4IMRA

Crystal structure of 3-oxoacyl (acyl-carrier-protein) reductase (target efi-506442) from agrobacterium tumefaciens c58 with nadp bound
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
258
structure length
258
Chain Sequence
LYFQSMRLETIFGLRGRTALVTGSSRGIGAAIAEGLAGAGAHVILHGVKPGSTAAVQQRIIASGGTAQELAGDLSEAGAGTDLIERAEAIAPVDILVINASAQINATLSALTPNDLAFQLAVNLGSTVDMLQSALPKMVARKWGRVVSIGSINQLRPKSVVTAYAATKAAQHNLIQSQARDFAGDNVLLNTLAPGLVDTDRNADRRAQDPEGWDEYVRTLNWMGRAGRPEEMVGAALFLASEACSFMTGETIFLTGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-(Acyl-carrier-protein) reductase
publication title Crystal Structure of 3-Oxoacyl (Acyl-Carrier-Protein) Reductase Atu5465 from Agrobacterium Tumefaciens
rcsb
source organism Agrobacterium fabrum
molecule tags Oxidoreductase
total genus 99
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4imrA00
4PG6A 1ONNA 3FCOA 5KJFA 5CPBA 4WPGA 4WLEA 2UYYA 3PHGA 1RM3A 2I9PA 3SC6A 5B4VA 3ICPA 1LDYA 2RAFA 1NASA 1Q2XA 2PK3A 4YAJA 2FY8A 4HWKA 2HK7A 1X1TA 4TRRA 1ZJZA 3Q0EA 3CMMA 4WLVA 2ZTLA 1QYVA 3RC2A 3V2UA 4RF4A 3RAJA 2LDBA 1ZK4A 1NBOA 1PQUA 2BLLA 4DQXA 3AM3A 2AW5A 4BO5A 1K6XA 2D1YA 3ASVA 2TMGA 4FSHA 3G79A 2QQ5A 1XIVA 2P91A 1JKIA 4CR8A 1U7TA 1ZO8A 8ADHA 1LRJA 4EUEA 3IS3A 4OO3A 1ZKMA 2B0JA 1ZNQO 2DBRA 2IE0A 5EQFA 3KYCB 4O0LA 3ONEA 3KLPX 5EJ2A 1DHRA 4KDFA 5CPFA 1Z6ZA 2NVBA 2W90A 2J6IA 1U3VA 2V65A 1PJLA 4J6FA 1IB6A 3O8QB 2VNSA 3FR8A 1C3VA 1DIRA 1JQBA 4BNFA 4NFHA 2GCGA 2NTJA 2OXIA 2FP4A 5GY7A 3MCVA 2VZ0A 2V6FA 3O38A 2GDZA 2VN8A 1DHTA 2J8ZA 3H6KA 3OIDA 4J1QA 4LSMA 4YRDA 2ZQYA 4D0SA 2BI8A 5CP8A 1WAMA 6ADHA 1LDMA 2XXBA 4IBOA 3TQHA 1RKXA 3KYDA 1X1EA 4TRNA 2BH9A 5EMHA 4IJUA 4MKRA 2ZB8A 2VUUA 2Q2VA 1V3VA 2DBVO 1H0KA 4R3WA 1MUUA 3PZBA 3JQEA 4XRRA 2C20A 4BVAA 4OKIA 1U7HA 4DLLA 4IJKA 2DQ4A 3DL2A 5HBRA 4ZHSA 4IXTA 8LDHA 3Q11A 4E6PA 2AXQA 2Q45A 3SC4A 5I8WA 2BFPA 2WYWA 3RI3A 1RM5A 4YA6A 3GQVA 4XYLA 4JJGA 1B3BA 3C85A 2DC1A 5TIIA 3BAZA 1XR3A 1EDOA 3AM4A 4IGEA 3TSCA 3QW2A 5JFOA 3WSWA 1KBZA 4KDEA 1LSJA 2CVQA 1PGNA 1LXCA 2EKPA 1E7QA 1HDRA 3WNQA 4KOAA 5JSFA 1DIAA 1SZJG 4KUHA 4UULA 1U5CA 2DFVA 4ZRMA 1AHIA 3ZWMA 1QRRA 4G81A 5T67A 1BGVA 2X4GA 4LSWA 4C7JA 4ND4A 4CPDA 3JQ6A 2JHFA 5IN5A 2B37A 4CM8A 4UUNA 2EKQA 5JO0A 4WLNA 2Y1GA 1NWHA 3S2IA 3LF1A 3OJLA 4MVJI 2E49A 1A7KA 4FIZA 2VOJA 4XYGA 3ITDA 3U0BA 3WYEA 1BW9B 2V6GA 3OF2A 1EFLA 3MEQA 3V1YA 2F00A 2D59A 1HETA 1P44A 2A94A 2J3KA 2EWMA 4EJMA 1W8DA 1PS8A 2AEMA 3JQ7B 4ID9A 4PFJA 4J1SA 3L9WA 4ZD6A 3DZKA 4EUFA 2B83A 4NHEA 2DU8A 1TEHA 2PKQO 3VPXA 3PJGA 1ORRA 4PG8A 4D7AA 2NQ8A 4FOOA 3ROPA 1YOVA 4J4TA 1E77A 3RFVA 5JDCA 2VWPA 3RKRA 4RZHA 1NR7A 5B4UA 1Y1PA 3O03A 4KTVE 4RF3A 1HDXA 4BKQA 1O9BA 2E6UX 4RVDA 1J49A 1LSUA 1GZ3A 4Z9XA 4BNLA 1MG0A 5TF4A 1EUZA 1LBEA 3NTOA 3ZWXA 1R4MA 4P22A 4TZTA 3QHAA 4J3FA 2Q49A 2VWHA 2JJYA 3GUCA 4J2HA 4R51A 4XJSA 4YJDA 3OA2A 4U7WA 3WG9A 2X0JA 4MVJM 5L51A 1BG6A 3BMNB 2ZYDA 2ZTUA 4TVOA 4E2ZA 2OP1A 1KVTA 2HJSA 2NU8A 3KTDA 1EK6A 4Z0TA 1ZK0A 1F12A 3DZBA 4GGOA 4IDAA 1DO8A 3WGIA 4E5KA 1ADGA 2DUWA 5KKCA 3OICA 4P4NA 4M86A 3RUEA 5DZSA 4F46A 4YJGB 4CM9A 3DAFA 4YVFA 5A9SA 3AOEA 2EF1A 4II3A 3AUUA 4DBVO 1PJ3A 2GF2A 3U09A 1P1RA 4IDBA 4O59O 5TNXA 1NAIA 3UAGA 1O8CA 1VC2A 2RHCA 1QYCA 3P2OA 4G2NA 1I2CA 5HWSA 4I5GA 5BSFA 1KS9A 2QRKA 3F1LA 4B4UA 4UVHA 5G2OA 1IYZA 1ADCA 1I5RA 3B20A 4WASA 3TNLA 5ADHA 4IZIA 1QG6A 4R1NA 4L73A 3NT2A 5THKA 4RPKA 2PZKA 2UUOA 3NDJA 2QRJA 3KETA 4LGVA 5KVSA 4DMMA 1Q0LA 1MXFA 3NYWA 3QVTA 2HSDA 2Y1FA 4BOYA 5KJEA 1F17A 4Y98A 5U4QA 5FFFA 1GZ4A 2Y0EA 1NAHA 5JCXA 3RUHA 2XXJA 4DPKA 3UN1A 1OC2A 3BZUA 2P2SA 4DIBA 4BO6A 3FRJA 3PGJA 4GWGA 4CL3A 5KOIA 3ENNA 5A06A 3GVCA 2D5CA 4BNNA 1EQUA 1NM5A 5JW6A 4UVIA 3LC1O 3JQGA 3QWHA 3NTRA 4CMIB 5JYDA 4J49A 1WXDA 2QG4A 1SAYA 3P19A 3ORFA 3LYLA 4AJEA 2YY7A 2DLDA 3WQQA 5IAAA 1FDVA 1XG5A 5CDYA 4OMUA 1B26A 2W2LA 3EZYA 1N2SA 3C1TA 4ILKA 3WX0A 2C0CA 1DOHA 2QZ9A 1X7HA 3RBXA 2X0NA 4EDFA 1Q0HA 5JLAA 1QV7A 4CM9D 3DHEA 1CQIA 4N5LA 1LQTA 4FFOA 1BDMA 1KEWA 2BGLA 4XQCA 4BNHA 1VRWA 3GN1A 3Q2IA 3Q6IA 1KEVA 3E9MA 3UXYA 5L4SA 4R5HA 4CM1A 2G0TA 5HRUA 3U4HA 4XGIA 4U6QA 3KRTA 4NK4A 1LA2A 3ZZNA 1I10A 2O7SA 2P5UA 1GDHA 5T8KC 5KJ1A 2O23A 1EUCA 1LJ8A 2VHWA 5CAEA 2DBQA 4CM4A 3VAZA 2E82A 2HMSA 2PR2A 4FGSA 5EESA 1GQQA 2VHYA 4XQ9A 3ZU3A 3QIVA 4J43A 3WDSA 1E92A 2VT3A 3DBLB 2GUGA 4LVCA 2A92A 2B5WA 5EN4A 4WCFB 1AN9A 2PWZA 3K2BA 5COAA 4ALJA 2ZJ1A 3H8VA 5I8ZA 5L40A 5JYEA 3UCXA 1ZK1A 2FPGA 4EI2A 2E4AA 2J5QA 5DOVA 3W8EA 3OMLA 4MP6A 3TF5A 3EC7A 2O2YA 3TOXA 3HN7A 4L75A 2C7VA 5C7OO 3QLJA 1DC4A 1N9GB 4R5MA 2B35A 1YS4A 3N58A 4JQCA 1I8TA 1UH5A 3PPIA 3TOZA 3K31A 1KEPA 1GR0A 4OXYA 1E7RA 2Z1MA 1NYTA 3DFZA 3PHJA 4DIFA 1CWUA 1JDJA 1Z75A 2HUNA 4WJZA 1MFZA 4BNUA 4J7CA 4DQVA 4N5NA 1DIGA 3GUYA 2JD1A 3QVXA 4BO1A 4EJ6A 4AJ1A 1U3WA 4BKRA 2GYYA 5JY6A 2O3RA 4DC1A 4ZQEA 4NJMB 3M2TA 3QVOA 3A14A 3ULKA 3H5NA 3BMCA 3FTPA 3ZI0A 1P45A 1LEHA 1WVGA 2B4QA 2J3IA 3WIEA 2ZB7A 5CEEA 3E6AA 4DBZA 1C0IA 3DBHA 2PKRA 5CG1A 2OGUA 1Y5RA 5JAMA 1HYEA 3OEYA 3BTSA 2Y1EA 5F21A 1ZUD1 4I08A 3VZPA 3ETEA 5KJCA 3KZVA 4DVJA 2IRWA 4D46A 5FI5A 4BL5A 1LRLA 4XKJA 3VKUA 