2BCGY

Structure of doubly prenylated ypt1:gdi complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
b'SEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretory pathway GDP dissociation inhibitor
publication title Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 66
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2005-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bcgY00
1R0WA 3LO5A 4R7ZA 1RRPA 2WSSD 4JSYA 4DSUA 1TUIA 4M1WA 3ADKA 4L15A 4JL6A 2PH1A 4G3XA 1T0HB 2ZJ5A 4PR0A 5JI2E 4JLKA 1UADA 3A1WA 1II0A 3LWNA 4C4PA 4M9XA 2GCNA 1SHKA 1MO5A 2OT3B 4N3NA 4UJ5A 1DO0A 4RCZA 4JJKA 4B3BA 4LBVA 4XOIA 1ZVQA 1R6BX 2CE2X 3DL0A 4A8JB 4YMUA 2DFTA 2J0UB 2ZIAA 4B6FA 1P2VA 1I2MA 2GVZC 1RJ9A 1CR0A 4B3DA 1FFHA 4BWYA 1SXJD 2VRWA 4JVMA 4Q9HA 2HEIA 2ZR9A 5G53C 4BFSA 3LX5A 3ZH9B 4QL3A 4ZV4A 2KBEA 5J4HA 4TMXA 3QXCA 4KSCA 1KSFX 1ESNA 3QI2A 1NLYA 4M9QA 1N0WA 4FWTA 4A36A 1BKDR 1Z0KA 4MRVA 2B8WA 4JVLA 3GLIB 4PQRA 1EX7A 5FPTA 2QZ4A 4D80A 2OSBA 5IT5A 1XDBA 5TV2A 2HCBA 3RWMB 2IXFA 1Z3IX 1TL7C 4UNPA 2ZQ5A 1PLKA 3LY5A 1DAIA 4MH0R 1EFRD 2CCKA 4HB4A 4DDVA 2IYRA 2IXGA 1BH2A 4OYHA 4ACAA 3B5JA 3VU9A 2IUUA 1NKTA 2WWIA 5FBVB 4IOLA 5EXPA 2ODEA 2Q21A 3KKPA 2ZI9A 1CRQA 4PHHA 2IF2A 3GLHE 4PPQA 2RKOA 3VTKA 4WXRA 3MUFA 1YZUA 4POAA 3UK6A 4A92A 1WBBA 1U99A 4JL5A 1KI3A 2H57A 5D3MB 2XTZA 4OI1A 1AKEA 4S35A 2REBA 2XZPA 2CMKA 3SC3A 3IEUA 3PEVA 5G41A 3QKUA 1MRSA 1DS6A 3SYNA 4KO8A 4DLZA 2A5FA 4IDOA 3FVQA 1ZD9A 3GJXC 5EP3A 1XEXB 2ZAOA 4BFXA 3GEHA 1QHYA 2ZRMA 3L43A 3TSWA 1X86B 2LKCA 1D9XA 2XNDD 1N5KA 2GETA 2HV8A 2VHTA 3QKSB 5CJ2A 1G8PA 1X8KA 1CU1A 4Z1MA 4F4CA 4QGGA 1E1RA 4MGYR 5FPHA 3F5FA 1J90A 3PV0A 1EWRA 2R44A 3C5HA 3QXJA 2CK3A 4RD6A 3TQFA 4LV6A 2ZYVX 1Z08A 4MYTA 1FZQA 1NJGA 4OHXA 4WZ6A 4ZDWA 4TL9A 4XD7D 3GJ7A 4PC1A 1JPNA 4MYUA 4W5HA 2VHQA 2AK3A 1QHXA 1BMFD 2VSFA 4XVQA 5DHAA 3OE7D 3L0OA 2WWYA 1OH6A 2BKUA 3M0EA 1I2DA 4Q7MB 2FEOA 4DT1A 3A37A 5EXXA 4DEXA 3REFA 4C0BA 4BZQA 5JSZA 