4IMRA

Crystal structure of 3-oxoacyl (acyl-carrier-protein) reductase (target efi-506442) from agrobacterium tumefaciens c58 with nadp bound
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
258
structure length
258
Chain Sequence
LYFQSMRLETIFGLRGRTALVTGSSRGIGAAIAEGLAGAGAHVILHGVKPGSTAAVQQRIIASGGTAQELAGDLSEAGAGTDLIERAEAIAPVDILVINASAQINATLSALTPNDLAFQLAVNLGSTVDMLQSALPKMVARKWGRVVSIGSINQLRPKSVVTAYAATKAAQHNLIQSQARDFAGDNVLLNTLAPGLVDTDRNADRRAQDPEGWDEYVRTLNWMGRAGRPEEMVGAALFLASEACSFMTGETIFLTGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Crystal Structure of 3-Oxoacyl (Acyl-Carrier-Protein) Reductase Atu5465 from Agrobacterium Tumefaciens
rcsb
source organism Agrobacterium fabrum
total genus 99
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4imrA00
4JXKA 2GZ3A 4CM1A 4QT0A 4NI5A 3MCVA 2QZZA 2JFFA 4K9DA 1CERA 3RFXA 3ZNQA 2J8ZA 3LVFO 2AW5A 2X58A 1C1DB 4IBOA 1QV6A 4BO6A 3VH3A 4N5MA 1GU7A 2GCGA 3H3JA 1VI2A 1VPDA 4FC7A 1PZGA 5KJ6A 5ILGA 1KVQA 4IDGA 3HDJA 4NK5A 2QZ9A 1DB3A 4CV2A 3GEMA 1AE1A 3IP1A 4XGNA 3KSZO 4BMVA 2WTBA 4A03A 3TZHA 3PK0A 1BVUA 1EEHA 3PI7A 1EVJA 5JDIC 1YB5A 2BELA 4LGVA 3OJ0A 1HLPA 4CMEA 4EUFA 5CP8A 3VH4A 4LSMA 4D0RA 3OFSA 1CQJA 1LRJA 3C85A 2XF8A 4R54A 3HADA 3JQFA 1XIVA 1E1NA 5DCUA 2WEKA 3SBOA 2VHYA 1YS4A 4RVSA 3WYEA 3HZZA 4I9UA 1FDUA 5KOIA 4RPGA 3ROQA 3C8MA 3TQHA 2VCYA 1XHLA 3K2BA 3WICA 4IGEA 1DIRA 4CQMB 3KSUA 3ZU2A 4EW6A 4U5QA 4EJMA 2HQ1A 3LSYA 3MJSA 2B35A 2P9CA 2FPGA 3GEDA 4ROSA 4WOKA 1ZXLA 1P31A 4TZKA 2OXIA 3DTTA 3RFVA 3Q9UA 1QYWA 2EV9A 2R6JA 3EYWA 4FD3A 4GKVA 2ZJ1A 3P2OA 1NX6A 1N7HA 3SC4A 5COAA 4YQZA 2OO5A 4B4WA 3ZHXA 4A7PA 5CEEA 4D45A 2EKLA 1N8KA 4FC6A 1P3DA 5JAMA 1HEUA 3Q11A 3V2GA 3P7MA 3KXDA 3EHEA 2W2LA 3HNPA 1EVIA 2RH8A 2BH9A 3C1TA 4BNHA 3BTOA 1KIFA 3DOCA 2Y1DA 4PN3A 4FIZA 4CMGA 1X7HA 2OHXA 1EBFA 5COBA 5T8KC 1NHGA 3VZRA 2CNBA 2NTVA 4FR5A 3ANLA 4WUVA 3DHYA 4B8WA 5C7LO 4OMUA 4CM8B 1YBAA 3GA0A 4NIMA 4RCVA 3Q2KA 4JJFA 3RBZA 3WGYA 3D3EA 4I5FA 1UP6A 1YL6A 3JQGB 1M6HA 2NNLD 1C1DA 3GVIA 2FHSA 3C7CB 2HJRA 1NVMB 2ZQYA 5EERA 4D79A 2PZLA 1WWKA 3SEFA 5C5IA 2O50A 3V1TC 1Y7TA 1Q0LA 2E49A 4GWKA 3O03A 4YJGB 1K6XA 3JQEA 1P33A 3ZWNA 3D3WB 1I2CA 2VUTA 4XX0A 1KY4A 3NDIA 1ISFA 5KVVA 1B15A 1NVGA 4R69A 3DZBA 5J23A 4JJGA 4P22A 3FHLA 1WPQA 1ZO8A 3NDJA 4I1IA 1HE5A 4YB8A 5F1OA 1CRWG 2X0RA 4XRGA 4FQ8A 1JDJA 3ONDA 2CDBA 4BMSA 5BNIA 4DGSA 1TVEA 2X9VA 5A3VA 1ML3A 1XG5A 3JD4A 1NTOA 1SB8A 1AXGA 2PKQP 2X5JO 4CQMA 5IXSA 3PJGA 5GY7A 4AJ2A 3AFNA 1Q0HA 5F5NA 4DUPA 2RAFA 4ZRMA 3P19A 1HF3A 2AEJA 2YFHA 4I5GA 4R5HA 2A35A 4WCFB 3DFZA 3GN1A 5KVQA 2NSDA 3TWOA 4PLCA 1TA4A 4K6CA 4BO4A 3F46A 4BO3A 1I01A 3RFTA 5KWEA 4CL3A 1ZK0A 3PHJA 3NX4A 2WSBA 4CUKA 2JAHA 5EN4A 2WDZA 5A1TA 1PU2A 3F4BA 1PJQA 1ISGA 1VJTA 1IY8A 5AXBA 5U9CA 3WLFA 3FR8A 3QP9A 5G0SA 1K89A 1BHSA 1NPYA 2C2YA 3ADPA 4RF4A 5JAQA 3VDQA 4ILKA 2V65A 1KVSA 5T5QA 3ZWYA 3E6AA 3G79A 3WX0A 1E3JA 1QORA 2FSSA 3INTA 3BMNB 4DL9A 2O4CA 4J6FA 1DHRA 4CM8A 2JHGA 3AM3A 4WK6A 1BSVA 4E32A 2GZ2A 4AJ1A 2NVWA 3JQGA 4OSPA 3MJTA 4CODB 2DTXA 3TZ6A 3ZHYA 1OBFO 4BGEA 2GSDA 4XYMA 3ZDFA 4BOYA 5A02A 2ZCVA 3JYLA 2GNAA 4RVGA 2AEFA 4BL5A 1PS9A 3OJFA 4QECA 1P0CA 3ETEA 3L0DA 5CG1A 4JBIA 4DQUA 1G1AA 5IDWA 3VKVA 1H5QA 3PFWO 1V3UA 2C5EA 4OOFA 1LX6A 4FFLA 2DQ4A 3I3OA 4YJGA 3IS3A 2G82A 1N92A 3EK2A 2CD9A 3GK3A 3I6QA 3L4BA 3D3WA 1N7GA 4RQUA 1E3LA 1TLTA 4NZ9A 2JL1A 2O3TA 1YGYA 2PK3A 3PDUA 2WD8A 5IXYA 4YRAA 1RJWA 4DC0A 2VQ3A 3EZYA 3BIOA 4KWIA 1DRWA 1X0XA 1NBOA 3WJAA 1KVUA 5DBIA 4M1QA 1ZK1A 4IQGA 3VKUA 5ES3A 5JY1A 4DXHA 2ZYAA 4OYRA 4R68A 1UXJA 2IZZA 4PLHA 5H82A 1XU7A 5BSHA 4O6VA 2WWRA 4AJKA 2VYVD 2Q1WA 3VPHA 4KDEA 5LC1A 1NPDA 3B6ZA 3K5PA 3U0BA 2BGKA 2Y66A 3WBFA 4N18A 3U09A 1PJ3A 2YZ7A 4WCFA 4XDZA 5F1PA 2W90A 2ZB7A 1YB1A 3RIHA 2V6FA 2GN9A 1T1RA 4G5HA 8ADHA 1LSUA 1EFLA 4UEKA 5AXCA 1D3AA 4Y67A 4QEDA 3WTCA 3DC2A 2JJYA 4KQWA 3HDYA 4FN4A 3Q2IA 5JNLA 3DAGA 5AOVA 4YTEA 4CLRB 5L40A 1YDEA 1GZ6A 3QIVA 1IL0A 1E5QA 3AM4A 4IY1A 2UYYA 4RF3A 3ZNNA 2BD0A 3CEAA 2HUNA 3WGOA 1CDOA 4BNXA 4HNHA 3ZNOA 1B3BA 3KZVA 3NT2A 4L76A 4KZPA 5A03A 4MVJD 3C1AA 4JP2A 4IZHA 4L4SA 3K2EA 1JAYA 4QXMA 3ZHZA 4J9UE 1ZEJA 2C0CA 4XYGA 5U4QA 1Y6JA 3FNEA 4U6SA 1DJQA 2Y0EA 1MXHA 3WDSA 5B4UA 1GCUA 3PWKA 3WNQA 5HTOA 2VRBA 2Q49A 2G1UA 4EUEA 5ICMA 1A72A 4E5YA 3OBBA 1X13A 1BW9B 4L9RA 3OIDA 4TRMA 1AUPA 2DM6A 5B37A 5T67A 4NG5A 3JQBA 1JKFA 1GV0A 4NMHA 3FTNA 4GX2A 3FNHA 2AQHA 1EUCA 4F6CA 1GYQA 5C7OO 1ZH8A 3DZHA 3LDHA 3GR6A 2G17A 4YWJA 3HJAA 3FN4A 4TRNA 4UEJA 2CZCA 2R2GA 4EI2A 3LT4A 4XIYA 4HV4A 3A28A 2YV3A 3VPGA 1VKOA 3PQDA 3KO8A 1ZK2A 1GY8A 2ZJ0A 2IE0A 1UUFA 2AE1A 1QYXA 4UVHA 1X7DA 1LEHA 3RI3A 3Q6IA 3I83A 1JN0A 3GDOA 3KUXA 4W4TA 4MVJH 5JO0A 2D59A 3HDQA 2YDXA 3KEOA 4LRTB 3TDKA 4ID9A 1EK5A 4CMBA 4EJ6A 5TGDA 2X23A 3RUDA 3UCXA 2TMDA 4R1SA 3JQAD 2IYOA 4A26A 2Y0CA 2G76A 2GASA 5L95A 3CE6A 5IN4A 5DULA 1W6UA 3AUUA 4WLUA 3QWFA 3JQ9A 2QX7A 1DOHA 3PYMA 1DDOA 4J1TA 4DREA 4B4UA 3LLSA 2EP7A 1M67A 4CLRA 3L6DA 3I9KA 2HLPA 4YBZA 1BDMA 3O8QB 3EVTA 1ZKMA 2D1YA 4W99A 3NEPX 1A27A 4EGFA 5CEJA 4A10A 2JCXA 1PSDA 4Z6KA 3FR7A 3EY4A 4BKQA 2ZTVA 4YJFB 