2BCGY

Structure of doubly prenylated ypt1:gdi complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 66
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bcgY00
1FPMA 2B8TA 1O87A 1GIAA 2UKDA 1N6HA 4Q21A 1X8KA 3A8TA 4ABYA 3GLGA 2QZ4A 1UKZA 3U7FB 3THOA 2XNDA 3WNBA 4DLRA 4HLUC 4ASUD 1UPTA 4PPQA 2WJGA 2O8EA 1OV4A 4NCIA 4OBEA 5EJEA 2JLVA 4A0RA 2PLFA 3CWQA 3NDPA 3VX4A 2JEOA 4YXWD 1JQLB 1XTSA 1AJEA 2AWOA 2P2LA 3AH8A 3A4LA 3TVTA 3R20A 1ESNA 1Z6YA 1ZU4A 3NBXX 3KJGA 2C78A 1LFDB 3U2QA 1KK2A 4G5OA 4DLXA 2PZEA 3QUSA 4OI1A 3NXSA 2IC5A 4LJ7A 1XD2B 3FHTA 1E2KA 5EE9A 1EG7A 1VYVA 2AR7A 2G0NA 3L2OB 3LXRA 4J0QA 3EIQA 1YZTA 2IT1A 821PA 1CLUA 1W4AA 4D25A 3QKUA 2XOKA 3BB3A 5KU1A 1T6NA 4A36A 3HYTA 1E9CA 4I81A 1Z07A 1OH8A 5F3WB 4C0QC 1NL3A 1TQ2A 4EQ6B 3C15C 3Q9LA 1UADA 3TSZA 4IVPA 1E9SA 3C5CA 3LX5A 5IT5A 1US8A 2FSGA 1G7CA 2RGBA 2W0SA 4AKGA 4JT4A 1E96A 2O8BA 5JJIA 4A9AA 1BMFA 4FMCB 5FL7A 3RVBA 4BEJA 3WYFA 1R2QA 1SKYE 1N6NA 3OEED 1Z22A 4NH0A 5JBQA 3W5IA 3I61A 1FX0B 2WWIA 4FN5A 2W6ID 3QENA 2A2ZA 3RRYA 1P7CA 4ILEA 2CE2X 4GOJA 3LVRE 4M53A 2GJKA 3FWYA 1UDWA 3M6AA 1H8HA 4PHFA 4XTRA 4B33A 2FDCA 3CF0A 2R6CA 1KSJA 2XX3A 1N3BA 3OAAA 3QI2A 4K8OA 4QGGA 3EC1A 1OIVA 4ZO4A 2B7BA 1NG1A 4LI0A 1E2HA 1WB9A 5CK4A 4IHQA 3P4YA 2IWHA 1CXZA 2CVFA 1MOZA 4DB2A 5LBIA 4DCNA 4QGHA 3WBJA 3U4QA 4DLWA 3CH5A 3CZQA 1GNQA 2TMKA 1JR6A 2VSXA 4M21A 5EP3A 4PSAA 2C9OA 2H1LA 4WZBE 3MWJA 3SBEA 2QM7A 1U98A 1N5KA 1EFCA 4C0JA 4F7WA 1N2CE 2ZYUX 1ETUA 4ZDJA 4N1AA 2QMOA 2A30A 2QBYB 2GVZC 2QA5A 2ZI5A 3PUYA 4JIMA 3AB3A 3C7KA 2RAPA 4BRWA 5B57C 1GP2A 2MMCA 5SZKB 4DLZA 3EA5A 3VHXA 3PEUA 4P33A 2W00A 4TMXA 4NBSA 2OHFA 4N3NA 2OESA 3SJBA 5F98A 2QM8A 3TBKA 3ZZUA 3R9XA 2WWWA 2N46A 4M1TA 2WWYA 3JVVA 4IDNA 2G83A 4RKFA 1ZCAA 3T5DA 1K8RA 3SBDA 1GKYA 2XB2A 3C16C 2W2TA 2IXGA 5FTJA 1XTQA 3A1SA 1XEXB 2PT5A 2RKOA 3BIFA 3T34A 3IO5A 3VHLB 1TQDA 4GRAA 5EUMA 3HJNA 3CX8A 3WYAA 3AKCA 3UMFA 4C0KA 3SI7A 1VG9B 1DG3A 1TF5A 2R9VA 2JDID 3FKQA 1IN5A 2O0HA 2WWGA 2H57A 1ZM2A 1KO5A 3MFYA 3X1YA 4EPTA 4CF7A 1E2JA 5CM9C 3UPUA 4TL6A 2QT0A 2XAUA 2OBNA 5JMTA 1AA9A 3OF5A 4QC2A 3GD7A 1W5TA 2RGCA 1M7GA 4C0LA 1G5PA 1ZINA 2QMEA 5JS7A 2XNDD 3IGFA 2JLRA 4FWTA 2OXCA 1KSHA 1NSTA 2HUPA 3I5YA 4KAXA 3DO6A 2XGJA 1DVRA 3AUYA 3W34A 3DHWC 4JLVA 4MGZR 3AVTA 3DVLA 1RKBA 4A15A 3B9QA 1P3JA 3GFTA 3I8SA 3RAPR 4AYTA 4EAQA 1Z0DA 4QM7A 1OT3A 4G3XA 3CB4A 3U3JA 4EFLA 2E87A 3THWB 3TRFA 4TWZA 4NYJQ 1KK0A 4CGZA 4B32A 1G3MA 1CJTC 3AP3A 4S2EA 4P4SA 1MO4A 4YQFA 2RCNA 5JHHB 2UZIR 2ECKA 3K0AB 5K8UA 4C2TA 3L43A 2KBEA 5CDFA 2GTPA 3QKTA 4D0LB 3SJAA 5G41A 4BWYA 4D80A 4GOXA 3W6OA 1XPRA 2ZJOA 5KTYA 5FH9A 4OI4A 2XSZD 3EZFA 1ONBA 4GI7A 3KUCA 4Z54A 4ZIRA 4I4LA 1CKEA 1YHNA 3CF6R 4Q1CA 3U7HB 3LV8A 4HAYA 1D9ZA 1KI6B 3FYHA 3EZ7A 4A0FA 3A1TA 4TL7A 5DLQC 4C0AC 1XEWY 1XWIA 5DI3B 3FMIA 1G3IA 1J99A 3IO3A 4KLZA 1Z5ZA 3W8RA 2IEZA 3QVVA 4HAUA 5FTKA 2VHCA 5JLJA 1L2TA 5FBQB 4N0EA 4W9MC 3E2IA 4X8LA 4RKEA 2PL3A 2CL0X 1E9EA 1TU3A 2IYRA 2B92A 3PQCA 1N6KA 2G3YA 1X1SA 1DO0A 1UKYA 3B78A 1GDDA 3BB1A 5JSZB 4DLVA 1M2OB 1RRPA 1CBUA 1SGWA 1XRJA 1ZAKA 1UBGA 4PQYA 4TLBA 2G0TA 3GJXC 5CJPA 2YWHA 1XFAA 5JS8A 4A6XA 4LJAA 2GXQA 4P4UA 3TUIC 4A2QA 5FTNA 2ZROA 1WQ1R 3ASZA 1XD2A 3AVVA 4ZDWA 2H8KA 1XDBA 3MMPA 2NGRA 5UKDA 1IQPA 1NVWQ 1RFLA 3EPKA 1OF1A 2FPKA 1IY0A 1TL7C 4TMVA 3SC3A 4EUNA 5KO2A 3I92A 4V02A 2F1IA 2D4HA 1XP8A 1JALA 3QEJA 4DDWA 1KTVA 1G8FA 1JR3E 1UFQA 2ASEA 2Z5FA 5FBRB 2P3SA 4FMDB 3KQLA 3QEOA 4NCKA 5BWMA 4B74A 1ESMA 1M7BA 3RABA 3AGQA 2H7VA 3W9YA 2Q9BA 2BMFA 1P2UA 2ZUDA 3KZ1E 4MUAA 2KBFA 4BRUA 1E9FA 2WKPA 2GZHA 1NMYA 2Q6TA 2Q3MA 2DY1A 1CR2A 4BPBA 4G1UC 3DDCA 1ZNYA 2FA9A 2CJWA 2REOA 3MWYW 3S1AB 4A0GA 4MRVA 3UANA 2R6FA 1G20E 4GPTA 5IF9A 2WWFA 2Q0HA 5KPDA 1R0XA 2QMHA 5J4LA 3F0TA 1EFRA 4LZZA 4DDTA 2VSFA 4DBLC 2JLYA 4A0HA 1NSFA 1DEKA 3D8BA 2FZ4A 3DOFA 2A5FA 4E22A 3ZVLA 1TQ4A 1RYFA 2ZSDA 1JEDA 2ZSFA 1Z0JA 1JBKA 1W7AA 3GP8A 1XEFA 3H0KA 4KO8A 2QTHA 1W0KD 4M1YA 2QN6A 3NEYA 4Q4LA 1M8PA 1Z29A 1KY3A 1EXMA 3IHLA 4URXR 4V0KA 3PR1A 3WYGA 3GLFE 2A78A 1WF3A 2X2FA 4NCNA 3I32A 3CRRA 4E5UA 1OB5A 1CR1A 3FFBA 4ZDIA 1HURA 4O2RA 5KDOA 2FOLA 1CTQA 3GLGE 1G8PA 1OLOA 5FBWB 1N25A 4KU4A 1YR6A 1R6BX 3UG7A 2QEQA 1E0KA 2QBYA 5CK5A 3SYNA 8OHMA 2BBSA 1DE0A 1NNEA 3KDSE 1SKQA 2K5UA 1E2QA 3O8DA 1Q1EA 1N0VC 2GXAA 4OI2A 4PO8A 1IOZA 1UKEA 3ZD7A 4TT3A 4H1VA 3HPQA 4B75A 3X1DA 2ZXUA 1VCOA 1FOEB 5BN4A 2OEPA 3SOPA 1I2DA 3RS5A 1ZM3A 2C96A 1U9IC 1XEXA 3H86A 3HDTA 4CVNA 3PEYA 1E2LA 1EFUA 2BWJA 2DPXA 1ZIPA 5LD2C 5HZHA 4RD6A 3OIYA 4B3FX 3LY5A 2ZI4A 4AD8A 5AUQA 5LD2B 5K8TA 1S8FA 1AGRA 3Q85A 2YC2C 1VMAA 4FMCF 2J0UB 5EP4A 2KWIA 3JZMA 5D3MB 4CEJB 3WNCA 3BXZA 3TIFA 2QROA 1AQYA 2VP9A 3FKSD 1KZ7B 2ZQ5A 4IOMA 2XNSA 5EE1A 1XMJA 3LH5A 4I1UA 5EE5B 5B30A 3BGWA 3KQKA 2GETA 2RGGA 5FOWA 5HKKD 2FSFA 3BFVA 1LF0A 4Q4JA 2BM0A 1FQKA 1S4QA 2C03A 4NYJR 4QNRA 1D2EA 1OFHA 4V03A 5G40A 4OQNA 1JXOA 2P5TB 3LFUA 3AUXA 4RZUA 4BLTA 2B8WA 5BYJA 1U0HC 3RANA 2CDNA 4FIDA 4PX9A 4PQRA 4IOJA 2WWHA 4QHTA 3THWA 5AJXA 3U44B 5K8IA 4MYUA 1F2UB 1YZQA 