2BCGY

Structure of doubly prenylated ypt1:gdi complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Secretory pathway GDP dissociation inhibitor
total genus 66
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bcgY00
1S1MA 1L8QA 1ZU5A 2BMJA 2NOAA 4FIDA 1SVMA 2ZRIA 3B1YA 1RZ3A 2ZE5A 2QTHA 2QA5A 3UANA 2HDNB 4URWR 5C4GB 1F3OA 5BW8A 1PLJA 2VP4A 2WPDD 3REGA 3TQCA 4EJSB 4LUCA 1VYUA 4Q7MB 1QHGA 2GRJA 4Q7KA 1VCIA 4FMBB 1GNPA 2CE7A 4KBGA 1IN6A 4PHTA 3KKQA 5FUYA 1FNNA 3KB2A 3BBPA 4I1SA 1SXJE 1ZCAA 2XJ4A 3T1TA 5IK2A 2XEXA 3WYFA 1S0UA 2J87A 1SULA 4LSGA 1NVXQ 4MRPA 4M9QA 3QENA 4LCBA 3TE6A 4LBWA 2F9LA 1UKZA 4B3XA 1OT3A 2C78A 5EZ6B 4DKXA 5TVKA 1ZC3A 3VHLB 2QMHA 2UZ3A 2QRZA 3R9IA 4M9SA 5JLJA 2ORWA 1Z0KA 1D5CA 2KE5A 3Q5DA 5DSZA 2O8BB 3OEEA 3RDPA 2H18A 5G3ZA 3IILA 1TQ6A 3THOA 3Q8XB 1L7VC 2RH5A 2ATXA 3CPHA 3T06B 1G3UA 2QENA 2QBYA 2XZLA 3HR7A 3C4JA 1N0WA 2E87A 3EIEA 4JZKA 4RY2A 1Q1ZA 1UBGA 1JEEA 3TR5A 3KXIA 4KO8A 4AG6A 2BM1A 5L3VA 4N3NA 1DAIA 1OH5A 2V1XA 4JLVA 1JR3E 1P2SA 2ORVA 2V6JA 4ZPXA 4DRZA 3G0HA 1VIYA 3AVXA 1OF1A 2W83A 2F3TA 2VP6A 4AKHA 3WYAA 3U6KA 3LDAA 4OYHA 3H0KA 3KKOA 4BFZA 2CCJA 4OHXA 2ZI7A 3CIOA 4P4TA 4C0BA 4H9GA 4QNMA 3SE0A 4BPBA 4F7WA 3A58B 4QHSA 1G1MA 3PEUA 2J7PD 5IDVA 1OKKD 4JJZA 3N5CA 4AD8A 2WVJA 1F2UB 3FE2A 3QVUA 4Q03A 1UEJA 2C8VA 2WJHA 3X1ZA 4IXMA 1J8MF 3PIRA 4A8JA 5JJIA 4GOJA 5FTKA 2GXSA 4PC2A 1D9ZA 4LJ7A 1KJWA 1WF3A 5J4HA 4FCTA 4JLNA 3GMTA 3BS4A 1DO2A 5CIQA 3RS3A 5KPDA 5KO2A 3IEVA 5GJBA 5A0FA 3NC0C 3LLMA 4P33A 5GJCA 4BEJA 3AGQA 2FEMA 4QKQA 1IBRA 4OHZA 4U02A 1IXSB 3C5HA 3PITA 1NLYA 4L16A 2G9NA 3TSOA 3AVWA 3NVAA 4V03A 2D4HA 3PUZA 3K9LA 2D7DA 4V02A 4US0R 4NPHA 3L8ZA 4UXJA 3TAHA 1FX0A 2GILA 2IYQA 2VHUA 3NH6A 2IT1A 3FPAA 1E3MA 4ITRC 2CHGA 4GZLA 3KXKA 2P65A 4B44A 2ZS8A 3I61A 1GKUB 4C0SA 4E03A 5AJVB 4DT1B 4EJSC 2FOLA 2QROA 2ZJYA 2VO1A 4LJ6A 2DR3A 2ODBA 1DS6A 3I8SA 2X2EA 2QGZA 4BFYA 3H4MA 2FGKA 1A7JA 4M1SA 3RWMB 1SVKA 3CNNA 4LWZA 2FV8A 1W4RA 3CWQA 5LB2A 2IYLD 3SQXA 1HYQA 2V6IA 4S35A 1GZSA 1JEDA 3KQLA 5AJYA 2CMKA 1KMQA 2ZRDA 3VR2A 4GMXA 3WHKA 2CK3D 2PLRA 3U60B 4M1KA 1Z47A 2XTMA 4KJZA 1G20E 2BMDA 1VHTA 2B7BA 5TV2A 5FL3A 2VSFA 4RFSA 4XVRA 1FTNA 2F43A 4QGGA 1NI3A 2ZI4A 3GLFB 2ZE6A 2W6JD 4QGAA 1W46A 4RZXA 4OHVA 2QM8A 3CR8A 4URYR 1TTTA 2IL1A 1V43A 4XD7D 4ZDJA 2GA8A 1RW4A 1SQ5A 4WIAA 4CVNA 2WSSA 4XWAA 4K8OA 5KUTA 1DTSA 5E3HA 1SKYB 3BB1A 3GEHA 3FB4A 2QTFA 1YZKA 2GESA 3R8CA 4NONA 4L8GA 2OXCA 3FHCB 3QF4B 1XTSA 1IAQA 3EG5A 5GVSA 1U8YA 2ZJAA 2VQSA 3OEHD 1E0AA 5CJ2A 4ZI3A 3MWJA 3FKSA 1E1RD 4M1YA 4TLBA 5IRCD 4Q66C 4WZBE 3X1XA 3B6EA 1T3LA 4QFMA 4LJAA 2FG5A 4HAVA 4HZIA 4NYJR 1VG8A 1XTJA 1XMIA 1M6NA 1XDBA 1ZCBA 2CVHA 3ADDA 2IS1A 3A4NA 1QHSA 1YU9A 3W3AA 3ADCA 1DADA 3B1ZA 3KJHA 4LRWA 3P20A 3ZZUA 3WBKA 4D0GA 4IDHA 2RHMA 1SVIA 4MRRA 2BEKA 4JL8A 1HV8A 5F9HA 4I1VA 2JJ8A 4TQAA 2VA8A 3MD0A 2JJ1A 4OK3A 1KO5A 2O52A 4DEXA 2GAAA 2ZANA 3BGWA 4II7A 4QBIA 2DFKB 4HUQA 3I1FA 4URXR 4MDEA 3JZMA 2YVUA 1Z0IA 4BLRA 1EFUA 2H8KA 1HY3A 1HE1C 4KAXA 2P3SA 4LJYA 2O0KA 1AK2A 3KTAB 3OAAA 2B8WA 3GP8A 2JLSA 2W6ID 4H1UA 2ZXUA 1QRAA 1SHZA 2YWFA 2OHFA 4FCVA 2I1VB 2RGCA 4WZ6A 1H8HA 1UPTA 2ZUCA 1NVVR 1QHNA 2QBYB 1U0LA 2F7SA 4W5HA 2IEYA 3THWB 3CRQA 1W48A 2R2AA 2HEIA 2PT5A 2RGAA 4TWZA 2VPPA 1SXJC 3ZH9B 4IDQA 1BO6A 2O0JA 3CX7A 5BYJA 1G9XA 5TMPA 4O3MA 4DCUA 1RPZA 2VEDA 1GG2A 5TXGA 2G1JA 2P6NA 5FFMA 1Z6AA 5B57C 4OK6A 1OIVA 4F4CA 4JBYA 1AZSC 3GJ5A 4BQSA 4JLOA 4L15A 1XXHB 1N5LA 3VX4A 1KJZA 4IEIA 1JNYA 3LAWA 4XVUA 2TMKA 3U6BA 2YKGA 3QKRA 3ZVNA 1UFQA 3JZAA 2ZREA 1N6NA 2EWWA 3IQWA 2Z83A 5HE8A 4A8JC 1E2HA 4HLUA 2Q3FA 2QT1A 1OH8A 3PXGA 4M9ZA 1OE0A 1RJ9B 4FMDF 1N5KA 3C14C 1CLUA 1D9XA 3QEOA 2AWNA 5FI0B 1KI4A 5BN4A 2ZYUX 1C4OA 2EYUA 2O8EA 2OUKA 4R2HA 1XTKA 5JBQA 2EFHB 2YINC 4Q7JB 2D74A 2GHIA 2XTZA 3T35A 2QI9C 3E70C 1NG9A 1W4CA 1BS1A 5AUQA 2IWRA 3VR4A 4Q7LA 1R7RA 2QP3A 3MUFA 4ZIRA 4KYUA 1KDPA 5FOSA 4C7OA 2Z4RA 2CNWD 2XNDA 1ZU4A 1TU3A 1A2KC 2FJUA 1LNZA 1FQJA 3E1SA 3IIKA 3KUDA 2BJVA 1W36C 1X86B 2GCPA 2OAP1 3Q85A 4MA4A 2BV3A 1W5SA 2B8TA 3GLGE 1CF4A 3DL0A 5DN6A 3OE7D 2NG1A 3NBXX 1US8A 1OH7A 2CCKA 3AF1A 1KK3A 1Q20A 5JS8A 2QPOA 5E4FA 3GJ6A 2ANBA 5E95A 3SDZA 3BJIC 3ZIAA 4PPGA 5AK0A 4CDGA 1Z0FA 3ZD6A 1KO1A 4JLJA 1Q3TA 1GKIA 2FNAA 1Z83A 3GD7A 1W0KA 1LV7A 1NN5A 1ZM9A 3MJHA 4LBYA 4V0MA 2GXAA 1E32A 3FHOA 3KQHA 2PZEA 1G3RA 2ONJA 4AIIA 1KMHA 1LS1A 4IKEA 2GBLC 4OHWA 2FZLA 4B75A 4E5UA 2F43B 3EZFA 4X8OA 4RZUA 2XTNA 4GL2A 2R62A 2CE2X 3BIFA 2A2ZA 4LV5B 2GXQA 2RGNA 1KI1A 1R8QA 2QUZA 2X8AA 3NHBA 5E7MA 1MRSA 1XPUA 1Z07A 3U3JA 4QGHA 1MO4A 1XX6A 1F6BA 4HB4A 4HDQB 4MUAA 1EG7A 3EXAA 4OHYA 1P2VA 1T91A 1TUIA 3VR3A 4DSTA 3T61A 2VLIA 5FUXA 1W36B 4LC1A 1E4YA 4B74A 4I4LA 2Q21A 4HI0E 4LHVA 2FPLA 2QTVB 5CYOA 5J47A 2K5UA 3R20A 1XZPA 2ZE8A 5P21A 2CLDX 3QKRB 1G19A 1PJRA 2HJGA 4BLTA 3U61B 1GWNA 2WKRA 2YZ2A 3SJCA 1M34E 4E09A 2HT6A 4CYMA 2P5SA 2G3YA 4KLNA 4QL3A 2IEZA 1W4AA 3LX5A 5ANRB 3HU3A 5FPSA 2O8CB 3OEED 2IK8A 5BYKA 3ZQ6A 1A4RA 1OSNA 4POAA 4JMPA 5DI3B 2H7VA 4DIDA 3QQ5A 3IHWA 4EPXA 1K5GA 1N6OA 