3UCEA 1G6KA 3NYWA 1K6JA 2IZ1A 4LN1A 1LTHR 1IHYA 1EQUA 4L73A 3PZBA 2FR1A 2I65A 1Q7GA 1TT5B 3N7UA 3ITKA 4R1NA 5GZ6A 4DPLA 4OL9A 1A7KA 2OFPA 2Q2VA 4AJIA 4BNYA 1UAYA 2Q45A 2PR2A 1QLJA 7ADHA 1U5CA 1X7GA 3ZV4A 2J3KA 3OF2A 2DPHA 1O5IA 1Z82A 1ISHA 4CUJA 3ANNA 1I3NA 2I6TA 3DMYA 3EC7A 2NU8A 3WBBA 1BW9A 4HWKA 5COQA 4CL8A 4BO2A 5AQ1A 3IJPA 4F3YA 1HDYA 3PJEA 4UAGA 1DC5A 1P1KA 3ICPA 3WGQA 5EQDA 3AWDA 4FGSA 5TSDA 1MGOA 1A4UA 1A7AA 1DIBA 3KOUA 1EMDA 4ZD6A 3KB6A 1H94A 1NNUA 1ZXBA 3ONEA 2BFAA 3WFIA 4O5OA 3H9JA 4CMCA 3RUEA 2X8LA 4CV0A 1QYVA 3GHYA 4RV9A 2AE2A 4LSWA 4ALIA 4CM4B 3DB2A 4FPXA 4IZIA 4ZU3A 3WWZA 3EW7A 4GAEA 1GQQA 1V9LA 2HMUA 2PNFA 4QO8A 1L7EA 1R6DA 4CM9A 5THKA 4RZHA 4HXYA 4RJTA 2VWPA 2NQTA 2JFHA 1HLDA 3WIDA 1ZW1A 3GNTA 3KBOA 3PPIA 1ISIA 3QW2A 3LF1A 1LBEA 4U7WA 3PYXA 3BYZA 3GEGA 3ZCXA 3ZWXA 1ENPA 2Q4BA 4RQTA 4NU6A 3X2FA 1P1JA 4MP8A 2VRCA 3DONA 1J5PA 1YBMA 2F1KA 3O8QA 5JY6A 4RF2A 3QSGA 2BMAA 2C59A 3KHUA 4OXYA 1LRLA 1DIHA 1T4BA 3I9LA 3EGOA 1PWXA 4YJFA 3WQRA 2PLAA 1HSOA 3D4OA 4IGFA 1R4MB 2X22A 2G0TA 3PFFA 1B14A 4HUJA 4PVCA 3TSCA 1GUFA 1L7DA 2X5OA 5KCZA 2B5WA 2J3HA 3JCZA 1R0KA 1JKIA 2ZYDA 4EEXA 1D1SA 3FPLA 3VTZA 2CVQA 1TT5A 2P5YA 4WPGA 2AQ8A 3EDMA 3H9GA 5B4VA 1LSOA 2J5QA 3MOGA 4W9NC 3W4JA 3OIGA 1NFRA 4M89A 2PD6A 4RPLA 1WZEA 3OMLA 3RU7A 1R15A 1UXHA 1EE9A 1RKXA 3N74A 1GQ2A 1GL3A 3H9EO 3NRCA 3RC1A 3C24A 2FZEA 4HP8A 4I5DA 1WDMA 1YB4A 4G2NA 4YRBA 3LK7A 7MDHA 1F8FA 3M6IA 1WLYA 5BNFA 3UKOA 4CLEA 2IYPA 1ARZA 2B69A 1QRRA 5FF9A 2X0IA 5DBFA 1J0XO 3PTZA 1O6ZA 4BGVA 3MTJA 1PQUA 3E1KA 3NJ4A 1SO8A 1JWBB 4GKBA 4TMFA 2VHWA 2RHRA 5JYDA 2Y99A 3HG7A 2PH3A 2PKQO 2NU7A 1IOLA 4E2WA 3UUWA 3SC6A 3UH1A 3K73O 5L7WA 3R1IA 1JA9A 3DXFA 4HFJA 4CM4A 2Q4EA 3LYLA 3GT0A 1P1HA 3HN7A 4JNKA 2HMWA 3V1UA 2GN6A 3I9OA 3JQDA 3PEFA 1LSSA 1IE3A 4GMFA 1HZJA 3RCBA 1EDOA 5F21A 4D43A 3D5TA 4URFA 2ZB8A 3JYOA 3RC9A 4M54A 4IJKA 5DCYA 4TKMA 3R6DA 2WYVA 1HWYA 4CMEC 3BZUA 1E6WA 3AU8A 4U0JA 3JSAA 1JAXA 3V2UA 3WXBA 1Z73A 3IL2A 3MEQA 3BTUA 2AG8A 5A3JA 1Z7BA 1DJNA 2GDZA 4R9SA 3WGHA 2W98A 4RVUA 5KJCA 2D4AA 1NXQA 1U7TA 1CEQA 3OEWA 3VVBA 1ZJZA 4P4LA 1HDOA 2P9EA 4IMPA 2H5LA 4MKRA 1M75A 3K92A 4E31A 4RF5A 2GR9A 1R4MA 3AU9A 1H6BA 1JVBA 2FPIA 4LCEA 2P5UA 4PLZA 4IDEA 2VWQA 1N2SA 4NU5A 1E3IA 3VZPA 5EJ2A 4GX1A 1Y5RA 5KJEA 5L51A 4C4OA 1LLDA 5FEUA 2Y1FA 1PEDA 1Q1NA 1RM0A 2EERA 2QYSA 3NTOA 4LMRA 3H9UA 4BNMA 1R0LA 1HE4A 3B1JA 5JMPA 1IZ9A 1ZMTA 3LC1O 2OZPA 1VLLA 1DSSG 1U3WA 2EGGA 1B3RA 3L9WA 3IIEA 1H9BA 4O59O 1O95A 2UAGA 1C3VA 4R1TA 1U7HA 5IAAA 1X1EA 2DPGA 4AJHA 4AJLA 4L4XA 4ND3A 3SLKA 5I7FA 3RUHA 3HQ4O 3IKVA 1F12A 1SC6A 3I52A 3PYLA 3W8FA 2XPCA 1SEVA 2UVDA 4J9VA 3C7AA 2IXAA 4PLFA 5ITWA 4PRKA 4H15A 4NBRA 3VHRA 4EEZA 4CPDA 2NV6A 2RH4A 3ZI0A 3PQEA 4MDHA 3U5TA 3SXPA 3BAZA 4YPOA 4BVAA 4Q3NA 2VOEA 3A1NA 1F14A 4FFOA 5BSEA 1L1FA 3VOSA 2I3AA 4B8ZA 4YT2A 2DFVA 5ADHA 1LSJA 1ONPA 1YBVA 1FDTA 3AJRA 3CMCO 3RAJA 3UCFA 4B4OA 2B83A 3FNFA 1NQAO 3TJRA 4UUMA 1AN9A 3E82A 2PV7A 5ENDA 4NJOA 2PTGA 3WMWA 5F5LA 2QHXA 2DTEA 3JTMA 4MIYA 2OBNA 1OC2A 3VZSA 2IEBA 3GGPA 3I4FA 2HU2A 4KP7A 1HE2A 4RPHA 1BXZA 2NVBA 4WJZA 5HBRA 1EVZA 2O48X 1I8TA 2HK8A 4DRYA 3WGIA 3TF5A 4XQCA 2AEMA 4Y98A 3PZRA 1E3SA 2EXXA 1KEWA 2C82A 2EF1A 2ILTA 1LA2A 1WAMA 4AJOA 1VC2A 5CAEA 5ITVA 2JAPA 5I8ZA 1SB9A 3TFOA 3IUSA 3RJ9A 4YT5A 1UH5A 4JP3A 3WWYA 1SMKA 1HDXA 4HFRA 2Z1NA 3NUGA 3OA0A 2DT5A 4HFNA 5FI5A 3JV7A 3CINA 3BHJA 3INGA 4BNTA 4FFNA 1I0ZA 1T24A 2HO5A 3ZV3A 4PZDA 4J7UA 2X0JA 3GNSA 4J90A 1PGQA 2BGLA 4UVGA 3GRKA 2Q2QA 4ND5A 1M76A 4J43A 1VSVA 1XELA 4XQEA 4PG4A 4XWYA 5DOVA 1LC3A 2HAEA 3DWFA 5EQFA 5CEFA 4N5NA 3BA1A 4YRDA 2NU6A 4MVJM 2GUGA 3ICCA 4E4YA 3H6KA 3ZWAA 3WGZA 4S1VA 3DZJA 4RVFA 4PG8A 4A27A 4KUHA 1ZFNA 4CV3A 2X4GA 1HRDA 2SCUA 2WM3A 1X14A 3C3XA 4BO7A 3E03A 3DHNA 3H5AA 4MIOA 3GNQA 3FWNA 2NLOA 4E33A 3LU1A 1ENZA 4QO7A 4LRSB 4EZBA 4Z3KA 3RC7A 2HMTA 1KETA 3DOOA 1UZLA 1E5LA 1KVTA 1LLQA 4FSHA 5I7EA 1PZFA 2VOJA 4J1NA 4D7AA 3F5QA 4XB1A 1XQ6A 4Z9XA 2ZB3A 1XEAA 1MG0A 4JQCA 1PR9A 1LDEA 3IMFA 4CLHA 1T26A 1UAGA 3R0IA 4NH4A 4UVDA 4FFMA 2QYTA 4MINA 5JCJA 3KTDA 2V7PA 1H6DA 1I3MA 4ALMA 2P91A 4MVJF 1Y5MA 1Y8RB 4QX6A 1UDBA 2B36A 3L4BC 4DTIA 3DL2A 1DC4A 2PWZA 4MP3A 2VTEA 1P44A 2Z1MA 3DZGA 3OHSX 3H8VA 3OP4A 4BNLA 4L75A 4PFJA 5BQFA 2P4QA 1DPGA 4PZEA 3UFXA 1YJQA 2DFDA 2FZWA 2PKRA 1HE3A 2O7SA 2B4QA 4OXKA 3Q0EA 4XQGA 4TKLA 1PR3A 3TZQA 3JYPA 3KLPX 3I1JA 4JIGA 4DYDA 2H63A 3BMQB 2JKVA 4BKPA 2JD1A 2HRBA 3RVDA 3VH1A 9LDBA 2OBYA 3WGGA 4GSKA 4DBVO 3TFQA 4GLOA 4GLLA 4IXWA 3W6UA 1GYPA 1F06A 5FYDA 4QFCA 3NTQA 1YXMA 2CF6A 4E5NA 4KUGA 1DC3A 4WCFC 4WLOA 2D0IA 5IZCA 4WLNA 1ZJYA 1DBVO 4XJSA 1Z45A 4DBZA 3B20A 3WS7A 2CVZA 2B5VA 1YVEI 4R41A 1JKJA 4IDAA 3PJFA 4YAEA 3AI1A 5JDCA 4XDYA 5CDTA 1B7GO 2X9GA 3HHPA 1SOWA 4IQ0A 4W7IA 4BKUA 2VYNA 3PHLA 3TOXA 3ASUA 3K8ZA 4BNZA 5JCXA 2W2LD 1QYCA 4YAKA 5I9LA 4FS3A 4A5OA 3AUTA 5C3MA 4FJ2A 1PGPA 3E9MA 3GVPA 2DBRA 1JLLA 4G81A 4C7KA 4QTZA 1EUDA 4E6PA 2PZMA 3R3SA 3DBHB 3QRWA 1DLJA 1PJ4A 4IINA 5JLAA 3E9NA 1U3VA 2GD1O 1XSEA 1N1EA 4TSKA 1DAOA 1TEHA 5CPFA 4DQXA 3Q3CA 1EUZA 5DF1A 5IDQA 3KETA 4AG3A 5FI3A 3QHAA 1G0NA 1LLCA 