3O8BA 1QHNA 3CBQA 5FUVA 2V6IA 1E2EA 5EZ6B 2V55B 3QG1A 1UBFA 2YJTD 4C3ZA 3HU2A 2JLXA 2CL6X 5FPTA 2WOJA 3B1ZA 4MITA 1Q1QA 3SJCA 2DWQA 3HPRA 3PXGA 1NN1A 3WRXC 4EKDA 4AKEA 3SQXA 1VG0B 2D06A 5DGXA 4O25A 3CUEF 3EA0A 4DLTA 1XNJA 1GKIA 2WICA 3M0EA 1FW6A 4BZPA 4PAOA 3FDIA 1EFTA 421PA 4TZ6A 2I1QA 3GLIB 1KI6A 2H17A 1OJLA 4JLPA 1J70A 4OJKA 4YMWA 2FFHA 2ZI7A 1W48A 5DI3A 4TLCA 2WWXA 1M7HA 4KBFA 2QE7A 4QGFA 1A7JA 2AD5A 2XEXA 4BEBA 4I1VA 3AVXA 1G291 3QXXA 4MGKR 4DEXA 4C0SA 2HJGA 4QOSA 2F3RA 5GADl 2JLZA 1HT2E 3BS4A 4KLNA 1QHGA 3QKSB 4W7SA 1E1RD 4ASUA 3WXMA 4XSGA 3RC3A 3VMFA 2BOVA 3ZJYA 1XJCA 1OXTA 3N2EA 5JSZA 4TYNA 1II9A 2FN4A 1BYUA 1LF5A 4JVMA 4HAWA 3CRQA 1G8GA 4YXWA 1TMKA 2ZJ5A 1NP6A 2A5JA 3LLMA 3EIHA 5L3RA 4CIDA 1F60A 4RFSA 1GAJA 2Q3FA 3C41J 4RD2A 5FBLB 1TQ6A 4XWAA 1OH6A 5JFGA 3C8UA 1R5OA 4O3MA 4BASA 2X2EA 3W6PA 4PZYA 3MLEA 3NDBB 4CW7A 1KSFX 2GWHA 1PJRA 5TV2A 4IFEA 2CLSA 5DYIA 1GUAA 1ZYUA 1GKUB 2IYQA 4EPVA 3UIEA 1NVVQ 2QGZA 5TARA 2J46A 2EWVA 1AN0A 1QHHB 3HR8A 2NO6A 4XIGS 2V1UA 1E9DA 1U8YA 4I1OA 3CX6A 3I5XA 2Z6VA 5FPHA 4W5JA 2QI9C 4CT5A 1E6CA 3GEIA 2DFLA 5B58C 1AKEA 4RD3A 3QPVA 4PHTA 2DFTA 1I2MA 2OFOA 2IYWA 3L8YA 1G4AE 1GRNA 4A92A 4CDGA 2ZRBA 2QUZA 5E7JA 3ZQ6A 2VA8A 1PVOA 4MUBA 3BH7A 3DZDA 4TQ9A 1KOFA 2ZRCA 2QAGA 3K0FB 2RHMA 3PEWA 4QBGB 3FMOB 2FNAA 4UJ3A 1PLLA 3S1AA 3OEEA 4BQSA 1E3MA 4TT3D 5TY0A 3P26A 2H5EA 4MRNA 2W6IA 4OKSA 1Q1ZA 2O8CB 5GVRA 3ZLJA 1ZMXA 2QNRA 4G5GA 4JVSB 4NCHA 1HTWA 3SZRA 1OH7A 5SZHB 5KHOC 1XMIA 4TYYA 5JECA 4YMSA 4W5HA 4Q4AA 5JWOA 4JL6A 3SU8A 1MO3A 5CDFE 1RIFA 5D3QA 4F4JA 2CNWA 2VHTA 3NKVA 3OIUA 1S1MA 4DXAA 3V9PA 1NMZA 2YOHA 4BUJA 4HUTA 1YZGA 3UKDA 1IJFA 3ZS8A 3GJ6A 1GILA 1CRQA 2WMOB 3K70C 5DISB 2DCUA 3GJ8A 4BFUA 1EX6A 5DH9A 3GFPA 1A2BA 3CIOA 4MQBA 1XX6A 1YR8A 4Q47A 1A1VA 3K70B 1T8TA 2X1VA 4DEYA 2QSZA 3MG9A 1LTQA 2OE2A 3KKOA 4FINA 3SFVA 3QXHA 4UNQA 5CYOA 2IYZA 4P0TA 3UMSA 3R7WB 1LW7A 3TQFA 4Q66C 1YR7A 1BH2A 3BFXA 4HZUB 4F91B 1BOFA 2D2EA 2IUSA 2Z4RA 1ZNZA 1GFIA 1W46A 2RGNC 3OE7A 4GMXA 1UJ2A 3RWMB 2A7QA 1IBRA 4LYFA 4NMMA 1BIFA 1VCMA 4LV5B 4Q4HB 521PA 1XD8A 1SHKA 5JJKA 2GJSA 1D5CA 3K1JA 2NO9A 1KNQA 5FPKA 5GJCA 2CMKA 2PX3A 1DAIA 2CEAA 1B0UA 4AY2A 1KYIA 1YRAA 4TZ0A 2FV8A 4OHZA 2BMJA 2P0EA 3TSWA 3ADDA 3BERA 1CF4A 2E9SA 4IRUB 4RY2A 1FTNA 4LPSA 1WA5A 1PUJA 1AGPA 4IDHA 4FMDF 4LK2A 3PVSA 4ZKEA 3EC2A 1GITA 1RYHA 2QSYA 1GNPA 3K0CA 2WOOA 3CX7A 3RLFA 4N0DA 3FVQA 2VP0A 4QHYA 3KL4A 1G8YA 2MSDB 5D3MA 2HXSA 4IDPA 5BW8A 5B64A 1XJQA 3IQWA 4U5XA 2AFHE 3G82C 4LJ9A 4QKQA 1TX4B 4PC7A 3AF3A 2OBLA 4PANA 2YZ2A 3FHCB 4TSFD 2F55A 6Q21A 4BFXA 4C7OB 4LSGA 2XTZA 1EFHA 2ERXA 2WBLC 2ZI6A 4FW9A 1WRBA 4KFRA 3R8FA 1AM4D 2JJ2A 2FJUA 4R2IA 1HYQA 5AJZA 2VHUA 4D0GA 1HUQA 2XZPA 2IBMA 2F7SA 3IILA 3LDAA 1TPZA 3K9NA 1CJMA 3G0HA 4NL4H 3WHKA 5L3SB 1QVRA 4NDZA 5EXTA 3TSOA 4G5QA 4HB2A 3PUXA 5E3HA 5HR5A 2ZYWX 2FWRA 1F2UA 1VG1A 2RH5A 3IPYA 4HAVA 1Z2CA 1YVDA 1IN6A 2R44A 5A0FA 3CPJB 2G9NA 4F4IA 3ZVMA 1Z6TA 4PZLA 5HCIA 3IPXA 3GFOA 3CLVA 121PA 1PUIA 1ZRHA 3A1WA 5JEDA 2JIZD 4RD4A 4A2PA 3TAHA 4KITB 2DYKA 4U00A 5KSZA 1ZUHA 4URZR 4FI3C 4IVQA 3IIJA 3LA6A 4H9GA 1E32A 1KK3A 2XSZA 3MUFA 2G77B 5EE0A 5IK2D 1M34E 1WDTA 1P5ZB 3QSYA 3LX8A 5L8VA 1F6BA 1FUUA 1T4GA 4RD1A 4B3BA 1XEWX 1ZP6A 2WTUA 3ZZTA 3KTAB 3UK6A 3Q5EA 4AYXA 1VECA 1LB1B 2R62A 3O47A 3W90A 1FP7A 3GLHB 4CRWB 3GJ0A 3PIRA 5LDDC 1PZNA 2CK3D 3VU9B 2VHJA 3QKSA 3T1OA 3MRSA 3UG6A 2KJQA 4GP7A 4X8HA 3X1WA 2GVDC 3PFIA 5GJBA 2ZS7A 1P62B 4WOPA 4EJSC 4LY6A 4Q18A 3SEAA 2XTNA 1R10A 1G5TA 1Q44A 1X86B 4NYMQ 3B1YA 4PC3A 4EJSB 4CEIA 4GNKA 1FMLA 1ZNWA 2CNWD 2F9MA 2Z4SA 1T9HA 4Q1AA 1G9XA 3B5JA 1NVVR 4JS0A 4U02A 4Z1MD 1NKTA 2ZI9A 2NZ8A 3KQUA 2O8FB 1GOTA 4R7ZA 4OJQA 2J45A 4BECA 3AVWA 1ZM4A 2ODBA 4OYHA 3EWAA 2NOAA 1IY1A 1KJWA 2FE4A 3DPUA 4OQXA 2AXNA 1QHHA 1WMSA 4B71A 2IA5A 2QPAA 1ZIOA 2YVUA 1UF9A 3LBNA 4URUR 4TMTA 2OO7A 4Q5IA 4QRHA 1NBMD 2GBLC 1HV8A 4EPYA 1NMXA 4JYCA 4HB0A 2WSMA 2O52A 2H92A 1I4DD 3HWSA 3OE7D 2ONJA 1D2MA 1IXSB 1SZPA 1AK2A 4JVLA 4JJZA 4PPGA 5H68A 5FI1B 5L3QB 1NN0A 3CPHA 3CRVA 1J7KA 3K0FA 5AK0A 5EP1A 2V3CC 1DBSA 1S2MA 2BM1A 2FX3A 2WPDD 1YZLA 3ZZ0A 1E9AA 4Q9KA 1QHSA 2AL7A 1DAKA 3FGNA 3M4YA 3N2IA 4DUGD 3WBKA 4LHXA 4DLSA 3EXAA 2IK8A 4HI0E 2O8CA 2QPTA 4BLQA 1G5RA 4M9QA 2QL6A 4XTCS 1H8ED 2G1JA 1U94A 2J3EA 3TGPA 1QG4A 2IS1A 2EW1A 4DWJA 4MKIA 1KMQA 3KXLA 2REBA 4B2LA 1C4OA 2P5SA 3LW7A 5CIQA 4Q9JA 4WZ6A 2YWFA 3LQQA 1KJZA 2O8DA 2CBZA 3B7GA 3ND8A 2JLUA 3RRMA 3P20A 2V7QD 1PV4A 1W0KA 2ZANA 3QF7A 4D4JA 2J7PD 5EXXA 5FBVB 2WAXA 5EUQB 3VR2A 2QP9X 2RGDA 1X6VA 1QRAA 3A4MA 2DFKB 1FTSA 3LAWA 4URYR 1U90A 2D3WA 1D9XA 2A9KA 2J0SA 5J4KA 2KSQA 2IUUA 1W5SA 2FFAA 3L0IB 1KI7A 4C2UA 2JJ2D 1IN4A 1L7VC 3DKVA 1CEEA 2HEIA 2OCPA 4LJ6A 2VTKA 2VL7A 2XTMA 1XZPA 4FWIB 4KI0A 4Q4HA 4US2R 2RGNA 3NIBA 1ZVQA 2ZYTX 4KFTA 1ZU5A 1E79D 5DHFA 3AEZA 4EDHA 1GSIA 3BC1A 2WIBA 4BLPA 5KYKA 4PC6A 2LCFA 1XXHB 4ESHA 4CZ2A 5BN5A 3FE2A 1S0UA 2XB4A 2IHYA 1KI8A 3MAAC 1II8B 5FUXA 4AG6A 4IEIA 5JWHA 3SE0A 2KB0A 2ZJAA 2ODEA 4HDQB 4JSTA 4P3YA 4Q7JB 1ZUIA 2ZAMA 5LPNA 