1IUKA 3AOGA 4D42A 2GR9A 1GCOA 2ZJ0A 5TGDA 2PGJA 2GD1O 4EZBA 2HRBA 4F45A 3LT0A 2BKAA 4J90A 1PU2A 1ISMA 4E2XA 3V2HA 3Q2KA 4JBGA 1FDSA 4E3ZA 3VZRA 1A7AA 2HMWA 2EXXA 2NACA 3UHAA 2Y68A 3GMSA 3PWKA 3RWBA 2YJZA 3I4FA 4KUGA 1XGKA 5CDUA 4HBGA 3T7EA 1I36A 3L6DA 1K6IA 4W4TA 4HFRA 1B2LA 2VUTA 1Y8RB 1NQTA 1EBUA 2PH3A 3EZLA 3OQ1A 3QJ5A 2GGSA 3ZWYA 3AI2A 4R54A 1IOLA 3WXBA 1U9JA 2OBNA 2AMFA 1GUFA 3OH8A 2HDHA 1XLTA 1YH3A 2Y67A 4CMBA 4PLCA 1XDWA 1PIWA 1CF2O 1QKIA 1UDAA 1OBFO 1T26A 3D3EA 3NDIA 2X1HA 5HA5A 4YB8A 5TS3A 2HMTA 1E7MA 1P33A 2DT5A 3LQFA 3RBZA 4R1SA 1IHXA 1V35A 3NKLA 1TVEA 3HB4X 3JD4A 4BQPA 5A1TA 4FFPA 1XU9A 1D1SA 1ZBQA 4RV9A 3WGTA 5IDWA 2C2XA 3PQFA 4GX0A 4F3YA 6LDHA 4NU6A 2EG9A 3ZCXA 4Z6KA 3ZN2A 3ZWBA 1P9LA 1XQ6A 4OL9A 2GNAA 5ES3A 1XQ1A 4BNIA 1D8AA 1OFGA 4EEZA 4ALMA 1PJBA 2FR8A 4IY1A 1DBVO 1KC1A 4ZRNA 1PWXA 3DEYX 1ZK2A 4Y9DA 1ISIA 5FI3A 3TZHA 4EITA 4OKNA 3U4CA 2V7PA 1UXKA 3NT5A 1P1KA 3CEAA 3UKOA 5IFLA 1NQOA 1MGOA 2HLPA 3SX2A 3GGPA 4ROSA 3ADOA 3UOGA 4CLRB 2IZ1A 3AI3A 3NV9A 5LDHA 1LX6A 4WK6A 3HUDA 4J9UE 3KHUA 3AUAA 1LDEA 2HJRA 5G0UA 4XCVA 1AGNA 5DF1A 4IS2A 1I33A 1X14A 4I9HA 1AHHA 2B69A 2ZQZA 3ENKA 4PRLA 1ZXBA 1KVUA 2YDXA 1DAPA 1I24A 2FZWA 3RD5A 2PGDA 3AY3A 4LRSB 1E1NA 5K0ZA 5AXBA 3GT0A 5B12A 3OBBA 1WW8A 4UUMA 1T4DA 4BS9A 5L95A 4TKLA 3VDRA 1DEHA 3IP3A 3OSUA 1BW9A 4CUZA 4GSKA 4FW8A 4AJPA 2W2KB 2D4AA 1DJNA 3F1KA 4LN1A 5IDXA 1E3WB 3JD1A 3GVPA 3HNPA 1SNYA 3DBVO 4K9DA 2UV8A 2Y66A 2Q3EA 3VHRA 3PGXA 3LLVA 4ZGWA 3PHIA 2C07A 3EW7A 4R41A 3D64A 3LT2A 2WD7B 1UXJA 1WZEA 3CTMA 3VOSA 4TWRA 3DOCA 1C1DB 3ON5A 4J91A 4M54A 4MINA 5BSEA 5IN4A 1FDUA 2GERA 1ZH8A 4TRJA 2FOIA 3GGOA 4D41A 4IGFA 2AQIA 1N1GA 4WOJA 4BGIA 1T1SA 1GTMA 1VJ0A 5IDQA 1C1XA 3ANMA 4Z0PA 5T8KA 3DWFA 1E6WA 1SOWA 4CR7A 1W4ZA 2VUSA 3EAGA 4IXWA 1A9YA 2RH4A 3G1UA 1EMDA 4GX2A 2NU6A 4ALIA 4DTIA 1E1MA 3GPDG 1QLHA 2OUIA 3MJCA 1XSEA 3UVEA 3BMNA 2PZMA 1E6UA 2G76A 1L7EA 3H9EO 4YPOA 4S1VA 4RCVA 1KY4A 3MJ4A 1WDMA 2NV6A 4W6ZA 1M76A 2YV3A 1WDLA 2Q1UA 4M89A 2HKIA 1DJQA 4H15A 4JCOA 2Y1DA 4XGKA 2Q1WA 2A35A 4QT0A 4YAGA 1VI2A 4E12A 4E5MA 2OMEA 4YR9A 5L7WA 5L7TA 1N92A 3MJTA 1E6EA 2G82A 1P1IA 2BFOA 1QYWA 5H83A 3CH6A 1MV8A 3CZRA 3MJSA 5G4KB 5TX7A 4CLOB 3IDSA 4NFSA 4XQEA 3SBOA 1JN0A 4IQ8A 3H2ZA 2NTVA 3JQFC 1DFIA 3R0IA 5ENDA 4BHTA 5DNAA 1GYPA 4U0KA 1LSSA 1Y6JA 3FPLA 3ZHYA 3U4DA 5G4LA 4N54A 3PJFA 2VYNA 5CEFA 5K9ZA 3F4BA 3K30A 4XR4A 4NJOA 1ULUA 2BF7A 2O3SA 4Q3AA 5COQA 5C3MA 5I7FA 3DMTC 3AU9A 4CMGA 3KLMX 1UZMA 4Y8VA 3IMFA 4XZ3A 2IEBA 3E82A 2P9EA 2WE8A 3ZWAA 4YAKA 4AJHA 1ADFA 3ONFA 1XYGA 5G0SA 1BMDA 3AI1A 4BO7A 1NVMB 3R3SA 2FHSA 3WOHA 3UICA 1DPGA 2GZ2A 3I6IA 3HZZA 1PR3A 4CMIA 1A71A 2DTEA 5DOZA 2NVWA 4PGFA 1PZEA 4ZICA 3VTZA 3ZNNA 1E1KA 3FWNA 4BB5A 3BTUA 1YKFA 2AHRA 4NK5A 5BR7A 1H6CA 1NFQA 2VNAA 2NQTA 3VPHA 4AJNA 4GVLA 4TROA 1UJMA 3F6YA 4R1UA 1MX3A 1F14A 3ZWVA 3DMYA 1LSOA 3RUIA 5JO9A 1GY8A 1FK8A 5A3VA 2ZIZA 5AOVA 2FMUA 3ZV6A 5IDYA 1P77A 2TMDA 4IDDA 4CLEA 2EJWA 1NXQA 2R6JA 4ZA2A 2C5EA 2VHZA 1PGJA 3AU8A 3KM0A 4FBGA 3C8MA 4HFJA 4BNXA 4CQMA 3M1AA 4J7UA 1X0VA 1ISHA 1PGQA 3VH2A 1UR5A 1UXHA 1RPNA 1U28A 2I67A 2X9GA 1ISGA 3WIDA 5I7VA 2P9GA 3F46A 3ZHZA 3A1NA 3GR6A 4MJLA 1VSVA 3SVTA 1DFGA 4KWHA 2D2IA 3L4SO 1PS9A 2PFGA 4ZU3A 2ZYGA 1H6BA 1V8BA 1QLJA 2VRCA 3RC1A 2CY0A 3FF4A 1M2WA 2Q2WA 4XB1A 1FMCA 1LTHR 1YB4A 4MP8A 3IQDB 1HDZA 1A9ZA 3DBLA 3V1TC 1JKJA 1IHYA 2PY6A 4ND5A 4X54A 1HSZA 5ILGA 3BTOA 3ZW8A 4MO2A 4TQGA 1EZ4A 1HKUA 1NFRA 1JW9B 1ONPA 3KSZO 3GC6A 3E9QA 3NGXA 1N8KA 4FQ8A 1JAXA 1I3KA 1V9LA 2VZ9A 5B1YA 5T5QA 4OXNA 4G5HA 5L4LA 2JFFA 3H9GA 2A9FA 3IC5A 3JQAA 3VPSA 3WLEA 1N7HA 2AA3A 1DDOA 2X5KO 1VSUA 1PEDA 4L4SA 1GYRA 3ZNPA 4FD3A 1MG5A 1EFKA 1XKQA 3WWYA 3AUTA 2V6BA 1AUPA 3KSDO 4CLXA 4E0BA 3OJ0A 5L53A 1ISFA 3V1UA 1UP6A 2JFHA 4UVEA 5JAZA 1R12A 4DYVA 3CZMA 1MA0A 3AW9A 1UDBA 3LK7A 4OOEA 1WMAA 3GMDA 4GPD1 2IEDA 1H6DA 3M6IA 5JNLA 1KEUA 3I9MA 1PL6A 3P7MA 3R6DA 5EERA 1ZW1A 1GV0A 4J16A 4CQMD 4Z3KA 4F6CA 1ID1A 4YRAA 4JX8A 4RPGA 3GNSA 4EUHA 1YE3A 3D1LA 3KXDA 2VOEA 3WS7A 1ZZEA 1J0XO 4NJMA 5EIOA 2UDPA 1ZSVA 3D3WB 3U9LA 2WMDA 4WKGA 3FTNA 5TT1A 1QV6A 3ROKA 2OL4A 4JIGA 3GZNA 3HB5X 3E8XA 3JYOA 2B4TO 2VRCD 3KB6A 3OIFA 5DBIA 3PTZA 4HFMA 2P4HX 2FRDA 3O9ZA 3BHIA 4L8VA 5HS4A 3BIOA 3I3OA 4AL4A 3IJPA 5JDIC 5KJ6A 2OORA 3FSRA 5KWEA 4JGBA 3H9JA 4RVHA 3W6UA 1M67A 4ALLA 2I5PO 3BMQA 1PX0A 4M87A 3VVCA 1YBVA 3E48A 4UREA 1H5QA 1VL0A 4FDAA 3MOGA 1E7WA 2VCYA 4W9NC 4WGGA 2OO5A 3ZU2A 1LDBA 1OI7A 2RIRA 2VQ3A 4GMFA 4A2CA 4KQXA 4QECA 1YVEI 3JQAD 2Z95A 1YQGA 3IUPA 1E3JA 4BB6A 3D0OA 5BSHA 4RO0A 1LNQA 3GVHA 4HFNA 4CMEA 4AJ2A 5IZ4A 3BHMA 3TFOA 3WYBA 5GZ1A 1Z7BA 5A4DA 1FJHA 3GVXA 3DTTA 5TJHA 1DRWA 2B36A 1Y8RA 2CDBA 1VKOA 1NR1A 5CDGA 5F5LA 4YBZA 4RL6A 4NU5A 1N1EA 2B4RO 4Q3BA 4CJXA 3JYNA 1VM6A 1K5HA 1KVRA 1PL8A 3KUXA 5DBFA 1JTVA 1BXGB 2YV1A 2O7QA 4Y6PA 4WNIA 2J3HA 4B7XA 2YDYA 2EJVA 4NBVA 2WYUA 4KZPA 4AJOA 2I6TA 2VT2A 1VJTA 3IKTA 4CUKA 4WLOA 4B4VA 3BMOB 3UF0A 4XIJA 1HLPA 1B15A 3PYXA 2PA3A 4JP2A 1P1JA 4NG5A 3RU7A 3VH1A 3LT4A 4IDCA 2RCYA 3H4VA 3VPFA 4OIMA 3F9IA 1WWKA 3B1JA 4RDIA 1VL8A 3PQEA 2XAAA 3ONDA 4GVXA 3KOUA 4AJ4A 2NTNA 5THQA 