2BCGY

Structure of doubly prenylated ypt1:gdi complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Secretory pathway GDP dissociation inhibitor
total genus 66
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bcgY00
2IXGA 3GMTA 2WJVA 1ZAKA 4TYWA 1OB2A 4YQFA 1R5NA 5FL3A 5C4MA 5JS7A 2QNRA 3LVRE 3VKHA 3PJRA 1HA3A 2CCGA 4M9SA 3C5CA 1R0WA 4DDVA 1N6IA 4QKQA 2QL6A 4MH0R 1JXMA 3W8NA 3WHKA 2ZU0C 3R8CA 1W47A 3BXZA 2W58A 2ZJ8A 2D2FA 2F9LA 4DSNA 3OHMA 2J45A 2ZE5A 2OBLA 2AKAB 4TN1A 2PL3A 4E09A 3ZVNA 3CRRA 2WJGA 1ZC3A 1SVOA 3KXKA 4PC2A 2IYTA 2QENA 1M7GA 3MGCA 3K53A 4Q4AB 4YDHB 3GLHB 3ZD6A 2OXCA 4FINA 4C0JA 4HZUB 5DI3B 3CH4B 2X8AA 2F55A 1HQCA 4HYYA 3K0EA 1PZNA 2EWWA 5KHOC 1VCOA 5BN4A 2WJHA 5DIFA 1XEWX 2QAGC 4XVUA 3TVTA 3U3MA 3ICEA 4TMZA 3D8BA 4OQMA 2ZIAA 2G1KA 1XX6A 3THWA 1GILA 3W5IA 5GADl 2B8WA 3WXMA 1JR3A 4JS0A 5J4VA 1DS6A 3LBHA 2PLFA 2WM9B 1VG0B 1QF9A 2ASEA 1NVVQ 3QSYA 5F98A 1E2NA 1YVDA 3DM5A 1D6JA 1ZBDA 1G9XA 2XNSA 3ONWA 4JLPA 3X1YA 2QPAA 1NNEA 2DYKA 1VG9B 1LB1B 2WWGA 3I62A 4GOXA 3A1VA 521PA 4XOIA 3CO5A 4DC9A 1OKKA 2FH5B 2ONKA 4PXAA 3EPKA 1F3OA 1HV8A 2WMNB 4GFDA 3CNOA 1BO6A 3LBNA 4TTQA 1NMYA 2RGNC 3U6KA 2IYWA 5HR5A 5TXGA 3U3OA 2V1XA 4NCNA 1OE0A 4B33A 2AR7A 4M22A 4TLAA 2VF7A 3PUVA 2NPIA 1OPXA 1NVXQ 3CF6R 2OV2A 4DLTA 2NMVA 1G5RA 1XTJA 4ON9A 4O25A 1KDOA 1IY0A 1A4RA 5J40A 3RYTC 1I4DD 3L0PA 2H17A 4UKDA 5DYGA 3TIFA 3DMDA 2C78A 3HP1A 2ODBA 5IK2D 2R6FA 4QHTA 1G3QA 1JPNA 1KY2A 2Q9CA 2Q3HA 2JJ1D 3GLHE 2F1IA 2WSMA 1AGPA 3O47A 4JVNA 2XNDA 3IUYA 5ANRB 5HCIA 1D5CA 3VX4A 1MT0A 3T34A 4EFLA 1XJQA 2BWJA 4KLZA 3B1VA 2JLXA 1AS3A 5DYIA 1FP7A 2EYUA 3C41J 3P4XA 2ZRFA 1K5DA 3AVPA 3GLFE 2J0UA 3LQRA 3QEJA 3TJZA 4TL6A 5G41A 1U99A 2FG5A 5AJZA 4CDGA 1UFQA 1OJLA 3BH6A 3U7EB 1KI6B 2QQEA 2GBLC 1ZIPA 2GEVA 3EIEA 1EFUA 1N5JA 1XMJA 4KXFB 3THXA 2CEAA 3EWSA 4JLMA 1N6NA 1EFRD 5DISB 5KPJA 4PZLA 1X1SA 2OCPA 1N5KA 2BCJQ 2QP9X 4TYYA 2IUSA 1G3IA 4DB4A 1T6NA 4Q03A 3ZS8A 3WHLA 3MAAC 4PSAA 4NONA 2RHDA 3CKLA 5GJVC 3S1AB 2EFGA 4W5JA 3I5XA 2RCNA 4PZZA 2YOGA 3GLIB 4QBIA 4AYXA 1RPZA 3TK1A 4OHWA 1CR4A 1US8B 3DMNA 1G8YA 4PPFA 1FPMA 2GVDC 3LAWA 2ZI7A 2ZRHA 3EC2A 1BOFA 4MGIR 1KK1A 4D0NA 3K70C 5EUMA 3A6PC 2ZS7A 3ADCA 1E1RD 3MD0A 4ASUA 3OE7D 4HAXA 3VFDA 1W2GA 4HI0E 4C2TA 1MO4A 2GJAA 3EZ7A 5BN5A 1R6BX 1KAGA 3W9YA 4QBFA 2ZSEA 2DCUA 4DLZA 4HUQA 3NTUA 2ODWA 3BIFA 4Y0VA 1MH1A 3VR2A 1Z0KA 3CBQA 3A37A 2CK3D 4LSGA 1II8A 5C18A 4KFSA 2GZAA 3DM9B 1U0HC 4B6EA 2CXXA 2ORIA 4QJ3A 4UXJA 5K8IA 4BECA 2WKPA 5TDHA 1X86B 1A7JA 2FFQA 4AKGA 4Q48A 4ZDWA 3TAUA 4JLBA 1LF0A 3QY0A 2AD5A 1ZC4A 4FCTA 2XNDD 1ANKA 4L15A 2ZR0A 3ZZTA 5KYKA 5JBQA 1XCMA 2JCSA 2RGXA 2YWEA 3OIWA 4IJMA 2QM8A 3VKGA 4MRNA 2OBMA 5L3SB 3WY9A 1U9IA 1Z6YA 2AL7A 4II7A 2BMFA 2O8BA 2Q9BA 3CNLA 1RE0A 2PEYA 2Q21A 2CLDX 2ZE7A 3PUZA 4HB4A 3AEZA 2PMKA 4MKFA 1VPLA 3R9XA 4KO8A 2FZLA 4BZXA 6Q21A 4BFYA 4A6XA 3WBKA 2GNOA 3AGPA 5H8WA 1P75A 3KDSE 3FHTA 2PLRA 2V4ZA 3AUYA 2QN6A 2XB4A 4FW9A 5DGXA 1F2TB 1HYQA 4FCWA 3LV8A 4TL9A 1KDRA 2QA5A 3GLHA 1GNPA 2A5GA 1CR0A 2GZHA 2WSSD 4PC3A 4KLNA 4HZUA 2VRWA 3SHFA 4QBHA 5HKKA 3HU2A 4G5QA 3UIEA 3DO6A 5KPDA 3OAAA 1KSGA 2XJ9A 3W6PA 1IN7A 3P32A 1AQYA 4WBSA 1E9AA 1XPRA 3PUXA 3E2IA 3QUSA 2JLQA 2RGGA 5GVRA 1YZNA 121PA 2DWOA 5CK5A 2W6JD 2B7BA 1WBDA 3AVOA 1KZGB 2ZXUA 1J2JA 3A36A 1KMHA 4N0EA 421PA 1C1YA 4P33A 3A1SA 4RVCA 4C7OB 3LW8A 4RZ3A 4KV9A 4LK2A 1YR9A 2QPTA 4QGGA 1AZSC 1ZW6A 1E2MA 2CE2X 4V0ME 3SR0A 1F60A 3UMRA 3BOSA 2GXQA 1JAHA 3MLEA 3QXCA 1H8EA 4BASA 2WVJA 2FA9A 4V0LA 2IF2A 4KAXA 3F3YA 3EIQA 2J0SA 1OYWA 1XEXB 1MO3A 1E69A 1SKQA 4FMDB 3U4QA 1M2OB 2FDCA 3T5DA 5C46F 2CBZA 1AKYA 4EQ6A 1XFAA 1DO0A 4Q4HA 1GFIA 4WAUA 1VIYA 5J4KA 3X1DA 1E79D 2G0TA 3HR7A 2FSFA 1KO1A 1NN5A 1Z6TA 5BXQC 4BZQA 3IIMA 1G4UR 1EG7A 5HE9A 4D0LB 4LHZA 4X8LA 4DZZA 3IQXA 2AKYA 2QGNA 1EFHA 1GP2A 2XOKA 3LBIA 3U3RA 4URWR 5JI3E 3W6NA 1SXJA 1TF7A 3LDAA 5KSPA 3CPHA 4LI0A 1XMIA 2GZDA 2PJZA 3U2QA 5KDOA 2EU8A 2L0XA 1EX7A 2ZJOA 2PT7A 2VA8A 2OG2A 3WRXC 2FWRA 4B6FA 3DL0A 2QMUA 4ZI3A 1UBEA 4W5HA 4FCVA 5L3QB 4PQRA 2OFXA 2YNMA 2IYQA 2J0UB 1K8RA 2QE7A 3FKSD 4TTRA 2A3RA 1QHSA 2ZAMA 2NO1A 1CBUA 5IDVA 3VKWA 2WWIA 1LNZA 3WYFA 4LJ5A 1TL7C 1P61B 1KO4A 4B34A 3THXB 4PQFA 4TYQA 1QZXA 2ODEA 5E3HA 5H70A 2MSDB 1DAMA 1DE0A 2O52A 2F43B 1EK0A 4IFEA 4RKFA 1WBBA 4CW7A 1DAFA 1RRPA 5EQTA 3LXRA 4DIEA 3MUFA 4KVGA 1W4BA 1G64A 2RH5A 1AA9A 1MKYA 4N0DA 1W4CA 2DY1A 4IDOA 5D3MB 5JSZB 2QU8A 2NOAA 1KOFA 4D4LA 3HU1A 2Q6TA 2AFIE 1E3MA 1G1MA 1OH7A 1Z0JA 3U3JA 2NGRA 5IRCD 4GNKA 4ASUD 4A15A 2WPDD 2JLWA 4MKIA 1EWQA 2VSFA 1H65A 3EIHA 3IPXA 4KYIB 1SHKA 3DOFA 4C9BA 3X1WA 1E2KA 1H8ED 2W83A 2QMEA 2W00A 4M1WA 3V4RA 4KU4A 2NZJA 3KQKA 1G7RA 5AUOB 3DEFA 1FW6A 5GJBA 3FHCB 4M21A 3ADDA 1COWD 4FMDF 2P65A 1O3YA 3BAFA 2IS4A 1NI3A 3FMPB 4XTCS 1G19A 5EE3A 2PX3A 3ZZ0A 2QBYB 4GPTA 1MABB 3ZD7A 1GRQA 1ZMXA 2ZI4A 2ZSDA 4LYJA 1JEDA 1F2UA 1SZPA 2CJWA 1GKYA 3EZ2A 4A9AA 4V0NA 4DEYA 1X3SA 3BORA 3O8RA 2ZI9A 3GQBA 1SVWA 821PA 5J47A 1CRPA 4OI2A 2OLKA 4NE2A 4POAA 2W6JA 5BWMA 5L3SA 1R7RA 3PUYA 2ERXA 4N1AA 4M8NE 