4YDHB 2REOA 2DFLA 4AC9A 1G7TA 4NBSA 2WM9B 1Z08A 3AP3A 1GAJA 2KSQA 1RYFA 3V00A 1DO0A 5D3QA 4JJKA 1VKJA 3CPEA 4ZKDA 1GILA 2VTKA 3RSLA 1G16A 3J81k 1UDWA 3B13B 4NYMR 2DY1A 3VNUA 3NKVA 1E2EA 2KJQA 1G4AE 4ARZA 1YZGA 1E2NA 1JBKA 3ND8A 3R7WB 2BC9A 2QAGC 1AS0A 4PXAA 5JS7A 1NL3A 2DWPA 3KJEA 5SZHB 2YC2C 3KJIA 3AVOA 3CR7A 4IVQA 2XOKA 2GWHA 1RRFA 3LO5A 3GLIA 4TYPA 1HT2E 2ZYTX 4B6FA 1VG0B 3VU9B 4B73A 2YWEA 2Q9AA 2FDCA 2AD1A 3U4QB 3GCGA 1IOZA 4DDWA 4OJKA 3THWA 1ZVQA 3DZ8A 4HAUA 1PZNA 1QG4A 2A5GA 4HZUB 4D0LB 3CUEF 5G41A 1LS6A 4JYCA 4B33A 4EIWA 1MH1A 3EZ9A 3LXXA 4D4JA 3F8TA 2CEAA 4IOMA 5EXXA 2IHBA 1JPJA 5GJVC 4QJ4A 2WAYA 3BH7A 1TU4A 2WWFA 2ZR7A 3LH5A 4L4UA 4PQRA 1J2JA 5CJPA 2BJWA 1E9EA 3WRYC 3NBFA 1R0YA 4Q4LA 4Q9HA 1E0SA 2NO0A 4AURA 4BASA 1UKEA 3P32A 3IGFA 4YMSA 1CJTC 2XSZA 4B6EA 4DB2A 2WJVA 3RC8A 2R65A 3RHFA 1CP2A 2JAQA 3BAFA 3K0AB 1UKYA 5SZJA 3LNCA 4A0HA 1KNXA 3FDIA 2W58A 2WWWA 3A36A 1NIPA 3PV0A 3W6PA 5J4KA 2W00A 4PC3A 1Z2CA 2ZRKA 3QKSB 4KHZA 2XOKD 2V55B 4TT3A 4E07A 4JLPA 1KKLA 3UMRA 4Z54A 1OFIA 2WWYA 4Q9IA 4D25A 1U8AA 4E22A 4YXWA 3CF2A 3K8YA 4G5RA 3FHTA 1U0HC 4M1MA 2W6JA 4Q9LA 2RGBA 2BM0A 4G5OA 4A2QA 4C0HA 4AYXA 1XU4A 4EPVA 5C2JB 4HAXA 4RCZA 1YR8A 2NO9A 1NBME 1P9RA 3HU1A 3KJGA 4DUGA 5K8LA 4LZZA 3SR0A 1E98A 3PFIA 3LD9A 3HJNA 1UBCA 5JI2E 1RKBA 1COWD 1X8LA 2GKSA 2J5XA 3RRYA 1OXTA 1XCPA 1CRPA 1ZC4A 4TQUS 1VYTA 3KUCA 5BN3A 2NO1A 4BLQA 3FKSD 4M21A 2F1JA 1XD2A 1T8UA 1U9IA 3QXCA 1KZ7B 4NCHA 3E5HA 4I99A 2Q9BA 4MKFA 4DCVA 5KNBA 1Q1EA 2ZRGA 4UXHA 3I73A 4IDPA 4W5WA 4XTCS 2F55A 1E79D 1N0VC 5H8WA 2BCJQ 5FBWB 1M74A 2OBMA 3A1UA 3GLHE 1WQ1R 2CHVA 4HATA 1DE0A 1N5JA 4MDFA 2ZVPX 2WWXA 1HUQA 3BH0A 3VTKA 1NNEA 2YYZA 1EXMA 1ONBA 4P0TA 1I4DD 2WKQA 2BKUA 1G3IA 3E2IA 4MGIR 4DXAA 4ZCMA 1OXVA 2CJWA 4O2RA 3SZRA 4NU0A 2BBOA 3DO6A 5DYGA 3FKQA 1NMYA 4RVCA 1ZINA 2IYXA 2MSEB 3DDCA 1NN0A 3OIYA 1XB2A 1RE0A 3BXZA 5CM8B 3TW8B 4B2IA 3O8BA 4IOJA 1Q44A 5EZ5A 2VHCA 3N2IA 1E0KA 4JLAA 3W8RA 1AJEA 2ODWA 1RVDA 4BWYA 3L43A 4A82A 5J4YA 1OB5A 1FNMA 2WWGA 1R10A 3QXSA 5CIWA 5DI3A 4DVGA 2IYYA 4DDTA 2WJIA 1K5DA 2JJ2A 1CJVC 1F48A 3QVVA 4DEYA 1QHYA 4CW7A 1BMFA 3NHAA 4NYIQ 1GL9B 2ZRHA 1S2MA 1G41A 1E94E 4B43A 5KSYA 4F38A 4JSYA 3FVQA 3O8DA 2J3EA 2YHSA 2ZRMA 1FUUA 3TJZA 4FN5A 2VHTA 4CF7A 4A2WA 3LVQE 5FH9A 5UKDA 3CZQA 3SQWA 5KYKA 5CDFA 1KTVA 2GVDC 4TLDA 2IHYA 1M2OB 1CJUC 1OYYA 3X2SA 4TSFA 2V7QD 4MUBA 1I2MA 3VR5A 4XIGS 1Z06A 4HYYA 1W36D 1E9RA 2F6RA 2GAOA 1P60A 1GRRA 3F0TA 4K46A 4LJ5A 4PPFA 4TN1A 4CEHA 1N3BA 4C30A 1GFIA 1OH6A 1YRBA 3I3SR 1JJVA 1VPLA 3K70C 5LDDC 1N6IA 2ZJ8A 1RFLA 4JBXA 3EASA 4BFTA 4ZV4A 1YRAA 1TEVA 1VECA 1Z8FA 1OIXA 5B64A 2VRWA 1UF9A 1KO8A 2JIZA 2JLRA 2OLJA 4Q48A 1LF0A 2WMNB 5H70A 1DAMA 3LWNA 2ANCA 3K0SA 3QPUA 1FP7A 1E9DA 1UADA 2JEOA 3SEAA 1E9CA 2VBCA 4Z1MA 1ZAKA 1Z6TA 1E2PA 4CEIB 2W2TA 4DCNA 1T8TA 2C9CA 1OJLA 1IN4A 2QP4A 3EW9A 4KBFA 4XSHA 2FFHA 4NZYA 1N6PA 2JLXA 2XNDD 1CBUA 1GNRA 4WXPA 3TNFA 4G01B 3P4YA 1ZNXA 2G0TA 3PVSA 1N6LA 3BD9A 2IYVA 4TSFD 1II9A 3K0CA 1FFHA 1HH4A 1OFHA 3M0EA 4DLUA 1LF5A 2FEOA 2VHJA 4X8LA 5C46F 2AD5A 2B6HA 1T6NA 3H84A 4BFUA 2EU8A 2G1KA 3VKWA 3ZS9A 3BE4A 1IHUA 1UM8A 5J4VA 1TQ2A 1MOZA 4LYFA 1XMSA 1HTWA 1NJFA 3C7KA 1FTSA 1AM4D 3TVTA 2FFBA 3B7GA 3X1WA 4KV9A 2AWOA 5CB6A 4PC1A 4RCYA 1OW3B 4MKHA 1P61B 1M7BA 2CBZA 5F98A 5AR1A 4DLZA 1II8A 2V1UA 5FOWA 2QZ4A 3RS0A 2YNMA 2OBLA 2NTYC 1TPZA 3T12A 4B2LA 3UWOA 5JEDA 3G5UA 1ODFA 2AN9A 4O25A 2IYTA 2F1IA 5JRZA 3AP2A 2A5DA 2FGJA 421PA 1TL7C 1XPRA 4KVAA 4OQXA 2ZUDA 3P1JA 3M1IA 4GP6A 5JWRA 2VL7A 5BN5A 5LB4A 1LY1A 1NKSA 1FQKA 2HF9A 4IDNA 5FOXA 4JLDA 3UMFA 1MO5A 4KLZA 4M53A 5B58C 1TADA 2QU8A 2QMUA 2WZQA 4XTRA 4KCGA 2IYUA 4S2EA 4XVQA 2OV2A 2JGNA 3CBQA 2ONKA 1CIPA 4OKSA 5L3QA 3LVRE 3L0SA 4D26A 4D80A 3QXXA 1VCNA 4D4MA 5EE5B 1DG1G 1ELOA 3MWYW 4FW9A 2FSGA 1S3SA 3CNLA 1TF7A 2ZROA 1HA3A 2A5FA 3CX6A 1ZJ6A 3B78A 1N6HA 1U9IC 4ILEA 4WZAE 2ZM5A 3K9GA 2FPKA 2GEVA 4B3FX 1YR7A 1G4UR 1D6JA 1YHNA 4CEIA 1J99A 3EZ2A 3W3ZB 2JLVA 5JEEA 4AYWA 1W4BA 2QG6A 3K9HA 2JLQA 3KTAA 4KI0A 2JASA 3CKLA 4UJ5A 3T1QA 3VHXA 1E1QD 2F9MA 1J8YF 4BRWA 1PV4A 2HCJB 3GJ0A 3W8NA 3NEJA 3BWDD 3SBEA 2RGGA 5H68A 4IRUB 3HPRA 1D2NA 3AQ4A 2BHRA 3PUWA 2DWOA 1T4GA 1NG1A 3CH5A 3TBKA 4LHYA 2ERYA 1N6KA 4B47A 3Q7PA 2C03A 3QG5A 1JB1A 2P5TB 4UJ3A 2QAGB 3CW2A 3K53A 1G3MA 2ZSDA 3DEFA 3N2EA 4ZKEA 2YJTD 3BORA 3T15A 721PA 2QORA 2RB4A 1S1CA 5HE9A 3BFXA 2QSYA 4QXAA 2XXAB 1UDXA 5JWOA 2BDTA 2FSHA 3TMKA 3THYB 3TQFA 1S9HA 2C96A 2DWQA 4CEJB 1G5PA 1J7KA 4G3XA 4WAUA 3WNDA 3IPXA 4CIDA 1K6MA 4A1FA 4DLWA 4NKRA 1BH2A 2AKYA 5FBVB 2OCAA 3UXMA 4B34A 4BEBA 2LKCA 2RAPA 4EPRA 1XJQA 2ODEA 3M6AA 4DLXA 2WIBA 1KGDA 2C99A 2ZETA 3U2QA 1NP6A 3LA6A 3OHMA 1E1QA 4UXIA 4LC0A 3I92A 4AWXA 4LBZA 4PZYA 5CLQA 1E9BA 1E69A 2JJ1D 2XSZD 3EWSA 2XNSA 1KSJA 1GTVA 3TRFA 1DBSA 3UIEA 1L2TA 1JXMA 1CS4C 1KO7A 2JLWA 5AJZA 5FTLA 4C0KA 2C77A 3JVVA 1NN1A 3NBZC 5L3QB 1W47A 4J0QA 1JECA 4ASUD 5JHHB 4DDUA 3WP1B 2NZJA 4ESHA 4D81A 2P67A 1G8PA 4YMVA 2AR7A 1E9FA 3V4RA 1ZM4A 1WRBA 2N46A 3CO5A 1R4AA 4PC6A 2IX3A 2EVWX 3VMFA 3EARA 