1NVAA

Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
389
structure length
380
Chain Sequence
PTKISILGRESIIADFGLWRNYVAKDLISDCSSTTYVLVTDTNIGSIYTPSFEEAFRKRAAEITPSPRLLIYNRPPGEVSKSRQTKADIEDWMLSQNPPCGRDTVVIALGGGVIGDLTGFVASTYMRGVRYVQVPTTLLAMVDSSIGGKTAIDTPLGKNLIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENAETILKAVRREVTPGEHRFEGTEEILKARILASARHKAYVVSAGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAELARHLGILKGVAVSRIVKCLAAYGLPTSLKDARIRKLTAGKHCSVDQLMFNMALDPKKKIVLLSAIGTPYETRASVVANEDIRVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE SYNTHASE
publication title Ligand-induced Conformational Changes and a Mechanism for Domain Closure in Aspergillus nidulans Dehydroquinate Synthase
pubmed doi rcsb
source organism Emericella nidulans
molecule tags Lyase
total genus 135
structure length 380
sequence length 389
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1nvaA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nvaA01
1JQAA 3HL0A 1JQ5A 2GRUA 3OKFA 4P53A 5HVNA 1JPUA 4RFLA 1OJ7A 3JZDA 1UJNA 1VLJA 5FB3A 3OX4A 1XAJA 2BL4A 4RGQA 3RF7A 4FR2A 1RRMA 1KQ3A 1VHDA 1XAHA 1XALA 1O2DA 1SG6A 3CE9A 3BFJA 3ZDRA 1XAIA 1NVEA 2D2XA 4QGSA 5BR4A 1NRXA 3ZOKA 3UHJA 1NR5A 3W5SA 1NVDA 1NVFA 3QBEA 5K8CA 4MCAA 2BI4A 3IV7A 4RGVA 3QBDA 3CLHA 1NVBA 1XAGA 5EKSA 3OWOA 1TA9A 1NVAA 1NUAA 1DQSA
chains in the Genus database with same CATH superfamily
1XZNA 3BUSA 1DG3A 2D4HA 1K3TA 3WK8A 3VR6D 1H9BA 3W05A 3M6LA 1NN3A 1GUFA 5K0TA 1HKHA 2OV2A 1YQTA 3OSUA 5K4GA 2YXEA 1PDWA 2FETA 1ES9A 3K4HA 1EHCA 4OXKA 3NRJA 3NV9A 1JALA 2GO1A 1Y1QA 2AE1A 1E2NA 3HKEB 3F9CA 2R7AA 3KXPA 1DBQA 2WDPA 3JYNA 4MSUA 3P0RA 3ZEIA 5F5NA 4DYVA 2HLHA 2QVLA 2FLKA 2JBWA 3AW9A 3EH2A 4HHEA 5JAZA 3TINA 4OV6B 5K3EA 5ED4A 3JQ7A 2OWEA 1O58A 1XV5A 3BILA 4GOJA 2RHWA 4UBNA 4LFAB 2JZOA 3BULA 4NYJR 4JOQA 4QPCA 3IKLA 3UGKA 1BKSB 2CZGA 3QXSA 4YUZA 5JRDS 4UHEA 2GUWA 1E32A 2IRWA 2X77A 3HDTA 4MW5A 1T6XA 5F4BA 2Y1EA 3F3MA 1DBPA 3I32A 4JLMA 3H9GA 5A6SA 3G2QA 4GBMA 5J4VA 1Q0LA 3WRVA 1U0JA 3LHIA 4B6PA 4B8YA 3RR2A 5JECA 3WYGA 4CMKA 1QRUA 5CT8A 3RARA 3BK2A 3BL8A 1FW6A 3ZDBA 4AD8A 5CT4A 3PF8A 2LTAA 3GNLA 2K2QB 1CERA 3DQZA 4OATA 1KDZA 5EHQA 2CLHB 3TRJA 4C4TA 5HFAA 5GONB 5KYTA 4IHQA 4KNYA 3KJZA 4Y3UA 1INLA 3UWPA 3WJ2A 2X23A 5B5SA 1ST3A 3W79A 3WADA 4PWZA 4YP7A 4RK1A 3KZKA 2PM8A 2JLYA 1PHPA 2ZM6B 4M0LA 1YNOA 2BZSA 2YH2A 1YJXA 1J2JA 2W93A 2Z1DA 3WI7A 1PT8A 3DOCA 3Q0EA 2DHEA 5KVCA 2ZIFA 3KTDA 4MYUA 2BFWA 2O2YA 3H4IA 3RT9A 4DXHA 2YJGA 1EE2A 3K2IA 1NW9B 4EYSA 4I4NA 5J4KA 5K1ZA 3I9JA 3WDKA 2PYIA 2QMUA 2V0NA 2WF6A 4AP9A 1SUIA 2CWDA 1SM4A 1SIUA 5ARCA 1QKKA 5BRAA 2XQFA 4XGIA 1S3GA 2JGRA 3OHMA 4NONA 4RENA 2WSLA 4YV7A 2NU6A 4PQFA 2VQSA 4RPJA 2HBQA 1ORDA 2MYUA 4RV5A 4EFMA 4XWWA 3ZOKA 1G2PA 3KJQA 2R5NA 3CZMA 4KTTE 1U9CA 2C2ZA 3MMXA 1EWTA 1QU2A 4PVDA 4JP3A 3G0CA 4X94A 3H1PA 4HI0E 3HJCA 1C81A 2B1RA 2QUIA 4X3OA 2Z56A 3MW8A 3DD1A 4E1AA 1DRWA 1I3KA 3TSAA 4ZZ1A 2O8FA 4KGVA 3UMCA 3MRVA 1CX9B 2D1RA 1HYGA 1ZGZA 2YHIA 4R0NA 3CMMA 1USVA 3UXYA 1KI2A 4D9IA 1SKQA 1XJ5A 4M83A 1CB7A 3OOEA 2Q1WA 1Z15A 2EZ4A 4J94A 1M8GA 1GEEA 4MWGA 2O8DB 2J8ZA 5FL7A 3S4YA 1V95A 3PL1A 2EOAA 1EDDA 2IIQA 4TKLA 1FU4A 1PGPA 4MDFA 4IWNA 1DJLA 1OC2A 1U0OC 1U94A 3B8EA 4LI3X 4XTCS 4LHVA 3QLUA 4JLVA 4M4SA 1WZIA 4EAQA 5KYUA 5L3RA 3GX1A 3BWVA 2DTDA 4LJSA 5DLQC 1IQ0A 2ZE7A 3OFNA 4F7WA 1JQJC 6GPBA 5AI9A 2DETA 3F47A 2PIDA 3DF9A 4ND4A 4QUJA 1LSJA 2AWOA 3CNOA 4KV9A 4NBSA 4ZPXA 3GLVA 5E6RA 4MRMA 4N0MA 4EJ6A 2W6PA 3EUEA 2PGNA 3HEMA 3LQRA 3QVWA 1QQ7A 4MDYA 1E7SA 2R5FA 2CSUA 2E6KA 4M86A 3RRYA 1Z0JA 1EUCB 2WJ4A 1UKAA 3RIEA 4U7WA 4HNTA 2JLZA 1XRJA 2O3JA 4K28A 3BBPA 2NO6A 3G6WA 4AKTA 1ULSA 3ZX4A 3RWOA 4P3KA 3YASA 2P9YA 3RTAA 1ABBA 3PYXA 2QRKA 3I76A 4XTRA 3PZBA 2HMTA 3FF4A 3H8JA 5LDGA 3VV2A 1FVHA 3AI1A 5BRNA 1HDRA 1IBMB 2GZDA 5JAUA 1ISPA 4XH9B 4J3NA 1VB3A 4MHOA 4F9TA 3PQCA 1U3FA 2O7QA 2PSFA 1IRIA 2DT8A 4QYIB 3VU8A 2RH5A 5KNBH 1H5QA 2FSGA 5DX8A 4JLSA 3GJQA 4U0JA 3RYCB 3TFQA 4J4BA 3ETGA 2JRLA 3QLVA 5C81A 3PA8A 2L2QA 3I9KA 1U80A 2PT7A 4IP0A 5DF1A 1GU1A 5F7JA 3NVMB 1VKZA 4F71A 3WQQA 4EJMA 1JT2A 4H7DA 1Y63A 3U1TA 4AYWA 3ZWAA 4ACBA 5KREA 1DS6A 4KDRA 2Z6UA 1D1TA 4QTTB 1UFKA 3KJHA 3U40A 3DCIA 1LJUA 1NAIA 3U61B 5HOEA 4MZXA 1T2NA 2OKCA 2YV3A 1CZKA 2BZ1A 3U6KA 2HDHA 4DDHA 1HUQA 1KY5A 2D7CA 4LZNA 4X3CA 4QECA 3RC9A 5CDYA 1YACA 4Z4QA 3KEMA 3ROKA 4I1SA 1WAMA 4MR7B 2MINA 3OZAA 5E1DA 4JEIA 4QAJA 1ADGA 3KSRA 2R7NA 1CEXA 5EP4A 5LLSA 1PS9A 4F60A 4GR5A 1EFLA 3EIQA 4UOZA 2OOKA 4V0NA 1IG3A 2GUGA 4K9DA 3LIPA 3HBFA 2WJVA 1WUIS 3ICOA 2C94A 3MB5A 3TWOA 5JWOA 1WCXA 4D0RA 4U7DA 2J0UA 1L7OA 2W43A 3MG9A 1CY4A 1L5HA 2QT1A 2VK8A 4LYEA 1HC7A 4D2IA 4ZI3A 1KYIA 2EATA 5DN9A 4L95C 2ZIAA 1NP7A 3V9AA 3QVGA 3DF7A 4UMDA 1T0HB 4ZTZB 4X6LA 3IXMA 3R9IA 4ZHQF 3WLIA 1S8AA 4RV4A 1QH9A 2W11A 5JG7A 5JNSA 1PZMA 5DNCA 1NW5A 2JF0A 1EFCA 1DRUA 3C6MA 2R1VB 4YVFA 2KW5A 2O6LA 2ZSFA 2I2DA 2IOHA 4ZYWA 1BFKA 2ZJ1A 4UTNA 1JDVA 1T5IA 5B3JA 1JSZA 4H27A 3QUAA 4TV8B 4OLHA 1R8QA 3T7SA 3DE3X 3TYXA 5A4DA 1PD1A 3OZXA 3TF5A 5A1JA 2FWPA 2PFSA 2YHSA 4G25A 4JBWA 1J7JA 4UCQA 5FBRB 3OQPA 4CKEB 3PEEA 