA 1K0FA 5H3CA 3WL4A 4AMUA 3FRJA 3D8SA 2JATA 1E6EA 3MOIA 3QVGA 2X4GA 2YZGA 4B84A 4F3RA 5B55A 3DTTA 3D3NA 3EHEA 4WTOA 1G6HA 3N9IA 1KMQA 3GUCA 3KBOA 3NHFA 2D0OB 5EQDA 2DP4E 3SX0A 1J09A 1RYFA 1WHSA 4A8JB 4Y2GA 3BJRA 2GLTA 2OGWA 2TMKA 4EHHA 1NBWB 2Z6QA 2NX2A 1D2CA 4KAAA 3B1FA 4DYDA 2XCSB 1WOYA 4DV2B 2AC2A 1UQTA 2VSYA 3KSMA 1HWYA 1X14A 1NRJB 4WFKA 5FUYA 5KIAA 1GY8A 3DKIA 1KJ9A 1C2TA 3PL1A 3LPMA 4L75A 5FBLB 3VTZA 1XZNA 1ZBQA 4NARA 2BMWA 4JB2A 3THXA 4N76A 2DHDA 2EC5A 4EATA 4IILA 2YYSA 4JIGA 1LDEA 3BK2A 5PGMA 1EWVA 2BM1A 3EVAA 5AP9A 5TF0A 1JB1A 2KMLA 1W2HA 2OBMA 4PGAA 1Q14A 5ENZA 3OIGA 5JI2E 2XECA 2YCBA 1SN7A 16PKA 1W85B 3HYTA 1IB0A 3ZWPA 5IAAA 1YFZA 1FXWA 2QD4A 1BMFD 3OFKA 4G5GA 2WP0A 4D46A 3RYHB 2FWNA 4HAWA 4A36A 3T1HB 5JZMA 4PXSA 4DLWA 1LI5A 4RXUA 5KJ1A 1II0A 1WXIA 3KYDA 2Q1UA 3IT2A 2H4ZA 3G2PA 3KSBC 3E2PA 4EJSA 2W2MA 5GAJA 5LMNB 5JZSA 3PTAA 1TEXA 1SGWA 2HCRA 1XGKA 2C4HA 4UBLA 3UFXA 4ETNA 1TKAA 1U8EA 2RHRA 1X77A 3VI4B 1U8CB 3CZQA 3KUXA 4KBYA 2H1CA 3MM4A 4OJQA 4X61A 3HBLA 1Z9BA 5ERYA 4G81A 3T3GA 5LM3A 3IQFA 2XE4A 2YXBA 3QLUA 4GUDA 2REQA 2Z6AA 1XRQA 1E9DA 1MIOB 2R11A 1OU0A 4W8OA 1H66A 1CUXA 3HXKA 3NDRA 4BKUA 5EGNA 2PBRA 3T7IA 3MOGA 1QYWA 1FRVA 2X9LA 1OV6A 3ED1A 1NBIA 3H8WA 4YI3A 3ACCA 2HU5A 1FQJA 1R5NA 3VKVA 3JWHA 4CDRA 1PK9A 1GA1A 2GBPA 1FU4A 4ZO4A 5HF9A 1EFKA 2A5GA 3OZVA 2ONKA 1A8IA 1IC6A 1XNGA 3T61A 2QTVA 3N86A 3PB3A 3IV6A 1T3SA 3VDQA 1JAIA 1E63A 4FSXA 5EJ2A 4B80A 4BQEA 2WQ6A 2J9GA 2V7PA 3K6JA 1V9SA 1ZS9A 1XK7A 4GIBA 1FRFS 3TJMA 3PIIA 3P9KA 3CX7A 1T34A 1KJIA 4NK5A 3MJCA 4BAZA 1PEAA 2BR5A 1L8XA 4I5GA 3TCNA 3KPUA 4FLFA 4IDBA 2HSDA 1XTTA 1VPTA 2QP9X 4HRXA 1S7CA 1P9OA 3UUEA 4BJ6A 3F3SA 3HE3A 4OXXA 4LCEA 2FR8A 3KYIB 4JGBA 2ZUUA 2REOA 2HA0A 4QULA 4V38A 5DWVA 4LFBB 1FSZA 2DRIA 1GKYA 1LH0A 4IAOA 1VLJA 3FKJA 4BMYA 2K5UA 4DA8A 1XZCA 2DWPA 5IYZB 5L3QA 4RZXA 3ZX5A 2WR8A 3JASB 5EIXA 1HYBA 2CN1A 2Y2UA 3CIOA 1CHDA 3FAKA 3TLMA 4C0LA 4N3GA 3UATA 2OKCA 3QELB 4MRMA 4QPZA 1NM5C 3RYFA 3VNVA 2P4SA 5D3MA 2H1LA 2OHXA 4OJMX 4QKQA 1I4OA 3ADOA 4NNOA 1CUYA 1P0QA 2FWIA 4MUGA 3WLSA 2IV7A 1YL5A 1RP1A 4HS9A 4IUCS 1DV2A 4B6QA 4JLUA 1OXSC 1COWD 5L7TA 4UZEA 3TG2A 4GT1A 1RZRA 5IN5A 5EE0A 5EIEA 4JP8A 2J9FB 2ZJ2A 1JR6A 5IANA 2QE6A 5EL0A 3TFWA 1PR1A 3TR0A 4AY5A 4HNUA 1R0WA 1I80A 4XWGA 1F0PA 2Z1MA 2XMZA 2X2EA 1R27A 2M1XA 3LUBA 1N75A 4JC5A 4BEVA 4UDYX 2BLLA 4DCVA 1SNYA 1XMSA 3KQYA 5CM2Z 2X6RA 1JECA 1DPGA 4C9BA 4IOKA 2IYRA 3HUEA 1A2KC 2ZG6A 1JJFA 4ZD6A 3GYGA 2NUAB 1G6OA 2PX8A 3UJNA 2BZ1A 1ZOOA 2EJWA 3DULA 2G9RA 2YYAA 2D59A 3AI1A 3NC0C 3NC1C 4PZAA 3ZWBA 4F86A 3VKGA 4HLUC 1EFRA 1GSOA 3PIDA 4MKGA 2AFRA 2KW5A 2FAXA 4Y1FA 5A7HA 3K3PA 4RESA 2H5JA 1RC0A 3FR8A 4R3WA 3JZMA 3IR7A 1QPZA 5ISMA 1BMTA 1XTZA 4MUMA 4XGQA 2IPMA 3O8QB 1E9VA 4RGYA 2OP1A 2GS9A 4ILEA 4M0DA 4BC1A 4B83A 4FT4A 3K6SB 1L4LA 4RDIA 1CP2A 4C3VA 3CKMA 3EARA 2PO7A 2RGRA 1FPQA 4M2LA 1JB9A 5K8LA 3OMLA 5B4UA 2G71A 2J32A 4WZAA 2ZYDA 4LQLA 2OK8A 1X7ZB 1JHQA 2FK8A 2HMWA 4PCLA 2VTKA 3FUUA 4WN3A 5K3CA 4RVGA 3RIEA 3NB0A 1W35A 4DDTA 1F6DA 1L7DA 5FBWB 3D7SA 4MGIR 4I55A 4K6FA 2JFBA 3PTLA 1KQOA 4L15A 2NUPA 1YJBA 4DA7A 3H4MA 1R6VA 2HXGA 2JZCA 5L7YA 3RTEA 1T2VA 3U3RA 1R5JA 1IOVA 1YWGO 3INRA 1T6NA 4GOMD 4HDSB 2A9PA 5LDDC 4RTPA 4JN6B 2QAJA 3P52A 1VJGA 1L9KA 3VAZA 2QL6A 3RI3A 1XRPA 4RU1A 5CLFA 4FN4A 4GOND 4OXIA 2QZJA 3RM3A 1HFEL 1T6ZA 3P26A 3A9TA 2GDJA 3PUKA 1K92A 1TCBA 4TTIA 4YV2A 2P6PA 1M6YA 5ALSA 4X95A 4L8WB 1UPXA 4ZFNA 1K5HA 4NQRA 4Z4HA 1J2JA 2R2GA 4KGXA 3F46A 3ZWAA 4D9IA 3NANA 4KQCA 2CLMB 4FM9A 1JIUA 2B0JA 1UMKA 5EYPA 1Y6RA 1P1BA 3T1QA 3ZUGA 1XALA 4Q37A 4ZK2A 2H6EA 5T6MA 3V55A 3E1SA 2CNBA 1SHKA 5ICEA 2RJ3A 3PWKA 3IUJA 2YZMA 5B4TA 1E59A 2ZWVA 4XUEA 5AK0A 1L5ZA 2N75A 3RIHA 4RDHA 2AFIE 1VJCA 1T6XA 4MW9A 2CEKA 2X22A 2WYVA 3M4NA 2HHCA 2ZYWX 3RSGA 1Z73A 1T4CA 4BGIA 5L4NA 3DOHA 5KQRA 1HG1A 2H31A 4P38A 1JDPA 3TDKA 4E1AA 3HY6A 3JZDA 4IOMA 1H2AS 3BVPA 3NP9A 2OYRA 1AQIA 2WF5A 2ZQ5A 1RRKA 4RSMA 4DUGA 3HCNA 4KV9A 5JPDA 3UG7A 2XUKA 3L3BA 4GWGA 4RJKA 1ADFA 5E4YA 1N77A 3KELA 3RS0A 3BMQA 4C4OA 4QT4A 5IVKA 5BYBA 5A03A 1Q21A 2JGEA 4RM2A 1YA8A 1MG5A 2HF7A 3KVVA 3BX1A 4Y1GA 2AKEA 1BZYA 3LT1A 4OMFG 5BN5A 5IVDA 1S89A 1KSJA 1NFFA 2GT1A 2J4DA 3HADA 2OXIA 1DXYA 4Z4CA 7ABPA 3OHSX 4W9RA 4NSNA 3TKAA 