2GKSA 1XEWY 2KB0A 3AH8A 2FEMA 2ZQ5A 3BB3A 3IIJA 4BLQA 2BIFA 1EGAA 1UADA 2F9MA 2IL1A 1E2EA 1CTQA 4JBYA 1W7AA 2R6GA 2E1RA 4LV6A 1GL9B 1CP2A 2TMKA 3Q5DA 1MO6A 1SVIA 5H68A 5HZKA 3MJRA 3BS4A 1E94E 3GJ8A 2AK3A 3O8DA 3FOZA 1KTVA 1ZNXA 3B60A 2IS6A 1E99A 1NP6A 4B2LA 5FI1B 4MKHA 1NJFA 2D2EA 4LJ7A 1R8SA 5EP4A 621PA 1A2KC 1FFHA 1LFDB 2PEZA 1P2UA 1TADA 4LJAA 4K46A 1OFIA 1CJMA 1NSTA 2ZRPA 3BH0A 1T5IA 4OQNA 4RZXA 2LCFA 3QVUA 1IXZA 3LX8A 3VR1A 3RS5A 3AKDA 1ZD1A 4HAZA 2QY9A 5G3YA 2O8EB 5C4GB 1KDPA 1IAQA 2RGEA 4L9WA 2OBNA 4LV8B 4M1MA 5B2ZA 4U5XA 1E96A 5TMPA 3AVWA 1KI4A 2IHBA 2EFCB 4JLNA 5E7JA 4GZMA 1XP8A 1E9EA 1JEEA 4M1YA 1R10A 3GFTA 4LJ6A 4JVMA 1X6VA 2V9PA 4QGFA 2JLSA 1Q12A 1LY1A 2FFHA 1XD8A 1G7TA 4US2R 3SJZA 4NTZA 5FPSA 1JQJC 2GEUA 3KXLA 4C30A 2YINC 1PLJA 1EXMA 1HT1E 2ZITA 4BFSA 4Q4LA 4I1VA 2X1VA 1YZTA 4PC1A 2C96A 3CONA 1KO8A 3AKCA 4P4UA 1GKIA 2ZVQX 3NEJA 3B2EA 2X77A 3PEYA 3REGA 1CJVC 2P5TB 3CIOA 4NYIR 2CVFA 4MYHA 4XIGS 1NSFA 4DJTA 3WP1B 4UNRA 1W4AA 5FR2A 3HYTA 5AJVB 3WNDA 2VHCA 1G7CA 5SZHB 3I61A 1SKYB 5FI0B 1RJ9A 2CMKA 2IC5A 5TB5A 1AS0A 2JA1A 4OBEA 4TLDA 1MO5A 4EDHA 4RKEA 1LF5A 4IVRA 4WIAA 1T5LA 1XU4A 4ZDKA 1G5PA 4WVFA 3T15A 4GT1A 1KI8A 2CL7X 4QHYA 4V03A 4DCUA 4XTRA 2Q9AA 3FKSA 1KI3A 1Q1ZA 5H1YA 4WOPA 1W36B 2ZJZA 4PPNA 4OHZA 4H1UA 3RWMB 3VR5A 4BRWA 2MSCB 5L3QA 1E6CA 3RABA 2EFHB 1OXSC 1K6MA 3TGPA 4ARZB 1QG4A 1OSNA 3UKDA 3CR7A 1SULA 1DAKA 2IYSA 2RGDA 2ZI5A 3P4YA 1CEEA 3KQUA 2WWYA 3F5FA 2YOHA 4XWKA 1P73A 1HE8B 5LPNA 1ESNA 4WZBE 2H92A 5F9FA 1QHGA 5FPHA 1FUKA 2F43A 3QKSA 2J41A 4W7SA 3W8RA 3IEUA 1YJ5A 1OXUA 5BYKA 2QE7D 5FBQB 1JALA 1H8HA 4XSHA 5CK4A 3W90A 1P5ZB 1JPJA 1E9SA 1AQUA 2W2XA 3U7HB 3PEWA 4B3DA 4NPHA 5D3MA 1ZD8A 3WYGA 3VR3A 4DLVA 1XF9A 2XITA 4AWXA 4AKHA 1EFTA 3LRPA 3LLUA 5FPYA 1KHTA 3DKPA 2V8OA 5JMTA 2ZREA 4PHHA 5FR1A 2F7SA 1KK2A 3K0CA 1P2VA 1XNJA 1OIWA 1W36D 1NLFA 2J87A 4NP6A 1P60A 5D3QA 1T0JB 2IXFA 1NBMA 3GLGB 1KI9A 3HYRA 5CB6A 1RRFA 2REXB 5JWRA 3IGFA 3IQWA 5FTKA 3Q72A 5JRZA 1D9XA 4CVNA 4EPYA 3B6EA 3OFNA 1P7CA 2QAGA 2Z4SA 4H9GA 5EE5B 4AD8A 1Q22A 2ORVA 3Q3JB 4V0KA 2D62A 4BRUA 4NCJA 1DO2A 1RZ3A 2OHFA 3FYHA 4O2RA 4OQFA 3M0EA 1OH6A 1KYIA 1L8QA 4FN5A 4PC6A 2YWHA 1HTWA 2H8KA 4PR0A 1AZTA 1NVWQ 2FV8A 3B9QA 1DG3A 2HLDD 5KDLA 5CB8A 2HV8A 4A6PA 3T61A 3AP3A 1L4YA 1QHHA 5DI9A 1MABA 2W0MA 3FDIA 4L8GA 4DLRA 3RC8A 1QDEA 1AIPA 5EUQB 4B32A 4ZPXA 4Z54A 3A4NA 3L82B 5C2JB 4GMDA 1F2UB 2OCBA 1YE8A 3IILA 3EC1A 2EVWX 4WXPA 1G5TA 4NCHA 2ODNA 3JVVA 3HPQA 4YLGA 2RGAA 1ZM9A 4EJSB 4QGAA 4ZI2A 3IEVA 1ZM7A 2Z4RA 5AR1A 1VCIA 5L3RA 5AJYA 4B3GA 3QXHA 1OXTA 3K1JA 1Q21A 2ZR9A 4A0GA 3ASYA 1W5SA 3EZ6A 3ADBA 4X8MA 1DAEA 5J5CA 221PA 2YWGA 1IONA 3QNUA 2WTUA 1U94A 1XRJA 1SXJE 1Z08A 2ZJ2A 3LFUA 1US8A 1XTKA 2KWIA 3BRWD 1GWNA 3HWSA 4IEEA 4Z8XA 4URXR 4BLPA 2YVUA 4HZIA 2RMKA 1U2RA 2NG1A 3L0SA 3RRNA 2J9RA 4HB0A 2BC9A 2HCJB 2ZEJA 4JIMA 3K0CC 1JR6A 1MOZA 1KAOA 2B8TA 2P3SA 4YC7A 1G8PA 4DB2A 1VYTA 2XEXA 3EASA 4DDTA 3ICQB 2ZPTX 3NXSA 4Q7LA 1JXOA 5EP3A 4Q1AA 2ATVA 3PXGA 4CZ2A 2H16A 2O8EA 1RKBA 3SC3A 1V5WA 1XBTA 5FFMA 4HUQB 4KSBA 1NLZA 3UXMA 4TTPA 4K8OA 3PEUA 3A1TA 1ONBA 4AG6A 3QOFA 1M34E 2FE4A 3KKOA 1DVRA 1II8B 2ZYVX 1E2HA 1Z6GA 3QF7A 5FL7A 2I1VB 1ZUIA 4W5WA 3KTAA 4K81B 1N6KA 3FVQA 1CF4A 1XXHE 3SZRA 4Q21A 4NYJR 3ZVRA 2FFBA 1Q1QA 1W1WA 4D25A 3PG5A 1UKEA 3SE0A 3VHLB 5FOUA 3NDPA 2LKCA 2VP4A 1AN0A 2WJYA 4ZO4A 1UDWA 4YONB 4DT1B 2H1LA 1GVNB 2JDID 2OAQ1 3PFIA 3QBVA 4BZPA 2RGNA 2YHSA 1IXSB 1GITA 2DWQA 4IVPA 4AKIA 3U60B 1EX6A 4EAQA 3UG6A 1NIJA 2IBMA 3K9LA 1MRNA 4E07A 4IFBA 3AVTA 2HUPA 1P2SA 2XJ4A 5CITA 4Z8YA 4B3XA 4IOKA 1VYVA 2R65A 4P0TA 1RJ9B 4DLWA 3X1ZA 3IHWA 3Q8XB 4PO9A 1DAIA 5GVSA 1O87A 1XMVA 1GKUB 1RRGA 2W2TA 1U8YA 2Z5FA 2ZS8A 1VG1A 4KJZA 1VG8A 2IYZA 2ZRAA 3AVVA 2QPOA 2ZRCA 5FUYA 4OL0A 1UKYA 4C0AC 4CT5A 3RANA 2MMGA 3KUCA 5B58C 5LD2C 1OXXK 4LHYA 4RFVA 3OESA 1F2TA 4WZ6A 2IEZA 1U0JA 3FTQA 1EESA 4H1VA 4TMVA 2JDIA 5P21A 1NKSA 1E1QA 4JL8A 3NEYA 4L9SA 4QGHA 5AUPB 2V3CC 4R2IA 2DPXA 2AK2A 2UVQA 4YMVA 3MCAA 1CJUC 2QMHA 3G5UA 3WMFA 3UPUA 4R2HA 2B21A 2JLZA 1V43A 2F1RA 2HYIC 1UKZA 3CH5A 4TL8A 4HAVA 3AF3A 5EZ6B 5UKDA 1EFRA 1Q0UA 3RNLA 2D3WA 1PJRA 3RC3A 1OV4A 4ESHA 1KMHB 2BBWA 3CPEA 4IW3B 2XZPA 2CHGA 4DEXA 1TUEA 3EPHA 4BFTA 3QKSB 4JKIA 4G5RA 4D81A 1RYHA 4LHXA 2ZRBA 4EFMA 5EJEA 4D26A 3UWKA 4I81A 1S8FA 2VP0A 2G6BA 4CIDA 1FZQA 3W3ZB 3D31A 1XD9A 5JCPA 2UZIR 1N5IA 4Q1EA 3DDCA 1G6HA 2V7QD 1Y3AA 4TMWA 3HJNA 4US1R 2QRNA 4URZR 1G3UA 3U4QB 3C5HA 2D06A 5M04A 4EQ6B 1ELOA 4AKEA 1PUJA 3B8HA 4GRAA 3LX5A 3IIKA 4OQXA 4M1KA 2FX3A 2PH1A 2XX3A 2DB3A 4DCSA 1ZNWA 3IBYA 4Q1FA 3LQQA 4LYHA 3MWKA 4UXHA 2VHJA 3E1SA 2ANBA 4DDWA 2OLJA 1ZM4A 3A4MA 1LTQA 3TUZC 1SXJB 4F4CA 4HB3A 1JJVA 1KMQA 4KSCA 2IYXA 1I4TD 4IKEA 3CF2A 4LUCA 1XJ0A 3RSOA 3SYKA 2OAP1 2FEOA 3EA5A 3U5ZB 4DWJA 2GILA 4DRZA 4YXWD 4MQBA 3SN6A 3AF0A 4YMTA 5F3WB 5EP1A 3SEAA 3IHLA 3OAAD 1NL3A 3DPUA 1G4AE 2D74A 4JL5A 4BLRA 2BEKA 3K09C 2WWHA 5BN3A 3KQNA 2XZOA 3IDQA 4MUBA 2G1JA 2R6DA 2GCPA 2V7QA 3WBJA 4EJSA 1KJYA 1NBMD 4JVSB 1F5NA 2C5LA 2BMJA 4D4KA 4RD2A 