4QC2A 4DKXA 3ER9A 2R85A 1TTPB 4RAOA 2EGGA 3HB0A 3N2ZB 2C0PA 3NI2A 4MKRA 4YCAA 5HFJA 4BXOB 4G0VA 1JLLB 1RPTA 1QHEA 2R6CA 1SXIA 3AIMA 4FOTA 3KQMA 4D3DA 1D0SA 3UAGA 4IV5A 3L01A 4IFEA 3B6EA 2F7SA 5K0NA 4JI0B 5COAA 2QQFA 5U1PA 4Y2SA 3NHUA 3H75A 2WD9A 1DKOA 1ECPA 5LB2A 1LNQA 4YS6A 3AW8A 4LRWA 3TRFA 4F6RB 3PVCA 4FLEA 4GZ6A 3TOXA 4IH9A 4WA8A 4KC0A 3D4LA 1WHSA 3ABIA 2SHKA 5AVQA 2QMHA 4FDMA 5L4LA 3ONDA 4DRXA 1G17A 2O2XA 3HU2A 2XOKD 3FFAA 4MS1B 4PE5B 1E9DA 4UW9A 4O1IA 3REQB 5D6NA 2X9VA 4L57A 3NHPA 2ZU0C 3K1AB 4AICA 4EHNA 5F3WB 4NKRA 3VC2A 3JASA 4W4TA 3FCUB 1VYVA 1GL3A 2D6FA 1B3BA 1SXGA 3H99A 4ALMA 3A3OA 2CXUA 1JDTA 4HQKA 4O1HA 1A82A 2WU1A 4WOJA 5KMGB 1TAUA 1FZTA 3UYLA 1YBAA 2BONA 3SHWA 3EYWA 1XNQB 2FG7C 2H2DA 4YIHA 3HFJA 4IYJA 4V0OA 3DWGA 3T8YA 1YR3A 4E33A 3AVXA 3P2JA 3DCNA 2YW9A 4GI5A 3Q7RA 4JL8A 4GKJB 4K03A 4LOKA 4E46A 2Z2IA 2A5LA 2H16A 3LVFO 3BPSA 2MYNA 4BKPA 2C4HA 1B8VA 2FGKA 2PUWA 1VLVA 1TUBA 1EZZA 1E1NA 2OQRA 1FSFA 2IU0A 2B9VA 3KXKA 1WOMA 4Y2QA 3H83A 3HUEA 2BTOA 2IEDA 3Q98A 4RV9A 3NU1A 3TQSA 4BWYA 3MJRA 5B1YA 1KJJA 3S2SA 5FO1A 1TCVA 1A2BA 2DFDA 3I9V1 4H7PA 5DNEA 1NLYA 1R0BA 5LB4A 1UZUA 3F97A 4ZV9A 4P98A 1GZVA 1RQPA 5TMPA 2P3SA 2FPSA 1MAHA 5C7OO 1YS7A 2DBRA 1LJ8A 1UBFA 3GQVA 3SBEA 4ARAA 2YV4A 3DP9A 4GC5A 3HDVA 3IUEA 1GV1A 4IICA 5J63A 4EGAA 2A58A 1GUZA 2ISCA 2HMVA 1G5RA 3P4YA 3CUVA 4PS1A 3ROTA 2IGBA 4IEFB 3ZI4A 3TPZA 3GJ8A 3MWYW 3FTCA 4CFSA 1H5UA 1Y3FE 1CBUA 5ERGB 5IJZA 2FWMX 2PRIA 1QOPB 4MH0R 1BD3A 1ZSVA 3G8BA 1XZGA 3G9QA 1U0RA 3TLAA 3WLTA 4A0RA 4GX2A 2ZUBA 3L41A 4O2AB 3GUYA 4TT3A 3WDSA 1SWWA 2VHCA 1OLXA 1XELA 3EGXB 1PT5A 3PEYA 5CG1A 2OSVA 3EZ2A 3DA8A 2GETA 2X2OA 3CJQA 3HB5X 3CISA 4U2EA 3FTEA 3QOWA 1R6BX 1XBTA 4G0XA 3PEFA 2FMTA 2FRDC 5CJJA 1LZKA 2TMGA 1L4UA 3KK0A 4EYQA 2G82A 2C3PA 1NBEA 4IF4A 1NBWB 4AQYB 5C4IA 1ODIA 3K1TA 4NFHA 3U81A 3VNRA 4N8SA 4ER7A 2VDLB 4PCAA 1DWQA 5E3JA 3M7IA 2AIRA 4I5GA 1LSOA 5ELXA 2JG3A 3SHVA 3DQQA 1YBHA 4KH0A 1GTSA 2HAEA 4CLHA 4MJ7A 3JQ6A 5AVOA 2V45A 2R6GA 2RHTA 3IBYA 2GFQA 4MLCA 5CGZA 2Q3CA 3UFBA 1IK4A 2CCJA 5C4MA 3D2BA 2O1SA 3ACBA 1A69A 3FGPA 5B7GA 4QG3A 3AF4A 4Z4CA 4P8RA 1VL0A 5KYGA 2OVBA 1VLHA 4FIDA 4X93A 4C0HA 3D0RA 4PSKA 4Y6QA 5BN1A 2PWYA 2WV9A 4F38A 1W1UA 2ID9A 3SC6A 3EXHC 1L5WA 4JZYA 3C3EA 4C7XA 5JH7B 1D2HA 3T3PB 3KSBC 4MQFA 5AK3A 1JJIA 3GLGA 2PX0A 3R7WA 4C6HA 4A27A 1U90A 2EKBA 1YJ8A 4TMXA 1EBFA 2XPCA 4XSGA 1N33B 3GB9A 4EPTA 5IG2A 3U4QB 4OPMA 1VYHA 2A9FA 3REGA 1CS0B 1WF6A 2XT0A 3BKWA 1YTLA 3I2KA 7REQB 2PL1A 1SC9A 2CLFB 3KHTA 2QN6A 2FJUA 4Q9NA 1R18A 2HHHB 1RXSA 1XRPA 3U7EB 3R4VA 2IYXA 1Y1LA 2QTTA 5KJEA 2WE7A 5ALGA 1DKNA 1Z4KA 3RUHA 3O3NB 3K6JA 1NR7A 2P9EA 3BXGA 1P4SA 3WYNA 4CG2A 2OG1A 3FFTA 4EUKA 3OOHA 2IHKA 5BYAA 4Z4FA 4HG2A 1WUTA 2VT3A 1UBSB 1Z4QA 2ZK7A 2ZR7A 1YRHA 3A70A 1IPHA 2DZDA 3PUVA 3RKRA 3U13A 2HCJB 1AK2A 3SKYA 2VOEA 3S2YA 1MGOA 2WF9A 4I8XA 3I52A 4QO8A 2DR2A 4BQPA 2O2EA 2HPHA 1YIDA 2KJQA 4P80A 3I83A 2WWXA 3OOSA 1FFCA 1MB3A 1W5TA 4PYOA 4Q3DA 3VX4A 1TVEA 3QQ5A 1AQJA 3CVUA 4EL0A 2DWUA 1Q0ZA 1ABEA 3DTTA 3LC1O 2O3RA 4EA6A 3DG9A 3EZXA 3KQOA 4HDSB 1OHHA 3C85A 3ILVA 1I4OA 2IYSA 2X76A 3JCZA 2GBCA 4Z3DA 3QFCA 3GGCA 1ULHA 2XA2A 5FV4A 3E22A 1FRNA 2NUTB 1EGMB 1Z47A 2QJOA 3QBJA 1LK7A 4R2HA 2OK7A 2NP7A 2HA4A 3PNKA 4M0DA 1A27A 2QZ4A 4LE0A 3MUOA 1N5RA 2V6BA 2II6A 2VWHA 1CD5A 1EG7A 1E2HA 2HCRA 4LXIA 1E9AA 5A7GA 2W70A 2IP2A 3GZNB 3ROZA 3SYNA 1M5TA 4A15A 1A5TA 1QVAA 2CNOA 2CL0X 3GRUA 3CW2A 1KAEA 1W5SA 4FSHA 4JI4B 2A78A 1U04A 1AQUA 4PO3X 4GLLA 4IVNA 3TDNA 3GDOA 1M2EA 4JGGA 4UHJA 1KJWA 2UXBB 3NDPA 4DY6A 3AF2A 2HSJA 4RJKA 1QV7A 4JI8B 2QTGA 2GJSA 3ECCA 1QWOA 1WDLA 2XCSB 2X5JO 2QN1A 3Q2OA 2BKUA 4MPRA 1LBTA 2HY7A 2CBXA 4NJEB 2IYFA 1KKMA 4XIJA 3QVLA 1COWD 4BVBA 4RFLA 4DT1A 1B15A 1JR6A 1FMJA 5CURA 4O4HB 1H8ED 1JYFA 3IAS6 3L05A 1LD3A 3O31A 2H1VA 2O54A 3O95A 1F4LA 4JROA 2PX8A 2LE0A 2QSYA 2ZSIA 1QCYA 1Z35A 4BN5A 3QKSB 1ZIDA 2HB6A 3S3TA 3ZVLA 4R41A 3GAAA 3LWBA 3PGVA 1N2HA 3FYDA 4JEMA 1MJGM 4JITA 2Q3LA 1I1QB 2V1UA 2JLUA 3KQQA 2XB9A 4MI1A 3TLJA 4EHDA 4DM7A 1ZL2A 3FIJA 2ZSDA 3MGCA 1ZITA 3AY0A 2CJPA 4IDAA 1L4EA 3EIXA 1JWLA 3VGJA 2IUFA 2WWHA 4F91B 2JBAA 1NN0A 4MUXA 3WC4A 4LTDA 3T5PA 1HQCA 1XLUA 2YJ4A 3RV4A 1LS6A 1H2YA 3RUCA 1PU2A 2GESA 4X60A 5E6UB 2EFCB 5BV8A 1PJ4A 4MYDA 4QJBA 4BFYA 3U6BA 2IPLA 3BH7A 5J43A 1M2VA 5JYEA 4QREA 2YMMA 3HM9A 1FYEA 3OQVA 4ZVUA 4TWJA 1EBUA 1XE3A 3AHEA 4MQBA 2JC3A 3W8RA 4PCLA 1P7PA 3KQUA 1T5SA 2LR0A 2EWWA 4DIKA 1TYEB 3D64A 4L5JA 2RK4A 2W6NA 5C7IO 2HRDA 3UCEA 1LI7A 2OEPA 4FE4A 5JARA 1JKFA 3DM5A 3C1AA 2H2AA 1BEEA 4QJ5A 1IXZA 1XTUA 4UJ5A 3ZDEA 3GCGA 2PHZA 2NYVA 2QUBA 3QOXA 3VV3A 5I7RA 4AKHA 1Y5IA 1PJ3A 1TQ2A 1LV8A 4J9VA 3EAFA 3VC7A 4CDNA 5SY6A 1GZSA 1XEWY 2I99A 3DMYA 2O0JA 5FAKA 2Q9BA 4G0OA 5ILOA 5DEOA 5KI6A 2CD9A 3PB3A 1B93A 1CSEE 1YB5A 3UPUA 1HYBA 3RIXA 1QJCA 1JG1A 4G56A 4NFSA 2Y66A 1ELOA 3EGDA 4AZ0A 4DGSA 5KVAA 2NX2A 5AXAA 2A8YA 1KMHA 3QPBA 1RP7A 2CYAA 3IDSA 4QDJA 3S99A 3U44B 1QRRA 5FLEX 3DW3X 3M6FA 4GH5A 3R8XA 5EQFA 5CG2A 1DRKA 2IZOA 2VSQA 3U9TA 4L0QA 4OIFA 2BWJA 5DZSA 1W36B 2HGZA 1DEXA 2K6GA 3C7KA 1ZMRA 4KLZA 4L5CA 4MUNA 3HKDA 4FOOA 1R7RA 1KZ1A 