4WA7A 1KAOA 1DAMA 2BV3A 3OIWA 4R2HA 5FTLA 1TTTA 5DSZA 3VR5A 1XMVA 3BWDD 1P72A 2VIIA 4BLRA 3CONA 1NN3A 4GL2A 5GVSA 4DCSA 2VPPA 2VEDA 3B85A 4Q03A 2J0VA 3V4FA 5LB2A 4DKXA 1Q22A 3SYLA 1EWQA 2OLJA 2V9PA 4MYHA 2DWPA 4OQMA 2AKYA 3AQ4A 1Y63A 5GJWC 3IQXA 2G1KA 2ZRKA 3QVUA 3FKSA 2VQSA 1W4CA 5FUYA 2X8AA 4WBSA 1W1WA 2FPLA 4GMDA 5C18A 2D7CA 5EP2A 2NO1A 4XSHA 1NY6A 1G7RA 1NF3A 1WP9A 3QKRB 4B3DA 2PZFA 3KKNA 2YV5A 5EE3A 2PMKA 5HKKA 5KDLA 2Q9CA 4ITRC 4HLUA 3TMKA 2WHXA 2QT1A 1NRJB 2EFEB 4GSYA 5L3SA 3U3KA 2CE7A 1D2NA 1F2TB 3TKLA 2FZLA 2WV9A 4DB4A 5AJVB 2RGAA 5HCNA 4JLBA 5TMPA 2ZEJA 4D4MA 4ERNA 3CWZA 1MT0A 1RVDA 3NHAA 4YDSA 2QY9A 4JLAA 3N5CA 3PENA 1T0JB 4B34A 3L8ZA 2ZM5A 3BK7A 3RS0A 2ZVQX 4ZCLA 2NIPA 1HA3A 1RE0A 2PCJA 2AWNA 4TLDA 2ZSEA 2OCBA 4LUCA 4DDUA 3HU1A 1KGDA 4EQ6A 1KO8A 1T91A 2VSOA 2MMGA 4A1FA 1Z2AA 2OZEA 4GT1A 5J4VA 1SVIA 4LPKA 1IJEA 1EWRA 3KTAA 2PH1A 2YKGA 2QORA 2UVQA 2C8VA 3B6EA 3A4NA 4E07A 2W2VA 4Q9LA 1JPJA 1E1QD 2IEYA 4ZKDA 3O8CA 3H84A 4QJ4A 3NVAA 3D7MA 2P65A 5A5GA 1E1RA 1KKLA 3I8XA 4XOIA 1FX0A 4NYMR 3A6PC 3K0SA 2OM2A 3ECCA 4D4LA 1KI3A 4OHYA 4WVFA 4LC0A 1ODFA 5CIWA 2RHDA 621PA 4A8JC 2BC9A 4MRRA 5DI9A 4MGYR 5JCZA 3OESA 1YR9A 4K81B 2DHRA 5KNCA 2OFXA 4OK5A 4QBHA 3CM0A 3PUVA 3BJIC 721PA 4Y0VA 3AP2A 2V8OA 3CNLA 5JCPA 1VCNA 4Q9HA 2WZQA 3E70C 2ZS9A 2O8FA 4OK6A 4DCUA 3ZDQA 1XCGB 5G53C 1VG8A 5C46F 4AKHA 4M9SA 4XWOA 3K70D 3TE6A 3GCGA 4BFTA 2C77A 1G3RA 1XTRA 4DRZA 2AKAB 2QRNA 1BO6A 2ZSBA 1G7TA 3L0OA 1LS6A 4IOKA 1L4UA 3QBTA 1KZGB 2JJ1D 1E98A 3NH9A 4LBVA 4QHSA 2BHRA 4LJ5A 4TLAA 2GBLA 4LBZA 1QZXA 1W4RA 4JBWA 1EK0A 4JMPA 3PJRA 3B1VA 1GL7A 1YZKA 5FPSA 3IBYA 4E03A 3K53A 3CNNA 4UKDA 2GNOA 2AXPA 2C04A 4LYAA 2OLKA 2C5LA 2GF0A 3REFA 4DC9A 3UWKA 4O0MA 3QOFA 1ZM7A 2AFIE 3AP1A 5K8LA 4OHWA 4F92B 5A4JA 1VHTA 2Q3HA 4QGAA 3L0PA 2VH5R 1P9WA 2ODWA 2ZRGA 3OFND 2ANBA 1ZCBA 2GJ9A 3ADKA 2D2FA 4X8OA 1UBEA 1LNZA 2VP6A 5FUWA 3KX2A 3CZPA 1KK1A 1Q0UA 1VDZA 2GK6A 2QENA 4ESVA 4LJYA 1NJGA 4M2LA 4G5RA 3QIAA 1QHXA 4ON9A 4KV9A 4LWZA 3WNDA 1NY5A 1COWD 2O0JA 3Q72A 2ZJYA 1NVXQ 3A37A 1N0WA 4CEHB 4AKIA 1P2SA 4WIAA 5F2EA 1R0WA 1R8SA 3VNUA 2QGNA 3GLIE 1DTSA 1KMHB 1IXRC 221PA 5JWRA 4LOAA 1VCIA 2L0XA 1L8QA 3LLUA 3ZIAD 1G7SA 1LV7A 2I4IA 3K09C 2IF2A 1KO1A 4QJ3A 4OI0A 3VR4A 1WXQA 2WKQA 4G5SA 4JKYA 2HV8A 2OFWA 3OIVA 1Q57A 4GZMA 4KCGA 4RJLA 4Q7LA 4AIIA 3WP1B 3D3QA 5C4GB 3EPLA 1Y3AA 2ZRAA 2R2AA 4KFUA 5J4HA 1WBDA 1LVGA 3RWOA 2G6BA 2NMVA 1VHLA 1Z0IA 4IJMA 4XWKA 1QG2A 1GL6A 3SNHA 1DAEA 1OFTA 4S35A 2FG5A 1XXHA 3T12A 1TAGA 2BKUA 3W3AA 1VPLA 1MABB 4R9UC 2X19A 4TTRA 2X77A 4YONB 1ZJ6A 3N70A 1WCV1 4DIEA 3Q3JB 2WVJA 3K0AA 4Q1FA 2O8EB 2OG2A 4F93B 1W49A 4DIDA 4AYWA 4EFNA 1ZC3A 2IXFA 2A3RA 1IHUA 1G3QA 3DEFA 4MDFA 3U7GA 3EASA 3Q7PA 1VYUA 1DAGA 1MRSA 3A1UA 1YJ5A 2C9YA 1NLYA 4MRPA 4BGDA 4L9WA 4XVRA 2GDJA 4HDOB 1XTIA 2ZI3A 2WSSD 5AUNB 3B8HA 2ATVA 4L16A 4TN1A 1E0JA 2ZE5A 1HQCA 3KFXA 4GOKA 4LJ4A 4CT4B 4URVR 4V0NA 5DO9A 2W6JA 2QTVB 3NEJA 1XCMA 2N1BA 1JECA 4EFMA 3ZQJA 3KKQA 4TSFA 1S9HA 3AKDA 3GJ5A 1W36C 4MYCA 3QXJA 3QKRA 3R9WA 2HLDD 1AS3A 3I1FA 1TEVA 4B47A 2J87A 3H1TA 4AK9A 2GZAA 2A5DA 4P32A 1W36B 2QQEA 5HE8A 5FOXA 1W2HA 1US8B 5DN6D 5GJVC 2FFQA 2EYUA 1T8UA 2ZYVX 3AVOA 1F2TA 4M8NE 2O8BB 2IYLD 2YC4C 1KDOA 1PLKA 1SVWA 1XBTA 4OQLA 3TJZA 1JJVA 2JLSA 4RZ2A 1X1RA 1E0SA 3FPAA 3ICEA 2C2HA 1OIXA 1S1CA 3BH6A 3D31A 1M6NA 2BDTA 1RJ9B 2IYVA 4UQOA 3VTKA 1YQTA 2GHIA 2BIFA 1AIPA 1NIPA 1U0LA 2ZE8A 2JIZA 5IDVA 3FMFA 1P73A 3CNOA 3HR7A 4Z8XA 2YWGA 3SQWA 2OV2A 3B2EA 3FFAA 4ARZB 5J47A 1QF9A 2ORVA 4D2IA 3SFZA 5IK2A 4LHWA 2HDNB 5HTKA 4PQFA 1VIAA 4GP6A 4Q7KA 2ZITA 1YU9A 1IN8A 5FOTA 3QJYA 4RZXA 3ONWA 3BE4A 5AR1A 4A6PA 4R71A 4RCZA 1Z63A 3HYRA 1N6RA 2ZPTX 2CK3A 1FL9A 4B44A 1OYWA 4TLEA 3U4QB 3AF1A 3OHMA 5IRCD 1VKJA 2NZJA 2WKRA 3ADCA 4I1SA 4KJZA 3IEVA 5TDHA 1HQYE 5KDDA 4EIWA 1HE8B 5BN3A 3U5ZB 1E9BA 2YHSA 3I72A 3TNFA 1TEXA 4MDEA 5DE3A 4M9ZA 3AF0A 4XD7D 4GZLA 3HP1A 1EESA 2HT1A 2VO1A 4Z1MA 2IX3A 3KXIA 1HE1C 1QVAA 5TVKA 1CULC 3SS8A 3RHFA 1CR4A 2ZR0A 3Q5DA 3B9PA 4C9BA 3T15A 4EPRA 4M1OA 2BCGY 2BBOA 4JLMA 1SXJC 4M9XA 3QNUA 1K6MA 3K0EA 3TK1A 1V43A 3Q8XB 4LV8B 2W83A 3P32A 1SXJB 5DHAA 5L3VA 5KNDA 4ZPXA 1NBMA 2HF8A 5DIFA 4UNRA 4XH9B 2AHOA 3QPWA 1Q1BA 5AUOB 1E2MA 2V6JA 1FUKA 2Q21A 1G3UA 4M22A 3IHWA 1TF7A 2RGEA 1OPXA 1JI0A 2OXRA 3PUZA 3I73A 3B60A 3MWLA 4K46A 4RCYA 2WPDA 1JXMA 2BBWA 1KY2A 1TUEA 2ZR7A 3L0SA 3TR0A 2ONKA 1SVSA 2IUTA 4TL8A 4DUGA 3EW9A 4PZZA 4UXHA 2JGNA 4UXJA 3VR1A 3FMPB 3IDQA 1ANKA 1U8ZA 4LV6A 2D62A 4M1WA 1H8EA 4Z8YA 1CP2A 2VF7A 1DG1G 2BJWA 2ZRDA 4JL5A 4W5WA 3REGA 4DSUA 1TU4A 4M1MA 1HH4A 4LBWA 4NE2A 4YDHB 4C4PA 2IF0A 1U9IA 1YZUA 1DADA 3TLXA 1OW3B 1A2KC 2ZUCA 3A36A 4JL8A 3EWSA 3ND9A 4PO1A 4AI6A 3NH6A 1UEJA 3RS2A 1E2GA 2V7QA 3JZAA 3AVQA 3MCAA 3OEHD 4BFVA 2VHQA 2J0UA 2J9RA 5SZJA 2J7PA 1KMHA 1KI1A 4FXPA 3X2SA 4TQUS 4CEJA 2JA1A 3LBHA 2EFDB 2DB3A 1FP6A 3H2YA 2NPIA 3K8YA 5KSOA 4MKGA 2WIAA 2W6JD 3IIMA 2ZVPX 4WW0A 1BYIA 3W5JA 1GZSA 1EX7A 2JJ8A 3UATA 1E2IA 1TF2A 3VNVA 2H18A 2EYQA 2G88A 3A1VA 1Z6XA 4DJTA 1PLJA 