2BCGY

Structure of doubly prenylated ypt1:gdi complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 66
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bcgY00
1UKYA 2ODWA 4GL2A 1XWIA 2H8KA 2HJGA 4UXJA 4GOXA 4KO8A 4B6FA 2BCGY 4LUCA 4TMKA 3K09C 3SR0A 3TGPA 1QHIA 3ZS8A 1WDTA 3D7MA 1TF2A 1LFDB 1FP6A 3D31A 4P4UA 3THXB 2ZI3A 3DMNA 4U02A 5CIQA 3BS4A 2JCSA 4II7A 2QSYA 2EFDB 2GF9A 5FOWA 2F55A 2C2HA 2PL3A 2QSZA 3WP1B 4AYWA 2ZS7A 3AF1A 5EP4A 5L3VA 5E3HA 4N0DA 4KFRA 4KU4A 1KI2A 4BECA 3RRMA 1JEEA 3V9PA 1AA9A 4Q1BA 2ANCA 4N0EA 3VKHA 3NBXX 5AUPB 5DIFA 2EFCB 5KHOC 2CDNA 4Q4AA 2DFNA 3R9WA 2H1LA 3AVYA 4A36A 4CZ2A 4LV6A 3U2QA 3EWSA 4NCHA 2CK3A 2Z43A 1NN3A 1X3SA 3UANA 3GLGB 1HEIA 1NIJA 4FCWA 3RS5A 3ICQB 1CP2A 3M0EA 2RGXA 3AF2A 3TQFA 1E1QD 3CLVA 4M1YA 1KO1A 2LWIA 2GRJA 1QHXA 3GLIE 5LB2A 5JS8A 1L8QA 1SVWA 1N6KA 2D2FA 1YR8A 2P6NA 3H1TA 4LHWA 4PC1A 4Q21A 2O8DA 2RHDA 3CRW1 5CITA 2CLSA 1RVDA 1HTWA 2GCOB 2WPDA 4IOJA 4DCSA 2QQEA 3A1TA 2YWHA 5HZKA 4Q7JB 3U4QA 4D80A 2O8BA 1GKYA 2NTYC 4YMVA 1CU1A 1EWQA 1S4QA 3SZRA 4WBSA 2O8CB 1VYTA 1KK1A 2CE2X 2EYQA 2ZU6A 4QC2A 2DFTA 1W0JA 2ZI7A 3LXRA 1DO0A 3QXSA 2J87A 4WA7A 2R6DA 4KBGA 5HKKD 1AM4D 4GMDA 3TH5A 3B1VA 3WXMA 3NBZC 2GXAA 1A2KC 2F1JA 4MRRA 3VKWA 4HAXA 2KBEA 2J0SA 1T0JB 5J4KA 2AD1A 2F9LA 2J1LA 2J5XA 2HYDA 2VHUA 4L4UA 1MKYA 1VCNA 3B78A 4BLPA 2NGRA 3V4FA 2QI9C 4Z51A 3FVQA 4P33A 1M7GA 4V0LA 4TMXA 3U7HB 1J2JA 2GNOA 3OESA 3ZZUA 1ZM7A 1SVKA 4NCKA 2RMKA 1CR4A 2Q9CA 4URXR 1KOFA 3KB1A 1QRAA 4DDTA 4C0JA 2IYRA 2FSFA 3BD9A 3WRXC 4C0QC 4M21A 2B6HA 3L0SA 3TW8B 1KI9A 4KFUA 4KYIB 1T6NA 3IEVA 2ZXUA 4PSAA 2DB3A 3TSZA 1N0VC 2R62A 4LBZA 4QNMA 5E7JA 2QP9X 1G4AE 1FX0A 1F6BA 2OV2A 3U7EB 5DI9A 2QY9A 2NO0A 3EAQA 3G82C 2XZLA 1ZVQA 1N0WA 5IDVA 1UBEA 5IT5A 2WVJA 2FSGA 2ZRDA 5H8WA 1SVLA 4JBYA 1AS3A 2IC5A 2WJVA 1XTIA 3IDQA 3QKTA 2IL1A 3PJRA 4DT1B 2G1KA 4R9UC 2IS4A 4B76A 4LBVA 1EFTA 3KKOA 3LW8A 2VP4A 1BS1A 2W2TA 1DE0A 4GFDA 1R5BA 3W8RA 4AC9A 3VNUA 1N5LA 2IK8A 2PMKA 1YRAA 3T5GA 1ETUA 5JSZB 4YXWD 3P32A 2FA9A 1RW4A 3Q3JB 5TV2A 4OI1A 4Q48A 2XJ4A 3FE2A 1E2QA 1E32A 2PX3A 1R8QA 3RYTC 4XTRA 1M74A 1S1MA 1P7CA 2A78A 1BMFA 1XX6A 4PHGA 1TPZA 3NXSA 1OH6A 1S8FA 4HDOB 3NHAA 1G6HA 1DVRA 4S35A 3RC3A 1G1MA 2DY1A 3ZVLA 3N70A 4PAMA 3U7GA 3KTAA 1CJVC 1Y63A 1YZUA 2CVFA 2J7PA 3K9LA 4K8OA 4M22A 3AUYA 3I61A 4M1KA 5HCIA 3ICEA 2BEJA 1FFHA 2FPLA 2YVUA 1VG1A 4CEIB 1W48A 5G3YA 1JR3D 4AD8A 2ZUDA 1JR3E 3I3SR 1Z47A 2D7CA 1EGAA 4ZDWA 1ZINA 3TLXA 4D4KA 3T1QA 4ZDJA 3EARA 2ZETA 1A2BA 4V03A 5TB5A 3MLEA 5FTMA 1DAGA 3I92A 4JLMA 2WSMA 2WOOA 3T61A 1U9IC 3QG5A 1F3OA 1LB1B 5FFMA 1KI4A 5IK2D 1IM2A 1IOZA 2X8AA 2ZJ8A 3BFKA 4AKEA 1G3UA 4TTPA 2F3RA 3EPKA 1WQ1R 4P31A 2BM1A 2ZRJA 2RGNC 4OQNA 3HPRA 1OT3A 1JALA 3R9IA 1ZNZA 3I4LA 5IF9A 2K5UA 1D9ZA 5C46F 2VTKA 1DG3A 4Q7KA 3U44B 3BAFA 1Q21A 3OE7A 1M6NA 3O8CA 3H2YA 5CLQA 3EA5A 1Q57A 1SVIA 3K0FA 1KZGB 1P6XA 3U3KA 1DELA 4LK2A 4PANA 1T4GA 2O0KA 4MRSA 2EFGA 2F7SA 2GBLA 2VYFA 3U3JA 4Y0AA 3WP0A 3NEJA 3L0IB 2RB4A 3BOSA 2V6IA 1GIAA 2P67A 3SHWA 1O3YA 1F60A 1W0KA 1IHUA 4XTCS 3RABA 2X2EA 4TN1A 5AWFC 2OG2A 2F9MA 4PQYA 5KSYA 3TUZC 1UBFA 2JEOA 3K9GA 4DB2A 2JLQA 1Q20A 3OIVA 2OBMA 4QGAA 2OSBA 3BH7A 4JVNA 4IDNA 4C7OA 1P61B 5KDLA 4ZCIA 1G7RA 2WJYA 3AKYA 5M04A 4OHZA 3ECCA 2ZRIA 2J41A 4EPTA 4BLSA 3F3YA 3PUXA 4LBWA 2PCJA 1HV8A 2J0UA 1WE2A 2QAGA 3KXKA 3FOZA 1OFHA 2CLDX 4MGIR 3BC1A 4MRPA 1H8EA 2EFHB 2VP9A 2Z83A 4IW3B 1JXMA 1E9DA 1N6LA 1WA5A 3KX2A 4LWZA 5B30A 2QG6A 3U61B 2OUKA 5JWRA 2NPIA 3Q85A 4D0GA 3W6PA 4DC9A 2VSXA 5FPTA 4IDHA 4NYIR 4JVLA 1NL3A 2REOA 4Q19A 2ORIA 4QBIA 1HE1C 2QGZA 2W6ID 4Q1DA 4DCVA 2DCUA 3K9HA 4C2TA 3K53A 3LVRE 5J4HA 4QG7A 4EJSC 3V4RA 1ZIOA 4MGYR 5GVRA 1NJFA 3PUYA 3U6KA 4JVMA 2OT3B 1EESA 4JZKA 1E2FA 3QIAA 1ESMA 4B44A 4ZCLA 1N5JA 1NLZA 5D3QA 2A5YB 2D74A 3GJ7A 4IFBA 5KOYA 2VEDA 2VHCA 3TBKA 4MQBA 5FUWA 4DLVA 4E5UA 2BBTA 2AD5A 2X19A 4AKIA 2VF8A 4LHVA 1PUJA 721PA 3WMFA 4WIAA 1FW6A 3N2IA 3K0AA 1YKSA 1GOTA 3C16C 1US8A 5CYOA 1YU9A 1ZU4A 4YMWA 1GKUB 2GILA 2WV9A 4A0RA 5DSZA 4M0LA 1KO5A 3LY5A 4A2QA 4PHFA 4CEHA 2WJJA 3JVVA 2QTHA 4QGFA 4RFVA 4BEJA 1VPLA 1SXJA 2ZYUX 4B33A 4RY2A 2CK3D 2JLYA 2ZR9A 3JVUA 2EWWA 5BN4A 4JT4A 2ORVA 4X8OA 2FNAA 3NC1C 1P5ZB 3PEVA 5JJLA 3GJ8A 2JLRA 3B6EA 4A0HA 2OXRA 2OESA 1Z0JA 4MYTA 5E4FA 3UXMA 1Z5ZA 2CBZA 3GEHA 1KIMA 2O8EB 4U5XA 2VPPA 3RVBA 5KPJA 2GZDA 3FFBA 2HT6A 4MGZR 1XMVA 4URUR 2AX4A 1ZM4A 3LFUA 5EZ5A 2GETA 1LV7A 1OJLA 1RRFA 2WPDD 1KI6A 4JMPA 1G291 4A4DA 1XJQA 2JLXA 3WMEA 1A4RA 2G0TA 4PAOA 3B2EA 4MYCA 4NYMQ 1KI3A 4WZAE 3LDAA 1UBCA 1BKDR 1XMIA 2ZR0A 1NKTA 2GDJA 4LDJA 1WCV1 1XD2A 3TIFA 1U90A 2QT1A 2IEZA 4DZZA 1NKSA 4DHEA 2CCKA 4KYUA 5J47A 1OXSC 4HLCA 1W0JD 5KDDA 1MO6A 2CMKA 4HUTA 3PUVA 4MKHA 1Z07A 2GCPA 2FG5A 1KI7A 1Z29A 2PZEA 4P4SA 5LD2B 1TX4B 4Q66C 3HU3A 4DSNA 1ZNWA 2OILA 3B9QA 4JLJA 4EQ6B 5DHAA 1SZPA 3ADDA 3Q5EA 1DADA 1NVXQ 4JLOA 4TZ6A 4IDQA 1JB1A 1S1CA 2ZRFA 2P6RA 1V5WA 2V8OA 2GZAA 5HZHA 4ZKDA 4LHYA 3SBDA 5J4VA 1Q44A 3TJZA 1E9SA 2D3WA 3V00A 1NVVQ 2A5DA 3QG1A 1OHHA 2WWYA 1GNRA 4NU0A 