2BCGY

Structure of doubly prenylated ypt1:gdi complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 66
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bcgY00
2GHIA 4J0QA 1NVXQ 4NL4H 2QUZA 3AKEA 4ARZB 1VCOA 1QHGA 3VR4A 4B33A 3KFVA 3CKLA 3B1WA 1BYIA 2OILA 1CRPA 1XJ0A 4O0MA 5FOSA 1KY2A 4UXJA 4ERNA 2V6IA 3PUVA 4PQFA 3UK6A 3QKRA 4HDQB 3G0HA 1KTVA 4ZI3A 1YQTA 1YR8A 1AM4D 3W34A 3SYNA 4N0DA 3NH9A 5JRZA 1JR6A 1NI3A 1Q57A 1RFLA 4DIDA 2MSDB 3DDCA 1CULC 1RE0A 4DZZA 2GEVA 2IYZA 4M1MA 2KB0A 3MRSA 3Q72A 3LH5A 2JIZA 1N5LA 3KZ1E 1W44A 4HAVA 2J0SA 1KYIA 4KAXA 5EXSA 2VHUA 4BLOA 4JT4A 4DLVA 3T35A 2FG5A 2YWGA 5FOVA 4QJ4A 3QKUA 5EE0A 3AVQA 1ZD9A 3BB1A 3SJCA 1R0WA 4BFVA 2H18A 4BFUA 1M6NA 5DI3A 3GEEA 2WWIA 3UIEA 4ZV4A 3GJ0A 1JJVA 1ZNZA 2QGZA 3AM1A 1SGWA 4D0GA 3X1YA 3KUCA 3AVTA 1E79A 2D62A 2F1IA 4WZBE 1Z0IA 3NDBB 2J41A 2WJJA 4M9XA 1D9ZA 4I1VA 2ASEA 4F4IA 4NCIA 1NMZA 4JJKA 3P1JA 2IYRA 4PFSA 3AF3A 3VQTA 2QRZA 4HAYA 1CR4A 3LA6A 3R20A 2ZRMA 5D3MB 5KSOA 2JJ2D 3MWJA 4AKEA 4Q02A 1E99A 2PCJA 1OXTA 4BFZA 1HTWA 1N2CE 1Z3IX 3CLVA 4JSTA 1XF9A 1ZBDA 4PAQA 1VKJA 3FHOA 4RFSB 1UBGA 1L7VC 4RFVA 5DYIA 3VX3A 4BUJA 3THYA 3BBPA 2XXAA 4URZR 3SHFA 3THWA 2XNDD 1WP9A 2ATVA 4V0MA 1S2MA 2BM1A 1N0WA 3TVTA 1XMIA 3U5ZB 1W4BA 4D0NA 5FPHA 3TK1A 1XEFA 1EWQA 3OAAD 5CYOA 1SZPA 3Q7QA 4B74A 2B21A 5P21A 4P32A 2WWWA 4GZLA 1QBKC 2IWRA 4KYUA 4M9SA 1S1CA 2YWHA 3V9PA 1P9RA 1KSFX 2GNOA 2KJQA 2PL3A 5CB8A 2FGKA 2OCYC 4DCSA 3B1VA 1XEXA 4F93B 2OZEA 1DELA 4DJTA 4GBMA 4NP6A 1G6HA 4Z8YA 1I2DA 4DLUA 2J0UB 2ZYUX 4R9UC 4PHGA 2OBNA 2CMKA 1KDPA 1TF7A 2AKAB 1HQCA 3WRXC 4ZCIA 4HLUA 4V0NA 1CJKC 3GCGA 3KKMA 3CR8A 2JLUA 4DSOA 2BHRA 1E2EA 4L4UA 4TZ0A 4GP6A 4Q21A 4O25A 1IN7A 4HB2A 1NLYA 2G0NA 1Z47A 1YRBA 1S8FA 2C2HA 4E03A 2JEOA 2Q3HA 4TMKA 3PFIA 3K0CC 2C9OA 4YMSA 3T1QA 2VYFA 4QBIA 1OJLA 1QHYA 5EE1A 2QAGA 2O8BA 2H92A 4PZLA 1FOEB 3F8TA 4JLKA 2H8KA 3AP2A 3OFND 1TQ4A 2ZYWX 1A2BA 3ETLA 2BMJA 3IBYA 3QBTA 2YZ2A 3AKYA 3KJEA 2KSQA 4URVR 4CEIA 2ZR0A 4MKGA 4RD0A 4GL2A 5TMPA 2Q9AA 3MWKA 5HR5A 4KSCA 2DWOA 1OPXA 2WPDA 2Z4SA 5CIQA 2J1LA 5DIFA 3QXHA 4CT4B 2ZM5A 2WSMA 1CJMA 2ZAMA 2K5UA 3HWSA 4AKIA 2BM0A 1AQYA 1CR0A 2D06A 1OFUX 4BWYA 5SZJA 2EWVA 2ZRFA 4Y0VA 4N3NA 1VHTA 4TLEA 2REXB 2X2EA 4UXIA 1RIFA 2O8CA 5FR2A 3WMEA 3ZZ0A 4OHZA 2ZQ5A 4LHWA 1GTVA 4TYPA 3QBVA 5HE9A 3DMNA 521PA 3RSOA 1TX4B 2O8DB 4RZ3A 1AQUA 3UPUA 4Z51A 2IX3A 4C4PA 4MDEA 4HUTA 2Q9BA 5HCIA 3I73A 4RD4A 2R44A 4JBYA 2ZXUA 1WE2A 1Q44A 5KYKA 1EFHA 2QQ0A 3CRW1 4F91B 1Z0JA 1LTQA 3VTKA 2QM8A 3RC8A 3VU9B 4JL8A 5HTKA 4KSBA 3OEEA 1W4RA 1OT3A 4EPYA 3OE7A 1ZM4A 1ZNXA 4FMCF 3R7WB 6Q21A 3RSLA 3OF5A 2EWWA 3PUYA 3RRYA 2GEDA 3H84A 1DO0A 3QXXA 1AJEA 3LFUA 2R6DA 2A2ZA 3ADDA 2ZRPA 3EZ9A 3CBQA 3EZ2A 1GVNB 4GSYA 2NZ8A 3LLUA 2YJTD 4GI7A 2VHQA 2YWFA 2F1RA 1BS1A 3K70B 2GWHA 1JNYA 1MRNA 3LBHA 3RWOA 4JL5A 1K6MA 2O0KA 4JLNA 1XD8A 5L3RA 1OIXA 1SKYB 4AYTA 3KQHA 1Y63A 3NEJA 3WXMA 2GJSA 3TQFA 2GXSA 2ZSBA 4B3XA 1G18A 4XOIA 4G5SA 1WCV1 1JR3A 4LV6A 2JIZD 3CONA 4NCKA 1CLUA 2VH5R 3RAPR 5GJVC 2QTHA 3Q7PA 3FFAA 1W0JA 4HAZA 3AF0A 1UEJA 1T4GA 2Z6VA 4NKRA 2BBOA 4RZXA 3WYFA 1ZUHA 1IN6A 2PX3A 2OAQ1 4M53A 4MRNA 4BZQA 1LS1A 1TU4A 1HEIA 1SXJE 4AIIA 4B3CA 3WYAA 1E79D 1KAOA 5KNDA 1G8FA 2N46A 1E9EA 2A5GA 3EA0A 4P4SB 3Q5DA 1G8PA 4L9WA 4HB3A 3P4YA 4TTRA 2QPOA 2CE2X 5FUXA 2JLWA 3KKOA 1W48A 1HYQA 4A2PA 1TEXA 1XJQA 2GAOA 3PVSA 1X1SA 2IXEA 3L0PA 4WVFA 1VYVA 5KDDA 3MLEA 5E7IA 3AVVA 1E2LA 3VNUA 5AK0A 1II8A 2WBLC 4JLPA 1OXSC 1QHNA 2FZ4A 4A0GA 4A6PA 4B71A 2WKRA 2FSFA 2FF7A 2C77A 1XX6A 4Q03A 3TR5A 5ELXA 3UMRA 4XSHA 2REBA 3IHWA 4AKHA 1Z0AA 1RZ3A 1P75A 4M2LA 5LB4A 1X3SA 3K0AA 2NO7A 1W49A 1CF4A 4LJ8A 4NTZA 4EFNA 2ZRIA 1M1YE 1ZCBA 3CRVA 1X1RA 3U7GA 1XBTA 1G8HA 1HY3A 1TUEA 4NH0A 1IY2A 3C16C 3LXXA 4IFBA 4F7WA 2ZUBA 4HLUC 1EFRA 1NN5A 3ZJYA 3B85A 1XCPA 3PENA 3CNLA 3BWDD 3GLFB 1R2QA 4I1UA 3QNUA 4V0KA 2GILA 5ANRB 1OH8A 1Z29A 1SQ5A 2IXFA 2OHFA 4G5RA 4H1VA 4WIAA 1YRAA 1C4OA 4DLWA 3C15C 5A5GA 1KHTA 1GOTA 5CK4A 1QHXA 4P4UA 5BXQC 2ODWA 4BLSA 4P31A 4MYUA 4QXAA 2QAGC 3RRMA 2AXNA 2GF0A 3PG5A 4KLNA 1H8EA 3IPYA 3RHFA 4MRPA 4LV8B 5TY0A 4IKEA 4D4LA 4PHTA 2O8EA 3NHBA 1R5BA 1ZM2A 2ZI6A 2BCJQ 4QC2A 2W0SA 1OYWA 2AXPA 5DLQC 1XTIA 4FW9A 4IDOA 4WBSA 1XTJA 4Q7JB 1T0HB 2AN9A 1SVOA 3A58B 1ZM3A 1II9A 1XP8A 5DN6A 3NXSA 2ERYA 4B75A 1E3MA 4QNMA 1FMLA 1IAQA 2PLRA 1MO6A 2WWYA 2G3YA 1CEEA 2FPMA 3AF2A 1AK2A 3PCRB 4BLPA 2AR7A 4RKEA 5EP4A 5KDLA 5J40A 2H7VA 4CEHB 3AP3A 4TLDA 4EQ6B 2F3TA 1B0UA 2JLZA 4LJYA 2RMKA 1MABA 4BFSA 3L8ZA 2I4IA 2WIAA 4KFSA 4D4KA 4IOJA 1P60A 4JSYA 4GT1A 5G3YA 2J87A 2EVWX 4JVNA 3ZVLA 2ZR7A 2XSZA 5JS8A 2CL0X 2QP9X 1ZW6A 4JLAA 5D3QA 4ABYA 1WF3A 4HLQB 4IRUB 4UNRA 2ZIAA 1I4LD 2NO6A 4Q4HB 1G5RA 4A92A 5JZVA 1Z0FA 4DCTA 1GP2A 1E0JA 1D6JA 2A5FA 4RKFA 3QENA 5F2EA 4NCNA 1NVVR 3FMFA 1G9XA 1VCIA 3OEHA 2ZROA 3K9GA 2VBCA 1E9RA 2F43B 3CF6R 3LAWA 4DLZA 2RGNC 2CHQA 4O2LA 2VLIA 2QP3A 5LD2B 2WOJA 2D2FA 2JA1A 3GEHA 4TQUS 1TEVA 5EQTA 4BEJA 1DADA 2PT5A 5J47A 3IEVA 5DNYB 3A4MA 4CW7A 3L82B 3BJIC 3IBGA 1DOAA 1KNQA 1E1RD 