1SVMA 2C2HA 1WCV1 1XWIA 3NBFA 4X8HA 3WNCA 3I4LA 3K0AA 2X2EA 2FSIA 1ZCBA 4PHTA 4C0BA 2O8DA 1QG2A 4ZKDA 3PVSA 1UBFA 4JKYA 2FPMA 3H1TA 2A5DA 5IHPA 4TT3D 4MRVA 1BYUA 4B47A 2GCNA 3PV0A 3RS0A 1E1RA 2A5YB 1G8GA 2QUZA 5DH9A 1NY6A 4LHVA 1ZIOA 2I1QA 1NMZA 4LRWA 1CS4C 2ERYA 3Q9LA 1C9KA 1JI0A 5E7MA 4KBGA 4B3FX 3AKYA 1W46A 3V00A 4DUGA 4TYPA 3TSWA 3QENA 1TF5A 1KKLA 1W4RA 4JBWA 4MYUA 3ZYCA 1P4SA 1WA5A 2FGKA 2Z83A 2EQBA 1E9CA 3O8BA 1M8PA 4Q66C 5FTNA 3R9IA 4FD2A 1OYYA 4TLBA 5FBVB 1T8UA 1XCGB 3DZDA 1TTTA 3VU9B 2BBSA 1L4UA 3C15C 4NCIA 4DXAA 4PO1A 4AY2A 2O0JA 1Z28A 2NZ8A 3BD9A 2J0QA 3IKJA 2XSZA 5JCZA 3CRW1 3AF2A 4A2QA 2ZE8A 1JECA 2GF9A 2GJ9A 4B2PA 4AYWA 3KTAB 3X1XA 1Z0DA 4QFMA 3RVBA 4D4MA 4ILEA 3NHBA 4F4IA 5LB2A 2C77A 3EAQA 1S96A 3LWNA 3B82A 4RZUA 1OT3A 2GTPA 3FB4A 2AXNA 3KX2A 1PUIA 3PIRA 2GXAA 4B48A 2JLVA 3R7WB 3O8CA 4DT1A 3WRYC 3PQCA 3K09A 3KKNA 1XPUA 3TSOA 1XDBA 2ZUBA 3OIYA 2C04A 3C4JA 3N2IA 5BQ5A 1M7BA 1TU3A 4IDHA 1YZKA 4B2IA 1WXQA 3KB1A 3K70B 4QL3A 1OXVA 3P20A 4JVLA 3QPWA 1G20E 2QG6A 3QEOA 5JEEA 4JSYA 4ZDJA 1CR1A 1U8ZA 1G7SA 5CYOA 4Z51A 5KTYA 5FOXA 1HQYE 2Q0HA 4TL7A 1GRRA 1Y63A 3F8TA 2DFLA 3VX3A 4EKDA 4CRWB 4I4LA 3RS2A 4HUTA 1GL6A 3CX8A 2PX0A 5E4FA 3CRMA 2IYRA 2O0HA 1CULC 2W2VA 2ZU6A 3I3SR 5JWOA 4PSKA 4QC2A 4B44A 4F38A 4R9UC 3OF5A 5IT5A 4LX0A 2J1LA 1NVUQ 3NBXX 5EP2A 5DN6D 2ZRDA 3B1ZA 5AJXA 4B75A 1Z63A 1A82A 2N42A 4MUAA 4P31A 3SFZA 3KL4A 1Z22A 3NC1C 4KODA 3CRQA 1FX0B 4DSUA 3THYB 3C14C 3T1QA 2UKDA 1R8QA 4MGZR 4OI4A 1OF1A 1ZP6A 1E4YA 1Z0FA 1TPZA 2JEOA 1DG1G 2CHQA 1Z2CA 2ZYTX 3Q5EA 4R71A 1T3LA 1I2MA 4TQ9A 1QRAA 4QJ4A 1JBKA 1GUAA 2QTHA 1S1MA 2GJ8A 4BEBA 2JLRA 3GP8A 1T91A 3EG5A 4A8JB 3SJCA 3ZQ6A 3VNUA 1JAIA 4J0QA 4LJ4A 3CX6A 2WKRA 3TRFA 2JASA 5HCNA 1GOTA 1FQJA 3U7FB 1KSJA 3L8YA 4JLAA 4U00A 1DARA 4R7ZA 4KFTA 1VECA 5KNDA 2C95A 4KCGA 1G41A 2B92A 4OKSA 4BLOA 2WAXA 4Q01A 4NDZA 2D7DA 1YZGA 4MKGA 3NG1A 3VQTA 4Q4JA 2C8VA 1M7HA 1D9ZA 1HURA 1XMSA 2VP6A 3T1VA 1Z07A 1QVAA 2E87A 3LA6A 4BE7B 2NO9A 2G0NA 1Q1EA 5A4JA 2KSQA 1X8KA 2P0EA 1NG1A 3Q7QA 4IRUB 3TR5A 2GETA 2J3EA 1E0AA 1Q44A 1T9HA 1YZQA 4DLSA 3J81k 1ZJ6A 3RAPR 4AC9A 4X8OA 5LD2B 3T1TA 3KFXA 3P26A 1E0SA 3QJYA 3FMIA 2ECKA 3WNBA 4DCNA 2H7VA 3SNHA 1G8HA 2V6IA 3GJ6A 2P5SA 5LDDC 3B7GA 2WOJA 4ARZA 3UWOA 4NH0A 2SHKA 4P4SB 4PHGA 1COWA 2BJWA 2DHRA 4L4UA 3EX7C 4HAWA 1T4GA 5DHAA 1IN8A 2GDJA 3X2SA 4HLQB 2IHYA 1IXRC 5E95A 4A2WA 4TZ6A 3TBKA 3VAAA 1OH5A 4S35A 2IEYA 3BB4A 3OEEA 2XXAB 4M4SA 2QT0A 3QG5A 4DSOA 3W3AA 4TMKA 1E4VA 4KHZA 2CE7A 2LKDA 1F6BA 4RD4A 3CW2A 2WJIA 4C4PA 3EZFA 4M53A 2O8FB 2XTMA 1D8TA 3SFVA 4BEJA 2A5JA 2GESA 1VMAA 1W0JA 2A9KA 4DHEA 4CEHA 1TQ4A 4BLSA 1A1VA 3UK6A 4A0RA 4DIDA 3RS7A 2QGZA 4A36A 4GOJA 1HT2E 4US0R 3VHXA 2VIIA 2IYVA 3KUDA 4LOAA 1OFHA 1GNRA 4Q9HA 3CF0A 5E7IA 4FWIB 4DVGA 3GLGA 4C0KA 2QAJA 5A5GA 2ANCA 1IJFA 1NY5A 1N6LA 4IOMA 4AK9A 3JVUA 4D80A 3VU9A 4TYNA 1W0KD 2QAGB 4EPXA 3BJIC 2P67A 3BFXA 3TR0A 1K5GA 1U98A 4ESVA 3T1OA 4LYAA 1TF2A 4UJ5A 1KI1A 1WE2A 4GSYA 1XB2A 4PAQA 1M74A 4PX9A 4U7DA 2W6IA 2FN4A 3LY5A 1TQ6A 2R8RA 4OJQA 1RFLA 2GA8A 4O2LA 3M4YA 4HLCA 2REBA 1XJCA 1QHHB 4RD0A 1E2GA 3K0FA 5DO9A 2RB4A 3ZQJA 3ND8A 3LD9A 4C3ZA 4B74A 1CIPA 3VNVA 2FSHA 4LGMA 2C9CA 3R7WA 3D7MA 2ZSBA 3EPJA 1XTSA 3QG1A 3QXJA 4KFUA 4NYIQ 1XTQA 4TZ0A 3TSZA 1VIAA 2GRJA 2VSXA 2KI5A 1S0UA 3SBEA 2QTVB 5HZHA 1E79A 5FTMA 4ZIRB 3B85A 3K8YA 2BDTA 3F0TA 3NH9A 2NO6A 2ZSFA 3IO3A 4XD7D 4A92A 3C7KA 1N0WA 3AP2A 3OEHD 4RFSB 1P72A 4YMUA 4OJKA 1TQDA 4DUGD 2G83A 4I99A 4NCKA 4F93B 1AJEA 2HT1A 1VYUA 1WRBA 3BB1A 4A0FA 4EUNA 3AM1A 1UEJA 3CRVA 5BW8A 5JJLA 1NMXA 2C98A 2G3YA 3KFVA 3CWQA 1IY2A 2HF9A 2VL7A 4LCBA 4Q1BA 4QRHA 5DHFA 3DZ8A 4QOSA 3JZMA 2GWHA 4URUR 1GM5A 1T8TA 1R5BA 2CL0X 2ZVPX 3UG7A 4ERNA 2AFHE 2AWOA 1PLLA 1YKSA 1ZM2A 1CRQA 4B43A 4TQAA 4PTLA 3LW7A 3FKQA 3B9PA 3D3QA 2P6UA 1KI2A 1FMLA 1CJKC 1WMSA 2Z0MA 4RZ2A 5FBWB 3WYAA 3K9HA 5F9HA 3ZIAD 4C0QC 3B5JA 3UMSA 3I5YA 2OO7A 1X8LA 2BKUA 5TV2A 3VMFA 4W9MC 1N3BA 1E0KA 4JBXA 1DELA 4F91B 2QP3A 4Q9KA 4GDFA 1Q20A 2NO0A 2V6JA 4YMWA 1E2LA 1S9DA 2WSSA 3B13B 3BGWA 4JT4A 4M1SA 2OEPA 2IK8A 5AK0A 1S9HA 2ZJAA 4BQSA 1UAAA 4ZCLA 2R44A 4A8JA 1E9BA 3TQFA 4N3NA 1W48A 4EFNA 3U6BA 4MGYR 5HKKD 1Z0AA 2A7QA 3OFND 1E2FA 1OIXA 2GEDA 2EYQA 1ZU4A 4PZYA 1VHTA 1S3SA 5KDDA 1TQ2A 2WMOB 1GL7A 4OQLA 1Z6XA 3Q7PA 2GXUA 1RYFA 1UJ2A 3UMFA 5TARA 1N0UA 4IXMA 2JIZA 2QEQA 4JJZA 1YU9A 2AD1A 5KUTA 4FI3C 1U90A 2Q3FA 1N6OA 2AX4A 4OYHA 4FMCF 3NDBB 3WMGA 1ZUHA 4EPRA 2ZRKA 3I32A 5HPYB 1GIAA 5C1BA 2FJUA 4JJKA 2GVZC 1RC8A 2ATXA 5AUNB 2FFAA 2JJ2A 4D82A 3BFVA 5JJKA 1H8HD 2EW1A 2B7CA 2HF8A 3AV0B 3B1YA 3LLMA 3OEHA 4I1UA 1NJGA 3QKRA 4EPVA 4QG7A 1FP6A 5DN6A 3QKTA 3T12A 3WP0A 2CVHA 5JRJA 4LDJA 1P2TA 2WIBA 4P4SA 2IUTA 3M6AA 1NIPA 3GPLA 5EXPA 2NO7A 2V55B 1Z06A 3DOEA 2D7CA 1DPFA 4BLTA 1GAJA 4E03A 4PHFA 1I4LD 4LBVA 2KBEA 1II9A 2BBOA 2WJJA 3IO5A 4CGZA 3N70A 2RGBA 3DVLA 4PFSA 3R9WA 3MWYW 1YZLA 4RSGA 1IM2A 1UBCA 2PT5A 4O0MA 5FBRB 1OW3B 4CEIA 4Q7MB 1UEIA 2GCOA 2CCJA 2W6ID 1ZD9A 2OESA 4QJ5A 1IY1A 1J8MF 1NF3A 1T3SA 4TMTA 2O8CB 3TW8B 1X8JA 