1LNZA 3ND9A 4RCZA 1TNDA 4A9AA 3KJIA 4HI0E 3QVVA 2YWGA 3QY0A 3BIFA 3GJ4A 3ZZTA 3MJHA 5EP2A 3VR4A 3K70B 1AQYA 3BK7A 3W5IA 4A8JC 2IYZA 3EIQA 3GLGE 3SNHA 1GVNB 1R5OA 3EZ7A 1FQJA 3CZPA 5GADl 1OB2A 3PCRB 1E9FA 2I1QA 3VQTA 1XEXA 1GM5A 1ZM9A 2RGGA 2G0NA 3PENA 3EIHA 1FUUA 1AGPA 2ZUCA 4POAA 4XSGA 3DKPA 1CRPA 3CPJB 5CB8A 1SHKA 3EZ9A 4BUJA 1H8HA 4JLVA 3A1UA 1NMYA 5FR1A 1W44A 2J46A 4URZR 4ZI2A 1GG2A 3CONA 121PA 4DSTA 1XP8A 1DAHA 2CEAA 3PG5A 2BIFA 1N6RA 2HF9A 3RLFA 2AWNA 1HT2E 2NO7A 5SZKB 1ZUNB 4OQLA 4ABYA 3GJXC 2ZAMA 5FI1B 4BZXA 2V1UA 3CB4A 1G8PA 1S2MA 4ARZB 4NCIA 4RD0A 2ZS9A 4IOLA 4UNPA 2Z6VA 4ZDIA 1TUEA 4NYJQ 5L3SB 1OSNA 1G4UR 3OIWA 1LTQA 3LQQA 4HSEA 2YOFA 2RGBA 4ASUA 1BMFD 4DLWA 4RVCA 2WBLC 4PXAA 3CH4B 5FOVA 2R6AA 1FNMA 1GNPA 1Z6TA 1ZM3A 1BYUA 4QHTA 4BWYA 1Q1EA 1FP7A 1Z6XA 2ZJ2A 3Q9LA 1XEWY 3KL4A 1ODFA 3ZDQA 4EPWA 3QSYA 3R9XA 4QHYA 3FMFA 3FGNA 1OF1A 2IEYA 2V3CC 4RD6A 1KY3A 2RGDA 2I3BA 4M53A 4L8GA 4G5QA 4YQFA 3X1XA 3BB3A 2CLCX 2J7PD 3N2EA 5LBIA 1II9A 4OHWA 4Z8XA 1OE0A 1MABA 2ZRCA 2E87A 2LKDA 4HB4A 2GKSA 4LZZA 4FWIB 3KZ1E 3CBQA 3VNVA 1NMXA 2WJHA 3NDBB 2WIAA 3RAPR 5FUYA 3GLFA 2N1BA 2IUSA 1E0AA 4ZIRA 1OV4A 2WZQA 3C5HA 4Q5IA 5FPHA 4CT4B 5HCNA 2GHIA 4D25A 1RFLA 2GVZC 2GK6A 4JL5A 3UPUA 2P6UA 2Z5FA 4M1OA 3QEOA 4BLTA 2OHFA 3RRYA 4BFWA 1EFCA 1VDZA 1E2JA 1EFRD 1ZP6A 1CULC 3BGWA 4LV5B 4ZV4A 1BO6A 2A7QA 5DH9A 4JBXA 2UVQA 3O8RA 2I4IA 4F92B 4R71A 4NKRA 4Q4JB 2HT1A 4RKFA 2AK3A 2CE7A 3GEEA 3OE7D 1NN1A 2VP0A 5JJKA 1D2MA 1COWA 1R0WA 2D62A 4MUBA 1B23P 3X1WA 4PO9A 1DARA 2P65A 2VHTA 3FFAA 2YOHA 1NRJB 3ZGXA 2OBNA 1ONBA 3R8CA 2V1XA 3LLMA 1BOFA 2QROA 1PJRA 1CR0A 2J7KA 2D06A 1MR3F 3ASZA 4GPTA 4IOMA 3KQNA 1HUQA 2ZAOA 1EG7A 2GEUA 2NO9A 3AKEA 4L15A 1T3SA 4A2PA 2RGAA 1S3SA 4GBMA 2H17A 3VR5A 1Q12A 4DUGA 2F1RA 5G41A 5EXXA 4LJ9A 5B58C 3QF4A 2R6CA 4Q9LA 3K0CC 1N5IA 1FTSA 2OFXA 3ZJYA 1I2MA 2ECKA 4LHXA 3UWOA 5CB6A 3CW2A 3K8YA 2J3EA 1G3MA 4IVPA 3BERA 1X6VA 1YZGA 2EVWX 2AKYA 3EA0A 1D2EA 2B92A 2XX3A 4C4PA 1KJYA 3THYA 4RD2A 1OW3B 4A15A 4QGGA 3RS3A 5FTLA 2ZJ5A 1H8ED 3MWLA 1QHYA 2PLFA 4FMDB 3LBNA 2ZJBA 4PC7A 2VHJA 5EUQB 3REGA 1KO7A 4HZUB 5EE3A 2FX3A 1X1SA 1YQTA 2DFKB 4JBWA 5DISB 1IXSB 4JL8A 3SYKA 2E9SA 4CIDA 6Q21A 4M9ZA 4MH0R 4QFMA 2NOAA 1KY2A 4PZYA 4MKGA 3GJ6A 4C3ZA 2BDTA 2DWPA 3VTKA 2Q3MA 3E5HA 2FV8A 4C0LA 4EPRA 1GWNA 3RS0A 3CIOA 3A58B 2ATVA 1T5LA 2ZRKA 4LYFA 2IA5A 5TARA 3ASYA 3FYHA 1Z28A 5K8LA 4OHYA 2IYYA 3AVTA 5J5CA 2JA1A 3OF5A 4IXMA 1YZLA 4KVGA 4TL7A 5FR2A 2PZGA 5BN5A 2ZI5A 4YMTA 5KTYA 3TR0A 3OAAA 1P60A 1VIYA 4NH0A 2JLUA 2GXSA 4ZO4A 2G1JA 2PT7A 4RFSA 5DLQC 1XZPA 4FMCB 1M7BA 2BOVA 4PHTA 4PQRA 5DHFA 1YR9A 1HY3A 2B7CA 2ZVQX 2FFBA 4LY6A 5DYIA 4C0SA 5H68A 4OYHA 1KGDA 5EE1A 1KSHA 3NWJA 1LVGA 1EFUA 2VQSA 1RJ9B 2Z4SA 3QOFA 5J4LA 2CCGA 3IHLA 3NIBA 5SZJA 4XJXA 1SXJD 1SXJE 4JKIA 2B8WA 2ZPTX 4U7DA 1GP2A 4OK6A 2Q3HA 1U98A 2RAPA 5JI2E 3GFPA 5JRJA 3MD0A 3NC0C 4O2RA 3RS2A 4F7WA 2V6JA 5EJEA 1IONA 2FFQA 2ZE8A 2FZLA 3ETLA 3GMTA 3TSOA 5LPNA 2ZSEA 4OHVA 3BH0A 3I5XA 4FN5A 2WMOB 2IS2A 5JBQA 1QHHB 1KAOA 3B9PA 3EXAA 4HZIA 3KJHA 3UMFA 1U8ZA 4OL0A 1AQUA 4AI6A 2ATXA 1YJ5A 1TQ2A 1N6IA 4KV9A 1IY0A 2P5TB 4PSVA 2HEIA 3I73A 3PEWA 1GNQA 4UQOA 1E1RA 4NMMA 4K81B 5B57C 1RKBA 3MCAA 3K0EA 1RRCA 5G3ZA 1XD9A 1S9HA 1QHSA 3WYFA 1QVRA 1L4YA 2IT1A 2D7DA 5FTNA 3C14C 5E7IA 1SVOA 3W6NA 1NG9A 4G01B 4LJ5A 3A8TA 2Q9AA 2A5GA 1CS4C 3TKLA 4EPYA 4H9GA 4IDPA 1IN6A 3IHWA 4LYHA 1M34E 2QMEA 2B21A 1ZUIA 3FTQA 3ZZ0A 2IW3A 1P75A 1Z8FA 2IYTA 2W83A 3GQBA 5CK5A 4F93B 5DI3B 3GFOA 2IXFA 3TK1A 4W9MC 4WAUA 1XTRA 2GVDC 3THWB 3THXA 3BB4A 4HLDA 5EP3A 2D2EA 2ZQ5A 3MMPA 1W36D 1OHHD 3B1WA 3N5CA 1XJCA 1Z08A 5CDFA 4GDFA 1T3LA 4HEJA 3I62A 1JNYA 3CWQA 4JT2A 5FPKA 1T8UA 1U0HC 1ZUHA 3ZYCA 4IOKA 1G5PA 2ANBA 3SE0A 4US2R 1SVSA 4Q9KA 3PEYA 2ODEA 3J81k 1MO4A 4KLNA 4P0TA 4C0AC 5JRZA 1D9XA 3IBYA 4A82A 1IN5A 1MV5A 2DR3A 1LF5A 3AGQA 1G3QA 3VKGA 1KDTA 2AK2A 3BRWD 4LYJA 4NE2A 4JIMA 3NBYC 1DTSA 1MH1A 4MRNA 4Q9JA 1XCPA 3CRMA 3LO5A 3GLGA 1XCGB 4O3MA 1NP6A 1DS6A 1DAFA 2OFWA 1N6HA 1H8HD 1W4AA 2IXEA 3PUZA 4RJLA 1JXOA 5HTKA 4PR0A 2XGJA 1W2GA 2WIBA 2P2LA 1DEKA 3W8NA 1KKLA 4QOSA 3A1SA 1TU4A 5SZHB 3A1WA 4TT3A 3SC3A 3MFYA 1X8LA 621PA 5EXTA 1II8B 3LBHA 2GCOA 3IIJA 3OFND 4MKIA 3RANA 4BZQA 2YWFA 1KO4A 1XEFA 1W7AA 1UKVY 4TLCA 2VH5R 3I5YA 1K6MA 3GLHB 2NQ2C 4Q4HB 2BHRA 2FGJA 4M1WA 1A5TA 1OYYA 4ASUD 2DYKA 2O8CA 2J59A 1R8SA 2J45A 4M9SA 4PPQA 3R8FA 3Q5DA 3HJNA 1VG0B 1G19A 3W9YA 4OHXA 4IVQA 4BFTA 1XPRA 2RCNA 4B3CA 1SHZA 1P4SA 5FBLB 1YR7A 4LI0A 1KK3A 3EX7C 4FCTA 3SDZA 4XWKA 3A6PC 2V7QA 1UADA 1TF7A 1GKIA 2CNWA 3CPEA 1UEIA 1HE8B 5F98A 2KBFA 4BFSA 3RNLA 3VU9A 4Z54A 2JAQA 2ZYWX 1PV4A 1WBBA 4B35A 3EWAA 2V4ZA 1U8YA 1RRGA 2NG1A 2O8FB 1SGWA 2FPMA 2JLZA 3AVUA 3GLFE 1UFQA 2IHYA 3NG1A 4ZCMA 4GZLA 1NIPA 2VF7A 1W1WA 1IY2A 4NL4H 2EU8A 2F43B 2WWHA 2RGCA 3DDCA 2YOGA 4LJAA 1KI8A 3SN6A 5FBVB 1FPMA 2CL6X 4EJSB 2VL7A 3WMGA 1ZCAA 5JEDA 1JPNA 4PSKA 4TMZA 5C4MA 2GK7A 3DOEA 1UPTA 2ZRAA 4BE7B 4JJKA 1VG8A 1JQJC 4C0HA 2XXAB 2A5FA 1COWD 2MSDB 4G5OA 4NDZA 1OIVA 5AUQA 1G5TA 