1Z63A 1AS2A 5CK5A 4B73A 1K5GA 2Z83A 3NBYC 2GXUA 4DHEA 2ZVQX 2BEJA 2IA5A 4B47A 3T15A 2QORA 1RJ9B 4I99A 3VFDA 4QJ3A 1K5DA 2B7CA 3THXA 1XFAA 2PMKA 2YNMA 4H9GA 5BN3A 1JEEA 1Y3AA 3A6PC 1ELOA 2AKYA 2CNWD 3W6NA 4BE7B 3GJ6A 2QP4A 1JPNA 1SVKA 1PUIA 1OFIA 1Z6YA 3ADCA 2BJWA 2FFQA 4FMDB 1PVOA 3VR2A 1EESA 2NPFA 1JR3D 4CT5A 4UNSA 1NF3A 5C46F 2QTFA 2BMEA 4MQBA 1W0JD 2V55B 4B3BA 5G41A 4NYJR 1QZXA 2PZFA 4JJZA 2QSYA 2CCKA 4G3XA 1KMHB 1GDDA 4ZDKA 5JSZB 2BBWA 2G6BA 1N0UA 1IONA 1E32A 2OXCA 2H17A 1JBKA 2HLDD 4NE2A 2A5DA 4YXWA 5FPSA 2ORIA 3L0SA 1IXZA 1KMQA 1G17A 1CBUA 1G19A 4Q4AA 1T3SA 3EZFA 5CDFE 2BKUA 1EX6A 3H1TA 4W9MC 3MFYA 1Z8FA 1U0HC 1XD9A 1GNQA 3C5HA 1P2SA 1KKMA 4XSGA 5FL7D 3UWKA 2V1UA 3DPUA 4N1AA 3RDPA 1SXJA 4M1TA 4C2TA 1IN4A 4Q18A 4MKHA 1OH7A 2TMKA 2ZJZA 1MOZA 1CIPA 3CNOA 4X8OA 1UAAA 1Q0UA 1XDBA 3ZQ6A 4G5OA 1FNNA 3JVUA 4MDFA 1KDOA 2DFKB 3CW2A 4UJ3A 3TAUA 4AC9A 3I8SA 5C18A 5B58C 3D8BA 1OHHA 1E2DA 3TJZA 2OCPA 1ZYUA 1MT0A 2XNSA 3PEUA 2GZHA 1VCMA 1US8A 1XWIA 3GEIA 2J3EA 4Q4LA 4E5UA 3CPJB 4C7OB 1EFCA 4GFDA 1XRJA 4ESHA 5JI3E 5GADl 3QXJA 4ARZA 3VHLB 2C96A 1WXQA 3OAAA 1Q22A 4RZ2A 1IQPA 4TSFA 5EP3A 1EFRD 2O8FB 2DFTA 4R71A 1SKYE 3FMIA 4M22A 1D8TA 5JJIA 2HEIA 1KZ7B 4QGFA 3VR1A 4ILEA 1ZUNB 4GNKA 3DOFA 2ORVA 1YR7A 4C0BA 1G5TA 1UFQA 4HB0A 4AG6A 1NVVQ 1XMVA 2CL7X 2BMDA 5FH9A 3IEUA 4UNPA 8OHMA 1CP2A 1YZUA 1ZNYA 1I4DD 4PR0A 1G4UR 1H8ED 3FKQA 4W5HA 2YKGA 3D31A 2J0QA 3EARA 4MKIA 1GIAA 5J5CA 2ZSDA 3BGWA 2V6JA 4AI6A 1NVUQ 2RGXA 1WDTA 3AH8A 4DSNA 1X8LA 1XJCA 4AKGA 1U98A 2OE2A 4EJSB 2ZSFA 4MA4A 4D26A 2XB4A 3TNFA 1GL6A 3FYHA 3SJAA 3Q3JB 3TSOA 3SN6A 2JASA 3PR1A 3ZH9B 3BH6A 5DN6D 4A82A 2OV2A 2DY1A 1G3RA 4UXHA 4PANA 3FTQA 1N5KA 4DT1A 3X1WA 1HE1C 1ODFA 3OFNA 3GLIB 1HT1E 4EPWA 3FPAA 2BEKA 2IYQA 2OAP1 1FP7A 2ZUDA 1H8HD 1PLKA 1OIWA 5KTYA 5L3QB 4NCJA 1FTSA 1V5WA 2VRWA 1XEWY 4LCBA 4LYAA 5D3MA 1E94E 2GXQA 3U2QA 2YWEA 4ESVA 1Q3HA 3JZAA 4G5QA 2UVQA 4IXNA 4NYJQ 1S1MA 5CB6A 1TNDA 3I5YA 3AUYA 1EFUA 3BOSA 3VKWA 1TF2A 3RS0A 5FPKA 2QY9A 2XSZD 5J4VA 1G16A 2QBYB 2AWNA 4L9SA 2X77A 3P26A 3G5UA 4Y0AA 1E2FA 3HPRA 1T8UA 1Q1EA 1KI6B 1A7JA 2XEXA 2G1KA 2RGGA 3N2IA 3GLFE 4LZZA 5EUQB 3RS4A 5AUNB 4B2LA 3IIKA 5FI0B 4GOXA 2QL6A 3U4QB 3MG9A 2CE7A 4MITA 3GP8A 4ASUA 1W4CA 3OIVA 3GFOA 5DE3A 2J46A 4RVCA 4B2IA 4A15A 1F48A 2QSZA 1KJYA 4DB2A 1LNZA 3F3YA 1N6LA 5EP1A 2IS6A 2B6HA 5HKKD 1KI7A 2ZRCA 2IW3A 2HCBA 2J0UA 4LSGA 2B8WA 5AJWA 4FWIB 2PH1A 4IW3B 2D7DA 1G3QA 3F0TA 4JIMA 3W8NA 1VPLA 5AUQA 3SNHA 3DO6A 2ZE7A 3E2IA 1W36B 4R2HA 1N6HA 3LRPA 3LX8A 2EU8A 4PSKA 5DHAA 5SZIA 5L3SB 2JLVA 2OEPA 4PTLA 3S1AB 4QRHA 3UKDA 3W9YA 1ZU5A 3D7MA 2NQ2C 4DBLC 2N1BA 4P4TA 3A4LA 1JAIA 3BH7A 4KBGA 4C0QC 4YDHB 2C04A 3GJ8A 3U44A 2Z5FA 1Z07A 2IYXA 1BMFA 1DG1G 3C7KA 2FSIA 4D0LB 4MYHA 4UKDA 2AL7A 2DB3A 3IQXA 3U7EB 1WQ1R 2EFEB 3K1JA 3JVVA 1PUJA 3ZQJA 2WWGA 2ZJ2A 3QVVA 2JLQA 1SXJC 1W46A 2FWRA 4LUCA 1LS6A 1S0UA 2AHOA 1TUIA 4LX0A 4D25A 3A8TA 1Q1ZA 3EIEA 5FI1B 3NDPA 1CXZA 1H65A 2E9SA 2ZJ5A 2DPXA 3NC1C 1ZU4A 2OFOA 4LOAA 4YXWD 3WY9A 1E2GA 4XJXA 5KHOC 2AWOA 2G88A 4WXPA 5FR1A 4P33A 2ORWA 3K0FB 4ACAA 1CJUC 3CNNA 2O5VA 3IQWA 1SXJD 5C4GB 1N6RA 3H4MA 2FZLA 4RJLA 3SI7A 4X8LA 4A8JA 2RHMA 4DDVA 1TF5A 1AZTA 1NG1A 4MGYR 5A0FA 5JWHA 2OSBA 1DS6A 2KBFA 3NVAA 4WA7A 3SDZA 1FZQA 1OHHD 2JDIA 3DVLA 1QVRA 5E3HA 1E6CA 1VCNA 1E2MA 1ZINA 1KJWA 3U3KA 2MSEB 5JFGA 2C78A 4D6PA 3KB1A 2VP9A 3QF4A 4FCWA 4LYJA 5CLQA 1E2KA 1E2HA 5E95A 5FBRB 3R7WA 4IVPA 1OV4A 4QGHA 1JB1A 2GVDC 2IWHA 1SVWA 1F2TA 4L16A 4TSFD 3IO5A 3AVYA 4QGGA 1IXRC 1N3BA 3R9XA 3RABA 1F3OA 4B48A 2WJYA 1T5IA 1QHHB 3B9QA 3CPEA 4MH0R 2LKCA 4BFWA 1FL9A 3QXSA 3WRYC 1ZAKA 1E1QA 1N0VC 5TB5A 2WZQA 5B64A 1JXOA 2QRNA 3B9PA 1J8MF 3ZVMA 4AURA 5KU1A 3M6AA 1LFDB 2HT1A 2IS4A 1NKSA 1S96A 3DMDA 2CLSA 3RLFA 4IOMA 3LNCA 2BJVA 4JBWA 2OO7A 1AKYA 2GBLA 3RVBA 1R0XA 3L8YA 4TL7A 2IC5A 1EG7A 2IXGA 4LHYA 3GLGA 4CEJA 2DFNA 3REGA 1FX0A 3KTAA 2GDJA 5K8LA 4KV9A 2V3CC 2BBSA 4TYYA 3QXCA 4PC1A 5BQ5A 4YDSA 2AD1A 4DUGD 5KNBA 1E98A 1OB5A 3KQKA 2GCOA 2JLYA 2ZI3A 3W3AA 4LHVA 4YMWA 2UZ3A 1UKYA 4Q48A 1L2TA 1P72A 2GXAA 2PZEA 3CWZA 4HB4A 4B35A 2FX3A 1GWNA 3PUWA 5LBIA 4AYXA 4DCNA 4JVLA 3N2EA 2FFBA 4M9QA 4MRSA 4OK6A 4XVRA 2ZJOA 4HUQB 3CWQA 4M21A 4F38A 3KQUA 4QHTA 2P2LA 2D2EA 3QG5A 3BXZA 3IGFA 3JZMA 3K0SA 3Q85A 3LBNA 1Z83A 3PEWA 2HT6A 3TR0A 3AB3A 1W4AA 3GLHA 2EFHB 2CJWB 2GA8A 1PLJA 4C0KA 2VSXA 2VP2A 4OHVA 3ZGXA 1KI9A 4PC3A 4TL6A 4OJQA 4G0NA 5DI3B 2AFHE 5TXGA 1UBCA 2WJIA 3KX2A 4NPHA 2RB4A 4ASUD 5JEDA 3GLFA 2F3RA 1W2GA 3CH4B 1T3HA 3AGQA 1GAJA 2W6ID 3GQBA 3QF7A 4IDQA 4K81B 5FL3A 1RRCA 4MGZR 4EFMA 3I3SR 3LXRA 2GESA 1LF0A 1GILA 4UNNA 1XTQA 3T5DA 2ODNA 1G3MA 2FE4A 4Q1DA 3QG1A 3QJYA 2XTMA 2ZI4A 2GJKA 4Q66C 4RD1A 1T91A 1E1RA 3FWYA 2FDCA 4KFTA 2DHRA 3GFTA 2XX3A 4LYHA 4HDCA 3VR3A 3ZLJA 2IL1A 4M9ZA 2HJVA 1P4SA 4YLGA 4LJAA 3M4YA 3NIBA 4RD2A 3GLIE 2V9PA 4M4SA 2QMUA 3EPLA 3NBXX 1GZSA 4PSAA 4Q4JA 3WBJA 2CNWA 3A1VA 4DRZA 2ZS8A 1NKTA 2EQBA 4DDUA 4Q9LA 2OG2A 3MCAA 2P5TB 4H1UA 4IJMA 1BMFD 4U00A 3RS5A 2PT7A 3U7FB 3PIRA 3BS4A 1NSTA 3DZDA 