3UCEA 3ZWCA 2DPGA 3WGGA 1PJCA 3Q9UA 4ZN6A 2I3GA 3MOIA 3WBBA 4HUJA 4EW6A 5JXWA 3LLSA 1R16A 3JQFA 2E37A 1JWAB 4J2OA 2ZCUA 4B7UA 3JSAA 4J0FA 4NNJA 2ZCVA 1ULSA 4WOKA 1KOLA 4F6LA 3HN2A 3FN4A 5JY1A 1U2GA 4FC7A 4M8SA 3VH3A 1NX6A 1G1AA 1ZXLA 5CHEA 1Z74A 4RORA 3DMTA 3QWAA 4OSPA 3HFSA 5L4NA 3RJ5A 4FJ2A 2QX7A 3M1LA 4U0JA 3JYQA 3S2GA 4DMLA 3I52A 3NTQA 4D43A 3MTJA 4XR9A 3I9NA 2AEJA 3DBRB 3PIDA 3OJFA 1HXHA 4DLAA 5L45A 3GNQA 5TT0A 3WGOA 4CV0A 2Y1OA 3M2PA 5DCYA 2POQX 4EGFA 4DPMA 1BDBA 3ADPA 2XOXA 1IPFA 1NPYA 1UZLA 2IZZA 4J0EA 3JQCA 3A06A 3MJVA 4IMPA 1OZAA 4A10A 1HTBA 1V6AA 1DLJA 5CDSA 3GLQA 1BVRA 1P31A 4DWVA 3IJRA 2DKNA 4OSOA 3SLGA 1TT5A 2YFHA 4BNYA 4GKBA 3D4NA 4QTZA 3PEFA 1SMKA 4NBWA 3WGZA 2AQKA 3ZWWA 4URFA 4KQWA 2ZTMA 4GBJA 1JA9A 1YXMA 4L74A 4UUPA 5F1OA 1IZ9A 2O4UX 9LDBA 5J23A 2EERA 1O6ZA 2O50A 1E5LA 1H9BA 3B70A 1W73A 1TXGA 3RIHA 2WD7A 3JQDA 2DUUA 1CERA 2IXBA 4B8WA 3ZV3A 2FPIA 3S8MA 3COSA 1C1DA 4Y67A 1ZK3A 3LDHA 4WUVA 4Y6SA 2DTDA 4BKPA 4DREA 4RVGA 5IXYA 5JPIA 1HE5A 4IIVA 2IYOA 3VVBA 3UW3A 3KV3O 3O26A 4HADA 4YAIA 1GADO 4JJFA 1E7YA 4A26A 5F1PA 3HHPA 1MLDA 2EKLA 2P5YA 2NLOA 1F06A 3TJRA 3PVZA 4FFNA 4ZVVA 4XRGA 4NZ9A 1P74A 2WWRA 4OGWA 2W2LD 5KVQA 4L0QA 2W8ZA 4NBUA 4NMHA 4FJ1A 1LLUA 2JCXA 1LDNA 4IJVA 4J1NA 4OQYA 4II2A 5B4TA 4BV8A 1H93A 4QO7A 3RC9A 3JYPA 1O0SA 3H2SA 3WQRA 4QSMA 4LISA 1G0NA 3ROMA 5A9TA 3DOOA 5A05A 3OFSA 2EW8A 1H2HA 2EW2A 4IIUA 1ZCJA 3RQSA 2CVZA 4AFNA 3SLKA 2NADA 1RM4A 1HWYA 5KIAA 3PWZA 4PLWA 3RUAA 4J4BA 2X0RA 1LQUA 4BNKA 1MFPA 2QRLA 3EVTA 4BNJA 1K2WA 4DIOA 4FCCA 4CV2A 1R15A 4CLOA 4PCVA 1R37A 1SB9A 1Y5MA 4KUEA 3WFJA 1YB1A 4WCDA 3WB9A 4AVYA 2X9VA 3NRCA 3QP9A 4ND2A 2YHIB 4YEDA 3ZU4A 5ER6A 3W4IA 1DXYA 3GNTA 2CVOA 3ANNA 2Y0DA 4AJKA 2GASA 2O3QA 2VHXA 1PTJA 2PD4A 2VWQA 3ZGYA 3DHYA 4MVJG 4RZIA 1ENPA 3BHJA 4DPLA 3RU9A 3ZHXA 3WQSB 2DBZA 5I9NA 1PJSA 3K73O 3I6QA 3I23A 1KVQA 2ZTVA 3GN2A 3TZCA 2RH8A 4NDNE 4LMPA 1CRWG 4PZDA 1LU9A 3EK2A 4B3IA 4D79A 3GRKA 4FFRA 2WYVA 1GQ2A 1CDOA 1GV1A 4LW8A 4E21A 4GLOA 2CDCA 4IDEA 1Y8QB 2FR1A 3BXXA 4Q3CA 1EUDA 4JXKA 3H3JA 2CSUA 2UUPA 1IPEA 1RJWA 4K6FA 2IZ0A 4UVDA 4RF5A 3S1LA 3PDUA 5BNIA 3TRIA 4K6CA 5KVVA 2RHRA 3KEOA 4PLTA 3FNEA 2YFQA 4BGVA 2D8AA 4HKTA 5DBGA 5A04A 2EGGA 3NUGA 4PLYA 1U3UA 4BO3A 3N7UA 4YJFB 3KYCA 5IZCC 1RYDA 4E32A 5TRTA 3S2FA 4PLFA 1UDCA 1O94A 5JDIA 2YW9A 3D5TA 3L6OO 3VDQA 5I9MA 1Q1NA 2X22A 1Z7EA 3O8QA 4ZQHA 4WNCA 4W9NA 4IDFA 4XA8A 2EHDA 1XCBA 3PHHA 3WWZA 2VHVA 3PFWO 4WCFC 2QW8A 1VJ1A 5I7EA 3IKVA 3OIGA 3OJOA 2NWQA 5ITVA 1B0AA 1PZHA 3JQBC 4PIVA 4Q3NA 3F5QA 4RVUA 4YXFA 1Y9EA 3GAZA 4MVJH 5A5EA 3NX4A 3RFTA 3RROA 4OAQA 1GPJA 3FPCA 5MGBA 4MP3A 2JL1A 4NR0A 3OP4A 4OM8A 3AUSA 4IINA 3INRA 5F5NA 2WD8A 3OA0A 4BKUA 3C7DB 4QEDA 3L0DA 2P4QA 3DAGA 3IUSA 3VZSA 2D5AA 1YBMA 4RLHA 2PLAA 2Q4BA 2X5OA 3G1TA 4FFLA 3QA9A 3ZU5A 3I9KA 1IY8A 1EVZA 1LUAA 2HMUA 4J1TA 4E33A 1ARZA 3HWRA 1O95A 3RBVA 1A5ZA 3RVDA 3MJEA 4WEOA 1C14A 4Z9FA 1PJ4A 3HADA 4HNHA 4HXYA 3W6ZA 1V3UA 4HX5A 5JMPA 3G49A 1R4NB 1GEEA 3JQGB 1GU7A 3GEGA 1UXIA 2EEZA 2YQ5A 5JMWA 2JCVA 1LDGA 2GZ1A 3NDRA 1BRMA 2OOSA 2YZ7A 3WSVA 4PN3A 3GHHA 4R68A 5C7IO 3JD2A 4ZJUA 4IZHA 3G0OA 1JWBB 1PZGA 1EVIA 2CF6A 2QYSA 4O5OA 2WM3A 5CG2A 3LT1A 3HDJA 1T25A 4QUKA 3TL2A 1NQAO 3E18A 2FR0A 3VKVA 1HYHA 3PQDA 5C37A 5JCJA 3JQ7A 5IF3A 5ITWA 1QORA 2HK8A 1DIHA 4OOFA 4AICA 2WSBA 3D3WA 1J4AA 1GCUA 5MDHA 2PD3A 5TQVA 1O89A 4MDHA 1U5AA 5JS6A 4NBRA 5LCXA 4GL4A 4YT4A 3DR3A 4E31A 1JKFA 3SXPA 1EE2A 1DRUA 3EYWA 4DYDA 3CKYA 2VWGA 1R0LA 2AE2A 3T4EA 4Q3EA 1UAGA 2EGHA 1ZIDA 3PHLA 4ND3A 4QFDA 5T57A 3V5NA 1N7GA 2CDAA 4BO2A 3AM5A 4BMVA 4ALKA 3K5PA 1D7OA 3FR7A 1NPDA 1JU9A 3HDHA 2NVUB 4BNZA 3KSUA 3AFMA 2ILTA 1YBAA 3DHNA 2C7GA 5EL0A 3ZV4A 1PS0A 4JROA 4R69A 1CJCA 4CM3A 4DC0A 1F0YA 4R4JA 1QXSA 2Q99A 2DM6A 5GMOA 2R2GA 4ND1A 1O5IA 1P1FA 3AY7A 4DLBA 1GUZA 3PYMA 4W99A 4WLUA 3H7AA 4GI2A 2R00C 1XELA 4JBIA 4IQGA 5GZ3A 1ZMOA 5A03A 5ICMA 3X2EA 1ZSNA 3K96A 4FGWA 2EV9A 1YQXA 4E2WA 3QWFA 1ONOA 3R3JA 4YJGA 2Y1CA 3TDKA 4BQRA 4AJJA 2Z5LA 5TC4A 3TN7A 1HL3A 1P0CA 3PP8A 2ZB4A 5JC1A 3ST7A 4MVJF 5HTOA 2V6MA 1BSVA 1HDOA 4BO4A 5LC1A 4CQLB 1HYGA 2NU9A 1D4FA 4PLGA 4MOWA 2JFGA 2YQ4A 2WJPA 4NQZA 5ENVA 4FFMA 4XYBA 1XWFA 1FF9A 4UAGA 1DLIA 3HE3A 1ZVMA 4L4RA 3PYLA 5JCJD 2Q50A 2CF5A 2HCTA 4D45A 1UP4A 3BMOA 1GL3A 1MC5A 5JC8A 3E1KA 5DCWA 1LLQA 1Q7CA 2ZKLA 4RGBA 4ITUA 4C7KA 2BI7A 1B8VA 2PH5A 3W1VA 1KVSA 2PZLA 3P5SA 1S6YA 4YT2A 4N5MA 4WE3A 4YRBA 1YB5A 3DXFA 1FXSA 1U4OA 1H2BA 3DBHB 1XA0A 5DN9A 4IS3A 1JLLA 4ZQGA 3HG7A 2C59A 3DONA 3GRPA 2BGMA 3O4RA 4PG7A 4Q3DA 4YJHB 4L9RA 3IIEA 1EDZA 1NVTA 2JHGA 4CMKA 1BTOA 3VZQA 5ICSA 4GAEA 4XIYA 4NPCA 4UEOA 2X58A 1QYXA 2FWMX 3I9JA 4LCEA 1T1RA 3RCBA 3DZIA 3GFBA 1D3AA 1NVGA 3FNGA 5I7SA 2BFAA 1UUFA 1VL6A 1V3TA 1P3DA 4EJ0A 2W4QA 4MIEA 5GZ6A 4RLSA 4CMHA 4R16A 1I01A 3DBRA 2P68A 4YWJA 1LRKA 4DL9A 4LMRA 5KVCA 3RUFA 5BQFA 1ML3A 4O6VA 4M55A 1U2DA 4QFCA 3W4KA 2ZK7A 3NT4A 4AG3A 2UVDA 1B7GO 2GN6A 4YAEA 1HSOA 3AK4A 2EIHA 2H1SA 3IL2A 1AXGA 2O3UA 2PV7A 3C7AA 4RPLA 1GFSA 4BV9A 1H6AA 1WPQA 3ABIA 3KYBA 3RFXA 2GN9A 3IP1A 3WR5A 1WDKA 3DAPA 3WGYA 2JAPA 2VYND 4MVJP 1A72A 2DAPA 1NWCA 