4EFDA 2W7TA 1CP3A 3VTKA 3A6DA 1AN0A 4AT1A 2AMLA 2F6RA 2QENA 1R64A 4FQ7A 2I6UA 3LPDA 3O1IC 1W73A 2G09A 1KIAA 3KPVA 1L7XA 1ZUNA 5EE5B 2FZ5A 4MVJG 4FR2A 3HZRA 1GTMA 4MWSA 1FLAA 4TV9A 4BRSA 1EJ0A 1QFSA 5CDFA 4RW0A 4RTLA 1A4XA 2H5LA 1BW9B 4PIVA 1UJ4A 4J0DA 4F9EA 1SU4A 3ABQB 3FCYA 3IMEA 1LTHR 2Y99A 4E2WA 3TMAA 1KDTA 3CX8A 3P9QA 5IF9A 2JI6A 4YT2A 1QCCA 4DCPA 1PGOA 3KT0A 2HI0A 4G85A 5JDCA 2Y71A 3SSNA 1DEAA 2OXTA 2VDWB 3KUCA 2BBSA 3EOAI 1PW7A 2GAIA 3S55A 3L92A 4QATA 3USES 3TE7A 1W8DA 2WUVA 5DRYA 4QDTA 4B46A 1BQEA 4EYKA 3BJEA 1N5DA 2A1UA 1ZJZA 2P67A 2YVLA 4IV0A 1O03A 4V39A 5TX7A 1X1RA 1DZIA 4QJ3A 1IB6A 4F86A 4U7FA 5K8LA 3IX7A 4YHHB 4XEUA 5HCUA 3BMNB 1UDXA 1PTJA 2PRKA 2V03A 4N5LA 3TQRA 2VH5R 5GJWC 3WG9A 1M2WA 2XIJA 4D5EA 5I01A 1UMBA 4JJ6A 4N6GA 1JS1X 1F60A 2W2XA 1ZH0A 3LP8A 5CH3A 1QGUA 3BWXA 3MD9A 3RJ5A 4BJ5A 4RELA 3SM9A 2PZGA 4UCXA 3VSBA 1UZMA 5E1BA 2C9OA 2AN9A 2ST1A 1SBTA 5JO0A 7GPBA 5LA6B 3MERA 2BSAA 1AO0A 1XZCA 1M9NA 2J31A 4TWIA 4E6EA 1U81A 5FOVA 1Z38A 2OM2A 4K05A 2B94A 2G1PA 3IALA 3UK7A 2GYUA 4NU6A 1ST2A 2JI7A 2J9FB 1E6EA 1R15A 2NSJA 1T9CA 3G9XA 3GFFA 3RVBA 1MO4A 2R8PA 2YDXA 2VRNA 2QZPA 1WVIA 3JAKB 4IUCS 4OJKA 5E9JA 3N8GA 1N6HA 5MGNA 5AIBA 1YTUA 3I12A 4RA6B 1JYEA 1YGYA 3ZWNA 2BBTA 2CC2A 2Q9UA 3P5BA 3WK6A 2HLPA 5F23A 5CX1B 3ZLJA 1QIJA 3M6AA 3HXMA 4AO8A 2I7CA 2QA5A 3IAM1 4BGUA 4MW4A 2B2CA 3IC5A 4RIEA 1Q1NA 4BFZA 4DIUA 4DWJA 1OVMA 2A5FA 2BLLA 3VPHA 2QX7A 4KQJA 5DN6D 5C18A 2BKLA 2IFTA 4BNKA 1Z12A 3UFXB 1CRPA 1ESZA 4AMBA 1L3CA 2HUPA 5D3ZA 1UBJS 2ZETA 3MTBA 4IGEA 2BSQA 2I2XB 4MWZA 2C5SA 5THQA 4D80A 1VBKA 1IBCA 2BPOA 3FLAA 1EX6A 2OQ2A 2XNCA 3G1WA 3MWJA 4LK2A 2ZTVA 2O2CA 3Q10A 4ZIRA 3CIFA 5CA0F 3LZCA 5JAOA 1A8PA 1JA9A 2PSEA 2X9LA 1EXWA 3CH7A 3R0ZA 2I4RA 5AH0A 5E8JA 5DHAA 3A3YA 2FP4A 2OO5A 3LCCA 3ET5A 4WKOA 3DBIA 2GOYA 1II0A 1Z74A 3LVRE 3JR3A 3O2QB 4NOLA 4KYVA 1DCFA 3QXHA 5EZ6B 2VBCA 3LMKA 3MXTA 1UEXC 2VUIB 2ZBPA 1NJSA 4IQ4A 1XDWA 3KWMA 4JJIA 4MTLA 3RC7A 3VI3B 7YASA 1QP7A 3PLRA 1P75A 1Z22A 2ZJ3A 1UXJA 2XXBA 3ITKA 4D5GA 4Q3KA 4D45A 3EXG1 1MJNA 2Q3DA 2IXDA 2JFPA 3NQ41 4MVJD 5F1PA 3WAKA 1R4MB 5FH9A 3PQFA 1N3IA 4H4DA 4BP3A 3M1AA 4AULA 3SBXA 3MS4A 4RK7A 5BUSA 1FUYB 2V7XA 3B70A 4U9HS 3DEIA 1ZISA 1UKVY 3WY9A 2BHSA 1VDZA 1XN1A 1V8OA 4DREA 1HDOA 3MT9A 5HMLA 3X44A 4C7OB 2VDVE 2VYFA 1MH9A 3DFUA 3EE6A 3I9NA 4P2BA 1IXKA 4R7ZA 3UWKA 3KTAB 1KEEB 4E3ZA 4QGAA 2GH1A 1TO1E 3FLMA 1ONSA 2OSBA 3LBYA 1OJLA 1X7YB 2BEKA 4Z99A 3T41A 3VVMA 2FEPA 2QIOA 3RTDA 3DDNA 2YRFA 2H1RA 4PRLA 4KXFB 5TNXA 1XTSA 4R7TA 2AEEA 3PIIA 1E69A 1H4TA 1TECE 4Q9HA 1RKVA 2OILA 4X71A 4YMVA 4PNEA 3DBHB 2YJTD 3CMCO 2O8DA 4J0EA 2QZZA 4NU5A 1XMXA 3I72A 2ZTHA 2PZJA 3HBJA 3TTYA 3WHPA 1W5BA 1S2GA 1FSPA 2V3WA 1TM1E 2CYCA 1CYDA 1SB8A 4MLZA 3I4FA 5BSVA 1U3GA 3RTBA 3D8UA 3GFVA 2GVNA 1HLFA 4DWWA 2ZUDA 5T4FA 4R9NA 2AG1A 5K2OA 5L51A 3OIVA 1FDIA 4JNKA 4ZVKA 3KLMX 3SVZA 5AW9A 4YBRA 3DLBA 2WQZA 5I3ZA 3N8NA 4DYHA 1MAUA 3AERB 2BEUB 3FGOA 1KYTA 4BX0A 1T6BY 1G6KA 1FSSA 2EL7A 1EUCA 1G291 1GZ5A 2I65A 2ZSKA 3COVA 1Z2PX 1F2VA 3M9XA 5JCJD 1PKXA 3K5HA 4ILEA 3NIFB 1PQYA 3UJAA 4TMFA 3WRYA 4OM7A 3DFKA 2XNDA 2FVXA 2Q6KA 4C4SA 2PWZA 4LZZA 1ZK1A 4D02A 3EWSA 5ULLA 4AS1A 2HU8A 4G8JA 4GXNA 2OGZA 2YJ3A 1RCUA 3EGIA 3ECAA 4CE6A 3FOWA 4KW7A 3OY7A 3T7TA 2FJ0A 1ZD2P 3IDQA 1HV8A 4P3XA 4JXZA 1GGVA 3P1JA 3WGQA 4QYIA 3ZWMA 3K32A 1SEVA 3DNPA 1PSDA 1TF5A 4NSNA 4Q03A 4JFAA 1U2DC 1EGQA 3FDFA 3PC6A 1KZGB 4P6VF 4RXUA 4XVHA 821PA 1ZJ6A 1M5UA 3CG0A 3E4CA 1MQAA 2H0QA 4MKGA 5DWQA 2P40A 1JVNA 2LXNA 3TZ6A 2ZE6A 2GZAA 1E61A 4PQEA 2QPOA 2QUZA 3LO5A 1PR1A 3G0GA 3C5EA 3MFYA 4MQLA 4RLHA 2XCTB 4R6WA 3LL7A 3ROEA 2HMAA 4FIZA 4OHUA 2X3FA 4REMA 2NVOA 3PNBA 1W0CA 1DHTA 4L8VA 4M3NA 2CFIA 1UJCA 2PKQO 5BWCA 4ALNA 4OHOA 2YZMA 5HDQA 4MR7A 4QUKA 3I9LA 2HMYB 1WSDA 1JPVA 2C82A 3G1UA 4R2MA 3KP1A 2P2NA 2Z04A 1PT9A 3OEEA 3H84A 1VL8A 3LXMA 2PD6A 3E61A 5B2FA 2TS1A 3D54D 2O1WA 1TK2A 3DMPA 1H4VB 1SCAA 2VZ9A 3NBKA 4K26A 3KDAA 4S1TA 5FOTA 4Q4DA 2YKGA 3LWZA 4BLOA 2HA2A 1Q84A 2IHZA 3SQOA 4TMKA 4DLZA 1CUEA 1JGTA 2YBEA 2JJ2A 4EF6A 1BS2A 1HFWA 3WRWA 2QLTA 3DNMA 3M2TA 4KXQA 3NEPX 1JZSA 3OP1A 5D01A 1YHYA 1ORTA 2FKNA 3A4YA 3VH1A 4PG8A 5ILGA 5HKOA 1XOIA 5ERYA 1U6JA 2ERCA 2W2NA 5JXGA 4NH4A 1QFMA 1GQQA 3EEYA 5DSZA 3LUJA 2HJSA 2VHWA 3IAEA 2WZBA 1GRQA 2YOFA 4JB0A 4ZXFA 1HX7A 2I71A 4OAQA 1DBRA 4TMWA 2NNLD 3WLMA 2IH5A 4C07A 4FOPA 1XCBA 2R1VA 2VRBA 1MB0A 4UDXX 2JVIA 1X80B 5G40A 4LSZA 4PGGA 3WGLA 1N5LA 3S1LA 5CH8A 4JGBA 4TV8A 1YDMA 3H2HA 4YMUA 3ZWPA 3DMTA 1BXRB 4NYJQ 5BNFA 4EHHA 1NBIA 4D4IA 4HQ6A 4DTCA 3PHGA 1JRLA 4OFZA 1KZ4A 2W2PA 2EG5A 4NAVA 3FMOB 2GEBA 4KLRA 1E3QA 1N9KA 2J85A 3PS9A 1EE9A 5J5VA 1ZM3A 4BXOA 1JLLA 4G5SA 2VAMA 4OI0A 1ZH2A 3L8ZA 1LQ2A 1X1EA 3I5XA 3EXEB 5DISB 3OA2A 4BO9A 4RM2A 3GFGA 1HLGA 3TBFA 3AINA 1FBNA 1ZI9A 1N6OA 2E5WA 1QC5B 1Q22A 4HNHA 2WI8A 3H04A 5F7XA 2XCIA 2XYGA 3OZUA 4H77A 4LHWA 4NNPA 3QVKA 3UXMA 1KFKB 1A9YA 2YICA 4B5LA 5JMOA 3VNUA 4F6RA 1MZVA 2VYVD 3WWEA 1EVKA 1S9HA 2QSZA 5H9WA 1NVMB 1OFUX 2JKYA 1I4EB 2VZ0A 1RM5A 1A2OA 3L8YA 3Q1LA 5LBUA 1YASA 2BI8A 5C5IA 2PH1A 1IXYA 2WT8A 4MKFA 2A9JA 3AEYA 1AKTA 3QHQA 3REQA 4DJAA 2BI4A 