1J8MF 1KDPA 5JEEA 1W44A 1GRQA 3KQNA 3QPUA 1E79A 2IS4A 3U44A 3CR7A 5FR1A 1G6OA 2EVWX 2KI5A 2PBRA 2ZRFA 1NJFA 2IYUA 1MABA 3PCRB 3AF2A 3LBIA 3T61A 1V5WA 1LY1A 2QQ0A 3WP0A 4YLGA 4PHHA 4Q01A 4OK3A 1J2JA 4M1KA 1HEIA 2J5XA 1ZD1A 2WJHA 3GEEA 4HLDA 1OXXK 4LHZA 1A4RA 2GZDA 2PX0A 3RSLA 1NG9A 4Q9IA 2IL1A 3VX3A 4GFDA 2F1RA 1O3YA 2FEMA 3D6TB 4KVAA 4QFMA 4QNMA 4BZXA 3B82A 3GLIA 3PEVA 3BORA 4JBYA 3TW4A 2JASA 4BZQA 5JI3E 1SQ5A 3ASYA 3NTUA 2ZSAA 4NHOA 1OXVA 3KFVA 1R5NA 2CVHA 4LBYA 1ZM9A 1E69A 4HLQB 1Z0AA 4HDCA 2ZREA 4JLDA 5F9FA 4Y0AA 3FTQA 4RZ3A 2FGKA 4Q02A 3VKHA 2HCBA 1YE8A 3GPLA 4POAA 3BD9A 4Q19A 4E09A 4MRSA 3Q7QA 3DMDA 2FU5C 2W58A 1IY2A 4HAZA 4LC1A 1ZUNB 1JJ7A 3X1ZA 1F48A 1WE2A 5CJ2A 5E95A 1CS4C 2R6AA 4MKFA 1C9KA 2OILA 2DWOA 5DNYB 4TTQA 2J1LA 3DM5A 2XZLA 1UEIA 3SHWA 4EPWA 2CJWB 1RJ9A 2ZAOA 4LYHA 4B3XA 2NO0A 2XITA 4L4UA 4TMKA 2HYDA 3JVUA 4ZDKA 4NCJA 1DELA 2VF8A 1II0A 1NIJA 4CYMA 4D81A 4ARZA 4M1SA 1Q3HA 5HZKA 4M4SA 2AN9A 1H65A 1GRRA 4KHZA 4WAUA 3UXMA 4DSTA 1FQJA 4BFZA 3ADBA 3BB4A 3TR5A 3I4LA 3U3OA 1E4YA 1OXUA 1E4VA 1R8QA 2IXEA 2BJVA 4JBXA 1XB2A 3EZ6A 1E1QA 5B2ZA 4KSBA 3B1XA 4JZKA 2EFHB 1IM2A 4OHXA 5KPJA 2DR3A 2HCJB 1JR3D 2GA8A 3OZXA 3FHOA 5CM8B 4FD2A 1XXHE 2WJJA 2V54A 3U6KA 1JQJC 3DMNA 5C2JB 3SJZA 4D82A 1Z6AA 5IHPA 5KOYA 1G6HA 1XTJA 3TUZC 2N42A 3WHLA 1SVLA 3LO5A 1FMJA 1OFIA 2FF7A 3DZ8A 4UXIA 1ZW6A 4V0MA 4YC7A 4L8GA 3ZH9B 1D8TA 1SKYB 3CRW1 1R4AA 4TQAA 3BOSA 4UJ5A 5JJLA 1CIPA 2GJ8A 2PJZA 5AUPB 1NVUQ 2GRJA 3AKEA 2F43B 3RS7A 3RS3A 1OHHD 3QE0A 1YRBA 4HSEA 5CB6A 4JT2A 1S96A 2PEZA 2ZJZA 2ZRNA 2EWWA 2P6RA 4GBMA 1JNYA 4EPXA 1K5GA 1W2GA 5AJWA 3PV0A 1L4YA 5CB8A 3C4JA 3U60B 4II7A 4V0OA 1SXJA 1JPNA 4B6FA 4ZI3A 5J4YA 2ZETA 3R7WA 5H70A 3WY9A 1K5DA 1CJVC 4DSNA 3KKPA 4HEJA 2JJ1A 1M74A 4HZUA 3ICQB 3GJ4A 3ZS9A 1U99A 2GXUA 1P9RA 3I62A 4QBIA 2FPMA 3VR6A 1SVMA 3AGPA 3GEHA 4NONA 2PEYA 1W47A 1RW4A 1Q20A 4NYIQ 3LD9A 4JLJA 1OSNA 4DT1B 3NBFA 2FH5B 4B3CA 4UNSA 1N6PA 1W0JA 3R8CA 1ZC4A 4AURA 1T3HA 2IS6A 3NG1A 2PLRA 3GQBA 1U2RA 1Z6GA 3SN6A 5G3YA 4JVNA 4Q4JB 1JAIA 5CYPA 2DFNA 3OFNA 2CXXA 1I4TD 1SVKA 3BBPA 3M1IA 5C1BA 1P60A 3BAFA 2C98A 4PSKA 3R9IA 4ZI2A 1KI9A 1ZD9A 4A2WA 2P67A 2VP5A 4BFSA 4HUQB 1KAGA 1COWA 5P21A 1NN5A 1AS0A 3BH0A 4FCWA 2A5YB 2RB4A 1U0JA 2OCYC 3SR0A 1YZNA 4LCBA 2AK2A 3IUYA 4B35A 3QXCA 1GWNA 2QRZA 3J81k 2EQBA 2XJ4A 2O0KA 4IVRA 5HPYB 3ZIAA 4C7OA 2XOKD 1E94E 2CHVA 4RD0A 5ANRB 3EARA 3NC0C 4F4CA 3VFDA 2QTFA 4PSVA 1W36D 3A58B 2VP4A 2PZGA 1OKKA 1U81A 2GF9A 2J59A 3MJRA 2GCPA 2SHKA 2HXYA 2IYXA 2QP3A 2LKDA 1BMFD 1AZTA 4D0NA 2GXSA 5FL7D 1P6XA 3NBYC 1WBBA 4HLCA 4PC1A 2CCGA 5E7IA 4A4DA 1ZNXA 2ANCA 1CRPA 2ZRPA 1X3SA 4L9SA 1ZD8A 2LWIA 3EPJA 2DBYA 1P61B 4IOLA 1N0UA 4TYWA 5FR2A 3X1XA 2I3BA 1Z0KA 5H1YA 4MKHA 3W3ZB 1T5LA 2ZRJA 1C1YA 1H8HD 5EQTA 5KNBA 1FNNA 1N6LA 3LNCA 4RFSB 2HYIC 3OAAD 3WRYC 4XVUA 2KE5A 2ZS8A 2GCOB 2D7DA 1NBME 3RC8A 5G3ZA 1SULA 1Z47A 3THXB 2WSSA 2IWRA 4XJXA 1R0YA 4LJ8A 5EXSA 4QJ5A 4JSYA 1KSGA 3GLHA 3SYKA 2C95A 3AVPA 3RYTC 3VU9A 1NLZA 2AK3A 3TQCA 4TYQA 1GVNB 1N5LA 5FPYA 1RC8A 3UWOA 1LS1A 1R5BA 1I4LD 2BMEA 2HLDA 4PTLA 3KJHA 3EIEA 4XVQA 4B2IA 2WJVA 3BFKA 3DOEA 3CR8A 5E7MA 4LDJA 2GCNA 2JAQA 5DN6A 1HT1E 1HY3A 4LYJA 1QBKC 2QAGC 2J0QA 4A8JB 5BQ5A 3WMFA 2BMDA 2Z43A 4EJSA 1OE0A 4I99A 3U3MA 1KKMA 4JJKA 2QAGB 3KB2A 3KJIA 4B48A 2OUKA 2YYZA 3EZ2A 4OQFA 4DDVA 3PITA 4MYTA 3T35A 3UMRA 1F5NA 1DAHA 2IYYA 2GAOA 1SVOA 2W2XA 3IEUA 1Z08A 4MH0R 5SZIA 3ZVNA 3KB1A 4TL9A 1D6JA 4ACAA 3P27A 4L5BA 2ZRIA 3QXSA 4PR0A 1UDXA 5J40A 1OYYA 2REXB 4IKEA 1SXJD 4Q4AB 5CLQA 1J8YF 5JRJA 2ZJ8A 2HJVA 4MA4A 2QP4A 3QF4B 1FNMA 3V4RA 1FFHA 4G0NA 4O2LA 2RMKA 4D26A 1CJUC 4NTZA 4C0BA 3ZYCA 4PAQA 2QMUA 4NZYA 5FI0B 4BLSA 1VTKA 1OB2A 2ZUBA 5L3QA 4IFBA 1YKSA 1NI3A 2NQ2C 4QXAA 4YMTA 3THYB 1NKSA 1Q21A 4H1UA 2IS2A 2QG6A 4LGMA 1DAFA 5BXQC 4IW3B 1W0JD 2ODNA 3AM1A 2RGXA 2AX4A 2ZJ2A 4YMUA 3L82B 4Q1DA 3EZ9A 2GK7A 2VP2A 2OBMA 3K9LA 4DLYA 2NTYC 1Q12A 3QY0A 4KBGA 2P6NA 1E9RA 1W4BA 4JLOA 3E1SA 3C5HA 2B7CA 3GMTA 1R7RA 2WAYA 1UM8A 2QU8A 4KYUA 2VBCA 3VKWA 3TH5A 3PUWA 4XD7A 2PJRA 2ZRMA 3MD0A 1Q3TA 4ZCMA 1FZQA 2OAQ1 4B2PA 5F9HA 5KUTA 2F43A 3NC1C 3MSXA 4TMWA 4R98A 4AWXA 3EG5A 4P31A 1OH5A 4UNNA 2Z83A 3B1WA 3P1JA 3DM9B 4PPFA 4FCTA 3H4MA 3T1TA 1KIMA 3KQHA 1CU1A 1G8HA 2OCAA 2GAAA 2R6DA 3CH4B 4TTPA 2VLIA 2V1XA 2XXAB 2ZJBA 1UBCA 4US1R 3T1VA 1KDTA 4NP6A 2QAJA 2BCJQ 1T3LA 1TUIA 1BS1A 4BFWA 2ZE7A 2PT7A 4LHYA 4NYIR 3K0CC 3EAQA 1XU4A 2YWEA 1QHIA 3C14C 5BYKA 4IXNA 4L15A 3TAUA 2YOFA 2CLDX 4DCTA 1F3OA 2Y8EA 2NO7A 4B6EA 1Z3IX 4HAXA 3K9GA 1OKKD 3LWNA 2D74A 1G19A 2CHGA 4ACBA 1NLFA 3GLFB 3RRZA 2F9LA 4DVGA 2CHQA 1T3SA 4DT1A 2F1HA 3GJ7A 4KXFB 4PHGA 4C0HA 3GLGB 5FTMA 4NU0A 2CCKA 4Q7MB 1JAHA 3AV0B 5FOSA 1II8A 2UZ3A 2BBTA 1RZ3A 2J7KA 4URWR 5JI2E 3NHBA 3LW8A 4UNPA 2H16A 4Q1EA 1CR0A 2Q9AA 5KSYA 3CKLA 1QDEA 4HUQA 3T1QA 1XF9A 3IBGA 3RSOA 3VQTA 2F6RA 3OEHA 1A5TA 4U7DA 3FB4A 3IKJA 1QHYA 1XD9A 1G4UR 2CL7X 2GESA 5EXPA 3CRMA 5CLLA 4Q00A 1B23P 3KJEA 2JLQA 2ZU6A 4D6PA 3MWKA 1MRNA 4D4KA 2YNMA 2LKCA 2R8RA 4DZZA 2XZOA 2AD1A 1DPFA 