4MYHA 3D8BA 4YXWD 1BIFA 1H8HD 1OFUX 2G83A 2FE4A 4LYAA 3QBVA 4P31A 3TR0A 2IS4A 1LFDB 5JMTA 2IXFA 5DHFA 1WMSA 3TUZC 3LXRA 4NTZA 3RNLA 2FN4A 1VMAA 1CR4A 3A4LA 1S9DA 4DLTA 4GPTA 3KQKA 1X1RA 1X8KA 4OQLA 3W34A 2ASEA 4ZDWA 1NN3A 3K0EA 4Q00A 2B92A 3PEYA 3NH9A 3GEIA 4Q02A 1DAHA 4C4PA 2L0XA 4FXPA 4JLBA 3SN6A 6Q21A 3ZQJA 4FWTA 1SVWA 4Q4HB 2IUUA 4DLSA 4Q9JA 4RKEA 1NIJA 3H2YA 3O8CA 4HUTA 3CLVA 1B23P 1KSGA 1RRGA 3B8HA 1X3SA 4FMDB 3LFUA 2XXAA 4QJ5A 1WXQA 2C5LA 3TIFA 1WB9A 5DI9A 4GDFA 3IBGA 3EAQA 1E99A 2ZUBA 2WJYA 2JATA 1MT0A 3W5IA 3M4YA 4CT4B 4DSNA 1W0JA 2ZRBA 3SJBA 1RRCA 1R2QA 1TAGA 1YZUA 3HU2A 4BFWA 1FPMA 2WHXA 2RKOA 3UWKA 4QJ3A 2QRNA 5AUOB 1AQYA 4OBEA 2RHDA 3GFOA 2MSDB 1Y3AA 4NHOA 1YE8A 2DBYA 4JT2A 4YLGA 5EQTA 4HB0A 4QBHA 2O8FA 3I5YA 2X2FA 4D0NA 4URVR 4AKEA 3HYTA 2BOVA 1F2TB 1PUIA 1SHKA 3AUYA 1XTRA 3NXSA 1F2UA 3MMPA 3I8XA 2J0UA 3R8FA 5BQ5A 3AEZA 2JA1A 3OE7A 2P2LA 2H17A 2AX4A 2AFIE 1NBMD 3L0PA 3V9PA 1EX7A 5KDOA 3MFYA 1Z3IX 3NEYA 4NCJA 4V0KA 2GJSA 3AVPA 4ARZB 3THXA 2JJ2D 2O8EB 4ON9A 3AKYA 2XJ9A 3NWJA 4IVPA 4UQOA 1YR9A 2FWRA 4H1VA 4HDOB 4P4SA 4EAQA 3K09A 1KI7A 3NTUA 2PT7A 3MCAA 4A6XA 1A82A 2ZITA 4D4KA 2JLUA 2XZOA 3IIMA 4TQ9A 3B9QA 2OLKA 2IF2A 5BWMA 4HLQB 2H5EA 2GZAA 1X6VA 4A36A 3MWKA 2NQ2C 4ZIRB 1P9NA 4L5BA 1W0JD 4QBGB 5EXTA 2E9SA 4ZDIA 2O8DA 2V7QA 2WOOA 2WOJA 3GJ8A 1J70A 2R6AA 2FFAA 3DVLA 4TMXA 1R5BA 5CM9C 2AKAB 1EFHA 1YKSA 1N25A 4OQNA 4U7DA 1GOTA 3WNBA 1AQUA 2JDID 1KOFA 1YVDA 2EWVA 1VCOA 3EC1A 3L2OB 2OG2A 2QEQA 4OJQA 5L3RA 3WYGA 3RC3A 1Q21A 2J7PA 4K81B 4RSGA 4NCKA 4Q47A 5KSOA 1XJ0A 1M7HA 3UK6A 2GDJA 3AF4A 2VP0A 3SU8A 4LI0A 1QF9A 4FCWA 4A92A 2EFEB 3HWSA 4DWJA 5FPYA 3THYA 2J9RA 1ZNZA 2BBTA 2JIZD 3L82B 3NDPA 5BXQC 1HE8B 5K8UA 3RWOA 4XWKA 1FMJA 2UKDA 3GJXC 1ZUHA 3K09C 1BKDR 1DARA 121PA 3PUXA 1WP9A 3QUSA 3B2EA 5EUMA 1U94A 1WBBA 4YMTA 5HKKA 1E2FA 1UJ2A 1A1VA 4IHQA 2YWHA 4RD4A 1DELA 2ZPTX 4I81A 2E1RA 3WY9A 3VAAA 4NH0A 1DPFA 3WHLA 5SZKB 4OI2A 4TLCA 4TTPA 1SKQA 1OPXA 1ZMXA 4RKFA 1XMVA 4US1R 1QHIA 1MR3F 4OQMA 4CGZA 3ZVMA 1N0UA 1YQTA 1RYHA 4NYIR 1XEWY 1S4QA 3ECCA 4GRAA 2NPIA 2CLSA 2EW1A 2FSIA 4A0GA 4DCSA 4PAMA 3CF0A 1JJ7A 2IYSA 1CR2A 4PZZA 4MH0R 5D3MA 3GLHA 1OB2A 1G291 2OILA 3QXJA 3EIHA 4X8HA 3F5FA 2ZU6A 5F3WB 2X77A 2PEZA 3PQCA 1CEEA 5FI1B 3D7MA 3FMOB 1T0JB 4LJ4A 5CDFE 2IW3A 3RS2A 5CK5A 1AGPA 2KBEA 1YZTA 4MYTA 3GLFE 1LB1B 1XEXA 1VG1A 2EQBA 4M1WA 1UKVY 2ZSFA 1QHHB 1S96A 2J1LA 4PX9A 4URZR 4BZPA 3OIUA 1YZNA 4G0NA 3L8YA 5EUQB 5HZHA 4RFVA 1CKEA 2QQ0A 1U81A 3NC1C 4DSUA 2IXEA 3NDBB 2V9PA 4FMCF 1P75A 2D62A 1G6HA 2CCGA 5KDDA 5CYPA 4XD7A 2C9YA 1OIWA 1ANKA 2IYZA 4DCTA 5JJLA 2HLDA 3LBHA 2WSSD 3EPHA 4JKYA 3IO5A 3B1XA 4F92B 2ZS9A 2V4ZA 2IBMA 4DZZA 2WMOB 1PLKA 2GCOB 4YQFA 4KU4A 2QE7A 4PAOA 1XD2B 2ZRJA 2R6FA 5FOUA 2J59A 3R9XA 4C3ZA 2VP9A 2QT0A 3IO3A 4Q9KA 5DH9A 4W7SA 4Q01A 1KDOA 4BRUA 2JLYA 2J7KA 2IUSA 4PHFA 1G5TA 1VG9B 2B21A 2NZ8A 3W9YA 4GP7A 4A0FA 2G0NA 2PCLA 4JVSB 5CB8A 4A4DA 1BOFA 2VIIA 3EX7C 1Q3HA 3ZZ0A 3IQXA 2OO7A 3CNOA 4Q18A 2OXRA 1ZUIA 4W5JA 1Z6XA 1TNDA 5IF9A 4UKDA 4TT3D 4JVMA 2ECKA 2YOHA 1P5ZB 2ZRCA 3A8TA 3IHLA 4KFRA 5KOYA 1U98A 3SHFA 3GLGA 1NVWQ 1O87A 2ZE7A 4JLKA 2QPTA 2VF7A 4FD2A 1TF2A 5J5CA 2Q3MA 3U3MA 2R6DA 2W2XA 2ZVQX 4LV8B 4Q1FA 3I62A 2OCBA 4TZ0A 4DSOA 1TEXA 4LV6A 3RSOA 3WRXC 2WV9A 3MRSA 4DIEA 5HZKA 4XJXA 2A5YB 1WA5A 2D06A 1FW6A 4Y0AA 3EC2A 1KNQA 1FMLA 3KKPA 4GNKA 3AVUA 1G8YA 2VP2A 5JI3E 1P4SA 2QPAA 1U0JA 3QXHA 3KDSE 4KSBA 1COWA 4RD0A 3D3QA 4A6PA 4BLPA 1SGWA 3QG1A 5CK4A 2G88A 1AKYA 5EE1A 4EPWA 3AV0B 2O8BA 3IKJA 4Q4JA 2A9KA 2REBA 4UNNA 4JLMA 1CR0A 2P6RA 3N70A 3PR1A 5JSZA 3AKDA 4EFNA 2KI5A 3C16C 2BVNA 4CEHB 1NLZA 5FR2A 1VHLA 2IC5A 2WWIA 5FBRB 3NBYC 1XD8A 5F2EA 4Q4AA 1TUEA 2QSZA 2AXNA 1SXJD 1FZQA 3SFVA 2PX0A 3CRVA 5G53C 1E9AA 3LW7A 1E2IA 2Q0HA 1G7SA 4QHYA 3WMGA 1YR6A 2RMKA 4R9UC 1EWRA 4AG5A 3X1DA 3X1YA 1RC8A 2Z0MA 4M1OA 2F1RA 4LJ9A 5EE0A 3ZGXA 4JYBA 1XP8A 5LD2C 3FWYA 1MV5A 3RANA 5M04A 2PZGA 3SHWA 4A15A 2Q9CA 3IUYA 1G5RA 4PQFA 2OEPA 3P4XA 2D2EA 2HXYA 2OCPA 1EWQA 1KHTA 1E2KA 1UEIA 4XSGA 3A37A 5EP1A 4JSTA 4C0JA 2XB2A 4A8JB 3ZJYA 2ZAOA 2V54A 1H8ED 1E9SA 1LTQA 1W49A 1XF9A 4U00A 1R5NA 1ZNWA 4EFMA 1SKYE 1JPNA 3GJ4A 5DYIA 1E1RA 3F3YA 2PJZA 4HB3A 4LPSA 1OHHD 2CL0X 2BCGY 1ZM3A 5KSPA 1E96A 5C18A 1UBFA 4NMMA 3A1SA 3GLGB 4IJMA 1CJKC 2P6UA 3FMFA 2BEJA 3U3RA 3EZ7A 5FBQB 2W0SA 4TLAA 3CWZA 1G6OA 1Q22A 1GL6A 5AWFC 1SXJA 1U90A 4LYJA 3AUXA 1YZLA 1JXOA 2RGEA 2AK3A 2C04A 3ONWA 4TYWA 3W5JA 3NG1A 4A9AA 5JFGA 3TUIC 5D3MB 4PSVA 5G40A 5FTJA 2GJAA 4G5SA 3WXMA 1II8B 3A6PC 2GXUA 3EIQA 3SJZA 3ZIAD 3ZS8A 5GADl 2ZJBA 4JL6A 1Z5ZA 2R9VA 3SYKA 3BB4A 2PMKA 4PPNA 4XWOA 5JCZA 2H1LA 3TLXA 1XEFA 3AF3A 2GJ8A 2RCNA 3IPYA 1C9KA 1E4VA 1GP2A 1D2MA 2ZJZA 5CLLA 5L8VA 2FFQA 3P27A 1NY6A 3IDQA 1GUAA 2W6IA 3QNUA 5LPNA 2VHQA 1OHHA 5FPKA 5KNCA 4QC2A 1N5IA 1GL7A 4TTRA 5FTMA 4DDVA 5HPYB 3ZD7A 1G8HA 1DAKA 4TYQA 1NVUQ 1L4YA 3KFVA 3TGPA 1KI3A 2QP9X 5DISB 2BIFA 4UNSA 5L3SA 3ZVLA 1M1YE 4MGKR 3TSZA 1AZTA 4LX0A 2O8FB 2PX3A 3GLIB 1EFCA 2ZTSA 1ZM2A 2X19A 3P26A 4Q1EA 5A4JA 3OFNA 2WBLC 