3OZXA 1E2JA 1G17A 1FTNA 1W0KA 1YQTA 4CEHB 4JMPA 4GMXA 3QF4A 1T0HB 3G82C 4Q19A 2VP5A 3R8FA 2O5VA 2IA5A 3OIVA 1SGWA 1RW4A 4I1SA 3U44B 1A5TA 1CLUA 3CZQA 4I1OA 3SQWA 3TUJC 3K70D 2ZETA 4QHSA 3KB2A 1SXJD 4GP6A 1WF3A 2ZE6A 2PBRA 4KFRA 2BJVA 5FUWA 5EXTA 1MR3F 1U8AA 4M1OA 2WICA 1W0JD 1IQPA 4B3BA 5CLQA 4HLUA 2YC2C 5FOVA 2QI9C 4BUJA 3RS4A 4KI0A 1Z6AA 4JZKA 1IJEA 4D0GA 4QXAA 2X19A 4LV5B 2Z43A 4G5SA 3HU3A 5J4HA 2QRZA 2XOKD 4CEJA 3CWZA 4PPGA 2VP2A 2IYYA 4B73A 1CXZA 1QBKC 3NIBA 1G8FA 3L0IB 1NN0A 2FPKA 4LC0A 3SBDA 4JLJA 1TAGA 3NC0C 1SVLA 2GAAA 3I8XA 4WW0A 1TUIA 3B1XA 2QMOA 1PV4A 1DTSA 1G291 4UNSA 2QP4A 5JHGB 2VHQA 1IN5A 3GJXC 3NHAA 4ACBA 2OILA 1FQKA 1VHLA 3NBZC 4IOJA 1LW7A 1ZU5A 3SDZA 4B35A 4B76A 4BWYA 2IS1A 2ZANA 2MMCA 4MYTA 1XD2B 4NMMA 1J7KA 5AUQA 2WWWA 2YZ2A 4RCZA 2BEJA 1II0A 2BCGY 5FL7D 4WA7A 4HB2A 2HJGA 2ZYUX 2BM0A 1Z0IA 4IDQA 1GG2A 1S1CA 2IWHA 2ZS9A 5L8VA 5J4YA 1R2QA 3ZZUA 1A2BA 4RFSA 1RVDA 4JLOA 2B6HA 4HSEA 3K0AB 3KJEA 1IHUA 1N25A 1TEVA 2VTKA 2BHRA 1D2NA 4TSFD 4D2IA 3UANA 2OE2A 4URYR 1PVOA 2O8DB 3VTKA 5EE1A 2OZEA 2ZRIA 3K0SA 2VEDA 1BH2A 2R6AA 5EE9A 3QQ5A 4NKRA 4V02A 4OI1A 1YHNA 5JJIA 1AM4D 2J7PD 2F3RA 3CPJB 2FF7A 4OI0A 4LJ8A 4DLYA 3KKMA 2WKQA 4RD1A 5ELXA 1CKEA 4LBWA 3KJHA 3FMOB 1N6RA 2FMXA 5CIWA 4F7WA 2FOLA 4YMSA 5IK2A 4Q9LA 2HCBA 1BMFD 2GK7A 1FMJA 2WZQA 3RRMA 4E22A 2R9VA 1LS6A 4OK6A 2GJSA 3AVYA 4GP7A 3ZIAA 2J0VA 3PENA 2EFEB 4LPSA 1SHZA 3BH7A 4Q18A 3L0OA 5EZ5A 1BIFA 3RDPA 4XWOA 2H57A 3RWOA 2GBLA 5SZJA 2W0SA 3QPVA 3QXXA 4IEIA 1Z29A 3FHOA 5CYPA 5KNBA 2WOOA 1KGDA 1YRAA 5KSYA 1G21E 5B57C 4P32A 1WDTA 5KOYA 3MWJA 3GLFA 4M9ZA 3SI7A 3ZGXA 2HDNB 1B0UA 2HEIA 3FMFA 4QBGB 2F6RA 2AHOA 2ZJYA 3L8ZA 2ZAOA 3GCGA 3EWAA 4Q9JA 1E9FA 1OFTA 3QBTA 1R4AA 2G9NA 1L7VC 3VR4A 4B71A 3KQLA 5KNCA 3C8UA 1DEKA 1M1YE 3FGNA 3ECCA 1G3RA 3CZPA 1ZUNB 4G01B 4Q4AA 2P6NA 4XH9B 2RAPA 3Q85A 3QXSA 3AVQA 1B23P 1JR3E 1OIVA 2J7PA 2REOA 2ORWA 3DKVA 5AWFC 2GXSA 2IF0A 3TQCA 1KJWA 1T3HA 3T06B 5FUVA 2YWFA 1NRJB 5KSZA 3RRZA 1E2QA 3DHWC 4A1FA 4UQOA 3WMEA 3EPLA 1WB9A 1D2MA 1KZ7B 2ZRGA 3G0HA 3CX7A 4TMXA 2BMDA 4A2PA 1S4QA 1N6PA 3N2EA 4CYMA 3QKUA 4NBSA 2G88A 1M6NA 3EA0A 3EARA 1ZCAA 4GL2A 5BYJA 3GJ0A 3E5HA 4A4DA 1IN4A 3QKRB 2V54A 1MRSA 4KYUA 2OT3B 5G40A 3I73A 3BFKA 1W5TA 3SHWA 1KNXA 4PAOA 5K8UA 1ZVQA 2HYDA 2BOVA 1IBRA 2BKEA 3NBYC 1E1QD 4ZV4A 1FUUA 1S3GA 1JB1A 2KE5A 3KXIA 2VHTA 4M9XA 5LB4A 1FX0A 2CHVA 1N5LA 4BPBA 3THYA 3FPAA 4Q7KA 4EJSC 4GBMA 1P9NA 2EWVA 1TMKA 1P9WA 1KKMA 2J7KA 2RKOA 1Z47A 1OHHA 1KIMA 1XXHB 3AGQA 4Q1DA 1R0YA 2WHXA 4NZYA 2DFKB 2PZFA 2GCOB 5DE3A 2ZUDA 4FMBB 3U3KA 1N2CE 3MG9A 4Y0AA 3KKQA 2O8CA 2IX3A 2GK6A 5G3ZA 3AF1A 1XZPA 2OUKA 5FOWA 1P3JA 3LO5A 2YKGA 3AB3A 3I92A 2VYFA 1OH8A 3ZS9A 1Q3HA 3QF4B 3D6TB 5FTJA 2XSZD 4F4JA 1IOZA 5K8TA 2VO1A 2ZRMA 4HEJA 1ETUA 2XZLA 1D2EA 3MRSA 1Q57A 3BWDD 1E9DA 1GNQA 1Z3IX 3MWLA 4WXRA 1QHYA 2VLIA 2PZGA 5A0FA 4IVQA 1HE1C 2K5UA 3TNFA 4Q4JB 4TT3A 3E70C 4JT2A 4LYFA 1KSFX 1W2HA 2PJRA 5TVKA 1SVKA 2XGJA 3SQXA 4LPKA 4XJXA 2JJ1A 1KI6A 3MSXA 4KBFA 4MDEA 3TW4A 3ZDQA 2CL6X 3TAHA 2CNWD 2YV5A 4CEJB 4LBYA 3RRYA 1U0LA 2JAQA 4BFZA 2P6RA 4KVAA 2N46A 4MA4A 4V0OA 1KSHA 3NH6A 2KBFA 3H84A 1YR7A 2ZI3A 2QSZA 5JEDA 3EZ9A 1KI7A 5EE0A 3S1AA 3TVDA 3W5JA 3HDTA 4ACAA 2QQ0A 3GEHA 3OIUA 3CB4A 3GLIA 1X1RA 3SU8A 1KJZA 2FPLA 4Q5IA 4OHYA 2BBTA 3UATA 4P4TA 1ODFA 3V4FA 5JECA 2QROA 4F92B 3SJAA 4EPWA 3TUIC 3THOA 1OKKD 1U9IC 4RCYA 4UXIA 721PA 2R6CA 5CDFE 4XVQA 2XXAA 4JSTA 4A0HA 1KY3A 2O0KA 2DR3A 3U61B 3L2OB 2JJ8A 3AQ4A 1NKTA 4NYJQ 1F48A 4IXNA 1QVRA 2A30A 3QI2A 2Q3MA 4MDFA 3MJHA 3HR8A 4GI7A 1LV7A 3MFYA 4DSTA 3BERA 2O8FA 1TX4B 3BK7A 3W6OA 4LJYA 2HJVA 4AG5A 3K9NA 3AVUA 4TWZA 4TLCA 3CUEF 5F2EA 1SXJC 2VF8A 4HDOB 3ADKA 4LZZA 4L16A 4R98A 3GJ7A 1Q3TA 1QHIA 5TY0A 3R20A 1W36C 1CR2A 1E0JA 3TH5A 1P9RA 2CCKA 2HXYA 2VP9A 2ZI6A 2OXRA 2J46A 1AS2A 5CLLA 2GHIA 2NIPA 4M2LA 2QTFA 5HE8A 3CNNA 3CR8A 1KDTA 2BV3A 2A78A 3SYNA 1NLYA 4BFXA 4HAUA 4E5UA 2HLDA 3KZ1E 5FPKA 4G5GA 3B1WA 2X2FA 3RHFA 2J5XA 5CIQA 1G18A 5GJCA 4AIIA 5K8LA 4UNQA 4TSFA 5JZVA 3QPUA 2C99A 3HPRA 2IS2A 2HT6A 5CM9C 3M1IA 1E2DA 2O8BB 1ZNZA 5DSZA 3GLGE 3GLFB 4JYBA 4DBLC 2F1HA 3QE0A 5IF9A 1JJ7A 3NWJA 3K0FB 4Q1CA 2JATA 1ZYUA 1MV5A 3P27A 1CU1A 2BM1A 2NQ2C 4Q02A 4PAMA 3GJ3A 4LJ9A 2G77B 4JL6A 4O3MA 3QIAA 2AN9A 1WP9A 1AKEA 4BFVA 5DNYB 1FNMA 2DBYA 4RD3A 4C0LA 1GRNA 1DOAA 3CLVA 4MRSA 2BVNA 2QSYA 2F3TA 4PANA 1GTVA 2RGCA 2LWIA 5CJPA 1TEXA 3A4LA 4ZIRA 2C03A 2OFWA 2DFNA 3AF4A 3A1UA 4YDSA 3VR6A 3MMPA 5FH9A 3A58B 3LH5A 1NG9A 2GJKA 2WPDA 2FSGA 2ZR7A 3NKVA 3RSLA 3SYLA 3W34A 3AP1A 2UZ3A 4LHWA 4NYMR 3T5GA 1YR6A 4XSGA 1G6OA 4Z1MD 3ZVLA 5CM8B 2J59A 1KK3A 3SOPA 1ZRHA 1CJTC 1YRBA 3GEIA 2KJQA 1XTIA 4LC1A 4GZLA 1UDXA 4OK5A 4C7OA 1NN3A 2F1JA 3GEEA 2QT1A 1IN6A 2CK3A 3RLFA 4MITA 1QHNA 1FOEB 4G0NA 2IW3A 4G1UC 2DFTA 4A82A 2OCAA 3KQHA 4EIWA 3OE7A 1R0ZA 1J99A 3K9GA 4S2EA 3KKPA 3TE6A 2PCJA 5JWHA 5FTLA 2RHMA 4NU0A 3GJ4A 1TU4A 3A8TA 1NN1A 1XEXA 4QM6A 4Q9IA 4UNNA 1W44A 4G3XA 4Z1MA 1KO7A 2OCYC 2MSEB 1XXHA 1N6HA 1G16A 1P6XA 2XTZA 4Q47A 4Q4HB 2WAYA 2ZUCA 