4R9SA 5IZCA 5L3ZA 3DZJA 1DC5A 2JKVA 3GA0A 5TJ9A 3NGLA 3WGQA 1HE3A 2C2YA 1H94A 3DFUA 4D3DA 2VTEA 3ZHBA 2PKQP 4JNKA 3I9OA 3OEWA 5DCUA 4WCFA 1EQ2A 1HT0A 1EVJA 4NBTA 1LI4A 4GKVA 4YQZA 2DFDA 5TSDA 2H63A 4XWYA 3K6JA 2AQ8A 3JQBA 1EE9A 5AVOA 1Z45A 3DOJA 3GVIA 3QWBA 5AYVA 3FI9A 3IAHA 4KMSA 3N74A 1VPDA 1F8GA 1I0ZA 3EDMA 1WLYA 4PZEA 4CR6A 1N9GA 5K6AC 1T2FA 1VLLA 2GLXA 4FS3A 4H3VA 4K26A 4JBHA 5DP2A 1YDWA 2IODA 2G5CA 1PGPA 5AXAA 3X2FA 4EBFA 3RUCA 4QO8A 4CV1A 1A27A 4KP7A 1SOVA 2J5KA 5F1KA 3L07A 4RVSA 3TWOA 3GOHA 3D5QA 4B3JA 1LLDA 5F3RA 1T2CA 1PQPA 4FC6A 4IPTA 3GZ4A 2QZZA 1I2BA 1DAOA 3CIFA 3VC7A 3WLFA 1HDCA 3UCFA 4J4HA 4QXMA 4C4OA 2B5VA 1I3LA 3EHEA 1KY5A 3CMCO 4D3SA 3L77A 1J5PA 2OHXA 3I1JA 1WZIA 4GX5A 2X23A 3W8FA 4RVFA 1SC6A 3AWDA 4N7RA 4GQAA 4Z0HO 2VRBA 5FEUA 3WFIA 4GLLA 4JK3A 4DRYA 2YHIA 4A7PA 3HDYA 4YDRA 3JQ8B 1CYDA 3PI7A 1LLCA 4TMFA 3AJRA 5ILOA 1U8FO 3JQ9C 4IUYA 1I2ZA 2HK9A 1TI7A 3W4JA 3PK0A 5CEJA 2Q46A 1H9AA 1U4SA 1AXEA 2HAEA 2RBEA 1PGOA 2EP5A 1OOEA 3JD0A 1QSGA 4BNMA 4MVJE 3C1AA 3R1IA 4UVGA 3PRJA 4BO8A 1MXHA 3MZ0A 4P4LA 4PVCA 1K0UA 1Y8QA 3F4LA 2O2SA 4NFYA 5KCZA 2JD2A 2CNBA 3B1KA 5COBA 5H82A 4OQZA 2NSDA 4CODB 4BGUA 4DUPA 1ENYA 4XEHA 3H9UA 1PQWA 3RJ9A 2BD0A 4DXHA 3LSYA 1C1XB 4YTEA 4B4OA 4ALNA 3AY6A 4E5NA 2WEKA 1A4UA 5KTKA 3H5RA 4CMCA 1GQYA 1UP7A 4R1TA 1MC4A 4YJFA 4H7PA 3TPCA 4PVDA 5C5IA 1DB3A 1E5QA 2QIOA 3BTVA 2C5AA 4OH1A 5A5FA 3L4BC 2Y0CA 1B16A 3B1FA 2W98A 2OZPA 1YJ8A 4I5EA 1J6UA 4MVJA 2C29D 3JV7A 3BYZA 4W82A 4JLWA 1HEUA 3GDOA 1UXGA 1WMBA 1X15A 3OHSX 2NNLD 3WICA 4LK3A 4EYEA 1JVSA 3EUWA 1NQ5A 2ET6A 3I83A 1QR6A 2XPCA 4BMSA 2R00A 1BHSA 3W8DA 4A0SA 5DP1A 4CLDA 1G6KA 1ZJYA 2QYTA 3C1OA 5U9CA 4XQGA 3LVFO 2AE1A 2IDZA 5BT9A 1SCUA 2C54A 5CFZA 1SB8A 3KO8A 3L9XA 4BNTA 3JYLA 5CDTA 1NHGA 2GO1A 2HQ1A 3DQPA 2DVMA 2G1UA 3LC2O 1Q7BA 4KWIA 4R9RA 1D1TA 4FPXA 7MDHA 3LZ6A 3U4IA 2Q4EA 1HDYA 3KEQA 1YDEA 4MKZA 4H16A 1YQDA 4CM6A 2I99A 2CMDA 3H65A 1GD1O 2GSDA 3QY9A 4YT8A 1M6HA 3ETGA 3ZH2A 2X6TA 5DULA 5L9AA 3QV1A 3ETDA 4RQTA 3EMKA 4K28A 2PTGA 4ESOA 4CLRA 3GF4A 1CETA 2GPTA 1I32A 1R4NA 2CD9A 1OMOA 4R01A 4E13A 4CLHA 5JE8A 1SEPA 3D4OA 3G17A 2ZYAA 3INGA 4CV3A 2BMAA 4E2YA 3V2GA 1T2DA 4CMJA 1E3EA 3HFGA 4FR5A 5BSGA 3JTMA 4MVJD 5U1PA 3GAFA 4B4WA 2J3JA 4XDYA 1YWGO 1MB4A 3I9LA 2GN8A 1B8UA 4P38A 3ZNOA 5KKAA 1G0OA 5A3JA 4HY3A 2JD0A 1GUYA 1HE4A 3OJEA 2FN7A 5G0WA 4BO9A 4NIMA 2PD6A 2W2KA 3DZGA 1E3WA 3DZFA 3GEDA 1NNUA 4MKXA 2YYYA 5JAIA 4UEKA 1PL7A 3PLNA 3D7LA 4CQMB 4B79A 4J9VA 5L7YA 3FNHA 4BNVA 2I65A 4ZQBA 1NP3A 3SEFA 4QQRA 1P1HA 2WTBA 3D4PA 3E03A 1GAEO 2H5LA 3KYDB 4I5FA 1FDWA 4PZCA 4GMGA 1E3IA 3STHA 1SBYA 3ITKA 3ZDFA 3PIIA 1A4IA 4E5PA 2D3TA 4WEQA 4GGPA 3C3XA 3UH1A 4W7IA 4A27A 1P0FA 4BMNA 1KIFA 3PFFA 3PZRA 3ZW9A 5AQ1A 3ZV5A 5HM8A 4I9NA 1E1LA 3GDGA 3AFNA 1M66A 2BGKA 2Y93A 5FF9A 3ICCA 2AG5A 3CSDA 2Q1TA 3GPIA 5FYDA 1QYDA 2NVUA 4XB2A 3OQ6A 1LC0A 1YONA 2AG8A 1ENOA 2JCYA 1NPTO 1Y9AA 2X86A 3ANLA 1YL5A 1HE2A 4BNWA 1B3RA 1ZMTA 1OC4A 3GGGA 4O1MA 1WNTA 4TRMA 1PJ2A 2Q2QA 2PZJA 1Z82A 5KNLA 2HU2A 4A73A 2O48X 1YJQA 5EINA 4BNGA 2OBYA 2C82A 3K9QO 3Q1LA 4K1LA 4PRKA 1V0JA 3PJEA 3JQAB 3PWSA 1C0PA 3B6ZA 1UZNA 4JP3A 1PSDA 1TA4A 4TSKA 1E7SA 2EP7A 1ENZA 3A9WA 1X0XA 2O3JA 3FD8A 2IXAA 4XJTA 2OP0A 3F3SA 2X9NA 4LRTB 4CM8B 4XD2A 5G4KA 4CQLA 1T24A 2D0IA 4OXKA 4Z3DA 3MTGA 4IMRA 5K6AA 4OYRA 1R66A 3OQBA 3U62A 3WBFA 1ISJA 2FSSA 1S7CA 3I5MA 3RSHA 2LDXA 3EVNA 4FN4A 2G17A 3A28A 3MWEB 2XF8A 1T2EA 3GDFA 3CUKA 2GRAA 1XHLA 2YUTA 3QSGA 1NFFA 3C24A 1FDTA 1C0KA 3ZNQA 4KTTE 1B8PA 2CUKA 2NU7A 1F8FA 1IZ0A 4U8GA 3ZWNA 4JN6B 1BXKA 2CZCA 1L1FA 3RUDA 2E48A 3CPSA 3LF2A 4GH5A 3SJUA 2HMVA 2HO5A 2I66A 3FWZA 5I9LA 2X5JO 1YOVB 1HZJA 3GZNB 1JAYA 1TT7A 5DDIP 3DB2A 3OETA 4HP8A 1U3TA 1DFHA 4YJHA 1HRDA 1DSSG 1RM0A 3NJ4A 5IXSA 1K89A 4MIOA 2YV2A 4RJTA 1VKNA 4OJNA 3TZ6A 3JQ9A 4E4YA 1EVYA 4M49A 1M75A 5DT9A 2BRUA 1R4MB 2WDZA 3BMQB 3ROQA 1K3TA 1ZSYA 4FOSA 3WGHA 1VE9A 4N18A 3ZWPA 1W6UA 4B3HA 1HDGO 1TB4A 3CE6A 3HSKA 4XGNA 4GX1A 3K92A 3MWDB 4O63O 2P9CA 2PGLA 2H6EA 2IYPA 4BUCA 1YO6A 1BVUA 1YGYA 4B7CA 2X0IA 4AJIA 4PLZA 3GH3A 1X7GA 3QQPA 1E0DA 1X13A 4LVUA 2A4KA 3TZQA 4FJ0A 4A5OA 5JAQA 5TLSA 4U6SA 1RWBA 3T4XA 1CEQA 2BELA 5A9SB 2BFMA 3OM9A 1SEVA 2AEFA 2DTXA 2VYVA 1SO8A 3E9NA 4I9UA 3DO5A 4NI5A 2JAHA 3WTBA 4CMAA 3A4VA 1L7DA 4BKOA 5A9RA 4RPHA 3FHLA 1I3NA 4PG5A 3WYCA 1Q0QA 4P8RA 3UFXA 4M1QA 3U5TA 3QVSA 3KBOA 2X7HA 3ZWOA 1DRVA 1R0SA 2NM0A 1OAAA 3DTYA 1IL0A 1KC3A 3GHYA 4MPDA 3TFQA 2F1KA 2VZ8A 3L4BA 3WMWA 4BO0A 4EEXA 1Q7GA 1RYEA 3DC2A 1QP8A 1NTOA 4OHUA 1KYQA 4XDZA 3V8BA 1MP0A 4AJLA 4B8ZA 1PJQA 2Q1SA 4XYEA 4IM7A 1KETA 1Y7TA 4I5DA 2ZATA 4I1IA 1T2AA 3WNVA 3E5RA 2AQHA 4E5YA 4TVBA 4IQ0A 1W0CA 4I8XA 5B37A 3NAQA 1DC6A 3INTA 4ONEA 3CINA 4Q39A 1WP4A 3L6EA 4PLVA 4WLFA 4PLHA 4INAA 1XU7A 4L4XA 3G3EA 3FNFA 2GZ3A 4FB5A 3Q9NA 4NH4A 4GSLA 3GG9A 3EGOA 4YCAA 4CM5A 4D44A 4DGSA 4DQUA 4U5QA 1AE1A 1X7DA 1HF3A 3UUWA 3ASUA 5FWNA 2FZEA 1I3MA 1IULA 4MIYA 4HNGA 4G65A 1EEHA 3H5AA 3GK3A 4CUJA 3VTFA 4Y6RA 3GEMA 1HZZA 1U8XX 4Q9NA 2CFCA 3S2EA 2O3TA 3WMXA 3JD3A 1T4BA 1Z73A 3I4CA 1QMGA 4RQUA 2H9IA 3GFGA 5EPOA 3QRWA 3F47A 4ZQFA 3WTCA 2NUAA 