4BLOA 3ZGXA 2F1JA 1KHTA 2ERYA 2WJYA 1Z06A 1KDRA 5E4FA 4BFYA 1S3GA 1G1MA 1T0HB 4DHEA 2GILA 1M1YE 2BEKA 3CPEA 3U3RA 2BVNA 4A82A 3BRWD 1XJ0A 3KKMA 1S3SA 2GEDA 1R0ZA 2YOGA 5AJYA 5LB4A 3DL0A 2HF9A 2OAP1 1S9DA 1U8AA 2JLWA 4PAMA 1IXZA 4X8MA 2WM9B 4QBFA 3U7EB 2I1VB 1Z8FA 3PG5A 3F3YA 1DARA 1A82A 1G41A 1P2TA 4TYPA 1N6IA 2NPFA 1G18A 4V0ME 4OL0A 4AC9A 5TB5A 1N5IA 3B13B 3CO5A 4RFVA 5HE9A 3IIKA 4TMZA 3TVDA 1MO5A 4RVCA 2WJIA 1KNXA 1RRGA 1E0AA 3EPHA 3LVQE 4Z51A 1EFRD 3SDZA 5JRZA 4B73A 2FMXA 3CF2A 5FOVA 4B43A 4PO9A 1AKYA 2ZR9A 4US0R 1IONA 1SXJE 1SHZA 2GCOA 3KXKA 2VYFA 1P75A 4PFSA 5TXGA 3W6NA 1JEEA 4CEIB 4LX0A 1IN7A 3AVYA 2ZU0C 3THXA 4FMBB 5C4MA 1MH1A 2ZIAA 2CCJA 4Q1BA 2GKSA 1X8LA 2GEUA 3VAAA 3WMGA 5AWFC 1DOAA 3RRNA 2C99A 4YMVA 1N6OA 2PMDA 1AS2A 3G5UA 3EX7C 2IYTA 4MGIR 2IYSA 3GJ3A 3KUDA 3I3SR 1P4SA 4ZCIA 1GG2A 4FCVA 1KO7A 2WMNB 1GL9B 2GJAA 4HYYA 5M04A 2MSCB 1TNDA 1KI2A 1MR3F 1XPUA 3VR3A 1G16A 2JATA 4KSCA 1GTVA 1UAAA 1BKDR 1AZSC 4HZIA 1RRFA 4A8JA 3FOZA 1OIWA 4B76A 3QQ5A 1AQUA 3HU3A 3T5GA 5H8WA 4KFSA 3E5HA 3T06B 5ELXA 1E2FA 4WXRA 4KODA 1G64A 4DSOA 3LQRA 4IEEA 1XCPA 1EGAA 2BKEA 1E99A 1XMSA 2P6UA 1T5IA 1XZQA 3AF4A 4JYBA 1RPZA 4HATA 4BE7B 4PXAA 1Z83A 3MJHA 5JZVA 4DLUA 1JB1A 1ZBDA 2FSIA 2YINC 3QBVA 1ELOA 3F8TA 4HB4A 1X8JA 3DKPA 2R6GA 3SHFA 4G01B 4PPNA 1XTKA 3ZVRA 4NKRA 1GM5A 1P2VA 4WXPA 3QF4A 1E2NA 1KO4A 2R65A 2EU8A 2XJ9A 4OHVA 1Z0FA 4IDOA 2O8DB 3NBZC 2FSHA 3O8RA 1MV5A 1DO2A 2VRWA 4Q48A 3RDPA 1TADA 2O5VA 1XPOA 4RSGA 3TW8B 3U61B 3ETLA 4KYIB 4JKIA 3THYA 4GDFA 2FFBA 5JHGB 2B6HA 3AKYA 5J5CA 2ZRLA 1RRCA 1CJKC 2V4ZA 4JLKA 3LRPA 1JR3A 3RS4A 1E2DA 3F5FA 2A5GA 3MGCA 1OXSC 3K9HA 4F38A 3RNLA 1GNRA 2ZTSA 4DCVA 4QG7A 4V0LA 1P9NA 4P4TA 5DYGA 5KSPA 1G17A 4LRWA 1VYTA 2HT6A 4IDQA 4IXMA 3QG5A 4NPHA 3WMEA 3TUJC 2GEVA 3ZD6A 3P4XA 2CLCX 2FEOA 2ZRHA 1UKVY 2ORIA 2EFGA 2PCLA 1J90A 3U6BA 1Z28A 1MO6A 5FOUA 4HB3A 5FFMA 2Z0MA 4CEHA 1KI4A 2IHBA 3VKGA 2IW3A 2E1RA 2J41A 1OHHA 2ATXA 2B21A 2F3TA 4QL3A 4P4SB 5FL3A 3CW2A 3NWJA 1N5JA 1OFUX 3W8NA 1DS6A 2NG1A 2W0MA 1E2PA 2C9CA 2JCSA 2ZE6A 2XXAA 2MSEB 4JLNA 2QPOA 3GLHE 4WZAE 2OT3B 1IAQA 4ZV4A 1KJYA 2EFCB 4AG5A 3LXXA 4LHVA 4C30A 4QM6A 2FGJA 3K09A 3AVUA 1G21E 2ORWA 2JDIA 2OSBA 4ZIRB 5EZ5A 4PC2A 5CITA 4B3GA 4KVGA 2BEJA 3GLFA 1VIYA 1MKYA 2QE7D 4M0LA 3V00A
chains in the Genus database with same CATH superfamily
4KLRA 2B8TA 4DPMA 1RJEA 4NJMA 3MUOA 2YYYA 1OI3A 2UKDA 3FFXA 2AI2A 1JNXX 1KOLA 4PU0A 1ZS9A 1U5BB 2JGKA 4F2DA 1RC1A 1K4YA 1XKTA 2R87A 3SDBA 3WNBA 4HLUC 4RENA 1YASA 5LM3A 4QYTA 4ENQA 5AI6A 3FSGA 2O8EA 5KKAA 4R5MA 1H0RA 4AXBA 5THQA 4A0RA 2P0YA 5FQNA 1NUQA 5C1PA 1F9AA 3S7TA 4YXWD 1JQLB 4B0OA 2WIDA 5IDQA 1NHWA 3MHPA 3KRTA 2ZYDA 2FQYA 3U2QA 5HF6A 5A0TA 3BF8A 4Y1EA 4DLXA 4PX3A 2XOEA 2F3SA 2RAFA 1XGKA 3JU3A 5I9LA 2YH2A 4UEKA 1QCCA 1QB7A 5JZ9A 1WNTA 5IAGA 4J03A 1UPXA 5CXSA 2GPAA 1K3TA 3V2HA 4B7UA 1E2KA 5EE9A 1O03A 1I0ZA 5AW2A 5FLKA 5LSAA 3LXRA 1F17A 1DBIA 4I5DA 4J0QA 4KR3A 5DGHA 1ORWA 4LJRA 2FJ0A 3NRCA 7ABPA 5DYNA 4D9IA 3BB3A 5KU1A 3BX1A 2QRPA 5D1HA 1TI7A 4A36A 3AR2A 4R69A 4DJDC 5BVHB 1T13A 1J0CA 1TQ2A 4ZCRA 2V7EA 1JJIA 4C4YA 4D56A 3RAEC 2ZJ0A 1WSBA 4IVPA 9ATCA 1FLDA 3C5CA 3MTBA 3EQ2A 3ZKWA 1NUUA 3BRQA 2X9GA 5C5IA 3JTEA 1H2AS 5JJIA 3T7EA 5MDHA 1BMFA 5AVJA 1Y8RB 3GT4A 4FMCB 5FL7A 4Z7OB 1TK2A 1SG6A 1CSEE 3PPXA 5JAIA 3C2QA 3Q7EA 1CB7A 2C97A 3AOEC 4R7GA 1YCDA 3A25A 1NVMB 2FB9A 3FYUB 3L93A 1SKYE 1N6NA 1KFCB 3IV9A 3PGMA 4JEIA 3U26A 5IWAB 2DG2A 4NH0A 5KOJA 3T5PA 3W5IA 1FX0B 2VNJA 2WWIA 4BL5A 2W6ID 4L85A 2A2ZA 3RRYA 1ABEA 3EWIA 1FFXA 3F98A 3WIBA 1N2OA 1RI3A 2XE8A 2LZ0A 3LVRE 1J2UA 3OH8A 2GH1A 4CM5A 1T0PA 5AW9A 3O7MA 1E7RA 2GYWA 3I01A 1LQTA 1H8HA 4XTRA 3E8MA 4B33A 1Z5WA 4L8YA 1KSJA 1ULBA 2RHWA 2XX3A 5CT5A 2YKGA 1L7OA 3CGWA 3O21A 1RM5A 4HLNA 4Z9AA 2GM5A 4ARCA 3TLEA 3PHLA 1VIVA 1NW6A 2XEDA 4WH0A 3HB1A 5H16A 1E2HA 4ZTBA 5CK4A 1CWUA 4UD6A 1WB9A 5DP1A 2ZJ7A 3QZUA 5C8VA 3K0KA 2HF7A 5D3KA 4DB2A 3G8AA 2Q5FA 1G2QA 3FJ1A 1FXWA 4C88A 2CXOA 3CR3C 4N6GA 4KQXA 4Z4FA 2FUG1 3DUFA 4J6EA 3MCTA 3PXXA 1ISRA 2H1LA 5JAZA 1KL7A 2R96A 1I7LA 1U2DC 3EMKA 2PA0A 4OKIA 3RTBA 2BM8A 4JWKA 3GT0A 2C7OA 1M34B 1MC4A 4HEQA 4KV7A 4QATA 4F7WA 2QMOA 1JPUA 3LT2A 3WLMA 4W6ZA 4E7PA 2ABWA 2OQIA 3PUYA 2EL9A 4JIMA 4Y8VA 1TLTA 4YB8A 3V7YA 1TT5A 3M1AA 4OUKX 1P4AA 3PWSA 1TZBA 1QRSA 3KK0A 5SZKB 5COBA 1KRHA 3K1ZA 3AY6A 5L7TA 5C8DA 4N3NA 4HMQA 2II6A 2ZIXA 1RYYA 1NDQA 2Q2QA 2QM8A 4KYVA 3ZWNA 1WXXA 4EI2A 4LHSA 5DM4A 1UWKA 2PU7A 3S2SA 4KK4A 2VNAA 1K8RA 5IH7A 5KVSA 4FGUA 2CLFB 3FCXA 3VSDA 5EIEA 3RR2A 1TFUA 1ZHFA 5FJJA 2PT5A 3BTOA 3KE9A 2XHZA 4BNIA 1P1HA 4WKPA 2FMKA 3WYAA 3A6KA 1CP3A 3GD5A 3UMFA 2A58A 2L19A 3ESAA 5TIIA 1X14A 1H1DA 2VDPB 4XLTA 2CV1A 1G8SA 3PTLA 1R3DA 4W82A 1CZRA 3SMVA 3FFTA 1TF5A 1VE6A 1K89A 2QLLA 1MO2A 4Q4CA 2AGVA 4ZREA 2O0HA 3WTCA 2BR3A 3N2ZB 3OLCX 3FPGA 4MVJI 2JZCA 3CTMA 4RF4A 1Q15A 5J58A 1KO5A 1JHAA 1L5VA 4MGEA 1ZD2P 4REQB 4WCFB 4CF7A 1QP4A 3ENWA 3Q0EA 1VSVA 3WLKX 2P4EA 3ZY5A 5IZCC 5JMTA 2BE7A 3ST7A 1E3JA 4H7JA 5EZSA 2Z2KA 5C1OA 2A84A 2GYVA 4DUZB 