3ZJYA 2JJ2D 2IT1A 4Q00A 4HLDA 1J90A 1DAHA 2A2ZA 2VH5R 4HDCA 4Q7JB 4QNMA 3GJ5A 2VQSA 2FZ4A 2PMDA 1AGRA 3N5CA 4G5OA 4DDUA 1XZQA 3PITA 4NHOA 4TQUS 4QM7A 1JNYA 2GF0A 3V9PA 4ABYA 2Y8EA 1GSIA 2N1BA 5FOSA 1UM8A 4JLDA 3REFA 5FUXA 1E98A 2ZJBA 5J4LA 4M1TA 2QM7A 5DI3A 3I72A 4IDNA 3TLXA 1BYIA 4ZCIA 4FIDA 1GZSA 3FFAA 2FU5C 1AK2A 1HUQA 1S2MA 1R0XA 1TNDA 4IDPA 4ITRC 2FGJA 2ZRLA 3OEED 4WZAE 2HXSA 5LBIA 1ZM3A 3L43A 2R2AA 2CLCX 3KJIA 4AYTA 4YXWA 3THWB 4IHQA 1UBGA 1XTRA 1FL9A 2QZ4A 4PSVA 3GFOA 3FFBA 4M0LA 1GDDA 4LBZA 1G3MA 3PEVA 1P62B 1Z83A 2WV9A 5SZKB 1KO5A 4RD6A 5HTKA 4D4JA 1J8YF 3LVQE 2CDNA 4HDQB 4TLEA 4BGDA 2WIAA 4UJ3A 2IUUA 1R5OA 2I3BA 3RS3A 2IYLD 2QORA 1BS1A 4D6PA 5AJWA 1Q1BA 5SZIA 4CF7A 2VBCA 3I8SA 4A8JC 2JIZD 2R62A 1OLOA 1XCPA 3LXXA 4FMCB 2NPFA 4MRPA 5JSZA 2VPPA 5CJ2A 3IBGA 4HAYA 1RIFA 1DBSA 1FTSA 1ESMA 3BE4A 1UKVY 2PZEA 5JFGA 2E9SA 1ZNYA 4EPTA 2ZTSA 5EXXA 1SKYE 1BMFA 2WBLC 5G53C 4CEIB 2ZROA 4B3CA 1C4OA 4AURA 2AWNA 1L2TA 1HEIA 2ZSAA 1QHXA 1HH4A 2FNAA 4HATA 3T35A 5B30A 4AI6A 1KK0A 3A1WA 2CLSA 1E9RA 4LWZA 3ZVMA 5KO2A 1PLKA 4PPQA 3GD7A 3I1FA 4DLUA 2XAUA 1LS1A 3SJBA 4RJLA 4DLXA 4ZCMA 4PO8A 4QNRA 2ZJ5A 4DKXA 3PCRB 3P1JA 1VCMA 4XD7A 2WWXA 3TMKA 4PC7A 3ETLA 1RRCA 2YYZA 5JLJA 1EFCA 8OHMA 4IOLA 2DWPA 3U44A 3QVVA 3ND9A 4LY6A 5B64A 1EWRA 1JR3D 2OM2A 1WQ1R 1VCNA 2QBYA 3U7GA 4NYMQ 3H0KA 4NL4H 1NVVR 1OB5A 3BBPA 2CNWA 1VKJA 1ZINA 2PCLA 5FOTA 2C9OA 1FNNA 1UF9A 3AUXA 2YJTD 1E2PA 2YOFA 2CJWB 3CM0A 4OHVA 3H4MA 3BC1A 1E2IA 2C9YA 2JLUA 4DCVA 3AKEA 4GOKA 2Z6VA 4XWAA 4BFUA 1JQLB 2NTYC 1SQ5A 2VHUA 3PR1A 4FXPA 3GFPA 1I2DA 1VTKA 2V1UA 1YZUA 3TKLA 1LVGA 2WWFA 3AVXA 2OFOA 2H18A 1J70A 4RY2A 4BFWA 5FBLB 1BKDR 4V0MA 5EXSA 4JLVA 2YC4C 4JLKA 2ZRJA 4CT4B 1XD2A 2BMEA 2XB2A 1Z5ZA 1OFUX 2JLYA 4MYCA 3PUWA 1U81A 3C16C 2A5FA 1HY3A 4OK3A 3LNCA 3NVAA 1Z8FA 2ZYWX 2XTNA 4M9QA 3ZH9B 4JYCA 1DADA 4XVRA 4DCTA 3B78A 3FE2A 4OHXA 4KITB 4C0HA 1Z2AA 2H5EA 3H2YA 1XPOA 2I4IA 3JZAA 2IYUA 5JHHB 1YR8A 2ZRNA 1W49A 3FWYA 2ZM5A 2OSBA 2GAOA 2IXEA 4PQYA 1UPTA 5GJWC 3ASZA 4MRRA 2P2LA 2ONJA 1E32A 3EXAA 2AXPA 4HLUC 1OHHD 3SS8A 4C2UA 2D4HA 2EFDB 2VSOA 1N0VC 4P3YA 5DLQC 5JI2E 3ZLJA 5L3VA 1NBME 2IWRA 4U02A 1DAGA 3H86A 1XEFA 5KU1A 4ZKEA 3GLIE 4L5BA 4ZDIA 1VDZA 4UNPA 4URVR 1SVSA 2JGNA 3IPYA 3KJGA 4FWTA 1KNQA 4C0SA 4MGKR 3EW9A 5JS8A 5KSOA 5FPTA 5CDFA
chains in the Genus database with same CATH superfamily
1QYXA 2IXGA 3GMTA 1D7OA 5AOVA 4PF1A 4YGYA 2AOTB 1B6TA 2ROQA 1GT6A 3R7SA 4YQFA 1OB2A 2C88A 3PFNA 3O7MA 1V7ZA 2QNRA 1DCFA 2AUMA 3PQEA 3P97A 3G02A 1RQNA 4KACA 3RRFA 3OZVA 2J3LA 2HDHA 5LJIA 4DDVA 1ZLYA 2Z1NA 5H80A 1N6IA 2W4QA 1OROA 1FNCA 1XQ1A 1JXMA 3WHKA 3MCTA 4B4OA 1LNSA 1DDOA 3E05A 2ILTA 2HBRA 4PXSA 3T7RA 4BWVA 1JQ5A 3V8EA 2J45A 4F72A 2AKAB 5BWNA 1Z2DA 3DLTA 1B73A 1O7JA 3PXDA 3OEWA 4P38A 4DDHA 2G06A 2DTDA 3KXKA 6YASA 4PC2A 2VDOB 1HO3A 3B1JA 3MGCA 3PHBE 4WGGA 4YDHB 1LW6E 3W9UA 3ZNPA 3GLHB 4J16A 1GZ6A 2OWEA 2OXCA 4FINA 4KRGA 4HZUB 2WUVA 4M88A 3KSDO 5DI3B 3SX0A 3W2FA 2X8AA 1GUBA 3AR3A 4EAAA 1P31A 3K6KA 5EHGA 4J0GA 3K0EA 1PZMA 1PZNA 2EWWA 2I6XA 3ETCA 3I9MA 1Z33A 3QNMA 1RVV1 4MO9A 2QTLA 2DJIA 2EFYA 3BXHA 3OFJA 4ND6A 2Q1SA 4JA2A 4NQZA 1C2TA 5C5DA 3ICEA 4GKKB 2UZ0A 4E5KA 4EGAA 1G8JA 2I29A 4U7PB 5CR9A 1H0RA 2K6GA 2IE0A 3B5EA 3R5KA 3VNBA 2B8WA 1JEYB 1JR3A 3K94A 4XCVA 3SZ3A 1EVJA 4G8DA 1XWWA 5J4VA 1NUSA 2J09A 5K99A 4MUJA 4ND5A 1YS1X 2D1SA 2Q7DA 3FF1A 5GMOA 3JAWB 3GJTA 3NUZA 4R1TA 1JG6A 1YBHA 2ASEA 3QSYA 4AT1A 5BRJA 1E3JA 4Y2TA 5LQKA 3F4BA 3ONWA 4ONEA 3DHYA 4HEQA 3ZDBA 3R7FA 1ZESA 2QPAA 4UHCA 1JLRA 2QTBA 1YDEA 3V32A 1CDOA 4CG1A 1NXSA 1YZVA 1R4NB 4RV5A 5DTIA 1F3OA 2JFXA 2HA0A 1XWFA 2GARA 2H9IA 4M6WB 5C34B 4TTQA 2RGNC 5K0LA 1IHOA 3R5SA 4N3GA 4EZIA 1N1DA 1DJNA 3M2TA 4INJA 5JALA 1UKCA 3UH0A 2AR7A 1UBKS 3BSSA 4R3WA 1RM4A 4QFCA 4IM7A 4B83A 1ONNA 2I4TA 5CFNA 1XTJA 4ON9A 1QGAA 4LTNA 2QIPA 5J40A 1TMGE 3LUJA 2QTZA 3L0PA 4LF9B 2O06A 2UUOA 2QGFA 4MP8A 3FSEA 3TIFA 1FDUA 1MMFB 2C78A 2XXBA 3HP1A 2D0DA 1SBCA 1C2YA 1DV2A 1JSLA 3TNJA 1ZOLA 1T6ZA 2FVXA 1Z5PA 2XD9A 3ZGYA 4JJGA 4ZHQB 4NNPA 3ETEA 3FCOA 1D5CA 4N5NA 2PRKA 4QLOA 3BKWA 2I7XA 4KLZA 4KNWA 4L8FA 3OLZA 4GECA 2OPHA 3MJDA 3UUWA 1FP7A 1JLLB 3C41J 4G8JA 4Z9AA 1UWKA 1K5DA 2AYZA 2NNWB 2ZRFA 3IODA 2ZUEA 3SPXA 2J0UA 1N8KA 3TPCA 2HA2A 4QDKA 2IZ5A 5G41A 2XUQA 1U99A 2FG5A 4CDGA 3BG5A 4UBKA 3BH6A 1W88A 5AK4A 1KI6B 3EYAA 3SC4A 2BE7A 4DIUA 1XMJA 1VSQA 2CEAA 3EWSA 5M3BA 3CLKA 2Q0SA 2ZIWB 3JXEA 1UZUA 2JIMA 2YMPA 1NUUA 4TROA 1XU9A 4TYYA 3ZCVA 3G17A 1G3IA 1Z26A 1T6NA 4HDNA 4YJ2B 4YTEA 3CLTD 2IEBA 3KHSA 5AI0A 1CZHA 3LGAA 2EFGA 3CTMA 1I1HA 3I12A 4FHFA 2RCNA 5HEKA 3L4JA 4OM8A 4D3DA 2YOGA 1NAHA 3ORSA 3WGQA 5GOTA 2A6PA 4Y0NA 1B1CA 1P1RA 3LK7A 2WWTA 1FPMA 1OI7A 2DSTA 2GNPA 2GVDC 2PT9A 3D8RA 2GPTA 3LAWA 2Q6OA 3U16A 3EC2A 2ZRHA 1BOFA 4MYSA 3V4ZA 4OY3A 1QGUA 2GBPA 2X40A 2R7LA 2BRUC 3BZWA 1QAQA 2VJBA 4AULA 2EDAA 1MV8A 3OOJA 2B98A 1MO4A 1NVMB 1E6UA 2GJAA 4PG5A 4JQOA 4XFDA 2Q5HA 2ZSEA 2DCUA 3JYNA 4IS2A 4HUQA 4DLZA 2DH5A 2XRYA 3UWDA 2AF3C 3BIFA 3MXTA 4KQXA 3S7ZA 3WV4A 3EFHA 3ZCRA 