4RPGA 4YUVA 2A57A 2XSZA 2GEJA 3JPWA 3P9XA 1JJVA 3T54A 2O2DA 3QEJA 4RADA 4DNQA 4CCWA 1G18A 3MB8A 1PT6A 1WB5A 3FSRA 2BP7B 4TYQA 3RFUA 3WGOA 5EVJA 4OA5A 4FKBA 4W82A 5IRCD 2JGDB 4EA7A 1Q92A 3Q9SA 4IVRA 2ZB8A 2HF7A 4WESB 3VHXA 5EJ6A 3E15A 3F8SA 2O2HA 3A6EA 1N6KA 4O0MA 4B3MB 1H85A 4XA8A 3OE7A 1KH3A 4MUBA 1OGYA 3OUTA 3U3KA 1GPWB 3DHWC 3DYBA 4O5AA 1E3WB 3N2GB 5KDOA 3HCBA 2B35A 4X7PA 3T7IA 2OK8A 5JTTA 2QT0A 3FA2A 4D4GA 2HWKA 2EFGA 2QQEA 5D7BA 4IS2A 4AZSA 1CYEA 4EGFA 5CK5A 3URMA 3IV7A 2VT7A 4R2IA 1G2QA 2GZRA 2L69A 1ZXXA 2R2GA 4DCTA 5KINB 1KOGA 1E2LA 4ZANA 1Q7CA 2WIJA 4D3YA 3QIVA 1E77A 2UXCB 3E9YA 4OHYA 2H54A 1U63A 1OUMA 4DEYA 2GBLC 3GJ4A 3VO2A 1D6SA 4LS3A 1FRVA 4F3TA 5JBNA 3KXLA 2E55A 1FOEB 1MT3A 1O96B 3HJAA 1E1YA 3GPBA 3OQHA 3ENZA 4AP6A 1PDOA 5K6RA 2B1IA 1TJPB 2PL5A 5L9AA 2I6TA 2FPWA 4J0QA 4BO6A 1KF0A 1P4RA 1SCKA 4L16A 1KEKA 2O07A 2J0VA 2GCNA 4EATA 1X7ZB 4PZLA 1USKA 4QXOA 3F96A 3G3EA 4QODA 1KVRA 2FPLA 4HLCA 3WP0A 4BUJA 2PCJA 4ZZ0A 4R01A 5HXAA 2I9PA 3KB2A 3F46A 1VXOA 1ENPA 2GWRA 1ADCA 3PC2A 4FZ3A 3M3PA 4LJLA 3UK6A 4PSDA 4YEDA 2GJ4A 4ID9A 3LX6A 4ZU3A 5IUJC 2IKSA 1CNMA 1U0SY 1V4VA 3GNQA 1F3LA 5G3YA 3BIWA 1TADA 2E3JA 4JODA 1XTBA 2YY7A 4R51A 5M29A 4O2AA 1I4TD 1HNZB 5AOAA 3LJKA 2CLOB 2O05A 3EGXA 1QG0A 3KWJA 4JELA 1OTXA 1QFZA 4IINA 4HUJA 4Y30A 1MG5A 2J3LA 2X4GA 3EK2A 3LAWA 2VA8A 4PX2A 4WNAB 4CG0A 3OLWA 1CWUA 2C9DA 2PT5A 3U0BA 1XSEA 2HC9A 3DEHA 1A5SB 2D2EA 1TEHA 3C5WP 4WXEA 3RTCA 3TL6A 4W1SA 1OPXA 2HQRA 4FYXA 4QRDA 1T0PA 2H7XA 1GFSA 1PFWA 3QJYA 2WWVD 3F3SA 1S2LA 2JVJA 4YFYA 1FLNA 1KEZA 1T2DA 4Y2JA 3QFSA 4GMDA 3KVNA 1HQDA 2EBUA 1EX9A 2HBYA 4OI1A 2RJ3A 1K9SA 4K9RA 2XV1A 2QIPA 3D7KA 5ARBA 2Q2OA 1N7IA 4PQGA 5L6MB 3K9HA 1C1DB 2ZBVA 4Q66C 4P86A 1P33A 3TMYA 5ALNA 1HK7A 1WXXA 3LQ2A 4EO7A 4C7VA 1C0PA 2E4UA 1W59A 2VI5A 2VFAA 3W2GA 2ZVPX 1OIXA 1W0JD 1RIFA 3D31A 3PJGA 4N65A 4RFSB 1H94A 1XD9A 4I4TB 3I23A 3LQKA 1T8YA 5FADA 3VTZA 4D8YA 2PBZA 4XASA 1R8JA 4R2JA 3T1TA 1ODKA 2DVMA 4FJ1A 3K96A 4PYIA 4E07A 5EKSA 1JWAB 3ZVNA 4RF2A 3KPYA 2OORA 2H1FA 1C30B 4HDMB 3A14A 4EA8A 1QHNA 1P73A 4B8WA 5I7SA 4XM0A 5JH7A 3T12A 1VP9A 1ZINA 3BTSA 3SYLA 2OC4A 4M54A 1H93A 3SU8A 3FMFA 1EA5A 1T15A 1AUVA 3T4PA 7REQA 4AXBA 1RHUA 3IQDB 3KYBA 4NZMA 5AKZA 4LGVA 3E70C 3WL7A 4J29A 3VSEA 1WB9A 1D2MA 2WJ3A 3P4XA 5JCXA 2M98A 4EI9A 5EJ8A 1YGPA 5JSQA 3ITDA 3W5SA 2HJGA 1G3UA 3BFVA 1PLKA 1TI7A 3NPAA 2Q28A 4MQUA 2WG1A 1U0LA 1VRWA 1ZK0A 1AZTA 2P4EA 4QU8A 3CUEF 3AXSA 1OXSC 1J9EA 2DC1A 1Q95A 2P79A 2R60A 1XQVA 3DDHA 4K5QA 3W7BA 3ZVRA 2EWVA 2VDRB 2XCUA 4RKEA 3HSKA 1QRSA 4G1FA 5IMSA 1X86B 1NL3A 3T9FA 1GKYA 3A1TA 3NGXA 3E5HA 1UT8A 2Z4RA 3H5IA 4V0ME 2XD9A 4QDKA 1GNRA 3LQFA 3LX5A 1Z36A 2RHRA 3FHCB 5FFNA 2BL4A 1O8BA 2LBPA 5FD8A 1RXIA 3MIIA 1ADJA 3IDZA 3QWHA 2FSVA 4DV6B 3LQYA 1GZ6A 3QKRB 3OZIA 3D7NA 4LJYA 1RTKA 1RJGA 5SYAA 4XLTA 4Z7OB 4HDSA 1BX3A 4IYRA 2Q7DA 3TZLA 3WIOA 5TF0A 1GT91 2BGRA 2ZB4A 5BSHA 5L95A 1JEYB 4EIWA 2QKYA 2BW0A 1MGPA 3DOOA 4GPTA 1GSIA 2XXJA 4GPBA 4I19A 5SY4A 2DP4E 5EXPA 3N9IA 4BKRA 2PWAA 3KVOA 1MTOA 2O8CB 3PLAE 2HIMA 3BIFA 2FUKA 3RO7A 4TYMA 1ILWA 3RBXA 1S8OA 4RD1A 4G0MA 4Q47A 1EE1A 4WQMA 2ZIGA 1PR4A 4GMFA 1KQPA 1IEWA 2IZZA 4PG5A 3DGFC 3ENQA 1ZY2A 3ED1A 3QNUA 3OAAD 2BDEA 3CV3A 1V43A 3GZNA 4HDKB 1J97A 1XKTA 4HFNA 5GGXA 1YT5A 2C2XA 4DRYA 3WMWA 2I55A 1W29A 4X6UA 4DM4A 2DFVA 4RY0A 9MHTA 2QTMA 1F17A 4PRZA 3WLKX 5BR4A 3THYB 1PJ2A 4JQZA 4RL6A 4ZOBA 1OFGA 5F33A 1F8XA 1VE5A 4X61A 1T3SA 3RYFB 4NJEA 4CTKA 1B76A 2Q4TA 4BB0A 1IDN1 1L5FA 1O0CA 1CZHA 4KXWA 2JAWA 4JD5A 4O4HA 4U7GA 3DZHA 3B1FA 5KU1A 2W8ZA 3FZGA 3T9AA 1XP5A 2WMDA 4TRMA 4B3GA 3AIIA 1NVKA 4V38A 4WK0B 2WKRA 4DNOA 3BJMA 1T2AA 3R5XA 4NE7A 2ETVA 1U8TA 5EJIA 1T2VA 2HA5A 3MMSA 2FZGA 2DHCA 3WWCA 2X1VA 1E92A 4D8XA 3OM0A 4LY3A 2JGMA 3CW9A 3NEYA 4BFVA 1P1BA 5KDDA 1OR8A 4TXLA 4LGMA 4F92B 2GM5A 3LECA 3REOA 3QUQA 4WBXC 3L4JA 4F8EA 1QIMA 3FPLA 2YQZA 4W9NA 1JIXA 4Z5XA 3E53A 4TT8A 4GP6A 4TKVB 4LISA 3CCBA 4R2LA 4FTWA 3ITEA 4G8BA 3O91A 1WQ4A 3B5IA 4PPFA 2AJBA 1EZ4A 2QRZA 5LWHA 2O2SA 2JVKA 4B7CA 1SAYA 3KKOA 3C6YA 3QPVA 5E6UA 4J7AA 5JJLA 2RE8A 2OV1A 2GBPA 4I46A 1JFRA 3PC8A 2OCAA 3E6AA 4C04A 4EZEA 3QOFA 4WDRA 5EZYF 4YRDA 3FWZA 2WM9B 3K0BA 3KKLA 4J7XA 4EFLA 1FFDA 5I7FA 2JFNA 3BT7A 1B41A 4MKXA 4C4OA 4LZJA 3CWQA 3NKVA 1GGKA 2NXEA 2J3IA 1UCFA 2CUNA 2C1XA 3RRBA 5EHGA 1GVHA 2C5AA 5FI5A 4R7GA 2ZIXB 1Y33E 3DZKA 4R8KA 2GX6A 4UU7A 2BE7A 1QR2A 2GYWA 5AW2A 4ESHA 2WT4A 3PQ7A 1ORHA 1UKEA 3AIKA 4XUEA 1R0ZA 2IPXA 5AKJA 4XVUA 3ERCA 2P5SA 4IUDS 3DYVA 1EB8A 4MRVA 4RXTA 2Q7XA 3VKVA 1HDIA 3X1MA 1JQ3A 3AR9A 4QOIA 1O6FA 5MFZA 2J5QA 2Z98A 1YUNA 3I92A 1E1QD 1P62B 1ID8A 3UK1A 4UE6A 3V2HA 2KBFA 2J9RA 4JT4A 4QRHA 5DTQA 3U44A 3TRDA 3UWSA 3M9LA 5BXYA 2CFRA 4DNPA 3NT4A 2DH6A 2F3TA 5IM4A 2ZYRA 4W6ZA 1ZVKA 1UPTA 2GI4A 4Y9UA 4YWJA 2OENG 4XJXA 3QF4B 4RPIA 3N58A 4I6JA 3S6JA 3RAFC 5I9NA 1F6DA 1P0IA 1ZH6A 2BGIA 1KNQA 5LQAA 2ORWA 3TUIC 1T8PA 2ZRAA 1CY0A 1LPBB 2GO7A 1KK0A 2VHZA 3IHLA 4I8DA 4PAGA 3UENA 5HRAA 1QYVA 4L0MA 2DU8A 3I2HA 3AV0B 4BLTA 1XWFA 4KSBA 3PFKA 4CM4B 1WXWA 2E5FA 1KNXA 2FSSA 3OIWA 3VOAA 4GPIB 3L5KA 4PHGA 5CU7A 3VR5A 3CKMA 1GILA 2XZTA 3PU6A 