2GKSA 2IYWA 2YOGA 2C9CA 3I92A 4FD2A 4HZUB 4PXAA 4WOPA 3FDIA 4A8JC 3U3RA 4JMPA 1TL7C 1XXHB 2DWQA 3F5FA 4CEHA 4IDNA 3BB3A 4B34A 3BFXA 4FXPA 5CYPA 2HLDA 4OJKA 1J90A 1E0SA 3QPWA 1W2HA 4M1SA 1P7CA 4P0TA 3K9NA 1G6OA 2OM2A 4C30A 4A2WA 3KL4A 2WMOB 4WZAE 2QENA 4BLQA 2ERXA 1G7SA 5FL7A 2J5XA 2FJUA 2RCNA 5E7JA 4LRWA 5AJZA 4B6FA 1YKSA 2VPPA 4QL3A 3ZS8A 2DFLA 1E96A 1XTKA 4Q4HA 1NG9A 4FCVA 1UKZA 5GVRA 1UBFA 5FTMA 1U90A 1BH2A 3NBZC 1OW3B 2JDID 3IKJA 4IHQA 1XU4A 3LWNA 3C4JA 3CX6A 3LW8A 3QOFA 5FPYA 4Z1MD 2ZSAA 1U9IA 3R8CA 4DDTA 3X2SA 1YJ5A 3BIFA 5BW8A 4CGZA 4I81A 1YZGA 2PJRA 2V8OA 3C5CA 1WBBA 2CL6X 2O52A 1Z2AA 5H68A 4B44A 4S35A 4M1YA 4ACBA 2FPKA 2GBLC 4QG7A 1NBME 2CEAA 2V1XA 1M2OB 4D80A 3Q8XB 3D6TB 1FP6A 4RY2A 2FMXA 2OUKA 5G40A 4TMWA 3ASZA 1YZLA 4MUBA 1NN1A 3A1TA 1B23P 1CTQA 1EFTA 4JLJA 3BK7A 2X1VA 1E1QD 3K70D 3BC1A 1N5IA 2Z4RA 4LGMA 4ZKDA 2P5SA 3PXGA 5FUWA 4ZKEA 2GVZC 1ESMA 5H1YA 5LDDC 1NSFA 3QEOA 3PEYA 4AK9A 2BV3A 4PSVA 5K8IA 3MAAC 2NOAA 1P9NA 4LYFA 2GJ8A 121PA 2ZS9A 3CM0A 5FBQB 5F9FA 3QPUA 4IDHA 5SZHB 4B3GA 5JHHB 4A0RA 1SHKA 1S4QA 3SS8A 1CS4C 1NIJA 4OYHA 4OK3A 3SJBA 5JHGB 4ITRC 1JALA 1YZQA 4US0R 5JSZA 3EX7C 2H1LA 3AVOA 3VAAA 2WSSA 1ANKA 4LC1A 4BRUA 3BB4A 3KKNA 4B6EA 1YZTA 1HT2E 1KI4A 2ZEJA 5DO9A 3KXIA 4TLAA 4V03A 1UBEA 2FA9A 3DM5A 3OIWA 1XPUA 4NYIQ 2ANBA 2V4ZA 4Q9JA 3T5GA 1RVDA 1CR1A 1G4AE 3ONWA 3OHMA 3T1VA 2V7QA 1SHZA 1L4YA 2OXRA 3DKVA 3NWJA 1H8HA 4IDPA 4OL0A 5FBLB 4MRRA 4KVGA 4U02A 2D74A 1G7CA 4LJ5A 4LY6A 4PO1A 3KXLA 2BCGY 1G8YA 2JGNA 1T0JB 1DVRA 3AGPA 3TMKA 5IT5A 1E9FA 1DE0A 2AD5A 4BZPA 4PQRA 3AF4A 1OE0A 2EFDB 3ICEA 4OI2A 4GPTA 1V43A 4HI0E 1UKEA 3GJ3A 2PEZA 2P6UA 3N5CA 3UXMA 3TKLA 4B32A 2CK3D 1Z6AA 1R5OA 5EE9A 4JVSB 3U7HB 4W7SA 3CRQA 3IO3A 5JRJA 1G3IA 2VIIA 4C0SA 5FTKA 1G7RA 2MMGA 3R9IA 3CRMA 3AQ4A 2VA8A 3SHWA 2L0XA 1E9DA 1M7BA 2DR3A 3B6EA 2KWIA 2JJ1D 1U8ZA 4IOLA 3P32A 2IYUA 2ZJBA 3H86A 3TLXA 5F98A 4GOKA 1KDRA 2B7BA 4DXAA 4LC0A 2JLRA 4KFUA 1E0KA 4MGKR 1XPOA 2IHYA 4QNRA 1FNMA 4EPVA 5HKKA 1MR3F 3QKSA 3J81k 1RW4A 2VSFA 3D3QA 2KI5A 2ZRDA 3THOA 3W5IA 5FFMA 1WRBA 3GD7A 1RYHA 1II8B 1XB2A 4QM7A 1EK0A 4KI0A 3P20A 1DAHA 3LW7A 1EGAA 221PA 2R6GA 5DYGA 1HQYE 2Y8EA 1DEKA 2AK3A 3O8CA 2BDTA 2HCJB 2ZREA 4ZCLA 2I1QA 4DB4A 1G41A 3I62A 3U61B 4EJSA 2DBYA 5CM8B 4A4DA 1DAEA 1PZNA 1S9HA 3FKSA 4KFRA 3GFPA 2NO0A 2VL7A 821PA 1ZUIA 5FOTA 3CUEF 2C95A 3QI2A 2WVJA 1G64A 4EUNA 5TV2A 1N6PA 3ND8A 4TTQA 4E09A 621PA 1AA9A 4F92B 2G9NA 1DPFA 4E22A 4A0FA 2F6RA 3CO5A 2ZVPX 4DKXA 4PX9A 4ZDIA 4WZ6A 1N25A 2ZJYA 3BFVA 4BZXA 1GITA 3KB2A 4Q1EA 1BYUA 1TQ2A 1X86B 3SZRA 2ZJ8A 2Q21A 4XTRA 5EUMA 5KDOA 1KOFA 1VG9B 1S9DA 3B7GA 5TDHA 1OSNA 3I72A 2MMCA 3KKQA 4US1R 4NU0A 1U9IC 3B5JA 5BN4A 1P2UA 2BMFA 2I3BA 4P3YA 4Q1BA 1GL9B 1OFHA 3V4FA 4YMVA 1O3YA 3TUJC 2QBYA 2ZI7A 3ECCA 3G82C 4MGIR 3IUYA 1JJ7A 3CIOA 4GZMA 2O8EB 4CZ2A 4OBEA 1P2VA 1IN5A 1U99A 2GETA 3SQWA 3HDTA 1M7GA 3TRFA 1E9BA 4CF7A 1BIFA 2CCJA 1Z2CA 1EX7A 2P67A 4L15A 4FN5A 3U4QA 3FB4A 3W90A 2F55A 4NBSA 2BBTA 4ON9A 1F2UB 2ONJA 2RGBA 5KSPA 4NDZA 3BERA 4JKYA 4XH9B 1GKYA 5CITA 2WJVA 1ZM9A 3RYTC 3NHAA 1P73A 1R10A 4XWOA 1TMKA 4Q7MB 2NG1A 2O0HA 4JZKA 4OI1A 2ZSEA 4FMCB 1OXXK 2QT0A 1TADA 3IIMA 3QE0A 5EXXA 5GJCA 5JWRA 1TTTA 1UDXA 2RGDA 2IUTA 3LD9A 3NKVA 3HJNA 2HYIC 1MABB 4KO8A 3SBDA 5HCNA 4TZ6A 1Q1QA 4ZDJA 1E9AA 5FTLA 1DAKA 3WNCA 5HZHA 3FHTA 2IYTA 2QMHA 3EPHA 4ZPXA 1KO1A 3M1IA 4TLCA 4D2IA 3UWOA 1MH1A 1EXMA 3KUDA 3MMPA 2JLXA 2F1HA 2ZPTX 3CZPA 1U2RA 3T12A 1XD2B 3SQXA 1VYTA 1NBMA 1RKBA 2WMNB 4JS0A 2EFGA 5JBQA 2OT3B 3PEVA 1CKEA 3I8XA 1G21E 1TQ6A 5FOWA 2O0JA 1XXHE 2ATXA 5C2JB 5H70A 3C8UA 2HXSA 1UPTA 5DI9A 3AEZA 2FH5B 3X1DA 2WJGA 1Q1BA 1KK2A 5FTNA 2PMDA 5KOYA 2HF9A 1IN8A 1JAHA 2YOHA 3EW9A 4TMVA 4UQOA 1E4VA 2WSSD 1XCMA 2VP6A 4A0HA 4DUGA 2VQSA 2YINC 3C14C 2C99A 4Z8XA 5FBWB 3TSWA 1KJZA 4JLDA 2NO1A 1FMJA 2VP5A 4Q9KA 5BYKA 2QROA 4HAXA 3ZZTA 1XZQA 2F9LA 1VMAA 4JLVA 2RKOA 4XIGS 2OFWA 3K0FA 2WV9A 2FNAA 1KSJA 2V7QD 4RCYA 2RAPA 2QGNA 3FGNA 2P6NA 4AWXA 1WA5A 1P3JA 3THXB 1W5SA 2WWHA 5HE8A 4PAOA 1R4AA 2ZU0C 4PHFA 2X2FA 4MUAA 2QE7D 1NNEA 3NH6A 1GSIA 4IEIA 421PA 2G83A 1UEIA 4RFSA 2IK8A 2G0TA 3MD0A 5AUPB 4Q7KA 4GRAA 4Q7LA 3DKPA 2H16A 2QQEA 1BO6A 1CU1A 2HYDA 1NMXA 1KK0A 4DLXA 4B3DA 2XZLA 2NZJA 3TGPA 2FEMA 1E69A 1ZC3A 1KSGA 1IM2A 2W6JA 4GMXA 1Z6XA 4G5GA 3V00A 3ZS9A 2KBEA 4Q19A 1W0KD 1KIMA 2B92A 1XEWX 4KVAA 1VHLA 2ECKA 2Z43A 3OZXA 5JMTA 2FPLA 1COWD 2QN6A 2W6IA 3SOPA 1A5TA 3KXKA 4ZIRB 3HR8A 3QY0A 3WNDA 5KPJA 2HF8A 3QKTA 4OHXA 3AVWA 4WXRA 4CYMA 1U8AA 3P4XA 3BFKA 1PLLA 2FSGA 3IILA 4IFEA 2DCUA 4V0LA 2VSOA 4TQAA 3MSXA 1KI2A 3KFXA 5SZKB 5FTJA 2IEZA 4DLRA 2A5YB 2QPTA 4V0OA 4QBFA 4A6XA 3PV0A 2N42A 1TPZA 2JATA 4DCUA 2XZOA 1GFIA 4FMBB 4PPNA 1IY0A 4HDOB 4BECA 1DTSA 1SULA 2CHVA 4TWZA 1XNJA 3O47A 1US8B 4AYWA 1YE8A 3REFA 5E4FA 2NTYC 3IDQA 1A2KC 1MO5A 3GJXC 3I1FA 1QRAA 4II7A 1XMSA 2IHBA 2UZIR 1C1YA 3CPHA 3FKSD 2QU8A 5J4YA 3TW8B 1W7AA 1A1VA 4PPGA 2WTUA 4PC6A 3EPJA 4US2R 4A36A 2W2XA 1E2IA 2GAAA 5CJ2A 1RRPA 1DARA 4DDWA 1OKKA 4Q1FA 1O87A 4WW0A 2FGJA 