1XZAA 2G17A 1BVHA 5BW4A 1MH1A 1TRKA 5FA8A 4D5EA 4JXXA 3NB0A 5E4TA 1CUGA 2FQQA 3CBQA 4FZJA 4K3UA 4IHJB 4W82A 4Y8VA 1QR6A 2JH9A 3A37A 3KG2A 1SU8A 4M9UA 5FNZA 1JIIA 4N3CA 4OQPA 1QGZA 5GGYA 1QDLB 1OREA 5BMOA 4N0QA 2CXXA 3OA0A 3M82A 4K3VA 4WSOA 1Z4LA 5DNVA 4ZTUB 4S0XA 1RLMA 4DADA 5TDHA 4AJJA 2NSHA 3HY3A 3HB4X 2ZLBA 1KH2A 5B3AA 4NBWA 3V6LA 4Q48A 4ZDWA 5K0SA 2QQ5A 2QS9A 1V95A 2X0DA 3VTAA 3ZWMA 3QY0A 1EB9A 3ROFA 3E03A 3LUDA 2H00A 2ZR0A 4YP0A 2XE7A 5KYKA 5JBQA 4DIKA 1C30A 1GPNA 1JV2B 1XCMA 2C5FA 2JCSA 2RGXA 1C9JA 4EYOA 1KTIA 3OIWA 2BGJA 1CC1S 3EEBA 3KKLA 1JKXA 3VYVA 4MCHA 4D3SA 1V3QE 4CIWA 3HKDA 1KYZA 4HGNA 4II7A 1PR1A 3PI6A 1TYBE 3NYQA 2HK9A 1T4DA 3PWZA 4UHHA 4DA4A 1YRLA 4HB4A 2EL7A 4OGLA 2B36A 3QITA 2Q2QA 3DWGA 2J6CA 3F71A 3PHJA 2PUJA 1MX1A 1VPLA 3C0KA 3BMCA 1PJSA 3A10A 3TR6A 3R9XA 4KQMA 4PRYA 4WERA 3SS9X 1QV6A 3FCUB 3M49A 4BVEA 4BZXA 4P6VF 3QW4B 4BFYA 3SVZA 3WMRA 3T94A 4C1NA 9MHTA 2GNOA 4H7JA 5DP2A 3RARA 2QRUA 3G8BA 1P75A 3KDSE 4DA0A 3IKLA 1EDBA 1H3EA 4RQAA 3GO4A 3AUYA 2QN6A 3WSVA 2XB4A 3T4UA 2FWIA 3T7SA 4C5AA 4X62B 3DF9A 1HYQA 4O1MA 4FCWA 1Z73A 3LV8A 3GLHA 2GZHA 4EYKA 1P4AA 1TYZA 2ZKIA 3LSTA 1XCBA 3TTYA 3CXUA 3VKUA 2G6TA 1ZR4A 2VRWA 1PDWA 4W8OA 4WGFA 4D4GA 3T3HA 5HKKA 3HU2A 5KPDA 3FPBA 1ACJA 2AMYA 1KSGA 3L8MA 5HKLA 3VVLA 4GX0A 3P32A 4DIMA 4DMFA 1E9AA 3E2IA 1BAPA 3H6KA 3HEBA 3DYIA 1AKUA 1XROA 3A32A 3FCXA 1J0BA 4EW6A 2V9CA 3GNLA 2B7BA 4HJXA 1XVAA 5AVWA 4N0EA 421PA 1ISPA 3HBFA 1ISJA 3ZLUA 3RPEA 3ZUPA 1C1YA 3ON5A 2N3ZA 1BFKA 1R6DA 4D4HA 3LW8A 3GL9A 5LM3A 4EL5A 3I6YA 3VXKA 3U7RA 1UM9B 13PKA 3F8SA 4Q4CA 4RZ3A 1KIAA 4C4XA 1EIWA 2X7XA 4ID3A 4YJGB 3STTA 1ZGJA 3ROQA 1UEXC 3O4VA 2H2AA 4QGGA 3MA0A 1E2MA 2CE2X 2L69A 3KS9A 4V0ME 1RI1A 2XAAA 1FYXA 1JAHA 1E5XA 2DSNA 1BEZA 3OC0A 4NFYA 3KC2A 3ORFA 2FA9A 1QYIA 5J5VA 4OYYA 1DEAA 1YQQA 3F3YA 1X9HA 3EIQA 2YBEA 3QVGA 4G86A 4X1YA 1WETA 2J0SA 1JLHA 1QJ4A 4LRUA 4E70A 1FEZA 1Y5NA 2JAHA 3VHRA 4FZVA 4YA6A 1KEVA 2YIJA 5ESDA 2CBZA 1Y8QB 5ETJA 5C46F 4OLAA 4CE6A 4RTPA 1Z6PA 4YWJA 2QTAA 3OZUA 1DO0A 4Q4HA 4FX5A 4WAUA 1L4MA 1VIYA 1Q1NA 3ZXXA 4X1KB 1ONOA 1KO1A 3NGLA 2VAWA 5ARBA 5BMVB 1MN6A 5BXQC 1SB8A 1G4UR 4D0LB 4LHZA 4PLVA 3KLPX 3IQXA 1SOWA 4HH1A 5J9FA 1GP2A 1Q0RA 1UUFA 3LBIA 4DEVA 1U0NA 1YUBA 3U3RA 3WLSA 2XQJA 3AEUA 4F6RB 3QZUA 4JBHA 2B1QA 1TIKA 3QY9A 2ZGVA 3L46A 4DNOA 2PJZA 1M2JA 5T3YA 1QC5B 3U2QA 3ZV6A 1RM5A 2L0XA 2XY4A 3I6QA 4UPVA 3U4GA 2VA8A 3P9RA 4BAZA 3LT2A 4LXHA 1XG5A 3SY8A 1D2RA 4RK5A 2QMUA 4B6FA 2JGKA 1Z18A 2FYTA 4C43A 3GFRA 1JSCA 4K6OA 3OTQA 2IYQA 2WTBA 3T7JA 2H9YA 3AFGA 1K8RA 4UUMA 1X7XA 4BV2A 3REQB 1LFAA 1P9LA 5IDVA 1H3FA 3SGLA 2WWIA 3TF5A 2GQ0A 2IEAA 2Z9DA 3KSZO 5BN3B 1NJ1A 3ZOZA 4EG5A 1UK7A 1WY5A 2VUHB 4KVZA 2VDWA 1EX1A 4TYQA 3IAXA 3ABRB 3V1NA 1JFSA 1ZA2A 2P2CA 3MJTA 2O52A 3G2OA 2O3QA 1EK0A 1RKXA 3DO5A 3ZBQA 4H7FA 1WBBA 3LT4A 3HCWA 4KPYA 1J9ZA 4ZP1A 2H0QA 1FX1A 4YJ2A 1F6WA 4DIEA 1J06A 1QZ3A 3SBOA 4EH1A 2RIRA 2VT2A 1WOMA 1DQNA 1ZL2A 2ZVJA 1PWYE 4WFQA 4N0DA 5CH5A 3SEQA 3GPBA 2NXEA 1VLQA 2WQZA 2AN5A 2I4OA 1G59A 1E5DA 3L93A 2SKDA 2JCBA 3DKIA 3DOUA 1T6XA 1AGXA 2BM9A 2VRCD 2IW1A 4RADA 2AFIE 5F64A 4NJMB 4HWGA 4D4LA 1XNHA 1G1MA 3T3GA 1ADJA 2M98A 1NVKA 4GNKA 4A15A 2Q7XA 4OHKA 3UWSA 2WPDD 3OTHA 3L02A 2ACVA 1OBHA 2R97A 1LK0A 5ERYA 1EWQA 2VSFA 2VDPB 5D7BA 3RTAA 1WF6A 4FFNA 5BN5B 1MORA 3RWMB 3D3JA 3I2IA 4E2FA 3GXBA 3RC1A 3X1WA 5LMCA 1E2KA 1VPDA 1ZH2A 3S3TA 2W00A 3ZY4A 3V4RA 5I51A 1EAMA 2NZJA 1E3QA 3HJAA 4AFNA 3QUAA 5GJBA 1ZGCA 4X5OA 1COWD 1E89A 1OAOA 3PYLA 4YMLA 2P65A 3EVGA 1O3YA 1LLFA 1T2UA 3P9KA 3QVMA 4INPA 4NNJA 3U48A 3W8EA 3LU1A 2IS4A 1R4MB 3FMPB 4X61A 4XTCS 1NA5A 3WRXA 4BBZA 2PX3A 4LDAA 3ZZ0A 4EO7A 1Z75A 3G68A 2QBYB 3EDYA 4TZKA 2V58A 3HG7A 4ARAA 2ZI4A 2NWQA 3MT0A 2CUNA 1BD4A 3OI7A 2VZEA 3QVJA 4LYJA 1SZPA 5KI6A 2CT8A 1RXWA 1QAMA 4FSDA 4V0NA 2Y3IA 4DEYA 1RQPA 1YD7A 4HAOA 4WLFA 1DCMA 1FA9A 3V8RA 2PUDA 4JI4B 4JWTA 1I5EA 4KX5A 1KZHA 5KWIA 2XWQA 4MVXA 1CDEA 4OI2A 5B1YA 1JBEA 4TV9B 4WA8A 4BNDA 2AJBA 3DW1X 5LR6A 5L3SA 2QB5A 4NULA 1DINA 4MIYA 1Z88A 2G76A 2HJWA 4HTAA 4CM9D 2GKSA 5HMMA 3FI9A 5AM0A 2AH5A 1NW4A 2IP2A 4Z2AA 1RYEA 3FROA 1L7EA 4QRIA 3KYCA 4ER6A 2J08A 1I3MA 2XUZA 3L0ZA 3X2EA 2F9MA 2IL1A 1E2EA 2DE0X 2GN4A 1J23A 2E21A 3C48A 4JBYA 3SR4A 1W7AA 4CKYA 4GEKA 2TMKA 1IM5A 3EUFA 1MO6A 1SVIA 4GPEA 5H68A 3LKVA 4ZYZA 3WADA 1EVYA 1WTCA 2PMCA 1E94E 3BS4A 4GGPA 4HXYA 4U7GA 2BGIA 4YRAA 3O8DA 1QHEA 4LWPA 1ZNXA 1NRXA 2QR3A 4YPVA 1H4SA 4Y2VA 1R6AA 4JGIA 1Q0SA 4MKHA 4LJ7A 1R8SA 1HNZB 1U28A 2R25B 1FXSA 1LFDB 2CF6A 3LWDA 2OPBA 2QLTA 4MW1A 5ALRA 3ZCUA 3P8ZA 4CMJA 1TADA 3GGDA 5CD1A 2D5IA 2Q5CA 2JLAA 1OFIA 2CMGA 5CXSA 1S8NA 2YV1A 3UMCA 3BH0A 4RZXA 3QVUA 3PI7A 1XU7A 4GUAA 3LTNC 1N3LA 1SR8A 4RXTA 3EVBA 3TD9A 1OLUB 1SM4A 1ZD1A 4HAZA 1N2XA 1KQNA 4YV0A 2ZT6A 3UJCA 2O8EB 1KDPA 5BVGB 1ZZEA 3EG9B 3SAJA 4KK3A 4M1MA 3WGTA 1C1DA 5B2ZA 4P5PA 2HKIA 4U5XA 4BO1A 4ETIA 2EFCB 5CDFA 1T0IA 4PCLA 4JLNA 4H08A 3AVWA 4Q3BA 4FFVA 3MN1A 2G1AA 5CBPB 3ETGA 3AWIA 4I2NA 2M6LA 1X6VA 2V9PA 2WIJA 2Y27A 1WU8A 3B3AA 2LPMA 2Z2ZA 