2C2KA 4RQUA 3OWHA 4TLAA 5TS2A 3VVBA 4MUJA 5CPBA 2HK8A 3C5VA 1ESNA 4KGZA 1MKYA 2XCLA 3V8NA 1N2GA 4HAVA 4OGKA 2VDWA 1WEHA 2C4VA 1RPNA 2QR5A 2VEDA 1S4MA 2WHPB 1WBBA 2F64A 4DIBA 1Y8QB 5JSYA 1VMEA 2I2CA 4II2A 1SCUB 3WLAA 1I7QB 5GOTA 4RWEA 2YS7A 3AVUA 1RAHA 2Z9DA 2NO7A 1CEEA 1RZRD 2VYQA 1SK9A 3FYUC 2JCBA 3K5IA 3PYMA 1XVTA 3RLFA 1F51E 1R50A 1YC5A 2JKVA 1IBRA 2OBBA 4UJ3A 1UFVA 3MUFA 4JBIA 4B6OA 1E2JA 2MR6A 1EEHA 1IFXA 2AN5A 4ZYLA 5JAHA 1D4OA 3R77A 1ODCA 1X7WB 2PUFA 2GDZA 5TMDA 3UA3A 2D8MA 1NBAA 4FN5A 3SXUB 5A7FA 1ZGJA 4OL0A 2JD2A 5BY2A 1Z0SA 3CLHA 1MIHA 3UV6A 1EKXA 1GDHA 1YB6A 2NWQA 5AESA 1B14A 1MQ8B 2ZAGA 2YYAA 3C16C 1E7RA 3ZQUA 3RIHA 4DDVA 5ITVA 1L7VC 1N34B 4L4UA 1T5TA 1X2BA 3HKCB 1DLIA 2J9FA 4Q24A 3JRNA 1YRQA 3CCFA 1SUBA 1FNBA 2H59A 1JJFA 1UDBA 3JAKA 4Y67A 5AW7A 4NXMB 1J2RA 1LNSA 2AUNA 1EFPB 4NZOA 4IO1A 3KRTA 2BEWB 3RUIA 1DOHA 1OBOA 4LPKA 3UWDA 2PZFA 4B7ZA 2X7XA 1BIFA 3E9RA 2ENWA 1YFKA 5CX1A 4N3NA 2Q6VA 5K0LA 3OPXA 2ODAA 1U5CA 2QR2A 4BV3A 1XU9A 2Z3VA 2GB4A 1UOPA 2XH8A 4Q4HB 3I6ZA 1ZM9A 1FFWA 1BS9A 3HCOA 1Z7YA 4JBLA 1FLDA 1GITA 2XRYA 3KG2A 3OIFA 3D3JA 1X2EA 5K0BA 3UFXA 3B8HA 4BO1A 2IIVA 3MLBA 1NRJB 5FKJA 1RZUA 2VUSA 3WGVA 4PGAA 3TBHA 5EJAA 3D8TA 5LOVF 1H2RS 1QKJA 3MCAA 3GHYA 3VPGA 1OA1A 3E23A 1CR4A 3V1LA 3T5CA 4MRAA 1BMFD 1MFZA 3LRPA 2GGSA 3P2MA 2E82A 2FHSA 2E37A 2YQ5A 1E9BA 1P2BA 2DQKA 3ISTA 3RIMA 3ROMA 4DLUA 1GPKA 1OPRA 1L8LA 1SUFA 2VYNA 1MAWA 3LZDA 3PCTA 4JFRA 4C7JA 4O2LA 1HKUA 3S70A 3I45A 1V25A 4O4LB 5F2KA 4U8GA 2AC4A 1KVTA 3A1CA 1NMXA 2WJWA 4PSUA 5HZHA 4Y1RB 4LPSA 4OQEA 4WZAE 4QSHA 4S04A 4J76A 4P5DA 1L7PA 4HPJB 4KV7A 3VPSA 4EKIA 2XQIA 3DZDA 3LPAA 3NHKA 4FU0A 2LKDA 4EX6A 2CNKA 3QENA 4HWKA 1AIPA 1PR2A 1R4MA 4BDSA 3FPCA 5IUKC 4D96A 3W1VA 1QORA 3C3AA 3OZRA 4PBRA 2QRVB 1MN6A 2R68A 4PAQA 2A92A 1A9QA 2WY2D 2AN1A 1KAHA 1NVXQ 4RGYA 4P58A 1JNXX 3CN7A 3IR6A 5AT1A 5TPZD 1GTG1 5IARA 3E5RA 4BNXA 5JQGB 3L1VA 4C7OA 1YIOA 1H2HA 1BVUA 1ZQ1A 3SS7X 3KTAA 3WQBA 1KEEA 3HO1A 2O7RA 1Z45A 1RPAA 4IOLA 4CG3A 2QLJA 4KNWA 1E8NA 3K4PA 3N2EA 4WAUA 1TJYA 3DQPA 1QV9A 1VM6A 3W2HA 1W94A 4N0PA 4BVHA 4R0VA 1E96A 1H1LB 3DBHA 4UVIA 3RB8A 3EXIA 5EQDA 4F2DA 5IJ9B 2XMCA 3QW4B 5DX0A 5IKPA 1PJZA 5GONF 2Y4OA 1WSAA 1IJBA 2OB1A 1LDMA 2P2YA 2YWGA 3NWJA 1Z16A 2F1IA 2RGNA 2G77B 4LXHA 1K4KA 4E30A 2Q5EA 4A1OA 4QGSA 2OWDA 4JL5A 4LMBA 2O5CA 1U2EA 4Z9XA 3GLQA 5BNTA 1GZHB 1M2NA 4FB5A 1AZWA 1KPGA 3GN1A 2AG0A 2YUIA 5GZ3A 1A77A 3GRAA 1TUIA 1WX1A 5KYYB 2YN4A 3NBUA 4R1LA 5IKOA 5EIFA 3RNOA 1YJCA 3HSYA 3W5IA 1T9ZA 3AUYA 1NNLA 3RK0A 3AERA 2BEUA 4OQYA 2W58A 4ZVRA 4DV4B 4A03A 3MJFA 1LI4A 2JLVA 3JRWA 5AUNB 2ZRFA 2JARA 3ETCA 3GDWA 1ATIA 1FVOA 1BMQA 2W5UA 1IEXA 2Z5LA 3EZFA 2HPZA 3SYMA 3TEJA 1N0VC 4LBYA 2RC5A 3E35A 3NTVA 1DXQA 4NDNE 3LYHA 3B52X 3G5LA 3AL2A 3SLRA 4OBEA 4Z49A 1QAMA 1R27A 2A9PA 5JJCA 4BMCA 2BYTA 1XMQB 2N47A 5D5HA 3ZW7A 1F2DA 2RAFA 3ZWVA 4RGBA 4DQ0A 3EA4A 1KPHA 1V5FA 3G2JA 4LXYA 4AU1A 1T1RA 2DUWA 3C41J 5UKDA 2H48A 4ISCA 2QTVB 1UFQA 1UDCA 1YJQA 1H69A 1YL6A 2BCJQ 2VK2A 3IBGA 3K0CC 5JEDA 1N78A 2CLIB 4C3VA 2W4QA 5A03A 3ZBQA 3AZPA 2JI9A 4TMVA 1KGSA 4WLUA 1THTA 3V33A 4F8YA 1MJHA 2XGGA 4HX9A 5CLIA 3GAFA 3MAAC 3C8HA 1YVEI 2V6FA 3AY3A 4WKGA 5F35A 5CAEB 2WMYA 4L74A 1ODLA 4IEIA 2XGOA 2ALJA 4ITVA 3CLKA 2H5IA 5EJGA 1TK3A 4UZSA 4HK4A 2J5RA 4LNUA 1L7MA 1OI3A 3VZQA 2PJRA 2PT9A 2YTZA 4XX1A 2QE6A 3L06A 5M7EA 4ZFNA 2AFVA 3TLYA 4CIAA 3JWGA 3ZLUA 2POQX 3BB4A 4AS2A 5AOCA 4NULA 1ECJA 4FR5A 1Z0ZA 1FU8A 3UKDA 1QM5A 2QJTA 3K9QO 5CYFA 1TB4A 3FR7A 2H1CA 1UDRA 4AIRA 1FXSA 2YOGA 3JARB 3ZIUA 4C03A 4QASA 3M1LA 1UJ2A 2ZB3A 3WIUA 1BQ3A 1LCIA 3WNCA 2Q41A 2XWPA 4Q82A 3IIKA 4YECA 1XROA 5DM1A 3AY6A 3BD8A 3A36A 3OZFA 3ZV6A 5AM0A 5F9FA 4QTUB 3LC0A 1FYVA 1Q19A 2I4NA 4N1AA 3TVYA 3V46A 3V2UA 1Z4PX 5BO5A 5A3SA 1BTOA 2WJZB 3PDWA 3TX2A 4UBJA 4YRGA 3FNEA 2IS4A 4F2GA 3S68A 4GVLA 5C7YA 3PEUA 1BKDR 4UDYX 4LHSA 5IZCC 1DV1A 1MXHA 1G19A 2HW8A 1BYUA 3FVTA 5BSEA 3IP7A 2EZUA 1EFKA 1UR5A 2J6CA 2WHYA 1X80A 4WK2B 2H2IA 3IESA 4LJ8A 2W22A 2IDKA 3O2JA 2Z6AA 4AN0A 3ICEA 3NZEA 1YVDA 4R3NA 5GVSA 1BXRA 3FWPA 1J8YF 2H1LA 2PZMA 3OTWA 4LYAA 3KKPA 4W99A 1CNFA 1ZEJA 1HNNA 4LWZA 5A4IS 5BP7A 2WWTA 4M36A 2CKMA 5ESRA 1ORRA 1UKZA 1AHHA 5A9RA 4EM6A 3ELWA 1M0WA 3GY0A 3ILYA 1U4OA 4Q7KA 1E7WA 4J1TA 1NTOA 1Z6GA 2O50A 3EXEA 2VXBA 3KEFA 5H7XA 4IJUA 1WP9A 1GU7A 5AHKA 4Q1EA 4KXLA 2WYWA 5G0SA 2BJVA 1PZGA 2RH4A 2QJWA 3PI6A 4MYTA 1U8YA 2ZSBA 4E09A 2XZLA 2OAP1 4KITB 1SELA 1LBEA 1SQ0A 1XHEA 3MJHA 3SZ3A 1NUPA 1ZUWA 2PD3A 4HVCA 3GJ5A 1NLFA 4MCJA 5HIIA 4WCFC 1A9PA 1H0RA 2GN6A 5KQSA 3GYGA 3C7TA 3OFJA 1E3JA 1O94C 3V97A 1QCZA 3ZK9A 1P5JA 1Y3IA 3L82B 3QEBZ 1UQUA 1M6NA 1ECLA 4E4RA 3VNAA 1PRYA 3AG5A 1I9CA 1BS1A 1P60A 3PYLA 1XTJA 1AKYA 3FOEC 2VN8A 1KZ9A 1GD1O 4UPEA 1GQYA 5EFOA 2W0SA 3BDVA 4QYSA 5JMTA 2BP7A 1ND6A 2EV9A 2XB4A 4G1MB 2CZQA 2JGDA 1XLWA 2J3EA 4D3ZA 5C32A 2WEKA 2XYHA 4WESA 3BJZA 4ZZ2A 2NXNA 4PO9A 4ND7A 1Y80A 4JV5B 4KBFA 4Q3LA 2CDRA 3NAQA 2FNAA 1H42A 2ZQYA 1MJFA 1O3YA 2O3TA 4K7JA 1CVLA 2ZI3A 2OLKA 1E3WA 2H06A 2UV8A 4V0MA 3VU3A 3ZVMA 2NW6A 2YY5A 2D1SA 1XZFA 1DX4A 3LW8A 2I3ZA 2UZ1B 5CDUA 1QO0A 1V96A 2XRMA 3K2QA 3K6KA 