2VYVD 4DA9A 1N5DA 5G0TA 1GEGA 1DIBA 1IE3A 3FBTA 3VPGA 5JDCC 3K2EA 1Y81A 4QX6A 2WE7A 3Q3CA 4XX0A 1PZFA 1I30A 1BWSA 3CXRA 3UGKA 1E3SA 4YYZA 1YL7A 5JBIA 3JQ8A 1PJTA 3LC7O 4L76A 1TT5B 5EQDA 3PXXA 1GPDG 3FBGA 4WECA 4GWKA 4Z9YA 3KVOA 3RKUA 3C7CB 4CM4B 1NHWA 3S55A 1CQJA 3BA1A 4HV4A 1GYQA 3TZKA 1HLDA 3QVWA 3HDQA 2BHLA 2Z1NA 2Y99A 5BNTA 2FPPA 3JCZA 5T6BA 3QWIA 3T7CA 5G0VA 3LU1A 3GG2A 4CMEC 1SPXA 5IJZA 1ADBA 3P2YA 1GZ6A 4UUOA 3AOEC 3H9QA 4S3MA 3HQ4O 1M6WA 3U3XA 3NJ8A 2PNFA 2OFPA 4JJIA 5C7LO 3EY4A 1EBFA 4PG4A 3SJ7A 1CIVA 1PWZA 4E30A 4IDGA 3IOYA 1K6JA 2I76A 1PR9A 2UAGA 2DPHA 1ZEMA 4D3FA 2HRZA 3DDNA 2Y05A 4RDHA 3QE3A 7ADHA 4YACA 4D0RA 1U1IA 1YL6A 1EK5A 3WJAA 1JVBA 3PLRA 1YRLA 4W7HA 1UAYA 4TZKA 4RF2A 4P4GA 5T64A 2O4CA 4J7XA 1BXGA 1BXZA 1LC3A 4PLPA 1R0KA 2J5RA 3HJAA 4CM7A 5AXDA 5BNFA 4XYMA 3E5MA 2I3AA 3PDJA 3GY0A 1ZEJA 5A02A 5LDGA 3WJ7A 1DC3A 1R6DA 3F5SA 4R3NA 1E3LA 3H3FA 4CL8A 3VH4A 4TKMA 4YT5A 4BIIA 1XEAA 5AXCA 4LCJA 2SCUA 1B14A 4A03A 3BMCB 2GN4A 2X8LA 2YHUA 3RC7A 2VTDA 3RASA 1ZFNA 4YQYA 1C0LA 4BGEA 3PJDA 1KERA 2FSVA 3NEPX 5H81A 3OECA 4UEJA 3U49A 4RPJA 3K8ZA 5IG2A 2ZB3A 5ER9A 9LDTA 1TLTA 3DZHA 3TL3A 4IJWA 2QHXA 5HS6A
chains in the Genus database with same CATH superfamily
4PG6A 3SSNA 4YROA 1DQPA 5CD1A 1AUOA 2J6CA 3HB1A 5CPBA 3RAGA 1A9SA 3WGUA 3D1VA 3Q8XB 1P91A 4CNBA 1D5WA 3EZ2A 5IYZB 1N0IA 2RIPA 4Y2VA 2ZSKA 1RKBA 1LDYA 4DYHA 3V46A 3IPXA 4YAJA 1G2QA 2QNIA 1Z7GA 3FXAA 3TLXA 4HWKA 2FX2A 4TRRA 3V4LA 1ZJZA 2AG1A 3WZMA 5A4IS 5AH0A 2ZWIA 3CMMA 1JIVA 1QYVA 4JELA 3V2UA 1QGUA 3PE6A 2XOKD 1UZUA 1NBOA 4DQXA 3IV7A 4GM0A 3CUEF 2GJAA 1K6XA 1LJUA 1EK2A 3O95A 3EVZA 2PGAA 1GZHB 3G79A 4M4SA 2HRDA 4NOLA 2IF0A 2P91A 3A4IA 3HKBA 2NXNA 2BJVA 3PF8A 5DHQA 1ZO8A 8ADHA 4P84A 1LRJA 3UHFA 4BLQA 2REBA 5JZOA 3I01A 1N36B 3SQLA 2DBRA 5AOAA 1PSWA 4ZI7B 1KDYA 5EQFA 4UOEA 5JI3E 1VLQA 1PZMA 1X70A 4DAOA 1HEYA 4W5WA 3UV6A 1K75A 1O58A 1ZHHA 1HYQA 1K8QA 4KDFA 3A3NA 4L7QA 4A2WA 5CITA 1JH8A 4TSFA 1W59A 4I3FA 1DBWA 2J6IA 2H1WA 2BSAA 1WVIA 4ENTA 1VIYA 3LECA 4RNCA 4QHYA 3UWSA 5IJWA 3RC8A 3O8QB 5LBTA 1TK2A 2PVCA 2V7XA 4D74A 4DVGA 3I04A 3IV9A 3OOWA 2ZM6B 4NFHA 1C8VB 2OWDA 4DLYA 1MQAA 2XE6A 2VZ0A 5CVTA 3DVSX 1IY0A 3RHSA 4X71A 2J8ZA 5AR1A 2WJ3A 4YRDA 4D0SA 1ZN7A 1U0LA 3PCXA 4EG7A 3LQQA 2GOYA 3L8HA 1WAMA 2IYWA 1GQSA 1TTQB 4N39A 3EJWA 1V41E 5HW0A 4I81A 4PIMA 1W49A 2ASVA 1MA3A 1VIAA 1X1EA 2BH9A 2QG9A 3EIEA 3L0YA 3LUCA 4MQEB 1AN0A 4XD7D 1A2BA 1XNQB 5T41A 2Q2VA 4A0GA 3Q9LA 1T9BA 4R3WA 2CNWA 1DBQA 3PZBA 4PHTA 2C20A 5LP6C 4O4JF 2CNLA 1GPNA 1U7HA 2GJ4A 4GI5A 4KX5A 4UCXA 2BMVA 2Z5VA 3KVVA 3MHPA 3KEFA 2IVFA 4P1ZA 5HBRA 2AHOA 1NY5A 2JI8A 3MMZA 3W34A 1WETA 2XV1A 4UMVA 4F96A 1RM5A 1QIGA 2QORA 3GQVA 3L8FA 1EPUA 4EG0A 4Q66C 1MW9X 4HB0A 1AQUA 4EKYA 4YPFA 3BAZA 1XR3A 2GRJA 3WJ2A 2ONKA 3TSCA 3CUYA 3AMVA 1T3LA 2JH8A 1L7QA 3QW2A 5CLQA 3P9SA 4FGUA 4KDEA 2CVQA 3BB4A 4WUTA 1N8SA 1PFWA 4Q4DA 2GPNA 2O5RA 1E7QA 5FBLB 4URYR 1DIAA 2B4AA 4DKJA 3UWMA 4CVNA 3NCHA 1QH0A 4RTRA 1ABFA 2GCOB 1QRRA 4PLPA 1JJVA 5T67A 1PNQA 2F3TA 4R2HA 3H2HA 3HYNA 2G83A 3L8DA 1UEIA 4CPDA 2DUJA 4GBMA 4HDQB 2Q1YA 1QE0A 4TSFD 1NW8A 2EKQA 3EJ6A 5FBVB 4DEXA 1QIDA 1WIWA 4EO4A 2YIJA 5IWAB 1LPSA 4R8LA 4QBTA 1NWHA 4IFEA 4YRLA 3G88A 3LF1A 4PFKA 1Q50A 1RAEA 4HX2A 2CXUA 4MVJI 4F84A 4WKCA 1A7KA 4FIZA 1EP3B 2VK1A 2V3VA 1EA7A 2BKUA 3PNPA 1JBEA 3QPCA 5LVAA 4C0HA 3WYEA 4UFPA 4PC7A 3OBIA 5DV9A 2VP4A 3V1YA 1M1YE 1M73E 2QN9A 1TKCA 2ZJAA 3H4IA 3PQCA 4GZMA 4Q6BA 4O4LF 4R2JA 3FVTA 5B58T 1P44A 1XZ8A 2A94A 2EWMA 1LBIA 2OYRA 1N5RA 4K6KA 3UV3A 4PFJA 4NL4H 3L9WA 4ZD6A 1IQ0A 2W48A 2GPAA 5E7JA 3IEKA 2RK6A 4AUEA 1MC1A 1TEHA 4MICA 4FKMA 3UQYS 3LUAA 3QHQA 1DQYA 1U0GA 4XWTA 1MAHA 2JAOA 1WHTA 2ODTX 1YOVA 4J4TA 2WTNA 5IKPA 5TEVA 2JEYA 4Q1BA 2C8VA 2R8EA 3MCUA 2PV0A 2PX2A 2IUSA 5JRZA 5B4UA 2I2WA 4G86A 3V55A 5LM3A 3ZXIA 4XXHA 4FX5A 2E6UX 2NXEA 2Q5LA 1QH9A 2B7BA 2VK8A 3NG1A 4HGRA 4JLDA 4CEIB 3FDFA 2XYHA 1MG0A 1Y7HA 1EUZA 4UNSA 5TF4A 2FWRA 3CLHA 2C2OA 3QX7A 2IUUA 5B6JA 4P22A 4J3FA 4I1OA 2NPIA 3L8CA 1B8OA 3V4RA 4OI2A 4QJ4A 5B3JC 1ODTC 4AKHA 3QPVA 3W3AA 4JC4A 5FR2A 1RD4A 2HTEA 3R5FA 5L51A 1KY3A 1JR3A 2ZYDA 4TVOA 3RANA 5TQ2A 3RSOA 4E2ZA 1Z83A 5H9WA 2OP1A 3KBBA 2KPOA 4OQQA 3AIOA 4ZHQB 1U3GA 1AB5A 1ZK0A 2JBHA 2VJMA 1F12A 2F3PA 4Z0TA 2X40A 2FSGA 3UAYA 4EF5A 1M2VB 4X63A 3IJ5A 4MWZA 5KOHA 4O02B 3NV7A 2C5LA 4JYBA 4QVKA 2RGNA 2J6BA 5FQOA 3YASA 3L1HA 1WG8A 1EGQA 5AFSA 2JHPA 1VHQA 3DOHA 4TV9B 2VSXA 3RUEA 4BJ3A 1QF7A 2REOA 3QXHA 2VBGA 3QUBA 4C05A 1CIJA 1S8NA 4PQYA 3KPYA 4Q03A 5B1DA 2EF1A 4AQ7A 1GTRA 3AUUA 5JCOA 2ZIAA 3CHYA 4REQB 2BDTA 4G9EA 2WQZA 3RJMA 3AETA 2YC2C 4E22A 4ZC1A 2YY5A 5ADUS 4IDBA 5ELXA 5TNXA 1PNRA 1NN1A 1D2NA 2QYOA 1K3FA 4ERNA 1N4DA 1VC2A 2RHCA 2XZDA 3BE4A 4G2NA 2UZ4A 2Y6UA 5IVPA 1Z5VA 2ZRBA 3CX3A 1HEIA 4IDOA 4UVHA 4B4UA 1JNYA 2RGCA 3EA0A 1ADCA 3B20A 1O97D 5ADHA 3U40A 1ZESA 4P83A 5DCLA 4WRRA 4RPKA 1N2CA 3NDJA 4ZGGA 1AS0A 2QRJA 4LGVA 4C5AA 5MFPA 1MXFA 2V7BA 2AI3A 2CKMA 4ZALA 1W6RA 2HSDA 4MITA 3AHHA 4KXLA 5KJEA 4H0CA 3O7WA 4JI0B 2Y0EA 3FYHA 2UXDB 2FEAA 4AZ3B 4FIDA 1LLFA 3DJFA 2QAGB 3GXBA 5CVCA 1E96A 2ZBUA 4KNYA 4DPKA 3H0CA 