4IMRA

Crystal structure of 3-oxoacyl (acyl-carrier-protein) reductase (target efi-506442) from agrobacterium tumefaciens c58 with nadp bound
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
258
structure length
258
Chain Sequence
b'LYFQSMRLETIFGLRGRTALVTGSSRGIGAAIAEGLAGAGAHVILHGVKPGSTAAVQQRIIASGGTAQELAGDLSEAGAGTDLIERAEAIAPVDILVINASAQINATLSALTPNDLAFQLAVNLGSTVDMLQSALPKMVARKWGRVVSIGSINQLRPKSVVTAYAATKAAQHNLIQSQARDFAGDNVLLNTLAPGLVDTDRNADRRAQDPEGWDEYVRTLNWMGRAGRPEEMVGAALFLASEACSFMTGETIFLTGGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Crystal Structure of 3-Oxoacyl (Acyl-Carrier-Protein) Reductase Atu5465 from Agrobacterium Tumefaciens
rcsb
source organism Agrobacterium fabrum
molecule tags Oxidoreductase
total genus 99
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4imrA00
4CMIB 4E33A 3I9LA 1FK8A 3DBLB 3ADOA 1EVIA 1K6XA 3WMWA 1Z45A 2CZCA 5DBFA 1NPTO 4MVJF 1NFFA 2NQTA 3QY9A 3RUFA 2DUUA 2XF8A 2YUTA 3ITDA 4S3MA 3E9QA 3B70A 4M89A 4OKNA 1J0XO 2X23A 2G76A 3D3EA 4BO7A 4K26A 2DAPA 5JY6A 1PR9A 3EZYA 1DC3A 2DC1A 2CF5A 1BWSA 1XLTA 5FWNA 1MFZA 2VHWA 4ZQBA 4R51A 1GZ6A 3NT4A 1HLPA 5JC1A 1EDOA 1CJCA 3H3JA 3MJ4A 1E1KA 3JQ6A 1LEHA 1ISMA 4YA6A 4NK5A 5C7OO 1BDMA 1E1MA 3F6YA 4Q3EA 3V1TC 4DRYA 4OSPA 4Y6SA 2XXBA 4BNJA 5TIIA 1EK6A 5JBIA 5KVSA 1GUZA 4WCFB 4E2YA 1GADO 2Q3EA 1ISIA 4EEXA 3R1IA 4E31A 2NWQA 3BMCA 4ALJA 1K5HA 3CZRA 3ENKA 2J5KA 1GFSA 2NSDA 1WP4A 2BHLA 2X0NA 4GX2A 1ZJYA 4PG4A 4JQCA 3C7AA 1P1JA 1NHGA 1O5IA 4I5EA 2NVUB 1PJTA 2RH8A 4AICA 1LLCA 1DFGA 2QHXA 4BKUA 4YT4A 3NGLA 4GWGA 2ZCUA 4PG5A 5B12A 1X0VA 5JSFA 3UF0A 4RVHA 4TKLA 5EN4A 5A5EA 1NHWA 4U8GA 4NBRA 1YL6A 3JQBC 4B7UA 2GDZA 4L8VA 1VL0A 2W2KB 1P0FA 2D3TA 4CM7A 3P19A 1C3VA 1V35A 2OGUA 1DRVA 3JYLA 4J49A 4N7RA 1XG5A 1ZKMA 1DB3A 1IE3A 2EW8A 4KP7A 3DFUA 5EERA 4D42A 2VHYA 3K30A 1Y81A 3OEYA 2CD9A 2HLPA 3LC2O 1I24A 2JFFA 1RKXA 1WXDA 1NP3A 4XB2A 4R9RA 3U9LA 4MPDA 4B8WA 3DOOA 1NQAO 2VNAA 3GH3A 3JQGA 1E1LA 3WBFA 1CETA 3PHIA 1W4ZA 1PEDA 5TGDA 2GSDA 2ET6A 1ORRA 3C1AA 1E3SA 3ICPA 3PPIA 1P3DA 2D4AA 5T67A 1HKUA 1RYDA 2HK7A 2NVWA 3LVFO 1GTMA 4PRLA 4W6ZA 4YRDA 3WQSB 3DHEA 4D0SA 1XELA 2WM3A 1GQYA 3CH6A 4MVJD 4E0BA 2FZEA 1B8UA 3LC7O 3I9OA 2IE0A 1N1GA 4J1SA 4EJ6A 4D7AA 2DTEA 3U4IA 3ICCA 5A9RA 4NPCA 3K6JA 3IL2A 1IOLA 1I0ZA 1BVUA 4LMPA 3ZWCA 2A4KA 2Q4BA 4YT2A 3DBHB 5KIAA 4I5GA 5HA5A 4J6FA 3NX4A 1Y7TA 4FJ2A 1ZIDA 1U2DA 3IP3A 2ZYGA 3SLKA 1P1KA 2OBNA 2P5UA 3MJEA 4Q9NA 3ZWBA 2HKIA 5KJCA 3INTA 2PA3A 4XYMA 2F1KA 2B69A 3OFSA 3QVWA 4B7XA 4J9VA 2VYNA 1ZNQO 1RM3A 4IM7A 4UREA 3MOIA 1AHHA 5TS3A 3UICA 1S7CA 4YVFA 3UAGA 1EQ2A 3VC7A 1EBFA 5CG1A 2D5AA 1PQUA 3IUSA 1YJQA 1DPGA 4YWJA 1ZJZA 3R3JA 3FI9A 4Q39A 4XQEA 5L45A 2G0TA 2WD7A 2E37A 4NR0A 1JQBA 5KVCA 4EI2A 2FPGA 3V1UA 1RM5A 3PHJA 4PG6A 4R3WA 4YDRA 3EVNA 1MXFA 4GX0A 1YB1A 3TFOA 3WNQA 5TQVA 1XDWA 3WWYA 3TF5A 3RVDA 3GDFA 1T4DA 1VJTA 2J3HA 5TT1A 3B1JA 5L4SA 1M67A 4I5DA 4NZ9A 4BVAA 1BXKA 3E9NA 4XQGA 3RUDA 3ST7A 4MIOA 3CEAA 5DOZA 3GEMA 3FRJA 5EIOA 3VZPA 1R0SA 2HMWA 4IJWA 3JQ9C 1IPEA 3GHYA 3VZQA 5F5NA 1NR7A 5KKAA 2DBQA 3BTOA 2O3SA 3H9GA 1N92A 4TROA 1D8AA 1R0LA 5HS4A 3D64A 1X0XA 1ZK1A 1YRLA 2AXQA 3LT0A 3BZUA 3KXDA 1NNUA 5DF1A 4XRGA 1V0JA 5I7FA 4LISA 4BB6A 3MJTA 5T57A 3T7CA 1LLDA 3HZZA 1KVUA 1QYWA 2P9GA 4DMLA 2ZTLA 3OMLA 3ZH2A 5A9SB 1DEHA 1U8XX 2BKAA 3ZV3A 4ZRNA 1VLLA 4XB1A 4LRSB 4AL4A 3ASUA 3GDOA 4CUKA 3DDNA 2PH5A 3WGZA 1KIFA 1MGOA 2QIOA 4J2OA 4CLEA 1IUKA 5B4TA 2OUIA 2BI7A 3O8QB 2GZ3A 1YDEA 5FF9A 1TT7A 1TT5A 5GZ1A 2QYSA 3ZNOA 3C1OA 5G0SA 4BMNA 3GQVA 3GK3A 1E3LA 2UUPA 2QZZA 4CODB 1SOWA 4NFSA 3DL2A 3CE6A 4DC0A 2JKVA 3JD4A 3PHHA 4EUEA 4MIYA 1WW8A 4ILKA 4LK3A 3PWKA 5JCJA 3ZV4A 4E2ZA 4WECA 4YJFA 4OIMA 4XR4A 4OGWA 3WG9A 4FW8A 2ZTVA 1FJHA 2Y68A 5A06A 2JFHA 5G2OA 3BMOB 3BIOA 3WLFA 3AM5A 1ISJA 1JWAB 3JQFC 3OSUA 2VWQA 3KOUA 4O1MA 3L6OO 1AUPA 3QWHA 4FFRA 4NIMA 1EE2A 1YH3A 4TVBA 2EJVA 3DZBA 3C3XA 4GI2A 1NQ5A 4TMFA 3RASA 4MP6A 4E4YA 1K89A 2AQ8A 1JVBA 5DP2A 2BFOA 3U09A 3OICA 1PWXA 3LT2A 4UAGA 5KVQA 3HN2A 3HJAA 3JQ8A 2GNAA 3RCBA 5K9ZA 3I1JA 3FNFA 2YDXA 4CM4B 4RPLA 1RJWA 1SZJG 3QVXA 1W8DA 3VTZA 2PD4A 3JD1A 1ZVMA 1K6JA 3PYXA 5K6AC 2HQ1A 3LQFA 2W4QA 3GNQA 1PL6A 4GSKA 3JQAA 4JXKA 4BNMA 1JWBB 3ZN2A 5AXBA 1VM6A 3PWZA 1MG0A 1WZEA 3Q3CA 4DC1A 1Z7BA 3F5SA 3ANLA 3ZNNA 3GDGA 1EFLA 1UP7A 3QE3A 3H9EO 4Q3DA 4DIFA 4PLFA 2H9IA 4L9RA 4D3DA 4DPLA 1HDOA 1UJMA 4BNGA 2PH3A 3V2UA 3ZWYA 4RDIA 2WE7A 3EZLA 1EEHA 2Q45A 4M87A 1FDVA 3DZJA 5G0UA 4U6QA 4QO8A 4WLOA 2DVMA 1LDGA 2J8ZA 1IHYA 2Y0EA 1XIVA 1R0KA 3ZWWA 1XR3A 2OORA 1HE4A 1HTBA 3UCXA 1A72A 4D3FA 1H2BA 3WSVA 4DWVA 5KTKA 4Z9YA 2PKRA 3SX2A 4ND1A 4FFOA 4IIUA 4BGVA 2VHVA 3GT0A 4BQPA 3AOGA 1YWGO 2X0JA 2YHIB 1QXSA 5L95A 2FMUA 1GYPA 1HDGO 2PNFA 3HDQA 3EUWA 2FY8A 2GN8A 4MDHA 2GF2A 1CWUA 2O3QA 1DAOA 3F1KA 2EG9A 5CDSA 2VWHA 4GPD1 1HSZA 4P38A 3BMNB 1BG6A 1NWCA 5LDHA 2O2SA 3EY4A 3D3WA 4QFDA 1ADBA 4G81A 2NU8A 2CFCA 4AJ4A 3PIIA 3IC5A 2CVZA 1KS9A 1ZK0A 3OP4A 3RWBA 4Z6KA 5CPBA 4ID9A 1PGOA 1T2CA 3AUAA 1VRWA 4YT5A 4E5PA 4RGBA 2RHCA 3WYBA 4EJ0A 1KETA 3DMTC 4BO2A 3X2FA 9LDTA 1B16A 2P68A 2DTDA 5C7IO 4DLBA 2C82A 3MWDB 