3S8YA 1DO2A 3X0DA 5TSDA 4NVRA 4IIUA 4YUXA 1MH1A 1MRSA 1VLZA 4RD0A 4OGWA 4R2MA 3RBXA 5F98A 2QHXA 3TLCA 1J5EB 2PSDA 4URFA 1SG6A 4US2R 3G5TA 1AA9A 4PRYA 4EFKA 4U7WA 4AMGA 1EPUA 3UM9A 2HQOA 2AGVA 1T3ZA 3E9MA 4E7OA 4QRDA 4IWYA 1ZHHA 4QFBA 4MSUA 4L6IA 3ELBA 2R97A 3UJDA 4AULA 3H5AA 4UQLA 4JAVC 1DT3A 3BULA 1SUFA 2EG5A 2EYUA 1ZIYA 1G8MA 2X6TA 4H4EA 1BJTA 3HB9A 2Q5HA 3G5LA 2GZMA 2R6CA 3OUZA 4QYSA 3JZAA 5G2OA 1TAQA 2A9VA 3LVQE 3N8NA 1K68A 1CDOA 4J16A 2AUNA 5FOVA 5LBUA 2FW0A 4P7GA 4EFMA 5T5QA 3R6WA 4MROA 4CTMA 1O9GA 2D5BA 3BSYA 1NMEA 3D7LA 2CBXA 3HPQA 1EVIA 2VNIA 2JS7A 2QUBA 1Z75A 3CUWA 3WDKA 2I3DA 3AFOA 1LCIA 1G5HA 3ZV7A 4CV2A 1S5PA 1WLSA 2C4MA 5BO5A 4YMTA 3M2PA 2DH5A 1CJTC 4MCIA 2Z5LA 4MP6A 2QVGA 3OU6A 1E1CA 2PEZA 3SICE 2W6PA 3ZU4A 1QKIA 2WD7A 2ZUVA 4CM7A 4DLNA 2Z2IA 3L77A 3P32A 3HBFA 2V74B 1XLTA 4IJ6A 4F7WA 3PU6A 1QHYA 1VMDA 3MAAC 1W94A 3ID6C 5G53C 2JLVA 4EITA 4FLMA 3WLNA 1HETA 4E94A 2IYNA 2VRNA 5E2AA 1VJDA 2R5FA 2C29D 3JQ9C 2D1SA 5B1YA 1GT91 2RGCA 3C6XA 2JFYA 2AG1A 4O6VA 3FNRA 3VZDA 4JIMA 3AVUA 5TDHA 5CFMA 1OR8A 2ST1A 1XC7A 2AN9A 2WVGA 2K4MA 3BS4A 1KZ4A 3IPXA 4UVGA 4YRPA 5THXA 1U94A 4M1ZA 3WAJA 1YZHA 1Z62A 3FPHA 1QS0A 5DTJA 1GA6A 2HY7A 2GAAA 3NHLA 4ZICA 4BVBA 4L4UA 1KKLA 2B8JA 1M5TA 3IKTA 3G7UA 3ZHCA 4TTRA 4CQMD 2YFHA 4JUIA 3EIWA 2I54A 1LK0A 4J4TA 3KQLA 1RD4A 3U7IA 3KUCA 1RMYA 2DOKA 2AZXA 4K2HA 4LOAA 4UDNA 2FPRA 2Q29A 1T5IA 3U48A 1E6WA 2QJFA 1B0PA 2IXTA 5DU2A 1U8AA 2OQRA 4F3NA 4CL8A 4NV3A 5EEHA 3FMIA 3C14C 3M5DA 4MKHA 1RQLA 2C04A 3DO5A 2JLCA 3LQKA 3PNLA 4GICA 4WIAA 4IVRA 1QR6A 3TBFA 5KBYA 1OGJA 1QZXA 4EG1A 1TPYA 1JXAA 4Q1FA 3HYSA 1K97A 2XY4A 4MI9A 3I05A 1GITA 4G8BA 1K6IA 1PFGA 4HEJA 2HAEA 1VG1A 5FULA 1Y9DA 1Q1EA 4EMBA 4WGGA 4Y67A 4YCLA 1T9GR 1KZGB 4CMHA 1EYZA 4W1PA 2Z30A 4TWJA 1RJ9A 4N41A 1K8QA 3BE5A 2Q7OE 1ISJA 1HE8B 3DCYA 1XAGA 1KK2A 3P9SA 4V39A 2V8OA 4UTRA 4RLFA 4D8UA 5E38A 4ZCSA 5HPYB 3I8SA 3VX3A 3W0LB 2UKDA 3ZE8A 4H1WA 5IKMA 2P7HA 2CZGA 4M49A 2HCFA 2VK2A 2XZPA 1HEYA 4C1NA 5FOSA 2I91A 1K7SN 1RHJA 4MP8A 3TZKA 2JAHA 3ZLTA 4K6KA 5I7OA 2Q2WA 4MCHA 1M6WA 1FLNA 2QSZA 1OX6A 4JVOA 1YO6A 5ALOA 3T38A 4BNYA 4ZMBA 1A7AA 4DLSA 1E66A 1WPGA 1VKNA 4IH1A 1EBUA 1QVVA 2G4CA 2QD2A 3W5DA 2Q2OA 2YFQA 4LY9A 3VU1A 1KS9A 2JD1A 4D8TA 3L6DA 5B5SA 3QE4A 1ZH6A 4R69A 2FPPB 2X40A 1TM7E 1UEJA 2G0NA 3EVCA 2QGNA 4FDMA 4I1SA 4Z9BA 3WGTA 4QZVA 2OQ2A 4L74A 2V5VA 3ZD6A 1WOMA 2FCAA 1KYWA 2IA5A 2MT9A 4EKNB 1BA3A 1FQKA 4MGEA 2IIBA 1BH2A 5DX1A 2HUPA 1SXPA 1EFTA 5EHXA 5HKKD 1KIFA 1BHSA 2EJCA 3PEFA 1TMYA 1G3MA 4R5HA 1BRMA 1C30B 3HKBB 5DHAA 1AZSC 1P3DA 1T9AA 3WK5A 3C1AA 2OV3A 4XWKA 3SHVA 2OGSA 2K2WA 2NZYA 4TKMA 3PLAE 3ESCA 1V11A 2PXCA 4F12A 3R9KA 5G0SA 2FLKA 5BSTA 1ZA2A 4OJNA 3EBPA 1K63A 1RWPA 1G2PA 1RACA 4X64B 1VLLA 3ECAA 4MRPA 2F62A 5TV2A 3N75A 3S5JA 1U0JA 5AHRA 2V9CA 1LBQA 2ACVA 4O2BF 3JU3A 3IXMA 3KXPA 1IXRC 3W4KA 2VPPA 4XDYA 2OWDA 2PXXA 4ARIA 1ODKA 1EWRA 1G21B 2GN6A 1DXHA 2QLMA 3JYNA 4HBZA 2NWQA 3IHLA 3R3SA 4IXTA 3P1JA 3NXSA 4X3CA 3WWCA 1L5RA 2GEKA 1TYZA 5LU9A 5D3QA 3P27A 4LS3A 1WB4A 3EE6A 2PT7A 1CE8B 1MENA 3SC2A 5LQAA 3BWYA 3S55A 2Q2NA 1D6MA 1JSLA 2FZVA 5EZYB 2I6SA 1MOPA 1KNQA 4OGLA 3HBNA 4O4HA 3ZIDA 5DNYB 4XUDA 3FXAA 4XR9A 2FPWA 3HY4A 2QL7A 2W6JD 1HPLA 3WQBA 2FW7A 3EA5A 3KOUA 3R3JA 4PZEA 4IIXA 2LCFA 2IXAA 2AF3C 4TYYA 1MBZA 2P0EA 4P4UA 1GFWA 1WU7A 1JG3A 4A8JA 4BZWA 2VXBA 4NAUA 2WF8A 3G0CA 3EPJA 1QCYA 4HD8A 2QRVB 1BCRA 2DX7A 3OPQA 3CNNA 3TTUA 9ATCA 1ZO8A 3BFXA 4PE5B 2QNIA 3WX0A 3ZVMA 3KQMA 2YXPX 1AHIA 1H2FA 3EZXA 4RE5A 4TKZA 3NDPA 1MIHA 4J4BA 1JDZA 4AMBA 4B4DA 2XODA 1D4FA 2CE2X 5BY2A 1YB1A 1ZM4A 4MP3A 4UE3S 3KZMA 1XZDA 1C29B 2IU3A 4BMOB 2GA9A 4QECA 3TN7A 4FHEA 3U13A 1YTUA 4FN5A 5IS2A 1JG6A 3W3AA 2CE7A 2DC1A 2FEOA 3DEIA 3UF0A 2BVNA 3B70A 3QOXA 3LWBA 4GOOD 4GPIB 4JGGA 1I2ZA 1HXHA 3OZGA 5ALPA 3RD5A 5KPDA 3SSNA 4F93B 1A2BA 1T0JB 1S01A 4PAMA 3ZVRA 3VYWA 3RYHA 4QNMA 1KU6A 4JL6A 3QTLA 1CDEA 1E1KA 3AINA 1CYEA 2CLHB 4LMRA 3OO1A 1JHPA 1TOAA 2VDWB 1UP6A 1UBRS 2QR5A 1FP7A 3LTEA 1HX7A 1WP4A 4JMLA 3TZEA 5BN1A 4UD6A 1SCJA 5EPUA 2J0UA 4LZNA 5DWDA 1G9XA 4L07A 3IUQA 2H4FA 1O77A 2A4MA 3AU8A 1TK3A 3F9IA 4HMOA 5TMPA 1BE8A 1C0LA 1LSOA 2BAGA 2BM8A 3DFMA 3O3CA 4NH4A 4GOJA 3WWEA 2EZ4A 3IT1A 3SFTA 2UZ1A 1NOKA 2EATA 2V65A 3NR2A 3G2IA 