4A9AA 1R6BX 5EXPA 1N6NA 1Z08A 1NN3A 3AP1A 3TSZA 1JR3E 2F7SA 1TU3A 2VEDA 4K46A 4JLOA 1VG8A 4JLMA 2NPIA 3I5XA 4JLBA 3FVQA 1CJVC 5EE5B 2ZI9A 4A1FA 4HUQA 3TQCA 2J7KA 2QT1A 4HYYA 5AR1A 1RRFA 1G5PA 3K0EA 3IIJA 2D3WA 2DWPA 1E2JA 1K8RA 1NIPA 5KNCA 1LW7A 1NMYA 2GJAA 3EAQA 4I1SA 5FPTA 1E0AA 1VDZA 3GMTA 2QEQA 2F1JA 2CJWA 1LF5A 3O8DA 2KE5A 4PPFA 3HU2A 3W3ZB 4XD7A 4AG5A 3WMGA 2ZRGA 4TQ9A 3EIQA 4TT3D 1E9CA 3EC1A 3WP0A 5CDFA 1KK1A 4KODA 3WHLA 2VO1A 5AWFC 2GZDA 2O8DA 2HDNB 2QPAA 1W36C 1KZGB 4CRWB 2FEOA 2Q6TA 1ONBA 3EG5A 3Q9LA 1NY6A 2R65A 4B76A 4Z1MA 4DT1B 1LY1A 4QKQA 5JJKA 2QI9C 3B1XA 2IYSA 1P6XA 3VU9A 2FSHA 3QQ5A 4O2RA 2ZJAA 3LO5A 3N70A 2XITA 1X8JA 4IVQA 2QMEA 4AY2A 3HPQA 1A82A 2XTZA 4R7ZA 2XOKA 3LX5A 1W36D 5E7MA 4OI0A 5FUYA 4Q1CA 3VX4A 2OCBA 4PO9A 3B78A 3E70C 4GMDA 3T34A 1KI1A 2RH5A 1NBMD 1BOFA 5EP2A 1VIYA 4KHZA 2QTVB 4RCZA 3SE0A 1IHUA 2CLDX 5JCZA 3UG6A 3AVXA 5F9HA 2ODBA 3C41J 1D2MA 1SVLA 4EKDA 2YC4C 4HZUA 3GJ5A 2NIPA 4YONB 1UF9A 1KDTA 2IS1A 3LDAA 1UDWA 3KQLA 4JBXA 4MYCA 3GPLA 5G53C 1XXHA 2BWJA 3B60A 3ZD7A 2ZR9A 3HP1A 2OLKA 1MKYA 4R2IA 4O3MA 5DISB 2NO9A 1G7TA 4NYMR 1MO3A 5EZ5A 3EXAA 3RC3A 1KY3A 1ZNWA 3TAHA 5JCPA 3CX8A 3EZ7A 1F5NA 3E5HA 2GEUA 1W1WA 1FFHA 2J7PD 4BFTA 4EFLA 4P4SA 3VKHA 2ZRJA 1DG3A 1WBDA 2YHSA 4OHWA 3A37A 4RSGA 2CLCX 3BH0A 3QKRB 4TN1A 4DC9A 3EZ6A 2ZITA 4C2UA 2R8RA 1YVDA 1VECA 4LJ9A 4XTCS 5AJVB 3WP1B 2YOFA 2D7CA 3ADKA 5CM9C 1ZP6A 1R0YA 3U44B 3MGCA 2WWXA 4BASA 2FFAA 4C9BA 3ZVNA 2NMVA 4GOJA 5C1BA 5AJXA 4FMDF 2ZRBA 1MO4A 3HYRA 5H8WA 3VNVA 1P61B 5JS7A 1OYYA 1SKQA 2CBZA 2I1VB 4JT2A 4LJ7A 2VP4A 1LV7A 1T9HA 3EPKA 3ZD6A 4BLRA 1RPZA 2E87A 2XJ4A 4URWR 2CK3A 2FOLA 4LHXA 3A1SA 3UMSA 2W6JD 1YZKA 4OI4A 4L5BA 3AKDA 3ASYA 2EYQA 4OQLA 5DGXA 2LCFA 1YU9A 4DEYA 4POAA 2JJ1A 4DLTA 1S3GA 1YZNA 2QMOA 2ZRAA 1M7HA 4QBGB 1NN0A 1MRSA 4M0LA 1P9WA 3RRNA 1GRRA 2G77B 1FUUA 2UKDA 4HAUA 4KXFB 2W00A 2WOOA 2ZRNA 3RNLA 1NP6A 3FFBA 3NTUA 4OQXA 2SHKA 3KKPA 1IJEA 2ZETA 1OFTA 4A8JB 1NLFA 1P2TA 2CCGA 3CRRA 1ZD1A 4PPQA 2W0MA 3KQNA 4NHOA 721PA 1JECA 2IF2A 2WKQA 4KJZA 1I4TD 5L3VA 2C9YA 3DEFA 3T61A 2WWFA 4C0JA 1DBSA 4OKSA 4EPTA 3T1TA 1UJ2A 4C0LA 3NBFA 4KBFA 2WKPA 3QIAA 3FMOB 1CJTC 1HURA 4TL8A 1P62B 1R8SA 4BGDA 4DWJA 3THYB 3ICQB 2XXAB 4NYIR 1R5NA 4IXMA 2LWIA 1SVMA 3THWB 1F6BA 2VP0A 4BFYA 5FOUA 4D4JA 3QF4B 2ZRLA 1ZM7A 3SR0A 3OIYA 3W8RA 1E2QA 2PX0A 1U0LA 1F2TB 2CDNA 4FI3C 4C3ZA 1E2PA 4CVNA 1N6OA 2DYKA 1OKKD 4WAUA 1DAIA 2R62A 2RGAA 4TLBA 3SBEA 3B1YA 4PZZA 4PO8A 4OK5A 4B3FX 2MSCB 3PUXA 1VIAA 5FOXA 4XWAA 1ETUA 4E07A 1XEXB 1YR9A 2GZAA 2RGNA 4EQ6A 1ESNA 2XGJA 1UKVY 3WMFA 1NJFA 2XZPA 5B57C 2Q9CA 1FPMA 4PAMA 1IJFA 3NC0C 3RANA 3TUIC 3AUXA 2ZE6A 2OLJA 4L8GA 3DL0A 4BQSA 3KDSE 2OESA 4QHYA 4NYMQ 1Z06A 5IK2A 2CVHA 1ZIOA 4RZUA 1ZD8A 1Z6TA 3B8HA 4XD7D 4OQFA 1G20E 4Z54A 3B1ZA 4LJ6A 3T1OA 3GLGB 4CEJB 2REOA 3KJGA 5JWOA 1FX0B 2QM7A 2WIBA 2WAYA 3KTAB 1VYUA 3MJRA 1EWRA 3NG1A 4TMZA 1KO5A 1QDEA 3A1UA 3SYKA 2ZYTX 3TE6A 3VR5A 1CR2A 1D5CA 2IYYA 2W2VA 5DH9A 4HEJA 2EFCB 4YQFA 1NVWQ 4IVRA 2QAGB 3ZZUA 1KSHA 2A30A 2O8BB 2F43A 2GCOB 3DM9B 2OFXA 3K70C 2AFIE 2LKDA 1J2JA 3A1WA 4D81A 2BKEA 3ZIAA 2R6AA 2PEYA 3I61A 4CEIB 2HXYA 4UJ5A 3OESA 4X8MA 2WHXA 5CLLA 1R7RA 1Q12A 2QG6A 5A4JA 1T6NA 3KJIA 4UNQA 1BKDR 2GF9A 5GJWC 3B82A 3P27A 2XOKD 3AKCA 1RC8A 1GRNA 2GRJA 1N6KA 2WJHA 3SEAA 4HATA 2PCLA 2VHTA 1RJ9A 2W2TA 3TH5A 4FCTA 2EYUA 3PQCA 1NJGA 4HLCA 2YV5A 2IUUA 3GLHB 3CH5A 3ZDQA 5GJBA 3MWLA 4JL6A 4Q9IA 1IOZA 3K8YA 1A4RA 2O8CB 3UATA 3LBIA 3K09A 3OIUA 4B2PA 3BD9A 4AD8A 1RYFA 1JPJA 1PV4A 4S2EA 2E1RA 3AV0B 1WB9A 1DAMA 1AS0A 2OBMA 4KLZA 3RS7A 3I4LA 4LDJA 4KYIB 4M8NE 4LBZA 3B2EA 1OF1A 2ODEA 4BPBA 2EW1A 4GDFA 1KMHA 4D4MA 3KJHA 1Q20A 3DOEA 2WM9B 2OBLA 3PITA 2C98A 2J59A 1Z0DA 1N6IA 1HH4A 2A78A 4PC2A 5K8UA 5B30A 1OLOA 2CHGA 4FWTA 1VG1A 2IBMA 1JI0A 4Q00A 4W5WA 3V4RA 3U60B 4EIWA 1X6VA 3ADBA 3CZQA 2A9KA 2WAXA 3VHXA 2VF8A 4BLTA 3HU1A 3K9HA 2J45A 4BFXA 1IY1A 1N5JA 2IT1A 2RGEA 1AIPA 3DZ8A 3SFVA 3TW4A 2XB2A 1U8YA 1NLZA 1AGRA 1IXSB 1AKEA 2Q3MA 3R8FA 2OCAA 3PJRA 4Q4JB 1KKLA 2W83A 3I32A 2A7QA 4JYCA 5EXTA 5LB2A 2QE7A 1F2UA 4LBYA 2ZE8A 2ZRHA 5J4HA 3CR7A 3W6PA 1C9KA 3RRZA 2NGRA 1FTNA 2P6RA 1AZSC 3EC2A 1HUQA 4EDHA 1ZRHA 3RWMB 1DAGA 3B13B 2IYLD 4C7OA 3CB4A 4NZYA 3LLMA 4YMTA 2BVNA 3UG7A 1KNXA 1R8QA 4K8OA 3TIFA 1KO7A 5G3ZA 4OQMA 1W0KA 5M04A 2O8FA 2BOVA 2WPDD 4PHHA 5IHPA 1ZJ6A 1FQJA 4U7DA 3CX7A 1L8QA 5B2ZA 3HR7A 1HE8B 1W47A 2HV8A 3K9LA 1COWA 1DO2A 1W5TA 1HA3A 1CRQA 3TBKA 1GRQA 2B8TA 4EPXA 5BN5A 2CVFA 1XD2A 2A3RA 1U94A 3MWYW 3SJZA 1VG0B 2HUPA 1DAFA 2ZUCA 1OH6A 1UM8A 4C0AC 5BYJA 4KITB 5KSYA 1GNPA 4F4JA 3WNBA 5LPNA 5HZKA 1Q3TA 2ANCA 3L0IB 2GK6A 3BE4A 4QBHA 2FFHA 3K53A 4XWKA 1NRJB 5DSZA 4Q01A 4M1OA 1IBRA 3A36A 2BC9A 2VHJA 4RD3A 1ZVQA 1KI8A 2R9VA 3X1ZA 1D2EA 2G1JA 1NY5A 1AN0A 4LV5B 5CIWA 3FMPB 1GUAA 4D82A 1M8PA 1L4UA 1Z0KA 3DHWC 3K0AB 3M0EA 1XCGB 3QPVA 3QUSA 3OEED 3UANA 3EIHA 2H5EA 3OE7D 1J7KA 2R6CA 4I4LA 4KCGA 4MRVA 4TL9A 4ZO4A 1GL7A 3SFZA 1G8GA 2CXXA 4ZCMA 1Q21A 4Q9HA 1RRGA 3A4NA 5DHFA 4DSTA 3RS3A 3VKGA 1ZC4A 5JLJA 