3U5TA 1X13A 1IYZA 3D5TA 3DAPA 3GN1A 4GBJA 3JYNA 4XIYA 2WSBA 1N7GA 4YJGA 2Z1NA 2FN7A 5T8KC 5IFLA 4DA9A 5ENDA 3OIDA 4B3JA 4D79A 4GGOA 3UCFA 4AJPA 5I7EA 1LSOA 3AJRA 1LDYA 4WUVA 1ML3A 3WIEA 4R01A 3M1AA 4UUOA 4TQGA 2FR1A 5C37A 3TJRA 3RBXA 4B4VA 2ZATA 3WX0A 1WWKA 1DLIA 2JFGA 3ANNA 3KYCB 3L4BC 3NEPX 3RKRA 3L07A 4BNIA 3N7UA 1R4MB 1NFQA 3HWRA 5A3JA 3WICA 3ETEA 3ZWAA 3P7MA 1O6ZA 3OEWA 4OQYA 4FFLA 3ZV6A 3RBVA 2PD6A 4P4LA 2DTXA 5ER9A 1KERA 4CLHA 5F3RA 2HRZA 4D46A 1JTVA 3WGQA 4KUHA 1PJCA 3WNVA 1K2WA 2RHRA 3DZIA 5JYDA 3AM3A 3D1LA 2GYYA 2QW8A 5IF3A 3VPGA 1A4UA 1M66A 3DWFA 3QWFA 1BMDA 3ORFA 4FR5A 2DPHA 1XEAA 2NQ8A 5CP8A 4ESOA 4XYLA 4FFPA 4FN4A 4BGIA 4OOEA 1SBYA 3TZHA 4F45A 1VL6A 3OJFA 2FWMX 3ANMA 1VPDA 1EBUA 4GX1A 4J0EA 1MLDA 5T6BA 3GY0A 2CSUA 2BFMA 3K73O 1TEHA 4H15A 3H4VA 2EXXA 4PLYA 3LC1O 5JXWA 2YV2A 4BNKA 2X9NA 1H6AA 1E92A 3AUUA 1NR1A 4HWKA 3U49A 3UH1A 1BW9B 1OZAA 3WWZA 4CR8A 3LU1A 4O63O 4OL9A 4YRBA 3L0DA 2O7SA 4XDZA 4ALIA 1EK5A 3DO5A 1U5CA 4NNJA 2EGHA 3PP8A 3ASVA 4YAGA 1LRLA 4RVSA 4PLTA 4J0FA 3ROQA 5BSFA 3MWEB 1YBMA 1E5LA 1LNQA 4WK6A 3DOJA 3AOEC 1AXEA 3Q6IA 5F5LA 2BMAA 3MJCA 2Y05A 1QMGA 4A0SA 2X7HA 5JO9A 2YHUA 3ONEA 1C1XB 3SXPA 4BNZA 4Z3DA 2WYUA 1B2LA 1LXCA 3G1UA 5FI5A 4IDEA 1HZJA 1H0KA 2BH9A 4JBIA 5J23A 2VT3A 3WR5A 1NBOA 5COBA 2EJWA 1T26A 2H5LA 4MIEA 1PZHA 4JJGA 3ETDA 2V6GA 5DCWA 3FBGA 4CQMD 1H9AA 1UDBA 3RD5A 1GU7A 3MTJA 5AXCA 1FDSA 1P1RA 1EUZA 4WCFC 1EVZA 2DBRA 4GH5A 3EYWA 2CDCA 2GPTA 1UXKA 3Q0EA 3OF2A 4AJJA 2NNLD 1ONNA 3QVOA 3IMFA 6LDHA 4BV8A 3JQAD 4J7UA 3EC7A 5AXDA 3EHEA 3D5QA 4MVJA 1Y1PA 1O89A 2CF6A 1E7QA 4RL6A 3A14A 3UOGA 3HHPA 5BNTA 4MINA 1GD1O 2VTEA 5THKA 2R6JA 4K9DA 1IPFA 1CQIA 3H9QA 1VI2A 5L4LA 1D1TA 1SCUA 2HDHA 1M75A 2Y0CA 3UFXA 1ULUA 2B37A 1KVTA 3FF4A 3K31A 4J4BA 4PG7A 1ISHA 1ENPA 1JLLA 2W98A 3GAFA 4FB5A 1BGVA 4NU5A 4RVGA 5IJZA 1RPNA 3LF1A 1F12A 1JW9B 4PCVA 3PFWO 1ZMTA 2YZ7A 2JAPA 1QORA 5IXYA 1DJNA 2IDZA 3I9KA 3JCZA 4OQZA 4MO2A 4P4NA 4J4TA 5DN9A 4CMCA 2EEZA 4FS3A 3E03A 4XWYA 2QQ5A 4XYGA 5JDIC 1Q0LA 1HE3A 2FRDA 1LDEA 4ZRMA 4CM9D 4FIZA 2XXJA 3H9UA 4TSKA 5GZ3A 5ILGA 4NU6A 3O26A 4DREA 1SOVA 2R2GA 4CQLB 1XHLA 2VOJA 3LK7A 4J4HA 1ADCA 4JIGA 1Z73A 3GOHA 5G4KB 4JP2A 5COQA 3GC6A 4E12A 3TOZA 1Y5MA 4K1LA 1E3JA 1GUYA 1NAHA 4DQUA 5LDGA 2WDZA 2UUOA 4S1VA 3EDMA 1HYHA 3MTGA 4PVCA 4WOKA 2WWRA 3VH1A 3V2HA 4FC6A 1GQ2A 2E49A 5AVOA 4QT0A 4ZVVA 1I2ZA 2I67A 3BTUA 3H5NA 4AJLA 3KEQA 5DCUA 3QW2A 3S8MA 3QWAA 2WYWA 2Y1CA 4E13A 4P22A 3KYDA 3S2FA 4L4SA 1AN9A 3ZI0A 4B3IA 4NMHA 2UV8A 1LU9A 4J43A 3OJEA 4IQ8A 4Q3BA 4B79A 2GD1O 1ZW1A 2O48X 1O94A 3KSZO 2OBYA 3AI3A 1MFPA 3L77A 2OL4A 3S1LA 3DZGA 5G0TA 3MJSA 1WZIA 4KMSA 3RJ5A 1DJQA 4ND5A 2G82A 4FJ1A 2CVOA 2W90A 4PG8A 2DPGA 2WEKA 4BMSA 5BSEA 2V7PA 3JQBA 3X2EA 3WGYA 4AJIA 2O4UX 1YE3A 1EVJA 3SEFA 2Z5LA 1XU9A 2HCTA 4CL8A 4IINA 1R15A 4O59O 4BOYA 1WDLA 1PZFA 2HRBA 2WE8A 1IB6A 3VAZA 4RZIA 3COSA 1MX3A 2W2LD 3I5MA 1CF2O 3ZU3A 3PTZA 1BVRA 4BNHA 3KM0A 5CPFA 1T24A 4I9HA 5L7WA 1C0PA 4F6LA 3I3OA 2XOXA 2X1HA 3IKTA 2P9CA 2PKQO 4I9NA 4FQ8A 5TT0A 3H2SA 1YS4A 3W8EA 1NVGA 4IS3A 1X14A 4U6SA 4IDFA 1RYEA 3PWSA 2FHSA 2OMEA 4QTZA 1KY5A 1H93A 1NXQA 3A28A 4II3A 5GMOA 3HB5X 1E6EA 4CV0A 4KUEA 2PK3A 4IQGA 4OH1A 4J1TA 3V1YA 2GO1A 2A92A 4IDBA 1GDHA 3KO8A 2C5AA 1HSOA 4WGGA 3G1TA 2I3GA 3HADA 2CVQA 4QX6A 3RFXA 1HWYA 3HG7A 1P0CA 4J91A 3JQ7B 3U4HA 2Y1FA 1YB4A 3ROMA 1PJBA 5JMPA 3K2EA 1TA4A 4UEJA 7ADHA 2HSDA 2PGJA 1SB9A 3JD0A 1N1EA 4I9UA 1GCOA 4BGEA 2PFGA 5A04A 1OOEA 2GN4A 4PLWA 4PLPA 1HXHA 5IG2A 1WLYA 2PY6A 4DQXA 1NVTA 5DBGA 5A3VA 3ZWOA 3DXFA 4TVOA 4GVLA 2DM6A 4XZ3A 1VC2A 4ALMA 4TRJA 4E30A 4NJMA 1T4BA 4YQYA 3GVCA 2VHZA 1KEUA 1GV0A 3VOSA 4DYVA 2ZYAA 2C20A 1UAGA 1DIRA 1R4NB 2BGMA 1HYEA 4JJFA 4Q3CA 4CM1A 4A03A 3FSRA 4L0QA 1NPYA 1U3WA 3OIGA 4XJSA 4MVJI 4ZJUA 4B4OA 5H83A 4U0KA 2G1UA 4GVXA 5JFOA 2AMFA 2P4HX 5DCYA 4BO8A 2JHFA 4NBVA 3CKYA 4LSMA 1I10A 2D1YA 3WGHA 5MGBA 1T2DA 5K0ZA 3GRPA 4BNVA 4L73A 1DRUA 4NI5A 4TRNA 4C7JA 2E6UX 3VPSA 1RM0A 4A5OA 2UAGA 4PRKA 2V6FA 2YQ4A 4R16A 4PZCA 4EITA 1L7DA 4IDGA 1RWBA 3Q2KA 1NAIA 1RM4A 3M2TA 2TMGA 3F5QA 1XKQA 5JC8A 3PRJA 1DC4A 2DBZA 4BS9A 3RC7A 4D41A 4YT8A 2GLXA 2VZ8A 1R66A 3PHLA 3IOYA 1DFIA 1DIHA 2V65A 1B8VA 3IUPA 4BHTA 3RROA 4GX5A 3PGJA 2P91A 3JQ9A 2PZLA 4L75A 4R1TA 2ZQYA 4OAQA 4CLOB 3RUCA 2QRJA 3W4IA 4F46A 1E0DA 1SMKA 4A7PA 1BHSA 1TLTA 4M1QA 4AJKA 1UDCA 3WMXA 3RBZA 4DTIA 2OHXA 4QFCA 3NAQA 2PZKA 4DYDA 1ADGA 1C1DA 2NTJA 3PJGA 4ALKA 1JAXA 4IXWA 1AXGA 4JP3A 3ROPA 1R37A 2CNBA 3IAHA 3OHSX 5CDGA 2D0IA 2BFAA 3UKOA 1ENZA 3T4EA 4H7PA 3VKVA 4A2CA 1HT0A 3JD2A 3TOXA 1ZK4A 4D44A 5B1YA 1D7OA 2NVBA 5AQ1A 1E1NA 1UZNA 3C7DB 3OQ1A 1P1HA 1P74A 3W6ZA 2FPIA 2GASA 3NV9A 4KTVE 1QP8A 2HJSA 3QSGA 4OOFA 3QP9A 2HK9A 1GZ4A 2VRCD 2ZYDA 1HYGA 2R00A 3GG9A 1U3UA 2O50A 3TWOA 3NTQA 4HFRA 1E6UA 2IZ1A 3JSAA 4KQXA 3WIDA 3KYCA 1QRRA 3KEOA 1UUFA 4BKQA 4H16A 5BT9A 1MUUA 1R4MA 2SCUA 1D3AA 3N74A 4L76A 3BMQA 2HJRA 4WCDA 4TZKA 3MJVA 1QLHA 3JQFA 4CM6A 4W4TA 1UAYA 1PL8A 4L74A 3O03A 1IZ0A 5EQDA 1WDKA 3WBBA 1LDBA 3GVIA 1KY4A 3GNTA 2OZPA 1BXGA 1P44A 3HNPA 4CM8B 1T25A 4GWKA 3ITKA 2JJYA 1LBEA 5JO0A 3GUYA 