4K9LA 3V33A 4N0EA 1P62B 4ZOLA 4IDFA 4MW2A 1EK6A 3KTOA 5EUQB 5C8VA 3PQ4A 2OFWA 2OHHA 4HMPA 3CTMA 2X5JO 4QHSA 1MIOA 2ZATA 1DI0A 2ZIWB 2VJAA 5FA5A 1FFYA 2ZDHA 3ZTWA 1XMQB 1DSSG 2DE0X 2W6CX 1T6BY 2GOYA 3E48A 3IVXA 4BNJA 4GF5A 4DG5A 2D8MA 4FZ3A 2Q45A 4V0KA 3L8CA 3DZIA 3AR2A 4JODA 2QLFA 4AX8A 4OX9B 1L7PA 1IMJA 2C0QA 1JHYA 1RWBA 2P67A 1N92A 4RD3A 1SAYA 2OHJA 3SFZA 4BLSA 4ZI3A 4G26A 5CM8B 4Q9JA 2NU6A 3H8VA 4GC9A 4O2BB 4Q93A 1Q50A 5HRUA 1Y42X 2EBFX 3FZEA 4X93A 1DC5A 4XM0A 3UJPA 5ECWA 1HUQA 2AW5A 2WT4A 2BH9A 3HKDB 3S2UA 1YHNA 3H2SA 3TQRA 1F8FA 1X9IA 3ZZNA 1E4OA 1JQJC 4EG7A 4H6WA 2XUHA 4UVIA 4LRUA 4AUEA 3AX6A 3I9MA 3SF0A 1DOZA 1XP5A 2XYVA 3CZMA 3DD1A 3SQMA 2PS0A 4HH0A 4R6WA 3JQAD 3I39X 4NKRA 1KEKA 5BV1A 3SYTA 2ZM6B 3P96A 5IYZA 4J7UA 5KYTA 1TMKA 1GPWB 4HWRA 1XL0A 4EYEA 1ZN8A 1QK3A 3C98A 3STHA 4G0WA 2WSBA 2O9JA 3ANTA 1DWOA 1NASA 1RCTE 3M1AA 3BXEA 3QELA 5D85A 1JHUA 2ZSUA 2Q1YA 4P58A 4JASB 2ETVA 1DC6A 1XCLA 2IP4A 2Z43A 4W5QA 4NTZA 2QAGC 1KBOA 2ZOSA 3IQGX 1PP4A 2A3RA 5L7WA 2I4MA 5BUZA 2MWMA 1NL3A 3KSRA 4FSHA 1N1EA 4C2UA 1GG2A 1UBCA 1J2UA 3JD0A 3PWSA 4HUTA 3VNSA 5BQFA 3LZCA 1JR4A 1ZFNA 4DZRA 4FQ8A 3T3PB 1KJJA 1XCBA 3GVHA 5AI0A 3VBCA 4LYDA 1G55A 3ICPA 4ARUA 2PWYA 4IDPA 1JQ3A 3MUNA 1V7ZA 3K0FA 5DHSA 2A8YA 4GX2A 4XUCA 2FEMA 3T1TA 2EFJA 3SAJA 2BW0A 4S24A 3GNTA 3GWGA 3IDFA 2NVWA 2BI8A 2NUAA 1JQBA 3CMCO 3F71A 3I0MA 3KLNA 3O5AA 4K9OA 5L95A 2IUEA 5A5VA 3UMBA 5IVPA 1ILWA 2XNKA 4AMVA 4OHZA 3SJ7A 3N3AC 5A71A 4YRRA 3NTVA 3Q7QA 1V16A 1NNEA 1L5GB 4TMZA 4AECA 4B6JA 3F0TA 3DHNA 3TIXB 4AK9A 4DL9A 1ACLA 1XELA 2X7JA 3N8HA 4H7HA 1FDWA 4QOEA 3DM5A 5H5JA 3TVDA 2IYAA 1X7DA 3O8QA 4DBVO 1JEJA 1R2QA 4QYWA 2JIBA 1XA4A 2IHZA 2ZJZA 4KXWA 2V7QA 5L3SB 4UBOA 4R9NA 2A1IA 3GRFA 1F2TA 5MFPA 1UT5A 3AVOA 4RZIA 2CMFA 3KQOA 2JKZA 2JIMA 3A3KA 1KYIA 1X74A 4Y2SA 4CL0A 3OD1A 1U63A 5IAKA 2B34A 2VS1A 4O2RA 1ESEA 4XPIB 1Y4ZA 5G0WA 2MSCB 2PD6A 3EOZA 1II9A 1G17A 5DTEA 1SD5A 4C2TA 4ZTBA 1X7GA 2VJCA 1Z2DA 1R5OA 1RWQA 2YNMD 2QTRA 2ZTVA 4NAVA 4OKNA 3U5TA 3U39A 4ENSA 1FFXB 5IKPA 1LFDB 3T95A 1ISFA 2VJBA 4KLRA 2CHQA 3DM9B 4MVJI 1D7OA 4MYUA 5LBIA 1NLZA 1IK6A 1R66A 2E5WA 3ROXA 3UKDA 2ZRNA 4QUGA 4HDSA 5EMLA 2NXNA 3WKAA 4I8XA 1I4WA 1XKQA 2DWQA 1NXWA 1YFJA 5J40A 4ZZ0A 1PJBA 3DLBA 1KEZA 2I6QA 4AMZA 3MGKA 3X1WA 3PJRA 1ZCJA 4IMRA 1PQWA 2GTIA 1C7JA 1AKUA 2GGSA 1J99A 1K4MA 1MEJA 1JJAA 4WK6A 2A92A 1VYVA 3UMFA 2Y92A 1R8QA 5J43A 1JG1A 1OC4A 3CZCA 2VF5X 1GFSA 3AM1A 2OCBA 3OIWA 4LJYA 1U5CA 1VI5A 3AUFA 4RPGA 2E55A 3V1MA 4YV7A 1RXCA 2OBFA 3NEJA 5DI9A 4E30A 3N2ZB 3UPDA 4ME6A 1K3UB 2AOWA 3O4IA 4KQGA 1A7JA 2OBNA 4H9GA 4OUDA 5EWJB 3P4XA 1Y4UA 3EISA 2R1TA 4NBTA 5GQSA 3GR6A 1ZI6A 2OBBA 3ZBQA 2VOJA 3DKVA 1E3EA 4LHWA 2TMYA 4RA9B 1T2DA 1MNAA 2B8TA 4OFXA 3SX4A 4N0DA 1O3YA 1QC5B 1SK9A 4RORA 3U9SA 2JLYA 4NXNB 1LBHA 2CDBA 3WRWA 3I5XA 2BMAA 1NXSA 3ZHVA 1XKTA 5BSHA 2W6IA 4DIMA 5EJ5A 3VDRA 3QE2A 1NUQA 3AUAA 4XKJA 5KSPA 4Y6RA 1AN0A 4L6AA 3G59A 3C3BA 1AGRA 5ED0A 1SEVA 3ADPA 1WM1A 3VO9A 2JANA 1MAHA 1ZQ1A 4XWTA 5AM4A 2EEZA 4YRSA 1J25A 2AMVA 2CXXA 1N2HA 1J22A 4ASUD 4UFPA 1F60A 3OTGA 1V4VA 4ICIA 4XCQA 4DNFA 3VA7A 3T0IA 3FWHA 1TF2A 1CLUA 1YZLA 3B2QA 3DDOA 3JWGA 3QXJA 3R5FA 4NBVA 2YH2A 3HO1A 4RPIA 5EN4A 3R77A 3CH6A 1IOWA 3H5OA 4ZCPA 3RTCA 4GI5A 4DMKA 1KFBB 4R1MA 2R8RA 3CH5A 1GPDG 2C84A 4NBWA 3PK0A 4RPHA 4H0CA 2YMPA 3R74A 2XGOA 2WAXA 4B8WA 3W5VA 1ISMA 2RARA 2IDJA 2ATCA 3FWZA 1G63A 1WXGA 4GM1A 5BQOA 2OGTA 4FFSA 5KWSA 4DKXA 3D59A 1IWBB 1QF6A 2HEGA 2KQUA 3D2BA 1I6LA 1U3GA 3TD9A 2XMCA 2LP4Y 3F97A 5AKYA 1Z2PX 1N0IA 2HBQA 1CUIA 5JCPA 4CEIB 1FY2A 3FRHA 5B3AA 1W4AA 4PU0A 5B58T 3OEED 3ROTA 4EAAA 1SG9A 1XR3A 2Q4RA 4LYEA 2PPVA 2I7XA 3A2NA 1XVUA 3L7BA 4PW0A 3G9TA 4B2LA 1XLVA 1VJTA 4Z1MA 3ITEA 4E3WA 4UEJA 3X2EA 4KN8A 2JEOA 1Y6FA 2HI0A 2XLCA 3CSUA 2DFDA 1OLUA 3PRKE 1OFGA 3V2GA 2FKAA 1OI7A 1U1EA 1UZLA 2PMWB 2BM9A 4NOLA 1NATA 1H8HA 1R00A 2PYDA 5FBZA 3D3JA 3RS5A 4JJGA 1IZZA 1Z28A 2WIAA 1Q77A 3CR8A 3A3PA 2BGJA 4FOSA 4IBOA 3FSJX 5H83A 5HMLA 4F4DA 2FW1A 3CC8A 1NMQA 3STVA 1ZISA 4R01A 1SM4A 1X8XA 1G4UR 1YK1A 2ICAA 4CBVA 1IXZA 4CIWA 3GDGA 1NVMB 5FYQA 4JI3B 4CLOA 1ZNXA 3Q0IA 4RJLA 1TT5B 3DQZA 3PFKA 4KMOA 3QTBA 4ZVSA 1C3OB 2ALJA 1ZK4A 4AM8A 2WSMA 1G41A 3RNLA 3MWFA 4URXR 5ANRB 3ONNA 1P0IA 4QEDA 1BQ3A 