2J6IA 4ONEA 3JQBC 2GLXA 5EIOA 1BRMA 3ORFA 4BO9A 1O89A 2ZB4A 1Y8RA 1YJ8A 5FWNA 5A5EA 3JQCA 2FR0A 3Q9NA 4E30A 4NFSA 2GRAA 2VN8A 1PJ2A 5L3ZA 2DUWA 1NR1A 5TS3A 3DEYX 2WD7B 4OKIA 4DIBA 4ALKA 3QJ5A 1FDWA 3T4EA 1RYEA 3VC7A 3FI9A 4BNVA 4J4TA 4J4HA 2AMFA 3BMQA 3ZWOA 3AY7A 3DZKA 4JK3A 1LDGA 4Q3CA 2ZQZA 2EHDA 3LT1A 4XYLA 4XR4A 4PLVA 2O3UA 4PVDA 5C7IO 1MFPA 1T2DA 4CQMD 4GBJA 2X6TA 3UGKA 3ZU4A 4CMIB 5IN5A 2QG4A 5AYVA 2QRJA 1ENOA 2OP1A 3TN7A 4GL4A 1GFSA 5JE8A 5KKAA 3BMNA 2CF5A 3JQ9C 2IDZA 3ZW9A 3I9JA 1C0PA 2D5CA 1LNQA 1PZHA 3H5NA 1ADFA 4BQRA 4HADA 5I9MA 3KYCB 1QR6A 2O23A 1BXGB 1Y81A 3B1FA 2FOIA 3CZMA 1NYTA 2I3GA 3QLJA 4MPDA 4OSOA 3ULKA 1I30A 4II3A 4DLLA 1RPNA 1E77A 3G49A 5GZ1A 2Q99A 1V3TA 4Y6PA 1Z74A 3QWHA 4B79A 2NUAA 2Y1GA 2HJSA 3S1LA 2EG9A 1BTOA 4QUKA 5TRTA 2P2SA 4XIJA 3TRIA 3WNVA 3OM9A 3AOEA 4PLTA 5FFFA 1EQ2A 4P8RA 3DBHA 3GMDA 3S8MA 4AJNA 3CH6A 4Z0TA 3IC5A 1HYGA 4Q3DA 1IZ0A 4WASA 1KERA 2XAAA 1UP4A 1NAIA 1IPEA 1PL7A 2POQX 1PIWA 3CIFA 2VT2A 3SVTA 4OO3A 4EJ0A 1ISJA 4JGBA 2Q1UA 4YA6A 3TL3A 5DNAA 3QQPA 1XR3A 1ZMOA 2WMDA 4W82A 4U6QA 1NVTA 4QSMA 2X9NA 1T2FA 5A05A 3L07A 2R00A 4WGGA 1MFZA 3OH8A 3ZGYA 2WD7A 5JPIA 2DUUA 4NBWA 4ZN6A 4UUPA 4HX5A 5F1KA 3ZWMA 1XU9A 3H65A 4J4BA 2C7GA 3ON5A 2BI8A 5DCWA 4CJXA 4K26A 5TIIA 3KVOA 3PXXA 2Y1CA 4DLAA 2Y1OA 1GEGA 3ETDA 2C5AA 1C0IA 1FDVA 2E48A 2Q3EA 5JC1A 3AI3A 3RUFA 4BB6A 2DTDA 1NASA 1CYDA 4R1UA 4YCAA 2UV8A 1ZK3A 4CMIA 1D8AA 1F8GA 2EGHA 1ULSA 3F1KA 4W7HA 5G0TA 4DYVA 4BV9A 3GVCA 1TB4A 4KWHA 2RCYA 4E3ZA 3BMOB 2OORA 1C1XB 3VH2A 1M66A 1OFGA 4RVDA 2D5AA 1TI7A 5IDYA 4ND2A 1U28A 4DQVA 1E7SA 1I5RA 4IS3A 4BNKA 3KYCA 5B12A 4J2OA 1BXGA 1I3LA 3OETA 2YQ4A 4CLDA 4D42A 1MV8A 4ZJUA 2VTDA 1YQDA 5T6BA 5HM8A 3GUYA 3RD5A 4MO2A 3ANMA 5BR7A 2YY7A 4I9NA 4B7CA 1GZ3A 2VWHA 1DEHA 4OAQA 5KJ1A 1MP0A 1MLDA 3VVCA 3K96A 1H93A 3G1TA 4LCJA 1KEVA 2O3QA 2OUIA 4E21A 1P74A 2CMDA 3ETGA 4UVIA 5KVSA 1PL8A 3MJ4A 4YAGA 4GGOA 1P9LA 1WMAA 3INRA 4GX0A 1KYQA 2ET6A 1Q7CA 3QVWA 3TZCA 1D1TA 4DA9A 1KEPA 1XYGA 4ZQHA 4RDHA 3JD2A 9LDTA 4GWGA 1Y9AA 1AHIA 5JXWA 4CR7A 3IUPA 3OEYA 3JQ7B 5JAIA 3GGGA 1PS0A 3F6YA 1J4AA 2A4KA 4NNJA 3AM5A 1MUUA 1ZSNA 3S55A 3NGXA 5K6AA 3AOGA 1ZEMA 3PRJA 2QRKA 4WEOA 5DP2A 3FD8A 1SZJG 2XXJA 4W6ZA 1OMOA 1VL0A 1T2EA 1PGJA 2IODA 3WQSB 4RDIA 3VTFA 4CMJA 1Z75A 3A4VA 2QIOA 4GH5A 4EUHA 1U2DA 2H6EA 3JYQA 1E7WA 1XLTA 2JCYA 5IJZA 2WE7A 2JCVA 2I66A 2NTNA 3RUCA 3F4LA 1B8UA 4CR8A 2Z95A 2XOXA 3AY6A 3IJRA 2NU9A 1XDWA 3CMMA 1ZIDA 1UXIA 5C37A 1E7MA 4XGKA 4B7XA 3OJOA 3FWZA 1FF9A 2OL4A 5LDGA 1IUKA 3GY0A 4MKXA 4AJEA 2P68A 1D7OA 1HDGO 2E4AA 3NAQA 2GPTA 3WB9A 4ALJA 1UXKA 2VNSA 3ZNPA 4H16A 2IEDA 4JX8A 1YL5A 2P9GA 3BMOA 1C1XA 3PWSA 1NR7A 2W4QA 4EBFA 3ZH2A 1XQ1A 4UVEA 1HKUA 2JHFA 3JQ6A 2D8AA 4JBGA 4PLGA 4FOSA 2ZIZA 1A9YA 2I76A 1DXYA 4CM3A 2OGUA 5L45A 3U9LA 4MVJE 4AICA 1I3KA 2ZCUA 4LISA 1WP4A 1UP7A 4XCVA 5ICSA 4TWRA 1PJSA 1K2WA 1RWBA 1IPFA 3H3FA 4RZIA 4Z9YA 1TXGA 2J5RA 1C14A 2J3IA 3GDFA 4RPJA 2BF7A 3B1KA 1U1IA 3AFMA 2Y67A 1Q7BA 1I10A 1VL8A 2P4HX 3DZFA 3GGOA 3ZWPA 3QVOA 3LT2A 5I7SA 1I33A 5KVCA 4E13A 3QWAA 4RVHA 1VJ0A 1AXEA 3NV9A 5F3RA 3PGXA 2CY0A 4K28A 5IG2A 4J0EA 1DLIA 2TMGA 2A92A 1MXFA 4FCCA 2DLDA 2BHLA 3I6IA 3HFSA 1UXGA 3ITDA 4BB5A 3UHAA 4LVCA 2YQ5A 1VE9A 3JQ7A 3L77A 2GZ1A 4ITUA 1W0CA 2BKAA 3RU9A 3RBVA 3DOJA 4YVFA 4J7XA 3K30A 3ROKA 5IF3A 1JWAB 2C2XA 3CSDA 4FFPA 1SEPA 1NFFA 4XYEA 5ENVA 5JYEA 3QVSA 1YE3A 4YXFA 4Y6SA 3ZHBA 2NADA 3IDSA 5ER6A 2BRUA 2O7QA 3B70A 3ZWCA 1E7QA 1XCBA 3DAFA 4LK3A 4S3MA 3GN2A 1PS8A 4GQAA 5EL0A 3UAGA 3FPCA 2EKQA 1IULA 1U4SA 1FXSA 1ADGA 2I9PA 3W1VA 1KS9A 1QXSA 2FY8A 4NHEA 2Q46A 4ALNA 5H83A 4F6LA 2VUSA 3WFJA 4BGUA 4C7JA 1B0AA 1DRVA 1GTMA 2AQKA 2DBVO 2W8ZA 3NJ8A 2YHUA 2FMUA 1KY5A 4J49A 4BNWA 5DP1A 3HUDA 3E18A 1XWFA 4YT4A 2D3TA 2Z5LA 4CM9D 2HSDA 3QWIA 1ZZEA 4O0LA 4TROA 2H9IA 2O3RA 1HZZA 1DRUA 4X54A 4UULA 4WKGA 5KTKA 2J5KA 4LW8A 3GPIA 5L7TA 4IIVA 3FNGA 5GMOA 2G5CA 1HSZA 2ZATA 2O3JA 2DAPA 3WGTA 2UUPA 2X5KO 3DBVO 1BMDA 4ZVVA 3ZN2A 2PGLA 3DBLB 1YOVB 1ULUA 1SNYA 2VRCD 3PHGA 4ZRNA 4MVJI 2Y93A 2WE8A 1RYDA 3HSKA 4FB5A 2QQ5A 3U4DA 1ZK4A 4PG7A 3LC2O 4GMGA 4R01A 3WQQA 3NTRA 2WYUA 4BIIA 2RBEA 1ZBQA 1LDYA 1GV1A 2FWMX 3BHIA 3CTMA 1NPTO 4IJWA 3LZ6A 4Y6RA 1J6UA 4GGPA 4DLBA 3JD3A 1I32A 1FDSA 4DIOA 1U2GA 2PGJA 3W6ZA 3QY9A 1B16A 1QP8A 3OICA 4XGIA 5GZ3A 1YWGO 1H2HA 1U8XX 4L8VA 2YV2A 5KJFA 1E1KA 3PGJA 4JBHA 3T7CA 3U62A 4MP6A 3RUAA 3TNLA 1E6UA 1PGNA 3V1YA 5A4DA 1G0OA 1E6EA 1EFKA 2OOSA 2Q50A 2E37A 3GC6A 4ZHSA 3H9QA 2E82A 3GFGA 4PLWA 4YACA 2DVMA 2EKPA 3I5MA 4H3VA 1U3TA 1BGVA 4KUEA 2DBZA 1P1IA 4WE3A 1N1GA 4Q3EA 4BO5A 5KNLA 4IPTA 1UR5A 4AJJA 1HYEA 1O8CA 3S2GA 4DMMA 4XRRA 4CQLB 1NWCA 1GDHA 1VL6A 4HY3A 2YHIB 1E3WB 1PJLA 4ZGWA 1DFIA 1VRWA 2NM0A 3BMCB 4QFDA 4OGWA 4CUZA 2A9FA 2DU8A 4HBGA 4J3FA 2NWQA 2X7HA 1UJMA 1ZSVA 4M49A 4P38A 1ZCJA 1TT7A 5HS4A 2CFCA 3RJ5A 3GOHA 2BLLA 4D46A 3VAZA 1GR0A 3ENKA 3D4PA 5CDUA 1PGOA 1RM3A 3W8DA 4YJDA 5T57A 3DBLA 1YOVA 1PJBA 1KOLA 5IZ4A 1MX3A 3BXXA 1WXDA 1XGKA 4E0BA 3DHEA 3AUAA 3EVNA 4DVJA 2GF2A 2X86A 4BKRA 4NFHA 2C20A 4BO8A 4CLOB 3DMTA 1FK8A 1VM6A 4AJPA 4NQZA 4E12A 3IAHA 4OJNA 3KEQA 