2QNRA 3L43A 5IRCD 2AK2A 2VTKA 5AJYA 3LVRE 3GLIA 2F9MA 2P0EA 2XTNA 1KAGA 4NMMA 1GM5A 3QSYA 4LWZA 4TMXA 5L3QA 1JQJC 4BRWA 4DVGA 2Z0MA 1Z6GA 4DLYA 5EZ6B 1QF9A 1G291 3SYLA 5KO2A 3SU8A 1R0ZA 4JKIA 2H57A 1VTKA 3EWSA 2PLFA 2C8VA 1M34E 4FIDA 1JEDA 2GTPA 2P65A 3CF2A 2R2AA 3BAFA 4U5XA 1KI3A 1JQLB 1M74A 1J8YF 3WBKA 1KI6A 5LD2C 5IK2D 4BEBA 1LB1B 4G1UC 2FU5C 3EWAA 3VR6A 2Q3FA 3W5JA 1HV8A 2JAQA 4PZYA 3AF1A 4QOSA 4TT3A 5GVSA 1T8TA 4I1OA 3L0OA 3WYGA 2C5LA 5F3WB 3GJ7A 2PJZA 5IF9A 5J4LA 1GKUB 1JXMA 1D9XA 1P5ZB 1S3SA 5EJEA 2RGCA 2IYVA 1WMSA 1FW6A 1SVSA 3LY5A 4ZIRA 3FHCB 4YC7A 4CDGA 1Z5ZA 3ZIAD 5KUTA 5L8VA 4M1WA 4R98A 1SVIA 4HSEA 1G1MA 4DEXA 4EAQA 4G01B 2WICA 1XMJA 2X19A 3AVPA 4EPRA 3K09C 3LV8A 2JLSA 1OB2A 1FQKA 1G3UA 2IEYA 3O8BA 3ND9A 2JJ2A 3BORA 5JECA 1OH5A 4V0ME 2X8AA 1ZCAA 2ZAOA 4C0HA 4DIEA 1KO4A 3IHLA 5L3SA 1X8KA 2ZU6A 2J9RA 4TMTA 4OHYA 2QA5A 2RHDA 4FINA 3S1AA 4B43A 2FV8A 1KO8A 1Z22A 2ZTSA 1I2MA 4LHZA 4XVQA 2BIFA 4NCHA 1E9SA 1KGDA 2XNDA 3U3JA 3WHKA 1OIVA 5BWMA 4JVMA 5AUOB 3HYTA 1II0A 4XVUA 3AVUA 5UKDA 1GKIA 1XZPA 3HU3A 4Q47A 1FUKA 2C03A 2D4HA 1J99A 2PBRA 2GK7A 4N0EA 1YHNA 3FOZA 1UADA 2IS2A 3TUZC 3U6BA 2YYZA 3L2OB 4QM6A 3QVUA 5HPYB 2ZI5A 4W5JA 2A5JA 3E1SA 1J70A 2J0VA 1QG4A 4JYBA 2AX4A 2R6FA 4MKFA 3ZYCA 3EASA 4LI0A 1QHSA 1TAGA 1TQDA 5EE3A 3TVDA 4KU4A 4LJ4A 4QFMA 3QKSB 3LVQE 3U3OA 3H0KA 5JI2E 3SC3A 1AS3A 4TYQA 2PZGA 3EA5A 2W58A 1GG2A 3GLGE 3MJHA 1GNRA 3LQRA 4PC7A 3ZVRA 1F60A 1T5LA 2J7PA 1MV5A 1YR6A 3NEYA 1ZIPA 3U6KA 4LBWA 2V54A 2XJ9A 3H2YA 2GJ9A 2ONKA 2P3SA 4LBVA 4X8HA 5TVKA 4IEEA 4CIDA 4URXR 5JEEA 3RS2A 4IOKA 4TYNA 5C4MA 3U3MA 4LPSA 4RD6A 1E4YA 4QHSA 1QHIA 4A2QA 5K8TA 4LPKA 1NL3A 1PJRA 5CJPA 4ZDWA 2JCSA 2IUSA 2Q0HA 4F4CA 3MUFA 3R9WA 2ZYVX 1XTRA 4URUR 5KSZA 1OXVA 1QG2A 3UMFA 2ZRKA 4MYTA 1QVAA 4DSUA 2JJ8A 3LQQA 3X1XA 4QJ5A 5FBVB 3GJ4A 3FE2A 4TYWA 3GLHE 2FN4A 4HLDA 4QGAA 3VMFA 2VHCA 1ZMXA 2ZE5A 5J4KA 2GCPA 1OXUA 2YVUA 3CF0A 5TARA 4TTPA 3K0CA 4Q4AB 3IPXA 2VF7A 1XPRA 1D2NA 2ZS7A 1QHHA 4Q5IA 5IDVA 3O8RA 2QAJA 1T3LA 2GCNA 2XAUA 4DCVA 4NONA 4EJSC 4Q1AA 3W6OA 4LK2A 4OQNA 1SXJB 4PQYA 4ZI2A 4V02A 1U81A 4M1KA 1KK3A 3PUZA 1AGPA 4YMUA 5FUVA 3T06B 1XTSA 4GP7A 5KPDA 3Q5EA 3OEHD 5JJLA 2ZANA 4DLSA 1U0JA 4HZIA 4HAWA 2YC2C 1Z28A 3BRWD 3QEJA 2IF0A 1E2NA 1LVGA 2QZ4A 4URYR 2HJGA
chains in the Genus database with same CATH superfamily
4IIYA 1QR6A 2GZSA 2OL4A 4J0QA 3H99A 3KT8A 4RULA 3T7KA 3AKEA 4UAJA 4ZHQB 4ZV7A 1QHGA 1C4WA 3D5EA 3DXZA 1KRXA 3U4HA 5CNJA 4B33A 3K8OE 3CKLA 2IZ7A 4X9XA 2OILA 2P68A 4EF4A 1CNMA 1AMUA 2AT1A 2QLNA 4E33A 1O9GA 3SZOA 1MOQA 1QPGA 4UXJA 4ERNA 1U0NA 3UK6A 4HDQB 3L02A 3EWIA 4ZI3A 4RTMA 5T41A 1JX6A 3AINA 2Z1NA 1DGQA 1AM4D 5K0FA 3W34A 1O5OA 2OK8A 2PRJA 4ZQFA 5ELLA 4C7XA 2P11A 1THTA 4O1IA 4BV3A 5KOHB 4LZWA 1PAUA 1KGSA 4QNNA 1E5LA 1DKOA 2GS9A 3RSGA 4M38A 3WBFA 2IYZA 5LQSA 1ZJ5A 3Q72A 2HWWA 3LH5A 2GZRA 2JIZA 3TFQA 3DOCA 3KZ1E 1KYIA 1T5HX 3C85A 3BZWA 3GZ4A 5EXSA 4BLOA 1YQWA 1IN1A 3IP8A 1ULAA 2V59A 4EB3A 2IZOA 5FOVA 1GADO 3M6VA 4QJ4A 3QKUA 1PJSA 5BXYA 3O7WA 3AESB 1KR5A 1ZD9A 2AR0A 2QZZA 3FOFC 3GOHA 1RXYA 3VYSB 4OBWA 2UYHA 1EYZA 2VYQA 4DQKA 3GJ0A 3RBVA 3R5TA 2J30A 1SGWA 3ILXA 1RRVA 2YHIA 3FFTA 4IS2A 5CAEB 1HSZA 1R3UA 4D0GA 5JH7A 1E79A 2D1YA 2F1IA 4MO9A 3B3AA 2W70A 4UVGA 3G5TA 3CA8A 3F4KA 4DYVA 2GYUA 1YE5A 3H3JA 4LECA 4MX8A 1NKVA 3B70A 3C3EA 4EK9A 4RTRA 2GPJA 2P9BA 4J0CA 4W4TA 3SS7X 3V46A 4NCIA 1QAMA 4RZQA 3ADOA 1QYCA 3MJVA 3HCNA 5CMLA 5EMKA 4UM9B 3FFXA 4PRYA 2OG1A 4WERA 2ZRMA 5D3MB 4XEHA 2UYGA 1E2UA 5NULA 5KSOA 2B9EA 3M4XA 4ZZIA 1P31A 5JXJA 4KXQA 4BBAA 2C1EA 1E99A 2A0KA 4WUTA 5CNIA 4QTYA 1HTWA 2GO7A 3CLVA 3IBSA 3ZE8A 5AYVA 5KQLA 1R9MA 3LQ1A 1VKJA 2IELA 5EJMA 1Q74A 1CF9A 3VO9A 5IHXA 3HBJA 4HRVA 1EB8A 4ANFA 2BGJA 2OCLA 5COQA 2E37A 2LBPA 3K94A 4BUJA 3BBPA 5A6VA 3ETCA 5TQ2B 2ZIXA 5P8WA 1S2MA 1ONSA 4YROA 1XMIA 1C0LA 2WPNA 4C2BA 4D0NA 3G6WA 2YUTA 3N3BC 4Q12A 3Q7QA 2B21A 4BO6A 5C0OE 4P32A 5HX7A 2LIPA 1EJ0A 2XYQA 3BPSA 1JTVA 2ZSJA 4OFBA 1VQ1A 2YWHA 1NC1A 2J9FA 2ZTVA 1YQQA 5C1OA 4MRAA 3CEHA 3V9PA 3FYUB 4IQ0A 1A0OA 1P9RA 2J08A 4CR7A 5CB8A 2X2PA 2OCYC 1X1DA 2OZEA 3TOXA 1CB0A 1DELA 4DJTA 4GBMA 1Z3CA 2IX9A 2P1ZA 1Q11A 4DLUA 5AVVA 2WD8A 4AS3A 5HHTA 4DV0B 3WA7A 4PHGA 2OBNA 1HQCA 2PGDA 3CVWA 4G6ZA 4WPGA 1CJKC 2EJWA 3KKMA 3N9IA 2BHRA 1PJ8A 1ILWA 2ZSKA 3AJEA 3JYPA 4HYQA 5F5LA 3G8AA 1K0FA 4L4UA 2IY7A 1QIMA 4GP6A 4KMSA 5IDQA 3A4VA 3F78A 2GAJA 4Q21A 4O25A 4YH1A 3C2QA 3NHWA 1DDGA 2DR0A 3QHQA 1VPWA 1PK9A 1YRBA 2YV1A 1S8FA 4K9MA 5EMHA 2WQ7A 3SXUB 2JEOA 2O7SA 3CZ4A 1NRWA 1TO2E 3NNSA 4NPAA 1BE0A 1TKCA 1YH3A 4CL8A 3KZVA 5EE1A 2GPTA 1KZYC 2C7BA 3RM3A 1VBFA 2J5QA 2O8BA 4HFJA 4WXYB 4M36A 3MQ2A 3M6XA 2HNKA 2J4CA 4KIGA 1TQ4A 1ZGCA 1DIBA 2ZYWX 3QBTA 5C3UA 3F6RA 3A1EA 1NASA 2QTLA 2LNDA 4TXJA 2ZR0A 4MKGA 3VKUA 3SIPA 1FSZA 1O57A 4FLFA 5E8RA 3ZCTA 3G0GA 7AT1A 3UGQA 2O3SA 3SC2B 4PYQA 1M1XB 3IT3A 4AJOA 3MWKA 3R0IA 5KREA 1KEZA 2V7BA 2IH2A 1M2OA 2BFAA 2V58A 5CIQA 2R8BA 2XMZA 4OB7A 1TCCA 3F3KA 3PDUA 1CJMA 1YUMA 2ZAMA 3IV6A 3PQ7A 1FSSA 2XB8A 4JUDX 2RK6A 