2YW9A 5JAQA 3IJPA 4DXHA 1DDOA 5U4QA 3IKVA 3E5MA 1PQPA 3GZNB 4NFYA 3LF2A 1JU9A 3RUIA 3O4RA 2VQ3A 2Y1EA 1B8PA 4UVIA 3WJAA 2GERA 2QG4A 4Y6PA 5K6AA 3WXBA 1Q1NA 5A9TA 5C3MA 2JCXA 3R3SA 1I2CA 1E3WB 3IQDB 1Z82A 4D3SA 1PTJA 3AUSA 1BW9A 1OFGA 1C14A 4ONEA 4J2HA 3TZCA 4ND4A 1XGKA 3F9IA 3JTMA 1NVMB 2AG8A 3SJUA 1JA9A 3BTSA 4R4JA 3PEFA 1OC4A 5U9CA 1U4SA 2B4TO 2R00C 3DONA 1Y8RA 2EKPA 4GLOA 5KJ6A 5DBIA 1Y8QA 3FWZA 1I33A 3AU9A 1YOVB 3A1NA 1GPJA 1YB5A 4HXYA 1Y6JA 3IS3A 5ILOA 3LLSA 1JKJA 2HMSA 4RQUA 1X7DA 1TVEA 1MC5A 5H81A 4ALLA 4Z3KA 4J7XA 2O3TA 1T2FA 2VOEA 2BELA 3NKLA 3EVTA 4OSOA 3E8XA 1TXGA 4UUMA 5IN5A 1HDZA 1Q7BA 4R1SA 4EZBA 4ZU3A 3F4LA 4FDAA 3GFGA 4KUGA 4B8ZA 1DHTA 1LI4A 3I6QA 4HNHA 1E7SA 1P33A 5G0WA 5DULA 4DBVO 3FWNA 2EP7A 1Z6ZA 2ZB7A 2EGGA 4XX0A 1B3BA 3CXRA 2YV1A 2ZTMA 5I7VA 4WNIA 3HE3A 2ZKLA 4JROA 4CQMA 5CEFA 4AJ1A 3H3FA 4ZQGA 4YACA 5ITVA 4KZPA 2Y66A 5ADHA 2IYOA 1PZEA 4RPGA 1KYQA 2BGKA 4I5FA 3DMTA 5CFZA 1M2WA 3AY7A 2PGDA 5U1PA 3WGTA 5CDYA 4G65A 5IN4A 1A71A 1PQWA 4NJOA 1J4AA 5JNLA 5CAEA 1UXHA 4YB8A 1ZMOA 5T8KA 5BQFA 3WJ7A 5JMWA 4E3ZA 3VPFA 1X15A 4BIIA 4TRMA 3BMCB 2E82A 3F47A 4R5HA 2E4AA 4GMFA 4DIOA 1U3VA 3ZHZA 1GEEA 4UVHA 2VT2A 1YL5A 3B1KA 3KYBA 2D8AA 3D4PA 3RUAA 3KSDO 4P4GA 5THQA 5IAAA 3ONDA 2EW2A 4II2A 5JLAA 2VN8A 1JVSA 1Z74A 4L4RA 1GQQA 1P77A 1JDJA 2PLAA 3L4BA 4QEDA 4LSWA 1Q7CA 1N9GB 4WASA 1HZZA 4GMGA 4FCCA 2IZZA 4G5HA 4CM9A 1ONPA 2ZTUA 5B4VA 1M6HA 1OBFO 5IDQA 2GUGA 2FP4A 4PGFA 1FMCA 2D59A 5I9NA 4IJVA 1P31A 3W6UA 1IZ9A 3GHHA 1GYRA 1L7EA 3AUTA 2GZ1A 3GFBA 5KJFA 1LJ8A 3U4CA 3PFFA 3DFZA 1PX0A 4Y8VA 4HY3A 1UP6A 3PI7A 4E5YA 3QA9A 2Y1OA 2YFQA 4DBZA 1E5QA 4FC7A 4WNCA 2EERA 1A9YA 3I52A 1HF3A 1T2AA 2Q2QA 3HDJA 3PLRA 3W4JA 1DOHA 3B20A 4KDEA 3NDJA 1I30A 1Q7GA 4QECA 3IIEA 4I08A 3K9QO 1A9ZA 2WD8A 3L9WA 5JDCA 2G5CA 4MOWA 3K96A 4AG3A 1W6UA 1VL8A 3UGKA 4IDCA 1ZSYA 1SPXA 2OP0A 3DTYA 1ID1A 4EEZA 1JKFA 1VE9A 4DMMA 4LGVA 1EE9A 4GQAA 5A05A 4E5KA 4CMIA 4M55A 1ONOA 4ZGWA 2WTBA 3DBLA 2JAHA 3JYOA 3WLEA 1PJLA 4CLRB 3U4DA 4AFNA 3S2IA 4U0JA 4GKBA 5GY7A 1YQGA 3F4BA 2RIRA 3PDUA 4E32A 3AOEA 3TRIA 2GRAA 4E2WA 3BTVA 4KWHA 3TDKA 2YQ5A 3U62A 2AEMA 2W2LA 4DUPA 1FXSA 2YYYA 4QUKA 3RKUA 3INRA 1BXZA 1DHRA 1MA0A 3NDIA 4WLFA 1EMDA 3H65A 5A4DA 2WD7B 2G17A 4UVDA 1U7HA 4LW8A 2BRUA 4JLWA 4U7WA 5L3ZA 3GGGA 4PIVA 2H6EA 3AY6A 1ZSVA 1YXMA 1CDOA 1KVRA 3K2BA 3WYCA 3WTBA 4DIBA 3DBVO 4UVGA 3G49A 1DRWA 5F1PA 1HEUA 5B4UA 1F0YA 5CDTA 1YVEI 4WCFA 3PQDA 4FD3A 4ND3A 4YJHB 1V3UA 4EDFA 4XDYA 1LLQA 4IS2A 4WKGA 3PYLA 2CMDA 2ZQZA 4XKJA 5TF4A 3DEYX 5DZSA 4R69A 4NQZA 1QYXA 1VKNA 4PLGA 3JV7A 3UW3A 4IDDA 4WJZA 3WDSA 4HV4A 1ZXLA 5JDCC 2VWGA 2NVUA 5G0VA 3VKUA 5IZCA 1GZ3A 4HADA 5JAZA 4R3NA 2B36A 4R9SA 3DOCA 4JK3A 2PTGA 3KRTA 4W7IA 1FF9A 4BO6A 5L9AA 5HWSA 4QO7A 4LMRA 4AVYA 5TJHA 2A94A 1PR3A 3UXYA 4BNLA 2W2KA 3FNHA 3KBOA 3AW9A 5BR7A 4QSMA 4B7CA 1U2GA 1YO6A 4NFHA 2A9FA 3W8FA 4R1NA 1VJ1A 2BFPA 2IXBA 2J3KA 2VRBA 1A27A 3GN2A 4LCEA 1AHIA 4EBFA 2Q4EA 5JDIA 2DBVO 2PZJA 4MVJG 1Z7EA 1ZSNA 4XGIA 3BXXA 5ICSA 4HUJA 1TT5B 5G4LA 2ZB8A 3OBBA 2NU7A 4BO0A 4J3FA 4LCJA 3E18A 1H6CA 5DOVA 3S2GA 4ROSA 3RUHA 3QWIA 4MJLA 3FPLA 4EJMA 2VCYA 4OKIA 1LA2A 4HFMA 4RVFA 2FSSA 1PS8A 3DTTA 5CEJA 4INAA 3NYWA 1W0CA 1H9BA 4K6FA 3WQRA 2ILTA 3C7CB 2C07A 1LRJA 1WVGA 3GMSA 4D45A 1E7RA 1PGQA 3JD3A 1PGJA 3OJ0A 4JBHA 1Q0QA 4CLOA 3NTRA 2IODA 1MP0A 4XGNA 4YBZA 1XCBA 2X58A 3DBHA 2ZK7A 3NT5A 4UULA 2B5VA 4TWRA 4XCVA 5BNIA 2I6TA 1SEVA 2I66A 4PLZA 1QLJA 2IZ0A 1V9LA 1DXYA 1EZ4A 5ENVA 4MVJM 4QQRA 5L7YA 1H6DA 5IZCC 1B3RA 3HDHA 3GG2A 4E5MA 5KKCA 5I8ZA 2O3JA 3JQ8B 1QV7A 3RC2A 3G79A 4OYRA 3LYLA 1XU7A 1N2SA 3ABIA 4JX8A 4K6CA 4KOAA 4CLXA 2LDBA 1LSSA 2CDAA 1YONA 4PLCA 1ZO8A 3EMKA 4MP8A 4F3YA 1X7HA 3F46A 5JY1A 4J1NA 4QXMA 4URFA 1I3LA 4YAKA 2Y67A 4DPKA 2P2SA 2ZCVA 2ZIZA 4XD2A 3NT2A 2DT5A 4UUNA 1EVYA 3G17A 3HB4X 4MVJE 4RF3A 3A06A 3H6KA 4HNGA 4WLUA 1KEVA 1ZXBA 4TZTA 9LDBA 3PLNA 4W9NC 4OXYA 4OMUA 5EPOA 4RDHA 1PGPA 1ZK2A 4N54A 2VRCA 5HTOA 1D1SA 1DFHA 3QVSA 3JQDA 5JE8A 3ZWXA 1XQ6A 3M6IA 3EK2A 2J5QA 4NH4A 4YPOA 3PHGA 5AXAA 1GAEO 4EW6A 3CTMA 3L6DA 4BNFA 3PVZA 3B1FA 5HM8A 2IXAA 5FI3A 1W73A 4BL5A 2I5PO 2HMVA 1ULSA 4CMEC 4KTTE 1M6WA 3HN7A 2RBEA 1UXJA 1WNTA 3HSKA 4JN6B 2AA3A 1FDTA 2UDPA 3Q9UA 3GGPA 1Z75A 3EAGA 1QYDA 4CM8A 4DGSA 2V6MA 2NUAA 1SO8A 3Q11A 5I9LA 5IZ4A 4RLHA 1PJ4A 2HU2A 1V6AA 2AG5A 1UZMA 1OAAA 4W7HA 3ON5A 1E7WA 1XYGA 1D4FA 2V6BA 3GZNA 5BNFA 3ZGYA 3AWDA 4ZHSA 1N7HA 3DZKA 4BNTA 3H7AA 2B4QA 3H5AA 1E3IA 5TNXA 8LDHA 1U28A 3D3WB 1DC5A 2AE1A 2TMDA 5A9SA 1HE5A 3DQPA 1SB8A 1E3WA 4PLHA 3ZWPA 2C2YA 2DFVA 3C85A 1AGNA 3O8QA 2DLDA 3LZ6A 3OJLA 3OM9A 1IL0A 2NU9A 3SC4A 3ZV5A 3BHJA 4DPMA 3ZHYA 2OO5A 4YJGB 4NBTA 4E6PA 1JKIA 1A7AA 1SNYA 2PR2A 4RPJA 5T5QA 5TRTA 4E21A 3PQFA 3AFNA 1YOVA 4PZDA 1HDCA 1TB4A 5KWEA 2OFPA 2X0RA 1NYTA 4BNNA 5ES3A 3WQQA 3AY3A 1BTOA 3BMOA 5HBRA 3GPDG 1E7MA 2BD0A 1EQUA 1CERA 2JHGA 2A35A 2D2IA 1KBZA 2GZ2A 2UYYA 5C5IA 1LUAA 1P1IA 1U4OA 3ZWVA 5TLSA 5T64A 3OH8A 2EIHA 3I4CA 4J9UE 4XEHA 5IDYA 1PWZA 2HK8A 2J3IA 1ADFA 3FNGA 3OQBA 3WGIA 1YQXA 4NK4A 4CM4A 2VNSA 4AJHA 3I83A 4IUYA 3GMDA 5L40A 1PJ3A 1YBAA 2P9EA 4CUZA 