4LJ8A 1M7GA 4YMWA 3AVYA 3U4QA 4RD3A 4HEJA 5GJWC 4IXNA 2ZJ5A 4HLUC 4OI4A 3GPLA 2R8RA 1IJEA 1KSFX 4TL8A 4EDHA 5DIFA 5TB5A 2XGJA 1I4TD 2DFNA 3FFAA 3CM0A 4QNRA 1SZPA 2IA5A 4NCIA 5DHAA 1LVGA 2FPMA 1XXHE 3QY0A 2WIAA 3QOFA 3TSWA 1OXXK 3VKHA 3DMNA 4B3BA 4BFVA 1CU1A 2LCFA 4QHTA 3PEVA 4P4SB 4V0OA 4R98A 3U7EB 1II0A 5EE9A 5TARA 2WJGA 1XCMA 1CRQA 4KSCA 2EFDB 1P73A 4KYIB 3KL4A 4V0NA 1CXZA 4ERNA 1E2QA 4NYMQ 2WPDA 1EESA 4BFSA 3U44A 1E2JA 1MABA 3DOFA 3VR1A 4BUJA 2JDIA 3B60A 2CNWA 2V8OA 2FZ4A 4TYYA 5IK2D 4C0QC 3QKSA 4EUNA 2QAGA 3C5CA 5KDLA 5C1BA 3UG6A 4ACAA 2GF9A 4PANA 2GTPA 4Q4JB 3DMDA 3O47A 1SVOA 2DFTA 2WKPA 3BK7A 4X8MA 4GFDA 4DJTA 1MKYA 4TYNA 3RS4A 1PLLA 3CB4A 2H92A 1HQYE 4EQ6B 4NP6A 221PA 3EWAA 4PAQA 4KITB 2A3RA 3T5GA 4CEJA 3S1AB 3GFTA 2D3WA 2OSBA 4FI3C 1TF5A 1E0JA 1DVRA 5HKKD 1ZUNB 1KAGA 2OZEA 4OI1A 3RVBA 1A2BA 5FUWA 2NO7A 5B2ZA 2RGNC 3QF7A 4DBLC 1GM5A 1OYWA 1T9HA 1F60A 4JS0A 4KXFB 4A0RA 2N42A 4P3YA 3EPKA 2ZYVX 1ESMA 3SJAA 3FYHA 4I1OA 4P4UA 3KB1A 3B85A 5JZVA 3LBNA 1GDDA 2A30A 1E6CA 5FUVA 4ZDKA 1XXHA 2FH5B 5KTYA 1N6RA 4AYTA 1S3GA 2Z6VA 1PUJA 4BLSA 2HCBA 2QY9A 1FX0B 1LW7A 1GKYA 3RLFA 5JJKA 5EP2A 4N0DA 1BYIA 2ZI5A 4Q1DA 5KU1A 4C0AC 4C9BA 1RJ9A 3RRNA 4DT1A 1NLFA 2FSFA 1TX4B 4IOKA 2DYKA 3QIAA 2MMCA 4TMZA 1KJYA 1QBKC 2AXPA 4QG7A 1Z63A 3EZ6A 1AIPA 1EK0A 2ZRPA 1G64A 3SC3A 4ESVA 4B3GA 3VQTA 2PEYA 1GRQA 1Z6YA 1QDEA 1R8SA 1T5LA 2J45A 4ABYA 1XCGB 4P32A 1US8B 4EJSA 2ZAMA 3SYNA 1YZQA 2OBNA 2I1QA 4KODA 4NL4H 3TW4A 4Q4HA 2X1VA 1OXUA 4WXRA 3K0FA 521PA 4EKDA 2G77B 3BERA 4PO9A 4HAYA 4FWIB 3QE0A 2BMEA 3Q7QA 1EFTA 1M8PA 4D82A 3PUVA 2Y8EA 1DEKA 4R71A 2UZIR 3GQBA 1G8FA 2HF8A 2QMEA 4A2PA 4B48A 4MITA 2QE7D 3VKGA 1MO3A 4G5GA 1C1YA 4NDZA 5GVRA 5FOTA 1JAHA 3IIJA 4M2LA 4HDCA 1G21E 1XTQA 3GFPA 2BMFA 4TLEA 2ZRFA 4TL9A 1VIAA 1IY1A 1W2HA 2RGXA 4O0MA 3C8UA 3SBDA 3DHWC 2HXSA 2OAQ1 5EP4A 1DAFA 3ND9A 3T5DA 1QG2A 5K8TA 2OFWA 2WTUA 3O8RA 1QZXA 4GOXA 5G3YA 3TK1A 4HLCA 5TY0A 1XFAA 4PHGA 2GNOA 2YC4C 3A1WA 2HJVA 5LBIA 3ADKA 3CRMA 2CK3A 4DB4A 3AVVA 3H86A 4DLRA 3Q9LA 2D7CA 1EX6A 2NO6A 5JRJA 4BECA 2CLCX 5J40A 4DC9A 4LBVA 3U7GA 2GETA 3SI7A 3CONA 1XNJA 4PQYA 3KQNA 3I72A 4HSEA 4LPKA 4TL6A 3SOPA 5FR1A 4B3DA 4AKGA 1KIMA 1P6XA 1SVSA 1NMZA 4MGZR 1F2TA 3A1VA 2R6CA 4N0EA 4MRVA 1R6BX 3U3OA 2A5JA 3PEWA 4LGMA 2HV8A 3EA0A 4O2LA 2XB4A 2CDNA 4LY6A 4R2IA 3VX3A 2OESA 1P3JA 2DPXA 3ZZTA 2N1BA 4AY2A 2XAUA 3LQQA 3ZVRA 1YJ5A 2LWIA 1V5WA 2O8DB 4QM7A 1XBTA 2IYRA 3RRZA 1TMKA 3THXB 1HT1E 4HUQB 3MAAC 4F4JA 1FOEB 3QI2A 5FPHA 2F1HA 1GNQA 2WWHA 3GJ3A 3RAPR 3WMEA 4U5XA 3UPUA 1GIAA 4WA7A 2ZS7A 4HLDA 4B2PA 1ZYUA 3FFBA 5J4LA 2PH1A 3MSXA 5JSZB 3LW8A 3SYLA 1VDZA 2ORIA 4RZ3A 1JR3A 3GEEA 3ASYA 1GSIA 2EFCB 3CZPA 5IHPA 3OIWA 3CH4B 2ZEJA 4JL5A 2J41A 5JCPA 4PPQA 4FINA 3KX2A 2MMGA 4D4LA 1ZD1A 2JCSA 3R7WA 5KPJA 5HCIA 4JVLA 1ZD8A 1KDRA 2ODNA 4Z8XA 3G82C 1Q1QA 2KB0A 2QL6A 4L9WA 1KY2A 3LY5A 3BRWD 3GLFA 4QRHA 3CX8A 4DUGD 2CHQA 3AKEA 3AM1A 4Z8YA 3B5JA 3C15C 2EFGA 3FOZA 3BOSA 3K70B 3OZXA 4ZO4A 3RABA 2XZPA 1SVLA 4B3CA 1QVAA 2AL7A 4EQ6A 2A7QA 5E7IA 2CXXA 1H8EA 3RRMA 1NBMA 1XJCA 4RFSB 2V3CC 1Q0UA 2VYFA 5FL7D 8OHMA 1FP6A 5HCNA 2MSCB 2Z43A 3TH5A 2F3RA 2BWJA 1VTKA 3I5XA 2DB3A 4M1TA 4TMWA 3REFA 1KI6A 4TMKA 1E79A 5FOVA 5AUPB 2WSMA 3QPWA 1X1SA 5FPTA 1VYVA 1XWIA 4IFEA 1KY3A 3LRPA 1JR3D 3WMFA 4NE2A 3Q3JB 2QGNA 3ZDQA 2B7CA 4B35A 1W7AA 4WBSA 4QOSA 3GLIE 3QF4A 1ZRHA 3IBYA 2SHKA 2XITA 3AP1A 5B30A 4MRSA 1G7CA 3C41J 5JHGB 4I1UA 4F91B 1WBDA 3B1VA 5A5GA 2GEUA 3GLHB 2HUPA 4URUR 3VR6A 2QQEA 1TQDA 1IY2A 1NMXA 2ZRNA 3ICQB 1KK2A 1HQCA 5TDHA 1U99A 4HAZA 2GJ9A 1G8GA 3KQUA 4PFSA 3MWLA 4GI7A 3MG9A 4C2TA 1QVRA 1G3QA 1KI2A 1R0ZA 1XD9A 2NIPA 1CTQA 1RIFA 2GCOA 2R6GA 3SS8A 4CT5A 4DLVA 4AI6A 1JQJC 3AB3A 2QMOA 5DGXA 1ZIPA 5FL7A 4M0LA 2NMVA 1MRNA 2JLZA 4W9MC 3K0FB 1IN8A 4GBMA 3CRW1 1KK1A 3H1TA 1Z22A 5DE3A 4C0LA 1BMFD 4MYUA 4PZLA 4BFXA 4QM6A 4Q19A 1KDTA 3BC1A 2P0EA 3KZ1E 1NSFA 4BLOA 4EPTA 3L0OA 3Q72A 3ZYCA 1L4UA 5H1YA 3HP1A 1DAGA 1KYIA 2Q3HA 4Q5IA 5EE3A 3LX8A 3TVDA 3AVTA 4PR0A 5L3SB 3TAUA 5DN6D 1AA9A 1GITA 3B1WA 1U2RA 4G1UC 3DPUA 3OFND 2O5VA 3T34A 4R7ZA 1GRNA 4IDOA 1T3SA 1KI9A 1OLOA 2GZHA 3KKNA 5EP3A 4EFLA 1HEIA 1IONA 1P2UA 1Z6GA 3HR8A 5EXSA 3OF5A 1NRJB 4CZ2A 1OKKA 1E2DA 1G17A 1E2LA 4PSKA 4YDSA 2WICA 1P72A 3GJ7A 3D31A 1HURA 2HYIC 1KI6B 2HT1A 1BYUA 621PA 2GBLA 1EFRA 4LK2A 1CULC 3VFDA 1FUKA 4YC7A 2CL6X 1Y63A 2YV5A 5AJXA 2ZU0C 2CVFA 3OESA 2IS6A 5AUNB 2AK2A 4MRNA 3FMPB 4LYHA 4ZI2A 2ZI9A 4Z1MD 2ZJOA 1ETUA 1NY5A 3LV8A 2WJJA 2ZI3A 4GOKA 2QAJA 1JI0A 4RD1A 4Z51A 3NIBA 3HPQA 1KO4A 2HLDD 4TZ6A 3ZLJA 1XZQA 3CPJB 5JWHA 1P62B 1IQPA 1XRJA 3AVQA 3FGNA 2GJKA 1R0XA 1ZNYA 3U44B 2ZR9A 3MLEA 4JBWA 3ADBA 3LLUA 2C9OA 2ZRAA 1T3HA 2AHOA 1D2EA 2ZSBA 2Q6TA 3QJYA 1W2GA 4GMDA 4JKIA 4NYJQ 1Z0JA 4YONB 3PENA 1KI8A 4LOAA 2ZYWX 4WW0A 4PO8A 3W6NA 1F5NA 1H65A 3CF6R 4M9XA 2ZR0A 5FBLB 2VF8A 1P9WA 2BBWA 1ZIOA 3WBJA 2GK6A 1CJMA 1NSTA 3I32A 1JALA 2A78A 1W44A 3AF0A 1QHHA 4LDJA 1WE2A 3AH8A 3WNCA 2ATVA 4C7OB 2FU5C 4HAWA 4KFSA 2WAXA 3VU9A 2UVQA 1IXRC 1P2TA 4IFBA 1UAAA 4LHXA 