4D44A 1GADO 2AHRA 4KMSA 6ADHA 5L9AA 5TF4A 1I2ZA 3RWBA 1LI4A 2JFGA 1SAYA 2HCTA 3M2PA 1DO8A 4CMAA 3PWZA 2QW8A 3IOYA 4F45A 2CUKA 3RUIA 5IZCC 3MZ0A 1BG6A 1Y1PA 3PHIA 1PTJA 1ZSYA 1LDMA 4J16A 1I24A 3WMXA 2X1HA 2NACA 3WJ7A 4A2CA 3BTSA 4TRJA 3G0OA 5JDCC 1NQTA 2X0NA 3DO5A 3OQ1A 4YT8A 4BGIA 1JW9B 4R3NA 5JDIA 4FFRA 1U4OA 1YH3A 1P77A 1MC5A 1Z7EA 4MVJG 3QV1A 4MJLA 1I36A 3GG9A 3GAFA 3JD1A 4CMKA 1U5AA 3KM0A 1LDNA 3FF4A 3RC2A 1HYHA 1E7YA 3LF2A 4YAJA 4AJ4A 3V8BA 4N7RA 1ZUD1 3NT5A 4BO0A 1JQBA 1K6IA 4CM7A 3DFUA 1PQPA 2VYVA 1LRKA 5A9TA 1V35A 2DBQA 5KKCA 4YYZA 4R5MA 3U4CA 3EZLA 1E92A 2FR8A 4TVBA 4CQLA 1JVSA 4PCVA 3JQAB 2YHIA 1E3WA 4Z0PA 2AQIA 3GRPA 3T7EA 3BMCA 4P4GA 4PLPA 4ZA2A 4YAIA 5HWSA 4E5KA 3M2TA 3EUWA 3VPSA 1EVYA 3H7AA 3RASA 3CKYA 1R0SA 1YRLA 5CHEA 1M6WA 3D4NA 3QWBA 3BHMA 3ZU5A 1H2BA 1OOEA 1CWUA 1VSUA 1I2BA 1DIGA 1C0LA 4Q39A 3M1LA 1GPJA 4PGFA 4R51A 2D2IA 2BI7A 3MOIA 4XYBA 2EIHA 3MJCA 3PLRA 1DFGA 4IDCA 1T2AA 2O3SA 2VHZA 2CSUA 4MVJA 1GUZA 2VUUA 5T8KA 4ND4A 1V0JA 4DMLA 6LDHA 4CLOA 1Y9EA 1DC6A 1NAHA 1GEEA 4II2A 1WDLA 3C7DB 3LT0A 4B3HA 4NBUA 1SBYA 1S6YA 2B4RO 3ZW8A 1KBZA 4NJMB 4B7UA 2Y1EA 3PIDA 4XR9A 2BFPA 3PDJA 1N9GB 3FRJA 3KYDB 3ZWWA 1Q2XA 3UN1A 2C54A 5LCXA 2YDYA 4DIFA 4U0KA 3AUSA 2PA3A 4J2HA 2HK7A 3EMKA 5A06A 3UOGA 3L6OO 2Q1SA 2H1SA 3PJDA 4J0FA 3GH3A 3JQ8B 5A9SB 2PFGA 4H7PA 4LVUA 3OSUA 4U8GA 5KIAA 5AVOA 3SJUA 5I9NA 4IQ8A 3KLMX 1EK6A 3RKRA 1GPDG 2HMVA 3CUKA 1YO6A 3L4SO 4DWVA 5K0ZA 3RBXA 2E6UX 3VZQA 1ONNA 3GVHA 1JU9A 1NHWA 5TLSA 5EESA 1K5HA 1UDCA 3KYBA 2UUOA 4KTTE 5THQA 5JFOA 1W8DA 3I9NA 3AOEC 2V6MA 2EJVA 3IP3A 3JQAA 1T2CA 2VZ0A 1SCUA 3CZRA 3P5SA 1AHHA 3A14A 3D7LA 4CLXA 4DPMA 1N5DA 3T4XA 1YQGA 3X2EA 4R16A 4NBTA 2ZTLA 4PZCA 1P1RA 4XB2A 5BSGA 1CF2O 4BO1A 2AG5A 1R16A 4EYEA 4ZICA 4XZ3A 4PRLA 4AFNA 2GO1A 4E5PA 2NTJA 8LDHA 5JCJD 1QV7A 4YDRA 1NFQA 3GPDG 5TNXA 2C7VA 1Z6ZA 3WYBA 3K31A 4I5EA 2R00C 3AK4A 4FJ1A 3U4IA 3ZV6A 4M8SA 4FOOA 2YFQA 2VZ8A 2NVUB 5L4SA 3DDNA 1BVRA 1GUYA 2EW2A 5TJHA 2VNAA 5L4LA 4GSLA 1H6CA 3DTYA 4D41A 5MDHA 1CETA 1GYRA 3S2FA 4IXTA 3MJVA 3MTGA 4Y9DA 3TZKA 1ORRA 2YUTA 1IHXA 1R37A 3D1LA 1IYZA 1OC4A 1B26A 4K1LA 1ZNQO 4NJMA 5HS6A 3OA2A 2VHXA 3LQFA 1HDRA 4BNGA 4OIMA 2FPPA 3OJLA 5DBGA 1A9ZA 1PJTA 3NDRA 3QVXA 1N9GA 3E5MA 2C29D 3KYDA 4J7CA 2HK9A 1OZAA 2IZ0A 4E2XA 4KOAA 2O4UX 3QA9A 4TZTA 3ZZNA 2WJPA 2VZ9A 1LJ8A 1HTBA 4O1MA 3SLGA 2LDBA 3JQ8A 5TT0A 5A9SA 4R9RA 3O9ZA 1MA0A 4A0SA 4L74A 1PZEA 2W2KB 1AGNA 2Q1TA 4XQ9A 2PY6A 1KVRA 2HDHA 2HKIA 3AI2A 4I08A 4RLHA 1WVGA 1GZ4A 3RQSA 4OOEA 5TX7A 1U8FO 1ENYA 3E8XA 1B2LA 1IB6A 3FBTA 5JSFA 3HDHA 3ASVA 3P2YA 4YR9A 1T1SA 3Q1LA 1QKIA 5L53A 4BNFA 4PLYA 2A94A 3KRTA 4NK4A 1PJCA 4D0SA 3UF0A 2VYND 3ZV5A 4CMHA 3UVEA 2PD4A 2RHCA 4BS9A 2GERA 4IUYA 4ZQGA 4XEHA 5CDSA 4EDFA 2VWGA 3F3SA 3MJEA 4NBVA 1YONA 3MWEB 4OM8A 3F1LA 1KEUA 3PHHA 4RLSA 3GLQA 1GCOA 1R4NB 3TL2A 3W4IA 1A71A 2FSVA 1B8PA 4JJIA 2PH5A 5HA5A 4JLWA 4BUCA 3ONFA 2BGMA 2Y68A 5TC4A 3WSWA 1LDBA 4DC1A 1PWZA 3R3JA 3V5NA 3UW3A 3LLVA 3O38A 3UXYA 1HL3A 3QE3A 4IDFA 3BTVA 4XJTA 4IDBA 1M2WA 5G0WA 4WCDA 5AXAA 1DIAA 1D4FA 1HXHA 3U3XA 1LLUA 4PG6A 3DBRB 1CQIA 4BKOA 4EITA 3E9QA 1NWHA 5CDYA 1H9AA 1EE2A 4IS2A 3GVXA 4FJ0A 1H6AA 5JW6A 5K6AC 4TVOA 2BFMA 3FTPA 4WEQA 4ZQBA 1O9BA 4TQGA 3MWDB 2WYWA 1OI7A 2NVUA 3F5SA 5ILOA 3DR3A 3H2SA 3WIEA 3A9WA 4Q3BA 3VPXA 1PL6A 4OKNA 4XA8A 4CM6A 3NGLA 4IM7A 3VPFA 1HDZA 1EBUA 5G4KB 5IFLA 4CV1A 3OECA 2J3JA 4OXNA 3RROA 1MG5A 5T64A 2FN7A 4G65A 4GI2A 3WR5A 3PIIA 1E1MA 5DDIP 2EEZA 3K9QO 3I23A 3GZ4A 1H0KA 1QMGA 1A4IA 1UDAA 1LQTA 3K6JA 3WOHA 4D3FA 3A06A 2OMEA 1YDWA 1ADBA 4FBGA 5LDHA 3ST7A 5G2OA 4BNIA 2I99A 1E0DA 4BNJA 2DKNA 5DZSA 3V2HA 5JAZA 2W2KA 4UEOA 2ZYGA 4AL4A 3FCOA 3OJEA 4PIVA 1V8BA 2GN4A 3I4CA 3PVZA 2CDCA 1GAEO 5HRUA 2B37A 1XA0A 4LMPA 2Y05A 3ENNA 4QQRA 2BFOA 4FDAA 1A5ZA 3JYNA 2I67A 4J1SA 3GZNB 1MB4A 3G17A 4R3WA 1QLHA 1VKNA 3GUCA 2PZKA 4GVXA 4UREA 5EINA 3S2EA 3ZU3A 1RM5A 2UDPA 3ABIA 3ADOA 2ZK7A 4KTVE 4XKJA 1ID1A 2ZTUA 1Y8QB 4K6FA 2JD0A 1WW8A 1K0UA 3EAGA 4D3DA 1KC3A 1K3TA 4GPD1 1R4NA 3QVTA 4Q3AA 5B1YA 5TQVA 4BNUA 2HMSA 4BQPA 4JCOA 3E48A 4JROA 2O2SA 3WYCA 1F0YA 2IRWA 2V6GA 5BT9A 4DPKA 3AY3A 4BMNA 3WSVA 5I7VA 3PP8A 5JBIA 1R66A 1YL7A 2AXQA 2QRLA 3W4KA 3ZWBA 4IDDA 3DBRA 1B8VA 1BXKA 1UZMA 1P0FA 1MC4A 1QSGA 3G3EA 4R4JA 3L9XA 3DZIA 4BHTA 5CDGA 1HDCA 1LUAA 1V3VA 4OQZA 1ZVMA 4NPCA 4WOJA 5MGBA 3NKLA 4WLEA 4IJVA 3TPCA 5I8WA 1LC0A 1T25A 1W73A 2RIRA 4WLVA 1ADCA 4HFMA 4KQXA 1PX0A 2VT3A 4MVJP 3IKTA 2YJZA 1YKFA 3HE3A 3O26A 5G4KA 2VHVA 1BDBA 3CXRA 3GF4A 2JD2A 5L4NA 5IDXA 2C07A 4FW8A 2B0JA 1EZ4A 1GQYA 3F47A 4I9HA 4WECA 3GG2A 3IQDB 4J91A 1SPXA 1RM4A 5L7YA 3TOZA 3HWRA 2PD3A 2FRDA 4UUNA 5CFZA 1BWSA 3I9MA 2GN8A 1NQ5A 4I8XA 4ESOA 2XXBA 2EW8A 1NP3A 2OP0A 3GAZA 2Y0DA 1CIVA 3JD0A 1LU9A 1PQWA 5DOZA 4ZQEA 4YQYA 3NT4A 4XD2A 1WZIA 5A9RA 1UZNA 3H2ZA 4JN6B 4B3JA 3GMSA 4A73A 5A04A 3SX2A 3ROPA 2V6BA 1V6AA 3VDRA 4NR0A 4RPKA 1X0VA 2GYYA 4N54A 3GZNA 5JO9A 1SOVA 4YEDA 3GQVA 4YJHB 2CDAA 1LQUA 2EP5A 5K9ZA 4RGBA 4IMRA 5BSFA 1QG6A 1HT0A 1GD1O 3KV3O 4Y8VA 2Q2WA 3L6EA 4Z3DA 1KC1A 1Y8QA 3D64A 3OQ6A 4NFYA 4KDFA 4E2YA 5JMWA 2I5PO 3E5RA 