5DLPA 1NVAA 2OXCA 5BO5A 3OX2A 5HEKA 5B1EA 3VU1A 4AM8A 1GTL1 4RAQA 4M76B 1DVRA 1I2AA 3W7VA 1JHUA 1GPNA 3URMA 3W34A 3C7CB 4KXXA 3DHWC 4G37A 4MGZR 3L8FA 3DVLA 4MINA 2O7RA 1A8QA 4PYMA 1LK5A 2WUWE 3D6VA 1VE3A 5DXFA 4ZVMA 3RAPR 3ZXUB 4EAQA 1Z0DA 4QM7A 2H1HA 1KH1A 4M8IA 1A9YA 3GT7A 4I3FA 2E87A 3DQZA 3K20A 2WSLA 3ONFA 4DMUB 1KK0A 1ZH6A 2HBYA 4ANFA 3U37A 3AEKA 5LOVB 1CJTC 1Q0PA 3PIDA 4FGKA 3DZIA 2DOKA 1JILA 3DTNA 3EGOA 3P97A 5DEOA 2VJKA 4YQFA 2WFLB 2RCNA 3EVGA 3S7ZA 2ILVA 2QD4A 3EIFA 2ECKA 3VSCA 5JY6A 2HYIC 2CZCA 3S2IA 2FMUA 4NJOA 1FSZA 2J09A 4CLRA 4JX8A 3A9TA 4BWYA 4BQFA 2QRKA 5JAPA 4FU0A 2O06A 4PS0A 5ECGC 3ZDDA 2X4GA 5CAEB 4OI4A 3WLRA 3G79A 1DEXA 3BXEA 1CKEA 3U7HB 3R7BA 2RAUA 3LV8A 4PLPA 1KI6B 4QIHA 3MT9A 4A0FA 2PKRA 4TL7A 5E2AA 4FONA 4C0AC 1XWIA 1GG8A 3FMIA 4MPPA 3IO3A 3WS7A 4DM7A 1XKQA 1J9GA 1N5MA 1WEHA 2MDTA 2V4UA 1L2TA 1N4DA 4Q34A 5HIJA 4NZ9A 4E2YA 1VL2A 3EMVA 3TTSA 1FNDA 3AESA 1EFDN 4EZBA 2ZXEA 1E9EA 1TU3A 3KEFA 3TZKA 1SKUA 3HEBA 4EW1A 2B92A 1I5EA 4WY8A 3LCRA 1O5IA 4D96A 3OBIA 1UKYA 2PZKA 4QPNA 3WO1A 1U31A 2RAVA 5G4LA 1V11B 4MS4A 3GWZA 5KVVA 4FBLA 2PMFA 4QD3A 2QJRA 3TFQA 2C2GA 4AJPA 4UM5A 5IDWA 6LDHA 4F2PA 2IJGX 3AM5A 2G0TA 3GPCA 3A6DA 4TLBA 4CU2A 4DANA 4B9EA 4QODA 2A9JA 1XFAA 3VR0A 5JS8A 1JHZA 4P58A 1QGED 4LJAA 1NTOA 5FBKA 3NUZA 2G1UA 3NBMA 5CA1A 2JGEA 1UMBA 3IQGX 1Q74A 2ZROA 3ASZA 4YRGA 3PNLA 4E51A 3AVVA 3UJNA 3OWHA 5IKOA 3MMPA 3O1LA 2AS0A 2JLAA 5BVGA 1W6UA 5LXTA 1PEKE 3E2MA 1K8ZB 1IY0A 1TL7C 3SC3A 5KO2A 1QP7A 4CKEB 4V02A 3KL2A 1EP2B 4EG3A 4CM7A 2Z1NA 1G21A 5ICGA 2FZKA 4Y2HA 3NIGB 3BK2A 1JALA 2FN7A 4G4GA 1NW7A 1PV2A 1KTVA 2QUAA 3R5KA 2JH8A 4RWEA 1HMPA 5C52B 2DMRA 5L40A 1DXOA 3UK2A 3O5AA 1ESMA 1UXJA 1FVFA 2WHRA 2BSAA 5AMXA 1TM4E 3WTBA 3AFGA 1P2UA 1VSTA 1PSWA 3GNQA 4BMPB 4IO1A 4CPDA 4KUHA 1VE5A 5A1JA 2DY1A 1JA1A 3NXKA 4DJ5X 1KWKA 1Z4JA 2D00A 1FUIA 3AUTA 4G1UC 1EJBA 4K9DA 3CEPB 4UASA 1ORRA 5JYCA 3GBSA 3LDUA 1B16A 4MRVA 4OAPA 4ZZ3A 4W5RA 1U5CA 3I76A 3ETHA 2LP4Y 3U19A 1AHPA 1G20E 4GPTA 5I9MA 2WWFA 1NQOA 3ZHOA 4RXTA 2VSFA 5DGDA 3NHRA 1NYRA 1DC8A 2V59A 3EF3A 2ZYGA 4KUEA 3EVFA 1USIA 4JAVC 2IHTA 1QG0A 3I04A 1R8YA 2WIJA 3OOSA 4F6RB 1FRQA 3KR9A 3ZVLA 5HKBA 1YA8A 4NZPA 2NYRA 5DYYA 5I9IA 1XA4A 1BFDA 5J23A 2JAXA 1Z0JA 4BMNA 1ZA2A 4Z0PA 3GP8A 1L5NA 1DJMA 2QTHA 3WNQA 1GPBA 4IPTA 4IUYA 1AQNA 4X66B 1Z29A 1EXMA 2H1CA 2XRYA 5A03A 4URXR 3IRVA 3WYGA 1DV1A 3GLFE 1YL6A 1VMKA 2A78A 2TSYB 3DYVA 3KWJA 3IUMA 4OAOA 1YE3A 3CRRA 1CR1A 3FFBA 3QHQA 4RIFA 3ZHBA 2FOLA 1T2EA 2ZIFA 4BBZA 1W8IA 3KLBA 4QUDA 5LYYA 3U3ZA 2OO3A 2F8SA 1YR6A 4ZALA 1R0BA 3FN4A 4IIJF 2IZ6A 4EOGA 3WG9A 1SCBA 1A5AB 2WUGA 2G63A 2PUBA 3GR6A 3ZWDA 1LI4A 4HC4A 5G0WA 1IXKA 3V1YA 1N5OX 2PM8A 1EINA 2K5UA 3KDSE 3RJZA 3KU1A 5JY1A 3DWFA 2PRIA 4QRIA 1Q1EA 4HN2A 4UUPA 1QH1B 2YRFA 1J20A 1IOZA 4Z4EA 1WX1A 3DKKA 4TT3A 2FZCA 1CZHA 4W1SA 2PT6A 4ZHQF 4H3KB 3IURA 4GPBA 4B75A 3X1DA 1VCOA 5BN4A 3TNDA 2VNHA 2OEPA 3B6JA 3FOBA 1RTTA 1ZM3A 2HAEA 4BS9A 5I7AA 5EINA 3HDTA 3H5AA 5HA5A 4CVNA 3IIIA 1E2LA 3OCJA 4Z4CA 3E7XA 4XX1A 1ZIPA 2C9ZA 3C7DB 4NAVA 3DMFA 4ZMSA 4RD6A 4B3FX 1EESA 4AD8A 1CZKA 1LGYA 1B42A 1O95C 3OIFA 1ZY2A 3N6XA 4PXSA 1MIOA 3EDMA 2PRJA 2WLTA 4WXMA 3ZHTA 3T99A 3K6RA 4A27A 5K8TA 4X44A 4PWZA 2RH4A 3UQYS 4BO0A 2VJLA 4LGVA 1SWVA 4WNAB 1P0PA 1XC7A 3C8MA 3QBDA 5EG5A 3LS2A 5B5SA 3KYCA 1PG5A 4IIFA 2NXEA 1U0FA 3IVMA 5DFAA 3D3EA 3WNCA 5E6UA 3G7UA 4AUKA 4CM9A 3WSTA 4P2GA 2XVYA 4RH3A 3L4KA 4HAOA 1KZ7B 1IUPA 2ZQ5A 5I01A 4BLVA 2GETA 2Y1DA 2QIPA 3HYCA 3G2HA 3E3AA 3IULA 3KQOA 4NBKA 2H6EA 1UZAA 4B6OA 1YK0A 4NYJR 1AC5A 1O6ZA 4QNRA 1D2EA 3V9AA 4G4SO 2R2GA 1TCCA 3IVXA 4OQNA 4LKRA 4XJVA 2W6NA 4JLSA 1U0HC 1RP1A 2MYNA 4FIDA 4K40A 2WWHA 4PQRA 3FXAA 1NAIA 4JC5A 1Y3DE 3S8MA 2ZSJA 3JQFA 4MI1A 4MYUA 1AQJA 1QHNA 1ND6A 2VF2A 3U17A 1UL1X 5FUVA 1E2EA 2OZVA 3QG1A 1JEYB 4JJFA 3EGDB 2Q99A 4FKZA 4J49A 5EFOA 2CL6X 3QJ5A 3W9BA 3L0DA 5FEUA 1L1QA 2AE2A 3B1ZA 4MITA 2G06A 3KZXA 2JAOA 3O03A 3ZXIA 1YF3A 3HPRA 2HHJA 5BSMA 1X80B 1ZPDA 4RKYA 4GGPA 4KPGA 4RHXA 5KYUB 1QB8A 3MCUA 3FLBA 4RA6A 4HWKA 3UUFA 1JFLA 5E1MA 1YJAA 1UJCA 1Q7CA 1TCAA 1LZKA 3EA0A 1XNJA 1J1ZA 1GKIA 1GGJA 1G8KA 1QIJA 2I4NA 2EIHA 3KEGA 4PAOA 1FW6A 1SH7A 2X0RA 421PA 1JGTA 4L1KA 5L6MB 2I1QA 2DKNA 3DLPX 4G4JA 3ROQA 4HDSA 4YMWA 1RZUA 4OJKA 3C1OA 3ZEIA 4EWLA 3SVLA 4CQMB 5K20A 2BMVA 3L7NA 4QGFA 3L9XA 3R7FA 1L4KA 3TD6A 3W5CA 1A7JA 3ESCA 1SRQA 1U9ZA 4D3FA 3DBLB 1DBVO 3AVXA 1G291 1SXGA 1XELA 3ITKA 4KW7A 4BKRA 1ZGCA 4MP8A 2H2DA 4BDSA 3BIJA 3TLGB 5CCXA 1HT2E 4KLNA 5EVJA 1KVTA 4JI5B 3QUBA 2DC1A 4QG3A 2R8XA 4XSGA 1FSFA 2XI4A 2BOVA 3M82A 4YREA 1XJCA 3H9BA 3K6SB 4IG9A 4E46A 1II9A 1PNRA 3HJUA 3AIKA 1LSUA 4JK3A 1T15A 2H2IA 1LF5A 2PTHA 1QO9A 4HAWA 4EGAA 1QGOA 4QJBA 3RVOA 4I2VA 5L3RA 1F60A 4G5XA 3DOCA 4RFSA 3ELWA 4AS2A 2JH3A 1V9LA 4XWAA 5DDIP 3CYFA 5A4FS 3KAJA 4BASA 1AO0A 1FTGA 2YQ5A 5ARBA 4PZYA 1UBUS 3MWEB 4OGFA 2BI4A 3O26A 3JVIA 3WL4A 5HQ3A 1KSFX 1NTRA 1OVGA 4NZOA 1YVEI 3QLUA 3NJ8A 1Y9EA 4IFEA 5LMUB 2CLSA 4X63A 2YRXA 4MV0A 3WMRA 1GUFA 1MN6A 3N7UA 4H3HB 4K1LA 1YJBA 