2IWHA 1EGAA 1K8RA 5ELXA 2DCUA 2VH5R 1EFRD 3BB3A 4XH9B 4NCNA 3WP0A 3UMSA 1R5OA 2OFXA 2J0VA 4M22A 5C4MA 2IS2A 1WDTA 3IEUA 3SNHA 2FX3A 3VNVA 2REXB 1Z29A 3AKCA 3A4MA 2NGRA 3HDTA 1XEWX 821PA 4IOLA 3DM5A 2NPFA 5DNYB 3B9PA 3OIVA 3BH6A 1I4LD 3W90A 2VSXA 3K9NA 2PL3A 4KVGA 3DKPA 1AGRA 3B82A 4RD2A 1IJFA 5DO9A 1RRPA 4G5QA 1KMHB 1NVVQ 3DM9B 1Z0DA 2GZDA 1Q57A 2KBFA 1A5TA 4ASUA 1B0UA 2XX3A 1QHXA 2J0UB 2VP5A 2YOGA 3K0AA 3OEHA 4Q1CA 2OT3B 1Z0AA 1T0HB 3RYTC 3BFKA 2AFHE 1AKEA 1ZP6A 1ESNA 4MYCA 1OFTA 1Z28A 1KAOA 3ASZA 2BKEA 2KWIA 3AGPA 4L9SA 5KHOC 2FMXA 2O0HA 5JECA 4US2R 1AN0A 3ETLA 2O8CA 3I4LA 2QN6A 1FL9A 3PCRB 4UNRA 3JVUA 5HTKA 1PVOA 4M4SA 4TMTA 3TKLA 2OE2A 3AF2A 3QEJA 4GZMA 3RS5A 4QGFA 2PBRA 2J0QA 2ZJ2A 3RS7A 5HR5A 4OI0A 2CL7X 2EYQA 2ZIAA 4CRWB 4IEEA 5CITA 4Q1AA 4ZCIA 2I3BA 2PCJA 2ZRLA 3QSYA 1G18A 2FF7A 2PJRA 2GVZC 3PJRA 1DAEA 2W0MA 3PG5A 3DOEA 3QKTA 4C2UA 1GVNB 2H16A 2OM2A 1E2MA 4M8NE 5EJEA 3K70D 3A1TA 4TMVA 4BE7B 1XPOA 4LHWA 1T5IA 4PO1A 4RJLA 1W1WA 4PC7A 4IW3B 4YMUA 4UNPA 1IN5A 3U7FB 4ZCLA 4RZ2A 3CRRA 3MJRA 2J46A 5FTNA 2HYDA 3K0CC 3DZDA 1JQLB 3D6TB 3OAAD 1Q12A 4Q4AB 4RD6A 3EPJA 1E2GA 3FTQA 2IF0A 2IXGA 4OQFA 3KXLA 2PZFA 2Z5FA 3R9WA 3U7HB 2R44A 1XTIA 2IUTA 2PMDA 3QPVA 3ICEA 1DG3A 5SZIA 3HYRA 3L0IB 1NF3A 4HZUA 1I2DA 3UATA 2ZSEA 4JVNA 2GEDA 4V0LA 2ERXA 3T1VA 1JAIA 2CJWB 1NJGA 1P7CA 3DKVA 4FMCB 4Q21A 1KZGB 4DLYA 2OFOA 5LD2B 2GK7A 5K8IA 5E7JA 1KK0A 2YOFA 2C95A 4PHHA 3PUYA 1Z2AA 2YWGA 1DOAA 5DLQC 4JIMA 4F93B 3FMIA 3KFXA 3V4FA 2RGDA 1TQ4A 1UBEA 1VCMA 4Q1BA 4AK9A 1AS2A 2Z4SA 1MABB 3LBIA 2I4IA 1AS3A 2H57A 4IVRA 4OL0A 3QBTA 4QBFA 2DHRA 4BZXA 5KNDA 4MKIA 2LKDA 2J0SA 4B32A 1WCV1 3Q5EA 4N1AA 3QKUA 2D2FA 4UNQA 4AKIA 3U3KA 4D6PA 3U5ZB 3TUJC 5IT5A 2GF0A 2GCNA 3EPLA 1OXSC 2ZQ5A 2G6BA 3BFVA 1XEXB 4D2IA 1IXZA 2W2VA 3UKDA 1IY0A 3MGCA 1SXJB 1Q1BA 3SFZA 3LQRA 4DHEA 1MO6A 2FA9A 1CR1A 4EPYA 4TTQA 4BZQA 1JR6A 2ZI6A 3EA5A 4BGDA 4HB2A 2VSOA 3T1OA 5KSZA 1KSHA 1ZW6A 1S8FA 1OV4A 4GSYA 4ACBA 1N2CE 2QM7A 1IM2A 5EXPA 1G7RA 4KFUA 1J90A 4OK5A 4TL7A 4MKGA 1NKTA 1W5TA 4LHZA 2IYWA 1R0WA 2OCYC 4KFTA 1IN7A 3UG7A 2PLFA 4JT4A 3S1AA 1O3YA 2BBSA 4V0ME 1ZD9A 5F9FA 1ZBDA 5AJWA 3W6OA 3K1JA 2ZSAA 4PSAA 4MQBA 2QNRA 1U8ZA 2C98A 4WVFA 4XOIA 4B76A 3KKMA 1W0KD 1KKMA 4GT1A 1X8JA 4WOPA 2C2HA 1D8TA 4Y0VA 4B71A 4F4IA 1XMJA 4MGYR 4PTLA 1ZM7A
chains in the Genus database with same CATH superfamily
4FIDA 1KS2A 1L8QA 1YBMA 1ZU5A 2BMJA 2XRMA 1SVMA 3M1YA 2AFHA 5DF1A 1RZ3A 2VWPA 2VT7A 4XDZA 3ESRA 1DGQA 1AKRA 2QTHA 3C8DA 3EPPA 4W82A 3EQZA 4BNHA 1C3JA 1U31A 4ZCSA 1F3OA 2H0AA 1PLJA 1T15A 2VP4A 2WPDD 2FEKA 2LCQA 3REGA 4BMXA 3WQQA 4Q7KA 3VJRA 1O9BA 2Z6AA 4RORA 4IJVA 4JUFA 1P8AA 1JYEA 1IN6A 2DBVO 4GRDA 1QAMA 5FUYA 3KB2A 3IIIA 4ND8A 2ODTX 2IZ0A 1T29A 3OT5A 1SXJE 4I1SA 2VDLB 4PNZA 1GY8A 2WTMA 2XEXA 3HJGA 5DSTA 3T1TA 1KGSA 5BSKA 1A69A 4BBZA 4NF2A 1NVXQ 3PC8A 2OVBA 4YPVA 2DUNA 4TXLA 3KAPA 2ERCA 4LBWA 1EFPB 4RETA 1TU0A 1K6IA 2FSUA 3TE6A 1NX6A 5KYTA 3ABOB 2OFPA 3RFFA 5EZ6B 3KYBA 2DQ4A 3NHWA 3P2JA 5TVKA 4BE9A 3BFPA 1I2AA 1OR8A 2QMHA 2EJUA 4Q9AA 1BDIA 2UZ3A 3QGMA 3HXLA 1NQAO 3LOQA 1YFZA 3OU7A 3R9IA 4M9SA 1D5CA 1NWCA 4J1QA 1LDEA 1MA3A 3OEEA 5B4TA 1JMVA 5A06A 4I5EA 1VZ3A 3MLBA 1CPYA 4Y6OA 2NO4A 3UCEA 3S2YA 1J2UA 4BMZA 3ONFA 3Q8XB 4PGHA 3OH8A 3ROQA 2RH5A 5THQA 1UR5A 2G04A 4O29A 3F78A 3MHTA 1QFXA 2FZKA 3CCFA 2A3NA 5KQGA 4BCDA 1WHTB 2SNIE 4Q7QA 3HR7A 2GHQA 3EIEA 3NAQA 2VJMB 1VSTA 4X1IA 2X9VA 5JROA 1DWUA 1UBGA 2F00A 2VJBA 4NEQA 4KO8A 1U3TA 3REQB 5I5EA 4FXOA 1RQNA 4QUBA 2V6JA 4IINA 2NQ8A 4AKHA 1OF1A 2W83A 2VP6A 4KMRA 2IY8A 3C6XA 4NENA 3WYAA 2E37A 1KFJB 3LDAA 2RONA 3PI7A 1F7UA 1WUJS 5JLAA 2ZBUA 3PWSA 2ZI7A 3CIOA 4P4TA 3IOMA 4C0BA 4I9HA 3V4PB 2EZ4A 3O2SB 3TCNA 4E5YA 1ZVJA 2DTEA 5JNLA 4S04A 1QLJA 4KWCA 4F7WA 3A58B 1G1MA 1IEQA 1EP3B 1KQPA 2C2MA 2G1UA 4IY1A 1QQAA 5IDVA 4A03A 2P5YA 2Z8ZA 1JQ5A 2C1XA 3N5CA 3VKVA 4DPMA 1N2HA 5B4VA 3NTRA 4D56A 2NUBA 3WLAA 3PIRA 5LM3A 1JIJA 5E0KB 1D6MA 2CD9A 3DTNA 3A6GA 1EK5A 3Q0EA 3WJAA 4BVGA 4UOZA 5J3JA 5J4HA 4FCTA 3JAWB 5BN4B 2AJDA 4JEIA 3GMTA 3U1BA 1YD7A 5CIQA 4CM6A 5KO2A 5GJBA 4UTRA 5A0FA 3LLMA 3WIEA 4BEJA 2FEMA 3BX1A 3V8BA 4QOIA 5LQDA 4I2VA 4KR9A 2FKAA 1NLYA 2BH9A 1VI6A 4N49A 1MNAA 1ULAA 2A1UA 1DQNA 2D4HA 3PUZA 4B8WA 2D7DA 1BN7A 5F78A 5ITZB 4V02A 2AF4C 2QM0A 1RQXA 4UXJA 5H59A 1ZJZA 1FX0A 1A71A 3BCHA 5JSKA 1E58A 2IT1A 3FSGA 3A4YA 1MAAA 3FPAA 3HUTA 5AW9A 4GZLA 2P0YA 5ALSA 1QF7A 3I61A 1GKUB 3C7DB 2OECA 4L4SA 4EJSC 2YYAA 2VPYA 5BUCA 4BQNA 4KPYA 1Z6QA 2QROA 4O63O 1J5EB 3ANTA 1LEHA 2QYSA 1H5UA 4LJ6A 4D3ZA 3LY7A 1MF7A 3DMTC 3ORRA 4KE8A 1ZL0A 1DS6A 3JCZA 3MTJA 1L6RA 3H8VA 1YQWA 3JQ6A 4HYTA 3CNNA 3DMHA 6ADHA 5LMUB 3CWQA 1VE3A 2IYLD 3IOBA 4JYZA 2YXPX 4S35A 4KV7A 1JEDA 3D2BA 1KMQA 2GQ0A 2VK8A 3AILA 3WHKA 3FOAA 3RU9A 3IHTA 2HDOA 2PLRA 4M1KA 1NRIA 2H3EA 3ZHSA 5K3FA 4H6WA 1B43A 2XTMA 4TWIA 1G20E 2BMDA 3M5WA 3MJCA 3WO1A 4DC0A 2R97A 4PYLA 1UC9A 3S1SA 4RK7A 5FL3A 3NTXA 4I5FA 1TZCA 4RFSA 1SUBA 3JARB 4BDSA 4LF8B 3PEWA 5F3RA 3NIGB 4R8RA 4RZXA 3E58A 4URYR 3R3YA 2IL1A 5IEBA 1J24A 4OHKA 