4PG4A 3IA2A 1MX3A 5CGZA 5CXSA 4YT8A 1CR0A 2Q1WA 2AF3C 4R5MA 1DXHA 2H2IA 4WXMA 4HXFB 1GLNA 1J20A 1T2NA 1FW8A 3C74A 1JW9B 3OOSA 1DQSA 1J39A 3MTIA 5DN9A 3WMEA 4X41A 4TYPA 3RSOA 1CC1S 4RWZA 521PA 1T6XA 4A6EA 4DTCA 2O8DB 1Z13A 1L5QA 3WK6A 5HS4A 4RZ3A 4Z51A 3EYWA 4QECA 4WTOA 1M6VA 3ZCVA 2GJ4A 2REQA 2Q9BA 5HCIA 2O54A 1GXSB 4RD4A 3O84A 1E6LA 1GYPA 3N6XA 2ZXUA 1Q44A 2JGMA 1EX1A 4YJ2B 1UPFA 3RK1A 1UCFA 3ORYA 1S3FA 5KYKA 2IV2X 1USIA 5BW6B 2JBAA 2QTRA 3FFWA 3CT6A 3ZCSA 4MAMA 2K7FA 3EUAA 5CD9A 5HTKA 4W6QA 4GVLA 1XR3A 4MHOA 5L7YA 3ZJ5A 3LCJA 4EPYA 4OJMX 1N8KA 2L19A 3CBGA 3S2IA 1ZM4A 2IU6A 2OHGA 4JI8B 4CU5A 1ZNXA 4FMCF 3AERB 3RRYA 4F56A 1SC6A 2DC1A 5JU6A 3HVUA 3KTFA 2FLKA 1SVNA 5FPPA 2ODPA 3PPVA 1CUBA 2O2HA 4RK0A 2OTCA 2VAPA 3AEQA 3PC4A 4QXQA 3ZVKA 1LLDA 1YA8A 3M49A 2NZ8A 3LHIA 4I3GA 3CLKA 2MSNA 4XRRA 1RAGA 5FWYB 3LLUA 4E46A 4YQEA 1BGWA 3K72B 4CLDA 2DEUA 3X1KA 1VPEA 1PZHA 2QYOA 1QX3A 4UBMA 3GYBA 1JNYA 1MRNA 1LH0A 2PMWB 4H60A 4DRXA 2O0KA 3UKOA 4IMJB 3TDMA 3KQHA 1ACMA 3AHHA 2GJSA 1DL5A 2GNAA 1B41A 3IUSA 3WVNA 3D6AA 4LJKA 1KYXA 4NC9A 3UKJA 1FFWA 3OFVA 4PWZA 4XOIA 1J2YA 1RLMA 1IZ7A 1WCV1 2PRYA 4MQ5A 4YFVA 3V7YA 2FMTA 2JIZD 4REQB 1FLDA 4DSZA 4NCKA 5GIPE 4K9RA 3LFHA 4RQBA 2FWJA 2HA6A 1P6UA 2QJRA 2Z58A 2CMDA 3RAPR 4B4VA 3IP6A 3AF0A 5DJ5A 3T4PA 3VUEA 1L8XA 1UT6A 2Z6VA 4HXGA 4C1BA 1MDBA 4JFAA 4D8XA 2JI8A 5J2TA 1BN6A 1BX3A 1VB3A 3IELA 2Z5VA 4JSRA 5LOVF 4JGIA 4KNWA 4DWVA 3IEMA 1SXJE 5BR1A 2X7JA 2RE8A 3PHJA 1JIQA 4KXWA 3QU9A 4R1QA 1E79D 1KAOA 4QFDA 1G8FA 3DQQA 1ZH2A 2HGZA 2KLBA 3EA0A 3FHLA 3FKJA 2GX6A 1IATA 5DHSA 3KR1A 5A03A 4P4SB 4YJDA 3BAZA 3IAFA 4NICA 1ZKMA 2CYAA 2XDAA 2CN1A 2QPOA 2Z2YA 5L45A 3PNYA 2H8GA 4I5GA 3KKOA 1ODLA 1TEXA 1VSUA 1T43A 5FUBA 1DTWA 1IJBA 2BGLA 3L0PA 3LSYA 1LBIA 2GPSA 3L7CA 3U7RA 4AXXA 3H9UA 3KWLA 3LKDA 5E7IA 4E31A 3AVVA 1I2ZA 4RX1A 5FBZA 1OXSC 2FYTA 2PJUA 3DZCA 4A0GA 5E2IA 5F52A 4IIUA 3MWDA 3IT2A 4BNDB 4B3TB 2FF7A 2C77A 3BULA 1XX6A 3VYVA 3B12A 3GUZA 1J8DA 3ZNNA 1FQWA 4HFMA 5ELXA 1UMCB 3B89A 1TKAA 4ODIA 3ZLTA 1RZ3A 4M2LA 4D79A 3RVLA 1DC6A 1M1YE 1EXDA 3FVTA 2FXVA 4X6UA 1KAMA 1KXJA 4RVDA 1G8HA 1JHUA 2PKXA 2VBFA 2ZB2A 4WNYA 4RESA 4BNXA 5MGNA 3C16C 3GJRA 4IFBA 2BRUA 4NENA 4YRJA 4F7WA 5AW2A 5ICCA 4QQ8A 2WTBA 3UJHA 4HLUC 3DZBA 3HZOA 4L8LA 3FLMA 4I1UA 1ZW1A 4ARZA 1C7ZA 1JV2B 3FTNA 3TLJA 5LQAA 4G5RA 4PZCA 3JARB 5AKJA 2GPWA 3JY6A 1T1GA 4DLWA 5A5GA 2PGAA 4ADSG 3EZNA 4LRUA 2XQFA 4MQLA 4Z0TA 4RDCA 4BLSA 2UUOA 4CM3A 5FEMA 1PCXA 2NACA 4MYUA 3PG5A 2D0PB 3EQ2A 4KLNA 3ET5A 2Q7DA 1PQPA 2I99A 4CG3A 1BXGA 2F8MA 3M4NA 1IWOA 2YBEA 4F8YA 3JAMA 4RA9A 2CJXA 2RJOA 4H1TA 3RIHA 1GVHA 1WJGA 2AN5A 5E1OA 5K3CA 4MQ4A 5FWDA 1J21A 4B84A 1ZM2A 4EYKA 3QEAZ 2YUIA 4ITVA 1P5RA 1XTVA 1GJRA 3E1GA 4HPJB 3BMQA 1YKGA 4MV7A 5DLQC 5F77A 3V2HA 2VATA 1XTJA 4P82A 2HA7A 3ZWOA 2AN9A 3H9JA 1ZDMA 3K31A 2IOFK 4OBBA 1YQUA 1NPYA 2FSUA 1FS6A 1II9A 3IB6A 2MSWA 2I78A 3BL6A 3NXSA 4G0QA 3M1AA 5EPEA 4DZTA 5BQFA 4TV8A 3NNDA 3GBSA 1SBYA 2XGOA 2BFFB 2ZDHA 1FYFA 3I5AA 4LE2A 1GNTA 3P2YA 4O29A 1QHEA 4B75A 1IAQA 1VJ5A 1YULA 2PLRA 2V98A 1UBJS 2GAFA 2QQGA 1Q2XA 1ISGA 3UY4A 2NV6A 4Z53A 3D2LA 1RQPA 1CEEA 4EUKA 4BVLA 3A06A 5GM2A 2P6MA 3WL8A 3ZGLA 4GLJA 4BLPA 4MKXA 2CD7A 5EP4A 1FVXA 1MPXA 1XRLA 2D7JA 2H7VA 4D9NA 4ICIA 2EW8A 4EQ6B 3C6YA 1B0UA 3G79A 1VE6A 1PS9A 2QM0A 4EFNA 3L8ZA 4U2KA 4KFSA 3HLYA 1XZBA 5F5NA 4EY4A 1Z75A 4NX2A 5KWIA 3QLTA 4D9KA 4ZOEA 1F4PA 5CXXA 2XCTB 2ZJFA 5GMOA 3ZVLA 1QFSA 2ZR7A 2XSZA 3BF8A 3C1UA 2VWGA 5JS8A 3HTXA 1TZMA 4UBOA 1PJ2A 3A6LA 4HLQB 3WWDA 4EP1A 1MO2A 1QQTA 2BSAA 4PYIA 3PE4A 5JXWA 3TTWA 3K5WA 4N76A 1I4LD 1QG0A 3B8EA 2QSJA 4Q4HB 4LVNA 4E5VA 3TS1A 4Y1RB 1P8JA 1IH8A 1GP2A 1NP3A 2ICAA 3GG2A 1Q84A 2VTDA 1RP1A 4LX8A 3I12A 4Q3DA 3VM6A 3NWBA 1QK3A 4QUJA 2ZROA 4EMTA 4IZ6A 1VPDA 2FB9A 3K9GA 5JQWA 2VBCA 2F43B 2KYRA 3S81A 2ZIFA 3NDBB 3T9CA 1IBMB 1L6RA 2CHQA 2Z3WA 4YWJA 4GIBA 5EQTA 3ROKA 2I22A 5HUJA 2HIAA 5DKFA 4CW7A 2X13A 3L82B 2D4AA 4WCFA 1IBCA 1ZJZA 4J76A 3PGJA 4EM6A 2IZ1A 2HCTA 1X15A 4RNDB 3O4IA 1K5GA 4PCUA 1O6CA 2Z83A 2NVUA 2GXUA 3FBTA 4OQZA 5B4UA 2WZCA 3OC6A 4DHEA 2WIKA 2ZVQX 2BEJA 3DBRB 4IY1A 3T15A 1MIOB 3VFDA 4KOAA 1K5DA 3M82A 4LOLA 4EW6A 5JWRA 4G67A 5IWAB 2PBFA 3BWXA 2AKYA 3W6NA 3ZHBA 1GZ3A 1H4VB 4KYTA 2OO3A 2VJNA 3CT4A 4NATA 1NTRA 4XEUA 2BJWA 1LI4A 2FFQA 2FG6C 5AM1A 1A04A 4P54A 2PPLA 1CY8A 1D4OA 4WLUA 1CHDA 3LUGA 4BNIA 3SCZA 1A5BB 1QKJA 2PXAA 2IE0A 2R6HA 3FROA 3RSZA 4MQBA 4RQTA 5EHQA 3T7CA 3UBTA 5G41A 3Q8MA 4RDXA 5JROA 5IC5A 3PNBA 2QSYA 1Z6QA 4G3XA 4ZDKA 5B6PA 1U8TA 4H77A 1N0UA 2W2NA 5DYWA 2WUGA 3UMCA 2W48A 1GQ2A 3EIUA 1E89A 1V5EA 3EXG2 1DBPA 3Q3HA 1MX9A 4H08A 4LRTB 4TTIA 5JD3A 4HVCA 4YXWA 1G17A 1TEZA 1E64A 1ZOPA 2IPNA 3FZEA 3HJRA 4ZQCB 1Z8FA 1XD9A 3ZWNA 1RXVA 3K1ZA 1YAHA 3QVOA 1P2SA 4GXNA 3KAQA 4OO3A 2LD4A 3UJ8A 3DAFA 5FL7D 3UWKA 1QIEA 3I9FA 1QGAA 4QELA 3WGLA 3NONA 3KBOA 4C2TA 3O9ZA 2CLOB 3JQFC 1OH7A 1JDJA 4ONEA 5BSTA 1XZEA 1L4NA 4MYRA 1T0IA 2WB4A 1UAAA 4M46A 1Q0UA 1SJ9A 1JE0A 3QE4A 4G5OA 1KDOA 3HZZA 3LQYA 4UJ3A 1CUDA 3UQZA 5BNTA 4AO6A 1Z4PX 