1JJIA 4XJXA 4BCBA 3ZWKA 4BX8A 5JU6A 4KR6A 1Z7WA 4EPXA 4CF6A 1MTOA 4EH1A 5BV0A 2E0IA 2QM0A 1PGNA 3O1LA 4YMIA 3R76A 1ESDA 4BMVA 5TX7A 1AKWA 1EFLA 4K9MA 4UOQA 4JLPA 1D6SA 1WKVA 3K9LA 1L4FA 1VL8A 3ZHUA 3CU5A 1OTYA 4N6GA 2WWYA 2AEMA 3PI6A 5KNBH 4JD5A 1OMOA 3BGVA 1C7RA 2YYYA 3HR7A 1ZXLA 3E81A 1DC3A 2JLBA 3C5HA 4V0MA 2CK3A 4Y7DA 2XNDA 3UICA 3MWLA 5C7LO 4DFDA 4YP7A 1IQRA 1JR3A 4TRNA 3EPKA 1CB0A 1VLHA 1WUTA 3FPJA 4NE7A 3ENNA 3HWSA 4MWSA 2OO5A 1LZKA 4I6GA 3CW9A 3L1IA 5DIFA 3V3TA 2XQVA 2DF8A 4OF4A 1RQ2A 1E2EA 4S1VA 3K5HA 3ZKWB 2X5OA 3BTSA 3E4DA 4TRRA 3WB1A 4YJGB 3GQBB 3LAWA 3FLMA 3OY2A 5HK8A 3VAYA 5JZVA 5BRNA 3ZUPA 1JL3A 1JKJA 3MTIA 3OPXA 2R1UA 1VMAA 2HK7A 1LVHA 2XUFA 2QEQA 2OZLB 4A73A 2Y0PA 3TEMA 2OHVA 3EIXA 3RSHA 2FEKA 3B3GA 2NVUB 2ODEA 4R54A 4C30A 2GM9A 2UYQA 5IWCA 1S8FA 3TAXA 1YI0A 2CMGA 2PH3A 4U6QA 4W5WA 2ID7A 5JBIA 4MV8A 3FNIA 3TZLA 1FRNA 4BNFA 2HM7A 4ROTA 4YV1A 4S35A 1EEXB 2PFGA 2GJSA 4FINA 1IBMB 4YP6A 3QVSA 4J6FA 3RKSA 2R62A 5JBNA 2HT6A 2Q3HA 1TC1A 6REQB 2K7FA 1W6RA 5K8VA 5KYUB 3GF4A 2CFCA 1CZHA 1ZYUA 3BAZA 4KN5A 2C58A 3A32A 5BSEA 4OHYA 3GEIA 3WBBA 1RRGA 4BWFB 3SBEA 4LJ4A 3RR2A 3KXDA 4DPMA 2VOEA 4RNCA 2PVCA 1NYQA 1GZ6A 1D6NA 2GEJA 3U4QA 1Y1PA 5H4HA 1L8AA 2I67A 1EX6A 1QGYA 2QZ4A 2ZIXB 3EFOB 4L3VA 2EARA 1C30A 3FMOB 1EDBA 1X1RA 3PE3A 1LJ8A 4Q1VA 3NASA 4RGVA 3QNUA 4RYDA 1NMYA 5DM60 1QUEA 3ND9A 4CG1A 1RE1A 3VYVA 2O8NA 1JZSA 4COKA 4MB6A 1NBAA 2LPMA 4S1WA 3D31A 5LYJF 4JFAA 4WLUA 4QD3A 1UEXC 3A6GA 4UHJA 1I1QB 3HZRA 2CB9A 2JFVA 4FEEA 5CBKA 2V59A 3AUXA 4Z3DA 4JI0B 3DC2A 3ZZ1A 2GEUA 4AY6A 4PX2A 3EULA 3V4ZA 1FBTA 4D0SA 4Y2YA 2II6A 1A5AB 4D82A 4LQ4A 3HCDA 4JDUA 2QL9A 3TRIA 5DNUA 4XLLA 3ROGA 1TA0A 5DYWA 4Q47A 3R09A 1TYCA 5ARDA 5C1DA 5EZYA 1HSZA 4ZYTA 4G4SP 3DPIA 2AUMA 4U0JA 4B32A 2JA1A 2GJKA 1YBAA 5KPJA 2B3DA 3BGWA 3MAJA 3H2BA 1XMJA 2ZVDA 4LXUA 3F96A 2F1RA 5AKHA 4JUAA 1JDNA 1Q16A 5I9SA 4JELA 2G28A 3CLTC 3Q3JB 2R84A 3DMTA 1MO2A 1D2AA 1S2GA 1U31A 2PS9A 4HAIA 4WNYA 3W5CA 1L4UA 5HFAA 4K40A 4CGZA 4UOZA 5LJLA 1VBNA 4JI7B 3GX1A 4DXHA 2PJZA 1REQB 4IXWA 2OG2A 2PX3A 4U00A 1UJ6A 4N5HX 2GK6A 1LPOA 1NDUA 1FUYB 1SK8A 3BXZA 3PXDA 5DW3A 3HWRA 2O5RA 3G8YA 4UXHA 4KQJA 3Q7RA 1GQFA 4KK4A 1M8JA 5EKDA 5FD8A 4KO4S 1IJBA 3KEFA 2WA2A 4I1RA 4J1TC 3CSDA 3GPCA 2A1UB 2VUHB 4HL6A 1R74A 4U39A 3RG8A 2NAPA 1UQRA 2DGDA 2IHYA 4XIFA 4X7BA 4LXGA 4WKGA 2Q6VA 2XI4A 4B3DA 4RY9A 5ILQA 4BGDA 3L7KA 2AVDA 2WG0A 4E07A 2HA4A 2Y1CA 3PWTA 1QG0A 1XU4A 3SE0A 1NMSA 3BWMA 3O4RA 4JT2A 2BIFA 4POOA 2YV3A 3NC4A 2DHEA 1E64A 2V4MA 4P54A 3CR7A 1XU7A 2Z5FA 1WF3A 5DBFA 4AZVA 5DX8A 2IYQA 3EVGA 2X86A 4JYPA 2UZ3A 4I5EA 1M0EA 3BZWA 3EPRA 2E5FA 4EVQA 4RK4A 1ZEJA 4DM7A 3WR5A 4N65A 2Q99A 3NTXA 4GW3A 2OB2A 3BD7A 1R0LA 3Q8XB 2Y77A 4MB0A 3FOCA 3E5HA 2L2QA 1R9JA 1RQGA 3RJ9A 3I52A 1GTG1 4O0LA 3MTDA 3IE2A 3ZHZA 1VPWA 4MCJA 1T9HA 3ZU2A 4LQCA 1C4KA 3WKBA 4XJVA 3GIDA 2QTCA 2ZYHA 5AJYA 3TOSA 1XZJA 5GTDA 4JP2A 2Z0MA 3AFGA 1TFUA 4BATA 1U2DC 5FFMA 1V39A 2Z2KA 5CCBA 3G89A 5JMTA 1RMTA 3IIKA 2WPNA 4C0HA 1FDUA 1V8DA 4LNUA 3WAGA 2XDQA 4R2JA 4ZVPA 3SVTA 3IFSA 5BSWA 5LQCA 1P0PA 8OHMA 2AG5A 2BEVB 4K0KB 2ZBDA 3V97A 5BWBA 4J6EA 2HL6A 4KQ6A 4DN6A 1IHDA 3I2KA 1RRMA 1GN9A 1QIJA 1TJNA 3NJ4A 4M22A 5DXAA 4BFTA 5GV7A 4ZV4A 4NDNE 3UJ9A 4PZUA 4Q4JB 2ZSDA 5B57C 5BYKA 1TUIA 2GVDC 3A6JA 2H1VA 3ZGZA 4XEHA 1I3LA 4MVJH 5EZ5A 2GCIA 2V6FA 3AR6A 3DG9A 2F59A 2HU2A 2V54A 3OQIB 3R6LA 3ETCA 2QDKA 4JLVA 2RGNA 1BC5A 3FHJA 1O08A 4B74A 4YXWD 2XYHA 5FWYB 3HKDA 1SPXA 3P2EA 1L8OA 3HFJA 4HF7A 3U7RA 4J91A 3B6JA 4FB4A 4RTOA 2D1RA 5HKAA 2GN8A 4PG7A 4TXMA 4GS5A 1NQUA 5H8WA 4L78A 5DBEX 4HEHA 4JJ8A 5B2ZA 1JT9A 3P9ZA 2O1SA 4WKPA 2PUWA 3R0JA 5HHTA 3FX2A 4AMYA 1GGHA 1UK8A 4OG2A 1TPZA 3D8UA 3L7OA 2HJGA 5ALYA 5BWMA 3S40A 2IU6A 4GLBA 2RD2A 1ZA1A 2LVBA 4TWRA 4KACA 5KNCH 1WY7A 3P0JA 4JVLA 2XAAA 4BO3A 3KQVA 4KXFB 3W6UA 2GJ8A 3DFKA 4GYYA 1PJAA 3V7YA 3CGGA 2LGJA 1K6XA 2P3QA 3V7NA 4O0MA 3AP1A 3LYHA 3ZGOA 2P69A 3UMSA 3W2IA 3QQPA 5LIRA 2G1AA 1L3BA 1O95D 2ECKA 2C5AA 1XZAA 2IDZA 4ZAVA 4FGZA 1S4QA 2GILA 5GZ3A 1OTHA 5HM6A 4DLXA 3L2OB 1VCOA 2A78A 1BW9B 2WABA 2WINI 3Q11A 2VZEA 3NHUA 5CHEA 2DCUA 2DU8A 3EPPA 1SKAA 1G5FA 5CH8A 3SMQA 3VH2A 2B4RO 5IU6A 2OM2A 3O26A 3K72B 1AMUA 5C7OO 3JQFA 4C4AA 4YJFB 1P7YA 5IVIA 1LC3A 3H16A 5MN6A 