1RW4A 1SQ5A 1Y1SA 4U7JA 3U1VA 4CVNA 3AZPA 1ZJ4A 4XWAA 5EYPB 1BGWA 4IF6A 4NENB 4BX8A 4C6TA 3OZVA 3KJXA 3QYAA 2BHLA 1YZKA 4YGYA 1PS0A 3R0XA 4IQ8A 3IEIA 2OXCA 1SIBE 5A6SB 4DUZB 3Q7TA 4GECA 5GVSA 5D3ZA 5LKRA 3TOZA 1U8YA 2R8YA 3O3CA 2ZJAA 1XTZA 3VSEA 5B1IA 4ZYXA 2VQSA 2M6RA 3CC8A 1MFZA 3OEHD 4ZI3A 3MWJA 2NPOA 3ZK9A 3FKSA 1BD3A 1AGYA 3H3FA 3OPMA 4TLBA 1SUPA 4FFBB 4UPEA 5K0FA 2YW9A 4WZBE 1Q0RA 4J49A 1T3LA 4EHIA 4HAVA 3AR7A 4HZIA 3EGEA 1UL1X 5KVAA 2BONA 3D7KA 5LLSA 5HJ5A 5KTNA 3MFQA 2DTDA 4GZ3A 3EDCA 5DFAA 4R1OA 2G8LA 4BQOA 3RFUA 2OP0A 3WWCA 1J2YA 1QHSA 4DQXA 2PD3A 3ADCA 2QF7A 1I6WA 4JOSA 3IVCA 3WBKA 3DQPA 2XIQA 4IDHA 7ADHA 5KJ1A 2RHMA 1QQTA 3MSCA 1Z7BA 1NJ8A 1NZFA 2BEKA 3GRVA 3QMVA 4I1VA 3PGLA 2JJ8A 2PGDA 4TQAA 1AU9A 2VA8A 3WLJA 1KAMA 4AN4A 3P9CA 4OK3A 4YTEA 4XWGA 1X7YA 2ZANA 3FOEC 2HA7A 1LPMA 4KQGA 2PV0A 3BZUA 2Z2ZA 3MJEA 1V0JA 4BCBA 4H1WA 1KWKA 2QG9A 3LCVB 3V3TA 3K6SB 2PWAA 4D3YA 4I8DA 4J8PA 4IICA 4BLRA 4REQA 4YMLA 1EFUA 3V48A 2Y1KA 1HY3A 4EEXA 2YL2A 3RG8A 4ARUA 3ELDA 3KTAB 3L6BA 2W2KB 2PSDA 3DOOA 3G1UA 4QTXA 4IDCA 5L4SA 2VXCA 3LKDA 1YK1A 4G1EB 3E9QA 4D9JA 1EUCB 4RABA 4FCVA 3W7AA 3U09A 2FHSA 1VA5A 4OQ4A 2W6PA 1NMQA 4JEMA 2DWCA 3JTMA 2CUNA 3VTFA 1PQWA 1U04A 2VZ9A 3H9GA 4QVIA 3IE0A 2IEYA 3THWB 5FNZA 1Q14A 1NPDA 2VPPA 2J9GA 1GUZA 4N47A 5CT6A 1QRTA 4QYXA 4IDQA 1BO6A 3A10A 4WY5A 2P2CA 4GH5A 4WZBB 1U8FO 2ATEA 1I80A 1LTKA 1T36B 4H1TA 3O90A 1GG2A 1XVLA 3DLTA 1IBCA 3A4TA 5TXGA 5LU8A 3KV3O 1Z6AA 4NBRA 5FFMA 1OIVA 3A6FA 3V46A 4JLWA 3ZNQA 1LVHA 1K92A 1AMNA 1NLUA 4Y6SA 2C2ZA 3WQBA 4OKNA 4R05A 4ATNA 5FLXA 1KQNA 1Z88A 1XXHB 3UBTA 1CEXA 1XRQA 3UJCA 1KJZA 3G2MA 2CD7A 1POWA 1X42A 3R6TA 4ZV9A 5KHAA 1JNYA 3LAWA 1SOUA 4H3SA 5ALGA 3QKRA 3ZVNA 3LZ6A 4W9NA 3OM9A 2EWWA 2VDOB 5ITWA 5HE8A 1E2HA 2RJ3A 1X38A 4HLUA 1QCDA 2HL6A 2Q3FA 2QT1A 4NZNA 2Q6KA 4AP5A 4TV8F 1OE0A 1KEKA 4FMDF 4GX2A 1C0KA 3MF4A 3DV2A 1D9XA 2WJWA 3QEOA 4GYWA 4UAGA 4FPXA 1TIKA 2ZYUX 4YT2A 4L73A 5F64A 2PSFA 1RPJA 1BSVA 1XTKA 4MEAA 5D01A 3RIXA 3RUIA 3I6ZA 3E9NA 2YINC 2WYIA 4EKGA 5CCBA 1NI4B 1Z8NA 2YS7A 3QBDA 4D9EA 1KARA 4X95A 3L1KA 1N8KA 1DXYA 4WDRA 4CKBA 3NONA 1FE8A 2PJDA 2H2AA 2OHGA 1DZIA 1R7RA 2QP3A 4X66B 3PIDA 4ZIRA 3HB4X 1KDPA 2JF0A 2VTDA 2ZUVA 2R1VB 4NZPA 4C7OA 2Z4RA 2DTXA 3BE6A 4ENPA 3O4GA 5FP0A 1TU3A 3FDZA 1A2KC 1ZUWA 2AQ8A 3E1SA 2JIPA 3F2VA 4PZUA 4YUAA 1WWKA 4G0WA 1OA0A 2OAP1 3E1GA 4MA4A 3IVAA 2R1TB 3A3NA 3VPGA 2SCUA 1ZI8A 1U6KA 3D54D 3R23A 2OG1A 3DL0A 2UYGA 3WLNA 4CR8A 5EJ6A 1CF4A 4KYTA 5KCZA 3EISA 2XOXA 3H5RA 3AF1A 4BIMA 3K30A 1KK3A 1T9GR 2JGDA 2O3TA 3LQKA 2QPOA 3PXEA 5E4FA 2X1MA 3SDZA 4I1RA 5BT8A 1S2IA 4CDGA 1Z0FA 2RH4A 4L4ZA 4UVIA 4E2FA 3ZD6A 3OMLA 2GN8A 1KO1A 4ZXFA 5I7UA 3KBOA 3K8ZA 4JJGA 1CRWG 3LGAA 4JLJA 3GUZA 4EF4A 1YQQA 3KJQA 3RSFA 1GKIA 3T1HB 1Z83A 4ZO7A 5KJCA 1W0KA 1NN5A 1MD9A 2NXNA 3F47A 1U7XA 2OM6A 3HWWA 1E32A 3FHOA 3PU6A 3Q15C 3BJMA 4JC4A 4V0MA 1P1RA 4AIIA 3ZD8A 1KMHA 3ABZA 4DV5B 4IKEA 4B75A 3V1MA 2ON6A 4RZUA 5K2OA 2BF4A 4LV5B 2ZCVA 1Z38A 2GXQA 4E5DA 2DR2A 5JQWA 1R8QA 2X8AA 3W4JA 13PKA 2VT6A 1G6KA 2AMVA 3FGZA 4JVOA 4QGHA 5CXQA 2Z8YM 1NQOA 2EDCA 3FCOA 4HDQB 4D43A 1EG7A 3H5AA 5C8XA 1R6XA 4DA4A 1V6SA 1QH8B 4GXRA 1T91A 3TCXB 3UT6A 3G7NA 3E7XA 4C4SA 5AW6A 3I5YA 1BXKA 2AA3A 2VLIA 4FFWA 2QW8A 4PHCA 4QQ8A 1D4FA 1K0FA 1KC3A 2GEKA 5J47A 2FPLA 3ZK8A 4BUZA 2K5UA 1NE7A 3CJRA 3EPRA 4RJKA 4QG3A 1IQRA 3ANYB 3QKRB 5P21A 4D3DA 5LYJF 3INNA 2G71A 1R0RE 3KVRA 3V34A 4AX8A 4EM6A 2C5GA 3U61B 1PNRA 1Z34A 1X7ZA 4OY3A 2ID4A 1NOKA 2WKRA 2YZ2A 3L1UA 1AKQA 3FPBA 2GKGA 2HT6A 1QP8A 4AZ3A 5IABA 4B3IA 3IMGA 1X94A 2GM5A 2WTAA 4KLNA 1W4AA 1W4ZA 4GLFA 4XGQA 5ANRB 1L5VA 3GUYA 5FPSA 5SY9A 4EZBA 2IY7A 3RSCA 4J1SA 1A4RA 2H7VA 1CB7A 1FY2A 1COZA 2EX1A 3D3EA 3FM9A 1BZYA 2DQZA 3IHWA 1NTRA 2AF3C 3RUCA 1UJBA 2HFJA 4AMYA 4D0SA 4AZSA 1ESZA 1VIMA 3GGSA 3KR9A 2Q4TA 2BEVB 2FF5A 3ELBA 1NVKA 4QFDA 1G21B 1TW2A 2QUBA 1TRKA 3QLEA 3R2JA 4HS9A 1GAJA 2KSQA 3W8FA 5HOQA 4M88A 3G0GA 3AHFA 4AJ2A 4GGPA 5F1KA 3RIEA 5AYVA 1JMYA 2FP4B 4BFLA 4QUKA 1TLTA 2VNJA 2H5LA 5D1NA 5IKXA 1JHRA 2Y05A 4IEFB 2YXNA 3VM6A 4GDMA 1RP1A 1TVKB 4ARAA 4CMEC 5D84A 3NHPA 1E3TA 5AW8A 2AFRA 1JFTA 2PSSA 2ZCUA 5IAGA 4LXUA 2PX4A 4F6LA 4ALIA 2JAOA 4WUVA 5H4HA 1AS0A 1X1BA 3WLFA 3RARA 1TCBA 3GROA 2QT9A 2HH9A 5LYJB 3A9TA 1PT6A 2ZBEA 1O6CA 2B0CA 4BJ6A 4BVLA 3AZQA 1C1XB 4OA5A 1Y8QA 4D6YA 5EIEA 1YA6A 2XLBA 1YR1A 4GLLA 1ZD5A 4Q16A 3FCXA 5TSDA 4XLZA 3VU9B 3QJGA 1ZJJA 5JAOA 2XCUA 1GV0A 2AD1A 4F9GA 1ZVQA 2JC3A 1QG4A 4X3CA 4HZUB 3W5HA 4EIWA 3CUEF 4MQFA 5G41A 1MH1A 4RTRA 2Q5CA 5B1SA 3ZGVA 4D4JA 1YVUA 5HKAA 4HDMA 2CEAA 5ER6A 4J6FA 2H4YA 5GJVC 2H7CA 5K6TA 1W25A 3BH7A 1TU4A 1J5PA 2WWFA 3LH5A 4ZAWA 5K0LA 3KEGA 3VKUA 5HP4A 3DCIA 2X0RA 5CCDA 3FPHA 4HFJA 1GQFA 2Q28A 2BFBB 4ZK6A 4MVJD 1K8XB 3ZX4A 1NR7A 3QVTA 2HU2A 3SD7A 1E3SA 2XZDA 4YACA 4YI3A 1I2CA 4KR0A 1SQGA 4HXFB 3A7EA 4B6EA 2HLNA 3L1IA 1DBRA 1UM9A 2GUWA 3PJDA 4BNVA 4B1FA 4KNYA 2R65A 3RHFA 1CP2A 3BAFA 4K40A 3RC8A 1CVRA 2V9CA 4A0HA 2W58A 2C5FA 3SEFA 1Q2UA 1D1PA 2WWWA 1P5RA 3QOXA 1NIPA 4GXTA 4IJUA 