3H05A 4KC0A 2JANA 2YHBA 2MCFA 2DMRA 3QBDA 1NRIA 3B36A 3S7TA 3O4VA 3OWXA 3RS9A 4XXHA 4BO2A 2R8ZA 3EGXA 3VVBA 2PL1A 2XNSA 1MHPA 1ZY2A 2FPRA 3RFFA 1OAOC 3GRAA 2I2AA 4K3UA 3LDUA 3MUOA 5KYVA 3TD2A 4E5UA 3C3DA 3CPJB 1XQWA 4Z9YA 4AFNA 1T5DX 2W8ZA 1XRJA 3FPSA 1QXSA 3HLTA 2VPIA 4R1OA 1W8IA 2GM9A 3LUPA 4WKCA 3SX0A 3OAAA 1RWPA 1M73E 3DHYA 4IGKA 1ND5A 1TYEB 2IXBA 1FRNA 3MHPA 4ETMA 2XQIA 3JRWA 2DFTA 3KJZA 1DC8A 2CWDA 2PRSA 2VVTA 2Z8ZA 4Q3EA 2HEIA 3MAGA 4S1NA 1DZ3A 1KZ7B 1WSAA 3HXPA 5FNVA 3RTGA 4ILEA 1QFZA 2PYDA 1QTIA 5E1DA 4C5AA 2OUIA 4JOCA 2V8BA 3GH1A 5TT1A 5ISMA 5KNCH 2PVPA 1YR7A 3HVIA 1M2EA 3SOZA 3DFUA 3HJFA 2ZG6A 2Z2IA 5IBPA 3SY8A 5A9RA 3LMKA 5ARDA 4OGWA 5F7OA 2H1IA 3PUIA 1BC5A 4KPUA 1PIWA 1T36B 2XF8A 3IOMA 3M83A 5H82A 4PX5A 3FKQA 1ORRA 4OSOA 5M3BA 4UEWA 3UWDA 3FNHA 3G9UA 4RA6B 1W93A 2II6A 3LL4A 3FZYA 4L0CA 3LT2A 3BHMA 5HWSA 3OQIB 1JQEA 4IXTA 1VJGA 4RVHA 4YRCA 1NVUQ 1BRTA 5U4QA 2BHTA 3AH8A 5LUAA 3I9LA 1ZJWA 1QMPA 4ZT6A 4G4SO 1CIVA 3SJAA 2VHZA 1DC3A 3LPCA 3TSOA 3OF3A 2JASA 1CQXA 1ZHFA 2W6QA 2OV2A 1Y7LA 2WHRA 4UXHA 4PANA 4PSDA 4Z4IA 1HYHA 1YASA 1Z37A 1QWOA 1HT1E 2C97A 2G9VA 2ZBDA 1PTKA 2VRBA 1J2RA 3NUGA 5I4IA 1H8HD 1DBQA 1UC4B 1F51E 4MWOA 3GRYA 3JQ8B 5K3SA 4B6GA 5CBKA 3HYNA 4OIMA 2QR3A 2UUPA 1V5WA 3CV3A 1L1FA 4H6PA 3VKGA 3U2QA 1AKWA 1DIAA 1MVOA 2GEBA 4F6LA 5AW8A 4ESVA 1WSBA 1Q3HA 3NWPA 6YASA 1ISPA 2UVQA 1S1MA 4F4HA 2Q5HA 2XAAA 4D9GA 4E4RA 1O95C 4JXJA 1IAVA 1ST2A 3BOSA 5DEIA 3TRKA 1DCMA 4MI3A 4QBTA 2XSZD 5J4VA 4FZ3A 1JGTA 3DZJA 1PK7A 3ITNA 4DCJA 3HPRA 1Q1EA 2VNJA 3GELA 3HYLA 1SCQA 3GLFE 4DM4A 2R47A 4OATA 1ECPA 2Y9PB 1U28A 1RPJA 2B61A 3V97A 5I9NA 4DIUA 4B2LA 2YXNA 4I3HA 1SZDA 1QDUA 4K3VA 4O1MA 3VPXA 4HNTA 4Y1EA 3MG9A 2DY0A 3EVEA 4Z2AA 4EQZA 3E8MA 4V0QA 4DC1A 4J4HA 3TTSA 3GFOA 4A23A 3BT7A 1LPAB 4QFBA 4A15A 5HJ7A 2WYIA 5A4AA 1KJYA 4KQGA 4UZEA 3K32A 4XPIB 2YNMC 2O1WA 3OZGA 4QUGA 4UM8B 2MU1A 3N6RA 2EIXA 2WYVA 3MWDB 1QS0A 3KC2A 2IW3A 3SKYA 4EMUA 5CPBA 3BCHA 4LSGA 5FRDA 1AOXA 3IQHX 4RSHA 3F0TA 5U4XA 4JIMA 4MS3A 1CRWG 4CJXA 5E6SB 1VPLA 4YJGB 4M55A 3SNHA 3DO6A 3ELDA 4KREA 1YJCA 2ZE7A 1A96A 4DJDC 1RWXA 2YZKA 5AHOA 5L3SB 3NW9A 2X8JB 3IEIA 3E82A 5C34B 3C3XA 3V1NA 5FDFA 2ETXA 2JJMA 2O5RA 2OEPA 1Y4AE 3OOHA 1MUUA 1NU8A 1Y82A 2XMPA 4MB0A 3H2SA 3S1AB 3UKDA 1R27A 2OECA 4QDOA 3D7MA 3IT1A 4JP3A 1V6AA 4OA5A 4EZIA 1JAIA 2FK7A 2V6GA 1AKUA 3A3NA 2ZUWA 5LXTB 3P2IA 4WJZA 4C0QC 4YDHB 1KMCA 3BSYA 4OLJA 1KY4A 4OHPA 3GJ8A 1M6YA 3U44A 3Q9SA 4OUKX 1Q7CA 2QNIA 3TLMA 2IYXA 3EDQA 3GNTA 4LJSA 3ZDCA 4D0LB 1LJLA 1N92A 2DB3A 3O74A 4P4GA 3U7EB 3N8KA 3EJWA 1URPA 2J3LA 4IINA 2XCLA 2FPUA 2H1FA 2ZJ2A 3I9OA 3QVVA 3UK7A 1SXJC 1ADYA 2JIMA 2Q6IA 3DF7A 3N74A 1PR2A 3A6HA 3HE3A 2CYBA 3ENVA 3GT7A 4F4DA 3A8TA 4D25A 4ND8A 1Q1ZA 3CLRD 5ICEA 1TD9A 5E4YA 3OTOB 1ISJA 2HPAA 3DV0B 5JVDF 2DPXA 3GHYA 4QUEA 1C0PA 2WJWA 1ZU4A 2VUUA 3DE3X 3AI1A 4LOAA 5CP8A 4YXWD 5ICGA 1JHMA 4KPFC 2UYOA 2VQEB 1P44A 3HRKA 1PGNA 1PT7A 2Q9UA 3CCBA 3GLVA 4UE6A 1XUOA 2JCBA 1U1FA 3H3FA 4H7JA 4K9PA 2I62A 2QMQA 3VUFA 4S1PA 4YAIA 2O5VA 4PN7A 5L95A 4UW9A 4F0JA 5C4GB 4YPVA 3DTVA 4NARA 3SI7A 2QY6A 2XDQB 3TQTA 3REQB 1P4JA 5D87A 1E8MA 1CUEA 1PJ3A 1YKFA 2GR9A 3SZ3A 5A0FA 3UH1A 5C1DA 3FTEA 2OSBA 1QGYA 1EFKA 4GQAA 3EXG1 4DNXA 3A31A 3PKZA 4F9GA 1FZQA 2PQ0A 3B9RA 1FRFS 1VCNA 2PHZA 3OJ0A 2O7RA 1T4DA 4QPNA 4RMIA 4CI0B 3OMWA 2IEGA 2X15A 2C7RA 3W9UA 2A1UA 4HF7A 3R7DA 5IUJC 4NV3A 3HEMA 3A3KA 3RHTA 1VB5A 1W34A 4NFLA 2AVDA 4PGAA 3G8YA 1JZTA 1O8CA 3CN9A 1XNQB 1DFIA 5JV5A 3D4BA 1VXRA 4AM8A 4BUCA 1E2KA 1YJ8A 1RM3A 2XMSA 4N5DA 4TTSA 1SCIA 4UUQA 5FBRB 5JC8A 1OV4A 1XVUA 4QGHA 3VOTA 2GVDC 2IWHA 2PE5A 1T2VA 4UUOA 2IXAA 1OI4A 4L16A 1X42A 2O50A 3L4BC 2NSDA 1COZA 2V74B 3VSAA 2HU8A 4ID3A 3AVYA 5EIEA 4HJRA 5DX1A 4QGGA 1JFFA 2A9PA 1F17A 3KQOA 3KVOA 4YDRA 1Z4LA 4DUPA 2CEKA 5G1NA 4OY3A 3T7IA 1JHPA 3H8JA 3IHKA 3U80A 3DEHA 1WV0A 2XMBA 3IMCA 1FL9A 3HKBA 3NGLA 1J9GA 4N82A 1E1QA 1N0VC 3BD7A 1NR1A 3ACBA 3C6XA 5B64A 2J3DA 3L7OA 4AURA 2Y0DA 3AFOA 3LKBA 4V1CI 1R00A 5ITSA 2IQIA 2FPGA 1CVIA 1GQSA 1Q7TA 1TE2A 2CLSA 1O97D 1A2QA 3VU1A 1WUKS 5CH3A 3OQVA 2XB6A 3EH1A 1FMTA 1YZVA 1ZOSA 3RVBA 3VR5H 5DTRA 4DMUB 3L8YA 3EF0A 3KYBA 4X7MA 1NF8A 2IC5A 3FOWA 3ZJUA 4D96A 1EG7A 2I7DA 2YW2A 3GG9A 4KTVE 5LM3A 3TPCA 1UPBA 2DFNA 1RAAA 4BBJA 4QOFA 4ZOLA 7MDHA 5ESRA 3PJGA 3OUTA 5KQPA 5JDIA 2VDWB 2SCUA 2WA2A 4IJUA 2JBHA 1EHYA 1OBVA 2AD1A 4UD2A 2J3JA 1PWXA 3BJEA 3FPJA 4LQLA 4FHGA 1UMBA 5FUQA 4UAVA 4CG0A 4ZRMA 3LOQA 5DM70 1OB5A 4O4JA 2GCOA 3CKYA 2UXBB 1I5OA 5D6OA 3SS9X 4D74A 4E0BA 1LBTA 3G5LA 4C04A 5A0VA 2OKCA 2WRZA 1T26A 1UKYA 3RVQA 4WK6A 1D4AA 5EHIA 4O4HF 2RBKA 2WA1A 3LWDA 1SHLA 4B35A 4DF3A 2IY9A 3PUWA 1G98A 2HFKA 5LBIA 1FU7A 1N5MA 4ZYWA 3HBMA 2OGWA 3W77A 4CKCB 3N2EA 4PYJA 2FFBA 1BMQA 3MMZA 4OK6A 3W7BA 2CDBA 2R6R1 4HUQB 4MW9A 4N40A 2E5WA 4F38A 10MHA 1OAAA 2P2LA 2JJYA 3IGFA 3L7KA 4ZMRA 1Z83A 1XL0A 4PS1A 1XNRB 1WL8A 1UM9A 2C4HA 4OXIA 2EFHB 2CJWB 2GA8A 3BJZA 4P58A 1D6SA 3SSMA 4C0KA 1WLYA 2VSXA 3LF2A 4PC3A 4R40A 4Y98A 2JFGA 3K71B 4MWCA 2VPWA 3BVPA 2K7ZA 