1SCDA 4DIBA 1JHRA 5E3HA 2WIGA 3V6MA 4N76A 5DYGA 3FRJA 2C99A 2I2FA 4RKQA 2QTLA 2ZRLA 3GVCA 3L7JA 1ICEA 2ZEJA 4K9MA 1NM5A 5JW6A 4CMIB 1EFPA 3W3AD 1T8PA 2C7BA 3ORFA 1NT2A 1KMHA 3V32A 1JR3D 3CWQA 3F67A 4WBNA 3HXQA 2FMTA 1YR1A 5EUQB 2PXCA 1T1GA 4MYCA 4OBWA 1ZXXA 3EIHA 4WXRA 3JSXA 2RFLA 4OMUA 3MRVA 3N3BC 1VIMA 1EVLA 2E5WA 2GLTA 1PKEA 2W2LA 3C7KA 3COWA 4G9GA 4RS4A 5CK4A 1Y1LA 1D0SA 3R4VA 1FU4A 3DT8A 2X7JA 3IAS6 1JBKA 2MSCB 4ILKA 4YCDA 3WX0A 3U4QA 4OAPA 2QPLA 1NDQA 1X7HA 2O52A 1MAAA 4KKXB 3RBXA 2J3MA 4BN5A 5JLAA 3IQZA 3PD1A 4GMXA 1MTZA 1C50A 4LWZA 5AJVB 1TUGA 3CZ4A 4N5LA 4D9BA 4LHZA 3F97A 2LD4A 2XKKA 1BDMA 1KS2A 4RD6A 221PA 2PMKA 3PHBE 4XQCA 2WM9B 1JHMA 2D7JA 5AHWA 4GM1A 5FYQA 3AEUB 3B6MA 3GN1A 1RXSA 3OT5A 2IELA 2L19A 2V5UA 4WY2A 1JHYA 2HMAA 4MUEA 2G0TA 5ALKA 5A2QA 4BFZA 1RHJA 1HE1C 1C7FA 3WL3A 3ELUA 1ECLA 5IW8A 2NIPA 4F3RA 5DO9A 4RD2A 4M8KA 1J9GA 1UJ4A 1FFCA 1T9HA 2HLNA 2OCBA 3HL4A 1ZGJA 621PA 2OLEA 3C14C 4HQ6A 1QRDA 4IYRA 4ETMA 5KJ1A 3PRHA 4C2TA 1CEYA 1LJ8A 2VHWA 5DNVA 5CAEA 2DBQA 1GG5A 2AXPA 2OVBA 1DEAA 1V1RA 1CQXA 3BWMA 2E82A 1NXOA 3OZDA 1BKYA 4H9GA 4KQ2A 1EFDN 1V8PA 3PI6A 1P6XA 4RANA 4J43A 1KR5A 3G2NA 4U2KA 3TNFA 5BXQC 1E20A 3NBXX 5CU7A 5C2JB 1KZ6A 2JW5A 3IAM6 4IDQA 3RARA 3BD6A 3T9AA 1AN9A 4O1IA 2JAXA 2QR5A 2NOAA 4EFLA 5A4MS 5COAA 3OLVA 4RE5A 2C7PA 3OMWA 2ZJ1A 3H8VA 1SQGA 5HQ3B 3E35A 4C4ZA 4S1PA 2EU8A 5F76A 4AXBA 1JJAA 4M1MA 3UCXA 2IPLA 2E4AA 1NGSA 2J5QA 1XYYA 3AIKA 3R75A 1ZVVA 3LUBA 1T29A 3QOXA 4FZRA 1UDXA 3TOXA 1ZJJA 2C7VA 2QB5A 3QLJA 2GJSA 4TLLB 4BBJA 1RLMA 4AJ9A 1DC4A 4U00A 4UM9B 1N9GB 2IPXA 1PP4A 2JHAA 3L43A 4ZDWA 4ZEVA 1YI0A 3U3ZA 3MUOA 1W34A 4KO8A 3TR5A 2B35A 5T4FA 3HP4A 2BEWB 2W6PA 3ZJ4A 3TUJC 3QVUA 4JQCA 1UH5A 5DMHA 5KOJB 4PQGA 1FJGB 1QAOA 3BUSA 1Z5OA 1JNXX 1NBAA 1XZAA 4DXAA 4OXYA 1AKTA 3V4OA 4E07A 1CY0A 1FNMA 2X8BA 3DFZA 1MENA 3EG9B 4MKIA 5JZ9A 5KC8A 2WG2A 1H2AS 3MYRA 3K72B 4OF4A 3VOBA 4WJZA 3PGA1 3UO8B 1VECA 4A5SA 1KIMA 3OZIA 1P62B 5JCPA 3WL4A 3BWXA 5TQ0A 5EP4A 3TW8B 2ESRA 3GPBA 1Z35A 4Y2SA 2B20A 5HXAA 4JHLA 2GDJA 3AUYA 4KI0A 2IV3A 3UYLA 3K0SA 3MWGA 3C4QA 2P41A 2PZAA 4ZQEA 4KQ9A 2ZW9A 1GGEA 3M2TA 1BS9A 2D13A 3ULKA 1BU8A 2A1TR 4I4NA 3ZIAA 4MV5A 5H4HA 4H60A 3ADCA 1NSTA 3BJRA 4AB1A 3T35A 3I5XA 4CU5A 3HBAA 2ERXA 4KPUB 4RM2A 3WIEA 4E03A 4V1CB 2ZB7A 3AXSA 4AY2A 5CG1A 4YI3A 3HTXA 1UOQA 2RK4A 3V1NA 3RK0A 4IJ6A 4C0WA 1Y5RA 4RX1A 4ZXPA 1PHPA 4HQKA 3RYTC 2H4HA 2YJ6A 4EZEA 5JPDA 2L2QA 1YZFA 1I1OA 2G1KA 1C30B 4ENSA 4I08A 5KJCA 4DVJA 6AT1A 5FI5A 3W7BA 1ZGAA 4BL5A 3AFGA 4CL0A 2VA8A 4QDTA 3N2GA 3TAUA 3ZDAA 4F45A 1QX4A 3DV9A 2QE6A 3QELA 3V7NA 5LMZA 3AF0A 4MB6A 2H00A 1PU2A 3FJYA 3FPAA 3RW9A 3TS1A 1REQA 4JBGA 3Q1KA 1RWQA 2PX4A 1Q7EA 5FI0B 1ULBA 3DPUA 3W9YA 3VZRA 1QH1B 2OHIA 1A7AA 4NENB 1A96A 4DB4A 3AFHA 2DEUA 2HMWA 4IWXA 2QP9X 3TMYA 1W2GA 4TX1A 3FDXA 2NACA 3LQ4A 2A5GA 1E99A 4IR7A 5EE1A 4JMPA 3GMSA 3PWKA 2P27A 1TAUA 3OFVA 1XCJA 4FNOA 2Q0HA 2YWFA 1AZLA 3EB9A 2XB9A 3L8EA 4HBGA 1I36A 4KE8A 1L7VC 1LK5A 5DGIA 1F4PA 1GSIA 2Q4RA 1BCRA 4L4UA 5DLQC 2ONJA 1A95A 3ESZA 4NARA 3ECAA 1JDBC 5KQPA 1JEYB 1OV6A 2OYCA 2PH3A 1MCZA 4AMVA 3H5IA 4BX3A 1XMSA 3AI2A 4FDUA 1DCMA 4E3WA 1IOLA 3PSHA 1U9JA 2OBNA 1IWOA 1AMOA 1RQXA 4RKFA 5CNKA 3ITNA 4EF6A 1XLTA 5AM1A 1XVLA 4CMBA 2KHZA 1W7AA 1CF2O 1QKIA 4M6WA 1PEYA 1OBFO 1T26A 3D3EA 1SURA 3NDIA 1KYWA 4LHEA 3T9CA 2X1HA 5AJTA 3R9IA 4Z1MD 3ZIAD 1R1DA 4GLFA 5KNDD 2O0LA 2VP6A 1SPBS 2CC2A 2DT5A 3RBZA 4JJZA 5AWFC 1I5OA 2HDNB 4N9WA 3K71B 4Z0NA 4IW3B 4P93A 3ZGXA 4GI3A 3IVAA 1K5DA 3E8MA 3ESYA 5D1HA 1GRCA 1SFRA 2H7YA 3S68A 1KFKB 4CTOA 5A1TA 5HIJA 3UTDA 1OYOA 3AGQA 1XU9A 4RV9A 4V2UA 1VRVA 4K46A 2PUAA 3VHLB 4IVPA 2IEGA 3ZKAA 1OXKB 3OZFA 2C2XA 3K0KA 3D6UA 4GX0A 2LVBA 3ZCXA 5GGYA 1Q0UA 4U8HA 3IQWA 1QP0A 4Z4CA 4DDTA 3BPSA 1GKYA 2J33A 1XQ1A 2VP3A 4BNIA 2BR3A 3I8SA 4LFBB 4XSGA 4JI3B 4Q1EA 1E2BA 4TL7A 4EEZA 1PJBA 2FR8A 3O93A 5A6SA 3GT3A 4C7VA 1FNSA 1ZM7A 3DEYX 3AKDA 3T7AA 1KH2A 1UT8A 1WB4A 3A9VA 4Y9DA 5ALLA 1XXHE 1ESMA 3GYGA 4TOIA 3WP0A 1UXKA 3ZJ5A 4AZVA 1T3HA 3NT5A 5IFLA 2GT1A 2FG7C 1NQOA 1MGOA 4FEYA 3G6KA 4DLWA 4B3SB 3MTIA 1EBBA 5GIPE 1G20B 2GWHA 3SX2A 1QBKC 3DZCA 3MGAA 3VC1A 5LDHA 1R3UA 4YMWA 1DDGA 3C87A 3OLZA 2QTTA 5JAZA 5F1YA 5E95A 4DCGA 4J9UE 3TSOA 1GT6A 2Q6IA 3FUWA 4DCMA 2CXHA 4IIHA 3OOEA 4KHZA 2B8TA 4NE2A 1KI9A 1ISRA 2PRIA 3B7GA 3JS5A 1XOIA 3NKVA 3KOMA 1DQZA 4LNHA 3ZQ4A 1MGPA 1VJRA 2X9LA 1CE8B 2C98A 5NULA 1KDPA 3G2IA 2R79A 2YDXA 1NNLA 4GYYA 5FHQA 1KIAA 3T8YA 1OI3A 2CLSA 1K4YA 1X74A 1DKNA 3C3JA 3HKEB 2E9SA 4X7RA 3DL0A 1ISSA 3MT8A 4UUMA 2CLEB 2QL9A 3EY9A 4NATA 5HIIA 1DEHA 5LYJA 4NBLA 4OI0A 3OSUA 1B41A 1BW9A 3TSYA 4GSKA 4M9UA 1LTKA 1PW5A 1NI4A 2D1TA 3F1KA 4MWCA 5IDXA 3A6FA 1E2PA 2H85A 2HWKA 3GVPA 3JD1A 4K9NA 4F9EA 2ZYWX 4EKEA 4L5BA 1RPZA 4EX6A 2IS1A 1R18A 4EPRA 2A5LA 2RAVA 1ANKA 2HBQA 2J9GA 4N3CA 4DZZA 3RSSA 4IWYA 5ITZA 3PGXA 2WJ6A 4HGOA 4FHDA 3LLVA 2IS6A 3O21A 2WJYA 3DTVD 3I2JA 3ORSA 3EW7A 4RGQA 3MWKA 5FLKA 3THRA 4HNUA 4AZ0B 4RKRA 4J91A 4MINA 5EI5A 3CO5A 3ME5A 2BFNA 1DCFA 1J97A 4IKOA 4ZT4A 5SZKB 4PAMA 4WDRA 2FOIA 1Z33A 4D41A 4H1VA 4IZ6A 2PKYX 2VUHB 3DVRX 4EQ6B 5IAEA 1T1SA 5CB4B 