3PR3A 5DNCA 4GX1A 2YRFA 2I7CA 4PLZA 3QKSB 4KHZA 3LA8A 3ZZ1A 3DAFA 5EEGA 3T6KA 1CT9A 1XZDA 2ONZA 4ENTA 3U7IA 1KKLA 2GAJA 4LQDA 3UMRA 2WWYA 5T8KC 4Q9IA 2QTRA 3ICCA 4KAFA 4DILA 1X2EA 1DB3A 4IHAA 4NG5A 4R2JA 3R24A 3WYDA 4YXWA 1CR6A 5C35A 3TF5A 1JU4A 1L4BA 2MSWA 3E15A 3HZHA 3AFHA 4FTWA 4FLMA 2NYUA 3IVXA 3MCWA 2VH1A 3NWBA 3PXAA 4A2QA 4AYXA 5FEMA 4UTOA 4HAXA 5C2JB 4YRKA 1M72A 2M32A 4LMPA 1LC0A 3KJGA 3HU1A 4LQCA 5K8LA 4QWMA 1GAQA 3C3KA 1YDEA 4HQ6A 2OP1A 2JZOA 4OYRA 2PU7A 1XYGA 3PZBA 1RKBA 1X8LA 3JQ9A 1QJCA 3GZNB 4WWHA 2IZ7A 3F1LA 1FCJA 1OXTA 1XCPA 3EZLA 3VVLA 2YUIA 5BN3A 1HK7A 3W6UA 1ICIA 4M21A 1XD2A 1T8UA 3QXCA 4NCHA 1KZ7B 3MOIA 3E5HA 4I99A 1TYBE 1ZK0A 4DCVA 1P91A 4XXHA 4M0KA 3TGLA 4UXHA 1R9MA 4HWTA 2JGEA 1SC1A 4DREA 3I73A 2I6TA 3RIMA 3L46A 2OSVA 5F2NA 2QVCA 1C4WA 3WA6A 2JI7A 3TQSA 1B7GO 3NP7A 3MCUA 2DU8A 3QE3A 2QVBA 4MGHA 1ISJA 1M74A 2OBMA 1QGUA 1WQ1R 2CHVA 2FPGA 4OX9B 3RLIA 5CA0F 2R7MA 3IR6A 3WLKX 3GG2A 3OOEA 1AXRA 2CFRA 5C8DA 1I1NA 1NNEA 4MHOA 3KYJB 3BWXA 4HDAA 4G0MA 4UBJA 2IELA 2WKQA 2DPGA 2WHYA 3I37X 1TGVA 3E2IA 3IUNA 1CQXA 4Z0PA 3QTTA 2CJWA 3FRIA 4NU0A 2ZBVA 4G97A 3FMVA 5IYZA 3ZQ4A 1KZYC 4I5GA 1T9AA 5TPWB 4YRRA 3RIHA 3SXUB 4MLPA 1EIZA 4IV5A 5E9QA 2AQKA 4OIMA 1IAVA 1K7EB 5CM8B 3G7SA 2L82A 4HXGA 3U7QA 5IJWA 5F5NA 4KR3A 1UM9B 3ND7A 4MI6A 3VJMA 4MYDA 1JIXA 2ZB3A 2VHCA 1X39A 1F9EA 4JLAA 3Q7SA 3W8RA 3VC1A 2I6SA 1BQ4A 4KMSA 4OBWA 5DYYA 1IRIA 4BWYA 1OB5A 1FNMA 4DDTA 1SUIA 4RTSA 1GYQA 3Q3HA 1K5DA 1QPBA 1T6XA 2PYIA 4KACA 4MP8A 3LM8A 3ZI0A 1F48A 2P9TA 3ZJ5A 4CW7A 1U8UA 2Y1DA 5D8DA 4L72A 3TCKA 1E94E 1Q7CA 3OUUA 4BU0A 4D8WA 4UCFA 4D57A 5ECYA 2V8BA 2ZRMA 4RS3A 4BJHB 1FUUA 2C3YA 4FN5A 4CF7A 2RKBA 4A2WA 1SBYA 3E7PA 3WG9A 2FY8A 3GXBA 2HMSA 1LLDA 2GGSA 5CDFA 1KEWA 2GVDC 2RIPA 4JC0A 1DP4A 2A14A 5BV7A 1M2OB 5ICEA 3ZKWA 3WDLA 4MUBA 1PDVA 4OAQA 5AI0A 3HK2A 5FOQA 2V5VA 3GQVA 3GYBA 1QB7A 2DH6A 3G2JA 1JG3A 4IGFA 4QVGA 4XIGS 2F6RA 2R86A 2YMLA 2GAOA 1VB5A 4XRGA 1GRRA 4MYSA 2W2MA 1RBZA 4TN1A 3VGJA 1HI9A 2ZYHA 5LYJA 1A27A 1MVOA 5EKUA 3SZLA 5HXAA 1KPGA 1OH6A 1E1DA 5EJ4A 1KAQA 4IL5A 5G1NA 5CB4F 1V8OA 2AJBA 2NV6A 2ZSKA 4JOCA 2XLCA 1QM5A 4NPCA 1N2CB 6NULA 5I9MA 4OHBA 2Z56A 2O2ZA 4N5DA 4HQNA 4BFTA 2VWGA 1DIGA 3BHMA 1TEVA 3BG5A 1ZCJA 4AXXA 1QK4A 4KAJA 2C4TA 1YIAA 2C9MA 1EBFA 3HTXA 3OJLA 4ZU3A 1OIXA 4P7JA 2EWMA 3LDFA 3RC1A 3TRHA 4XDYA 2VRWA 4AS2A 4YRMA 3PE3A 4DUPA 4Q48A 2LCIA 5B64A 1LF0A 2AH5A 5CXXA 5K4HA 4RDXA 3LWNA 2IZ5A 3QPUA 4W1SA 5TMEA 3ODGA 2E4YA 3C8ZA 2FXIA 2C3OA 3AL0C 3SEAA 2R96A 4EKNB 4GIBA 2WF7A 4R69A 2GYVA 3HVIA 1NV9A 2V74B 4X1KA 4LZLA 1ATIA 2VJQA 1V25A 4MS3B 1GM5A 4CBVA 1OJLA 1GQQA 2QP4A 3UJ9A 2FFHA 3UW1A 4NV0A 2JLXA 4O4IF 4B3JA 1Z13A 1CBUA 4WXPA 3ACCA 4UHJA 2NYAA 4Y7DA 1ZNXA 3BEDA 3PVSA 1N6LA 4DN6A 4ZEMA 1BS9A 5DXFA 2IYVA 2FEAA 3F5DA 1FFHA 1HH4A 1CCWA 1OFHA 1E5QA 2VNSA 4HMPA 2BR4A 2Z09A 3Q6NA 4WSOA 4KRFA 1JGTA 3JQCA 4CL3A 2GN1A 4QD3A 5JO0A 1L7EA 2B6HA 4ZVKA 1UPXA 3H84A 3GHYA 3DE2X 1PFGA 1TCCA 2VJCA 2YFHA 3LHIA 1JDZA 3ABRB 2A59A 4KO4S 4OLHA 4KXQA 5H3LA 4X63A 2GDZA 2V9ZA 3K92A 4OQDA 1Y8RA 4XD2A 3ZS9A 4AZ0A 5C52B 1SC9A 2AYZA 1UM8A 5J4VA 4H3HB 4WY8A 4MPTA 1K7SN 4QXMA 1B2RA 3GK3A 4J3NA 1HTWA 1YRHA 3HKBB 4PZPA 1TUBA 5FJJA 4JXJA 4C7JA 2UZ4A 3B7GA 4B9AA 3Q9SA 3CF4A 1GGMA 1TM2A 3NRBA 4N5IX 5CT5A 4LK3A 5CLIA 4CMJA 2X40A 1BN6A 1OW3B 1NMEA 1L5NA 1ZSNA 1ZJYA 3SS9X 2EBFX 2XMBA 1YRLA 5F98A 4DLZA 3C43A 1ECFA 1TQ8A 1JE1A 4HGYA 5FOWA 2MIIA 3VDXA 3AR4A 3FDJA 2WG1A 3WTBA 2NTYC 3FTPA 4TV9F 4ZCRA 3EVCA 4GVPA 4DPLA 5JOQA 2PUHA 2QRLA 5DRYA 1ODFA 4I5IA 3ESQA 2IYTA 3NIFB 4IIUA 1SPBS 2WT9A 3MUOA 5HBGA 4BNTA 1VRWA 4G1FA 3U19A 3O74A 3OQOA 3KPWA 1R0CA 3H42B 1TL7C 2WD7A 5SY6A 2XB8A 2RH8A 5JWRA 5BN5A 4LVCA 4Q4CA 1NKSA 4PQGA 3SF8A 3BIWA 4LE2A 2HIMA 2PD6A 3PC8C 4RV9A 5KB3A 5JU6A 4TKMA 1R0LA 3DEHA 3O4JA 4R81A 1UK8A 5FOXA 3QEAZ 2LBPA 2DBZA 5DNUA 2GN9A 1NF2A 2C57A 5KNCH 3VOTA 2WZQA 1UP4A 1ZGCA 1R16A 2Q4RA 4S2EA 3LS2A 4XVQA 1JHOA 2UYCA 5AKYA 4EX6A 2ONKA 5L45A 3KVVA 2G9ZA 5DVZA 4D4HA 1FUEA 3L0SA 4ND3A 4R1UA 1Z68A 4D26A 1L4MA 2BHSA 4YCMA 3PWTA 3MWYW 4FW9A 4YN3A 1S3SA 2ZJ3A 2UDPA 4K1LA 5IN5A 3KZVA 4DV1B 4ILEA 3URMA 1U7ZA 3Q2KA 3C3MA 1RAAA 4HRYA 4MV6A 1IZ9A 5AIAA 4ZAZA 4R2KA 5F7ZA 1W4LA 3MT9A 4B3FX 3FD8A 1CHDA 4CQLB 4ISCA 3CTMA 3HMKA 3BWCA 3IXLA 1MORA 1Y8CA 4PW0A 3V7NA 5ILOA 4LIPD 1TOAA 3HDJA 3DLBA 1EZ4A 1W4BA 2QG6A 3AY7A 4KI0A 4UE3S 4BRWA 3VHXA 2F9MA 5COBA 2GCGA 1USGA 4H77A 5J23A 1PV4A 2I4TA 4MNTA 4HDNB 1HE3A 1DRKA 3ASUA 4PQEA 4B4VA 4O0LA 3IP5A 1H6CA 2J5QA 3FYCA 2FLKA 3ODPA 1ESEA 2RGGA 2XF2A 4RVHA 1JTFA 4Y8VA 4IRUB 1CUHA 1D2NA 4KWIA 1J7JA 4BHTA 1OV6A 2DWOA 1T4GA 1E5DA 3AQIA 1NG1A 2G72A 2ZW9A 4FYXA 4LDPA 2RK4A 1F8YA 2IIBA 3BIOA 4FE4A 4TV8A 3V8RA 4LHYA 3UMMA 2GKOA 2ERYA 5LQUA 3CW9A 4G41A 4YBZA 2VATA 2CHUA 1JB1A 3MVEA 1TLFA 4PONA 5TRTA 3CW2A 2P8SA 3N2EA 2ZSDA 3IFSA 3WMXA 1M76A 2CJFA 3DEAA 3LT4A 5JD4A 4DV4B 2B4TO 4QSMA 3HBLA 1ODLA 2CXRA 3RGWS 3H5OA 3U3DA 2XXAB 5A4KA 5IJ0B 1H2HA 1VHJA 2BDTA 2YZGA 3FWPA 3C4QA 3GRAA 4DQDA 4OXNA 1S9HA 2JD0A 1WW8A 4CDNA 5CR9A 1Z4JA 