3NBXX 1R8YA 2FVYA 5AW1A 2BGJA 2B78A 3IOBA 4DCNA 4E1BA 5D87A 1F0KA 1G8GA 2WA2A 2HNBA 3BHMA 4XKJA 2B3TA 4ZC8A 3OF5A 1CT9A 4HAXA 1NVAA 5JRJA 3FPKA 5FJJA 4YQFA 4TWAA 3D7SA 1J1IA 4L76A 2RAPA 4ZT5A 3CXRA 5FLXA 4D4MA 2AGVA 3PCRB 4JK3A 4FZVA 3IIIA 3UMMA 4I4LA 3VRHA 4HVTA 4QKQA 5A5FA 4GR4A 4TTPA 1YRLA 5EL0A 5IJ0B 4DZZA 1SKMA 3TGLA 4HOYA 5COQA 5FTKA 4BX3A 2A0UA 3KQTA 5KU7A 4DQKA 1QX4A 2D8AA 3GDGA 4Q1FA 5FV7A 4AP5A 1KS2A 3OU2A 3E9MA 1EM8B 3RODA 4LY6A 2VDMB 2HJ9A 1U0GA 1W96A 4K6MA 3IKMB 1KZ6A 3AEUB 4GOKA 4NOJA 4UEJA 4KI0A 2GM4A 3ZIDA 2DLCX 2QUJA 2D7JA 1YAHA 4G5OA 1F0YA 4TTIA 2PZKA 3FPHA 3OLXA 3ORHA 3BCHA 4NBRA 2F90A 4P53A 3H5NA 4IAOA 4L8GA 2KLHA 2IYQA 4BFCA 2Z2JA 3AHIA 1L3BA 2B4AA 5LNK6 5KPDA 4MWEA 1G41A 1SQFA 4CHGA 1ACMA 1O0SA 4KB5A 4WNAA 3NWPA 2Z9CA 3A27A 4P1ZA 3P9IA 5AW3A 4LZAA 3WLLA 2ZYGA 2X5NA 4MHSA 3S2EA 4ERNA 3NHJA 4EYGA 3LF1A 5IJWA 1R6VA 1DJNA 2BBWA 3PK0A 4ZO8A 1TZ2A 4MUHA 4F96A 4UBLA 1VG0B 5CVTA 3CZ4A 1DAFA 5M5BA 4M8IA 4MITA 1BH6A 1ZYUA 4OEHA 1G55A 1ZNXA 4X6YA 5AUQA 2R6FA 1NW8A 1C1DA 5JMPA 1SZCA 4S12A 4WHMA 3KKKA 3NDRA 2AG6A 5JAPA 4OHBA 3OQMA 1N6NA 1Z6QA 3EFBA 5HM8A 1NSYA 1DEKA 4R2KA 1H1TA 1U0EA 3K16A 3UJBA 4RFSA 2CVHA 4BP9A 4I4TA 5EZSA 4E7PA 4ENRA 4QHYA 2PEYA 1L5MA 3EZ7A 3DBVO 1U8UA 1O8CA 3A3PA 4O4IF 3RK4A 1QLWA 1B6SA 1RMQA 4N12A 4C0LA 5FLYA 5BV7A 3SHTA 5JZMA 4XXHA 4DC0A 2GNAA 2BZGA 3R5JA 1FJHA 1JSLA 1C30A 4HDMA 2HF8A 2N46A 2DECA 4A0GA 1RYEA 2SNIE 1GKLA 2W6OA 1EK2A 4RTOA 3U0VA 4P83A 4DLYA 1VBFA 3EVDA 4O2AF 1FC0A 4HTFA 4NZPA 5DNVA 4WLOA 1G21B 1V35A 1NQVA 4JWKA 2PZBA 3O84A 5CLGA 2QN8A 3VSAA 3TKAA 2JNWA 3PQ8A 3ZE8A 2PZAA 3GUVA 1JIKA 4X0EA 1CRZA 4TS1A 2PXXA 3U4HA 2JLCA 3Q3EA 2FK8A 4MRPA 4B79A 3VYUB 3FUXA 2WWGA 2FR8C 1G4AE 2IOFA 1LA2A 3CF4A 4RCZA 1Z73A 2CBGA 1SCNE 3WGTA 2L17A 2W8BB 2W6MA 2NOAA 2WJHA 4QNMA 4RPLA 4L4ZA 2M6LA 1XVVA 1J99A 2OM6A 4M0MA 4D7AA 1E4VA 4I1UA 2F8MA 5KCZA 5AHRA 1KJYA 4AF6A 1XQ6A 3HB4X 2QI9F 3MJTA 3CU5A 3L4SO 5G1NA 3IVXA 3FNFA 4J2OA 4NDZA 4CMCA 4GX1A 5HZKA 2B1GA 1U1DA 1WW8A 2QL9A 3S29A 3CPHA 4NABA 3A05A 4DCUA 4AC9A 4LQCA 3DD5A 3QKRA 1RMTA 1GNSA 2I54A 4TS9A 5FUWA 5B53A 3C15C 3NX4A 4QIHA 4AO6A 4KAXA 4F4HA 5KKNB 4YY3B 3J81k 4KODA 4LBZA 2IC5A 4OK5A 2ZVDA 1P8JA 2IWHA 4AZVA 1TIBA 3R7LA 5AD1A 2YCBA 2PUGA 2H8KA 4UPVA 4WFQA 1R12A 4YRQA 1KDOA 1UBCA 3G5UA 1Q3KA 3R5SA 3W8DA 4QYWA 5C8DA 2O8CA 1X7HA 1XAGA 4ZAZA 2YNMD 5DM70 2WILA 3QLUC 2JFYA 1YRWA 3PFCA 1PHRA 4B47A 4LDZA 5EA2A 4XR9A 3S2ZA 3T95A 5BWLA 2GAFA 1YZFA 4OYHA 2D1YA 1UBUS 5I9BA 4YJ2F 2Y92A 3PSHA 1JR2A 3O21A 1FUUA 2PUHA 5I9MA 3BGSA 2OD2A 4HDKA 1Z5VA 4UVGA 2CLSA 5BQ5A 5JYBA 2NUAB 2QVCA 3GJZA 3WAGA 3TXYA 1VBNA 2XOEA 3KEOA 4CLOB 3D3QA 3OT1B 5BOSB 1MVNA 4UE2A 2BZ0A 2X19A 4DHWA 1USWA 3THYA 2HPAA 1U8XX 4YR7A 3ANSA 1D1PA 5DBIA 2C5HA 2AD5A 2O3QA 3QEAZ 2I8LA 1U65A 1K4YA 3RYFA 1OWNA 4WXPA 1HDGO 1AV7A 2I4OA 2P9BA 2V7EA 1M6HA 3HZHA 1BXGB 3LT0A 4YB8A 1G7RA 4IHKA 1ETUA 4RL4A 5DJ5A 3S5UA 3ZK7A 5EIOA 3EW7A 1WS6A 2JDIA 3IR7A 1DRVA 4MLDA 3IURA 2M32A 1T4CB 4YRMA 3QE2A 1NYLA 3L04A 2VSNA 4FHGA 5EIAA 3VR4A 4PC2A 5JJKA 1Y3DE 1DNPA 5EGSA 3GCXA 3A8TA 3UQYS 1YZNA 2XBUA 3EAGA 2DMRA 1MW9X 2J1LA 1ECCA 1NZDA 2AX3A 2QP3A 3CA8A 4G65A 4G4GA 4IJQA 5J5CA 1C0KA 2V6GA 2XUAA 2VZ8A 3KOMA 4Y2XA 3QLVC 4HGRA 2MT9A 1FMTA 3B7PA 3LX4A 1YQQA 1XT6A 5IU6A 2BH2A 5C46F 1HTWA 5HHTA 5T3UA 4JLUA 4M1EA 1EX1A 1YCFA 1ARZA 1XIVA 1MABB 3SJCA 4TKVA 5BV0A 3A3KA 4FWTA 1SUPA 4J49A 2GK7A 2HLDD 3E9NA 4K8OA 4XEHA 1N3YA 1R8XA 2W0MA 3WL5A 4ALKA 2XF8A 1A96A 3DZIA 3K92A 1VE6A 3DMNA 2CJWB 2EL9A 3EWAA 3M4JA 4J2TA 4HLDA 1WMBA 1ZIYA 4MUKA 5KTKA 2C78A 1XQ1A 3SFTA 4NOKA 5IJAA 4C0AC 5B7NA 4FKMA 5BQXA 1G0OA 2QVGA 2VWQA 1Y6FA 2QN3A 1OBVA 3RQSA 3FY4A 3C2QA 3SS8A 3KSAC 1CE8B 2H7VA 2WF7A 5AW4A 1Y98A 1KORA 1GYQA 3ND5A 3A26A 4JJGA 2CDCA 2ZT6A 3QI7A 5GM2A 4EELA 1GRNA 4YV0A 2VRCD 3DE0X 1DGQA 4EL5A 2H3EA 1WB4A 2ZBUA 3LDFA 3I1IA 1F9EA 1KYWA 2IOQA 5LBIA 1DEHA 3GHHA 1KZHA 5J4YA 4NU8X 1G21E 1P3DA 4HNGA 3B1VA 4UXJA 5E9QA 3RJZA 1V6CA 4M1ZA 2IX9A 3KS9A 3ZGNA 4MGZR 3B12A 4CEIB 1EPUA 3HPQA 3IAUA 4FHFA 3ADDA 3HUDA 1N9GB 4K9OA 2M6SA 4QXRA 4WZAA 4UTRA 1U2ZA 2F1OA 2CHEA 3LOPA 4ED9A 3ZWDA 4S1VA 2AEJA 3SIPA 5BSWA 3ULKA 4UM8B 4EHBA 3EOBI 3UVEA 4MV1A 3UAOA 5TIIA 1NQOA 2XBMA 5EQTA 5K99A 2ZUSA 4ZZ3A 2C7OA 1XXHE 4DR4B 4OLFA 5KEIA 5B3JC 4FQ5A 2ONKA 1PFUA 4M9ZA 3IYLW 4Z7NB 3GRFA 5D1HA 4BS9A 4EDHA 1KAGA 2AKAB 2CMGA 3QF4A 1P9RA 4QDUA 5LQNA 4TM7A 1WNTA 3R6TA 1H1DA 1ZNQO 2B8WA 3PRHA 4A6EA 1RAAA 4XGRA 1W4LA 5JIBA 4YUAA 1P19A 1JVSA 2OCPA 2P9QA 2XMDA 2CW5A 1CJMA 3AUUA 1P4JA 1ZM7A 3RV3A 2WP0A 2C57A 4EUSA 5KJFA 5JVDB 1APBA 1N75A 1S7GA 2P9HA 3IE1A 3TK1A 4LBWA 1KFEB 2VKQA 3UJ3X 2ORIA 5H4HA 4D9MA 4M55A 4N48A 2F4NA 1JIIA 3FETA 5LMUB 3L7AA 3PFWO 1E1RD 3E8SA 2GJAA 1JFTA 1M6VB 3A2LA 4MIOA 2WHPA 4IJKA 4G24A 3SEZA 2A1IA 3PICA 3AU9A 2AUTA 2CN1A 1SCUA 4P54A 2F9MA 1LPAB 1LDBA 1LBQA 2ONZA 5ALYA 3P26A 4MVJM 4FFDA 1EWVA 1RRFA 3GQBB 4U00A 3SGLA 4FFLA 2CHUA 1Y3BE 3DWIA 4QZVA 4W7SA 5NLLA 2QVYX 2ZOSA 3V9PA 4C6SA 5K0EA 3KHKA 3PNPA 3F67A 5ARDA 1J21A 5EG5A 4M98A 3O3OB 1I2ZA 3O0DA 1X7WA 1KAMA 3RSHA 2E7ZA 5JW6A 1TMYA 1G6Q1 1P4AA 3KJXA 2XZOA 3SXUA 1ZR4A 5K3OA 