2YW9A 1P45A 2EJWA 1W4ZA 4CM5A 2EWMA 4E2ZA 3HN2A 1X15A 2GGSA 1P1FA 3U4HA 3HFGA 3M1AA 3GHHA 2ZTMA 5EPOA 4WLFA 4O63O 4Z0HO 5H81A 3RSHA 1E1LA 1LXCA 5EMHA 3S2IA 1T4DA 4F46A 1CJCA 3DAPA 4HKTA 3D0OA 1R12A 4BNNA 4UUOA 3OQBA 3GDGA 5DN9A 1E7RA 4BV8A 4B4VA 2B4TO 4L0QA 4L4RA 1DHTA 5JS6A 4D3SA 3DQPA 4HNGA 4MIEA 5ER9A 3OIFA 2LDXA 3COSA 4Z9FA 4ZQFA 1J49A 3GFBA 3KSDO 1WDKA 4OQYA 2FP4A 2PZJA 4OH1A 5DT9A 4Q9NA 1WNTA 4ND1A 3WTBA 3HB4X 1E3EA 4GVLA 3W8EA 3ZWVA 1F17A 1FJHA 5U1PA 3LC7O 3PLNA 4ALLA 4J1QA 2PGDA 1ISMA 3F9IA 2O2YA 5TT1A 3N58A 3FBGA 4PG5A 1WMBA 1HETA 3FSRA 5BNTA 1NM5A 5AXDA 2YYYA 1DAPA 3JQFC 2YV1A 2ZKLA 4IIUA 4N5LA 3STHA 4INAA 3U49A 5A5FA 1JTVA 4M86A 5CPBA 4RL6A 4E5MA 1OAAA 4IJUA 2NQ8A 4W9NA 5B4TA 1X1TA 1EDZA 4AVYA 1U3UA 3HB5X 4M87A 3PQFA 5G4LA 4MKZA 3G1UA 5G0UA 1ONOA 3H5RA 3H4VA 4RO0A 5TJ9A 4MOWA 3D5QA 1YQXA 1VJ1A 1U9JA 3WLEA 3SJ7A 4GX5A 1Q0QA 4FGWA 4RORA 5JC8A 4WNIA 3C1OA 2DC1A 4B3IA 2AA3A 3O4RA 4NDNE 1S7CA 5CG2A 4P4NA 3RKUA 3UICA 2CVOA 3AW9A 4CR6A 1DFHA 1O94A 3ROMA 4OHUA 2HRZA 1O0SA 2IXBA 1NQOA 3WG9A 4YJHA 3CPSA 1QYDA 4WNCA 1FMCA 4TRRA 1C0KA 4M55A 3DMTC 5G0VA 1XKQA 2F00A
chains in the Genus database with same CATH superfamily
1FNMA 1Z0KA 1P73A 2GZ3A 2ZKIA 4G89A 4JMLA 3SZ3A 4CM1A 4EO9A 3MCVA 2IBTA 4JI8B 2AR7A 1TYDE 3DE7X 4RMNA 4UHFA 2BDUA 2E4XA 1G1MA 4YALA 4Z1MD 3LPMA 2QTWB 1H65A 1TUEA 4R1LA 4HT3B 1FS4A 3N0XA 5CA1A 2X58A 1TCBA 2ZAMA 3ESXA 3VH3A 2H2WA 2GCGA 3NIBA 3NALA 5E6UB 1S2MA 1K98A 1VI2A 2JAXA 4C05A 1U81A 1D2MA 1W30A 2VPZA 1UWCA 2FEXA 4I50F 4JH0A 2QZ9A 3FFBA 1DB3A 4CV2A 2KM1A 1AGPA 4J16C 3GEMA 1AE1A 5LP6A 2EKBA 4G5XA 2MINA 4ZI7F 4IEIA 1BVUA 1E2PA 2AX3A 4OJYA 2HHJA 4K9NA 3KD2A 2BELA 2COKA 2I7DA 3BXHA 4CDMA 1NUAA 4YYEA 1HLPA 4EUFA 3C3KA 1OX5A 3FGPA 3TGPA 3C85A 3EGXB 4R54A 1TCCA 3FKSD 2IOYA 1O0CA 4AY2A 1VI5A 1QOQB 3ROXA 4UZFA 3T35A 1MABA 2O0LA 3SBOA 2VHYA 3GI1A 2OM2A 2UYQA 3IEUA 2GKGA 4OFWA 3NP7A 1ZVKA 4WNAB 1UPBA 4RPGA 1T0UA 1CYEA 3Q5DA 5A5DA 4EENA 3OCZA 4IGEA 4QE3A 1DIRA 4BN5A 3FCAA 3SJAA 2PS3A 4D97A 1WJGA 1HM5A 3CT6A 4L4ZA 3ZU2A 2FPLA 1QPZA 3O6VA 2FR8C 1FDIA 4G0MA 4PHHA 1VMEA 2HQ1A 3PQ8A 4UHHA 2B35A 4OHYA 3Q2OA 4DLKA 2HF7A 3LY5A 2P9CA 1VJGA 4HPWA 5BUSA 4OX9Y 3W6OA 1ZXLA 1UC4B 1Y5IA 1IM5A 1FX1A 3DTTA 2OXIA 3QXXA 2WOJA 2C7QA 3U3OA 2EV9A 1FTSA 4FD3A 1XRJA 3UWOA 2ZJ1A 1NX6A 1JNYA 1N7HA 2R1VB 2VYCA 3L7AA 3CX6A 4PPGA 3ZHXA 1ESZA 4ZV9A 3TW0A 2IU3A 2C4VA 2KYRA 3UPUA 2IKQA 4CCWA 4D4LA 2RFLA 4IXNA 1Y3HA 3JVEA 5LQSA 4BQIA 1NI4B 1HEUA 2W22A 2ZYIA 3VOBA 3V2GA 3EPHA 2GCEA 3CRW1 4P34A 1QR2A 5LP1A 3HNPA 1Z8DA 2WVHA 6YASA 4PY2A 2AMLA 3WGKA 5BR1A 1OASA 2OCYC 4RPIA 4PN3A 3LW7A 3K9GA 5IEBA 2OLEA 3IO3A 4JSTA 1EBFA 2CYBA 1SC3A 4QA9A 1Y4SA 4W5NA 3WLRA 1ODKA 2NTVA 2EWVA 5L3SB 1GRRA 3ANLA 4WUVA 1TAGA 2YJGA 4Z8XA 1E2JA 3VISA 3RBZA 4BQEA 4YPFA 5ICCA 1BN6A 1GNVA 1J5EB 2WHRA 1XMIA 5SV2A 2YXNA 1C1DA 1E8NA 1K5PA 1V11B 2IHBA 1DJLA 2RAUA 3FIJA 4NP6A 5EIAA 2AVNA 4ENWA 2FQWA 2QRGA 1KR2A 1NVMB 2JLBA 2W6JA 4RY9A 5AVYA 3ENZA 4W5OA 4FHFA 5EERA 5LUBA 3NWBA 2LUOA 3RVQA 1BO6A 3LQQA 1THGA 2RDMA 3L6RA 4UMDA 4Y2VA 3GRRA 4AP6A 4YRRA 3FFAA 4MKGA 4EPXA 2PA0A 3BD7A 2Q3JA 5ITZA 2VG8A 2NZVG 3EXG2 4CF7A 4MGHA 3Q8LA 3TIIA 1P33A 1W2HA 3LBIA 3D3WB 2BF4A 4Q1CA 4A2WA 4Q34A 4XLLA 1M83A 1MORA 1B15A 2RGXA 1NVGA 4GOOD 4P7FA 1U0LA 3DZBA 3EUEA 4P22A 3HHEA 3QBDA 5AVZA 4NCJA 4YB8A 2IW3A 5HIMA 4S1PA 3HH8A 1M2HA 1EGQA 2IDKA 4L5JA 3FH0A 3ONDA 5FTKA 5AJZA 5DM0A 4LY3A 4YREA 3GV0A 4ER7A 3ODPA 3H0CA 5A3VA 2GILA 1XDUA 2PKQP 1UK6A 1D6NA 1KYIA 2Q6KA 4I5IA 3P8ZA 3F6EX 4IFEA 3CEMA 1OLXB 4M46A 1Q0HA 1GP2A 4ZOLB 5JTTA 4X61A 2ESRA 1XQ9A 1XTQA 2VUIB 2C5BA 1CUVA 3B13B 1CP3A 3D2LA 3HUTA 3PEVA 1L7AA 3EEQA 2Y76A 1L8OA 2AEJA 2YFHA 4M36A 1HEIA 3LRPA 3Q0TA 3DFZA 3GN1A 5KVQA 1ZN8A 4G3XA 4I1RA 4PLCA 1YJCA 3V4SA 4Z2AA 3KQOA 4QOSA 2BEWB 1I01A 4BO3A 1Y3DE 2IH4A 2SKEA 1AKUA 4FINA 3CY6A 1USIA 3DZ8A 4BN0A 5K8JB 4FHEA 3ZKWA 1YK0A 1HE1C 2WDZA 3TIFA 4JL6A 1ISRA 3A0UA 5FFMA 1KS2A 5A1TA 1PU2A 1VJTA 4HDMB 5AXBA 3G85A 5JR3A 2F59A 2PQ2A 1SKYB 1UOQA 2VAPA 3QTLA 4JJEA 2ZFUA 1BHSA 3ADPA 5G0SA 5JAQA 4ZV7A 1PEAA 2ZQ5A 3THSA 2WU3A 3AUKA 3P52A 3SDZA 1KOGA 5ICEA 2XCOA 1T8SA 1HNXB 4JL8A 1IUOA 4NCHA 3WX0A 4LJ6A 1QORA 1XZPA 3OAAD 5HUHA 1Q15A 2H4XA 4P53A 4PTZA 4CHGA 3DE1X 3ZOZA 1K3UB 3PJRA 4DIDA 4CM8A 5DSZA 2WD9A 1TO6A 2VLBA 3Q3HA 1BSVA 3FVTA 1YCHA 2GZ2A 5HMMA 1RXSA 1K97A 2TSYB 3TLAA 2NVWA 3JQGA 1DBPA 1AKEA 3MJTA 4JAVC 2JHCA 4ZO7A 5EHZA 4I4IA 4BOYA 4IICA 4XYMA 4FMCF 1U7XA 4QC2A 1U1CA 5EQJB 2CXPA 1PD0A 5FUWA 5J4YA 1PS9A 2O6LA 2HXSA 2J3MA 2YINC 3ETEA 3OJFA 4JOBA 4KLNA 4UASA 5E9AA 3TKAA 4DQUA 1OFUX 1N2HA 3O4VA 2PCLA 2GM4A 5LLDA 1L9XA 2FZ4A 1AKWA 2WJZB 3V3TA 3A1EA 1XFAA 1H5QA 1IBCA 3TRFA 1H8HA 2C5HA 2FKAA 3L02A 4YRPA 3WV4A 3A1CA 4AX4A 3X1DA 4F2WA 3HU5A 2ZYHA 3ZLUA 2FI1A 6CHYA 2I71A 2QX4A 1XCMA 4YJGA 5FAKA 4URUR 4Z4HA 1N92A 2CHUA 3L43A 2EG5A 2JK0A 3EK2A 3GK3A 3L4BA 3TTVA 3ZDXB 4F96A 4TUYA 3Q7QA 1TLTA 5I4IA 1PFVA 4NATA 5K3OA 3GRCA 3N2GB 2O3TA 4O8ZA 1FFAA 5JXIA 2WVJA 5IXYA 1EWYA 1NW4A 4LOHA 4LXIA 2VQ3A 4DV4B 3BIOA 4KWIA 3WWEA 1NDQA 3OQOA 5B1IA 2DGDA 3BCRA 1RWNA 2LE0A 1TU0A 5DBIA 