1PU2A 2NM0A 4CMGA 2VWPA 1G0OA 3KB6A 3OA0A 2I76A 4IJUA 3QJ5A 4IPTA 5JAMA 3V2GA 3F1LA 2DUWA 1LC0A 2AQKA 4WLEA 2I65A 2I99A 3VDRA 1DAPA 1IY8A 3C24A 1H6BA 1DBVO 2X8LA 1B26A 2CDBA 3W4KA 2Z1MA 2YY7A 1P45A 2X4GA 3H5RA 1JAYA 3M2PA 5ITWA 5A1TA 1ZCJA 3KETA 1PZGA 2C59A 2RAFA 2J6IA 2HO5A 1AE1A 1DIAA 1I2BA 4G2NA 1QYCA 5KNLA 2JL1A 4PVDA 2YV3A 4KQWA 3CIFA 1H94A 3PGXA 2Z95A 1M76A 3BYZA 4BO4A 1N9GA 5A03A 3AFMA 2VUSA 4RPKA 2YHIA 3IDSA 3PK0A 3ZU4A 1QR6A 2Y1DA 3SC6A 3TPCA 1O95A 3MZ0A 1ZEMA 1ISGA 1PJSA 3WFJA 3UHAA 4Y67A 2PKQP 3ETGA 3ZDFA 5GZ6A 3EW7A 5CDUA 1V3TA 2O2YA 4O0LA 2CY0A 1B0AA 3E48A 1J49A 1EFKA 3NDRA 2HAEA 2Q46A 5TC4A 4BNXA 3BMNA 3W8DA 4BB5A 5IDXA 3DAGA 3GAZA 4ITUA 1B15A 4CL3A 5FYDA 1O9BA 4ZICA 6ADHA 2AE2A 3PJFA 2EHDA 2EKQA 4BNWA 5IXSA 3C8MA 1NM5A 3WSWA 3HDYA 2ZB3A 4Q3NA 4NDNE 3OQ6A 4LVUA 4Z0TA 3KLMX 2FR8A 4YAEA 3TZ6A 4CM5A 3I6IA 1YBVA 4JNKA 4FGWA 4BNYA 2C7VA 1QKIA 1LDNA 2AQHA 3DBRB 4OXNA 3RFVA 1FDUA 2ZJ0A 1UXIA 1ZFNA 4N18A 3D7LA 4YAJA 3IP1A 1KEWA 1CQJA 2DKNA 3U0BA 1WAMA 1EUCA 2POQX 3G0OA 2C7GA 1I8TA 1UR5A 3P2OA 2BF7A 1Y5RA 2QX7A 4BQRA 4RVDA 1KVSA 1VSUA 4IZHA 1DIGA 2JD0A 3A4VA 1V3VA 1PS0A 2NADA 5F1OA 3QQPA 3R0IA 4YAIA 3TZQA 4IGFA 5EMHA 3KTDA 5A5FA 4FGSA 4CLRA 3M1LA 4RQTA 3PJEA 2X9GA 3QWBA 2PD3A 1A7KA 4DQVA 3Q1LA 1R12A 4ZD6A 1KC1A 4E2XA 4CUJA 1U5AA 3RQSA 2E48A 1ARZA 5L51A 3T4XA 3FBTA 4D43A 4PLVA 4K28A 4IJKA 3B6ZA 4MKXA 1ENOA 2YDYA 4XQCA 4A73A 4O6VA 3VVBA 3DZFA 4B4WA 2NV6A 1E3EA 3E5RA 4GKVA 1X1EA 2VYVD 3BHMA 2FPPA 1VSVA 3KUXA 1WPQA 1OI7A 4XA8A 4YRAA 5CHEA 3KZVA 2FOIA 4CV2A 3ZHXA 1BRMA 4R68A 3P5SA 4YJHA 2P5YA 3HFGA 4UUPA 3Q9NA 1Y9AA 5HS6A 1J5PA 1Q0HA 3RIHA 1P9LA 1QYVA 3UUWA 4RF2A 3CSDA 1U8FO 2C29D 3OIFA 1R16A 4HP8A 1J6UA 1XSEA 3N58A 3RC1A 3VH4A 4XIJA 4IIVA 3MCVA 1EUDA 3GA0A 4FFMA 4RVUA 4IBOA 1ZUD1 1TI7A 3MOGA 3WGOA 2EF1A 3RFTA 3CPSA 3KYDB 3WYEA 4CLDA 4UEKA 4WOJA 3CMMA 4J1QA 4ALNA 4ZA2A 2HUNA 1KOLA 5F21A 3V8BA 4YQZA 3O38A 1NQOA 2O3RA 2Q1SA 4RO0A 4AJNA 4BGUA 3L4SO 2PWZA 4MKZA 4J16A 3QV1A 4GAEA 1GR0A 2F00A 4CMAA 3ZWMA 2BLLA 3GUCA 4L4XA 2VHXA 2C2XA 5MDHA 1YQDA 4PN3A 1O8CA 5DNAA 5COAA 1GCUA 3RAJA 5I9MA 1YDWA 4Q3AA 4EUFA 1F14A 1C1XA 3C1TA 3RUEA 2UVDA 2C0CA 4IGEA 3RI3A 4CPDA 4WLNA 1LRKA 1OC2A 2AHRA 1LLUA 3KSUA 3TL3A 4BMVA 1B7GO 4IY1A 2X6TA 3G3EA 4BUCA 1GYQA 1OMOA 3ZW9A 5I8WA 4BV9A 1YJ8A 2PV7A 1CYDA 4WPGA 5JAIA 1BSVA 1FDWA 2AW5A 3VVCA 2OOSA 1SC6A 3VH2A 4MVJP 2H63A 1PL7A 3DAFA 4BKPA 1GV1A 2I3AA 1CIVA 4C4OA 4FPXA 4Y98A 7MDHA 4BO9A 4M49A 4EYEA 4Y6RA 3NRCA 4W99A 4LN1A 1B14A 4N5NA 1WMAA 3INGA 4XYEA 3GPIA 4GLLA 4JGBA 1ZBQA 4NBUA 4CV3A 1I3MA 4P8RA 2EKLA 3GRKA 3ZCXA 1HL3A 3FHLA 4FOSA 1V8BA 3LLVA 3PZBA 1F8FA 1LSUA 4RZHA 2RH4A 2Y1GA 3QLJA 3FPCA 1I36A 3E9MA 5I7SA 1PIWA 1GUFA 4NJMB 1JN0A 3KLPX 4KDFA 1HDYA 2QRLA 4RF4A 2IRWA 2H1SA 3GEGA 4UEOA 1ZEJA 2BGLA 3GGOA 5KOIA 2QRKA 2FZWA 1LQUA 4YR9A 4RV9A 4N5MA 4A26A 1DC6A 2LDXA 5AOVA 4J7CA 5C7LO 2IEDA 4CQLA 2JCYA 4HFJA 5EL0A 1QV6A 3GF4A 5G4KA 2JD1A 1ZK3A 1DO8A 1I3NA 3PDJA 4X54A 4PZEA 3WTCA 2BI8A 4B3HA 4Z0PA 5KCZA 3NUGA 1XA0A 3JQGB 3Q2IA 3AK4A 1I32A 4XR9A 4Z9XA 1NWHA 5DP1A 3I4FA 3LT1A 3TQHA 1A4IA 5FEUA 2DQ4A 4I8XA 5A02A 3H2ZA 4DL9A 4TKMA 4IZIA 2CUKA 1UZLA 4YJDA 1HRDA 3ONFA 5H82A 4OXKA 3ENNA 1X1TA 3JYQA 4CMKA 4HX5A 1Q2XA 3GVHA 8ADHA 1N8KA 3SLGA 2O7QA 3ZU5A 1I3KA 3I9JA 3ZW8A 3OJOA 4R5MA 3ADPA 1E7YA 2B35A 2B5WA 4XQ9A 4FJ0A 1BDBA 5EJ2A 5TJ9A 2JCVA 2AEFA 4HKTA 1EDZA 2O23A 4UVEA 5EESA 3CINA 3R6DA 4WEOA 4F6CA 1C1DB 4FSHA 2ZB4A 2VZ9A 3AI1A 3TNLA 1KVQA 1NPDA 3PYMA 4XYBA 3BAZA 2VYND 4ZQHA 4RLSA 5DDIP 4RPHA 1CRWG 4RJTA 5ICMA 2OXIA 3VZRA 3I9NA 3VPHA 2XAAA 1G6KA 2X5OA 3DHYA 2HMUA 3FR7A 5CG2A 2YJZA 3TFQA 2Q2WA 2P4QA 3RU7A 4CJXA 2GGSA 3FCOA 4MVJH 1N5DA 1DSSG 3DR3A 4BO5A 5BSGA 2EV9A 3BA1A 3DHNA 4BO3A 1ISFA 3UN1A 2Q49A 4RORA 2X5JO 4HBGA 4Z0HO 4PFJA 4I1IA 4WE3A 1UDAA 3TN7A 3K92A 1LQTA 1MV8A 3NJ4A 3SJ7A 2EP5A 4B4UA 2RCYA 1NTOA 1NX6A 3H8VA 1YKFA 2VTDA 1IHXA 2GN9A 3ZZNA 1G1AA 4R41A 2C54A 3FN4A 4AJEA 1YL7A 3ZNPA 1MXHA 3SVTA 1K6IA 3E82A 4CMJA 2DU8A 4U5QA 1WMBA 1R6DA 2WJPA 3K8ZA 1Y9EA 1LSJA 3BMQB 3JQ7A 5JYEA 3CZMA 3KHUA 3OETA 1C0KA 3L6EA 3K5PA 4ZQFA 1IULA 1LX6A 3FR8A 4JBGA 4N5LA 2FR0A 3STHA 5L7TA 3D4NA 1A5ZA 4J90A 5TSDA 3SBOA 3GEDA 4DVJA 5IDWA 3GNSA 2Q1TA 2AQIA 1DLJA 1UP4A 4FBGA 4KWIA 1GL3A 2VUUA 1BXGB 3PQEA 5DT9A 4NHEA 4FFNA 2X9VA 3O9ZA 3NGXA 4D0RA 5AYVA 4ZQEA 1PS9A 4WEQA 1S6YA 1SAYA 1HE2A 4R54A 4LRTB 1LDMA 2X0IA 3PJDA 3DZHA 4AJ2A 3AI2A 1R4NA 4Z9FA 2WYVA 3OA2A 3VDQA 2Q1UA 4EGFA 5BSHA 2O4CA 1I01A 1CEQA 1K3TA 4DLAA 2WMDA 2Y0DA 3E1KA 1H5QA 2QYTA 3ZU2A 4NBWA 3RU9A 4MP3A 3RSHA 3P2YA 4W9NA 4AJOA 2NTVA 2PGLA 4Y9DA 2GN6A 1KC3A 4R1UA 5L4NA 1C0IA 1E6WA 2Q2VA 3AM4A 5B37A 3QIVA 3GLQA 3ULKA 3VH3A 3T7EA 4XGKA 4CR7A 3KVOA 5KJEA 4EUHA 3D0OA 1Y8RB 4ND2A 5JCXA 4BKRA 3HFSA 3WOHA 5JCJD 1Y8QB 3OECA 4OO3A 3WGGA 2VUTA 3CMCO 1XWFA 4JCOA 1T1SA 1UXGA 3NJ8A 2I9PA 4LVCA 3VZSA 4H3VA 4O5OA 3KV3O 4CMEA 1WDMA 4M54A 2Q50A 5ER6A 4W82A 4BNUA 1F17A 4YJFB 2X22A 2HMTA 3DC2A 3MEQA 2D5CA 3JQCA 5JPIA 3RC9A 2NU6A 4E5NA 3GZ4A 4M8SA 3UVEA 1HDRA 2ZJ1A 2Q1WA 3FTNA 3TL2A 2OP1A 3VHRA 4A27A 4YXFA 1VJ0A 4GSLA 5JS6A 3E6AA 2NTNA 