2C3OA 1ZYUA 4YEDA 1TKAA 3RGGA 3UIEA 1RABA 4KXQA 1SFRA 2J46A 2P3OA 5J4YA 1K7FB 4JHXA 1AN0A 3DE1X 4S1NA 1TAUA 4ZMBA 4QDTA 1AXRA 3BK1A 4XIGS 4HQNA 2HRZA 3I5XA 2R0QC 1CFZA 2HCRA 2FN3A 4ECEA 3AF5A 1XUOA 3STYA 4BLUA 4EITA 1JLLB 3KZMA 2RHOA 4FVTA 3VO8A 5SICE 3JQEA 3EQ8A 1G4AE 3G6KA 3Q3HA 3DAPA 3EFOA 4O5AA 2GD1O 1PVOA 1EUZA 3MW8A 3VNAA 2VDLB 2QLMA 1UMCB 3DZDA 5M7EA 4KFCA 3K0FB 1ADYA 1PT8A 1WKBA 3EFHA 2J9FB 4RTMA 3EOBI 3G2IA 4CWAA 1TIKA 2FCAA 3ZDBA 3AL2A 4BQPA 1LCIA 1HYGA 1Q83A 4TT3D 5E6RB 2WNSA 4CQNA 4X6UA 1T9GR 4AZVA 1JV2B 1Q1ZA 4Y2RA 5GVRA 4MYSA 3W7AA 1ZMXA 3CVOA 4G5GA 1OH7A 5SZHB 1YUNA 3WJ7A 3AJEA 2K2WA 4YHHB 4TGLA 1USVA 1BDHA 5JWOA 3VVCA 3SU8A 1MO3A 1QQBA 4NG4A 1Q3KA 1O96B 5ALGA 4F4JA 1WCXA 2CNWA 2VHTA 3NKVA 4F3CA 1ZHHA 4X1IB 2GKOA 4HUTA 1EDEA 1HDOA 4LS3A 4ZVLA 4AMGA 1RXYA 1YB1A 2O2DA 2YJ5A 3D6UA 5JCOA 4C5BA 4BAZA 2R7NA 2ZBEA 1J2EA 1KJ9A 2ZIGA 4YJ3B 2FW8A 3MMNA 4AZWA 1IIRA 4LY0A 3UW1A 3OZWA 4PHCA 3GJ8A 1B2LA 1EX6A 3GFPA 3CIOA 4RHEA 5KYYB 4ISCA 3K70B 4CKBA 1F5SA 2X1VA 1G8MA 3NX4A 2NU8B 1M66A 4FINA 3LDHA 3QXHA 3E2PA 4G9EA 3E5NA 4HZUB 3LQ2A 3SSAA 2D2EA 4KQGA 1W46A 4J0GA 1YDGA 3UICA 2A7QA 1IBRA 3E61A 5D7NA 4LYFA 3WWPA 1CK4A 3BZWA 2C4VA 2EL7A 4FTWA 5B6JA 1F7VA 2OV8A 2VXYA 2FHPA 3K1JA 2NO9A 2VVTA 4KR7A 1KNQA 2EG5A 3TZ6A 3L1JA 1DZIA 1U0TA 2PT9A 3ZV4A 2BTOA 2W9XA 4BCDA 3D7KA 2FZGA 4AY2A 1V5GA 3RTEA 2G76A 2O14A 4JJIA 1EP1B 5CA0F 3W3AD 1XAHA 1YRAA 4O29A 2X7XA 4D45A 1Z56C 2YY7A 1PW7A 1U7DA 4N47A 2BMJA 4N65A 3QI7A 2HGSA 1DOZA 1BMDA 2OBXA 4PSUA 3TSWA 4TKMA 3BERA 3JWEA 1CF4A 1P81A 2PUHA 1Z13A 2Y0PA 3AR3A 4IGEA 3NM6B 1D6SA 3PFCA 2MJLA 4RVCA 1FMFA 5CVCA 1QV9A 3DNMA 1VXRA 3DD1A 1LRJA 4UHHA 3TIVA 1M6VA 5ENDA 4LK2A 5K8VA 1CY6A 3FCEA 3K0BA 4ZKEA 2WDZA 1J2TA 5K51A 2O3UA 2IE8A 4EF4A 4RTJA 1N3IA 5BSFA 3K0CA 5EXDA 5EJFA 3FVQA 3V4ZA 2QLNA 3VYVA 4KO3S 3EIXA 4X95A 2GHQA 4R3NA 2D59A 2MSDB 1TA0A 2ZBFA 2J32A 2VHWA 3IQWA 5IEJA 4U5XA 3G82C 2Q3EA 3WYBA 5IFKA 3ZY3A 5KYWA 3RG2A 1SQGA 3AF3A 3RYIB 3O2SB 2NQ8A 1AQIA 2CXUA 2R6JA 2H1SA 2VBIA 4L08A 6Q21A 4C7OB 2ZI6A 2WBLC 4FW9A 2CNBA 4M0KA 4FDAA 2ZZNA 2G4LA 3BGSA 4H6VA 2JJ2A 5F2OA 5BSVA 2BUBA 4KZKA 4NRDA 4ZV9A 4C78A 5AJZA 3VZQA 4D0GA 3NIFB 1R74A 2EX4A 1TPZA 1CJMA 5BQXA 4JMLA 5FP0A 3LX6A 2GGSA 1QVRA 4HNHA 3STTA 4CLDA 2FI1A 1R6AA 5ECWA 4DTCA 4G5QA 4ZV7A 5JXHA 1CF9A 3PUJA 3JWJA 4M7WA 2C84A 1UMDA 3WGQA 1MZVA 2B4AA 2AFIA 1ONNA 4MW4A 1F2UA 4OF4A 3PEEA 5T5QA 1ZQ1A 1L5KA 3V46A 4D6YA 1QXSA 2O2XA 3MJVA 1QPBA 2EJBA 2R44A 3KYJB 1MW8X 1C8BA 5BY2A 4DM4A 2RBEA 4P8RA 1KEUA 2ES4A 3NORA 1Z6TA 2X2PA 3QLVC 1Q6ZA 4GX5A 1VPDA 4RPCA 3DO8A 3IPXA 4HRYA 3ZU6A 2UUPA 1KZ4A 1XRPA 3HADA 3A1WA 3QVXA 4EMTA 2YCLA 1OMOA 1R3UA 3OT1B 2JIZD 2O20A 2WAMA 1M2GA 3P9ZA 4A2PA 3B9BA 3B6IA 4NF2A 2PUEA 3GYGA 1ZUHA 2Q6VA 4J16C 1T0IA 2A59A 1TCBA 2E7ZA 4C03A 2XUHA 4G4SP 2ZT6A 3VKFA 4DMFA 5F7ZA 4KIGA 3BSYA 2G77B 4KDRA 2OK7A 5CTJA 4AZ3B 1A98A 2YWCA 3QSYA 3HRKA 1ZP6A 1X94A 1UPFA 4KRYA 3ZZTA 4GLBA 4URFA 4UU7A 3Q5EA 2EJUA 2IH5A 2R00C 1R4NA 3FPBA 1I14A 3LC1O 5BUZA 3A14A 1VMDA 4XUEA 5CNJA 3UPDA 4CRWB 2MYUA 1PF7E 4GXTA 2BL4A 4CUZA 2HIAA 1D4ZA 1N2GA 2IW1A 1QR6A 3GOHA 2HIGA 1QIGA 4K6HA 4GKKB 4GP7A 4X8HA 1GNTA 1PN3A 3P45A 1R6VA 2XUPA 4HFNA 3FHJA 4IS3A 4L50A 5BMOA 2XUFA 4M6WA 5GJBA 2W2NA 1P62B 2I67A 3HS3A 1NT4A 1FVXA 2XWQA 2H29A 3IELA 3T8YA 1ESCA 1DCKA 4TRJA 4WQMA 4D9FA 5JXGA 5MGNA 3BJEA 5TQ0B 5ECDA 1ZZGA 2H0RA 5EVCA 3OZTA 1PSZA 1NXPA 1K9SA 3B1YA 4M38A 3L92A 1JHVA 1ODTC 2G9UA 2NU6A 4EA8A 1QVWA 3GV0A 4GNKA 1DHTA 1BQ4A 1KAQA 1ZNWA 2CNWD 2Z4SA 3PA6A 3B5JA 3R6LA 4MS3A 4Q1AA 4U02A 4UEQA 3I6ZA 3DV2A 4JXJA 1YS6A 3DUWA 3K9WA 2ADOA 4BNDB 5LIRA 1C81A 1OGJA 1GOTA 3A0UA 5A05A 1IJKA 4OJQA 3PGVA 1B1CA 3GPBA 1GPKA 4RIHA 1KZ1A 5ETJA 4BECA 4E2WA 1B8PA 5EA2A 1FP1D 3UJ8A 3GLSA 4RJJA 1E7YA 3UMVA 4FYPA 5BPHA 4B71A 1J5PA 2PANA 2VXOA 2YVUA 2IIQA 1UF9A 4LJLA 4XDGA 1GKLA 4YHBA 2PUAA 2FP4B 1JHXA 4TMTA 1OX4B 4PS1A 4UTZA 4WXEA 1WWKA 2DHDA 3LECA 2WV7A 1NBMD 2GBLC 4QRHA 3TGWA 3TXAA 4PYIA 4JYCA 4NENA 2WSMA 5IJ9B 5CDHA 1RU3A 2FSVC 3Q6MA 4JVLA 4C1BA 4Q3BA 1NJ5A 2CUTA 2IHKA 4WE3A 5EIWA 2CKMA 4MQ4A 1CNEA 3JALA 2NX2A 5H68A 5L3QB 2V3CC 5LZ8A 5EP1A 5AW1A 1OZGA 4BU0A 3OOJA 2WPDD 5LYJB 3RVJA 2JCBA 5L9AA 2PSDA 1A72A 3OPYA 3EGXA 4YBZA 5K5EA 4GU5A 5FUMA 2YMMA 3N2IA 3MA0A 5AW6A 3CT6A 5E9QA 3MGGA 5AVZA 2NVWA 5E8JA 2IK8A 4HI0E 2VJCA 3ISVA 2Q29A 3HNOA 3S99A 3H4TA 4M9QA 1JAXA 4ZQBA 3JZDA 1YB4A 4RNCA 4PCAA 2J3EA 4DGSA 1NASA 2IOQA 3P2IA 4ZYWA 5JATA 1W88A 3SM9A 4ZD6A 3ILSA 3G8YA 4IYJA 1I6LA 4R40A 1ZITA 4WZ6A 1EXNA 2YWFA 4D9CA 1CYDA 4BNFA 3H2SA 4C4OA 3LQQA 5LQUA 4HDKA 2CBZA 2VJNA 3ND8A 4EVIA 4RDXA 2WTMA 3RRMA 3WJAA 2JLUA 1RCTE 4KPYA 2ZUEA 2V7QD 1B43A 1F4LA 1M2VB 2GSDA 2GN6A 3E0QA 3PC7A 3RU2A 4B85A 3BIWA 2X0NA 2WAXA 1ADFA 4F97A 3VR2A 1T5SA 5BSTA 1SCQA 3A4MA 5ILGA 1HE4A 2DFKB 1FTSA 3UPTA 2D3WA 3U4GA 4YRMA 4NSNA 1LK7A 2HA5A 2YYSA 3SGLA 8GPBA 2FFAA 3L0IB 4ENTA 5AVVA 3G2JA 3PB3A 5TVGA 2JJ2D 1IN4A 1GFWA 3TLCA 3MC1A 1NXXA 2XMZA 3COSA 2VL7A 1OFUA 3D8RA 3WLOA 2FPPB 2Z6UA 1HDXA 1NWCA 4G63A 4WV3A 