3SJAA 2KB0A 1EFRA 4ESHA 5JLJA 4DT1A 1S9DA 1UAAA 1ZW6A 2Q9BA 3KQHA 4IRUB 1XXHB 2AWOA 2OXCA 2O0HA 2ZJZA 3SS8A 1VHLA 3BFXA 3FKQA 4X8MA 2OEPA 4OK5A 2GZHA 2KE5A 4YMSA 4DUGD 1XPUA 1TQDA 4FW9A 3LAWA 4AYTA 4I81A 2J0QA 4B3BA 2VP2A 4JJZA 4CF7A 3AEZA 3IBGA 5L3QB 3LW7A 1SKYE 1E2PA 4HB0A 1KMQA 2F3TA 1E4YA 4DJTA 1WP9A 2VP5A 3RS4A 3KXIA 1S96A 2GJKA 4QKQA 2CHGA 1X8KA 2X2FA 3KQLA 4CEJB 4D26A 2WSSA 5BXQC 5JMTA 2BM0A 2FZ4A 4NONA 2AXPA 4K46A 4Q02A 1Q22A 1OB5A 4ZPXA 2N42A 4BFVA 4YMUA 4PO8A 4LC0A 4CEIA 3CPHA 5UKDA 1E9BA 1TADA 1NI3A 4XSHA 3REFA 4DEXA 2WWGA 3ZD6A 4S2EA 5BYKA 1J99A 2GBLC 4ESVA 1QZXA 2I1VB 4RZ3A 2JLSA 3H84A 1ZM2A 3QXJA 1W49A 1OH5A 1E0KA 4Q1AA 2N46A 4DCTA 4A0FA 1OLOA 3UG7A 1NG1A 1RPZA 1N3BA 4FCVA 5G53C 3B60A 5CJPA 3F8TA 2C9YA 3QKRB 3DM9B 4TYNA 1GFIA 4KSCA 3NH9A 4F4IA 4UNNA 1KMHB 1R0ZA 4LJ6A 4WOPA 4IFEA 3UK6A 4BFUA 3HU2A 4DBLC 3IQXA 2V55B 3OAAD 4HDQB 2XZPA 4R7ZA 3TUJC 2CXXA 3NDPA 3JZAA 4MYHA 5FL3A 5FL7A 3U44A 4IJMA 1JBKA 4LOAA 4NTZA 2P3SA 2FWRA 5L8VA 1W4CA 4J0QA 3CUEF 4Q03A 1AS2A 3NBFA 4P3YA 1E9AA 2QAGC 4KSBA 4AG5A 1AZTA 1NY5A 2Z0MA 1TU3A 2WKRA 1E69A 1GRQA 2ZYVX 3KXLA 5ELXA 3Q7QA 2ZSDA 1U99A 3GLIB 4URWR 3OIUA 3SFZA 4HDCA 4DDWA 5DNYB 4LV8B 4HUQB 5FTJA 4PTLA 2QPTA 1VCOA 1GAJA 1E94E 1KNXA 3FHOA 4TYWA 4D4JA 3QVUA 3IEUA 4B73A 4NBSA 4A8JB 2OAP1 3MGCA 4X8HA 4UKDA 3EPLA 5D3MB 4EFLA 4JYBA 1QHNA 1Z6GA 4NZYA 2JDIA 1G7CA 2REXB 1GILA 2VA8A 3QKSB 3VR1A 5FBWB 4MRVA 3ZS9A 3ZVRA 4D82A 1CTQA 1II0A 2V9PA 1E1RD 3T1OA 4M1SA 3EZ6A 4D4LA 3E1SA 1Z63A 2BVNA 1WB9A 2IYUA 1KSJA 3AUXA 5TVKA 3SJBA 3AF3A 1CR2A 4TYPA 3CR8A 3EZFA 1NSFA 2QP3A 1Q1BA 5AK0A 5EZ6B 1BH2A 2GEDA 4EIWA 2JJ2A 2CHQA 2FN4A 4O25A 5KU1A 2YJTD 2AN9A 5TY0A 1K5GA 3EPJA 4US0R 3TVDA 4KI0A 4JL6A 4GNKA 4JKYA 3SYLA 4C0KA 3EIEA 3TRFA 2W0MA 4GT1A 5DYGA 1SXJC 1Z6YA 3HYTA 1N6OA 4XH9B 3FHTA 1PVOA 4JLAA 1FMJA 3U3RA 1SVMA 3A1VA 3SI7A 1JECA 4AKHA 5A4JA 2B8TA 4MUAA 2Q21A 3CZQA 4AYXA 2X77A 4TMTA 5JJIA 1G3IA 5KNCA 4BGDA 2F1IA 4YC7A 1CXZA 2LKCA 2MMGA 3QXXA 4B3DA 3HDTA 3NEYA 5CDFE 4JLPA 1E6CA 2IYXA 1TF5A 3A4NA 2P0EA 3E2IA 1KSFX 4BASA 2ERYA 1KHTA 1W2HA 2NIPA 2PJZA 2QORA 3S1AB 4RZUA 2CJWB 1ESNA 2KWIA 4URYR 1Q1ZA 3FWYA 2ZJYA 4NHOA 1LS1A 2C98A 2ONKA 3T15A 1L2TA 4A1FA 3B85A 2BBOA 3HP1A 3G5UA 4HB3A 3P4YA 2BKUA 3QNUA 4LJYA 4KXFB 1AKYA 3SHFA 1P73A 2QGNA 4NYMR 4FWTA 5DO9A 2BMJA 4BQSA 4DVGA 4TL8A 3F0TA 4JSYA 2WM9B 5ANRB 5IHPA 2G6BA 1G3RA 2WMNB 4QL3A 5HR5A 1T5IA 4NPHA 1X1RA 2B7BA 3OHMA 2R44A 4ZDKA 2QAJA 1E2LA 1TTTA 3WBKA 4C30A 5AUNB 1D8TA 1YZNA 3WYGA 1G5RA 4GOJA 3Q7PA 1E2DA 4TT3D 4UJ3A 1E2IA 3KKMA 4EAQA 2O8EA 1YHNA 4B71A 2IWHA 2OM2A 4IKEA 4N3NA 2H16A 2QM7A 1OXUA 2ZTSA 4LPKA 1E0JA 2HLDA 1F2UB 2QENA 1T3HA 1W36C 5HE8A 4R2IA 1Z3IX 1NVVR 2O0JA 3PQCA 4RD3A 3VR3A 2ZRLA 4DCNA 1KI1A 4M9XA 1VECA 3L82B 3LA6A 2MSEB 3G0HA 4PPFA 3K9NA 2CVHA 2DPXA 3OFNA 1JJVA 3DM5A 3F5FA 1AGRA 2Q6TA 1KDRA 1ZD8A 4BLQA 2WOJA 3GJ0A 3CX8A 4LCBA 5EQTA 5FBQB 3IIKA 4NP6A 4RKEA 4EQ6A 4TLDA 5DGXA 1E2GA 1NY6A 4DDVA 2V7QD 1AK2A 2CNWD 3CR7A 3HYRA 4QNRA 4TSFA 5DN6A 5GJBA 1E99A 4GZMA 3R7WB 1FUKA 1XZQA 5FOUA 3TVTA 1VKJA 2A3RA 4TZ0A 2HCJB 3AB3A 4CVNA 1F2TB 1GRNA 3VU9B 1W46A 2PEYA 3H4MA 5DE3A 5KDOA 4QHSA 1NF3A 3U6BA 1TEVA 2FFAA 2C03A 4DWJA 3MWJA 3CWZA 1N6PA 3K0SA 3ZIAA 3KQUA 2WJGA 4E22A 2OAQ1 5AJZA 2JATA 1D5CA 3B1XA 4NYJR 4V0KA 3W3AA 5BYJA 4DLSA 5BWMA 5F9HA 3VR2A 1CKEA 1JPJA 1Z06A 4ITRC 1R0XA 2R65A 4G3XA 3L2OB 3GFTA 3DKVA 5TXGA 3ADCA 2QBYB 3FHCB 2AFIE 3TE6A 1VHTA 2JJ8A 1NJGA 4HLUA 4JLBA 2FH5B 1XU4A 5H70A 2RH5A 5JI3E 4YLGA 1XNJA 1MRSA 3OEHA 3W90A 3T1VA 4DXAA 1DPFA 4JVSB 1FNNA 2XB2A 1ZIPA 3QUSA 1Z83A 1QHGA 4FINA 4ARZA 1XTKA 3IGFA 3DO6A 3PUWA 5L3SA 2BBSA 4G0NA 2HDNB 2YNMA 3RSLA 1MRNA 3AF0A 1OXXK 3KDSE 2DWOA 1P3JA 3LD9A 4RZXA 1DO2A 2IYVA 1NVWQ 4G1UC 4PFSA 4OJQA 1N25A 3CX6A 3BH6A 4QJ5A 1Z2CA 5EE9A 1I4LD 5HPYB 4QBFA 2ZU0C 2J0VA 2WSSD 1ANKA 1NBMA 3OIYA 2BKEA 5JHGB 1AJEA 5A5GA 2YKGA 1IJEA 1Y3AA 4P32A 4CRWB 5GJWC 2PBRA 4DLYA 3VR6A 2A30A 1ELOA 4GP6A 4X8LA 3SQXA 3TUIC 4ERNA 4CYMA 2G9NA 4KITB 3QI2A 3C4JA 4CDGA 4Q47A 3O8DA 3KKPA 3X2SA 4URVR 1FTNA 3CH5A 1GTVA 1P9RA 2YINC 3MWKA 5F3WB 2ODBA 2AFHE 1JAIA 3IPXA 2FOLA 3SEAA 1IN7A 5JEEA 5KSZA 2XITA 4IXNA 5FTKA 3AP3A 4A2WA 2QNRA 2PX0A 5EXSA 2ORWA 1NSTA 4QRHA 4B47A 3Q72A 1HQCA 1FOEB 2OFOA 4V0ME 1YZTA 2QPAA 5JCZA 4QM7A 4AWXA 4Q4AB 3HR8A 1P2VA 1KAGA 1Z0DA 1Z2AA 4G5RA 2ZRPA 3OEEA 4DLUA 4AIIA 1OYWA 1J8YF 2FFHA 2QTVB 2ZJAA 1TQ6A 1XXHE 4Q4JA 4WVFA 3LV8A 5FL7D 4XD7A 2XSZA 5B2ZA 4XVUA 3K09A 4DB4A 1JJ7A 3L8YA 3QPWA 3AV0B 4LPSA 2QN6A 2VRWA 5FBRB 1EK0A 4TMWA 3M6AA 1GITA 4KHZA 2CL0X 2VHQA 4PX9A 5IRCD 3AM1A 2C04A 4Q7MB 3SJCA 1XB2A 1OKKA 2NZJA 3AVOA 2O8DB 4DIDA 3EC2A 3SJZA 1VTKA 3MUFA 3Q8XB 4Q9IA 3H86A 1P62B 4FD2A 1OFIA 2XJ9A 1GL9B 2AL7A 2WAYA 1GSIA 4OI2A 3W6OA 1T0HB 1KK0A 3U5ZB 1Z22A 2G88A 1SKQA 4YDHB 1K5DA 2CCJA 3U4QB 1WMSA 3A36A 2JIZA 2JDID 2O8BB 2FPKA 2NPFA 3DPUA 3AQ4A 3GCGA 4RZ2A 2BMFA 4JLKA 4MDEA 3VX4A 1AIPA 4D6PA 1OH7A 4CGZA 1I4TD 4L5BA 3B1YA 1Z0AA 4B43A 3PR1A 3RSOA 1KO8A 4B3FX 3BB1A 2IXGA 2TMKA 2NO6A 4YONB 4Z8YA 