4ZN6A 4BO1A 4IQ0A 1PJQA 4XJTA 5KVVA 4MKRA 2PZMA 3F3SA 1K0UA 3EGOA 3FNEA 3DB2A 3HQ4O 3PZRA 2B83A 2JD2A 2O3UA 3BHIA 1YGYA 3DBRA 3GVPA 5LC1A 3WFIA 4CMBA 4CQMB 3ROKA 1L1FA 5HRUA 1XQ1A 2X5KO 2B0JA 3PIDA 3QHAA 4YEDA 1U7TA 1DIBA 3NTOA 5EQFA 1GY8A 3GR6A 2Y93A 1SEPA 3JQAB 3TZKA 4C7KA 3IJRA 3PXXA 1ZZEA 4TRRA 2Q99A 1ZH8A 3DMYA 2IYPA 3VTFA 3I9MA 4CV1A 2IEBA 1HLDA 1GEGA 1E77A 2Y99A 2GR9A 1NFRA 2FSVA 3GVXA 3JQEA 1X7GA 1T1RA 3FTPA 1GPDG 5LCXA 3S2EA 1MB4A 1MG5A 4OJNA 5FFFA 1QG6A 4RCVA 2J5RA 1PGNA 4CM3A 1G0NA 3LSYA 2GCGA 1LC3A 1NQTA 2C5EA 5EINA 4IDAA 3U3XA 3HUDA 3L9XA 2QZ9A 3FD8A 1H2HA 2NACA 4IMPA 2EWMA 3WS7A 4OM8A 4DLLA 1T2EA 1U9JA 3S55A 3CUKA 1ENYA 1PSDA 3H9JA 1F06A 1UH5A 4NG5A 4A10A 4YYZA 4HFNA 4BKOA 2X86A 3W1VA 1MC4A 4IMRA 2B4RO 5KJ1A 4WLVA 1LTHR 4FOOA 2DFDA 1C0LA 2VZ0A 2J3JA 3ZWNA 2VYVA 3VPXA 1VKOA 1P1FA 2AEJA 3V5NA 4JJIA 4M86A 2NLOA 1QSGA 2W8ZA 3JYPA 4GGPA 4YCAA 5JW6A 5CEEA 1U1IA 3ZHBA 3AU8A 3WB9A 4IXTA 3QRWA 3QVTA 3LT4A 4CR6A 1F8GA 3UCEA 4RF5A 1HDXA 1U3TA 3TSCA 3D4OA 4GL4A 4OHUA 1KEPA 1PJ2A 2YFHA 3LDHA 3RJ9A 3ZNQA 5L53A 4XRRA 1NASA 3A9WA 5F1KA 1I5RA 4YTEA 1HETA 5TX7A 1O0SA 3I23A 4CMHA 2XPCA
chains in the Genus database with same CATH superfamily
3IVMA 2LTAA 3IP9A 5EE1A 4CMIB 4E33A 1P19A 1RVV1 3ADOA 2EGUA 4LTNA 4Z2AA 1EVIA 4HQ0A 4ARZB 2ZREA 3LC0A 3ZBQA 3DBIA 3CF2A 1NPTO 5I4CA 3GRVA 1NFFA 2NQTA 3Q1KA 4UBNA 3SZ3A 5BSRA 3F8WA 2PKWA 4IIEA 4LXHA 1VGVA 3LG2A 5CNKA 3DP9A 4EA8A 4S3MA 1Z3IX 1XV5A 2A33A 3E9QA 3IT1A 4WK4B 3PUXA 4OKNA 1K7EB 1KOJA 1U0LA 2X23A 4LJRA 4BO7A 3LY7A 5AI0A 4K26A 2VFAA 1UCFA 2GHIA 1QH1A 3FPAA 5J2UB 4BFVA 1BHO1 5JY6A 3QH4A 4C3ZA 2DC1A 3D7KA 3OCXA 3V9PA 2DRIA 1BWSA 2I4TA 3PC8C 4IEFB 3ZW7A 2J9GA 1KEEB 4B6PA 2VHWA 5FAKA 5FWNA 2EC5A 1AHPA 4R51A 1IJKA 3ZS9A 1E63A 1GG9A 1GZ6A 3L93A 4DQLA 2WM8A 5AI9A 1HLPA 3KQSA 4CW7A 4IHQA 3D31A 3GJ3A 4KQ1A 1VLHA 2FPSA 4YA6A 4NK5A 1W88B 4BQEA 5C7OO 1TD9A 3IT3A 3TYXA 3WK8A 3F73A 4OSPA 4KK3A 5TIIA 3HUTA 1EK6A 2XTMA 5P8WA 1G8GA 4LYYA 121PA 1GUZA 4GFDA 4LBZA 5MHTA 2YY5A 4Z54A 3VC1A 1GADO 2Q3EA 4EEXA 5D51S 1DBQA 4ENWA 4CVNA 3ZI7A 3A3KA 4LZLA 2XSZD 4HS4A 2EDCA 5AMXA 5JJCA 1EK0A 4JJEA 2NSDA 2IUYA 2BR5A 3H2HA 2IYZA 4ZPJA 1P1JA 2LPMA 1MHTA 1X3LA 1L7VC 3GD5A 2QD4A 4FYJA 1V4BA 1PJTA 3HZRA 5DM0A 4AICA 1S01A 1NULA 3D9QX 5IT5A 1RBZA 4BKUA 4AYTA 1MF7A 4LV5B 4OQXA 3NGLA 4GWGA 2A3RA 2AFIE 2ZCUA 2A0UA 4EHHA 1OHHD 3SXUB 2R8YA 4DUGA 4RVHA 2YJNA 1L8OA 5A5EA 3SS7X 3UB4A 1J99A 1OWMA 5H3LA 2ZYTX 1MT0A 2VAXA 3JQBC 4US0R 2GDZA 4HSEA 5K3FA 2PUHA 4LFCB 3OU6A 1LW6E 1OROA 1QG0A 2W2KB 3GIWA 5C1PA 5BSWA 2JI8A 1WM1A 1DCFA 3P19A 1MENA 1RLIA 1V8DA 1DRVA 5AK5A 4QZVA 1XG5A 2WNHA 5KYYB 5ADVA 1CDZA 1FTWA 2GN0A 4EPVA 1C0EA 3C15C 2D62A 3QEMA 1PK7A 2VHYA 4D42A 3E8SA 4RHFA 1N8SA 2C31A 3FDZA 3LC2O 3E70C 3HZOA 4GT1A 4MCAA 1KJNA 2F67A 1NP3A 3L0IB 4R9RA 1IDN1 3DOOA 2VNAA 4OP3A 3GH3A 3OURA 3JQGA 3K09A 4BWFB 1BEUB 2RK3A 4ZAGA 1CETA 3TX2A 1FTSA 1W4ZA 2JIBA 2JIPA 2LWIA 2QRVB 3EXG1 2GSDA 1GCGA 3ABRB 2ET6A 5TGDA 4DZRA 1EP2B 3ZY4A 1LK0A 3R41A 4NC9A 1E3SA 1DELA 1KH1A 1L5YA 3B78A 3MAGA 4TWAA 4KXVA 1KP2A 1RYMA 2PRZA 4LV6A 3MJDA 5T67A 1HQYE 2XNDA 2YASA 4FGKA 4L07A 2D54A 4PRLA 3H3XA 4D0SA 1F9EA 2ZWPA 1XELA 1W5FA 2WM3A 4LZNA 1XTKA 1K92A 2YOHA 3CH6A 3M4ZA 4MHSA 2FZEA 4I19A 2B4KA 2FOLA 2P69A 4Q9IA 1N1GA 5CD1A 4EJ6A 2DTEA 5LU9A 1Q7TA 4TVKA 1FYFA 1K88A 3IL2A 1W36B 2RONA 2G1AA 2WIDA 3SKXA 3TW6A 1NW8A 2I6SA 4FN5A 4CKWB 2QJTA 3CLTC 3T3MB 2QW0X 1P6XA 2V3VA 1Y6ZA 1G42A 2ZE7A 5BW5A 4V1CA 1U2DA 2C5FA 4QFBA 1KK2A 3IP3A 3WC4A 1B6GA 1SKBA 3SLKA 16PKA 2WIKA 2JJ1A 3D7MA 2P5UA 4ZPXA 4Q9NA 3DPSA 3IJEB 4JJ8A 1TIKA 4S12A 4WKNA 2QSZA 2PA3A 3LGXA 4MW2A 1CRQA 2F1KA 2VF7A 4LC0A 3OFSA 2QMOA 3PCTA 3QVWA 4LGYA 3KZCA 4BX3A 4C6TB 4UASA 1SZDA 4DCGA 5JI3E 3OFKA 1U0NA 1L4NA 3T06B 1YUNA 5TS3A 4D96A 5AUPB 3UICA 4YVFA 5E6SA 2NIPA 3M1IA 5HUJA 1SC9A 1UMDB 2RJOA 2YNMD 1ZITA 3BDVA 3ESBA 3KX2A 1YRYE 4JB2A 4RFSA 1YJQA 4ZEVA 3RYCA 3AF5A 3SC3A 1ZN7A 4YWJA 4AMGA 2DWPA 1YRHA 4E4TA 4GI5A 2A57A 4JEIA 4XQEA 3GP8A 3TNJA 5KYVA 5IPFA 3U44A 1V4VA 3BH0A 4NR0A 1JQBA 3GCWA 4NS1A 5KVCA 1SPBS 4FI3F 3S2ZA 4EI2A 3B5IA 6YASA 4AXBA 3BDAA 3AQ4A 3A1TA 1ULAA 2GJ8A 2GBLA 1KEKA 2VDMB 3D3JA 3H04A 4I50B 1MXFA 4GX0A 3O93A 3ENWA 3OM1A 1XDWA 3UAWA 4TL6A 4ZODA 1OYWA 1FE8A 4Q93A 3ZDQA 2REBA 5JSZA 1T4DA 3DMFA 4N0MA 4LTMA 2J3HA 4TMKA 3C6YA 1IWOA 4LZAA 4KSCA 1FL9A 2UZ1B 4HWSA 3SP1A 1M7GA 2C2OA 2V97A 4IIYA 3STVA 5LYJF 1JR3A 2C0QA 3VZBA 3FRJA 4YRPA 4Y1FA 3Q10A 1A8IA 3EPLA 5TGZA 2XQVA 1IPEA 5IULC 1U31A 1NA5A 3G0IA 3LQ4A 1UWCA 1VOTA 3NYIA 3VZQA 4CTJA 1Z0JA 3PFCA 3PD7A 2GHQA 4ROTA 1D8AA 4C05A 5HS4A 3OWHA 4RTJA 3TUZC 1X0XA 1UPAA 3EWAA 5CW2A 2AXQA 3A4YA 3W5VA 2BISA 1B4DA 2HSGA 2VDWA 2D2EA 4XRGA 2V7WA 3BPSA 3I09A 1N2CA 1LLDA 5DI9A 3R7NA 3HM2A 2QXYA 4P93A 2ZYIA 3MMZA 2JGDA 2ZTLA 2AKAB 3OMLA 4ER6A 4OMDA 5CFQA 2GJSA 3EMVA 2VTKA 2X2PA 1B6RA 2VDOB 2CL0X 3N87A 4CUKA 3EIUA 3GDOA 3DDNA 3WGZA 4XSGA 3CUVA 1F4VA 4L5CA 2GZ3A 3L6BA 1TT7A 3ZXIA 2AJCA 4BMNA 2J31A 1NW7A 3HJGA 4V39A 4N48A 3UAZA 4CRWB 1P7WA 3C3JA 4FX5A 3CC8A 1PYGA 2UUPA 2QZZA 1Z38A 4RMNA 4CODB 3TX6A 3CE6A 2JKVA 1XMQB 3JD4A 