2P27A 2J67A 4IQGA 1PDVA 3VKUA 2XQGA 3TX2A 1T8PA 5JY1A 2PDAA 1UXJA 1MCZA 2IZZA 3MCAA 3SHTA 3OKAA 1Y1SA 4JD5A 2VP6A 2WJIA 2QLTA 3EPJA 4O6VA 2ZI5A 2BE9A 3DB1A 2FSVC 3ANSA 1SELA 1BE1A 1W85A 4L5IA 4XCXA 2KMLA 4AJKA 4I9FA 3MWYW 1MC1A 2IS2A 1GPNA 4MB0A 1GPBA 2V96A 5CT9A 2ZREA 1YB7A 1NPDA 4Y9SA 2GAJA 4GPIB 4ZCRA 2HLHA 3GEIA 5JD4A 4LNUA 1EJBA 4PS1A 3HR8A 1QCCA 1Z3IX 3PGMA 2W4IA 2V0GA 1E5VA 3WK6A 3H5LA 2ZRFA 2V6FA 2HA6A 2Z4RA 1Q2UA 4FFVA 1JL3A 2H65A 4G5HA 1EFLA 3MD9A 4WW0A 5CA0F 8ADHA 5KNBA 4ZI3A 1BE8A 4NKRA 1TQ6A 1PR0A 1Z2PX 1ODCA 1NP7A 3HKDA 4FN4A 5CVVA 5A3QA 2PT7A 3VOTA 5BSVA 1Q22A 1E5QA 1ZJ5A 2XYRA 4HN4B 1NJSA 3G2KA 1WTCA 3KOYA 3N1UA 3NHWA 4V2IA 4X7RA 3MB5A 3S81A 4GM0A 3FETA 2QG9A 3WGOA 1CDOA 3GRFA 2RHLA 2G04A 4TSFA 3KZ1E 5ADWA 4RYDA 2BFCA 3MF4A 2CBGA 2C0PA 3NT2A 4L76A 4KZPA 5ALOA 2HJHA 3GU3A 3KAPA 4F71A 3S2SA 3G6WA 1QIDA 4ZARA 1NBAA 2IYZA 4KXFB 4D8YA 3C1AA 2IDMA 4JB8A 4X6LA 3E9YA 3WLNA 4E03A 3GO4A 3EODA 5KOYA 2J3EA 3EFHA 3K2EA 4GQBA 3CCFA 4L4SA 4MV7A 4Q7MB 4EOGA 1ACLA 1N36B 4KO3S 1TYEB 2ANBA 4DDKA 2GA9A 3FNBA 4CKYA 4LJ8A 1JSCA 3QU7A 1OYYA 4RKFA 1RXVA 1G42A 2X0EA 2C9YA 2J4DA 3HU1A 4EP1A 1MXHA 2G9RA 1HEYA 1LPPA 2IUSA 1JEEA 1YZYA 5B4UA 3AZOA 3EG9B 2IXGA 3PWKA 2WB2A 3K0CA 1LK5A 3Q8XB 5REQA 4I4TB 4BJ1A 4D9HA 5F7OA 2ZCJA 3UC5A 4H08A 1GZDA 5T67A 1BW9B 1SIWA 1L5HB 2Z2ZA 3P5BA 4K6KA 4TRMA 4NG5A 4LZJA 2Q3LA 3JQBA 1HDIA 5M29A 3RREA 5LZ2A 4G0VA 3KUUA 1USGA 1TM3E 2AQHA 4GS5A 1BHJA 2CLSA 3SF0A 2FE4A 1FU4A 1I0LA 2FVYA 2G06A 1DZIA 4YV1A 1ZH8A 3ZD7A 1SKQA 2OHFA 2E4WA 3EWNA 4R98A 1CEXA 5FADA 3SYMA 1DAKA 3CLVA 4UEJA 1VECA 5ERYA 4KQMA 3SSMA 1A8UA 3TVDA 1SC4A 1U8ZA 2XBUA 4EFMA 2JAOA 5D00A 4HV4A 621PA 2YV3A 5ITSA 3WAGA 5B58T 1YZVA 3KO8A 4Y7DA 1UUFA 4NLLA 2G07A 4UVHA 5KREA 3B6IA 3RI3A 3PDIB 1H3NA 3WMEA 4W5RA 1JN0A 4C2BA 2XDQB 1BRTA 1VIDA 1TLFA 2H3HA 2H1WA 3TDKA 1EK5A 2COUA 2R6DA 5D5PA 3G9QA 4WXYB 1A5BB 3RUDA 1TFRA 4M22A 3UCXA 2XE6A 3A4LA 5ED4A 2WBLC 1C7QA 3AL2A 4A26A 3T1TA 3K0EA 4PR0A 1YJXA 1N0WA 3CE6A 2BYTA 3C3PA 3FAZA 1D2HA 4CEIB 4WLUA 2OFXA 3IP5A 2HSGA 4LHWA 3WLJA 4DLNA 4J1TA 2ONYA 3PYMA 4DREA 1ZU5A 1P17A 2EP7A 1Z0JA 3HO1A 3U48A 1M67A 4CLRA 3L6DA 2KE5A 3HEAA 1RJGA 3KT8A 1P3JA 2HLPA 2PYDA 4H17A 4ICIA 1GU1A 5FUVA 1BVHA 1BDMA 3O8QB 2WMNB 4UMFA 3EVTA 1P6XA 2VSXA 4DYHA 2XB8A 1REQB 1WBJB 1GTJ1 3QEOA 5BW6B 3WYDA 3D2CA 5EKDA 5AVKA 5AVVA 2Q4RA 2ZJ4A 2ATIA 3FR7A 4TXLA 4Z6KA 4QRHA 4PX3A 2PBRA 1E60A 2ZTVA 3HV0A 3N2NA 4G5SA 1W36C 2OR3A 4YJFB 3UCEA 4B35A 3TLMA 4PZ9A 2Q3DA 3M3DA 4D9MA 1VP9A 2Q3CA 4TLMB 3BSYA 4LN1A 2JLWA 3MPUA 3FYUC 5IW8A 3MTDA 3PZBA 3RSQA 1ZCFA 2FR1A 3X1JA 3LPAA 4C0KA 4CIBA 1J8DA 2CEAA 4M6WB 1Q7GA 1TT5B 4PBTA 4JBLA 5H68A 1YULA 2GHRA 4KSCA 4DW8A 4I3HA 4AJIA 3V9PA 1UAYA 3H2KA 3MTEA 3CRQA 4M1KA 7ADHA 4Y1RA 1X7GA 2XKBA 5DGCA 3WO0A 1MOPA 2J0UB 5DHAA 2DPHA 3VJKA 4MWGA 3GT3A 3CN9A 1O5IA 2R7MA 2XDAA 4CUJA 4P35A 2Y2UA 3EC7A 2QE7A 3WBBA 5MGNA 1DS6A 3NG1A 3O1JC 2HIMA 3W5UA 5E6RA 4CDNA 4HWKA 2R8OA 3NEJA 3KP1A 3AKCA 3NOVA 5MN5A 4PXAA 1F8XA 3G7SA 3NHPA 3LLCA 3GUUA 3PJEA 1E3TA 3H2GA 1DC5A 1BKDR 2PEZA 4JODA 3UOAB 4OV6B 3WGQA 2BH2A 1SXJD 1U1FA 3G5AA 4EI7A 1GJRA 4D9BA 4IGAA 1XDSA 4D74A 1R6UA 4E88A 2ZSKA 1XCLA 2HNBA 1L2TA 5KWIA 2VAWA 1P81A 2PHZA 5HCIA 2O8DB 3JATB 3IE0A 4G0ZA 1A04A 4JCCA 1M34B 3PVSA 3KOUA 5BQ5A 3FDIA 3VKWA 1EMDA 5FYQA 2XQIA 3H2YA 4PYIA 2WK1A 2XGOA 4ZD6A 1ZXBA 3RS0A 3WFIA 2VPTA 4CMCA 4QJ3A 3HB1A 1O5TA 5KS2A 4M9ZA 2Q6IA 1XDGA 2AE2A 3DD1A 4RV9A 5EPUA 2C2GA 4YWHA 3UJPA 3ZGVA 4C0SA 4UNRA 4CM4B 3DB2A 1NY6A 2GD0A 4JUCA 2ZYSA 1EJ0A 3EW7A 4B2IA 5FTWA 1L0BA 3RSCA 4KR2A 1GQQA 1NJ1A 4KXQA 4DLWA 2BTOA 5K3AA 1SCJA 2V5VA 2XUJA 1H9CA 2CCJA 4JLKA 1AS2A 3T61A 2VWPA 4QNMA 4RMJA 2FPMA 2CEKA 4QATA 2X0FA 1JPUA 4NU0A 5EP4A 3CNBA 2FPKA 4FLFA 3HDVA 5HGXA 2QB5A 1NMXA 4OFXA 1M3SA 3GJ0A 3KBOA 3OQIA 1ISIA 1P9WA 3F7MA 2V9PA 3E9CA 3K4PA 3PC7A 3PYXA 1M0TA 1GUBA 3BYZA 3IAM6 4M98A 1COWD 3DDUA 4MYCA 2Q4BA 3L8DA 4X71A 4XGQA 4YO7A 5GM2A 4ZYUA 5JXGA 5DI9A 1NI3A 1R8YA 3DONA 1J5PA 5ISMA 2JLAA 3FW1A 4PSAA 1DCKA 3QSGA 1GAWA 2BMAA 2ATCA 3BIJA 3RAFC 1OZ0A 4KNVA 2B1GA 3MCUA 1T4BA 2O20A 1QVWA 3K6RA 2VHQA 2ORVA 3I9LA 3KEFA 3D6FA 4PTYA 3WYGA 1KO8A 2EFYA 3G2LA 1U5BA 3D3KA 5BSMA 1A2BA 2YJTD 3D4OA 3DGFC 4UNPA 4WXMA 2X22A 4R2XA 5HIAA 1U1EA 3VKFA 3IQEA 4HUJA 1SKAA 1WULS 2FPIB 3UJ3X 1GUFA 3PEUA 1T9CA 3F6RA 2HBZA 2OPHA 2B5WA 3VYUB 1ADYA 1DQNA 5EUBA 1KJIA 4GXRA 2ZYDA 4R2JA 3K05A 1ABEA 1R88A 2WI8A 4MR8A 4NESA 3U7QB 1D1SA 3D9QX 2P5YA 4WPGA 1G7RA 3GXOA 2QL5A 3W5CA 1DADA 2WV9A 3OIGA 4B3SB 4M89A 2PD6A 3TE7A 2GETA 1P2UA 1WZEA 3OCCA 4BPRA 2FZLA 2WA2A 5EE0A 2ZPAA 3ZKAA 5JFGA 1UXHA 1BFUA 1ODJA 1RKXA 5BV8A 5EHQA 3KR1A 1OD6A 3LZCA 3L4EA 3VUFA 1JQJC 2FZEA 3KK0A 4BNDB 5FI1B 1QNLA 4QHSA 1MB2A 1GNRA 7MDHA 2PBLA 3M6IA 4MHSA 5AKJA 5BNFA 4WXEA 3TXAA 3UKOA 3U7HB 2IYPA 3ITEA 1O94C 4Q4AA 3BFVA 2F64A 1RRPA 4PC2A 5KTOA 4HGOA 3G0HA 2H4WA 3SJBA 1QQ6A 3OC0A 3NJ4A 4NEGA 1OIVA 1VTKA 3ECCA 4P2GA 3MUEA 4NNPA 5EKUA 3WGUA 3NTLA 3U6BA 5J1TB 2VHWA 3AR7A 3TE6A 2AUMA 2Y99A 1WMSA 4Z51A 3HG7A 2PH3A 1UAAA 1OWMA 3MSCA 4UTRA 3SC6A 2GZAA 5LA6A 5L7WA 4KQIA 2WKRA 2IEZA 2MYPA 3SF8A 