2YV5A 1G7SA 1PZNA 4OQXA 521PA 1U81A 1ZAKA 2IYWA 1E4VA 3NH6A 4B48A 2W58A 5TDHA 4BFZA 1TMKA 2PT5A 4I99A 4DLZA 1NN0A 4DSOA 4HZUA 2ZRGA 3UKDA 1OIWA 4UNSA 3CF0A 2JJ2D 2NMVA 3EPHA 3VHXA 1HT1E 3IO3A 2ZRBA 2PZFA 3IO5A 3X1ZA 4TTRA 2LCFA 4L9SA 1IY1A 2XNDA 4PZZA 3C15C 3AVPA 1B0UA 1VYVA 2XEXA 1ZD9A 1OFUX 1PLLA 4I4LA 4OQFA 1W47A 3A4MA 2QE7A 3GD7A 3DVLA 3DL0A 1R6BX 2EWVA 3C5CA 4L9WA 4A6XA 3WRYC 1DAEA 2FDCA 5AJXA 1DG1G 4XVRA 1IN4A 5CM8B 1SQ5A 1E2KA 1FX0B 1G64A 3EZ2A 3W3ZB 3JZMA 2L0XA 3KFVA 4XIGS 4TLAA 1CEEA 2Z4RA 5KYKA 1FMLA 2ZEJA 3HU1A 1G17A 5K8IA 1MOZA 5SZIA 4TQUS 4XWAA 4QJ4A 5TMPA 1HH4A 2ODNA 1XDBA 4KJZA 2YZ2A 4KFTA 1NLYA 2QQ0A 1RJ9A 2HV8A 2ZVPX 4W5HA 3M4YA 4QM6A 4TL6A 3CX7A 5JECA 2ZRMA 4W7SA 2XOKA 1CJKC 2R8RA 1LS6A 4HLQB 2GJ8A 2IX3A 2WAXA 2XB4A 5E95A 3KB2A 3OZXA 5FI0B 2IHBA 4ON9A 5AJWA 1P2SA 2GEVA 2F6RA 3ADKA 4HYYA 2DWQA 3LNCA 1JI0A 1ZYUA 1QHHA 5F2EA 3TSWA 1E9CA 1MO5A 2UKDA 3IUYA 3B1ZA 2ZSAA 4BZPA 2C5LA 2JLVA 1VYUA 4V02A 2HLDD 1V43A 4M4SA 4PC2A 3I8SA 3KTAB 4Q18A 4WZBE 1KDOA 3WNDA 1M2OB 4KLZA 4Z1MA 4KVAA 1C9KA 4A92A 1RYHA 2YYZA 3LX8A 4DRZA 4TLEA 1CF4A 1E2NA 3ND8A 2PCLA 2ZI4A 3VMFA 2BMEA 4DEYA 1UBGA 3DHWC 4C9BA 4B3GA 3AP1A 3T06B 4QGHA 3DZ8A 3QBTA 3CRQA 5CM9C 1KDPA 2H92A 4D0LB 1Z6AA 3EC1A 2GXQA 4TSFD 5DN6D 1W5TA 1S0UA 5DI3A 5L3RA 5CLLA 3THWA 1OXTA 1R5NA 2QU8A 1R2QA 3AH8A 4Q1FA 3VHLB 1KYIA 1TL7C 3BWDD 5JWOA 4Q00A 2QRZA 3BE4A 4JLDA 3UIEA 1P9WA 2BC9A 2EFEB 2FSIA 4EFMA 1BYIA 4B34A 3K70D 4F4CA 2WHXA 1ZU5A 4BLRA 1ZC3A 3SQWA 5KSPA 5KO2A 5EP1A 3C7KA 3K0FB 4LJ4A 2C95A 2IBMA 1XBTA 1YRBA 3ONWA 1U2RA 2SHKA 1G21E 4NCJA 3ZIAD 5BN3A 3SYNA 1AKEA 4I1VA 4UXIA 3D6TB 2JJ1A 4D0NA 1U9IA 2A5JA 1O87A 2VSFA 2WWWA 2IS1A 2GXUA 4MYUA 1JAHA 2QP4A 4US1R 3TAHA 1A82A 1CJUC 3MG9A 4B75A 1CBUA 2DHRA 2EYUA 2OBLA 3I72A 4MA4A 4PHHA 2RGNA 4G5GA 4M2LA 4C7OB 4TTQA 4DKXA 3U3MA 1XTJA 1G20E 2W6JA 3CM0A 1A1VA 1OXVA 3BBPA 3OEHD 3THOA 1HQYE 1II8A 4TWZA 3AVXA 2J0UB 2QAGB 4C2UA 1GDDA 3W5JA 4P4TA 1W4RA 3IQWA 4KAXA 1KTVA 2H7VA 4EFNA 4GI7A 3GLHA 4Q4HA 2FF7A 1ZNYA 4EUNA 5AUOB 5JSZA 1VG9B 2KSQA 4IEEA 4M9QA 4GSYA 4D81A 3PEUA 1KSGA 3CF2A 2RKOA 1NMZA 5J4YA 3UMRA 4B2PA 4MGKR 2AHOA 3QPUA 5FUXA 1XRJA 4WXRA 5GJCA 1G41A 3E70C 3AKDA 1WRBA 4AKGA 1G8FA 2FE4A 1NBMD 1NBME 2ZREA 3FMOB 1E98A 1E96A 2IYQA 3MSXA 2GA8A 1I4DD 4FI3C 2FJUA 3B5JA 1IQPA 1E9RA 3CRVA 4W5JA 3X1DA 4B3XA 2A9KA 3FKSA 3AVWA 1TEXA 2G3YA 1RZ3A 4HAUA 4DDUA 3L0OA 1D6JA 3B7GA 1CR1A 3QQ5A 4B2IA 2O8FA 2WKQA 4FMBB 3RC8A 3W34A 2REBA 1VIAA 2GWHA 3U7FB 4HB2A 1E0SA 3BORA 2XNSA 2ZR7A 3K0AB 3WYAA 3ZH9B 3D8BA 1US8B 5KUTA 4NYIQ 1Q3HA 2F43A 1E3MA 1OH8A 1P9NA 1PLJA 2Q0HA 1IXZA 1GZSA 4AG6A 2DBYA 2W0SA 4CEHB 3MAAC 2R6FA 3L43A 2ZRNA 3L8ZA 4KBFA 1G8GA 2IYSA 2PLRA 4EJSA 4B2LA 1SXJB 2H57A 2IF2A 1XMJA 4I1UA 1XPOA 1JR6A 2HCBA 3OEED 1H65A 4TL9A 1G9XA 2O52A 2ZYTX 2V54A 4XD7D 2XSZD 5CYPA 1XEWX 1IJFA 3H0KA 4B74A 4CW7A 3P27A 4V0MA 1QBKC 2XXAA 1NN5A 1QVAA 4EDHA 3FMPB 2IS6A 1VCIA 1F48A 1UDWA 3M1IA 1YR6A 2D4HA 2PH1A 2JGNA 1RIFA 2ZJOA 4LJ7A 4U00A 1EXMA 3AF4A 2A2ZA 3QBVA 1OKKD 1XXHA 5KNBA 4OQMA 1ZMXA 3WBJA 5KNDA 1E79A 1YZKA 2HXSA 2GJSA 4BPBA 4WW0A 2ERXA 5JZVA 4B6EA 1ZRHA 1EX6A 4Q01A 1KI6B 4EPVA 3LQRA 3CO5A 3LVQE 5JS7A 2KJQA 2OZEA 2ZUBA 2XTNA 2JIZD 2F1HA 1PUIA 1XTQA 5L3QA 2CHVA 2C8VA 1MT0A 2ZE7A 4LYAA 3PVSA 2NZ8A 2XZOA 1XD2B 3TMKA 4RSGA 3TW4A 3SOPA 1P2UA 3A4LA 1R10A 3MJRA 2BJVA 1GUAA 2C96A 3LX5A 4P4SB 1HA3A 1N2CE 3A37A 3T5DA 5GVSA 4CEJA 2FEOA 1RC8A 1U0JA 4JS0A 3IIMA 3RHFA 1LF0A 3KKNA 4PAQA 4TQAA 1TUIA 4LX0A 1UKEA 1WXQA 5FOSA 4DIEA 4E03A 1QG2A 1Q1QA 4XWOA 2QT0A 1W5SA 3FPAA 5LB4A 2AXNA 4PO1A 4HAWA 2QMUA 1YZQA 2ZRHA 1ZNXA 2WWXA 4PZLA 4R2HA 5FOXA 2JASA 1W36B 2XNDD 1XJ0A 3LLUA 2H18A 5FPYA 1M1YE 4D2IA 4BRWA 1Q0UA 1N6NA 4TYYA 1CJMA 4LBYA 1W4BA 4QBHA 4UJ5A 2VIIA 3QENA 1YE8A 1PLKA 4L16A 1UDXA 2OO7A 1Z0IA 2QE7D 1XD8A 5CIWA 4UNRA 1ZD1A 3C8UA 3QKRA 4PQFA 3GPLA 1KMHA 3DZDA 1KJZA 1N5KA 1YVDA 2VO1A 3VAAA 1DAIA 2QZ4A 1UEJA 1J8MF 1ZJ6A 3CNOA 4N1AA 4V0NA 3UG6A 1XEXB 2WKPA 1XFAA 2QA5A 5A0FA 5BW8A 3BFVA 2ZI6A 2OLKA 2OCAA 3AKCA 4M1MA 5EXPA 3TNFA 4OBEA 3AP2A 5AR1A 2R6GA 3EASA 4HAYA 2FMXA 3ZQJA 2MMCA 2QTFA 2FU5C 1E1QA 2JLWA 4RCYA 2BBWA 3BJIC 3GP8A 1WBDA 3RRZA 3GLIA 3T12A 1T8TA 2XOKD 4UXHA 5FOTA 5C18A 4HUQA 4B32A 5JCPA 3KQKA 2GESA 1HURA 1Q3TA 1Z0KA 2IUTA 4A8JA 3LH5A 5K8UA 5KSOA 2C99A 2J9RA 3MWYW 4OJKA 1J7KA 3QEJA 1J90A 2HUPA 1CRQA 4GMXA 3NKVA 5D3MA 2P5SA 4BFYA 3HR7A 4FIDA 2GF0A 4DLTA 1D2NA 4TLBA 2Q3FA 5P21A 1BIFA 4IDOA 1GL7A 4LGMA 2FGKA 4JLNA 2C9CA 3QKSA 1CLUA 1KZ7B 4ILEA 2MSCB 4AK9A 4HAVA 1KK2A 3KFXA 3LRPA 3EW9A 1G7TA 4H1VA 1E2HA 1G16A 5B64A 4Q9HA 5HKKA 3AVVA 1Z0FA 3GJ5A 3P26A 4MKFA 1DAKA 3ZLJA 3RS7A 1MO3A 1TAGA 4AY2A 2AR7A 2OE2A 4QXAA 1U0LA 4Z1MD 5GJVC 4OI0A 1MABB 2NO1A 3NTUA 4HATA 4EKDA 4KCGA 5C1BA 2IUUA 2PJRA 5K8TA 1UM8A 4QJ3A 4WZ6A 1KJWA 4E07A 1ZCBA 2C9OA 2YWEA 3DMDA 1SULA 4BRUA 3U60B 2ASEA 3FDIA 1AS0A 3HWSA 5JWHA 3GLFB 2VP6A 3QXHA 5J40A 3MRSA 5EE5B 3LBIA 4ZIRB 1EFHA 2ZI9A 1M8PA 5EUMA 4EPXA 2H5EA 2XTZA 3NHBA 4RD4A 1KNQA 1R0YA 1T91A 2QM8A 5FUVA 3UMSA 4MDFA 