2W6MA 4K8RB 3ID6C 4NH0A 3KQHA 2DFTA 1KK3A 4AZSA 3KSAC 3SLRA 4D9HA 4EUEA 4MIYA 1WW8A 5LQNA 1E0JA 4ILKA 4LK3A 2HA4A 3UOAB 4E2ZA 2G67A 1QCCA 4WECA 4PCAA 3PRYA 3P4YA 4XR4A 3WG9A 4DLNA 2TYSB 3W6NA 1TK3A 4IQ4A 2ZYWX 5EHNA 1OGIA 5A06A 3KWJA 1VDZA 4FS8A 3BMOB 4IIJF 1AUOA 5JNSA 3QJGA 1M6EX 2FPOA 3AM5A 4E88A 5ESXA 3SOZA 3OSUA 2H52A 2QI9C 2CVHA 1WB6A 3KOUA 5GOZA 1HTWA 1P5HA 1EE2A 2ZIXA 4F4IA 2JAOA 2EJVA 3SBXA 5BV2P 5LP6A 2XVAA 4UZEA 4MP6A 5DP2A 1KO5A 3U7HB 3H9CA 5AM4A 3U09A 4KJZA 1UFOA 3HJAA 4WZZA 5CT4A 1XROA 4DC9A 4MAAA 1TDJA 4JBNA 1Z5ZA 1PKXA 1R6VA 4KPGA 2R8OA 2YBDA 2P6RA 4F5WA 4FHCA 3AKDA 2ZM6B 2VATA 3E9DA 1VCMA 2W6CX 2WJ4A 4BNDB 3VTZA 4DTCA 2GTHA 4MICA 3CN9A 4CFSA 1ZVMA 3TLYA 1T9ZA 5M7EA 3TGPA 3LQFA 1PN3A 3MCAA 1I7SB 1R27A 4JXKA 3EF0A 2RMKA 5H02A 3UA3A 5AXBA 2IPXA 1M1YB 1WZEA 3PNOA 4B3FX 1GRNA 3HNOA 3D0KA 4L3VA 3F5SA 4WVLA 5JCOA 3ZNNA 4WERA 4EQZA 2BR3A 3FX2A 4W5HA 2BCEA 1BXRA 3DTVD 3H9EO 3R5KA 4DIFA 3L7KA 2NGRA 2ANCA 4M88A 1D8TA 2PH3A 3PRKE 4JBYA 3SQLA 3V2UA 3ZWYA 2QW1A 1XAGA 4F6RB 3DTVB 4C01A 2QRPA 4M87A 4KO3S 1H0SA 1GSAA 3ASYA 2GK3A 2JIOA 2QN1A 3PR1A 4FT4A 1OU0A 4U6QA 4V0SA 4B75A 5K0BA 3PNKA 3EC2A 1NNLA 3LH5A 4YPOA 3RDPA 4OATA 4P84A 3V2IA 2Y0EA 2C9OA 3AHIA 3PE6A 4EJFA 1R0KA 1Y6FA 3IX7A 5CRIA 2HX1A 3ZWWA 1HE4A 3AEYA 5TY0A 1NVFA 4MS3A 1GAWA 3L7OA 3TW0A 3DKIA 4DWVA 1YA6A 2CL6X 3BUSA 2PKRA 1A76A 5EJAA 1VL1A 3QOXA 4FFOA 2IV7A 2X0DA 4B44A 1XCGB 3AOGA 5TPWB 4U4AA 4X84A 3A4NA 3KQLA 1RKBA 3I73A 1ZVKA 2VF2A 1PT8A 4HDSB 4YHBA 5EKSA 5LBIA 3HDQA 3EUWA 3A6PC 2FY8A 2OV3A 3GD7A 4MDHA 5DTEA 5HILA 3WGJA 5JFTA 2PBZA 5L6LB 3SVLA 2WU0A 1XFDA 3OKFA 2C9ZA 2ZM5A 1DKOA 2RGRA 2P3QA 3UMCA 5CDSA 4DEYA 5K2MA 4OMFG 3JAKB 4ZEXA 5BR1A 1UOPA 1W2WB 4GPD1 3T0GA 4DRXB 3IEVA 1K4YA 1UMBA 3BMNB 1V8PA 3VSBA 2BGRA 4U7TB 3INNA 3E3AA 4DCCA 3IC5A 2ORWA 4K81B 1KS9A 1ZK0A 2O1WA 3RWBA 3EB9A 1Z4KA 3BL5A 3F3KA 4ID9A 1PGOA 1VRWA 4YT5A 4E5PA 4RGBA 1W1IA 4EA7A 4EJ0A 1KETA 1T0JB 2YW2A 3RRZA 1QHSA 3WKCA 2W58A 2G5GX 2P68A 4P82A 4Q4AB 2FFRA 2R6ZA 4UNPA 3HBJA 1SBNE 2VSOA 2IU0A 4CU5A 4EH1A 1DWUA 4EGJA 3FYUC 3MWDB 2CNKA 2PKXA 3AF0A 3GN1A 1QIFA 3QLVC 3A6ZA 4QDZA 3E2MA 1G7TA 5T8KC 1IUPA 1E1DA 4DLPA 5ENDA 3ADBA 1PK9A 2AT1A 2IXFA 1CQJB 3MWFA 1N36B 1KK1A 1EUCB 5K0TA 2GK7A 3EWNA 4KBFA 3TLKA 3OY2A 5I7EA 2X19A 3AJRA 3HRKA 3U4GA 5C0OE 5IM4F 9ABPA 2NXEA 1PBTA 4G23A 4R01A 5LMZA 3HTXA 2C2BA 2OD7A 3GQBA 1FMJA 4UUOA 3WLTA 1CB0A 3E27A 1F2VA 4CEIA 5DX8A 1EZ1A 4TQGA 3GJ7A 3C8DA 5C37A 2ZUEA 4B4VA 1RYZA 1T1GA 5UKDA 1O77A 1WWKA 1ESEA 3P94A 4QNNA 3EVFA 5BQ5A 1JEYB 4MV7A 1DLIA 3BXFA 1XP8A 3OE5A 1W85B 2E5FA 3HDTA 2WQ7A 1A9OA 1N0WA 3NEPX 3I04A 4FGJA 3U3JA 5KQRA 3ZHCA 4F1KA 4K9RA 4PGHA 1NFQA 3ZHVA 2O2DA 5K0FA 1ZGHA 4RTKA 1XB2A 2YJ3A 3ZQ6A 1OIXA 3RRMA 3ZKWA 5AVQA 4NCKA 2FZ5A 4QHSA 1Z22A 3ZHTA 2PD6A 4OFXA 2DTXA 2FEXA 1NI4A 1C3XA 4GQBA 4ARIA 1NC3A 1IAQA 4U9HS 4WX2B 3YASA 3MRSA 1LBSA 3AM3A 2E89A 3II6X 4B0OA 4JH0A 4ZYWA 2QL9A 1M66A 3WWDA 2LZ0A 1RJGA 3LDGA 5BR4A 4ZVKA 2FUG6 4EFDA 1D1QA 1NUUA 2I4MA 2UYGA 3DPUA 3HXTA 4PICA 3T0IA 4ESOA 5JR3A 3F6EX 2Z4SA 3OZRA 4ZOCA 1CS4C 2XUPA 3RVJA 3UUFA 1VL6A 5ALPA 3UYKA 4BLQA 2OCLA 4O8CA 4PWYA 2FWMX 3PT5A 4ARAA 5I8PA 4UNQA 5IH7A 1EBUA 4J0EA 1G5FA 4L8FA 3CNLA 1E2DA 3GFSA 3CLHA 1MLDA 1NXPA 3GY0A 3I6BA 2BFMA 2VQEB 3S40A 3IEKA 4PRZA 1KZ7B 4UAJA 3Q8XB 4MR8B 3EAFA 3H4VA 4PR0A 3LC1O 4Q6WA 1L4GA 5JXWA 5JBQA 4BNKA 2IUEA 2X9NA 3CGWA 2ERYA 4KFRA 3DG9A 4DR6B 1F0PA 3KKQA 1E58A 3U49A 2RHBA 3UH1A 5B6IA 2C5HA 3NLLA 3TSYA 3VJLA 1J2TA 1JHVA 2RI0A 1VMDA 2J4DA 3K20A 3MJHA 3LOUA 1OYOA 4I81A 4O63O 2D1QA 2B1JA 4AECA 3FXAA 3TUIC 1K06A 1EK5A 1UPBA 3Q4GA 2BM8A 2V55B 3IBYA 4NYMR 5KSWB 4U7DA 3FGPA 2WIJA 5C1DA 3PP8A 5C8YF 1UINA 3ASVA 4L7VA 3MS4A 3T4PA 1H69A 4OYHA 2YCBA 1Q84A 2OFWA 2DUNA 4FDVA 1B0PA 1E5LA 2UUAB 4EMTA 3IQZA 2ODPA 2Z9CA 2ENUA 3DOJA 4J2TA 2FLWA 3H83A 2H06A 1AXEA 3MC1A 3LP5A 3O4GA 1EKXA 3Q6IA 4Z4FA 1WXEA 1J09A 2BMAA 1FFDA 4GO1A 2VJDA 5TARA 1TYCA 1E20A 4OXXA 1H8ED 5JO9A 5FA6A 4EA9A 2EKZA 3RS4A 4FMDB 2PGXA 5BRJA 2WYUA 3VKFA 4MLCA 5JXGA 1UT5A 1PWHA 1GG2A 1HZJA 2BH9A 2VQDA 2I62A 3LP6A 2VT3A 3KDPA 3RSFA 5KTSA 5J23A 3H1GA 5E4YA 5TE9A 3V4RA 1A0OA 4NEGA 4GPIB 5LQRA 5C1OA 3WZMA 1LVUA 2EATA 2P27A 4QTTB 5DCWA 3FBGA 4CQMD 1ABBA 4DCUA 1HMYA 2QZSA 1Q17A 2Z8XA 2ZRFA 2CNLA 1P1RA 2FVYA 4JEUA 4E7PA 1N78A 2DBRA 3JXEA 4B3DA 2LVBA 2CDRA 3TAXA 3TQOA 2AHOA 3QVOA 4HXGA 1E32A 5AHKA 3ZY3A 3P2EA 1X7XA 2MYNA 2ECPA 2DFLA 2HFJA 2XHZA 3EHEA 1PF7E 2BVNA 3UTDA 2WJVA 2CF6A 1E7QA 3A14A 3HHPA 5BNTA 3NXSA 3FM9A 3H9QA 1EFVB 4V0MA 4X7RA 4F2GA 4DR4B 1HG1A 3TE7A 1MO3A 3C2QA 2HDHA 2Y0CA 1LLFA 2I80A 3CVJA 1J9EA 1RAEA 1ULUA 1QGZA 3UFXA 4C0QC 1ISHA 1P4RA 1UBEA 4PIMA 3GEEA 3UH0A 1BGVA 2PG3A 2QROA 2QUZA 4M8NE 1Q7EA 2PKEA 3QE9Y 5IJZA 3GRCA 1AURA 3LF1A 4FFWA 1ZCZA 2P9TA 1GQFA 1EFRD 1ZMTA 2WJYA 3CLRD 5FULA 3OZWA 3WB0A 1APBA 2IDZA 3W3AH 3I9KA 1B43A 2ZWOA 2JAQA 4OQZA 5BMVB 1YZQA 3DVQX 3FMOB 2EEZA 1U2GC 2QR2A 3HYRA 2XWQA 4FS3A 2X77A 4BLRA 4BE9A 3P2KA 3E03A 1PV2A 2FFQA 2HJVA 4WESA 3RRFA 1L7MA 2YVAA 1W1UA 2ONCA 4BPBA 1UANA 2NXWA 4EPXA 1N5JA 2R3SA 5FNZA 4EPWA 4YY3B 1Q0LA 1KDVA 3NEAA 4D97A 3MYYA 