4CQNA 4EJSA 1UQRA 3BL8A 5T8KA 2QTBA 4MS4B 1KO5A 2J9ZB 3I9FA 4IIJB 4CR7A 1U1FA 1J07A 3EAGA 3GI1A 3MGKA 3DBIA 3LBIA 3G1UA 2HNBA 3GPDG 1HLGA 3FZNA 3RVRA 4UDXX 5CLJA 3IH5A 2X4DA 2G76A 5J47A 5JAPA 4FGZA 4BP8A 1FC0A 4LJLA 1QZUA 4BN0A 2BHSA 1P4RA 2B9VA 3VPAA 1P8JA 1AUXA 2ZDHA 3BK1A 4M1YA 2OV3A 4CRWB 4RMHA 3UXMA 2OQIA 1DJQA 1THMA 2XGMA 3M1YA 1C9KA 2ACWA 2LNDA 3BGIA 2RB4A 5LZ9A 2M6SA 5C35A 3ZCQA 3DCNA 4YAGA 2D0DA 4TQAA 3C5CA 3IPRA 1J0AA 4YR9A 5L7WA 3E7XA 1LVHA 2AN5A 1E6EA 3J80A 2A0YA 1YVDA 4Q37A 4BMDA 5K0TA 4NFSA 4GM4A 2X8JA 3FDZB 2ZXUA 3MG9A 1DKLA 1FFBA 1JN0A 1MQ9A 2BTQB 3KEGA 2C92A 2NTVA 3DMFA 1DFIA 5ENDA 2EX0A 2RC6A 2CK3D 1G6OA 2GM3A 2Y4OA 3A9TA 4RTNA 1V1MA 1EQAA 2C9MA 3C3CA 4PPFA 2FZGA 2BDEA 2QSUA 5E2IA 4KHPB 3VKWA 3CLSD 5K9ZA 3K30A 2QXTA 4KQMA 4C6TA 3PR2B 1ULUA 4QAJA 2PGOA 4ZZIA 5F3WB 1HMYA 3NUZA 5COQA 3T5MA 5I7FA 3DMTC 2WPDD 5DM1A 1UZMA 2P1ZA 3NH9A 3OCXA 4Y8VA 5ENZA 4FWIB 1L5NA 4PWYA 2WU3A 1SRQA 2JEZA 1U9ZA 2PUWA 1AKNA 1DIOB 4FK8A 3WRVA 3ZBTA 2PL5A 4YAKA 4LXGA 1A7UA 1WE2A 3I1FA 4H2DA 1ADFA 3I5YA 1NN0A 4GR4A 5HYVA 2ASEA 3ONFA 2OCAA 4BO7A 3GEIA 3HR8A 1EUDB 3R3SA 3W5VA 5GADl 2FHSA 4NYIR 5GM2A 3W1EA 3WOHA 1DPGA 2Y1WA 1WP9A 4LC0A 3ZOKA 5KYXB 3ZD7A 3OQMA 4I1RA 3MD0A 4WBNF 4KN8A 4LZZA 5K0EA 2BJHA 2A8YA 2G71A 1E1RA 2N9UA 3I01M 4XX1A 5DOZA 5EUCA 4XVCA 1AM4D 4CG2A 3W2HA 1K7CA 1PZEA 2VZLA 3D4BA 3VTZA 5CT4A 1PCXA 3R0JA 2Z9CA 2RGXA 3Q0TA 3BD8A 2VPTA 1S1MA 3HR7A 3TGLA 1A4XA 1GAJA 4AJNA 2CVHA 3HJRA 3TG8A 1QIEA 3MT0A 3CC8A 1UJMA 4L6CA 5ALVA 3F6YA 3I04M 3BE5A 2M2IA 4JXZA 5JH7B 3H4MA 3WQBA 3DMYA 4AQYB 1PR2A 5JO9A 3HVHA 1RZ3A 4UTVA 1D6MA 2PLFA 4KQKA 1VE3A 5A3VA 3D5EA 1JTEA 1XD2B 2FMUA 2VPPA 3FLMA 2MSDB 3L0ZA 1CZUA 4JLPA 1A69A 3C3MA 3QUAA 2R6JA 4KPFC 2E5LB 2B2NA 3B1YA 3FNBA 3FYUA 2GN0A 2DZDA 4ZA2A 3A7EA 2FUNB 3K9LA 5EHIA 1PWHA 2NTEA 4FBGA 4BNXA 3C8MA 4HFJA 5TV2A 4S04A 1ECBA 4E5VA 1EXMA 5DNUA 1BROA 2JANA 2VNIA 2XYGA 3K2IA 3M6XA 3UOWA 1UR5A 2ZJBA 1ZMXA 3CNHA 3VTAA 4HDKB 4K9RA 1QIHA 4R8KA 3IEVA 2WF7A 2X0DA 4F3NA 4MJLA 3ER8A 1DFGA 1JYEA 4IX9A 2OQRA 3D9QX 2QJOA 2WYHA 1H6BA 4ZKEA 1V8BA 4JZKA 4JQZA 3TR6A 1FFHA 1JU4A 2BGRA 3F6CA 1AY0A 2VRCA 3RC1A 1KBOA 3F96A 2GEUA 4D3YA 1U6KA 2WTEA 3L1UA 1U0OC 3M83A 1FMCA 4RY9A 5K51A 3B2EA 3LP5A 4IG4A 5GV7A 2Q5QA 3F6SA 4J6EA 3NALA 2CCKA 1HORA 4MV9A 5KHLB 1DP4A 1E2IA 1ZQ1A 4X54A 2RKBA 1HSZA 5ILGA 4XE5A 4GRDA 4HEQA 4TQGA 3VNQA 3ZVMA 3KSZO 3GC6A 3CVUA 3NGXA 5KBYA 3C16C 3EPLA 3PX2A 1N8KA 4FQ8A 4CDRA 4PZ9A 3QPUA 1XJWA 1XHFA 3LPNA 5B1YA 4G5HA 2C5FA 4X1KA 3UK2A 3KB1A 3ROEA 1V43A 2VPIA 3AVOA 5HCIA 4G0VA 5EMLA 3DLCA 4M2LA 2DX7A 3IKMB 5F12A 3T1YB 3QW4B 5IC6A 1N7HA 3KQWA 1O7JA 1DDOA 2X5KO 1DC7A 1GAQA 3R23A 4NZZA 1GAWA 4BZWA 3EBLA 4JB2A 5M2QA 3OQNA 2PUCA 3ZNPA 4JLKA 1THZA 4QATA 1EFKA 4YRSA 2W71A 4MROA 4QZVA 3KSDO 1AUPA 1PT5A 1UADA 3OJ0A 3UANA 4PYKA 1ISFA 3COVA 4NS1A 4EWLA 1R4AA 3V1UA 3H6HA 5CH3A 4RVOA 1R12A 2QU8A 3IDFA 3CZMA 2AXEA 3V3KA 3AUJB 3L7DA 1SKYB 3KQTA 2G72A 4NXMB 3I4LA 1E2NA 1R74A 3TH5A 1X94A 1F5NA 3MWEA 4NG4A 4E15A 1YIOA 3CX7A 3JQQA 2RGRA 1ULTA 3I9MA 1M8JA 1PL6A 3CURA 3R6DA 4MWSA 3NXKA 3T3EA 3PJRA 5EERA 1ZW1A 3KFLA 3HWX1 3CIOA 4F9TA 2FF7A 3WSTA 2BCJQ 4EUHA 3VYSB 3HDGA 1KFEB 2XBUA 3ODPA 1LI5A 2PSFA 3ISVA 4Z7JA 1LVUA 5LQCA 2JFWA 3H2IA 2A30A 2BWJA 3R8XA 2UDPA 3D3WB 3KQLA 5EIBD 4B17A 2ORVA 2H7CA 2WMDA 3HYSA 2GZDA 4DUZB 3NWPA 1KZHA 1D1PA 4QUJA 1V8DA 4PTLA 3ROKA 1JPVA 4KPEC 1GKIA 2AKAB 2WIFA 3HB5X 2F48A 1KO1A 3B8EA 4GGMX 2VRCD 5LZ5A 1OROA 2AKEA 2GEJA 2GTHA 4JT2A 1OWPA 4V0QA 2R8OA 1KKLA 2FRDA 5FPPA 2ATCA 1W46A 3CEHA 3DAOA 5EE3A 2FUCA 1YRQA 4D8YA 4ZDJA 4P6VF 5KJ6A 1KP2A 1OE0A 3I1YA 4FP9A 9GPBA 1IN8A 2OV8A 2FU5C 4IIXA 4JGBA 3U3MA 5KWEA 1J00A 3CB2A 2OQ2A 2YHSA 4O4HB 2B61A 3TSWA 3W6UA 4P86A 3OKAA 5C31A 3LL7A 4MLCA 1YBVA 3E48A 4W9RA 1H5QA 4JA0A 2G40A 1SM4A 4I7EA 1KSGA 5JLJA 3MOGA 5DASA 5EZ5A 3TUIC 4WGGA 2OO5A 3ZU2A 3GJ7A 5F2KA 4GMFA 3AHFA 5G3ZA 2BFDB 3DLBA 1YVEI 2NZVG 1KK1A 1PSZA 4NY1A 3IBYA 1YQGA 3SXJA 3FTCA 3E4DA 3COZA 4ZK2A 5EJAA 3D6NB 3UGTA 3P9XA 1LNQA 3GVHA 4HFNA 4Q1DA 4AJ2A 2QM0A 5GZ1A 2P9QA 4QUHA 1Z7BA 3NVKI 4B9AA 2IWRA 4TTQA 5KTRA 2B36A 3T3NA 2H4XA 2E89A 1SOAA 2CDBA 3FOAA 4G1UC 1XA3A 5AKYA 5F5LA 3RVSA 4BTVA 4CEHA 2IZ5A 4QIHA 2E0IA 4RL6A 2ON6A 3F7TA 2B4RO 1UPTA 2PQ0A 1TE2A 2NU9B 3VVMA 4XIIA 3JYNA 3AJDA 3K1AB 4JVMA 1VHLA 1K5HA 2OFOA 1PL8A 3D2AA 3CVXA 2IW1A 3KUXA 2J9RA 2A3NA 1QOZA 1FRFS 1UMBB 2O7QA 3WWEA 3E27A 3TKYA 2J3HA 3ZYZA 1E0KA 5DI3B 2B6NA 5B7QA 2EJVA 4LWPA 2QR2A 2JRCA 4NBVA 3IQIX 3LPDA 4EI7A 1KJZA 2X5NA 4YMSA 4C4PA 1IDOA 1MR3F 2VT2A 3FNRA 5FORA 3WL7A 4EB3A 4DQ0A 1N3IA 1BCSA 3UF0A 3UK7A 4B2IA 3E7DA 1OT5A 1FMTA 1O95C 5K8CA 1A9QA 4BWYA 2QRZA 3KALA 4LJKA 4Z4HA 5DMXA 3R5KA 4ZXFA 3VPFA 3AF5A 1RE0A 2QTVB 5CVJA 4JVOA 2OILA 4RDIA 1NJSA 4IJ5A 2K7FA 1JSRA 4GVXA 3UCEA 5CK5A 2DLCX 5H3HA 1CQZA 1X7ZA 1ZM9A 2OD7A 3QUQA 3H16A 4OREX 4TXNA 4ZN6A 4KU4A 2C9BA 1JLLB 2VP5A 3R7WB 3N2NA 1XNJA 2GD6A 3LCMA 5FBHA 1TMOA 5GJCA 3WBBA 2Q5HA 5JXWA 5AJWA 3OZUA 3LLSA 2JA2A 3RAPR 4I4LA 2E37A 3RVJA 3JSAA 2AJTA 3HCWA 4NNJA 1X1BA 1ULSA 4LF6B 5AI6A 1OZFA 3AHEA 1CYEA 1CNFA 3NVMB 1EM8B 5EUMA 1EU1A 1QQTA 