2R2AA 2Y8EA 5AJVB 1M7HA 4TQ9A 1N0UA 3WNBA 2ONJA 3O47A 4MITA 1S3GA 4LRWA 2WWIA 2GJAA 2KI5A 3QKUA 4TMVA 4CT5A 3O8BA 5JFGA 4M8NE 3P4XA 2BMDA 4NCNA 1E2EA 1KKMA 1OFTA 3S1AA 2CJWA 4PC3A 3KUDA 4O0MA 3PV0A 3QJYA 1E2MA 2YHSA 4DLRA 4E09A 1L4UA 2IF0A 4HAZA 3PFIA 1DAMA 2DFLA 3X1YA 1E9EA 3SU8A 3GEIA 4ACBA 2VBCA 5C4GB 5C2JB 3WNCA 4G5SA 1QDEA 3DEFA 3T1TA 2JJ1D 3BXZA 8OHMA 1FZQA 5EE0A 3LXXA 4YXWA 3T34A 3FMIA 1TQ4A 4LC1A 4GOKA 3UWKA 1IN8A 2YC4C 5FH9A 4JYCA 1JQLB 4ZKEA 4IEIA 5LD2C 3IILA 1HYQA 3QF4B 2C77A 3ZVMA 4IVRA 2W2XA 1UJ2A 2XTMA 2ZE5A 1C1YA 1SKYB 3B13B 2IWRA 4YDSA 1P72A 2QMOA 1I2DA 2ZM5A 1IXRC 2VSOA 3TQCA 2W6JD 4PPNA 3B8HA 2WTUA 1XF9A 1OPXA 2GJ9A 4LSGA 3WHKA 2UZ3A 2BCJQ 2QL6A 4XVQA 2ZE6A 1F2UA 3THYB 1G8HA 3EG5A 3QF7A 4PC6A 4OKSA 2XAUA 3SBEA 2PMDA 3PXGA 4BLOA 221PA 3KUCA 3GLHE 2FEMA 3RWMB 1DOAA 3I32A 3KKQA 2RHMA 3D3QA 3UATA 3K70C 1RRPA 1X8JA 5BQ5A 1AZSC 1OIXA 2EW1A 1IAQA 2FSHA 3I1FA 1JR3A 2GAOA 3R20A 4Q7LA 1G18A 2WICA 3NVAA 3P20A 4D4MA 1EX7A 1FL9A 4WXPA 3DOFA 3K0CA 4XOIA 3QE0A 4Q1CA 4BEBA 4KODA 3ZQ6A 4F4JA 3CF6R 4FMDF 4A0GA 2QUZA 3TR5A 1FQKA 4GRAA 2OLJA 2BV3A 3HPQA 4BFXA 2ZS8A 4M1TA 1CJTC 5IK2A 3R7WA 2HJVA 3FKSD 2OCYC 1JEDA 2EQBA 4Y0VA 1RYFA 3T35A 4ACAA 5AJYA 1QF9A 2OCPA 3C41J 3FB4A 4OI4A 1F2TA 2RGEA 3P1JA 4RFSB 1T9HA 2BWJA 4HLUC 4QBGB 3CNLA 3QPVA 2ZIAA 5HE9A 1EWRA 1L7VC 1NVUQ 3TAUA 5F9FA 2QMHA 1X86B 1ZC4A 2GAAA 2O5VA 1U8AA 3IPYA 2QRNA 3AVQA 821PA 1A7JA 1W0KD 1AN0A 3ADBA 1UF9A 3AGPA 2UZIR 1VCMA 2HF8A 4DSUA 3KJEA 1P2TA 1LW7A 3VFDA 4C0BA 3ZD7A 4V0OA 1VMAA 3PITA 4Q4LA 3IKJA 3SFVA 4IHQA 5LDDC 2ZANA 2QEQA 1XTSA 3I8XA 3KJGA 5FPSA 4FMCF 4AURA 1K8RA 4ZI3A 2ZSFA 3PIRA 2W00A 4PPGA 2C78A 3CRRA 3VX3A 3WHLA 1GL6A 4I1SA 4LHZA 3K1JA 4KFSA 1R4AA 2W2VA 2WWFA 4TYQA 1J70A 2QBYA 5E7MA 2ZSBA 1GRRA 1DBSA 4W5WA 4DCUA 2PEZA 1U94A 1XCMA 421PA 4A6PA 3U3OA 5H1YA 2AKAB 1LY1A 2OCBA 1NLFA 1ZBDA 3CKLA 3L0PA 3QXCA 3RRNA 4F38A 2G77B 1E79D 2HXYA 4OK3A 2GCNA 4UNQA 2CL7X 4LJ8A 1F5NA 5CK4A 5KPDA 4RD1A 4Q1EA 2GTPA 2WJIA 1IBRA 1QG4A 4R98A 1RE0A 4H1UA 3RDPA 2YC2C 3ZVNA 1G8YA 2G83A 5CJ2A 2VLIA 5G40A 2E1RA 1CIPA 1R7RA 3LWNA 1C4OA 4DLXA 2QPOA 2HYIC 3CNNA 4F91B 2ZITA 1UKZA 5JHHB 2R9VA 3RWOA 2BJWA 2W6IA 3WY9A 3GJ3A 4FXPA 4O2LA 2BEKA 2IYLD 4GP7A 1XMSA 1G6OA 1WF3A 2X1VA 1NNEA 2ZROA 3B82A 4JSTA 4I1OA
chains in the Genus database with same CATH superfamily
2ODWA 1YB7A 4UXJA 3C7DB 2BI8A 1EINA 2YYAA 3DZBA 3IP1A 3OIGA 4KO8A 2FQXA 1CS0B 2NZXA 4RH1A 4U7JA 4C0WA 1LDYA 3WAGA 3CF4A 3SR0A 5IBQA 1K1EA 3TRDA 3W8FA 5KYGA 2CMDA 4MS3B 3THXB 4P4UA 3NBUA 4CF5A 3C6BA 3E7XA 1ECCA 2J4DA 4LOIA 4YJKA 2HMAA 1OD6A 1UZUA 4AO7A 5AXBA 2JCSA 1M8GA 2R5WA 1Z75A 2EFDB 4YJGA 1Q0ZA 2C2HA 2DETA 4BN0A 1VI2A 4REMA 4URFA 1MEEA 4HWOA 3DYIA 3OCYA 4FFRA 4N0DA 1D1QA 3PS9A 1JEEA 4MPTA 3T5BA 1GG9A 1V5FA 3E03A 1U63A 4PLPA 4Q05A 4HR7A 3PKZA 3VKHA 3HA7A 4CIVA 5K3OA 3NBXX 4OO3A 4DLAA 3DE5X 1U02A 3EIFA 1WV1A 2O8NA 3AUUA 5C52B 5KHOC 4OX9Y 5HKAA 4JROA 3FDFA 4OSPA 2IXDA 2V6MA 4ITVA 4PLFA 4RADA 5I51A 3DFFA 1P1HA 4UMVA 3E8SA 3M6IA 1E62A 3W2HA 3AR5A 4J0JA 2BI7A 1ZD5A 1PS0A 2Q2NA 2Y67A 2PZBA 3FPEA 4RWEA 1U28A 1VPTA 2JFGA 4UDXX 1H4SA 1DKOA 2LRHA 4FCWA 3RS5A 1UBNA 2W4MA 1G2QA 3ICQB 3NM6B 3WSWA 4FFBB 1CUZA 2AVNA 2RGXA 2Y1LA 3OC6A 4I2NA 3M6VA 2IDMA 3Q0EA 3TTTA 2LWIA 4KFCA 2B94A 2GRJA 4YV1A 1A9OA 4JFAA 1H4QA 1ZO8A 4JI5B 3RLIA 1N6KA 2P6NA 1YR8A 2WG0A 3H1TA 3M4ZA 5HQ3B 2O8DA 2EX1A 4M37A 4F5WA 1XVUA 1P7VA 2CLSA 3CISA 4PLHA 5BOSA 3W5HA 4Z7OB 1IBLB 1F0NA 1LW6E 3OWXA 2JD1A 1WMEA 4DCSA 4HBZA 3A1DA 3E1KA 2IEIA 4W5NA 4CM9A 4Q7JB 4YGYA 1SOMA 3RBXA 2XMGA 3HXPA 4NBTA 5IJWA 3PQ3A 1M2VA 2NTYC 2HHCA 4V3CA 1JQKA 4PRYA 1CU1A 2PXCA 1S4QA 3RVOA 3G2KA 1W5EA 13PKA 4O4LA 2CE2X 3E5NA 1T4CB 2ZU6A 2Z3WA 3DG9A 4QC2A 4BGEA 4DABA 4QDXA 3W4IA 2HJ9A 2HWWA 3ZU2A 3SWWA 3MQ4A 3ENNA 5IWAB 3VU1A 1O97D 5BWBA 2J87A 4K8RB 4M88A 4M98A 4WA7A 3AIKA 3F6YA 3KR0A 2DWCA 4GMDA 3RIGA 1SOAA 4XPZA 4ECEA 4JLWA 4RABA 2W2KB 2F1JA 3M6FA 5JY6A 4AJ1A 5KYUB 4MRRA 3VKWA 1SU7A 2NVOA 1W581 2KBEA 1D8AA 2H65A 2F9LA 1XK6A 1K92A 2ZQYA 4BWGA 1QE3A 2J5XA 5IT9A 1V25A 1UANA 2WMYA 3KK0A 4I08A 4IS3A 2C2XA 2VHUA 1FFEA 1MKYA 1VCNA 2PGNA 2WP8J 2FW7A 3B78A 3MJCA 4BLPA 2R7MA 1U3WA 3ESZA 3V4FA 3WGQA 1QH0A 5AHKA 5MN6A 3JQ7A 3BKWA 2X4GA 4ZQBA 1JWBB 1XOIA 3RJ5A 2BHSA 3UW1A 3G7SA 4RVDA 1KOFA 3U13A 1H2XA 3FUCA 2FMIA 2EDAA 3EVTA 1FLNA 3L0DA 2NZUG 3PFBA 3ZBTA 2FSFA 2BCEA 2IZ6A 3DMPA 3PE3A 1P4GA 1SO8A 5AKZA 1PW5A 2RE8A 2UYQA 5JC8A 1BS2A 1KP2A 3FIJA 1KI9A 4FFWA 4KYIB 5B3JA 1PNQA 4QQNA 2A86A 2YRXA 3ELYA 4E5MA 3HXQA 1C3OB 3I64A 2YX1A 1DKQA 4GUAA 3O82A 1USKA 3WB1A 3K9CA 3U7EB 5LP6B 2BP7A 4NK5A 1E5LA 1VGVA 1X80A 1YVEI 3BJRA 4ZVKA 1UXKA 2NO0A 3G82C 1SG9A 3AEYA 1ZVQA 5JYDA 5IT5A 1WCXA 2FSGA 4AZVA 2ZRDA 4FHGA 1SVLA 2BFWA 1AS3A 3QKTA 4PGHA 1XTIA 5JNRA 1FRNA 4L6CA 3V4LA 4B6RA 2JARA 2P79A 1R50A 4R9UC 1RQ7A 2JBAA 2V3WA 3VNRA 4B76A 2Z2XA 4YCMA 1JHPA 1UBHS 2W2TA 1ZX1A 1BN7A 2WAMA 4GFDA 4AC9A 1T36B 3I0ZA 3P32A 1PL7A 1RW4A 3I09A 4PIVA 5BMVA 3G8CA 5EERA 3KQOA 1NJ1A 3ZDYB 1RABA 2XJ4A 3DHEA 1E2QA 3HJGA 