1X1AA 3I0NA 4X92A 2VDVE 4TSKA 4TMTA 4Y6QA 5GZ3A 4NU6A 2HJHA 1WUYA 4DREA 5F7ZA 1RS0A 3LS2A 5EGSA 1EYZA 3IPAA 4ITVA 4PCLA 4QL3A 2R1ZA 4CKYA 4JIGA 1GAXA 3MK31 1T2NA 1Z73A 5E7IA 3GOHA 2WUGA 3ORSA 2PVCA 5FBKA 4RXUA 2GD6A 1H4VB 1GPBA 3HRHA 5G4KB 3GFFA 3HU1A 2OBFA 2A59A 4Q47A 2BZ1A 1GUYA 1NAHA 4DQUA 1ORIA 2H00A 3E2PA 1I7LA 2I1WA 4S1VA 4R0VA 4C88A 3TPFA 1D2HA 1Z47A 2WWRA 2IIBA 3HBNA 3TMKA 1EE1A 1PSWA 4I9FA 2P2YA 4UM5A 1QZ3A 4OXIA 5I3CA 4JBXA 2I67A 3BTUA 5EPUA 2YZGA 1W36C 3KEQA 1SIOA 3L7JA 1P62B 2ZBUA 4E13A 1JYSA 1A5BB 1AN9A 1S2GA 2OILA 3DHVA 5HDBB 2JJ2D 3GX1A 3FIJA 1M72A 3N86A 2BUAA 1X42A 1TF2A 1XD2B 4GPBA 1TEZA 4C4SA 2RC5A 2O48X 3IAFA 3NAMA 4D9JA 1O94A 2BFEB 2HF9A 1KZHA 2OL4A 1AKWA 4REQA 4BAZA 1CYEA 2CXNA 1FW6A 5G0TA 3N39C 5ESWA 2H2DA 4A0HA 4CN8A 4W5RA 1NLUA 3BFJA 4IGAA 4M0EA 1DJQA 1R18A 1V8ZA 2JFYA 4DHEA 2G82A 1FY2A 4WXRA 2K7ZA 4Y2TA 3V1KA 1KWGA 3X2EA 4IUDS 2OWEA 1Y6GA 2LE0A 5KSYA 2O4UX 1YE3A 3MGKA 2OV4A 2Z5LA 2FN8A 1N6IA 2AYXA 1SCIA 2HCTA 4KODA 3RS2A 2QQEA 1R15A 4O59O 3P9ZA 3U6KA 5E95A 1KMMA 2ACVA 1KZGB 3BIJA 2CFRA 1IB6A 2QN6A 4UCWA 1FRFS 1SVWA 4NX2A 3OFNA 4E07A 4QXOA 1OBCA 1A9XB 3PTZA 4S1TA 3GLHE 3V7WA 4JKIA 4UUAA 1WXWA 3MTBA 3RFUA 3OVMA 1IN4A 2XOXA 3OQIB 2GN2A 4RWEA 4YV2A 1ODJA 2KBEA 4EY4A 3IKTA 3WIBA 2P9CA 5DMXA 3UJNA 3GA5A 2G7MC 1FFAA 5FOXA 5D3QA 1T9GS 4FQ8A 3S1AA 3H2SA 2FFHA 2EYQA 1SC3A 4QJIA 4HJRA 4QU5A 1NXQA 3T6KA 3A28A 2A9KA 1KMIY 2I2CA 5GMOA 4KV7A 3PQ5A 5AW2A 1RC0A 2PK3A 2ZWVA 4MX8A 1PR5A 1XA4A 3AVTA 4OH1A 1X8LA 2ZSDA 2QTWB 1V5EA 2BZGA 2A92A 4D9CA 4IDBA 4QD3A 5BR7A 3CCBA 2NP7A 3N8KA 2CVQA 2WIFA 3AVWA 3RFXA 1HWYA 3HG7A 2C5SA 2FUCA 3CVVA 1PJBA 4BC0A 5JS2A 4FYIA 5ALVA 4A8PA 2FE4A 1SB9A 1T8UA 1GLNA 2ILVA 1OI2A 4JD5A 5A04A 2FG6C 1HXHA 2QZPA 4ICIA 3ZZMA 4KMOA 4ERXA 4KPEC 1NVTA 3OZIA 4DEXA 1SD2A 3A58B 3ZWOA 1U3GA 3DXFA 4TVOA 3X3HA 3OM8A 1YE5A 4EPRA 4CETA 4ALMA 3C43A 4E30A 2FW0A 2D7DA 4PG8A 1YR9A 3GVCA 2RK6A 3D6MA 1RXVA 1J24A 3CLKA 4D9GA 2Q9CA 1NXWA 1W75A 2C20A 3QVUA 4TGLA 4UM9D 1W44A 3RS3A 3T4UA 4D9EA 5GINE 3FSGA 2OQIA 1XEWX 3KAPA 2DCUA 5CVTA 4JKOA 2BGMA 2YV4A 4CM1A 4A03A 1E18A 2Q3FA 3QE0A 1CE8B 4XPIA 4ZJUA 4BEWA 2FX3A 3OIWA 1PW7A 2X7XA 1VGQA 3ILYA 1JQKA 2QBYA 3DKPA 2P4HX 3LKVA 3A2MA 4QXAA 5K09A 1QFJA 4NBVA 5BNWA 3QF4B 1D4OA 2R7AA 3WGHA 2GTIA 3HV0A 3JY6A 5IABA 2WIAA 5K0ZA 1D2CA 4N12A 5D1NA 1YFKA 4NI5A 1Y7IA 5HF6A 2PGIA 4JEHA 2E6UX 3VPSA 3CO5A 2WY2D 1X6VA 1IPHA 4GUAA 2UAGA 5FQNA 3FG9A 4H7EA 5LUAA 2YQ4A 3WA7A 4R16A 3TTXA 3WLRA 3KLNA 2GDJA 3USZA 3EH1A 2RJNA 3OZEA 3H5VA 3OO0A 1NAIA 1K9VF 4EY6A 1V37A 1CVRA 5E1DA 4UU7A 2IOFA 2A7XA 2AC2A 2HA3A 5FORA 1VA5A 5JPDA 2FSHA 3AKYA 1Y48E 2C2HA 4YT8A 4P32A 4M38A 3N7TA 2AXEA 4MQEB 4OHCA 4Q1DA 1YJCA 3PE3A 2JIRA 2P91A 1AS2A 3RK4A 4D82A 1NF9A 4L75A 1JKXA 3HL4A 5DGTA 3B9PA 3LWBA 3PXDA 4DB4A 4F46A 4QVIA 3PPYA 1KGSA 4CG0A 2IZ5A 3NBMA 4N0EA 2O0KA 1QC5A 3OZBA 2VLIA 2B7BA 4G36A 1MJFA 4MPPA 5CFPA 2XGJA 3NAQA 1ZESA 5HKAA 1KH2A 4WZBB 3MOSA 1DDIA 3K32A 2O8EB 4S1OA 1R37A 4URWR 1LV7A 2HTEA 3D6JA 3NC1C 5M29A 3OWXA 5CNMA 1YFLA 1YJBA 4H7PA 4KYUA 3V3KA 4D2IA 1WTCA 3QE4A 5EP4A 4E1AA 1HT0A 3JD2A 4RJ2A 2NG1A 2VHCA 3VJMA 2C9YA 3ZGXA 4DWWA 3L8YA 4X1OA 1SU6A 3EXFB 4IIJA 4JVLA 4PSCA 1T5BA 5H5JA 3C7DB 3WLAA 3NTLA 1P1HA 4E6EA 3BB3A 3G8CA 2CLIB 4E22A 5AHWA 3GW8A 4KTVE 2OHGA 3JVEA 1E2GA 4ECAA 1Y9ZA 5HUQA 5HZHA 2ZIAA 3FYDA 3OEHD 4OJYA 4UTNA 2H7CA 2ZYDA 4WDRA 3NR2A 3O95A 1HYGA 2Z3ZA 3GG9A 2BGUA 2HW8A 4ID3A 3TWOA 1II8A 3CH4B 2IZ1A 1RXYA 3KQQA 2V6IA 1FNCA 3KYCA 3KEOA 1E2IA 3DL0A 4GMXA 4J0JA 3ROGA 3AW8A 1CR2A 4Q6BA 2GAJA 2WHYA 4P4UA 3I61A 4YJ3B 4KIJA 1Q92A 4K6HA 4TN5A 3N74A 3TPZA 3BMQA 4F72A 3I8XA 2HJRA 5KREA 3G88A 3MRTA 3MJVA 1T15A 4QDUA 4ANFA 4W4TA 4MW1A 4KE9A 2LBPA 1NBAA 4X1YA 4QDJA 4EF6A 5LU8A 1FFHA 1AS3A 1TJ4A 3C5CA 3GVIA 4OB7A 3SZOA 4H0FA 2YWHA 4GD3Q 1J0BA 2GT1A 2EDAA 4AZVA 5IX8A 3A9UA 1P44A 3KSMA 1DAEA 1NVAA 1RWXA 4HGOA 4Y2XA 2HQRA 4GWKA 4WV3A 2NPOA 3ITKA 5DLEA 1LBEA 5JO0A 3G5TA 4BE7B 3QYPA 2PWPA 4IGKA 5HOEA 4BP9A 1VHJA 4KQMA 2WTEA 2I0FA 3IJPA 3WIUA 4ZDKA 2BGGA 3IKVA 2ZETA 2P1RA 3PHBE 3NV7A 2V58A 5HXAA 1N57A 1U8UA 2VQ3A 2Y1EA 2LKDA 4D6XA 1MIOB 2CYCA 3KFLA 1SG9A 1E1QA 3AKEA 1XCMA 2YL2A 4GWLA 2X1LA 4MWGA 1FQKA 1I2CA 5FKJA 5GVSA 1Z82A 2JFOA 1XHFA 1CZUA 4L8WB 4YN3A 3ELWA 2B1RA 2EHJA 3A8TA 1OPRA 1SXJE 3FDIA 4PZLA 2I7TA 2NUPB 4ND4A 3EXHB 1JFFB 3GXBA 3MB5A 1WABA 1JIQA 4IVRA 1IIRA 4KMMA 4FE3A 5FJIA 4ZEOA 3KVNA 3SJUA 2YBEA 4B71A 4B76A 2DMRA 5CAEA 1GQSA 3FZGA 5EZYB 1OC4A 1GKLA 4QSHA 3SNKA 2C5LA 1XZDA 1Y8RA 1MR3F 1XKTA 3K0KA 5KOYA 3FWZA 2O7VA 1QAMA 3AESA 4MRRA 3KZ1E 3AU9A 1AQIA 3IUYA 1GPJA 2YC2C 1Y6JA 2GVDC 1E6KA 1SUIA 2RKOA 5SYMA 5ILOA 2R1VB 2WJZB 2Q5CA 2VBIA 2HMSA 3L4EA 3NHBA 4RV4A 1ZH6A 2J9XB 5EJMA 2ENWA 5KNDD 3K70D 3L4KA 5F9HA 1X7DA 4TLBA 4Z3KA 2AI3A 4ALLA 1QHEA 4J7XA 5FBHA 3RYTC 3EGXA 1T2FA 3WJ2A 2BELA 2B1QA 3NKLA 4GPZA 3D2LA 2ZSFA 1G2PA 1RXUA 3WK7A 1C30B 2OCKA 2IPOA 4OSOA 4UUMA 1CQXA 2GS9A 3OQVA 5IN5A 3R2JA 4CKBB 2RGEA 2NT4A 4QJBA 4KUGA 4BB9A 1QQBA 3WDLA 4HNHA 1HC7A 3MSXA 1QH1B 3I62A 2R79A 5G0WA 2GKSA 4NATA 1WPRA 3EJ6A 5FUYA 1K97A 5IM4A 3O92A 2EGGA 3VO8A 1RJ9B 