1G8KA 3SHWA 2H2HA 2FTKE 4C14A 4GD3Q 4WBNB 4ZC8A 2M6SA 2QU8A 3B6KA 3FTDA 2IYQA 3GD7A 5AK4A 3QXSA 2GN6A 5LQKA 1N3BA 1LSSA 1V5WA 2ZRHA 3L8GA 1IE3A 4O8CA 1J56A 2C00A 3KUDA 3A04A 5LP6C 3Q5EA 4QJ4A 1E2DA 1UJNA 3EIUA 4HJRA 1YRHA 4GZ3A 2E4VA 1SPBS 4M54A 2G63A 4IJKA 4XIFA 1F7UA 1Q44A 1DAIA 3A11A 3IDZA 4TKMA 3U4AA 2WYVA 3WLTA 1U6IA 3VHQA 1GLVA 3WXBA 4I3FA 1Z73A 5EJFA 2Z9CA 2Z2XA 2P6PA 3L5KA 5CAEB 2FQXA 3BTUA 2E21A 1EBBA 4DDWA 2CCKA 5ALRA 3O4HA 4O2AB 1Y6RA 1WXIA 2CLKB 2VEDA 1U8CB 3RFFA 2OCGA 2Z3ZA 1U90A 3MD0A 4TLBA 3VVBA 4A5SA 4DCUA 2WP8J 4P4LA 3UWMA 1G41A 1HDOA 1SQSA 2FB9A 3B8EA 4MKRA 3HUEA 4RGQA 4MR9B 1M75A 3K92A 1GTVA 1W19A 4V0SA 4E31A 1R4MA 1ZRNA 4JUDX 3OKCA 1PNOA 1H6BA 1JVBA 2EZUA 2LV8A 2Z2IA 4LCEA 4IWNA 4DG9A 5JOQA 2PYIA 1CULC 4EPYA 3QPAA 1SUDA 3DP9A 5EE9A 1KQ3A 4GMHA 5C4MA 3VZPA 2ERYA 1EFHA 4GX1A 5EJ2A 5HKKD 1U0SY 4O4HB 5L51A 5BN4B 2IW1A 2CHEA 3ETLA 3KU1A 3ZDEA 2IPXA 2WUGA 5G3ZA 2Y1FA 3ZGLA 5FEUA 4MQFA 1S2IA 3NTOA 1CR4A 3TLKA 1KEZA 1R0LA 3N39C 1GGKA 5JECA 2O8BB 1IZ9A 1ZMTA 1SR8A 3UUGA 3FMVA 4A2PA 5KX5F 2HWXA 3B9QA 2A7XA 3C2QA 3KS9A 2Y1XA 3R6TA 1OTXA 1B3RA 2CDRA 4TQ9A 1H9BA 3NHJA 3S7ZA 1NSFA 5EUMA 821PA 2V6IA 3R5HA 4C08A 1QTIA 5BQOA 3UTDA 3AEKB 5JASA 1BFDA 1I4TD 1CNMA 3MYRA 4U3JB 1OZGA 3ZIAA 1XN4A 3VSCA 4GR5A 4AIRA 3UT5B 1KDRA 4KFCA 4WKNA 2ODAA 3PFBA 1LI7A 4B75A 4F86A 5I7FA 4X64B 4X6YA 3HQ4O 4IIYA 1F2UA 1R8XA 2J32A 3IKVA 1D7AA 2VPPA 4QAJA 5M5BA 1UJBA 2X40A 1SEVA 2K4MA 5HCUA 2UVDA 3GLIB 3HSYA 4JHXA 2O5EA 5ITWA 2OCBA 4Y2PA 2RH4A 3V55A 3S40A 3NM6B 2YH2A 4TS9A 3BAZA 3WGMA 2VOEA 1NXVA 4O2RA 4FFOA 1L1FA 4IJ5A 2I3AA 5EP2A 2YRWA 2DFVA 2XADA 4NMMA 5KNDA 1VFPA 1YBVA 3AJRA 3GFVA 2VXCA 5FNZA 5M34A 2B83A 1K92A 3VU1A 3ZWVA 4BFYA 3QBTA 3I5UA 5ENDA 2ZEJA 1CUDA 4RU1A 2PTGA 1USUA 1M2JA 4QSHA 4NBLA 1P5RA 3QFCA 1ZOPA 2PGIA 3KPYA 5G02A 4MIYA 2AMJA 3UAXA 3TTUA 1MZPA 3DDWA 2IEBA 2XECA 1FQOA 2L2QA 3GGPA 4CDRA 4KQGA 4KP7A 1HE2A 5F78A 1JYFA 4E7OA 8ABPA 4F9GA 3DPIA 3OVMA 3Q8WA 1M6YA 1L7PA 2HK8A 2O48X 3HBJA 3WGIA 1JT9A 4K8OA 3E4DA 1OUMA 3PZRA 4Q18A 2I2FA 5DW3A 1LA2A 1WAMA 2GEKA 1R0YA 1CVRA 4P5DA 4AJOA 5CB4A 4K86A 4N0MA 2JAPA 4NARA 1SB9A 2A3RA 3N53A 4E4TA 3KDSE 3I53A 2GPWA 3OU7A 3RVJA 4LYGA 3UY4A 3W2EA 5GQSA 2AN9A 4YT5A 2BBTA 1SMKA 2X8WA 1OLUB 1WB9A 5AVJA 1EFTA 3NUGA 3UMGA 4V03A 4BZWA 1GGNA 4MPJA 3TZBA 3CINA 3INGA 4YASA 4UBIA 2P2ZA 4FFNA 4BNTA 2OC4A 3K72B 3CJRA 1CR6A 1RHKA 2NXJA 1T24A 2X15A 4L15A 4F7WA 4PZDA 3C15C 1RS0A 2EDAA 3GJ3A 1G66A 2ZUBA 3WLHA 2DBYA 1PGQA 1QIJA 4UVGA 3TK1A 1JECA 4Q5IA 4C20A 2O1WA 5TE9A 4K87A 2P6NA 2Q2QA 1XUOA 1M76A 1YU6A 4KW7A 4OGLA 3N0TA 4J43A 3JTEA 2GJ8A 4DB4A 1QTQA 2YXEA 2Y27A 3P4UA 4PG4A 1QGDA 1LC3A 2HAEA 4OB7A 3WC4A 1AZTA 1OXTA 5GGYA 2ZIVB 5CEFA 1N1DA 5KDLA 4WFJA 1CR2A 1SURA 2GCIA 1JKJB 1VKJA 4MVJM 4A82A 2GUGA 2BFBA 1L7BA 3DOHA 3ZZ1A 5JIBA 2DT8A 5IARA 2D2XA 2GCPA 3ZWAA 3RS3A 1JQEA 3DZJA 4PG8A 4RY8A 1VZ3A 3BL5A 3P96A 1ZFNA 1NONA 3MIZA 4GYWA 3FLAA 3JZDA 2HDWA 4DCMA 5HE8A 2WJGA 1J00A 2SCUA 2ZRPA 1NBME 5KNBH 5ALUA 3C3XA 2BR5A 4TS3A 3KHTA 1ZH2A 4Z86A 3DHNA 2B4YA 4CTNA 4MIOA 3ICVA 2FWIA 2YN0A 2IU6A 4E33A 1NY5A 4Z3KA 2VHTA 5CB0A 2CMKA 1T2NA 4IIJF 4W5JA 1U1DA 4OXIA 4DV3B 4EELA 1GTZA 1E0SA 1ONSA 1WCIA 3DOOA 5K6TA 1UZLA 1E5LA 2G8LA 2C99A 2FDRA 2OHOA 4J0HA 4JEIA 4WY5A 3A3YA 2FV8A 1Z4OA 2MSCB 3I0MA 2CXRA 2I29A 2XMDA 2APJA 1P9OA 3F5QA 3MTQA 4Z9XA 4ZALA 2BFDB 1IWBB 3ZWXA 1MG0A 2C9OA 4JQCA 2PL5A 3UWDA 1TX4B 1LDEA 3ABZA 5BV2P 1FIUA 1YQUA 4CLHA 1T26A 4OQMA 3R0IA 1KYWA 2NZ2A 4B6EA 3JRXA 2IC5A 1XZGA 4UVDA 4L9WA 1PLLA 2BFEB 4UFPA 4CBVA 3L7YA 1E32A 1H6DA 2V7PA 3TO5A 3DVSX 4ALMA 1ZW6A 4MVJF 3G9UA 2FW6A 3OY7A 3BH7A 2OSVA 1LF5A 4G5RA 1QS0B 1Y8RB 2D5LA 3L4BC 4I4LA 4NULA 4C5CA 1NJFA 4PAWA 4YLGA 1M1ZA 1GPH1 4JYMA 5AR1A 1KE1A 2A7QA 2Z1MA 3DZGA 4EW2A 4JGIA 2GNOA 3QYAA 5AOCA 4L75A 1PG0A 3K16A 4PFJA 5BQFA 1D09A 1YJQA 1ZIOA 3I58A 1HTTA 1PQYA 5HUQA 3VO1A 4ASUD 1MD9A 1PR4A 2O7SA 3OF5A 4MMYB 3CG0A 4HCJA 2G3YA 4XQGA 1PR3A 3EWAA 2F3RA 3UG7A 2VP3A 4O29A 1HR0B 3SXJA 1J8VA 3MCWA 2PAFA 3VH1A 1KIMA 1IY0A 2CLEB 4B17A 2ZJYA 3AGQA 1UQUA 3ORSA 4GSKA 1Y7IA 3ZVNA 5F2EA 2D7DA 1FYXA 1XWWA 4YCMA 3PGLA 4IG4A 4TVKA 5E38A 4ERNA 2HL6A 5J3JA 3K1JA 3VNUA 3H5OA 1F8YA 3M5WA 3OHPA 4EX7A 1PQ4A 2B7CA 4GPEA 1EFVB 5DRTA 3SSOA 1XKXA 2VQSA 1QE5A 3C4VA 4E5NA 2DETA 2V7EA 1OKKD 4HYTA 1VIVA 2M98A 3MT0A 3S2YA 4BEVA 2ZJBA 4HTFA 5JXJA 4G41A 3B1VA 1YR6A 1Z45A 4R2IA 5C1DA 3B20A 1YI8A 2CVZA 2NQ2C 4KX3A 1DO0A 4IDAA 4GPAA 4PGAA 5E9JA 1Z8HA 3AI1A 3KSBC 2DWPA 1G3UA 2IOFA 2JARA 2R1TA 4JJ8A 4EGJA 5HRCA 1HX7A 3S44A 5CDTA 2X9GA 4FX5A 5D84A 2JBAA 5EWJB 4W7IA 2VYNA 5JS1A 1XZJA 3V6LA 2AV6A 1ZL2A 3PE6A 2WNIA 5LIPA 4EI9A 1ZZGA 3E7XA 4MWTA 2C95A 2OC9A 1XFDA 1KY2A 2QL9A 1Z0DA 3ZXIA 2VDPB 3T5DA 1RWMA 5K3SA 4FS3A 1M2EA 4A5OA 3AUTA 1Y63A 2ZW9A 4MYTA 4CG0A 4C04A 3IUYA 3M3HA 1JLLA 1KO7A 3HI6A 3VNRA 1AIPA 1KO4A 1EUDA 5DXAA 3AIOA 1I7LA 5HMLA 3V1NA 3OX2A 4HAUA 1S3FA 1OR8A 4RK0A 1DI0A 3QRWA 1VHDA 1NU8A 3CEJA 4FFBB 3NWOA 1DLJA 1MW9X 1PJ4A 4WVLA 3ZBPA 5HX7A 5K0FA 1F7VA 1CUWA 5FX2A 3BSWA 3GXBA 5JLAA 1BJTA 1U3VA 1XSEA 2GD1O 3K0CC 2FOLA 1MT3A 1TEHA 1Z2NX 2V7TA 4TSKA 