2H1SA 3SY8A 3ZHRA 5AICA 4F45A 4IM7A 2R00C 2HB6A 4MMZB 4RTJA 4EL5A 2P4HX 3K5IA 3B5IA 3HFRA 4GKVA 3L5KA 1NQAO 2WKRA 4Q01A 1OB2A 3B1YA 3KM0A 2AFVA 2C94A 4BNHA 3A10A 1OKKA 3WE7A 3M9LA 2WYHA 1UJ5A 2FCRA 4UCXA 3U37A 2ZJ0A 4JEUA 4N7RA 3HGMA 3ETGA 3MK31 4GQIA 4R84A 3V1LA 3W5BA 5I6DA 3KT3A 4X1OA 4CKYA 3A9RA 2MTBA 4Q48A 5P21A 2DPHA 5ALIA 4M89A 5GMOA 2QM7A 3V1NA 5BVGB 1MO6A 3AUSA 1HE3A 3JQBC 5IABA 2IL1A 4FMBB 3HVHA 3R7FA 4W5OA 2QMUA 3TG8A 1T5OA 2VYFA 5L3SA 2JHGA 1M3SA 2DYKA 3EXAA 3DLCA 4JLOA 3QPCA 2IIQA 2XNSA 2HJWA 5HBGA 4L3WA 3DTVB 4NULA 4JBXA 3ND7A 4XPIA 3E6AA 4LRSB 4PPYA 1O2DA 4H3VA 2XMDA 2XT0A 2YRWA 3TR5A 4CR8A 1JHRA 4TVBA 1T2EA 4WEQA 5KNLA 1NNLA 4HFMA 1SZCA 3L82B 4MLPA 1XD2A 4Y9SA 3OTOB 2FLVA 1E7WA 4HAYA 4CN8A 1JVBA 4ALNA 1TTQB 3MS7A 2BEUA 3Q5EA 2OV2A 1KZ9A 4QOFA 1NOIA 2WG1A 2RHBA 3BA1A 2JGDA 3G1WA 3HNPA 1YJAA 3RJ5A 1LPAB 4NZ9A 2NU8B 4WH0A 1BWRA 2ZRGA 4U6SA 1W5AA 4D6PA 1IH8A 3K0CC 4EIWA 2AK2A 2C98A 1E1RD 2OZEA 2VCEA 4E1BA 4I14A 2XIJA 5KTMA 3BICA 3DONA 3CLUC 5JWRA 1EP3B 1QBGA 1VKOA 4BNMA 5IDQA 3Q8KA 4BV9A 1PV4A 5KOJB 2I65A 3VU9B 2H2IA 3R7LA 1WY5A 3KVOA 4JV5B 1JPVA 2A9JA 3UOGA 3AVWA 4GX0A 1VE7A 5BVHB 1R8XA 5BT8A 1JDJA 2AC7A 4HB3A 1NI3A 2IEAA 1VRWA 4F5DA 3H5NA 5KWJA 1YE3A 4GI2A 2NUBA 4UU7A 2BFFB 3BK1A 3CVOA 4FOLA 3D5EA 5D51S 1ZICA 1R8YA 2P5YA 1GP2A 1N2GA 3OPNA 4JHLA 1Z4IA 4ONEA 4ZVUA 4R2KA 3WYDA 5DOZA 5LC1A 2X2FA 4MUXA 5HIJA 2QTBA 5JANA 1VCIA 4FXPA 5LQRA 3N2YA 1R18A 2E6UX 4RA9A 2O3QA 3CRQA 5FRDA 1VBMA 3DV0B 2QPAA 2WJYA 1VHLA 1PBNA 4NP6A 3HO8A 2H9IA 3KTAA 1BXGB 1BXKA 1OE0A 2NT4A 4PM4A 2WKWA 4S2UA 5JNRA 1XF1A 3BGSA 5SV2A 2VF7A 3GRKA 4YQZA 4ALJA 1AGYA 2MSDB 1E0SA 2V5AA 3JCZA 3SP1A 3VVBA 4BFUA 1IN7A 1SXJD 2OBYA 3IUNA 4B34A 2C92A 2EIHA 5CT4A 4TTTS 2Q6KA 5F73A 3B5JA 2GPJA 3OIYA 5KO2A 2XWJI 3LDHA 5F4ZA 3UA4A 1L7BA 2BFDB 1W4RA 1R3DA 3N8IA 2QL5A 5F78A 3MGGA 5KS2A 3CCCA 2MSWA 4C05A 1H9CA 2YHSA 2G72A 5K3AA 2GYUA 2R66A 2F9LA 1XXLA 3PJEA 2NXCA 4R2WA 3FN4A 2IOHA 3IBYA 3JR3A 5L45A 1W0JA 1TD9A 1ZD5A 2RBKA 4M7RA 5JJ5A 2PWAA 1E9FA 1SC6A 1XE3A 4EGFA 1YE5A 1T2FA 1Q2UA 2P9ZA 1L5MA 1UKZA 3FOBA 4BKMA 4ZQFA 4E13A 1XRRA 1ULUA 4RKYA 3ZE1B 1VCMA 1KVUA 1K88A 4BZZA 5JJCA 4Z0HO 3WBKA 2JCVA 3GARA 3ENKA 3Q9LA 3UVEA 1SD1A 3LZ6A 4PLCA 1SHTX 3T35A 3U61B 4YWJA 2CBGA 3G82C 2AEEA 1Q95A 4DSTA 2IJGX 2QGZA 3R20A 3PTZA 4KQWA 1JAHA 1Q1BA 3WSTA 1QQBA 2ISCA 1Z13A 2QDXA 1TUEA 2DFLA 3NJRA 3PDIA 5CK4A 5ADWA 3K4HA 4G8JA 1P81A 3B1ZA 1L7RA 3G9UA 1X1DA 1SUIA 1PL8A 1WKCA 1YIOA 2HWYA 2VUUA 3H11B 1TU0A 3QVJA 4F92B 4CEIA 2C8LA 4E15A 1ZGJA 1UMBB 3ZU6A 3OE4A 3EQ8A 4FYMA 3WLHA 1W48A 3CUKA 3LI2A 4M1TA 5A1JA 2ZRCA 4M21A 1EJ0A 3A6ZA 5FNZA 3TLZA 2G17A 3OEYA 3OP1A 3DPSA 3MCZA 4WE3A 4CKCA 2DT5A 4PICA 4RV4A 4PRZA 4A0RA 2EFYA 4A15A 2KYRA 3MJEA 2F1IA 1DUSA 1U8YA 1W88A 2GK3A 3SLGA 3B12A 3PHHA 3HV0A 4PHFA 1W1WA 1FDSA 4QVIA 5CG1A 4RY2A 3H6KA 1AZLA 2GLXA 3WGVA 4WL0A 4X60A 2NPFA 3W04A 4RK0A 2IYEA 3AFNA 3QLVC 7AT1A 3HYRA 5K6RA 1CY7A 3A1UA 3R8FA 2AWNA 1GFIA 4X3PA 2JPDA 3AKCA 2P2SA 2EBHX 4P3OA 1E6LA 2HDWA 4F4CA 3E9NA 3LGAA 1ZI9A 2C7VA 1I51A 4HB4A 5ECDA 1TT5A 4GQAA 4RH1A 1C3OA 4ER3A 3CE9A 3GPBA 1YS4A 4DCCA 4DILA 1GILA 3BCRA 1P1RA 4QYXA 1C9EA 5CFPA 1MA0A 4DLYA 5AD1A 1EBFA 1KRXA 1LPPA 1XQXA 2HGZA 2O7NA 3A1FA 3ASVA 5JAPA 1RYDA 4B3GA 1RI3A 4KREA 1XU9A 1WRBA 1Z7YA 2NXJA 3HBJA 1D8TA 1WNFA 4IIJF 3RS8A 1VLQA 3MD9A 1A5SB 2QTZA 3D8NA 3HEMA 1KMIY 2RIRA 3QNMA 1AS0A 1N2OA 5BR1A 1RPZA 1EXDA 4MYDA 1J00A 3VVLA 2QLNA 2C2ZA 3P2OA 5KVCA 3HBMA 3RUAA 3DD5A 1FLDA 3K9CA 2YFYA 4A2CA 3SXUB 3ZIAA 2HV9A 2LDXA 2C9OA 3H9CA 3GG9A 3TTXA 3ANLA 3VV3A 1LPBB 3F8TA 4CODB 2Q50A 5KQMA 3AYZB 3ME5A 2P3LA 1JALA 1M1YE 1PN3A 2W70A 4E1VA 3W1WA 4EGQA 1VG9B 3L7DA 4M99A 3CPEA 5CYOA 4NLLA 5KSZA 1JW9B 1Z8FA 5HA5A 2JFOA 1UBKS 3F98A 3OQOA 2Z8YA 4I19A 4OHKA 2FG6C 3OM8A 5PNTA 4YJGA 3GQBA 2PX6A 3DDHA 2ZITA 4LJ8A 3OCYA 3NH6A 2DBZA 3OJCA 3PA8A 4MIYA 4QBFA 5A1TA 4P98A 5CB0A 1RXVA 1W5SA 4FKMA 4M54A 1V3QE 1UZAA 5B7NA 5L8VA 2BV3A 3T5TA 1M8GA 3G13A 3MUEA 4K0RA 1YOVB 4LJ6A 3V34A 2NVUA 5ALEA 3IUYA 4O25A 4PCUA 5FTNA 2PG3A 3T5BA 5IX8A 5K01A 2ORYA 4BTLA 1GZHB 3INGA 2QB5A 4DB2A 1TM5E 1TW3A 1CFJA 2GXQA 3O4FA 4IPTA 1Z2CA 3U0BA 2BOVA 4RMNA 4HWTA 5IHPA 1HE2A 3LS2A 3N7UA 1YI1A 4DZTA 4RIIA 3F6RA 4LXQA 2C4KA 1QVWA 2FZWA 