2BI4A 3C5EA 2ZKLA 3EVZA 4Z2YA 1G2OA 2O1SA 3PUHA 4ZQGA 2O5RA 1U0TA 5FA5A 2DY1A 3AVPA 2B8WA 1U81A 2Y66A 4IHJF 5FNVF 3F0TA 2ZP1A 4KG7A 5ALXA 2IYRA 2IY7A 1JB1A 4RKRA 3TBFA 1L5QA 2DHQA 4PN7A 4X8MA 3NW9A 1QIDA 2QTNA 4ZANA 1V47A 4JGIA 2F55A 2JGLA 3VU8A 1YZGA 2CMFA 4G65A 2PCLA 2J32A 3A11A 2QM7A 3IPXA 5EJEA 4NJOA 1J4AA 2GUWA 2W8BA 5D87A 2R87A 2WWWA 3DQZA 3QXSA 4JYCA 4RHCA 1YZKA 3A7DA 4YB8A 2JDIA 3SC2A 3R77A 4OHWA 2J07A 4EUKA 2VF5X 4URVR 1IWBB 1XTSA 2H3EA 3IALA 2IF0A 4D80A 3ONVA 4XQ0A 3REOA 1Y4SA 4TRMA 5KKNB 2H17A 2E4AA 4LE0A 2QLTA 3CNQS 1U3VA 4QYWA 3ZHZA 2MDTA 4ZXFA 2C3UA 4FE4A 5E8RA 5BPFA 5LIPA 1YL5A 2W42A 3GXOA 4AMVA 1T6XA 2DT8A 2A0KA 1XZQA 3L8CA 5DRTA 5ICCA 2OLKA 2IY9A 2LV8A 1FP7A 2HCRA 2XTZA 1L5HA 3L0ZA 5BQ3A 1FDOA 3ZBUA 2CGEA 2Y3IA 1Z74A 4I0WB 1GQQA 4F9FA 4HWOA 1LPNA 2DX7A 2CNWA 5K3FB 1R0RE 1UJBA 2WZBA 1NRJB 1YA8A 3KT3A 2HH9A 13PKA 2VC2B 5J4KA 3VFDA 1Q5PA 1SUFA 4IX9A 1YB6A 2PO7A 2G4CA 4CKCB 3RKSA 3VR1A 1OBFO 3QEMB 4BX9A 1XDGA 1HQCA 2ZR8A 1FMCA 4OGLA 4TYNA 1PP4A 4M0MA 3SF0A 4ZKDA 2A1TS 4HJXA 1EG2A 5H16A 5BW6B 4BEVA 4WT7A 1KZ4A 4JQOA 1FNNA 2F8TA 1Z6PA 2BFFA 4WAUA 1ZH2A 2ZIUB 3PFFA 4FLMA 3ZJ5A 1QB7A 1X80A 1I51A 2K2QB 2RGNC 4OU5A 2QUAA 4Y8VA 4D26A 1TAUA 3ETNA 2R5WA 3KTFA 5C8YA 1T6NA 5D7BA 4DBZA 3R40A 5FXMA 4HZUA 4M1TA 1NVVQ 4G37A 4L1KA 3UBTA 4HLUC 3A7EA 4DNXA 5AM2A 1T3GA 2UVPA 4G25A 3D4BA 3FOCA 1DOHA 5BUQA 4BFTA 3O2SB 1CY1A 1EIZA 1KMHA 3NDJA 5KYXA 2VH5R 2DETA 2GPNA 2ZAGA 3IIEA 4HQOA 2DUMA 3HCFA 3ZIUA 3BIFA 1X86B 1A9ZA 1HT2E 4KWEA 3T5PA 4E46A 4RYLA 3GB9A 4EVQA 4PNPA 4TKZA 5DN6D 2CK3A 1OVGA 4DDVA 1A1VA 5D7NA 2V96A 4KN5A 1Z5UA 4ZAFA 1E1CA 3DTYA 1ID1A 2OBXA 2XBLA 4JLOA 5LA6F 3RS0A 1ULBA 1Z0UA 1AGRA 5IAGA 5LBTA 1VE9A 1A82A 3CBQA 4LGVA 4V1CB 3OZVA 5D3MB 1GTRA 3IE0A 5EXSA 1UZUA 2WTBA 3DLCA 3JYOA 5A0VA 1GTSA 4Z8XA 4PAMA 4CLRB 5SZKB 2QF7A 1KR5A 2CXHA 3IIKA 3WGNA 1QP4A 2A9VA 3D3KA 4ETWA 1BIFA 5ALUA 4TYWA 3FJ1A 1H05A 2D5BA 2RIRA 3IBSA 3MWLA 4HYQA 4MLDA 1TCVA 2AYZA 4L27A 2WTXA 5L3RA 3TRIA 5JQGF 5HF5A 3BTVA 4Y0AA 5E6SB 1AKVA 1LJLA 2XAUA 2XCUA 5T6MA 1NURA 1CNFA 5JNTA 4RFSB 1OV6A 3W34A 1LBTA 2YYYA 4QUKA 3DE7X 2VDQB 3BWVA 1DHRA 4M1MA 1EMDA 2PS9A 2XWBF 4NONA 2AX3A 2G17A 2I55A 1U7HA 1NW3A 3BGVA 1U7OA 1KZ1A 2EBWA 3FWYA 2OLJA 3QYJA 4LW8A 3CUYA 5L3ZA 3U48A 3U44B 4JT9A 3AY6A 1KDPA 4QPDA 2I9KA 3HVKA 4W9MC 1CDOA 3G8BA 3K2BA 1XYVA 4MI1A 4NZNA 2V45A 3KUKA 1DRWA 2GAAA 2XA1A 5F1PA 1HEUA 4CI9A 5B4UA 1F0YA 1Z6XA 3IUJA 5CDTA 1UC4B 1I9CA 4HMOA 1KFBB 3SD7A 3LKBA 1G5TA 5AR1A 1V2HE 1Y1LA 2VHTA 3QVGA 6ABPA 4LHVA 3KTAB 2HXGA 4X93A 2VTVA 4IS2A 4WKGA 4KIWA 5CVCA 2CMDA 2GD0A 4QLBA 1RIIA 2ZQZA 3LQ2A 1DC8A 1PFGA 4XKJA 3SGLA 4B84A 3DEYX 2ODNA 1VKNA 3UW3A 3JV7A 4IDDA 4KFCA 4TTSA 3WDSA 4ND7A 2VWGA 3T5TA 2NVUA 1R8QA 4LSZA 2W9XA 1GZ3A 4HADA 4P86A 5JAZA 3ZDZB 2WVAA 4UE6A 2CKMA 3WRXA 4D9FA 4R9SA 3KRTA 5LBUA 3K94A 4OU4A 1AC5A 3EVCA 3JPWA 3T3GA 5KX5F 3D4IA 3BH7A 2CL5A 1RHQA 1PD0A 2VDWB 2XMCA 4GNRA 1VLVA 1PR3A 4I4TF 1ZYUA 4LYJA 5G02A 4BNLA 4Z7OB 1ORVA 4MZDA 1WSWA 3GDHA 4ZHQB 1ULZA 1E98A 3AW9A 2GH1A 3WLSA 4RFVA 3IMKA 2ROQA 1JQ5A 3DMNA 5GAJA 4B7CA 2JGDB 1M8GA 4NFHA 3VUEA 1IM2A 3W8FA 5EVJA 3HKEA 2D7CA 4KYTA 2BFPA 2IXBA 3HJRA 1MC1A 1JLRA 4X64B 1AHIA 4PAQA 3FGOA 3VI4B 3KJQA 3AXSA 1F7UA 4KVGA 1GU0A 1U0JA 1ZSNA 2ID9A 3HYTA 4LKOA 4XGIA 3AF3A 4IYJA 3VJKA 2W2OA 5JNRA 3DO6A 2XRZA 3OBBA 3P9PA 3WLKX 1I6WA 5KYKA 4J3FA 1XPUA 1NNEA 3F49S 2KSQA 3C3PA 5AP9A 1XRNA 2XCOA 1YJXA 3B6JA 2Q7XA 2NUBA 1U0BB 3QPVA 4MJLA 1XAIA 1T5LA 2JW5A 4RTNA 1T1EA 4HDQB 4Q9HA 1WG8A 3C7TA 4B9EA 2VPQA 2XEXA 1Z5NA 2FSSA 1G4AE 4RVFA 4UXIA 4EO4A 4RZUA 5FOTA 6GPBA 1B1AA 1BMFD 4WACA 5GGXA 3NANA 2BGIA 3CFYA 1M1NA 3SR0A 3R3XA 1G20A 4IV8A 2BMVA 4CGZA 1H9BA 3WQRA 4D45A 2O59A 3C7CB 3OE7D 1E7RA 1PGQA 3NIDB 3JWPA 4FTWA 1PGJA 3OJ0A 4KQ6A 5EMNA 1NVXQ 2FETA 1IXSB 4IV5A 2JLWA 2IODA 1MP0A 5E1OA 3R6LA 3FUCA 2DXIA 3AG6A 1W5TA 4DZZA 3FYTA 3CPJB 3N07A 4L5IA 1QO0A 1P2VA 2VJLA 4UULA 4TWRA 1IG3A 3BB1A 3AONB 3HLTA 1CJBA 4N8EA 2WUVA 3VYVA 1Y8ZA 5LP6B 1DXYA 3WLNA 3PR2B 4IRMA 3R44A 4M0FA 1B3RA 2WF7A 4ESEA 1MJ5A 5IZCC 3KHTA 4E5MA 1F1JA 1VCHA 3REQA 1XZFA 5KKCA 2NMVA 1J00A 5CH3A 4YX9A 5JHHB 3NNNA 3VDMA 1VLZA 4DV3B 1BH6A 3RT1A 1SK8A 4EZIA 1BA2A 1XU7A 1QR2A 3ABIA 3KWMA 3M5PA 4U2DA 4YUAA 4MYRA 3Q3JB 2FUNB 2IZ6A 4MMYB 2JFWA 3PC4A 1KJJA 1D04A 1LSSA 1AB5A 1YONA 2I8AA 3EH2A 4PLCA 5T4EA 1ZO8A 3W5HA 3X43A 4KJXA 4TT3A 2KQUA 1O5TA 1X7HA 1GTG1 2GPSA 5DLDA 5DM60 1U65A 3ZLTA 1JJ7A 3OF3A 3OLVA 1GRQA 2A14A 3W5IA 1ZCFA 5C46F 2QUHA 1V45E 3G17A 2XUKA 3N2EA 1TVMA 4IFEA 3EARA 1E5DA 3H6KA 1KEVA 1ZXBA 1VKRA 2VI5A 3JS5A 3PLNA 4KH0A 4W9NC 4YO7A 3T8YA 1BXRB 4RDHA 1PGPA 1FLNA 2XA9A 3L7IA 2H48A 4K9MA 4N54A 4ZV4A 3AR6A 3T0FA 3F6PA 1FBNA 1VG8A 5HQ3A 1QRDA 1E79D 3JQDA 5JE8A 4AMYA 4D5GA 1XQ6A 2J5QA 2JK0A 2COUA 1F8YA 2QUKA 3BGSA 1YC5A 1O03A 4MI6A 1GAEO 2DY0A 2FLVA 4I1RA 4EW6A 3LUHA 1YCFA 2GHRA 2ANBA 3G13A 3PTAA 2JPDA 4M0DA 2IXAA 3UPDA 1VFPA 3FMVA 4KX3A 1DKUA 2V54A 5K4GA 1DU4A 2HMVA 3C5HA 1RJFA 1ULSA 1Q0SA 4CMEC 5KYNA 2AOTA 4BVEA 1EJBA 4RLQA 4JN6B 1CD5A 2WF6A 4IIXA 5HEKA 1CQZA 3TB6A 2WB4A 2CZQA 4N41A 1WHTB 4X60A 2MMCA 2FDXA 1THMA