3WLIA 4BN4A 4DILA 3D8TA 2WYOA 3AHHA 4ZGBA 5BOSA 3B3JA 1PX0A 1RSZA 2HSJA 4GVLA 4JOCA 1LDMA 1M8KA 3CLTD 5EMJA 1ZU5A 5E3IA 2CXPA 5DWQA 5EIOA 1NUHA 4EDHA 3BC1A 2Z6QA 5K01A 2LCFA 4C7JA 3W1EA 2XGOA 3E9YA 1Q0LA 3HJTA 5A9TA 3FE2A 2PXXA 4NBNA 4M7RA 4AMZA 1RYDA 3HKDA 2OQVA 4LDZA 2Q6OA 4TKVA 5EWMB 3F73A 1NOKA 2KB0A 1JIQA 4Q7JB 3A10A 4RIEA 5LPNA 4AKGA 1C3VA 3E9CA 2D0OB 3QGMA 4GPD1 2JKYA 1KAOA 4YRAA 2COKA 3VUFA 1QZTA 2VJYA 3OQJA 4UDNA 2GBCA 4FHZA 4N12A 4ND5A 5T8KA 5I3CA 5TX7A 3U48A 1BCSB 2VNIA 3OO0A 4Y2JA 4YMHA 1FUEA 3DR5A 5AXDA 1NN3A 1TPYA 2YCBA 1Z9BA 4C6TA 4D41A 4D57A 1DMSA 3E9QA 3IV7A 2PUCA 1ZA1A 4IGKA 3NYRA 1R4ZA 3OLXA 3D3WA 1L9XA 4OM8A 5CLJA 4G2TA 4ZAFA 4UARA 4WK6A 3O3MB 5IMSA 2VPZA 4TZTA 1Y63A 2MYTA 3IQXA 1MFPA 2G1KA 3IHTA 3RWBA 3PDHA 2QUIA 3O4VA 4FOOA 1O9GA 3F3MA 1RDFA 2VQSA 1EJ0A 4KWEA 4K6MA 5FUYA 2AF4C 3TR6A 2AJLI 2YIVX 1W1WA 3NUGA 4GMDA 4ZI7B 4DMGA 1YQEA 3VZBA 1H2ZA 4QVIA 3GA0A 1YBAA 2C5FA 5KNCH 1MEOA 3KKNA 3WL5A 2Q9CA 4ITRC 4HLUA 4I0WB 2QT1A 4IIJA 5AK3A 1RJDA 1SHUX 1T2NA 3NEPX 3ZNQA 1MB9A 2CZQA 3L1KA 1IK4A 2R751 1NM5C 2NACA 2WM8A 1LLDA 3EGVA 3L04A 3K71B 3LBFA 2FZLA 5AJVB 5HCNA 3PBKA 2JFOA 1U6IA 1N7GA 1D1QA 2VZLA 3G0GA 4JLBA 3WGLA 3ZE6A 3JY6A 3Q2OA 4ALJA 1V3TA 2CYBA 3PE3A 1HT0A 3RAGA 1MT0A 2C7RA 3NHAA 3C6BA 4U63A 3LRXA 1H2BA 3WB1A 4ZHQA 5JNLA 4JLAA 1YI8A 3TZEA 3N5CA 3PENA 3ELBA 3EGWA 4F46A 1CQPA 4B34A 3V33A 1XMOB 3ELDA 3L8ZA 5FV4A 3WWDA 4RU1A 4MUYA 1WQ3A 1R4MA 2GPJA 4OYYA 4D8VA 4C4SA 4BBPA 2QF7A 4RANA 4HF7A 2ZSEA 3LWDA 1BCRA 4Y67A 1KO8A 5BP7A 1HYHA 2R1ZA 1IHYA 4LF8B 1Z2AA 2OZEA 3QEBZ 2FMIA 2VDUE 4ZEOA 4FC6A 5F7OA 1JTFA 4E3WA 3VRHA 5G1PA 2PH1A 2C8VA 1MEJA 3TX2A 3UN1A 1PR1A 1VA4A 4BJ6A 1SD5A 1U4OA 4J9VA 4LISA 4X24A 2XB9A 4TRNA 2VBGA 4EG4A 5KNBA 1E1QD 1B4DA 1QANA 3ND5A 1JVNA 1KY5A 3NVAA 2O0LA 3ILHA 2VPQA 2IXBA 4LWPA 3WQSB 4I50F 4UDYX 5KKNB 1C2TA 1WZUA 2AZDA 1V45E 2IHJA 3I8XA 4GD3Q 5EWLA 4YJHB 3KYIB 4NYMR 1BA2A 1JU4A 1OV6A 1X7YB 2OM2A 3OU6A 5FO1A 4ZEWA 5IC4A 4WVFA 3UWSA 4QUAA 5AJUA 2RHDA 3BXFA 3NW9A 2BC9A 2NU9B 3SC6A 2MSNA 2AR0A 3N58A 4MGYR 4O3FA 5JCZA 4K81B 3TIIA 5KAPA 5KNCA 1FTWA 1RLMA 1HRDA 1YA4A 1HK7A 3BJIC 2PXAA 3PUVA 4R8SA 721PA 3LKBA 4MR9B 2GBFA 2CVPA 3CNLA 4GAEA 2EZUA 4Q9HA 4B46A 1TEZA 4RTLA 4Q3AA 4RHTA 2ZS9A 1C5KA 2ZB2A 4RJ2A 1UP4A 2O8FA 1XN1A 2H7XA 1Y4DE 3E9NA 3F3KA 3QPBA 2EFJA 2WILA 3P8ZA 4G89A 2GPSA 3VR2D 3TLBA 1P31A 4AKHA 1DQRA 4D74A 3TSCA 3USCS 4GLLA 3S3TA 3GGOA 1RPAA 2CFCA 1G3RA 3N39C 4Y6RA 2AKAB 2QRNA 4R2WA 1NC1A 1BO6A 4WKCA 2X2OA 1KZGB 4RS3A 2WMDA 2BHRA 4WUVA 3TEMA 1RAFA 2DEUA 1H0KA 3OOYA 2EW8A 4N0PA 2Z09A 4OB7A 3WGUA 1RPJA 4QQFA 3B1VA 3PJRA 2K6GA 3FA2A 5FPSA 1GPYA 5K99A 4D1YA 3N0RA 3K53A 3PDWA 4OJNA 4KKVA 4GG1A 2QAIA 1YQ9A 4XW2A 5EHXA 4OLJA 5FWXA 2J3LA 2GF0A 5FYDA 5AKGA 3UXHA 3NI2A 3QOFA 1GU7A 1ZM7A 2AFIE 3FNGA 4NDAA 1YVUA 4OHWA 4EHDA 1JE1A 4F92B 2XVXA 4MVJD 4MQ6A 3NNNA 2G04A 3KWMA 4F60A 4MLZA 2QTGA 5C7IO 4HZGA 1BQEA 2QJOA 2VHXA 2ANBA 3SICE 4BQEA 3ADKA 1NI4A 1EX1A 4WXHA 5LLSA 2VP6A 1WCWA 2PTGA 3KVRA 3PJDA 3KX2A 1Q0UA 2QENA 2HM7A 1NJGA 2YL2A 4G5RA 4ON9A 1QHXA 3I53A 4KV9A 1O54A 1DPGA 5JXWA 1KP3A 4QEDA 3WNDA 1R00A 2O0JA 1F3LA 1JZTA 2EJWA 1WTAA 1MOSA 2H4FA 3A37A 4FDVA 4PEVA 5AI0A 4KIUA 3T0GA 1M76A 2VAXA 3FVVA 4U9UA 3WAJA 4CEHB 1LTKA 2O2SA 5CVDA 3RT7A 2WAAA 1DTSA 2OGSA 1WHTA 2RHBA 4TLMB 221PA 3D8NA 4HMOA 3I3OA 3E0XA 3EDOA 4ZTZB 1Z4OA 1BGWA 1L8QA 1X8XA 3F6EX 4H6XA 1MA0A 2HQRA 4OXIA 1SOVA 5D6OA 1RR6A 3ZOZA 4J2TA 1JIXA 2I4IA 2YFHA 3JARB 2C7PA 3RVNA 2IF2A 1Q1GA 1KO1A 4WKBA 1WXQA 1C3XA 4NZNA 2ZIVB 2HV8A 1V4NA 4EGCB 3OETA 1JMYA 1Q57A 2DFVA 3MXOA 4KCGA 1SXQA 4O4JB 4GR5A 3V8VA 4G1VA 5C4GB 2FW7A 2Z8ZA 2BFFA 1YH3A 2OD9A 3CLTC 3L8DA 4L6AA 3VH4A 1Y3AA 2ZRAA 4FR5A 5J4HA 4UATA 2G6BA 4BB0A 4IJMA 5DCLA 4QT4A 3RLIA 2OLEA 1I0LA 2CMDA 1Z6PA 1NJ1A 3KTOA 3X44A 1XROA 1J1IA 1UM9A 3GDGA 1IWOA 3WYEA 3H11B 1H9CA 1TGVA 1ZVJA 1E5TA 1WCV1 4DIEA 1PBNA 3HJAA 2Y92A 3DV9A 4Q1FA 2ZW9A 3DEHA 2ST1A 4XQEA 1MIHA 1UOEA 1W49A 1XI2A 3NJ4A 4DIDA 1ZC3A 3JS5A 2G7ZA 1PQWA 3L8CA 2C3YA 5BSUA 1D2HA 3O1JC 3E6AA 1M5UA 3B12A 1QTIA 3EASA 1Z82A 5JBNA 4GYKA 3AUAA 1XEAA 4MMYB 2BT4A 1C7EA 5KNBD 2C9YA 1HQDA 1LPBB 1I33A 4MRPA 2F17A 3D4NA 2OK8A 1GXSA 5HCUA 2XWJI 3UBTA 1WMDA 1KYXA 1QH8B 4HDOB 2X8JA 3K8OE 4DR5B 2IZ5A 3U4IA 1DCFA 4HBZA 5AUNB 2GZRA 2ZE5A 3KFXA 4NEGA 2WFMA 2RC6A 3RPEA 1EU1A 2O5RA 3C48A 3KUKA 4N7BA 1XCMA 4BE4A 4WBNF 1BN7A 2C5AA 4ZU1X 3ZQJA 3D4BA 4YJFA 3V32A 4WFIA 4YAOA 1BVYF 2VSNA 4GX0A 2LCQA 2BEVA 3QXJA 3QKRA 1UKBA 2X58A 2H5JA 2XT6A 1R6UA 1ZMTA 4UCFA 1BTOA 3I1FA 2OL4A 5TQ2A 4CI0B 4ENPA 5JNVA 4ZOQI 5HW0A 3B3QA 3H1TA 4GYJA 4AK9A 1W36B 4OH1A 3B51X 2YDXA 4J0HA 4RHFA 4YFVA 1WXGA 5KWJA 3PKJA 1OXMA 3PYXA 1YB7A 3EG9A 3R23A 4NV3A 4Y0NA 1LNSA 4GUDA 3N8KA 3Q3GE 3K5HA 1WLYA 2WWRA 4QDXA 1HZJA 1JYEA 1PLKA 2VH2A 1KRXA 1K7CA 1SN7A 2C4UA 1E0SA 3FPAA 3GP3A 4K1XA 4RZ2A 2C2HA 3D31A 1U3VA 1DBPA 1EI9A 5BSHA 3LDGA 1ZGBA 5CA0A 3V8NA 1LSJA 3QITA 5KB3A 1U4NA 3IMCA 3HUFA 5HF8A 3RVPA 1AIPA 1ZMBA 4J0IA 5KNDH 5LWHA 4C5AA 1JR2A 1ZMRA 1LLFA 3IL2A 3MOSA 3P0JA