5FUXA 5AHKA 1QIFA 4WVFA 5I3ZA 2PZEA 5GM1A 2JATA 4DSAA 4LZLA 1B1AA 2K6GA 2HRDA 1ELOA 5BN5B 3JQBC 1CV2A 3H87A 2GLXA 3A4MA 4JDPA 4NS4A 1CUXA 4QGSA 5KTPA 5GJVC 2ZB4A 2BGWA 3E7PA 1YJ8A 2HDOA 2BE7A 3H13A 4YROA 3SD7A 4DKXA 2IWRA 2DUJA 4ZOBA 1J06A 3L6UA 2GRAA 1H0SA 1FFBA 2TMKA 4QOJA 4W5TA 4KYVA 4OI2A 3BWMA 3NW9A 2FWRA 2ZUFA 5TS3A 3DEYX 1MT0A 3R7BA 3K15A 1BVYF 3NIWA 3DVRX 4DIBA 3KVRA 2AFRA 2FWNA 1K7CA 1MO3A 3MIIA 1JKXA 5CBPA 4ZYLA 4CKWA 1NXWA 2J7PA 2C7RA 4J4TA 5AI4A 2IY9A 2BTQB 1ZPDA 2YWEA 1TF5A 1AN0A 2AMFA 2GZRA 5JCZA 3ZWOA 3KXPA 3DZKA 4JK3A 2NYUA 3L3BA 1ATZA 1A7JA 1SBCA 3AINA 1PO7A 3THYA 1RHMA 3LT1A 4M76B 3TQQA 4UXHA 4FKBA 3WL3A 3HEMA 4B0OA 5C7IO 5LD2C 4I4NA 5LZ8A 4B8YA 1YKGA 4D5GA 1FYVA 1Z4PX 3O4GA 1GIAA 3MBOA 4FVTA 3A9SA 1VXOA 1GUAA 2QG4A 4JYAB 2NSHA 3CUEF 1DEOA 1KFJB 1RAHA 2IHKA 3PL1A 3UK0A 2YWBA 1RLMA 2IIBA 1U4NA 4PO8A 4BFWA 2HMYB 1QCYA 3E0XA 5KKAA 4BLUA 4J1TC 2Y4NA 3HGTA 1PZHA 1XRQA 4PYRA 4FOPA 1DPFA 1ADFA 1XPUA 4HDAA 4RHTA 1UZUA 2QPOA 3DMNA 5TS2A 3N8KA 3ER8A 4GOND 5HGJA 2HT1A 5G1NA 2FH5B 5AJUA 1NYTA 2I3GA 4XUEA 1Q1BA 4AKEA 2OMKA 3F8SA 1QZXA 1RPNA 1IOZA 3D4BA 3GLUA 3KQPA 5CA0A 1ZM9A 1JDNA 3ZWQA 3G49A 4RWZA 1E79D 1Z74A 2ZGVA 4LC9A 3QWHA 2JGEA 2OBXA 1CFZA 4HN9A 4X3OA 1O03A 1B6GA 1Z12A 4G8JA 4O2BF 1BTOA 2AYXA 4QUKA 3S1LA 2IZ7A 3ZCPA 4ZOAA 5H9WA 2BY4A 2P2DA 2YBDA 4BJ3A 3TRIA 1CD5A 1QUFA 1H0RA 5FQOA 4I2NA 4BFLA 2H00A 3N0RA 5FFFA 4I1UA 3GMDA 4F06A 3DLTA 3IIKA 4P58A 3OJCA 2OZVA 3RW9A 2ZDGA 2OYCA 2ODTX 3AF4A 1K08A 3M6AA 4JB2A 1I6WA 4Q3DA 5K0CA 3E3LA 4WASA 1KERA 2XAAA 1Z7GA 1NAIA 4MVYA 5AI8A 5AJVB 3G5UA 2Q5LA 1B0UA 5AQEA 8ATCA 4HPXB 4KVAA 5AKKA 4X1KA 3SVTA 1ISJA 5JZ9A 1SCAA 5CYFA 4XAQA 5DNAA 1RAFA 1XR3A 4NCIA 1UQTA 4KBGA 5JNVA 2R68A 2OYSA 4OJKA 5FBZA 2MSEB 2VJYA 3PHCA 3DDHA 1JMYA 3NYIA 1OE0A 3NM5A 2P6UA 1T5TA 4Y1EA 3VO2A 1BGWA 3B2QA 2BKLA 3OH8A 4HRXA 3ZGYA 1RYFA 5FCDA 3I01M 5AHXA 2FXVA 1SH7A 4HVAA 5FI0B 3LZDA 5DNVA 2WIJA 3X0DA 9GPBA 4Q6WA 3IFSA 4FGKA 1IG0A 1OJ7A 1GAQA 3QEKA 3HM9A 4A23A 1FUUA 1NF8A 3E0QA 4J4BA 2REOA 3EBOA 3KKMA 3R44A 1ZJWA 2BI8A 3OHMA 1EFDN 1LFAA 1U6KA 3CVJA 5TIIA 3EPLA 4BP9A 4RGYA 4QG3A 1L1QA 2Y1CA 3R0QA 4DLAA 2OYRA 3AM1A 2Y1OA 1GEGA 2J48A 2C5AA 2J1LA 1FDVA 3EVBA 3KKZA 4M1SA 5AOBA 1PKXA 2J0QA 2OE2A 1TJ5A 3IALA 1CYDA 2P6RA 4LFAB 1JLKA 4CMIA 5JSUA 5FULA 4GEGA 1N6RA 4YRGA 1F8GA 5G0TA 3AVXA 4DYVA 2OQIA 1BX0A 2O9JA 1TQ2A 1X7ZA 2ZAYA 3GVCA 1TB4A 2GBGA 3IAFA 3H9CA 5FOQA 2RCYA 3BMOB 3AR3A 2RHGB 5E3HA 1M66A 3EFBA 4NAUA 1CSEE 5CT8A 4TWBA 2D5AA 2ZUEA 5IDYA 2FF5A 3KZXA 4DQVA 2QVXX 1I5RA 4IS3A 4NYIR 3DMDA 3EMVA 3KYCA 4AUEA 1PT7A 1P60A 2RK6A 2YQ4A 3AUJB 4CLDA 2VHUA 5KTSA 1JXOA 5AW4A 1NBMA 4BX9A 4MO2A 3D7KA 4N65A 1P9NA 2XD9A 3NBKA 4FT2A 4OAOA 5IK2A 3C3DA 1L7OA 3GJ5A 4CIVA 5CM8B 4B7CA 1GZ3A 4Q24A 1X86B 4F8EA 1ESEA 5EXEA 2YMQA 3KOZA 5FAXA 4OQXA 1VGQA 3FPHA 3OO0A 4MV8A 1H93A 4YI5A 5HILA 1O9HA 1LJLA 1CG6A 1P74A 1PT9A 1FP6A 2CMDA 3NWJA 1X9GA 3SICE 5FO1A 4HLUA 5TEWA 5B6IA 5KTNA 1FLAA 3WA6A 3QFRA 4M0PA 4FE7A 2ZR7A 1P9LA 2RJOA 2YNMD 3INRA 1KYQA 4GX0A 5M2QA 1Q7CA 1VYTA 4MWDA 5AKIA 3TZCA 4DA9A 4LJLA 2PMEA 3KCQA 1F2VA 3ZD6A 4RDHA 1LLFA 3ONVA 4I55F 4WFKA 4DMHA 1Y9AA 3IDQA 1AHIA 2P3QA 4AMYA 4O4JF 4RD1A 3QELA 4CR7A 1BIFA 2KHZA 5FO0A 4EG8A 1AQNA 1NIPA 1GPWB 2HWUA 1J22A 1YZKA 2AN3A 1C2TA 3E8MA 3GGGA 1PS0A 5JAOA 5EP3A 3F6YA 3GPCA 4EHLA 4KE9A 3VR5D 4TXJA 1V1MB 2KQUA 4EF6A 1NJ2A 4X20B 4DV7B 1ZSNA 2HSWA 3HBLA 1C3EA 3NGXA 5D6OA 3ZD8A 3AOGA 3AKEA 3LQRA 3N05A 3UJBA 3ZYCA 1XNHA 1OWNA 2JCGA 5K03A 1CZUA 2VDLB 1P7CA 3F96A 3WWPA 3W78A 1YI0A 1Z5OA 2NPIA 4W6ZA 5D5QA 1O4WA 4HLQB 1T2EA 5BYAA 5E3IA 3NC0C 1KDZA 3QE9Y 4KQ2A 4KACA 1IJEA 1M8KA 2BKVA 1USKA 4B33A 2H52A 2FN9A 3B3FA 1M5RA 4D6XA 3TINA 2H6EA 2IXEA 3AP3A 5KOJB 4EAAA 2N47A 3OZIA 4XD7A 1ZOSA 3A6ZA 3PXDA 2IHJA 1DWQA 1FVFA 2A9VA 1CQZA 2WE7A 2I66A 2V03A 3IV7A 2CD7A 4DCOA 4DABA 2HQBA 3RK1A 1TPZA 3K2QA 4U7TB 2NTNA 4Y3UA 3RUCA 4ENQA 3F4LA 2B61A 1B8UA 2X13A 3WNCA 1JA0A 4CR8A 4EBBA 3OLQA 2NU9A 3IB6A 3QXCA 1XDWA 4EMTA 1QANA 3KSAC 3CMMA 4MQ6A 1UXIA 2X1VA 4GDFA 1E7MA 2E1PA 3HBFA 1CC1S 1P5ZB 4GQIA 3GD5A 4B7XA 4EKIA 1WDWB 3FWZA 1TADA 3DNMA 1G5FA 4YCSA 3GY0A 3M5CA 3IDFA 4XOUA 5EHNA 3W1WA 3NAQA 4TYQA 2IS4A 4KO2S 2GPTA 1T0PA 4XWTA 3WB9A 1XXHE 1YJBA 4ALJA 1UXKA 2VNSA 3MLAA 4XFDA 4YQFA 4H16A 4JX8A 2HWWA 3UKDA 1K7XB 1Q50A 3U81A 1C1XA 3QEMA 5B6JA 4B5KA 3MMZA 1OILA 3PWSA 2IBMA 1NR7A 2W4QA 4HH1A 4U7FA 4EBFA 2EL9A 1BA3A 3W7VA 4Q01A 3SJCA 1XQ1A 1KR5A 3ROGA 3GYGA 1K8ZB 1NIJA 1HPLA 2Z08A 2FWJA 4TMWA 3VR3D 1ABBA 5DI3B 1YR7A 1G291 1ZDMA 4XSHA 5D3MB 1KRXA 4FOSA 4O4IB 1A9YA 1N2ZA 3PRKE 4NBSA 5D51S 1TUBB 2OGUA 3CX7A 4MVJE 5E7IA 4MUKA 4AICA 4N12A 1HNNA 2ZCUA 3BGSA 3W79A 1WP4A 3BILA 4MDEA 5ICSA 1VE3A 4MV5A 1PJSA 1RWBA 1IPFA 4P2BA 1TXGA 1C14A 1XZNA 2J3IA 1XZIA 3CLKA 3R20A 4M1TA 5GV7A 4AJ9A 4B3DA 2A1TR 2A84A 3LCJA 1P5FA 2QTHA 2GJSA 1I10A 3DZFA 4BFZA 1XWIA 4MQUA 3TS1A 4MX8A 4PR3A 1EKXA 1RQNA 2HF9A 4K40A 2I2BA 3KKNA 4M9SA 4C4SA 3ZZ0A 3DLHA 1BHO1 1QLWA 3PT9A 1AXEA 3FPBA 2H1VA 2PTHA 3GCXA 2RSLA 3IAM1 3U3RA 2QJFA 5IG2A 1QGUB 3BWBA 3CUWA 1Y4DE 4UTPA 4RZUA 1KP9A 1Q77A 3ZD9A 2A92A 4LZNA