5TS2A 1P6UA 1M2NA 3SHVA 5CVEA 4ZVRA 5J3JA 1NBWB 2COEA 3RYTC 5AVZA 3GIDA 1CETA 2EGHA 1M74A 1Q0LA 2V58A 2DH6A 2ZJ1A 1P7CA 2A78A 4KXLA 1ZEJA 1T5HX 4RGQA 4Q3OA 3PICA 1L8XA 4WDRA 3RPEA 1ODTC 2X8JA 1XCBA 3L7AA 3VC3A 4BVLA 1LZKA 4GLJA 2J5RA 3DXZA 3NXSA 4K86A 1S8FA 1JEJA 3MCTA 3NHAA 5KDDA 1DVRA 3GUHA 1PQPA 4S35A 2AN3A 4ZWNA 2DY1A 3M6LA 3ZVLA 3RUCA 2Z56A 1JIJA 4HD8A 5C37A 4GM0A 2ZAGA 4K8OA 2O4UX 3K9LA 1JSLA 4M22A 3AUYA 1ORTA 3LP8A 4W63A 3ICEA 3ZV7A 3JQAA 2CNKA 1KYYA 1FFHA 2SNIE 4QT4A 3IVCA 4TRNA 4CEIB 2E4YA 1R6XA 3TZKA 4BMZA 3R9XA 2Y27A 1OLUA 5KX5F 3INRA 4M55A 1Z47A 4N5HX 2QD3A 4CIWA 5EJ7A 1EGAA 4XYLA 3V4RA 1R8JA 2H9YA 4EVIA 1HDIA 4BC0A 5DNUA 4YAEA 5DM2A 3I92A 4OIFA 1W94A 1EDBA 1YS6A 1U9IC 1U7DA 4X91A 4TRMA 2CHEA 1UBJS 4PU0A 1F3OA 1LB1B 1LVUA 4XGRA 2YYYA 5D85A 4D9FA 2KW5A 2ZK7A 4TPKA 4BOYA 4D96A 3NDRA 4RKQA 1IOZA 2ZB3A 1JDBC 2ZJ8A 5CX4A 3HCNA 2F3RA 1RXIA 2XBLA 4U3JB 4BV8A 4CM8B 3K9WA 2QGFA 1PK7A 4OLAA 1T2AA 3MRTA 5A3SA 5AVOA 5BPHA 1PX2A 1ZWKA 3QYJA 3R9IA 4OQYA 3EBLA 1ZGHA 1ZNZA 3ESAA 4YIKA 5F1OA 4PLCA 2I7VA 3BAFA 4C4RA 2GS9A 1DQRA 3E58A 2DBZA 1X7GA 3SF0A 3I6YA 4R83A 1YBVA 1Z4PX 4GR5A 4XGKA 3O8CA 4WUVA 1U4NA 3CH7A 1Q57A 1SVIA 3QUCA 4IDBA 1C7FA 4BAZA 4ZC1A 4NOKA 3DO5A 1NSYA 4PANA 2O0KA 2F7SA 2GD0A 3QLTA 5AT1A 3IQHX 5K6AA 3MERA 1TKCA 2E4AA 3G85A 1D5WA 4KOAA 3WP0A 4BMYA 2RB4A 1QG0A 2V6IA 3T3PB 2P67A 4HUJA 4CMEC 5IU6A 3ZHCA 1SD1A 1M67A 1WHSA 2AN1A 1M9NA 1V7CA 3MFQA 3N3BC 4FE3A 4XTCS 5T4BA 3EHEA 4ZO9A 1K5HA 3SX0A 1Z12A 2YQZA 4Z4CA 3OJOA 1V37A 2F9MA 3P9ZA 4NMXB 4XXHA 3H6KA 1PJ2A 1ZH2A 4OOFA 4PQYA 4Y2XA 1CY1A 1RXWA 3K9GA 3IJRA 1BRTA 1Q20A 3OIVA 4NE7A 3BICA 4ZVNA 3Q4GA 4NJOA 4QGAA 5IF3A 3BH7A 2A33A 1P61B 4AJ9A 4EI7A 4IO0A 1G7RA 3AKYA 3T9EA 5M04A 5ALOA 3ECCA 2ZRIA 3MK31 4KQCA 2J41A 2BMWA 1OWOA 1E5DA 2IXBA 1N34B 3UUFA 4LDAA 2HMTA 4F2PA 4E94A 1H2AS 3T94A 3A7EA 3DVQX 1CF2O 1JHXA 1OFHA 2Q2QA 4RULA 3FOZA 4HYTA 2V6GA 3KWJA 2NSLA 4B0PA 1SUSA 5G02A 1HNNA 2Z83A 3BXGA 3FYCA 2MJLA 4TS3A 3KAPA 3SOZA 4NU5A 4RV5A 1NDQA 2A0XA 1KC3A 3Q85A 4DC9A 2EJUA 2GD6A 1VIMA 3OZFA 4J0IA 4JVLA 1NL3A 4EW6A 3KPJA 1IVSA 5EFOA 2XUOA 1HE1C 1A9SA 1QOQB 1MXFA 1Z4MA 2AEFA 2DCUA 3BHJA 3FAZA 1ZNQO 5J4HA 2HIHA 4K6CA 5DNVA 1YA8A 4OOEA 4AY4A 2DUUA 4CM4B 1ZIOA 2PKQO 2Q4RA 1KARA 4MWEA 3PUYA 4JYAB 4S1TA 4BB6A 2I2XB 4A91A 3GJTA 4JZKA 3VAZA 1E2FA 3QIAA 1H05A 1NVFA 4B44A 4KPEC 1PSZA 1N5JA 2H6EA 4B3RB 1XQVA 2D74A 3ZW8A 2FPPB 3V33A 4BB9A 5BSWA 5FV4A 3NTQA 5TT1A 2VEDA 2QZZA 4H7HA 2OZVA 2VHCA 3LUAA 4R8SA 3L0BA 2VAVA 3WFZA 3E8XA 5AJHA 4UVDA 2VF8A 4G0UA 5DYYA 3NIWA 4D8WA 3WV4A 721PA 1DJOA 3WMFA 3EOZA 1FW6A 2BFBB 1EPUA 1BW9A 2J6CA 4MKXA 5EFZA 2W90A 2WHRA 3L18A 4OYYA 3T3MB 2FSVA 2VWHA 5A7FA 4GYKA 4MPRA 4WY8A 4IG4A 1S2LA 4UC0A 2OHGA 4UCQA 4A0RA 3FTCA 5CFQA 3TL2A 4M0LA 1A7AA 1KO5A 3BL6A 3F49S 3LY5A 4G9GA 4PHFA 1WF6A 1GGJA 3ND7A 1T0IA 3F3KA 4QGFA 4RFVA 2BHTA 3CLRD 4MWSA 3SXPA 2VTVA 3O0TA 5I6DA 4LXTA 5EVCA 4K26A 4DMGA 5DM4A 2QD4A 4EECA 4UBJA 3JVUA 3KOXA 3ZD9A 1P80A 4ETWA 4EWLA 5BN4A 1LSOA 4P82A 4X8OA 3JD4A 4IIYA 4P0QB 3CVOA 2PAFA 2FNAA 3NC1C 3PEVA 4RMJA 3LP6A 4WECA 3QKIA 5HMMA 1HDRA 2HBZA 2JLRA 3B6EA 4YREA 3HUUA 3U4CA 4HEQA 2BE9A 5IRCD 3LZDA 3W5AA 1FUYB 3AJRA 3Q7IA 4NPAA 3GL9A 4HTFB 2P0YA 4LZPA 1VFNA 2R8BA 2Z8YA 5IYZA 2E7ZA 4IKPA 1NYQA 4I5GA 1YB5A 4V1CI 2R25B 2JFVA 4U5XA 2VPPA 4ATNA 3RVBA 2XIQA 2E49A 4KQEA 4N6NA 1STOA 1XMVA 2Q3LA 5CFRA 1ZM4A 1DFIA 1RRFA 3BAZA 1QM5A 5E9QA 1ZN7A 3NT5A 4A4DA 1WXDA 2P1RA 2J6HA 2YV2A 3S70A 4WZBB 2Q6KA 4MARA 4CE6A 4CM9D 3B2EA 1MA3A 4MYCA 4DCMA 4ZCSA 4I8XA 3LDAA 3P0HA 4WZAE 5LA6A 1BKDR 4YO7A 3LECA 1NKTA 3RFTA 2A3NA 4WT7A 1WCV1 1GFZA 1XD2A 3TIFA 1EQAA 1U90A 4V39A 3VPDA 4HRVA 3TBHA 5J47A 3I4CA 4KYUA 1J5PA 2WE7A 4HLCA 1AXGA 4V24A 1IZ9A 1MO6A 1LK5A 3EUAA 3TOSA 2PRSA 3HWWA 4MSUA 4HUTA 1X9GA 2X1MA 1NASA 3M2PA 2HDOA 4Q66C 1F8XA 5IVPA 1AXRA 3V8BA 3C3DA 2FEAA 3FETA 5DHAA 3VUEA 4ENSA 4MAFA 5CB0A 4DV3B 4TZ6A 4JOCA 1JB1A 3U7RA 5DPMA 1J0CA 1V5WA 4B7XA 5FWYA 2P6RA 3LKZA 2HK8A 4RJ2A 3ILVA 1SU8A 4ZKDA 3L5KA 1DT5A 3SBDA 5J4VA 4JI2B 1RAIA 3F4BA 4RZIA 2P30A 1Z2PX 3HGMA 3IAM1 3U17A 4P54A 3A3YA 2O5RA 2BH9A 3R7NA 3WB2A 1L4MA 2QMQA 1RMQA 4UFPA 5AFSA 3WWDA 4A8HA 3DAPA 3LLSA 1MHPA 1C8VB 1EUQA 3F7TA 1DBVO 3WK7A 3EW7A 2OORA 4WL0A 3KJIA 4H3KB 4PPYA 4UTVA 3ZHOA 3QY0A 3GRZA 1C4WA 1X0XA 5EJIA 2DE0X 2HMUA 1XLTC 1XTZA 3MJHA 4TLMB 3M89A 5E2BA 4AZ0A 5C3MA 1KWGA 2JFZA 3RTGA 4Y7CA 3FNQA 1PR6A 2IYZA 1PJ4A 3EIQA 4EI9A 1Z13A 1Z26A 4R7TA 4UTZA 3D0QA 1GVNB 1OFVA 1R5OA 2VXOA 3QU5A 3SNHA 1AKWA 1GZVA 3EZ7A 4BRZA 1FQJA 3CZPA 4IM7A 4R16A 2QZ9A 4IUDS 3P5BA 5GADl 2ISSD 1L1EA 2HMSA 4E5PA 1E9FA 1RI4A 1BSVA 3G59A 2YIJA 3BRWA 2P1DA 3HJFA 2HGZA 2RGGA 3HLTA 3PENA 4R9NA 1QIKA 1AGPA 1CY2A 1AXEA 3LDUA 4X0EA 1JHAA 1I2CA 5CB8A 1UZLA 1O97C 2OR3A 4RMNA 2AT1A 4MQ5A 2I2AA 3MJFA 2F00A 3W06A 4EFKA 5FR1A 1NMYA 4GR9A 4AF6A 1O2DA 1UMCB 2J46A 2XMBA 1ECGA 4HX5A 1M3SA 3K30A 3CINA 2AFVA 3JRXA 3L1VA 5CFNA 1YGYA 5HX7A 3HBNA 3WLEA 2TECE 3UBTA 1A4UA 1FTQA 1OILA 4JBGA 5A9RA 2HF9A 3RLFA 1G5HA 3DNPA 3IVXA 4MWOA 2CNNA 