1FJXA 3U7IA 3U3DA 1KC3A 4L75A 5BVGB 3A6JA 1L4LA 1MJFA 3ASVA 1W2GA 1YHYA 3KHSA 4FJ0A 3MWGA 4YMIA 1XF1A 5B1IA 4A0QA 4BVHA 4D9HA 3P2MA 2P2SA 2Y1OA 4TYMA 1YS2X 4Y2SA 5JPCA 5K8JB 2AIRA 3TLGB 3HMKA 4DR5B 3LPNA 4B2YA 2WJAA 1XALA 2QTGA 4KVZA 3SHQA 3OZWA 3F73A 1GILA 2VDPB 4UNNA 5SY9A 4ZZ1A 5M7EA 3T3MB 2L82A 1P0MA 1G3MA 1I5EA 1K66A 1ZPDA 1W35A 2FE4A 2R4UA 4IXDA 3R2JA 3KFLA 2V45A 5BSRA 1U65A 2I0FA 2GJKA 2V4MA 4RD1A 4A27A 5SYNA 1RHRA 4E5KA 2FDCA 2VI5A 2DHRA 4FE7A 2BFEA 3GFTA 2XCRB 4HUJA 1YFKA 1TVCA 1V3QE 3GHHA 4M9ZA 5D5HA 4GBED 3FYTA 2I4LA 1HTBA 1QF7A 2IZ0A 4IZOA 4DHWA 5A3JA 5C5IA 4H7EA 2CLMB 3I76A 4WVLA 3D1JA 3GLIE 1H0SA 1U2GA 2V9PA 2QMUA 4G0PA 5EZSA 1GZSA 2ZIXB 4KZKA 2CNWA 3L6BA 3A1VA 1VSQA 4WMLA 1JG4A 5H80A 1A8QA 1QIJA 2H3HA 4RPIA 4JXKA 4GLOA 4IO0A 4QU5A 4Q9LA 3BA1A 4IJMA 2IOFA 2AG8A 1V1RA 3CO0S 1QK5A 3A7EA 1SURA 4MQEA 3ESYA 4PN3A 5B58T 1CY2A 2IYWA 2MINB 2C9CA 3I92A 4J8PA 2J9FB 4P3PA 3ZLVA 3S68A 3F6BX 4A8JC 1RTKA 5JXGA 5I4BA 4JMPA 4RH1A 1YOBA 2QVLA 2H1CA 4CEHA 4D6XA 5HK9A 2YVKA 3QY9A 2FPPA 3Q0EA 1WCXA 2P41A 5DNWA 3V8RA 3W9BA 4G8CA 4O4IF 3F8SA 3AWIA 3KYJB 1XZAA 2HLDA 2JFWA 3QPWA 1E0SA 4F6CA 4CXMA 1W2HA 5HSGA 4ZV9A 1Y1LA 3V8QA 2C1XA 2B4YA 2JA2A 5JSUA 4C30A 3WJ2A 4E7OA 1QDLB 3AIMA 4A2WA 1EAYA 4WZAE 3CSDA 3GWGA 4X60A 1LSJA 4YV2A 3FZNA 1XLVA 1WDLA 2RCNA 5DLYA 4LRWA 5AJZA 1YKSA 1QE5A 2BZ0A 2WIDA 3L01A 2WJ3A 1QYVA 3HGTA 1FJ2A 1EUDB 4E1AA 3HP4A 4MMXB 4RTJA 1E96A 4QE3A 3DA8A 4ZYVA 1NG9A 1A97A 5T4BA 2WABA 1BE8A 1FF9A 2Z1MA 1C3JA 4FBGA 2I5PO 1SHTX 3D02A 1JDNA 3ZQ4A 3UVEA 2I65A 4GOND 1BH2A 1U7ZA 1E1LA 3DTYA 1NNUA 4K05A 4IHQA 1XU4A 1D1QA 3LWNA 5TR9A 4C07A 4WY8A 2BR3A 3CX6A 2IEBA 2ZSAA 3UHFA 4B81A 4M7OA 3P52A 3R8CA 4JUFA 1OBOA 1RJGA 3OWOA 4BNVA 4KR9A 3T7RA 5BW8A 4D8UA 1P1KA 1DJQA 1WV1A 2PJRA 4CGZA 3JTMA 3L7LA 4BQNA 3B6KA 3MS7A 1KFEB 3DBIA 3RUAA 4BP9A 1XZDA 1SUPA 2ZCVA 3AXTA 3OE5A 1Q5PA 1WUJS 2GBPA 3R74A 4M1YA 4ACBA 1KP3A 2CXQA 5ALIA 1M2OB 4UVEA 3SZUA 4D5GA 1CT9A 3KVRA 1RXSA 2PZBA 5K4GA 5HF5A 3F67A 3HVKA 4KRFA 2A6PA 1P6QA 4HK4A 3RUCA 1AHPA 3C4VA 3N3AC 5HKAA 1E1QD 5BMOA 4RE5A 4LGMA 1NQWA 2Y1LA 3DG9A 4L2IB 4ZKDA 1JQAA 2NYAA 5LA6A 4XGIA 3WK5A 1ESMA 4MR7A 4Z1OA 2QRUA 3QEOA 4TTAA 5LDDC 4CMHA 4OA8A 1FRQA 3OHPA 3ZH2A 5BWBA 5CG1A 4EG5A 1PSZA 1RI5A 2YIVX 2NOAA 4QO7A 3ER6A 3RUFA 2GJ8A 1M6VB 5F7XA 2BFBA 121PA 1HTTA 2R7LA 2AMJA 1YDFA 3HCDA 4IDHA 1EZ1A 3PC6A 5EZYF 4I46A 4IIJF 3PR2B 1KS9A 4RMGA 1S4QA 2IV7A 1E20A 1CS4C 2QVBA 5F1PA 3O31A 4O5OA 4US0R 2CLFB 3VAAA 3H8SA 4EHJA 3GUHA 2FPIB 4LC1A 4RCVA 3DQPA 4Z6KA 4B6EA 2I76A 1KI4A 5DO9A 5KTPA 3GEBA 4F86A 3CVJA 1Y7TA 2O5CA 1RXIA 3T7EA 1H1LB 3FLAA 3TCKA 4WBNA 2WW8A 2ANBA 3ETJA 4X95A 3DEKA 1YBAA 2FQYA 4B3JA 4HJXA 2O07A 1B8UA 1NUAA 1QV6A 3AEQB 2QYHA 2F8TA 2OXRA 1L4YA 3NWJA 4IDPA 2YJ5A 4OL0A 1KPHA 2Y68A 4RGQA 3ZWMA 1KTIA 4DS3A 5DTIA 4Y6GB 3RG2A 3VYTB 4QXOA 1KIAA 3SSAA 2PH3A 3N2YA 2JGNA 4YB8A 1WXDA 5F9MA 1LEHA 3DLAA 3DV2A 3EIXA 3BIJA 2DKFA 3CNEA 5IT5A 3WMRA 3DC2A 2DQSA 1YU6A 2AD5A 3TOVA 1NP7A 1WD5A 2R4QA 5IMBA 4N65A 4PBTA 1OWNA 4E08A 5IFLA 4HI0E 2QLJA 2UU9B 2PEZA 2Y99A 4YN3A 4JYMA 1VL2A 4B32A 5EJFA 2Z3VA 4YPFA 4GC9A 4WQMA 2QOEA 4ETNA 1STOA 3R1IA 1G3IA 2VIIA 3PRKE 1N1GA 1XRSB 2NPOA 2CDRA 3G5MA 4QDZA 4EI2A 1ECBA 4BXOA 5DHQA 4OBXA 3A9VA 1T1EA 2HRRA 3IUBA 4CV0A 1FDOA 4DMMA 1NNLA 1M7BA 2IUEA 3B6EA 3KZMA 2KWIA 2JJ1D 3NVDA 3T0GA 1XZLA 3WGQA 2QG9A 1I14A 2FZGA 3LC7O 3KEGA 2IYUA 3KDPA 3H86A 1QIHA 1AG9A 1PS0A 1KDRA 3B7PA 1EIZA 2Y93A 2B7BA 3TD9A 2FHSA 3P8ZA 1EP1B 4DXAA 5GZ6A 4G9EA 1RR6A 1E0KA 2HXGA 3F5MA 1F38A 1P80A 2AFHA 3R7NA 3PK0A 3EAFA 4BNJA 1S01A 2DJIA 2OSVA 3QKSA 3RJMA 3UA4A 3UOWA 1J25A 1DTWB 4GUDA 2VSFA 4M99A 2XA9A 3KR9A 4MVJG 3DONA 3THOA 3W5IA 4D3XA 2F62A 1YB4A 1VHWA 4QM7A 3M5DA 1XB2A 3T5PA 4KWCA 3MJTA 4KI0A 1BTOA 1DAHA 3CZ9A 1EGAA 2R6GA 1EDBA 1HDEA 3GFBA 3QIVA 4CM9A 1A69A 3QTBA 4NEGA 3O8CA 4EBBA 4EJ0A 3GT4A 2BDTA 2HCJB 4IS3A 2P77A 3I6BA 4DIMA 1XU9A 4UCFA 2BTQA 4ZCLA 4GWGA 3D8UA 2Z5GA 2HTEA 2DBYA 3PUKA 3DWEX 4A2CA 1NWHA 3L8HA 3NIDB 2FQXA 4XQGA 4P8RA 2FW1A 4HADA 4KFRA 2B1QA 1NBWB 2VL7A 2FX2A 3G7NA 3I1IA 2C95A 2G63A 3KQSA 1G64A 5C53B 3JD0A 3ZWWA 2Q27A 4EUNA 1FRVA 3ND8A 2VDKB 2ZULA 2SKCA 3VOBA 3K4HA 1A4XA 3T3EA 1XDGA 1BDBA 4LFBB 4LMPA 5DTJA 4TZTA 4PLVA 1KAQA 3E8SA 4BOYA 3JWEA 4D9BA 4PX9A 4MPTA 1ECJA 3BSWA 2F48A 2WG0A 2ZJYA 1UXJA 3BFVA 1GITA 3KB2A 3SZRA 1X86B 1YTLA 5KDOA 8MHTA 2ZWPA 5ITZA 5HVNA 3CNBA 1HDRA 4U7FA 1BU8A 1FX1A 3P9RA 5C8ZA 3C5WP 4US1R 1X1EA 2EARA 4Q1BA 2GH1A 1BXGB 2QBYA 3L1JA 2QVCA 1UK6A 4NIMA 3H5RA 3S2SA 1L5YA 1XKXA 4GZMA 1FYWA 2B37A 3JZFA 4CZ2A 2GETA 3MCUA 3TRFA 1M7GA 2H08A 3C7AA 5HRUA 3BMQB 1GNLA 1IHDA 1NI4A 2UYQA 4YAEA 4L15A 1O0CA 1XA0A 1GEGA 3NT2A 4YALA 2BW0A 4O2BB 1C7EA 1ZNQO 5HBGA 2Y0EA 3GARA 2PUCA 2PANA 2BY4A 1U0FA 2P1DA 3NYIA 3F96A 4I9UA 3BERA 2QWXA 4I6GA 2I55A 1L5KA 1Q0QA 1PDWA 4XH9B 5BV2P 5A0TA 1GKYA 3GYGA 1WUHS 2WJVA 3ILSA 5TT0A 3X1MA 5ITVA 1KHHA 3HY4A 1NC3A 3CZMA 5DK4A 3T0IA 4BGIA 4XWOA 3E3MA 2NG1A 1BXRA 1GQYA 5EQJB 1FFCA 1PL6A 1QRRA 1KY5A 1XQXA 4QYSA 3WLIA 2EGGA 3IIMA