3NOOA 1E7WA 1GPKA 5IKMA 3SJZA 3AJDA 3ZD9A 5FPSA 4HNQA 2ZYIA 4FK8A 4LAFA 2F9FA 1EFAA 1O0CA 1KEPA 2YINC 1RE1A 1PLJA 2Z8ZA 3ND7A 4ZVPA 9LDTA 1WPXA 3NV9A 4OQZA 3WFZA 4BFSA 1KPGA 4WXYB 1YZTA 3I01A 2C96A 3CONA 1KO8A 3QMWA 1P7WA 1RPJA 3AKCA 4M49A 2GPWA 4YYZA 3ZK7A 3NEJA 4W5QA 3OX4A 2SICE 4WKPA 4I55A 1Y1LA 4C2BA 1CJVC 2AOTA 2H4YA 2ARKA 3CIOA 5AM1A 3ZJ5A 4MYHA 4RZQA 1KU6A 1NSFA 3K31A 3P0JA 5D5PA 4UNRA 1Z4KA 2GN1A 3GV0A 5FO0A 5A9SA 4G41A 4QUGA 3HXPA 5AJVB 5K3SA 3WNDA 3BCRA 3V42A 1G7CA 4PYMA 3I61A 4ZOCA 2JW5A 4BN4A 3FETA 4ZZ2A 2IC5A 1U6JA 1XRLA 4LVCA 2PSHA 5JZOA 2RHCA 4TLDA 4OBEA 3TCNA 2IKQA 2XUHA 3BJEA 2DY0A 4RKEA 4EDHA 1LF5A 2XWBF 1SOMA 1XU4A 2IPAB 2ZSHA 1KI8A 1O08A 1VL5A 5HFJA 4FFLA 1UMDA 4BTLA 2XMSA 2ZJZA 3SE7A 3BMXA 4OHZA 1Q50A 4ZJPA 4H1UA 1V7CA 2R6JA 4CBVA 1B2RA 4U3JA 4YROA 3TLKA 4XQ9A 2MSCB 1GNSA 1GEGA 1FP2A 2Y1CA 4P5EA 2EFHB 5JTTA 1UPUA 2C1XA 4IWXA 2C5BA 3OTGA 3AUTA 4PE5B 5I9NA 1X7XB 3SIWA 3UKDA 5JSKA 1PT9A 3VJMA 5A6VA 1CNFA 1DWPA 1SULA 3LOPA 3QK7A 4WUTA 4YRQA 1CEEA 1J0AA 4AWAA 3TVYA 3UXEA 1EHIA 4ED9A 4HMOA 4BQFA 1ESNA 1U31A 2V98A 1Z15A 2A35A 1BNCA 1BJRE 2G4VA 3OOHA 3UJ8A 4GX5A 4FEAA 5FPHA 3QKSA 2VJLA 3P19A 4MS1A 3ZU4A 4W7SA 2OK7A 3IEUA 1OXUA 4TS1A 2PWAA 5ENVA 1MGPA 1X3LA 5FBQB 3JVEA 3HO8A 1OA1A 5LA6B 4HS9A 4DLBA 1UZLA 1JPJA 1YHZA 1SY7A 4CQLB 4ZICA 4NVRA 4XOUA 5ITZA 3AIKA 3N2YA 1UQRA 2GBIA 4W1PA 3RVQA 5D3MA 3VVCA 5CB4A 1SCUA 2R68A 2PX6A 5ALJA 4TV8F 2XITA 3DE0X 3VAYA 3Q15C 1CY7A 4KLCA 4QJIA 4W8GA 5F52A 2ADMA 2A0YA 3HB7A 3KQWA 2VA9A 4M1ZA 2F7SA 1GA6A 1PR2A 4LCJA 4W8HA 5FR1A 4DLLA 1WDWB 1EBBA 1YZFA 4QG3A 1ID1A 2SKCA 8ATCA 1U1EA 2UXBB 4CLRA 2E5WA 4NP6A 1G9SA 4TKZA 1P60A 4R1MA 5DM70 2G8LA 4G9EA 2LBPA 1F3LA 3MMZA 2VBFA 1THGA 3CLSC 5BVHB 1WB6A 3UFBA 4JBNA 3IGFA 4MVCA 5AVQA 4K6GA 4I5EA 4QEZA 4GI1A 3EQ2A 4MV6A 5JRZA 1OTXA 3S4YA 4F2GA 4AJ1A 1NW6A 3VO9A 4P4LA 4AD8A 3NDJA 5EE5B 2PM8A 1Q22A 1QO0A 3Q3JB 4V0KA 4K9MA 4PFKA 1DO2A 5TF4A 3FYHA 1KYIA 3SVTA 4FN5A 1JS1X 2YWHA 3ER6A 2H8KA 2PZJA 3H1FA 2AZ4A 1AZTA 1IK6A 2XW6A 3B9QA 3CIFA 3ANMA 2HLDD 4DMCA 4E88A 2JJMA 1PQWA 4CTOA 1CQWA 4FLMA 1N2CB 3T61A 3AP3A 3WLRA 2E4UA 2W0MA 3O6VA 3W5SA 4L8GA 2F3SA 5ITVA 1AIPA 4QD3A 3A4NA 4AN4A 3L82B 1F2UB 2MSKA 4DPMA 1RYZA 1ABFA 3GQBB 3T1NA 3TNLA 4TWIA 5EWLB 1KH3A 4MS4B 4NCHA 1FTQA 2OB2A 3Q8WA 2IPLA 1Q2UA 4NABA 2ODNA 4PIVA 4QNNA 3AXSA 4OB6A 4HWTA 3P2IA 4YLGA 2XKJE 3RBVA 1J00A 3ZPXA 4BO3A 4MYDA 5K45A 3FFWA 2RGAA 4OF4A 1QCCA 2P7IA 3TMAA 5K3EA 3TFQA 5AR1A 2C94A 4UNIA 2PUWA 3E35A 2IP4A 2IY8A 3IS3A 1Q21A 3KZNA 5TNXA 3U3DA 4EY7A 4HVLA 1WM1A 1O57A 5HQ3A 3OOYA 1M6VB 1RTKA 1PV2A 1DC8A 2R6HA 4L72A 4OUDB 4CM9A 1NHGA 2DOKA 1GPWB 1VL0A 221PA 3D6NB 4RDHA 3VH4A 4EEKA 5C8DA 4BX8A 1RWPA 4G4JA 2PSFA 2Q50A 2VNAA 1U94A 4O02B 1L5WA 2QZ9A 2KWIA 3O4JA 4J4HA 3BRWD 4URXR 2QL5A 4PVCA 2G36A 3PQ3A 2YVUA 3QFSA 1TECE 2WIGA 3SF8A 2OCGA 2NG1A 2CKMA 3R5HA 2FKAA 2NXNA 3RRNA 1ZZGA 2BC9A 1YE3A 1ZGGA 3D1VA 4J29A 4WLEA 3DKKA 1MOZA 3FOBA 3GAZA 1JR6A 1JSXA 4DUYB 2UV8A 2XEXA 2J6BA 2J3HA 3QVKA 3VDQA 1ZHOA 3PXGA 2R4UA 2EW2A 4Q1AA 4Y7CA 4CZ2A 2H16A 2Z3VA 4RVDA 4D8TA 2O8EA 1V5WA 3AEQB 4HUQB 1PG2A 5KAMA 2HQSA 3UXMA 4BTVA 2VDVE 3M4XA 4MVJP 2RI1A 4C6TA 2PJDA 2WZDA 5K0FA 2Q8QA 2NVUA 3EZXA 3VNUA 4AG6A 3QOFA 1RI2A 3E2PA 3KKOA 4HRYA 4R7GA 3RF6A 2CNLA 4MXDA 1E62A 4P7JA 1RZUA 5HX7A 2FTKE 4ZOLF 5IYZB 1E2HA 3N9IA 1QVZA 2XNJA 4YP7A 3ZY2A 4CV1A 4W5WA 3ANSA 3ZH2A 4CWAA 2KQUA 5C7IO 4YP5A 2VYND 3WRVA 3ZWNA 2VKQA 2W43A 5JQGA 1GPYA 4Q21A 3D6FA 1RYMA 2XYPA 5KYTA 1Q1QA 2PWPA 5TT0A 3U4CA 1HT0A 4R68A 3NWOA 1N3YA 1V45E 4A3SA 2WE7A 3NDPA 3C6KA 4WI1A 2WJYA 4YONB 2JDID 1C14A 2JNWA 1JJAA 4R54A 2IHTA 3HXQA 1Q0TA 1EM6A 1QK5A 4ZOQI 1TKRA 4QTUB 1FDTA 3V97A 1W9HA 1GITA 5EIOA 5GPBA 1E9VA 3GEBA 2PD3A 2ZTUA 3PVZA 4NBLA 2XADA 3HKDB 1W5AA 4KVFA 4JX9A 2IBMA 3K9LA 1A7UA 1MRNA 4E5DA 2J4FA 3EJ6A 4IFBA 4BCCA 4DQLA 5CITA 1X80A 4IJWA 2A1UB 3FOWA 2R65A 2XB8A 3FMGA 3I1YA 3DV9A 4YCDA 1GKUB 4KJZA 5BT9A 1U8YA 5LOVB 1VG1A 2JL1A 2FG6C 1KEZA 2HNKA 2IYZA 2ZRAA 1QV7A 2QPOA 1W76A 3U37A 3HCCA 1YHYA 3GP3A 3VSBA 4E0BA 2HHJA 4X90A 4KDCA 3RANA 1GN8A 2MMGA 3RJMA 5B58C 4LHYA 4GWKA 1Q84A 4KGVA 3UJ7A 3FTQA 1U0JA 4TMVA 1QTRA 2EWMA 1DQPA 5ALOA 4N47A 4RTJA 4W1SA 1OOEA 3NEYA 3PUKA 1JDPA 3MB5A 4Q37A 5GV7A 3V4SA 4F4DA 5FOQA 5AUPB 2E4YA 2OY0A 2PKCA 4UMFA 1N2JA 2AK2A 2UVQA 4E6EA 3A2NA 3U39A 3QIVA 2AQIA 2DRIA 2P30A 2V7GA 3ZBUA 4EG3A 2RCYA 3ZBTA 3TZ6A 3CH5A 4QYIA 4BNNA 4HDRA 4KQ2A 1H1LB 4JEIA 5EZ6B 2NU8A 4NK5A 5F23A 3MHTA 3RC3A 4GH5A 5ICEA 4BJHB 2XZPA 5KKAA 1U7HA 5LP6B 2G9VA 3CH7A 4X92A 4BFTA 4RF2A 4U9UA 2I66A 2QRVA 1JLKA 4UUQA 1JEJA 5AM2A 1GPMA 2ZRBA 4LHXA 1KZ9A 1QYDA 4DR5B 2EQAA 1E6MA 3N7TA 5L45A 1S8FA 2NSYA 3ABSB 3KPUA 1RHQA 1FZQA 5AUNB 1ISFA 1XD9A 2BP7B 2OZLA 1C8KA 2UZIR 3H6GA 1Z3CA 4H7PA 4LRXA 4N7JA 1N32B 1E77A 1G6HA 4TZTA 1Q0HA 4O0LA 3HJNA 3IUPA 3WE7A 4BQNA 5BV8A 2HU5A 2O3JA 4DS3A 3IUEA 1TM3E 2QD4A 1A97A 5M04A 1T9DA 1MB3A 2VT3A 4NBRA 1N2IA 2ODTX 3OM8A 1OVMA 4B5LA 3B8HA 1USWA 1NXPA 3IIKA 1PL6A 5KYGA 3JQ9C 1YTUA 3UHOA 1FSZA 1Y7IA 3R7BA 3RIYA 3CNBA 