4JGIA 2J5XA 5G53C 4ENQA 5IM4F 2PUAA 3CE6A 3H8SA 3T61A 3L4BA 2D0DA 4TSKA 4Z1OA 5CB8A 1FS5A 1NUSA 1E3DA 1II8A 1KOFA 3BQMB 3H2YA 4MOWA 1LB1B 2X41A 2FA9A 1TC2A 3MJVA 2VHUA 3HKCA 1IYZA 1X92A 1M7GA 4LXUA 5DHFA 2V7GA 3EVZA 1BGWA 2EVWX 1T4MA 1BRMA 2YHAA 2ZJ2A 4CZ2A 4ZICA 1SHTX 3JYLA 1Z2OX 2BEWA 4TN1A 1IOLA 1CCWA 4K2HA 4WIAA 1C0EA 1WQ3A 3TAHA 2FQWA 2PVPA 2FEAA 2GCOB 1KH2A 3C39A 4WBNB 4BVAA 4OM8A 2RKBA 5EMKA 4Q4HA 4JR0A 4AYTA 5DASA 4EJFA 1POXA 1AU9A 3PDHA 5K09A 4HT3B 2VS1A 3NVDA 3MEQA 4UOQA 2GD0A 4KN6A 1J8DA 1P9NA 1DVRA 1J39A 1HSZA 1NX6A 1QH0A 3C6ZA 4N0EA 1MV8A 1G0NA 1G3IA 4HVAA 2IWRA 3VR5H 2DHQA 2B25A 4UQLA 2C3YA 4X1KB 1GOTA 2HNAA 4UREA 1BYIA 3FNHA 2NU7B 3AVOA 3T1NA 4OYYA 3P32A 4RD3A 3I9V6 2C42A 3U31A 2AQHA 2QTFA 1KO1A 2G4CA 1M2JA 3ETJA 4L7VA 4YRAA 4QUEA 9GPBA 4A1FA 3I0ZA 2H52A 5LSAA 4Y2HA 3GEHA 3TRIA 1IEVA 2QWXA 4YQEA 2XHEA 2RMKA 2QG6A 3ENNA 2O52A 4O4LA 4URHA 4ZEXA 5A9TA 3L07A 4GRAA 5LA6F 1Y0BA 1QPBA 4Y1RA 4XQEA 4QHTA 2JKZA 4MR9B 2R4QA 4XGNA 3V6MA 1PUIA 3D8HA 4K88A 1ULTA 1PJCA 1UBGA 3QMMA 4L4SA 1V41E 1PFYA 2DG2A 1R9MA 4JWTA 4R9RA 2BMJA 1G64A 5FUQA 1ZA2A 3BG5A 1RRPA 2C61A 1VA5A 1DAOA 2FX2A 3CRW1 2QRVA 3DPIA 4MWCA 4J2HA 4DCCA 1GR0A 3WK7A 2FK7A 3AJAA 2GAOA 3CF0A 1ZJ5A 5A05A 2I1WA 2MMCA 2ZRHA 3H0EA 2RD2A 5JQGA 1ECFA 4KHZA 1U28C 2I78A 4P81A 1J06A 1KFCB 4UBKA 1MIOB 2I0FA 3H5AA 2IA5A 2OXIA 5GQSA 3LHSA 1V1RB 1LV7A 4XCXA 1TVCA 1B0UA 1I10A 2P2CA 2B8TA 3C7DB 3KJNA 4X7BA 5EVCA 3UK2A 1H1LA 5CHYA 4ZI7F 5BR7A 1VPDA 4NCXA 5E1MA 4CPDA 3ZJUA 4EGCB 4I50F 3RJ9A 1I4WA 1Q1AA 5KWVA 3G0DA 5G4KB 4NECA 2F8LA 4GM1A 2A59A 1HT1E 4GS5A 2VP2A 1DZ3A 3QYFA 3BWBA 2C96A 1FP7A 1BA3A 2QYHA 1XLVA 2VSYA 2Z57A 1PR5A 1O6ZA 1ZIPA 2PMBA 3B9BA 1UBEA 3O9VA 3UWMA 5FEMA 1Y5NA 2BGWA 3EC1A 5KYYA 1XVAA 4AY6A 5CFLA 4C14A 1TA9A 1BX1A 2CGEA 1V7ZA 1YUMA 3DC2A 2GXUA 3O0TA 4C1BA 1A8IA 2BRUA 4UBOA 2MWMA 3OU7A 2R6AA 2IF2A 3AR2A 3ZE6A 4O4JB 1VLJA 3PNSA 1H8HD 1T1JA 2HD4A 4LYHA 1BH2A 4YAJA 3WGGA 2RHBA 2OBMA 1PK8A 4IFTA 2Q4DA 4KWTA 1A72A 1GSAA 1Q7BA 3U1BA 2ASEA 3L18A 4KWIA 4TT3D 1ZVJA 3CW8X 4D56A 4HFJA 4XCVA 1Z2NX 1XCLA 2QTNA 1VKNA 5TJHA 4NI5A 3PE3A 1RLIA 4OD0A 4DCMA 5JDIA 3NONA 1N2OA 4HYYA 4MCIA 4IQGA 4MW9A 3T9CA 2IVZA 1WEKA 5HIJA 3QY0A 1Y1KE 4GIBA 1KXJA 5T64A 2ZZNA 2OP0A 5AW5A 4BO0A 3V8VA 3CVYA 4CLDA 3HL4A 5G0TA 2BD0A 2QTVA 4QICA 1MLDA 2X4IA 1J1ZA 3O2SB 2OLEA 2GTPA 3I4LA 1FP4A 5LZ8A 3SIXA 3QMWA 1V1JA 4IPTA 2IY8A 1E6UA 4CNQA 5CVDA 3WISA 5CAEA 3D2CA 2EWMA 2JJ1A 3ZW8A 2WABA 2HTFA 2OCBA 1XCJA 3GRPA 3O4JA 1E2GA 1IHDA 5D3MB 4G5FA 3WOHA 1ZSYA 4YCMA 2JA2A 2OPHA 1TEVA 5KSYA 2ZZMA 4NBLA 1Y8RB 1ODTC 4KXMA 2WSBA 4PFQA 5DM4A 4TZ0A 3IR5A 2P2GA 1DAIA 3ELDA 5FTNA 1P2SA 3OIGA 4V2IA 3UYKA 2KMLA 3NYRA 1P7ZA 1AKVA 4O8ZA 3COWA 2X0JA 3U80A 3EULA 5D51S 4JKIA 2A2ZA 2I91A 1YJAA 3GEBA 4P7GA 4I9NA 1VJCA 1Y7IA 5ADWA 2CL7X 1VGRA 3KL4A 1KJNA 3U7HB 3DKVA 3CYFA 2WSYB 3JARA 2V55B 3OE4A 3EXFB 4N3BA 2RKOA 5HRCA 2PRSA 1WZUA 3AEQB 3U56A 3CB4A 1J2YA 4TM8A 1VKJA 4DZTA 1D9ZA 1ZESA 4YRNA 2QYSA 3GH3A 4L7QA 4NEQA 4Q37A 2J9GA 2W4IA 4D8TA 2IS2A 4ZVQA 2ILTA 1PZNA 1PX2A 1WLYA 3UJCA 4MEBA 4G23A 2EZ9A 3CNNA 5D00A 2OD9A 3X1KA 5L4SA 5F2OA 3WGHA 1RI2A 1GPH1 2PKRA 1Q15A 2ANBA 2HXSA 3KQYA 1NJGA 2AW5A 1MDBA 3FHOA 2GN4A 1E2IA 4GUAA 4JVLA 1ILEA 1NXVA 2R00A 5TXGA 3C6KA 5BN3B 4H1TA 2E4ZA 1P0QA 4TKUB 3V5NA 4Y0NA 1T10A 3GEPA 2POCA 1AKWA 4A8TA 2A14A 5L7TA 4BFLA 5ALFA 3DDCA 2BCEA 2J7PD 2XIQA 1YL5A 2NQTA 2XNJA 1SOWA 1RFLA 4D9GA 1K6EA 4HWGA 4DLAA 3A04A 3A4NA 3M6XA 2UUCB 1IPEA 1GQ2A 1AURA 2YWJA 4J0GA 4HRYA 2HV8A 3LSTA 1CK4A 4F21A 1ZHOA 1Q3HA 1OHHD 1Y82A 1FFGA 1MX5A 4FGZA 2CNWA 2NZYA 2WUFA 4GMXA 4H59A 2QMZA 2GPNA 3ZX5A 4F3YA 2RH8A 3L0ZA 2GPAA 3RS3A 1MJGA 5CCEA 1C29B 1PR9A 3NB0A 5KTPA 1LI5A 2Z6QA 1PJ8A 3KFVA 1RYZA 4AY4A 4IJWA 4C5BA 2HU5A 1EFRA 3TOVA 1MO5A 1SQGA 2R7MA 3AKCA 3MTDA 5BORA 5FRDA 3H1FA 4YV1A 3B6KA 3SNKA 4IIDA 4D0LB 3HJTA 4GKKB 2FOLA 4FWBA 1SQSA 2CDNA 1YS4A 1LVHA 3Q5DA 4KQEA 4RZXA 3L1HA 2GBIA 3H86A 4GI7A 2VAWA 4IZ6A 3DV9A 1VLMA 3P0HA 4CL2A 1VSBA 4BPRA 2HU7A 4Y1EA 4EVSA 2OHXA 1UEJA 2OCXA 4Q9LA 3C3XA 1W8IA 1MEOA 1RQGA 2AF3C 5DWDA 3BXZA 4YN3A 4KP7A 4ZVLA 5EMLA 3U2QA 3R9WA 2YRWA 1OZAA 2OFOA 5F51A 4DMHA 5IXYA 1RHKA 2HOQA 4ZAYA 2D3WA 2Y0BA 3EGVA 2WIFA 3PV0A 2ZBFA 3MUNA 4YV2A 3LQ4A 4C0SA 4ER6A 2QRGA 2DXIA 2J87A 4YCJA 4U6SA 2G9ZA 4GI3A 4KYUA 4ECEA 4UEWA 1SHZA 2O14A 4Q3BA 5IH3A 3GLUA 3MSCA 3X43A 2Q5CA 1M2FA 1C7RA 2ONJA 3EGWA 4MARA 2V7QA 3S8MA 3FPFA 2DBYA 2UZ1A 1K6JA 1P7VA 2EEZA 4RH0A 1K8QA 2OHIA 3LY9A 3EDYA 2GEFA 3SEQA 3O93A 1P0PA 5JQWA 1BWRA 4NYMR 4BYMA 1TNDA 3PUXA 3SG0A 1SXJD 3FXAA 2RFLA 4CDMA 5LIPA 3K70C 2FQYA 2IIBA 1UINA 2XJ4A 1CUAA 4KVAA 4QAQA 3SXJA 2HBZA 4MVYA 1V11A 5CTAA 2ZROA 4HB2A 5IKMA 3VH3A 2HM7A 1HQYE 1EP3B 5CP8A 2NTVA 5JDCC 2W6IA 2BEVA 3RVDA 2Q3EA 5ECYA 3TSWA 1PV2A 2CYBA 3MINA 1CIVA 1NF9A 3NDIA 4LJ9A 5IJ0A 1WO8A 5SZKB 4NBWA 1O4WA 4MXDA 5B6IA 4A2QA 4EHIA 3WBJA 3WNQA 4I55B 4XDHA 4OQXA 4BFUA 1QH1A 3OC0A 3HO6A 3N7AA 1PZFA 1DKUA 5E9WA 2CLMB 1EM8A 4ABYA 2ZR8A 1D9XA 3HK2A 1BWSA 1K5GA 1JEDA 3AEUA 3DCYA 4XDZA 4HB4A 4PZ9A 4IL5A 3O03A 3D3WA 4C06A 5HE9A 2UZ4A 1HBJA 1L7NA 3ESYA 4RQBA 4CFZA 1PR3A 4G5QA 