3G5MA 5SZKB 3MJVA 1ZUNB 4I36A 4C7BA 3KQYA 5K99A 4E5SA 2ZAMA 5FI1B 1TO6A 1G8PA 2MHCA 3B89A 3CB4A 2FB9A 4I7EA 3ETGA 3OT5A 4JIGA 4RD0A 3TIGA 4D5EA 2ZYHA 4MYSA 1PDWA 1RCFA 2G72A 4L7VA 3RRJA 1TUEA 3CX4A 3CUTA 4NYJQ 2B5OA 1YDHA 4ZDIA 4BNDA 4O2AA 3EUWA 5FIUA 2ZWVA 1HEYA 3T0GA 1XA3A 3PFGA 4I5FA 2TMYA 4TTJA 5FOVA 5IC4A 1W25A 5F1YA 1J07A 1Z6TA 5E6UA 2P3LA 2PMBA 1Q1EA 1FP7A 2QRQA 3BGDA 4BWYA 1BQEA 1Z6XA 6REQB 2PS3A 1UP6A 4BBJA 4F1JA 5F7OA 4I1IA 2I3BA 1PQWA 4L8GA 1NFFA 1R0LA 2ONZA 2ZATA 3BXHA 1PGPA 1VE3A 4JUAA 4YBZA 2QK4A 3UUGA 1ZAYA 2D6FA 1EAMA 3WMRA 2DPMA 2NWQA 3JQAD 3LL7A 1MABA 2D0OB 4Q1VA 3TLCA 3WE7A 4HB4A 2LKDA 3IB3A 1PT8A 3R74A 4G8DA 4FWIB 3EXFB 4QDTA 1AZLA 1Y80A 3R40A 3ZJ4A 1NMXA 1U2DC 3O26A 1I9CA 2GYYA 2Y1OA 3IDSA 3RAPR 4UTXA 5G0TA 3HNRA 3VPHA 3WA6A 4CKEA 1CUWA 1ABBA 3F6BX 4ZIRA 1OV4A 3M9XA 2ON6A 1PZFA 1T25A 5D00A 4FQ8A 4D3YA 4DTIA 2GHIA 2XMPA 1VIVA 5D6NA 4P58A 4C4AA 1RFLA 5CA0B 1J9GA 1YJXA 4Y2UA 5DOVA 3WYCA 4C06A 2LP4Y 1RJGA 5F7XA 2XD4A 4BLTA 3GK3A 2OHFA 3EQ8A 4XYEA 3RRYA 3NYRA 4PFJA 1QO7A 4ZV4A 2E0IA 1XT6A 2WF8A 3M9LA 5CTJA 4NFLA 5DH9A 4LE2A 4F92B 3O8OA 2AK3A 4JB0A 4W1SA 2GEJA 3H2SA 2VP0A 3VOSA 3MAGA 4I50A 2NLOA 1Y8CA 4PO9A 5AVTA 4DQVA 1NX9A 3ZI0A 2XKBA 1TXGA 1ONBA 1U2PA 3EK2A 3UB2A 1APBA 1GCIA 3I83A 3EDYA 4IIVA 2QROA 2CC2A 3KDPA 2D06A 1MR3F 4GPTA 4IOMA 1CIJA 2DEUA 2VKQA 5AVQA 1EZ4A 5FBHA 2CNDA 2XVAA 3P0IA 3IOBA 3PZBA 3HA5A 5F73A 1GDTA 1OVGA 1LRKA 1XO1A 1JMKC 1S3SA 2AYYA 3ANXA 3BDIA 4BZWA 3C1OA 2PL1A 4XDYA 5G41A 2D54A 3L84A 5EXXA 2RGWA 4AY3A 1N2BA 2I99A 3OETA 3AFIA 3OHSX 4IS2A 2BMVA 1CIVA 2WU3A 4KXQA 1J0EA 4RESA 5B58C 4L7QA 1N5IA 2XMCA 2OFXA 3OURA 3EGDA 1RYZA 4LHXA 1XTBA 2CJFA 2FQYA 3UWOA 1L7XA 1SC6A 2Y9PB 3L8GA 4B85A 3DQZA 1EUDA 1BDMA 2DPGA 2J3EA 2JGMA 4FBMA 3DOCA 3IP7A 4FYKA 3HG7A 4KZPA 4IVPA 5CVJA 4FYHA 1T4DA 4QLBA 2KX7A 1SUPA 1X6VA 1YZGA 2N9UA 4P38A 4QLAA 2QN3A 4XQEA 3ZLVA 3UWPA 2XX3A 2H7YA 1NJ6A 2VBFA 2R3SA 4O4IF 4RD2A 3SKXA 5BRJA 3NALA 4GRDA 3WHIA 1GO2A 3OQPA 3BHNA 1THTA 4X97A 1FVHA 1KPHA 1LZLA 4OCZA 3LBNA 2OCDA 3PSHA 4PC7A 2BD0A 5EUQB 3RTDA 1M6VA 4HZUB 4JQYA 3R7SA 2VHEA 1ZESA 1J7JA 1X7XA 3HRKA 4JL8A 3OQMA 3FCSB 5JAIA 4LAFA 5ECDA 4M9ZA 3PHHA 4ZYZA 4EP1A 1ZLXA 1VSQA 1KY2A 2QUJA 3W79A 4RX1A 5KWIA 5IBCA 1W19A 3H83A 3VKUA 5AKIA 4YK7A 4QG3A 1CPYA 3N2YA 2FV8A 4D8UA 3DVRX 1L4LA 5IHXA 1NU8A 3H9QA 2ATVA 3AKZA 1T5LA 1G9TA 1Z5GA 2ZRKA 1P77A 2ZBUA 4DV2B 2OKGA 4MK4A 2FJPA 1VJRA 5COAA 4ZOBA 3TYXA 2Z57A 4OHYA 1GZ6A 4BE4A 1E6UA 1GPJA 4FUTA 3SF8A 2HU5A 3OA0A 3HKCB 4MV6A 4JJEA 1EUCA 1UBTS 3AFMA 3QXGA 1VSUA 2XGOA 4UOQA 4TWBA 1V1MA 3SHOA 4C2TA 3PRYA 4FMCB 4AP5A 4EO9A 1EQUA 3NP9A 5E1DA 4ZYWA 2GBCA 4PQRA 5M7EA 3MYRA 1YA4A 5DHRA 5I9SA 2V9CA 2ZVQX 2FFBA 2IOYA 3HJRA 4Q3DA 4MP3A 4C0SA 3TTWA 4CQMA 4YR7A 4I1PA 2ZPUA 4OYHA 2Z6AA 1KFKB 3NOVA 2R85A 4HX2A 4ZI7B 1L7QA 4QUJA 4L0QA 2R1UA 2YQ4A 4HGOA 2CCGA 1NC3A 2FXVA 3HJUA 3IHLA 3OIDA 1VJCA 2H59A 4JVOA 4F71A 4IMPA 1SXJE 2QV0A 3PGJA 1HLGA 1XUOA 2IZ7A 1R74A 3AR3A 3QHQA 1T9DA 2LE0A 3N2NA 1WUHS 4OK6A 4RA9A 3VJLA 2Z2YA 4GL4A 3WSTA 3FSEA 5FI3A 3WL8A 3FCEA 2HBYA 3GFPA 4O2RA 1WW2A 3RS2A 4EB6B 2FFQA 2ZE8A 5EJEA 3CNBA 3MLBA 5IKEA 3MC1A 1K6EA 3ETLA 3GMTA 1FCJA 3DV0A 4RHFA 4TLLB 3TSOA 2RIPA 2BKVA 3CSUA 3QITA 1RT9A 3I5XA 1QTNA 2H2AA 4S3MA 1CUBA 1E5XA 1GTL1 1UZMA 5AD1A 4C0XA 3VH4A 1ONPA 8GPBA 1KAOA 3EXAA 3IELA 2R6ZA 3NOOA 5EZYF 5C8ZA 4G0WA 1Q0HA 1MX9A 3PI7A 1OLXB 2ATXA 5BV0A 1KJJA 3VOTA 2BLLA 1IY0A 5F3DA 3I73A 4Q3BA 4A03A 3F2IA 1E1RA 4Z1OA 1FU4A 2V7GA 3KSBC 4CM7A 1TK2A 1E60A 5BSGA 2PKRA 2V7VA 4Z7QB 1RKBA 2JGAA 2L69A 4AMYA 3GT3A 3OZWA 1S9HA 2VSYA 3U09A 2FPXA 3R7AA 4BEVA 1W87A 4FYJA 5HTOA 3NWOA 3C14C 4UATA 1OI3A 3W6NA 5JXIA 4EB3A 3AETA 5J2TB 3FDXA 1NG9A 4LJ5A 2Q9AA 2A5GA 5DCWA 3IEPA 2GX6A 4H9GA 2VUSA 1GA4A 4C7XA 4Z9YA 3D4IA 1J97A 2PFSA 1MFZA 2GZMA 3CLRC 1AUOA 4JOBA 3OSUA 2IU0A 3AJDA 3LLCA 5EMHA 4BDSA 1AO0A 4FCCA 1UXOA 3FTQA 4IIFA 2Z09A 5EXEA 2IW3A 1CG6A 1Z8FA 3D6FA 1Q95A 1IVNA 1U28C 2IYTA 5CK5A 3FF4A 4YN3A 2F3PA 2FQQA 5DGDA 3PNOA 1Z8HA 4GS5A 2VJMA 2P2YA 1XTRA 4LWPA 4ZQEA 4BHTA 1L5QA 1FFAA 1J2RA 3AEQA 2D2EA 4JXZA 1GQRA 1CFJA 2CXOA 2IV2X 2IYFA 4ZXFA 4GOOD 1XJCA 4U6SA 4ZOLA 5ELLA 2IQIA 3FLMA 3OVMA 4TXLA 2VS1A 3CWQA 4R1LA 3UXEA 1T8UA 4P36A 3J7AC 2HAEA 4ZEWA 4IOKA 1G5PA 2ANBA 2XYGA 3AB8A 4GLFA 3SDBA 3PEYA 2J9GA 2E82A 4J91A 1YL7A 2PE5A 4KLNA 4HVCA 3NRBA 5JRZA 3MT8A 3ESRA 2ORED 3KT6A 4Q9NA 1N1GA 1LF5A 2Y1CA 3AGQA 4JA2A 1G3QA 3PFKA 4LXGA 3VKGA 4NESA 1NQXA 1C0EA 3BRWD 3FPJA 1J23A 2G0AA 3Q1KA 4R0NA 4P3PA 3X44A 3KKKA 2QV7A 2HJRA 1XCPA 4J0EA 4Z0PA 1O03A 1TRHA 1YS9A 5EHQA 3IT3A 5JVDA 2OFWA 1JDBB 1DAFA 1O89A 1TCAA 3IV7A 2IELA 3GVCA 3UK2A 4DPLA 1E3SA 4EOGA 1W4AA 4TUYF 5HTKA 4IDDA 3MTAA 2WQZA 4M7PA 3KOOA 4KTTE 2HA0A 5GZ1A 3MJEA 4QOSA 4M0MA 4CF4A 2VNSA 2WRZA 1TU4A 1QKIA 2Z58A 3GYGA 3IIEA 1X8LA 1W6UA 2FUEA 5EXTA 1LPBB 2LNDA 2DBRA 1II8B 4RDIA 3ZV6A 1NLUA 1TZCA 4BO1A 3GWGA 1WETA 4OYRA 3IDOA 4CV2A 1KO4A 1XEFA 3K1ZA 1W7AA 5K6TA 3FPFA 2VH5R 3HL4A 3NQ41 4UUQA 3VSEA 4BJ6A 3GFVA 2FW6A 2PKCA 2NQ2C 4CIAA 