2Z2JA 1ZNWA 4LHEA 5BMVA 2QTGA 3LQQA 3MWKA 4UXHA 3B89A 5E6UB 4EJ6A 3DCNA 1A77A 1TVMA 1XNGA 2OLJA 5HRCA 2JARA 1J22A 1M1YA 3P96A 1VA4A 3E22B 3A4MA 1A27A 1L5MA 4N3BA 4F6RA 1KMQA 2Z5LA 2IYXA 3EXFB 3HL4A 4IV0A 5BSEA 5IUNC 4QDOA 1EGMB 4FS3A 3LQ2A 4I36A 2E6UX 4CF6A 3RSOA 4AJ4A 2OAP1 3ES9A 4AF6A 4DRXA 3EA5A 4P3XA 2B30A 4DRZA 1LSJA 3KPJA 3EGDA 4MQBA 4QUEA 4CN9A 1KEEA 4YMTA 5F3WB 5AVOA 4WZAA 5BPFA 3NGXA 2OFFA 2JFFA 1NL3A 3C6MA 2WUWE 3R3VA 4MIOA 3DE4X 4FDLA 1N2BA 3OQVA 3S81A 3HM2A 3K09C 5BN3A 2X3YA 4E2ZA 3IP8A 1A71A 4Q12A 4JELA 1W96A 5H3HA 2HRBA 2EERA 1IL0A 2R6DA 3WBJA 1C1XB 1KJYA 2ERCA 1L7AA 4HXGA 1HSZA 2ZTVA 1V2GA 3RTCA 3FYUC 3IT0A 1PAUA 2OXFA 3GEMA 1SVMA 2GCIA 2Y1XA 2ZTMA 4ND3A 4D41A 4DGSA 1WCV1 1XWIA 3C97A 5KHLB 1UC8A 3WNCA 2Z6QA 4IJUA 1XZEA 2YIDA 4KGZA 3AEXA 1SOVA 3GEDA 2AB0A 3NAGA 5FAXA 1H0SA 2AFVA 3EULA 3STHA 2IZZA 4B2YA 4OJMX 4YFYA 1I7NA 3UXYA 2O8DA 3QKWA 4K9LA 2CLKB 3MF4A 3S2IA 1UBFA 5FLEX 4BVJA 3SBXA 1Y8RB 4B3HA 1XQ9A 2A5DA 2BPOA 2PQ6A 3H1TA 5CA0A 3WZLA 2WDZA 3ZGNA 4HTFA 4TT3D 5DLYA 5IHPA 4B47A 1LRLA 3RS0A 5FCDA 4JU8A 5DH9A 2OD2A 1NSYA 2ZSJA 4BO7A 2HIAA 3ZHUA 1NMZA 2EIHA 3O2SB 4IAOA 1CS4C 1CQXA 2H2IA 3Q9LA 4F3CA 1JI0A 3EMKA 3ZI7A 4GKVA 4J4TA 3TSWA 3RG8A 3QENA 1TF5A 4JBWA 1D1QA 1P4SA 3KQOA 1JKJB 3QJGA 4CMGA 4Q66C 4F5DA 5FTNA 2QRPA 1XCGB 2E82A 3QUQA 1J39A 1LBTA 1A9XB 1T1JA 1UODA 3GFVA 1TTTA 4JR2A 4NCIA 4DXAA 4AY6A 4Z7JA 4AY2A 4HNSA 3PYXA 4BNZA 2CUZA 4BO5A 4X97A 2D6FA 2PH7A 3IP1A 4OIFA 2X76A 4HVAA 2C58A 4PAWA 3DDWA 1E7YA 1M6EX 1RBMA 2Z95A 3O03A 5THXA 5B6JA 3BX1A 3DBHB 1PTKA 4NMWA 2EG9A 1SQ0A 1DIAA 4QFMA 3PS9A 4CETA 1I6LA 3GMDA 2WB2A 4F3NA 5G0UA 5LB2A 5MFZA 1WQ3A 3VV2A 1OT3A 1BCSB 3NDRA 1H23A 2AXNA 2EGGA 1PUIA 2E1PA 3KX2A 3WA7A 2GXAA 1I2BA 2VTVA 1P33A 2V7UA 2ZJ0A 1MEJA 3ESZA 1T0PA 4BTEA 3EY4A 3KKNA 4NBVA 1XPUA 2ZUBA 3OIYA 2M6KA 2W37A 3LPNA 2GJ4A 3VI4B 4BNDB 5BQ5A 1M7BA 1OBCA 2V3VA 2ZQYA 1XDWA 3TMYA 5P8WA 3HBNA 4IDHA 2EGHA 3WLHA 2CYBA 5BWBA 2D1YA 4DSAA 3B6ZA 3K70B 1HF3A 3AT1A 3LUBA 3DTVD 3Q8MA 1ZH6A 1BZYA 2QG6A 3SX2A 4EYSA 2CYCA 4JUDX 4JSYA 5H83A 4ZDJA 3WGJA 5K03A 3B1FA 3NBUA 3RFXA 3GDGA 5CRIA 1UBNA 3WMXA 2TYSB 5M34A 4MHTA 1DDGA 1IWOA 3VDNB 4Z51A 1VL6A 1NMEA 3H0CA 1HQYE 3RHZA 1SCAA 1IVYA 4EKDA 3R6WA 4AKIA 4JWKA 3IR6A 4L76A 3LOQA 5AI8A 3CX8A 4FW8A 4OFZA 1RCUA 2YTZA 3CRMA 5E1DA 1CULC 3SR3A 1L5QA 2W2VA 5JWOA 1GQSA 2D00A 1IRIA 3C45A 1BXRA 4B44A 4D3FA 5BXYA 2C7BA 5IT5A 3PR3A 4BEWA 1XK7A 3TQTA 5DN6D 5JFTA 3KSMA 4IVNA 2ZR8A 4BUZA 3ROEA 3KVVA 1I6WA 3PPXA 1EPUA 3SFZA 2FZGA 1GG9A 1BXKA 2YYAA 3WLQA 4KODA 1DSSG 3OUUA 3EG9A 4CODB 5DYYA 2P9HA 2XB6A 4IQ4A 4NU5A 4P3PA 4P36A 1JDBB 1ODJA 2CHFA 3ORHA 4HNAA 4DLAA 3ABIA 5E38A 2BGTA 3SHVA 3TAXA 1KMNA 1T6BY 1Z0FA 2O2ZA 2Z3ZA 4LS3A 1Z2CA 2NO5A 1NPYA 1LBIA 1NHWA 3HCRA 4R71A 4E14A 1YBAA 3VJRA 2CXNA 3QYAA 4XIYA 4IYJA 4EZBA 1VXOA 3AB8A 4Y6QA 4BEBA 3RRBA 1B2LA 4MRMA 1RKQA 4ZPJA 4A8JB 5MN6A 2FPGA 3NHUA 3O1IC 3J7AC 2QD5A 3EVDA 4GR4A 5KTOA 1EXWA 1K0UA 2JCXA 3BEDA 5KSWB 2HA5A 7ADHA 4J0QA 1SXIA 3GCDA 3OCUA 4A0QA 4KREA 1KSJA 1EU1A 4IGIA 2JFNA 1KQOA 3HV0A 3IAM1 2HH9A 4HDMB 1SOUA 4Z0TA 3RJ5A 3VOAA 3OF2A 3GRPA 2X4LA 2NW6A 4OBWA 5JD6A 1JPVA 3G5AA 4R7ZA 2BTEA 4CTJA 1EJ6A 2J07A 2QM3A 3DDOA 4ID9A 4L0MA 3NJ4A 4P83A 3DZFA 4K9QA 4NG5A 4F2DA 2CBGA 2D7DA 2O7SA 4C3OB 3WFIA 5DGHA 3PBKA 3H05A 4Z9XA 3ELWA 1M7HA 3KAQA 1Z07A 1QVAA 3LA6A 3O94A 4BE7B 3NFYA 1R00A 4EI9A 4YRFA 5A4JA 4RQBA 4AXXA 1NG1A 2GDZA 1FNSA 4DV3B 3GUYA 4JOSA 2PUEA 2A84A 4AC9A 3QBEA 2LDBA 3PYMA 5LD2B 3T1TA 3KFXA 2YXBA 3P26A 3KTDA 1E0SA 4FZ5A 3V4OA 4MR9A 3WI7A 2P79A 2I8AA 5FF9A 5TQVA 4RELA 2C2BA 1Y5IA 1TK2A 1ZK2A 3DCYA 3C43A 3H04A 5ELMA 4DHWA 4F60A 2BFCB 2VP3A 4JH0A 5LDDC 2A9OA 1VB5A 3DBVO 1QIMA 1Y6QA 2VTEA 4P54A 4R9RA 4E11A 2F4NA 4F3TA 2Q3LA 1XLTC 2R2GA 2SHKA 4PHGA 5EL0A 3G0CA 2DHRA 1K3FA 5LBTA 1JFTA 2IX9A 3CLSD 5IHXA 1IN8A 4HLQB 3SM9A 4GXRA 5K2MA 2IHYA 3ND6A 1Z5UA 3VAAA 5KVQA 3IC5A 3WLJA 5E1BA 2IEYA 3BB4A 4GE0A 3VHQA 4CFSA 3OEEA 4DG8A 2QT0A 1JE0A 3ZX4A 3LBAA 2A9RA 3IR7A 1URPA 3RHTA 1N7HA 1WKVA 1FYEA 2EKBA 1E4VA 4IGKA 5DNWA 1OV6A 5SYNA 1X7YB 3ZGVA 1NJSA 2WJIA 1U11A 1U2GA 4X71A 3CVUA 1BW9B 3PX3A 3FJYA 3UMVA 1FDSA 2ISQA 4GRDA 3SIRA 4TTTS 4OHUA 4M83A 2GESA 1Y1SA 5BW5A 2A9KA 1W0JA 2A9JA 4BZWA 1U3CA 2B4TO 4HTFB 2Y9PB 4BLSA 4LYEA 3U56A 3D0KA 2GUGA 3WOVA 4J03A 1Y3HA 4QODA 3RS7A 3T3EA 3UY4A 5M7EA 1Y6JA 3WL5A 3AW9A 3KZCA 4EGFA 4R4JA 1MCZA 1HT2E 2WNHA 1N78A 4I46A 3KUDA 4U2GA 1XR3A 4LOAA 3AHIA 5G0WA 4Q9HA 5LSAA 2GFHA 5E7IA 4C04A 3ICVA 4X54A 2G67A 4JODA 4YJFB 1CUWA 4K9OA 4EG8A 1KKUA 3NETA 2QVYX 3VU9A 3ZD8A 1Q3KA 2BFFB 3MFQA 2QAGB 3V1TC 4S3MA 3BJIC 3IUQA 4MCJA 2O7RA 3E18A 3BXOA 4Q3KA 2Z8XA 3OTIA 4DRYA 1MC8A 1JJFA 1XDDA 2RARA 2UUPA 1WE2A 1DWOA 3JU3A 4G1EB 4IIGA 5AK5A 3ZEIA 1IBLB 4RQTA 4J90A 4WN9B 2YJ6A 3OUZA 5LN1A 3H99A 3N8HA 1LRKA 2GA8A 4A8PA 3EVZA 4CNBA 5HJEA 4HLCA 3MTBA 1QE3A 3HLTA 1SWVA 2K7FA 1T5BA 1DKNA 1UBMS 3ME5A 1E2GA 4RD0A 1MHTA 3K0FA 2COUA 3QBDA 2ZQZA 2HI0A 3ND8A 4WCFC 1N2OA 2D5AA 1YFLA 1CIPA 5D3KA 1USVA 3FYDA 1E3SA 3LF2A 3VNSA 4YJ2F 1ES9A