4Q9NA 4Z0TA 3FROA 3V7UA 6REQA 4LY6A 5KYUA 3ZQKA 2O2CA 4NCKA 2CY0A 1VG8A 2NO4A 3AB8A 3OQPA 5EJ7A 3FOWA 3LD9A 2W2VA 2QQGA 3BZBA 4CGYA 2XYQA 4ZCMA 1A97A 3RANA 1XCMA 2O0LA 2HWWA 5EOVA 2JIZD 4X24A 1FX0A 5JARA 3H8JA 2YMMA 2NZVG 2HR1A 1L7NA 1GSIA 1EP9A 3E7FA 3EFOA 2ZIXA 2OGUA 3GJQA 3QF4B 4HQLA 4EHDA 3ABRB 1RXIA 3UWDA 1W4CA 1QXSA 1EUQA 1MQ8B 3CJQA 4FNMA 4TL7A 3EDOA 1YNSA 1B43A 2FA9A 2IUYA 1J8MF 4G63A 3H87A 4REQB 3LOQA 2IS2A 1EH5A 3UAXA 4LZJA 1R4AA 2G6TA 1FS4A 2ZXEA 4REOA 2JI7A 1G9SA 4ESHA 1KMMA 1ZRMA 2FWBA 4PO3X 3AI3A 3UXYA 4CMCA 4LDRA 1XWFA 2G77B 3CN7A 1IK4A 3EASA 3H17A 1DKMA 1T0PA 5A9RA 3IVAA 3DVQX 4ZCRA 1KO8A 3B8HA 3JZFA 4ROSA 1CJVC 8LDHA 1USIA 2VN8A 3CX3A 3DBRB 3JRNA 3PJGA 4MLZA 4ADSG 4D4MA 3FNGA 1GUBA 1TKBA 3TTWA 4EYOA 1NV9A 1JG2A 1SOUA 1HBJA 1FS5A 2MSKA 1OROA 3FZGA 3S4YA 3TL2A 3FHTA 4HXEB 3U4CA 1YGPA 4YB8A 3SS9X 3AONB 1S2LA 4M98A 4GKKB 1KH3A 3LFHA 4WT7A 1E1NA 4FX5A 4MUBA 3GUUA 4NBUA 4TLAA 3LF1A 1RHRA 4GR4A 5G1NA 2FW8A 4DC1A 2Q4TA 3H4VA 4BWVA 1PIWA 4BCDA 4E5DA 3NJ8A 1VGVA 4AL4A 1XEXA 2XRMA 4IIJB 5EXTA 3UH1A 3BXXA 2OAQ1 4H4CA 1XFDA 1X8JA 4G23A 3WISA 4EGSA 1AY0A 4ZC8A 3T12A 2BMDA 1FNCA 4XGRA 1REQA 4BGEA 4EW2A 1ULSA 4HXFB 1ULHA 2QVZX 2QXUA 1TYDE 2WDPA 4TGLA 1Y82A 4QUHA 3WLPA 4E5YA 3HP1A 1SCKA 5CJ2A 5F1PA 5JG7A 4B5LA 5IJ0A 4ND8B 1TW2A 1WXWA 1DFGA 2W6NA 2QSYA 4LYFA 1QIIA 1ZNWA 2QRUA 4AP9A 3DCJA 4H3KB 2NO5A 1G7CA 1DHRA 2J7PA 1EK0A 2R8OA 3EBOA 4XA8A 4BXOB 2OZPA 4S0XA 3L0ZA 3LGSA 4M7PA 1EUZA 1S02A 1ENYA 3GC6A 3RRBA 1QIKA 3ICCA 4FYPA 2AFIB 1HK7A 2P6OA 1JDBC 1DIRA 1R0CA 4OMCA 4JI5B 3R23A 2GPTA 4GOLD 1KYQA 1YFLA 4AS3A 2P9TA 1I6KA 1WVIA 3FCAA 3ASZA 3WYGA 3THYB 3D8TA 3QGMA 4HATA 4CEJB 2WJAA 4KQFA 3VJMA 1NQOA 2XVYA 3FUXA 3NIDB 4U3JB 4CDNA 4EJ0A 1ONPA 2ON6A 1N5DA 1JXQA 2D2IA 4IO1A 2E1RA 4G0ZA 1AXRA 4H7DA 1F3LA 1YNOA 2JBWA 2VRBA 2CUKA 3AR3A 3CG0A 1UUFA 1Y6JA 3OJWA 2ZJBA 4G0YA 4H7JA 3OPYI 3HZOA 1JIJA 4KWCA 3ZKAA 2DKFA 4O59O 2SBTA 2BGUA 1DARA 3ROFA 3WADA 2GFQA 4M1MA 3IB3A 4RD1A 1KE1A 3F2IA 3OJLA 4GKAA 4PPNA 3IULA 2PKQO 1EB9A 1VIMA 3NTUA 4G1BA 4DTCA 4P5EA 4J07A 2FMXA 4P22A 2JLZA 1FP6A 2ZS9A 4AYXA 1Z4PX 1R4NB 3STXA 1FNSA 2Z3VA 1D2HA 4ZEMA 4U2FA 5L3ZA 3JWJA 3RBVA 1QHGA 2PD4A 2YY7A 4OQNA 4YJ3A 3O31A 2HK6A 2ZRBA 2NPOA 5DRYA 1E6UA 3PR2B 1OH6A 2IYFA 4UEQA 5HW0A 2VK1A 3STTA 5JHGB 2UVDA 3FFBA 2V7XA 1PVVA 5CLLA 4ZV7A 4C3ZA 2AOUA 4MKRA 4WSOA 4TMVA 2H4YA 1H3EA 2GBLC 3F1KA 3PPYA 2CMDA 2BEVA 2HT1A 4FR2A 1KY5A 4N5IX 3E9CA 1OWLA 3COZA 4OQMA 4ZO7A 5AK5A 4X5OA 2DUMA 2DKOA 3E22B 3P2JA 4FFDA 5JOQA 1H69A 4Q4JA 1QRUA 1XG5A 4QPDA 2A4KA 1RZRD 1EG7A 3GLKA 4EJ6A 3TE7A 4AZ0B 2COUA 1UP7A 2J0EA 2P2NA 3SVLA 4JOCA 5CJPA 4JVNA 1DWUA 2NV2B 3LIPA 2FZ4A 2G8NA 4UPDA 1MO4A 3RWOA 5ICFA 4XJTA 3KT0A 1LSJA 4BVEA 2ZPUA 2M6SA 3MMNA 5F1OA 5EWMB 3FUTA 3HLKA 5B3JA 2W90A 3LQ2A 1NU8A 1STOA 4TV9A 4CLXA 2OC4A 3PYMA 4HNSA 3HXOA 2XZDA 2IX3A 1PFUA 1SVKA 2DJ5A 4L28A 5CMLA 2R0QC 2XOXA 2P1RA 3NOVA 4LY0A 3SFVA 4K03A 1KE2A 3BSFA 2QJRA 3UJCA 4JLSA 2G7MC 3DXFA 3E61A 1EFRD 4IZ6A 1KI4A 4ODIA 2HCJB 2CFIA 5D8DA 5F64A 1OT3A 3V2HA 4BBAA 5HRAA 1JIXA 2VF8A 1WL8A 4NZZA 4PO9A 3Q6MA 1XF9A 1X3LA 3KVNA 4UPVA 4Y6LA 2R6DA 5KYWA 4G0PA 4G5FA 3LO8A 3BXOA 3D4LA 4KYIB 4Q6WA 1PT6A 2HMUA 4ZJPA 1JKXA 1DQSA 1F2DA 1JI3A 3DWIA 3SD7A 3ZX4A 5AOAA 3WRVA 3B6MA 4WY8A 4YGXB 4DAOA 1ZN7A 5IZCC 4UMDA 4DMHA 4BFWA 5CA0F 3CLKA 3RK0A 1PQUA 2XNHA 4P4TA 1C7QA 1QWOA 2GHIA 3DAGA 3UC9A 4D02A 1FDVA 2EV9A 3NTOA 3E84A 3WYEA 5BW5A 3OZCA 4RMGA 1DCTA 2OCPA 5I45A 4QDOA 2EJVA 2CLOB 2PLAA 2QMHA 2D0PB 2EFDB 2EX0A 4G56A 4GSYA 1RAFA 3NKVA 4GUAA 1KVTA 3CY6A 4YP9A 2A67A 3VSDA 4C21A 1NY6A 1C4WA 4CLRA 2XYGA 1YRYE 4JU9A 3TK1A 2QMYA 3N2LA 4R16A 4NJMA 3VR4H 3D7MA 3E8XA 4Y6PA 2IHKA 4RDXA 3BF7A 2PD3A 2VZ9A 5D2CA 3H2GA 1M8KA 2JK1A 3CRNA 3TTYA 3MF4A 3JD2A 4X6UA 5MF6A 5LP1A 1VXOA 4UNQA 2W0MA 1X1BA 2FG7C 3RUDA 3ZK9A 2AJTA 1VOTA 2DZDA 2FPGB 1H8ED 4W99A 5ENVA 3M1IA 1QIHA 3R7WB 3DGFC 4Z4FA 4ERNA 2R4TA 3W5SA 1M6NA 4EHAA 1CUUA 1V5FA 4MA5A 3UNXA 2I6GA 5BVGA 5DX0A 3G49A 5AVVA 1TVEA 3OLXA 4OB8A 4UHFA 5IN4A 4U9IS 4YTEA 4IIEA 3DNFA 2FH5B 1N9GB 1GNSA 1MJNA 1V8FA 1XEWX 1IZYA 1YR2A 3AM3A 3DHEA 3T0GA 5FORA 4DRXB 5HGJA 4YT4A 1BEEA 4BP8A 3CUTA 3DTVA 4DLPA 5JFOA 3ITDA 4Z4QA 3BDVA 3MJDA 3IC5A 4FYXA 2QV7A 1SU6A 1WS6A 3ISTA 4QLAA 