1DUSA 1KXZA 2IY9A 3P2KA 4UZEA 1VL5A 2IEBA 4IIFA 2FMFA 3ZWQA 3JQFA 3EUFA 1P0MA 1DWOA 5FPHA 2C07A 1OLSB 2XUQA 3ET4A 1KTVA 4GRDA 4YRLA 2EW1A 2XKAA 3CLUC 1Y7HA 1VGVA 2Q5HA 3L6OO 5AI6A 1ZGHA 3E5NA 3GT7A 3A1DA 3Q9UA 1OV4A 1DOZA 4PLZA 5CCDA 1D7OA 1FEZA 3USZA 4H1WA 1JDBB 2RONA 3W6ZA 3N2KB 2REQB 1T4DA 5AJZA 1N6IA 2QQ5A 4YP9A 5AUOB 2VBGA 3LFUA 5CB0A 2IUSA 1HLPA 3K0FB 4CT4B 3D5EA 4HBZA 2QUKA 1VL1A 3BRCA 1YOVB 4AWXA 1FVXA 1T43A 3TTXA 3RYTC 1OBCA 4YIKA 2RGXA 3EYAA 3G0HA 3BN3A 1E18A 3M2PA 3SC2B 2NGRA 5JRZA 5HKKA 4Q18A 1TCBA 1IZ8A 4HNVA 4LJ6A 5FTMA 4TZTA 1IE3A 1SH7A 4GSYA 3W3AA 4GOLD 1IM8A 1XRQA 3RPEA 1KFBB 4ZDIA 2O3SA 1NU8A 3HY6A 1WZNA 2ZFUA 3CEPB 2AW3A 2B21A 1IWOA 1SU6A 1ZCZA 4L9WA 4BATA 4BRWA 4E5YA 3TO5A 2QNBA 4HAZA 4Z0PA 1ZVQA 4BBPA 5B30A 3RUFA 1UL1X 2PCLA 2WJPA 4CDGA 4RTMA 4EJSA 2RGBA 3C97A 4YNBA 2VK4A 2ZDGA 2GHIA 3QVOA 1C14A 3O5AA 4JP8A 3VZPA 2QLFA 4K8RB 1XRLA 4GOMD 1XMOB 3IAM6 4KWEA 1AQIA 1V5EA 2O48X 1J0EA 4GQAA 5K0FA 4KPYA 1LTKA 3S8YA 1N9ZA 2GPTA 4BB5A 5SICE 2EXXA 4BEWA 1YR6A 4BNZA 3WO1A 1KJ8A 5ALRA 3DAHA 3OLYA 5FNVF 1SVLA 5LJIA 1CJBA 2G0AA 1G21A 3LW7A 5J2UB 3CG4A 1D6MA 1ZC4A 1QTRA 3G85A 4GL4A 4HWRA 4TRNA 3WLSA 5EHZA 5FWYB 4TUYA 2E1PA 3H1TA 3LLMA 4R9SA 1NG1A 3BE4A 1LDGA 1VCOA 4BMZA 4C4ZA 3ANTA 3JY6A 1FFSA 5HYVA 3GT4A 4J0FA 5JADA 1P18A 1P7CA 4XB6B 7AT1A 5T6MA 1LPSA 2HSGA 4BWVA 2W8BA 3IUJA 5JZVA 4P4UA 3BWDD 2O8BA 2ECOA 3D43A 3KUDA 1R3DA 4I4IA 1J0DA 5KTYA 1ZRSA 1XXHA 5BSTA 4BU1A 1NE7A 4QWMA 2ECPA 1QYIA 3WHLA 3UGJA 2EJCA 5L3QB 4S0ZA 2W2TA 5AKYA 1J5EB 4OREX 3O4RA 2FI1A 1SXQA 3KSZO 3VJLA 4B1FA 2HHLA 2BFMA 2FOIA 3NLLA 4M46A 4UMFA 1UKBA 3IBCA 4KN8A 2OV4A 4YXWD 3WO0A 1NZJA 1D2GA 2F8SA 3WTBA 2HT1A 2IOYA 2HMWA 2FFQA 1MG0A 4QT0A 4H1HA 4OSPA 1D4ZA 2OO7A 2YHBA 2ZRBA 1PNTA 3U48A 3D4BA 4BGDA 3KQSA 2R97A 3ITNA 2NPOA 4HL6A 4TXMA 3VC1A 5K20A 1ZM4A 1QR6A 1IQPA 1G7TA 1F4PA 4PXYA 5CM2Z 4OHMA 4MV0A 2Q62A 3HCNA 2IITA 1A9RA 1A97A 1QIIA 4O5OA 5GM1A 3RBAA 4BFTA 4DIDA 1I7SB 2WJIA 5F7OA 3DYIA 4IGAA 4WK6A 4J9UE 2WZDA 1IJEA 4V0KA 2VSOA 3TOZA 1F7VA 1J8QA 3C8ZA 1AKUA 2GCEA 3N76A 4FFWA 1DC8A 3AJ8A 3TEFA 4UULA 3L4EA 1NM5A 3AH8A 3OT1A 1NF2A 5BOSA 2DPLA 1V4BA 1QK3A 4R9UC 4MGEA 2NPFA 3HB1A 2J9ZB 1EYZA 3LP6A 1K8ZB 3OSZA 1V2GA 4LNHA 1Y37A 3R23A 2R0QC 3IVRA 4JVOA 3NCTA 1L8XA 1SMKA 2FX3A 2FZKA 4H3KB 3TS1A 3WRYC 4BMVA 3VR3D 4POAA 1BXGA 3KPWA 5FUBA 1B1AA 3GPIA 5CB4F 1DMSA 3CVOA 2BUAA 3I6YA 3L6RA 3SK0A 3WZLA 1GTZA 3NORA 3BCRA 3ZR4B 1DAHA 1CJSA 3TUZC 3RU9A 1T4CA 1YONA 4B4DA 1YS6A 3M4ZA 5FL3A 2X2EA 1SVKA 3N87A 1YVRA 1OAOC 3BK7A 3U4IA 4BV2A 3OJ0A 4DSNA 4KXNA 4CIYA 3RG2A 1L4MA 3ZLVA 4BL5A 4JLDA 2A7QA 1RS0A 3LBHA 1QXSA 2HIAA 2WAXA 4U0KA 1YZUA 5DLPA 1UC4B 2ZB7A 3FCCA 4I9GA 3UC5A 5GMOA 4DARA 1U0BB 2BFCB 1RWKA 2MSWA 2GHTA 1ISSA 3AHHA 1J07A 2CF6A 1KOJA 2IW1A 3GROA 4R1MA 1A7UA 1MABA 5IAGA 5E9AA 1FSZA 4S1NA 2QE7D 2NO5A 2ODNA 3HA5A 4OCZA 1YCGA 5B4TA 4AMUA 1HR0B 2VF4X 2WVAA 5JTUA 3B2QA 4ZEVA 1IN7A 4AZTA 3GK3A 1QUEA 1ZA1A 3FZQA 2CJWA 4Q6WA 4GXQA 4Q15A 1DT3A 1V9CA 4PLYA 3HDYA 1RLMA 3NR2A 4KUHA 4G0WA 4ER3A 5LD2B 2E87A 3CURA 4H0CA 2YFKA 3IT3A 3VDMA 2ZTLA 4PBSA 3H13A 5KQRA 1ZGCA 5E6SA 2CHFA 4JX9A 3PL5A 3RVPA 3BA6A 1CE8A 1XHLA 1NG9A 1QTQA 2BVNA 4KNVA 4ZVPA 5GVRA 4E31A 1H0KA 1XZ8A 1QHXA 1QRTA 3F78A 2JIZD 1OAAA 2AOTB 4A23A 1HOTA 1KARA 1NQWA 1ZCAA 2OXRA 2Q6OA 3KUXA 4G5RA 4UARA 3R7DA 3URKA 3WIDA 4Z53A 3SJ7A 2OGUA 4W5RA 3GRZA 4UNQA 5ENZA 5IM5A 1K88A 1XZKA 2R8YA 3EBOA 4F9GA 2W6CX 3KE8A 4LY9A 5TQVA 1PZEA 4CEIA 1XJWA 5CBPB 3BM5A 2JHFA 2BC9A 3OEHA 1N9GA 4KYIB 1TPZA 4F46A 1I7NA 4YP6A 4IHJB 3MD0A 5J40A 1KDPA 2OZEA 2PV7A 5FFMA 5DOVA 3RFVA 2O8BB 1R0RE 1WZEA 5KNCA 1SULA 5COBA 2EKQA 4LUCA 1JDPA 2AHRA 3DOFA 2UYYA 4OYRA 3TNLA 4EW6A 2FMKA 1OXBB 3Q3IA 4EG7A 3HBMA 1XZJA 2QMYA 5EJ2A 4LNAA 1U1FA 1ZC3A 3IAXA 5KYVA 3K1YA 4B45A 2XUJA 3VR4H 4EG3A 5C5CA 1KL7A 3A6HA 4CM6A 1XX6A 1K27A 3DMTC 4DUGA 4L50A 3EPLA 5CA1B 3K72B 4BU0A 1E89A 2CXOA 3E8MA 2PMKA 3HFRA 4JC8A 4G0PA 1QFXA 5AVKA 4DBVO 1A88A 3IKTA 2B5VA 3HADA 4C20A 2YWXA 4D43A 1TCAA 3Q4GA 3QNWA 3FF1A 2PUBA 1TZBA 3L8DA 5DM60 1GGEA 4IWXA 1U4NA 3WB9A 3AZOA 4GGPA 4PFJA 3KYIB 2GSDA 3RFFA 5JVDA 4YJ2A 4ROSA 4B6JA 4WKPA 1RQNA 1H2XA 1GTVA 2PX6A 3DTVD 1N0WA 2BY4A 3HQ4O 3UHPA 4BCCA 2NAFA 3A06A 3ELUA 2CUTA 2Q4OA 2V3VA 3ECSA 3J80A 1M6VA 2DFTA 3MHPA 1LW6E 3HR8A 4AK9A 5KTSA 1XNHA 2VJCA 2QN9A 5CJPA 3V8QA 2SCUB 3KQKA 2QTZA 4Q1AA 2UUAB 3E4DA 4IQFA 4MNTA 2I7XA 4MW0A 1BWQA 5AICA 1OBFO 4WXRA 4MEAA 3EEFA 3VNQA 2V4MA 1VQ1A 3GQBA 3PT5A 4E32A 1SC3A 1CZUA 1B7GO 5FHQA 2XKKA 3AR8A 1QE3A 3UJNA 3OEED 1TT7A 1NKVA 3QPWA 521PA 1HWYA 2LUOA 5JWHA 2WU3A 1XEXB 2N0SA 3S2IA 2C7QA 1CUHA 3KZOA 1N4DA 4V1CI 1XZEA 3TSYA 3V1TC 3UM9A 4Z2AA 4LFBB 1CUVA 2L42A 1SBQA 1AGXA 5HW0A 1QB8A 4KOEC 2G5PA 4LKOA 3U9LA 1NVFA 3KXDA 1FRZA 1IBLB 3HG7A 4FFNA 3I62A 1XQYA 1VL6A 1SKBA 5GWXA 1OIWA 4RY2A 2GCPA 3N59A 2FUG1 2JGLA 3ZE7A 3U3MA 2A86A 2IYRA 3OI7A 3VTFA 4YQYA 4LVCA 4KHPB 1YUBA 5FI0B 3TNYA 4PYNA 3S2GA 1DFGA 5H80A 1KU6A 2NXJA 2XMSA 2OGWA 4GL2A 1QHYA 3U17A 3GCZA 1DBSA 3T3MB 4BEJA 2AMFA 4UDNA 2X8JB 3PA6A 4QA9A 4BQOA 1PWZA 2H9YA 4YA6A 1IK6A 3JQAB 3UV3A 4ZD6A 4DDTA 3P0EA 2PUDA 3U4GA 2YJ5A