4IUCS 1N2SA 2FWJA 4G3XA 4WAUA 3A9WA 3IP3A 4WKNA 5EWMA 4MMXB 2FPPA 2CLIB 1YB5A 3HN7A 1FDIA 2I87A 2WJZB 1A76A 3BRSA 3KEOA 3OE5A 3RG2A 3VV2A 1M5RA 2Y9PB 3VZCA 4EI8A 1KOLA 3ABIA 3BDVA 3LLSA 4D8TA 5BMVA 3OOJA 2IODA 1E3DA 3TINA 4JBNA 2F64A 2MYPA 1VFNA 2ZETA 1F8UA 1NP6A 3IB6A 3COSA 3OKCA 4PLPA 3OHMA 3U2QA 4AP9A 4CG2A 1Q0TA 5JY6A 3ZU2A 1P4RA 3UVEA 3FVVA 2TS1A 4ALLA 2X7JA 1CUVA 2EGGA 2XSZD 1CUWA 4N0MA 3Q5GA 1YE3A 2XNSA 1KSJA 4QODA 2FPSA 2BEUB 4FU0A 1RI2A 4EI7A 3A11A 2UXDB 1JXMA 3ZGOA 1QPGA 1M3SA 2I0FA 2IHVA 3JYPA 2WHRA 5AJZA 3ROTA 1LPOA 1OI3A 4P36A 3TX2A 3V80A 3WGZA 4C0KA 3PNKA 4B2YA 4CCYA 3WYEA 5L3QB 1JQBA 4J0QA 5IZCC 1JECA 5JHHB 1J1ZA 1G55A 3B70A 3BHNA 2JFFA 4MYRA 4ZOEA 1RZUA 4OHMA 1XQ9A 2P67A 4D81A 3N8KA 1GKLA 3PJFA 3O83A 5ARCA 2N46A 2OCDA 1CUFA 1PAUA 3VSCA 4IQ4A 3NNNA 1ND6A 5AM5A 1GLNA 4UBOA 1Z62A 1ZNQO 2P9ZA 1H8HD 1OFUX 4P31A 3W5UA 2C7OA 2IS4A 1X7DA 1L6IA 1D0SA 4MLZA 5AHOA 1SBQA 4GYKA 1TM4E 4OUDA 5C5IA 3TUZC 3LXRA 1TM3E 5DWDA 2NU6B 2Z5LA 2H2IA 1ZS9A 2VPZA 3VPBA 3GNLA 3FNGA 1BC5A 10MHA 1Z2NX 2XNHA 3FFWA 4KXWA 1DQZA 2FX5A 2VWQA 3TJRA 4DLTA 2P9HA 5HYVA 1C0PA 3KQKA 1PZXA 1XL1A 3E35A 1BWPA 4XCVA 2ZT8A 2W2NA 4H7EA 2M1ZA 1VPVA 3I58A 5KYUA 1K6XA 1ABFA 1UFOA 3F6BX 2ASEA 3NJRA 3QWIA 1M6WA 3V5NA 5T3UA 1VPWA 3K0EA 3VO9A 2B92A 1KVQA 1QKKA 3NH9A 3UC9A 2L0XA 2HA2A 1GT91 3JWHA 4FXPA 4NOMA 3SN6A 4X6LA 1U7WA 3TN7A 6Q21A 2G07A 2DRIA 2RBEA 3BK2A 4Q4HB 4EYGA 1I6LA 4ES6A 3HYNA 1SJ9A 4OJYA 2Z08A 1KSGA 1RRGA 1V7CA 1X3SA 3B8HA 4FMDB 5EVJA 3H11A 4EOGA 5CFPA 4DF3A 2XXAA 2QTBA 3PFGA 3KT6A 1WB9A 2BKXA 2G28A 1O6FA 1YQDA 2NO5A 3HO6A 3LLCA 2Y0DA 1E3QA 3A6EA 3EAQA 3PXXA 2HU7A 2YBDA 4BQRA 3VU3A 3HJCA 3M4YA 4TVSA 3H1AA 1ORVA 2IDKA 4ZMRA 4QZVA 5IW8A 1ECLA 2YY6A 3UWKA 3KLNA 4QJ3A 2RHDA 3L84A 5BSTA 3ZTYA 1YR2A 1H85A 4L2IB 1RI3A 2YJ5A 2I3DA 5LNK1 4HFMA 2X2FA 4G0YA 1U1DA 4RADA 1XZMA 2GWRA 5H3CA 5K3DA 3WNQA 5A4DA 1XTRA 3A04A 3WNZA 3WR5A 1GA6A 1OWMA 1FNBA 3I8XA 3R8FA 4RF5A 3CVUA 1GFWA 4HGOA 4N0PA 3WLEA 2NP6A 1HE5A 3DBRB 4YCSA 1VHQA 5I9IA 2BI7A 3I1YA 4TX1A 3TJMA 1DLIA 3AZOA 4ARZB 3SC6A 1FLVA 3CNBA 9GPBA 2Y0EA 3OSZA 5KNDD 3TTUA 3NWJA 4EYKA 4IGAA 2MOKA 4ZI7F 1O5IA 4F60A 5KYYA 4BL5A 2GD1O 1NQWA 4D5EA 4MDHA 4LOHA 1CFZA 3VR4H 2JLUA 1UPAA 2WZCA 3AONB 1JZTA 2XZOA 4L5CA 3KLMX 2P4QA 4TQ9A 1P1IA 3LBYA 1ORTA 4KIWA 4QWWA 4ZIRB 1P9NA 3AUFA 3JU3A 3K9QO 1BWQA 5EXTA 2A9RA 4ZDIA 3P96A 3LT1A 1KVUA 2V7QA 3AINA 3LGXA 1ZCFA 5EUCA 3G89A 4K9RA 2ZTUA 3LYAA 3GLRA 1T5SA 1EFHA 1YKSA 4DLAA 3MWEA 4WN9B 5BRJA 3AM3A 4FT2A 4Y9SA 2J3LA 1AQUA 1KOFA 4NS1A 3EC1A 1EJ0A 4C4YA 2OG2A 5HCUA 1ESCA 1YZVA 3LUBA 3AUKA 3RSGA 2EBHX 3AUSA 3A6ZA 2J7PA 2NM0A 2ZYRA 1M1YB 3ZBUA 1TM1E 3M5DA 5C9ZA 5CTJA 4Q47A 1XJ0A 4B3HA 4AMVA 1YMVA 3AF4A 3VTAA 4R4JA 3HJUA 5E1MA 1K8ZB 2YIVX 1QF9A 3PEEA 4ZU1X 1C3VA 3FZQA 3ZUPA 4JEUA 3TMYA 2F3SA 1Q83A 1Z35A 4JSRA 3PUXA 3K09C 3QUSA 1ZUHA 4R2LA 1BKDR 5EUMA 4FYMA 3TX6A 5FUQA 2HJ9A 4W1PA 2HHAA 1Y34E 4YMTA 1WBBA 1T0IA 1ZXXA 2IYFA 2WW8A 1X8XA 4LF5B 1EDZA 3S3TA 3KQQA 4U2KA 3G2NA 3ZXYA 2Q4BA 1F7VA 2ZPTX 4I81A 1GCGA 4ENRA 2EXXA 1GGFA 1ZH2A 4G5FA 4GUAA 3PR2B 5T6BA 1OPXA 5SV2A 1H2EA 1PZEA 1XMVA 1KAHA 4XKJA 5EIBD 1IQUA 4ZHSA 3W05A 4JU9A 4DAOA 5KYXB 4CLRB 2PNFA 1Z39A 1YQTA 1JZSA 1DEHA 1Y81A 1S4QA 3OD5A 4GRAA 4I2NA 4S1NA 1BJKA 4CTMA 2EW1A 3M5PA 4JH0A 1WXIA 3DBVO 1VGQA 3SYTA 1LZLA 4DCSA 3DHVA 4PAMA 4EGSA 2PWYA 3L01A 3QKWA 1CR2A 4PZZA 3AOEA 3MOSA 2HCFA 3GLHA 5C3UA 1AMUA 1ZRSA 4YJ2F 1M1NA 2VZ8A 1R12A 1KY4A 2C0PA 5F3WB 4R40A 1SXHA 3QX9A 4EMBA 4OQZA 1LDGA 2DWUA 3W1VA 3I9OA 3LKBA 5FV4A 1U80A 2YYSA 3JYNA 1I10A 5DNEA 3CVVA 4EHJA 4M1WA 1HLGA 3IBCA 2YZMA 1G6Q1 4BFVA 4BO7A 3DJYA 3H17A 2DP4E 3TTVA 3NQ41 3TFQA 5FWXB 4BV3A 3OIUA 3DT8A 1YZNA 3OJFA 4G0NA 4CI9A 4V0SA 5EUQB 2EKQA 3PCXA 2PMEA 4DSUA 3JQEA 3KV1A 3NDBB 2IXEA 4MIEA 3PNYA 2XCRB 4NMWA 4HNHA 1KZ4A 2PBFA 1C7ZA 4OGKA 1JDBC 2TECE 4LOJA 5CYPA 1H94A 1OIWA 1CYEA 3WL5A 1GR1A 1CLEA 1P0MA 2HLDA 2WSSD 3EPHA 3DMFA 3IO5A 4F92B 1DV2A 2ZS9A 4JODA 3T4PA 5B36A 1CETA 3F98A 3QEKA 1UT6A 2J67A 3N8IA 4JBHA 4RPGA 1A97A 3R4VA 1PLKA 1R4NA 4KU4A 4XLTA 3Q8WA 3QE2A 4CMGA 2DETA 3FCUB 4WKOA 4PWZA 2A0UA 1BXZA 5FOUA 1RVV1 3ANXA 3V8QA 3R9XA 1SCBA 2BL4A 3HM2A 2QT0A 5JXHA 3VZQA 4F46A 4F0JA 2JLYA 4XYLA 4AQDA 2IUSA 1G5TA 1VG9B 3JSXA 4W8OA 1BJRE 2P2NA 5TQVA 3KOOA 5DM1A 4DQLA 1UINA 3DKRA 3LQ2A 2DBQA 4DRXB 1ADYA 3CNOA 3IEKA 5EQJB 2RFLA 2B61A 1TNDA 3E7WA 4LYEA 4ANFA 3HCEA 4JVMA 2FG7C 4IMRA 5IVKA 3RAFC 4L5JA 5COAA 3A3YA 3W3AD 3FHLA 4BZWA 3EQ7A 3GLGA 2GFIA 4G4IA 1BVHA 3TG8A 1YS6A 1QKJA 1NQXA 2B69A 3HXTA 3DBIA 4H7PA 1TF2A 4L9AA 1UWLA 1Q16A 3AC0A 1VXRA 2J6HA 4ITUA 5B3JC 3V2HA 2Z1NA 2ZVQX 1W35A 4Q1FA 5CEJA 4TZ0A 2A9JA 3U13A 1TEXA 1Z8DA 4X0EA 5EIXA 4YP9A 1MB0A 1RYZA 2XCOA 3FYUB 2O7RA 3MRSA 4X3OA 5FORA 4BNZA 4DIEA 5HZKA 3A2KA 1WA5A 2VDUE 2D06A 1FW6A 1JEQB 2BFEA 3I0NA 4Y0AA 3WWDA 5A03A 3KKPA 9LDBA 4BGEA 3I01M 4J9UE 3C1AA 1P4SA 1RQRA 2NXEA 2PUCA 5LDHA 1QIJA 1EBUA 3KDSE 5HFJA 3UY4A 2PX2A 5BOSB 2EZTA 1MC8A 4O4LB 3NJ4A 1SGWA 3C7AA 2O2DA 1A04A 4AXBA 3QUBA 2ZWVA 3HVRA 2G88A 2P90A 4EPWA