1PE0A 2Q6IA 1HLGA 5HP4A 3JARB 2FWAA 2WHQA 3I2JA 4GWLA 4UBIA 1D5WA 1EZ1A 3FZNA 4CM5A 5E3JA 1BS9A 2X13A 3GEPA 4D4KA 2F7SA 4JXXA 1CZNA 3INTA 4ZRDA 3P94A 1AZWA 1NW9B 1JEDA 3S44A 3KL4A 3NS7A 4DEVA 4RKWA 1O03A 1Z29A 1PKXA 1WCWA 1IUNA 3AG6A 3R3WA 5CFLA 2NU8A 2QE7A 1ZAYA 2P4UA 5F3WB 4DUGD 1NNSA 2YZ7A 3GROA 1ZH0A 4MV5A 2OC9A 4L7QA 2FFBA 3BIXA 5C32A 4PG6A 3RUPA 3DP7A 4TOIA 4N0MA 5E1OA 2FN8A 5EIBC 3K70B 3F6YA 3KBBA 5BR4A 4NMHA 1SUSA 1XRSB 4O5OA 5CB8A 5LQSA 2NU9B 1IN1A 5KOJA 3VU9A 1QTQA 2PMCA 4WXPA 3EYAA 3GH1A 2BSQA 3KEOA 3NCTA 2J3HA 3HVIA 4G4GA 3HEAA 5B1IA 5BVHA 1DBIA 1ZK1A 3UB2A 4ZO9A 3SOZA 2Z9DA 2AOTB 4GC5A 1JLLB 3UHOA 2QX4A 1EDZA 3R9IA 2BFFA 4NYMQ 1ZM7A 4EI7A 1T3LA 1NNUA 2WT8A 1C1XA 5D87A 4AWXA 1DBSA 3ADCA 3CW8X 3SC4A 3K1ZA 1SD2A 5K8IA 1PV2A 1T26A 3FMVA 3WK9A 2O5EA 2O8BA 1E2IA 1NZDA 4L5CA 3GJ0A 5I7SA 1OFVA 4KVZA 4Q1DA 3CO5A 1ZCAA 2FPIB 2HSJA 1F7UA 3GIWA 2CXSA 1BQEA 3DV0A 4HZGA 5JD5A 3N6XA 1X92A 3WC4A 5LPNA 1U7UA 2YVLA 3CM0A 3ONWA 4DUPA 1KRWA 5SYAA 5GADl 1WCIA 1VFNA 2VSFA 1KVQA 1ZVMA 5DWQA 3UANA 3WJAA 4OL0A 1SH7A 4RVDA 1Q57A 3SHOA 5KYKA 4DSZA 1K8YB 1Z2OX 2ATIA 2VTVA 4G65A 4GI3A 4DUYB 3J80A 4Y2QA 2EKQA 4Q21A 1UM9B 2NAFA 2JK0A 4DLAA 5CA0B 3WQQA 3NVKI 1RABA 1ZI8A 5JNVA 3L40A 5C5EA 3FPFA 5A3QA 5K0EA 2JG3A 1Q0HA 2ANBA 3MMXA 2BFDA 4M0FA 4ZVKA 1BSVA 3R5SA 4IO0A 1FU7A 2EAUA 4MQUA 1DKUA 1RAIA 3RTAA 2NZ8A 4URUR 1SHUX 2FMFA 2AHOA 5D86A 3ORYA 3C45A 1ENPA 2B9VA 2G9VA 4IF6A 3NBFA 4PQYA 2OYCA 3FMFA 5T4HA 4BDSA 1DE0A 1G291 2XF8A 4EGAA 3VOAA 1U2PA 3NU1A 1SBIA 1JP7A 2E49A 2CXTA 2MIIA 2POCA 2XT6A 3QA3E 4QBIA 1CW2B 3GFPA 5E95A 3DZFA 4D9KA 5C8XA 4BQIA 1HTBA 1WZNA 1PK7A 2J1LA 2VHYA 3GB9A 1A4UA 4CW7A 1BEZA 3O2JA 1R6TA 4HFJA 1YZUA 4N8SA 3S7TA 3WGJA 5CVTA 2VRWA 4LK3A 5GV8A 1Y7IA 6LDHA 1L0BA 4BMZA 1LWOA 3OT1B 4LMAA 4B4KA 4JI2B 2IS6A 5JSFA 5LZ9A 3H11A 3OEHD 1BS2A 2IZ0A 3LCRA 3QWAA 1H0HA 2ILTA 4IIVA 1E1MA 3KOOA 2H8GA 1DQNA 2CEAA 4HMQA 2OB1A 4B3FX 3S27A 2Q5IA 1COZA 1I9CA 4H6XA 3KKQA 3NUQA 3HKEB 1UCFA 4AY2A 2WD9A 3VC7A 3HB1A 4R3NA 6ADHA 4DQDA 1E69A 2UZ0A 3DW3X 1J42A 1XJ5A 4F3YA 1VA4A 3WQRA 3VKFA 1RQXA 2FMUA 5DEIA 1GGEA 2OP0A 2CV1A 4ZVTA 2G70A 2HEIA 4ZYLA 3LX4A 1UJ2A 4V0LA 2QVBA 3G8AA 4MVCA 2H8KA 1QCZA 4INZA 4OSPA 3VO2A 2FX2A 3TSWA 4IWXA 1U4OA 1HQCA 3MJFA 4YCJA 3RWBA 3QRWA 3EJWA 4YUVA 4ZVVA 3HCFA 3CCFA 3IEUA 3C0KA 3TTTA 4QQFA 4A0SA 4EJ2A 3IRVA 3QY0A 2RAPA 4QWWA 1X1QA 1PR5A 4YIHA 1CQWA 5JNSA 2O2YA 3MS4A 4P7BA 1HGXA 4NC9A 1HQYE 5DNWA 3QEMB 1N3YA 2FUEA 3WGQA 1TU3A 1NJ2A 2Q8QA 3FPLA 5EI5A 3GH3A 2C9YA 3I37X 4CIYA 2WYIA 2H18A 4EUHA 4EYQA 3SM9A 1RPTA 1UXOA 2WSSA 3K70C 2I3BA 2W2LA 1D1PA 3DR5A 1ORIA 5A5EA 3IQZA 4N3AA 3B38A 2IU0A 3C7DB 2CW5A 5IXSA 1QFZA 3A3YA 5CYFA 4QQRA 1FSSA 3LXUX 3G7NA 1YRLA 3ZHXA 3SXUA 1BVUA 2QM3A 2HQSA 2KE5A 3AO0B 3I92A 5F5LA 2CXRA 5AXAA 5IMBA 5F9HA 4ALMA 3SYRA 3HQ4O 2ZJ3A 5CIQA 3KJGA 1QKKA 5HIIA 2BH2A 1HTTA 1EUDB 3EG5A 1IUKA 4C6TB 1VI6A 2H07A 5LIPA 1N3BA 2NXWA 3LDFA 3WOVA 5A4IS 5KTTA 4RACA 2P5TB 2PX2A 3E5NA 4WFJA 3M4XA 1C7IA 4ZU6X 2Q4BA 3ZN2A 1ZRHA 2LKCA 5BSGA 4PZ0A 3ZDQA 3PPWA 4PR3A 1YUMA 1GQ2A 2G83A 2IEDA 3DZHA 3AR8A 1ESNA 5AKZA 4MDHA 3KPVA 1OA1A 1JTEA 5REQB 5T57A 5F3DA 3ML1A 1Q7GA 1RHUA 5FPKA 1CCWA 5D3ZA 3GGCA 1NHGA 4R7TA 5IT0A 3IP9A 3NYWA 3CVYA 3HA7A 5JLAA 3NOXA 2Q2VA 5D3MB 5AKGA 2JLXA 4OP1A 2VH2A 4NU0A 3GEHA 4YWHA 2FB9A 3NIFB 2VH1A 2ZB7A 5JI3E 4DM4A 3GP3A 1XKLA 4RY8A 2IXEA 1BN6A 3D7RA 3Q2IA 3DAFA 2J3IA 2F48A 3WAKA 1SXHA 1XVVA 3RF6A 2OCGA 1OA0A 2ABWA 3KK0A 4OCZA 4P80A 2HN9A 4S3MA 2CLFB 4CYMA 4ZPXA 4Z3KA 1SELA 3JWEA 4N49A 2X8JB 2XBLA 3O3NB 2HSWA 5KX5A 2F1KA 4FYJA 4MW6A 2FEXA 3MIIA 1PTJA 1WO8A 3KB1A 4XB1A 3TZCA 1JEAA 2QN1A 4XDZA 5KKCA 3B60A 5EGSA 1HI9A 1NVVQ 4AKIA 3BL8A 5IXYA 1JKMA 1J8FA 1CDZA 2FY8A 3SX2A 5JQWA 3O83A 1AH2A 3WQHA 3B20A 3FYUC 3G2JA 4BP1A 2H54A 1B6SA 4Q9DA 3AIKA 1N4DA 1SU7A 1I30A 5KTSA 3WHLA 1E3TA 2YASA 4I4IA 5BW4A 3FDZA 5TQ0B 2PK3A 1U0NA 1ADBA 4DLBA 1H6BA 4RIFA 3L02A 4N5DA 2QMEA 4BUCA 3NNSA 1RADA 3DBRA 1FTYA 1H2YA 1QVRA 2VUTA 1ONOA 4LDJA 4PXAA 5FOXA 2I6XA 4LEIA 2UVPA 2R68A 4M86A 4ZOAA 1GTL1 4YAEA 4D74A 2H4HA 1H22A 4RF2A 3GHYA 3W3AD 3X1ZA 2HK8A 1T36B 4C6HA 2PIDA 3KZOA 2X76A 3TL6A 2XW6A 2NN3C 1CQIB 2ODAA 4FONA 4R2HA 2XKBA 1UPTA 1G3UA 4GHWA 2X14A 1K2WA 1RYZA 3RYIB 1QRSA 2VT3A 