3JQRA 2V6FA 3KBBA 4YI5A 2DYKA 2O8CA 1R8SA 4M9SA 4PPQA 2G7ZA 3UJ9A 4ZAGA 2ZIEA 2YJ5A 1G19A 7MHTA 5ECGC 3WBBA 5B3JC 4BFTA 1U3UA 4FPXA 4MW4A 4L07A 4PRZA 3B6KA 4REOA 1CVLA 3LT5A 2XKJE 1YR7A 3A0RB 4LI0A 1KK3A 3EX7C 3SEZA 3RK4A 4XWKA 2V7QA 3H13A 1QGAA 4E1VA 4F97A 4FJ2A 2CVQA 3RFVA 4BFSA 3V2HA 4ZT2A 1A71A 4NV0A 4PG7A 1PV4A 3F8WA 3GRAA 4E4RA 4B35A 3FKJA 1COZA 3LBYA 4YJ3B 1G9SA 4BJ3A 3T3OA 1ZSYA 2I03A 2C5GA 3Q0TA 4QWMA 2DT5A 5SYAA 1SGWA 1GCUA 2FPMA 2FN9A 1M6HA 2Y66A 4RBNA 5H80A 5IKOA 3QTLA 3C97A 3M1AA 2QQFA 4NPCA 1NIPA 1Z37A 1V3UA 2VF7A 5DNCA 6YASA 1IY2A 1FP4A 1M5TA 2A6PA 3FD8A 1ZVKA 1LQ2A 4L85A 2RGCA 4L3VA 3ROGA 4E2XA 3KBOA 3M70A 3VGPA 1JA1A 4LJAA 4CG3A 1DHTA 1FPMA 1RJDA 5EEHA 3RC1A 2CL6X 1P4RA 2AFHB 3HMQA 2VL7A 4H0CA 3M3HA 1ZCAA 5JEDA 5T4HA 1JPNA 3TCKA 4PSKA 4TMZA 4CG1A 3FOFC 2RAFA 2GK7A 5HQJA 2O1WA 4BE7B 5ELMA 4O1HA 4R1PA 3QBEA 4JJKA 1X8XA 3CB2A 2J08A 2N3ZA 4C0HA 2XLCA 4CFSA 2MSDB 4KWEA 5FWAA 4QLOA 4R8KA 2L42A 2FF5A 1OIVA 2Q1TA 5AUQA 3SJAA 3NCHA 1JLLB 1EFRA 1P0IA 1B76A 3LQFA 4DT1A 2ZBVA 1E3DA 3KTDA 1NRXA 1ZW6A 2ZUVA 3MTDA 1TT5A 4IRUB 1HZZA 4F2DA 4MR9A 1RZUA 4KMSA 3DBLB 1OTXA 3SS8A 4ZGWA 3BFXA 4GR4A 3SZUA 2OEPA 5AHXA 4BC1A 2GZHA 1EU1A 5KWVA 1PR0A 2CF6A 1PV2A 3DFIA 4AY6A 2YV1A 1JDTA 3IERA 4AYTA 4XM2A 4L08A 2J0QA 3KDAA 4G1BA 1NUHA 3HU5A 4I1RA 4K88A 4PRLA 5ESDA 3AUSA 5BY2A 2Q6LA 3LW7A 5FTWA 1JFTA 2QN7A 1YJBA 1H1LB 1VPEA 2RBEA 2ISCA 3GD5A 2QL7A 1TM5E 1KU0A 2JH3A 5B6JA 2IRWA 1S96A 4OXYA 2VNAA 4Q0MA 1X8KA 3K96A 4QU0A 1DAOA 1C5KA 4RIIA 2Q5FA 2X2FA 3QOYA 2YWJA 3BE5A 4CEJB 3NP7A 1P9LA 5HF8A 1GGEA 1GGKA 1HYBA 2FZ4A 1VHDA 2AXPA 2BEUA 1OB5A 1EXNA 4ZPXA 1Q74A 3CLHA 3PQ7A 5BT9A 1XVTA 4UAVA 4N5LA 3ELWA 2EBUA 1J56A 4LRQA 4MQEA 4KKXB 4QDZA 4PO8A 1ZN2A 5HW0A 3N5KA 4CKBB 1IXKA 1M10A 3VYTB 1OTYA 1RAGA 2W6PA 3N2GB 4FYMA 4XSHA 1Y7IA 1DX4A 2W9XA 2Q07A 1HQKA 4S2EA 5BYKA 4WVLA 1JGTA 5LIPA 5EIXA 1AD2A 4LG1A 5K6AC 1ACLA 1QZXA 1KOJA 2JZNA 3O3CA 4N0PA 4RTKA 5LOVA 4BJ1A 1QYIA 2QW8A 2VCHA 2G70A 3OWHA 4I66A 2AUMA 4ZRDA 1UPFA 3F3SA 2N46A 4DCTA 4A0FA 1AU9A 1OLOA 2WT9A 1FIUA 5C8DA 3I34X 4QNNA 3BD6A 4JQOA 3EVAA 1RPZA 1N3BA 1S8AA 1T43A 2H1SA 2V5UA 1C7RA 2JFYA 2YFKA 1GFIA 4ER5A 2VKTA 3LA8A 4KSCA 4F4IA 4LJ6A 1R0ZA 2DQZA 1W88B 4IFEA 3UM9A 4MW5A 1NV8A 3IQXA 5B1SA 4CMIB 2JHAA 1CYEA 4J6EA 4JT8A 2HD4A 3N74A 4I6EA 3O8QA 1G8AA 2I8LA 3CJTA 3MT9A 5FL7A 4B09A 1ECJA 3BQ9A 4IJMA 2FE1A 4AJLA 4QSMA 3GYBA 4CU5A 2BUCA 2FWRA 1W4CA 2Z2ZA 1XQ6A 3EY4A 1QTQA 4LKRA 4LCJA 4Q03A 1W5AA 1PYGA 4IP0A 4CQMD 4DJEC 1E9AA 3A1NA 4GPEA 3A9UA 4AG5A 3BHIA 3ZU3A 1RCUA 2Z0MA 4EHLA 1I01A 3KXLA 4FOSA 1C3VA 1VXRA 4ESEA 3CKKA 3SFZA 4KO3S 4X20A 4HGYA 4HUQB 1Y82A 4PTLA 1VCOA 1XCLA 1E94E 4BVBA 3FHOA 1E1DA 1L1QA 1P4AA 3FTPA 2GR9A 3IEUA 3QVUA 2JPDA 4B73A 1SXHA 4GLOA 4ZARA 3AR8A 4FFVA 4XVHA 2GRAA 2XRFA 2QW1A 5LZ9A 3ODPA 2O2GA 4NMHA 1G5FA 1DC3A 1G7CA 3KLOA 3I9FA 5FA5A 3C43A 2OV1A 5TPWA 4KUGA 1BN6A 2REXB 4AJIA 2O1EA 4INJA 3FNHA 1U65A 1N92A 1Z73A 2G06A 3AY3A 1YIAA 2BZSA 2ZSJA 2ZXEA 3L7CA 4II2A 3U1VA 5A2GA 2I9PA 1E1RD 2G5TA 2PLAA 2PTHA 2FZWA 4M1SA 4DJ5X 1Z33A 4ND6A 4D4LA 3QNMA 3KSUA 3MZ0A 2BVNA 4I3GA 1L4EA 1Q7GA 1KSJA 5BT8A 5TVKA 5JQGA 5A0VA 4TYPA 3CR8A 2QP3A 4G6ZA 1BH2A 2GEDA 1X92A 3O21A 1KQ3A 1VPDA 2HFJA 1I3MA 3GRPA 4OGFA 5K2OA 2FSVC 5JBIA 5MF6A 1F9EA 1IUNA 1UXGA 3PUJA 3O91A 5KU1A 5CTAA 3HV2A 3N6RA 5E4TA 5EMLA 5GGXA 3GAFA 1K5GA 1DEHA 3AHGA 1DIGA 1DRUA 4US0R 3ADOA 2LW7A 1GRVA 4KI0A 4YFVA 3TVDA 1SZJG 3WWEA 4BDTA 3QEAZ 3R7DA 2WB4A 3TRFA 3FFWA 3RSZA 3WL7A 4Z2AA 4JEHA 1DIAA 1FFCA 1Z6YA 3AV3A 4FD3A 3T7AA 4C08A 4OL9A 4RTRA 3RC9A 4UPEA 1U1IA 2LTAA 2A58A 3OQNA 4OSOA 1NJ5A 1H2BA 1SJ9A 4WERA 2X58A 1JN0A 4CV0A 1RWBA 3SI7A 2VF4X 3DLBA 2JAHA 4LXUA 4EYEA 2AQ8A 3NDIA 4WGFA 3GJQA 2P9TA 3CZQA 1UM9B 4GBJA 1R3DA 4U0JA 5JJIA 4MUEA 2B69A 4PRKA 4YP5A 3DSRA 3ROZA 4E4TA 5KNCA 4L4XA 1FYDA 4Q18A 2VSQA 4IG9A 3ZGNA 4YC7A 3SLKA 4RORA 3RUAA 1Y5NA 3OOEA 1D0SA 3OQ1A 3QXXA 4KW7A 1E6CA 1PQYA 1V4BA 3AO0B 5EGNA 2IYXA 1MOSA 1NTRA 3TX6A 5GZ3A 1KHTA 2QORA 4B40A 1NW6A 2B9EA 2HREA 1GG8A 1Q1ZA 2KWIA 2UZ1B 4N3AA 3TWOA 2VJAA 4AZSA 2ONKA 2ZULA 3PA6A 4A1FA 2GYWA 2HDWA 2YIMA 2NYVA 3G8BA 4G56A 3BSWA 2I7XA 4HB3A 1IY8A 3E9RA 4R2JA 5DCYA 3QNUA 4LJYA 4KXFB 4EGAA 4RNCA 5C7LO 1ZL0A 5JANA 3SHFA 1P73A 2QGNA 4JBHA 3N8GA 3ZWMA 4FWTA 4BNHA 1RLJA 5DO9A 4FEAA 1G8JA 1PNVA 3BA1A 3CCBA 5IHPA 1M1ZA 3FRHA 2G6BA 1OFUA 1HEUA 2WMNB 3A2MA 1RHKA 4QXQA 3FTDA 5HR5A 5K9ZA 5KYXB 2V3VA 4NPHA 2B7BA 3RJZA 2C8LA 2W2MA 2WFMA 3ZLTA 5C5CA 3TQRA 5K51A 3WBKA 2C9MA 3EMBA 1AKUA 3DDWA 3L46A 1N7JA 3FRIA 1D8TA 3H1FA 1F4PA 1C30B 1YZNA 3GX1A 3IE2A 4M0UA 4TV9F 4EG1A 1G5RA 5KREA 4PLYA 2JH8A 3ROPA 4TOIA 5T4FA 4XJTA 2FP4B 2OM2A 3GG2A 4N3NA 1ZKMA 1GNLA 2HLDA 1BA3A 5CNIA 5JS6A 5A6SA 1PFVA 3QKWA 2OORC 3VKVA 4MVXA 3OOHA 4IAOA 5ALDA 2PWPA 2FPIA 3DMYA 3EF0A 1P0CA 3EDQA 3EDCA 1SIBE 4DCNA 4YT8A 5KU7A 3KQMA 1GZUA 4M9XA 3UV6A 2KYRA 1UAYA 3L82B 3ANSA 2PYIA 5CG1A 1J0DA 3DM5A 3F5FA 2NT4A 2Q6TA 4HN9A 4EW2A 1ZD8A 1U2EA 3JQ8A 3HO6A 2D1YA 5HZGA 2JL1A 3CX8A 5EQTA 5FBQB 4NP6A 1PJ3A 2WD8A 1H66A