1U2GA 1WZNA 1U0BB 4LJYA 4L28A 4WDQA 1Q0ZA 2BTEA 2UYOA 3OIUA 4RORA 3QWAA 4HGZA 4G0UA 1UWVA 3RF6A 3HFSA 2P90A 3CUVA 3RJ5A 5L4NA 2QX7A 4MA4A 2BFEB 4XW2A 1NE7A 3C6YA 1OX5A 4HTAA 4L3VA 1YKSA 4YK7A 5FPQA 3BOSA 4URFA 3FJ1A 1HXHA 4Y1RA 5DCYA 4BU1A 4CV0A 2C8KA 3D7NA 3EBPA 3KUUA 4EGFA 2XA1A 1VSQA 1P9OA 3CF4G 3OLXA 1BDBA 3EVGA 2JGAA 3WMRA 2XOXA 1SUEA 4M46A 5A0TA 4CG1A 2ZR9A 4IXDA 3K1YA 4RCZA 1CR2A 3LQRA 1N77A 2J7PA 2X77A 1A3CA 4AECA 1C9YA 1FSFA 1J9EA 1HTBA 3B78A 5C8VA 3FYTA 3GLQA 1YZYA 2OGTA 1Z3IX 4PANA 5LYJF 1P31A 3ROGA 1VCOA 2F3RA 1DUIA 1Y3AA 3IB6A 3K8OE 4MS3B 3GT7A 1TT5A 2FFRA 5KPDA 2VT7A 4NCBA 3R40A 3CZCA 1DTWA 3D1JA 1T9CA 4WBSA 1A9OA 1XRMA 3D4NA 4ETIA 4F8JA 4QTZA 4I1PA 2JZCA 3PEFA 5K5EA 4NBWA 1YHYA 1C8KA 1HFKA 1L1EA 1XNHA 2ZTMA 4I5IA 4OJTA 1NA5A 2ZU0C 1D6JA 1YXMA 1KY2A 2W6MA 2WAXA 3ESDA 3EODA 1JGTA 1K63A 4UUPA 2YNMA 2IDJA 4BGDA 1P2SA 2F4NA 2O4UX 2QJTA 2BEKA 4JKYA 1N2ZA 9LDBA 1WHSB 2JIBA 3DLTA 4H3SA 1W73A 2CXNA 3B36A 3NNSA 5HKLA 3ORQA 1G8KA 2IOHA 3RIHA 4YMGA 2ZM5A 1FX0A 3IBCA 3F6BX 4CF3A 5TB5A 4M9RA 2GHTA 2PMWB 3COSA 5T7BA 3R5TA 1XTTA 1ZK3A 1EG2A 5IM4A 1YVPA 1WW2A 1IUOA 1QM5A 4JU9A 3RRMA 4LTDA 4P7JA 2C7RA 1JMVA 1HE5A 4WIAA 3IUQA 1DG1G 3JWIA 1SKMA 1LF5A 4X97A 4OA5A 2AW3A 5GONA 3TL6A 3UW3A 5TPZA 4HADA 1X9HA 1EZ1A 2QQGA 3EXIA 4MQMA 3E5NA 4ZCRA 3WLNA 5H8WA 1YE8A 2EKLA 3H0EA 3RIYA 3LAWA 1Z6PA 3VOAA 1GGKA 3EASA 4EY6A 3HJHA 2L0XA 4PXYA 1C80A 5HKKA 4OGWA 1TTHA 2HDOA 3DDCA 3KB2A 4YV7A 1AKRA 1BGXT 1MX9A 3CSSA 4IJVA 2XA9A 1Q92A 3DE4X 4II2A 1N2JA 5HF8A 4DT1A 2EBHX 1E5XA 4F6RB 5KQLA 1H93A 2BW0A 2MIIA 3DOEA 4N1AA 2M1ZA 4ZEXA 3QU5A 5IK2A 3RC9A 5CA0A 3SICE 3L4KA 3WQRA 1BA3A 4QSMA 3HCCA 3MTAA 1NMSA 5JZBA 3JAWB 4C2UA 3DOOA 3PC3A 2VF4X 5L9AA 2AOXA 3KD2A 4H3HB 1HH4A 2EW8A 4LHYA 1D2AA 3CF0A 5AHXA 1JQLB 1RCTE 2CVZA 2ZYSA 4OHZA 3SLKA 3N59A 3IOCA 4JOCA 4QODA 4U7JA 3VX4A 3A6DA 3DKKA 1YT5A 1VG1A 4X8OA 1ST3A 3NKFA 3K16A 4PLWA 4J4BA 4QQFA 3VJLA 1DO2A 4O29A 4BP1A 2GK7A 3C7TA 2IHBA 2C88A 3H0KA 3QUCA 1YIDA 1UINA 4XM2A 4CV2A 3O3MB 4DIOA 3S8EA 1C7EA 1AT1A 2KI5A 1ECPA 1YB1A 4ZVLA 3WFJA 2J85A 1J0BA 2X9VA 3NRCA 2VYQA 4DSNA 3PC2A 5GJVC 1CF9A 2GEKA 2QTNA 4FR0A 4P3OA 4BQNA 5I45A 1NW3A 2F1OA 2UUBB 1N2BA 2R2AA 3G7SA 4C0XA 4C7XA 5C4MA 5KHOC 4AKIA 1X1SA 1PTJA 3R4CA 3O4HA 1G8SA 3RYIB 1ENPA 5FBWB 2Z08A 1TLFA 4HQNA 3A9RA 3HBMA 4PZYA 1JWLA 3IEMA 2O8DB 1M8GA 3AEQA 3HEAA 5TQVA 4JX9A 4KXVA 3W7VA 3I6QA 3I23A 5TMBA 1IIRA 2VNJA 2ZTVA 3CO0S 1LFAA 2RH8A 3GN2A 5F78A 5IYZA 1THTA 1YR2A 2I6SA 4WL0A 2PRKA 1T2VA 3G2PA 3GRKA 3CV3A 4AXXA 3EA5A 1JXOA 1CDOA 2N75A 5G02A 4EHLA 1Y8QB 4PW0A 4D6XA 2CSUA 2UUPA 3LTEA 3PFIA 5TPZD 1IPEA 3F78A 2A9PA 4N3NA 2BPOA 3P9ZA 4K6FA 4RXMA 5E6RA 1VPWA 3PDUA 2DHDA 3LWZA 1K2VN 2REQB 1Z2NX 2VPXA 2W22A 1VDMA 4LGMA 4YREA 1Y9ZA 4DLXA 1BWPA 4NMXB 2WKWA 3ZTYA 1KXJA 2RHRA 3KEOA 3FNEA 3X1DA 4Y9UA 1QDEA 3ZHCA 2Y1KA 3LXRA 5BSVA 3I2YX 4PLYA 3HACA 4ZI7A 2I6FA 4YP7A 1M1YB 4B9EA 5IZCC 5TRTA 3S2FA 5FTMA 3L7CA 3SSOA 1UDCA 4INOA 1JRLA 1NP6A 5JDIA 3VNUA 3B51X 2O6LA 1RHMA 3ZIDA 4K0KB 1KJWA 1Z8HA 1Q1NA 1MBZA 4JLAA 3O8QA 4ZQHA 2JCSA 2GXUA 4WNCA 3V34A 1WEHA 1G16A 2JDID 5FBKA 1CUYA 2LP4Y 4ZVKA 5KQRA 2AFIE 4GQIA 3PHHA 2PT6A 3WWZA 2PZ8A 4WCFC 5AI8A 5CYPA 4OIFA 3ZHVA 3OJOA 5CBPB 3W78A 4W9MC 1Q5PA 5EVJA 1FZQA 1VL5A 4AZWA 3DKIA 4OB8A 4Q3NA 1C5KA 1OBOA 3GAZA 4MVJH 1SUBA 3BX1A 5FOTA 4PQEA 2XBMA 5L3RA 4DQKA 3L5KA 1X19A 1GGMA 1CP3A 3RROA 1KKMA 2CVPA 1U3DA 1UC9A 4JKIA 4KXUA 3NLLA 3FX2A 1GQFA 1UJ5A 2VL7A 4HGPA 4HDRB 3BWBA 2HRRA 2VJQA 2JL1A 4NR0A 3AUSA 2IZ7A 3K5HA 3Q72A 5B1HA 5F98A 1GTVA 3IEUA 5F5NA 2ZOSA 3AL0C 1FDRA 1G63A 2WD8A 1NF8A 4Q4HB 3TQOA 1SQ5A 5AW6A 2A9OA 1V11B 3I6BA 4M1TA 5DGCA 3UMYA 1Z8DA 1ZOPA 1TKAA 3QMVA 1YBMA 5LWQA 5JZVA 2Q4BA 1DKQA 2VF5X 1GRRA 1YCHA 3KSMA 3DNMA 3KZMA 3G1TA 5EP1A 5BUZA 3BFPA 4FFLA 3S70A 1Q12A 1CF4A 3ZU5A 3HB0A 3I9KA 2K6GA 1EVZA 5SY4A 2JI7A 4ME6A 3KT0A 2BHTA 4ZANA 3HNRA 4HVTA 1ARZA 3HWRA 2IZOA 4E70A 3S0JA 1FS6A 1LBQA 1JPUA 2GFHA 2XDAA 2I4MA 3RVDA 3WIVA 4ZIRB 2A4MA 1U7PA 4X7MA 4OQMA 4KPYA 4HLUA 4HXYA 5BR8B 4OGLA 1V3UA 1IJFA 3K0FB 3U39A 4AMUA 1CUHA 4MW1A 4B3BA 5U4XA 3UAVA 1R4NB 2DFLA 5EZSA 1GU7A 2BYTA 1B73A 1FBNA 1XQXA 4OMCA 1FY2A 1RHUA 2WUVA 4DDKA 3SS8A 5JMWA 2JCVA 2QR3A 3HCPA 2MINA 3ED5A 2WIAA 2X15A 2YZ7A 4UMDA 1B93A 5LA6B 2P1DA 1F3LA 3AJ9A 2XE4A 1MPTA 3HCBA 2PUTA 4J0QA 4N4AA 2X6RA 2FVYA 3CONA 5BN3B 4R68A 1S02A 2Z57A 2EFEB 1LZKA 5L8VA 1PZGA 4FYPA 4QOSA 1CS4C 1CBUA 1ZKDA 2HF7A 2P75A 3T7IA 4D82A 5CG2A 2JASA 2FWAA 4C20A 3K6RA 3KDAA 3ZV7A 3L84A 4MUBA 2H2AA 2O5VA 3D31A 5C37A 4CEJA 1IJKA 1A5AB 1MDBA 4UKDA 4RK0A 4QU5A 4F2DA 3K2QA 3QFSA 4OOFA 4AICA 2IPNA 1NY6A 4QRHA 3D8SA 1J4AA 1GCUA 2WFZA 4MDHA 4EPWA 3A27A 3JU3A 4V02A 3AR6A 3LCRA 5MN4A 2QU7A 1EE2A 1DRUA 4F8YA 3O8RA 2RGGA 4EGAA 3RHZA 3QKSB 4HAVA 4OL0A 4Q3EA 1CY2A 1UAGA 1H3NA 3LY8A 3NHAA 3X44A 5JG7A 1ZIDA 4FHZA 3V5NA 1W36D 2F9FA 1U7XA 1BQEA 3ZW7A 4N3GA 3KZXA 3WK5A 4ALKA 2HADA 1G55A 3MBKA 1OR8A 4DBLE 1JU9A 4OLFA 3GZJA 5EZ6B 4WZAE 4BNZA 4XRGA 2NYAA 5TVGA 4BJ1A 3KSUA 4FWBA 1U02A 1TF2A 2ILTA 4MEJA 1CJSA 3JW8A 4PS1A 5EL0A 3DZDA 3ZV4A 3ZY4A 1DI0A 3G5AA 2L82A 3ZXXA 4FYJA 4R4JA 3ZJTA