1T4MA 1XNHA 1RJFA 5DHQA 3HM9A 4YPFA 3RB8A 5LP6B 5D84A 3S7ZA 3D4PA 4BYMA 4RMHA 2HYDA 1H2WA 2N3ZA 2YWBA 2O2XA 2FR0A 4K6HA 2W4QA 3UC5A 4O3MA 1MX1A 5FWAA 3K2IA 2AZDA 2YVAA 3LOUA 5L9AA 2W8BB 1YXMA 2J31A 4Q7KA 4O4IF 3NOOA 2ZRFA 4PYNA 1VIDA 5JDCA 2Y1KA 4ABYA 3VKHA 3WA6A 2ZYRA 1UJNA 3DWFA 2J6CA 2YV1A 4HAZA 3D02A 4MGZR 4YLGA 1K9VF 1Q3HA 1Q7BA 3VZCA 4U2GA 4MR7B 4YRDA 1P2DA 3D8RA 1DINA 4JX8A 2VEDA 2E85A 4OBBA 1BTOA 2PR7A 3D2AA 3GLGB 2EZUA 5A06A 5EJEA 4HDOB 4ND8A 1FIUA 1E4EB 3DHWC 5CDFA 4E88A 2TMGA 3HUTA 4LSWA 3EFBA 2ESRA 4NPCA 1ODTC 1P1JA 2NQ8A 3N0WA 4BXOA 3JPYA 3E0XA 1G7TA 3ITKA 3I4CA 4JSRA 1PNVA 4CL3A 5BSFA 5FTLA 1G0OA 3AOEC 5F2EA 2P9BA 3PFCA 1GNRA 2F17A 4JCOA 2BBOA 1GYPA 1Z7BA 2AFIA 4YDHB 3GJ7A 5EXPA 4DQUA 5EHZA 3JQ6A 3I61A 3HR4A 4XM2A 4KLCA 4X7MA 3LY7A 1X9HA 3PBKA 5BUSA 3UT0A 3VUEA 4BZQA 3THYA 2NO9A 4CEJA 3TSCA 1AHHA 2EW8A 2O2EA 4RIGA 2IXFA 3RSQA 3DVAB 3I6IA 3IAUA 4U3JA 2GHTA 3R44A 1WDLA 3G0HA 2SCUB 3DS8A 5DNCA 5H3HA 3R3XA 2B7CA 3A1EA 1KSGA 3HHPA 2GNOA 1IMOA 1FVFA 2W00A 2EDCA 1O94C 1CZUA 2JHFA 2NZWA 3AEYA 3CEHA 3JYHA 4MTCA 1XRMA 4W5HA 5IH3A 1L4MA 4OI1A 1IN6A 3WWZA 4PX9A 5HJ7A 1I7SB 1DJQA 1NLYA 5AOBA 2VT6A 2J6IA 2L0XA 1ACJA 3CH7A 3K6KA 1PAUA 3L7NA 3GJ4A 2F1OA 3ZNNA 1EVKA 1PR2A 3UKOA 3M3DA 3RC7A 2OE2A 1LWNA 1R4NA 4CIVA 1TM3E 1E8NA 5IJ9A 2QVXX 3QYJA 3TIIA 5AVQA 3EN0A 4WPGA 3ZDEA 1YVPA 3V8PA 2QMZA 2IU4A 1G7SA 4GSKA 4MUEA 4D45A 3TRFA 5KYXB 5F3RA 4Z99A 1Z4JA 2C7BA 2EWWA 2XUAA 2Y05A 2Y8EA 3DMPA 3MNFA 1P4SA 2H52A 4JZKA 3SYMA 2OQVA 3THRA 4P33A 1EXNA 2W2XA 3ZBPA 1KDYA 4XGIA 1WDWB 4RVUA 4ZVNA 2ETXA 2NIPA 2QZ9A 1BHJA 3E22A 4ZQBA 4D8XA 3ONEA 5DNDA 4CWAA 1IZ0A 3H5WA 3RTGA 4YI5A 4RPKA 4DNOA 5IJWA 5EEGA 3S81A 3KKPA 2RHOA 3PR3A 4FEGA 1T13A 2NNWB 4L0QA 4RWZA 5AVTA 2QTTA 1XZBA 3TD6A 1HSOA 1RRVA 3R5TA 1JPJA 3UKJA 5IK2D 1KP3A 4MYSA 4C20A 1A82A 1P6QA 4AJNA 5L4LA 2A5YB 5DCUA 5BR7A 2FU5C 1Z0SA 4D1YA 2ZI3A 4HNHA 3N8DA 4HDQB 2A2ZA 3F8SA 3CZAA 4PANA 5E7JA 5AIBA 5A3RA 5F23A 3ZV5A 5HZHA 2K7ZA 1C5KA 3ZU5A 2HWKA 4QXQA 4TLMB 1RFGE 3KJEA 2P11A 3ROMA 4BNDB 3Q88A 1NG9A 1YRWA 1ML3A 1UC4B 2MU1A 3NV9A 3W8RA 5ITZB 4BBJA 4DIDA 2ZDGA 4FBLA 1P33A 4N9WA 3W9UA 1Y8AA 2VL7A 3CBQA 5DP1A 2Q3FA 2QU7A 2O07A 3K30A 5LA6F 3GCDA 3OZSA 3ER8A 2WSYB 3GAFA 3NM4A 1ZSYA 4O4IB 3ZWNA 4BIMA 4E5KA 5K0BA 3HI4A 3DBVO 2WJWA 4EM6A 1PZMA 1D09A 3A6KA 4MWTA 4NHOA 1C2YA 3R40A 4MQ6A 1Q19A 1WBJB 3LBIA 4Q4LA 1E5QA 5I9BA 3ZY2A 2P35A 2V7QD 1SXGA 4HQ6A 1ZVVA 1NN5A 1SOWA 2OAGA 2P2CA 2VXOA 3GJ8A 2AL7A 3H7AA 4O1IA 3E3LA 4P1ZA 5F4BA 1EBBA 1JBQA 4C4ZA 1YR6A 1NRXA 2OORC 1NW5A 5CCXA 1SC9A 3OX3A 4C78A 2Q5QA 4FJ2A 1WJGA 4KDFA 3GGOA 1VGRA 4RJJA 3GZ4A 4EZBA 2B4AA 2UZAA 2JLRA 4I6JA 3A7DA 4LJ9A 4CQMA 4XSGA 3ZIUA 4C04A 4MH0R 1E5LA 4QJ4A 1WBDA 1CUDA 1QONA 3T1NA 4TMFA 5CIYA 3H5TA 3GGDA 2CCKA 2Q4EA 5DGIA 7ADHA 4KLNA 4M0MA 4YCCA 2OD2A 5L3RA 2QG9A 3P9YA 3IBGA 1Z5UA 3TEJA 5C31A 1GPLA 2Q5FA 4J3FA 2AKYA 4HZUB 3WDMA 4JBLA 1NQWA 4C7XA 2JRLA 4P0TA 4A6PA 2HNAA 3DE0X 2WOOA 1A9YA 3A9WA 1PGOA 3U62A 1N8NA 4BRWA 1WU8A 3UWSA 4BZPA 5E4FA 1DAPA 1M6VB 1D2NA 3PDJA 4HB0A 1FA9A 2ZPAA 1YMUA 2HO5A 1N9GA 4B0PA 4DRXA 1I94B 1QG2A 3KDSE 3CMMA 3TWOA 4L76A 3V8BA 1B26A 3E8MA 2J8ZA 1QZTA 1K6EA 4KQ9A 1Y9JA 2H4XA 4IKPA 1R8JA 2L82A 5C81A 5M2QA 2ZROA 1K2VN 3JARA 5JCOC 4BX0A 5J47A 2QTWB 1RPJA 1VJRA 5B3LA 4MV9A 2B83A 3LUKA 3ND5A 4TUYA 4WV3A 1V43A 4OHCA 1OHHA 2HGSA 3HB0A 1P29A 4NICA 3ZG6A 1X2EA 4QDZA 4K9PA 4D98A 3VISA 1OVGA 4FDTA 5TMBA 4G5SA 5EXSA 1UBSB 3EY9A 4NMWA 1DAGA 4DOMA 3A04A 2YJ4A 1SKQA 2R2AA 3V4OA 1NKSA 2W6ID 2WEKA 3ACDA 4QDTA 1FW6A 3MXOA 4MDYA 1Z6PA 5GOTA 3A27A 5J3JA 1JFFA 1W5TA 4DDUA 2QQ0A 2P1ZA 3OFNA 1LPSA 2ZQZA 4EY4A 1HO3A 1JQKA 2O2DA 2H2GA 3D3EA 2XPCA 1WCXA 4ND2A 5DISB 4HX9A 1D8AA 3V42A 5IVHA 3W2GA 5KNDA 2Z8XA 2AEJA 2NU9A 3Q6NA 1E1QA 1X19A 2I1VB 2HRQA 2DULA 2QV0A 2WE7A 3KOMA 4B33A 5C9ZA 3ZDRA 2A0XA 1NI4A 3AZPA 1ABFA 3HZHA 4IRMA 6NULA 2AOTA 4YALA 5HDBB 1JLLA 2DQYA 3GDWA 1G18A 1HEIA 1TZBA 3HU5A 3PI7A 5TXGA 1XJQA 3MJHA 3BH7A 3K0SA 1PFQA 4HLQB 4XQCA 3DKPA 1EUYA 2UXBB 2Q4OA 2J6HA 3F6PA 1GLNA 3QXHA 4KWIA 4RS3A 1N3IA 4HAUA 4WMLA 1DG3A 1NN1A 2PR2A 4RM3A 4GGPA 4Q9HA 3GRPA 1NU6A 5LA6B 3BF8A 1Z36A 4DT1A 1ISSA 1QVZA 1Z0FA 5D7BA 1F20A 1WZCA 3A6LA 4P2GA 2IVZA 4R1TA 2QJOA 2YW9A 2G8LA 5AW6A 1VM6A 2V45A