3P27A 4Q5IA 4N0DA 1ZINA 2ZVPX 3RVBA 2D74A 4TTPA 4ABYA 1R0ZA 2JLZA 2ODWA 2BIFA 2ZUBA 2ZJ2A 3UIEA 3WHKA 3AV0B 3L2OB 4EAQA 3TAUA 2XX3A 2JLRA 4RJLA 3ZQJA 3ETLA 3RNLA 1KO7A 1XXHB 4FINA 3CONA 3S1AB 3TGPA 4UJ3A 1CP2A 5JMTA 3KFVA 4HZIA 3B1WA 4LUCA 4E5UA 1TADA 4URZR 4AKIA 4LJ5A 2ANCA 2G88A 2F3TA 3QNUA 5G3ZA 3MSXA 4IHQA 3AVWA 5TMPA 3WP1B 4U02A 1JR3E 4QXAA 1A1VA 4FI3C 3N70A 1OFIA 3UG6A 2CNWD 2F1JA 3D6TB 2FH5B 1KJYA 1XTKA 4W5WA 4G5RA 4UQOA 3O47A 4EPYA 3T1QA 2BBWA 3VQTA 3BJIC 3K0EA 3EIQA 4G01B 1QHIA 3IPYA 3WMFA 4MITA 3W9YA 1E2DA 2YINC 5FTMA 2SHKA 1L4UA 2RGXA 4WZAE 4HDQB 2QY9A 1GOTA 2W6ID 1E9AA 4BUJA 4XVUA 1B23P 3BS4A 1H8HD 4JJZA 4LHWA 4EFLA 3DM9B 2ASEA 4ZO4A 1MKYA 5EJEA 3CB4A 2A9KA 3HWSA 4I4LA 4Q19A 5F2EA 3VX3A 3X1DA 1OT3A 1TX4B 1QHHB 1GNQA 3FMFA 2NTYC 3GJ5A 1YRAA 4TYQA 3M6AA 1W44A 4BFZA 3BIFA 4WVFA 1R8QA 3UMRA 2EFCB 5JHHB 2WIBA 2OZEA 1QG4A 3KUDA 5AUOB 3NDBB 2ORVA 1G21E 3K9GA 1ZRHA 4XSGA 2QGNA 3NIBA 4JLBA 2ZS9A 2VHCA 2DBYA 3KXLA 2EFDB 2HCJB 4MKIA 2JIZA 3BB4A 1W4RA 1SKYE 5DN6D 3HU1A 4A2WA 2GXAA 4PO8A 2BCJQ 4FW9A 3HYTA 3GLFB 5IDVA 1VECA 1ONBA 4OK5A 1JR3A 2WJYA 4YMTA 3CR8A 3RRYA 3L82B 2OCAA 3AVUA 3BXZA 4HZUA 4W7SA 1KK3A 5L3SB 1E4VA 2F43A 4LDJA 4WBSA 2G9NA 4B2IA 1OFHA 5C2JB 5AJWA 2QMUA 1IQPA 2BOVA 1GRNA 1O87A 2WIAA 1TAGA 3KKQA 3X1XA 4OQMA 1CKEA 4A0HA 1Y63A 1SVMA 4BLQA 3R9IA 5CYOA 2BBTA 3WXMA 3TUJC 5CYPA 3KQHA 2EYUA 2GK7A 4DBLC 3PUYA 3BBPA 3T5GA 1U0LA 1G64A 2ZU0C 2ZTSA 4HLUA 1F2TA 5FPSA 3RAPR 1Z28A 5D3QA 4MYCA 2BCGY 1LS1A 4OK3A 3RSLA 3SZRA 3W90A 3ZQ6A 4DCUA 1RPZA 2EW1A 3F3YA 3KKOA 2QUZA 4Q47A 2XB4A 3B8HA 5DLQC 1TQ4A 2I1QA 1YZGA 1FUKA 1SXJE 1KJWA 1R5BA 5JI3E 1XWIA 2CBZA 5DI3B 3TR5A 4F38A 3T1TA 4FMCF 4R71A 4RVCA 5FI0B 2YWHA 4TYWA 3WNBA 2QE7A 4LHVA 2YOGA 4S2EA 1KHTA 1LW7A 2Y8EA 4I81A 2D06A 4FMCB 1LB1B 4L9SA 3X1YA 2EFHB 1Z63A 3EIEA 3NBZC 2PT7A 4TYPA 1ZU5A 4LI0A 1M7HA 2D62A 4PPNA 1NF3A 4MGZR 3U44B 4PZYA 3ZD6A 1OIWA 1KMHB 1ZUIA 4AIIA 3RYTC 5FPYA 2WSSA 4TQUS 2D2FA 1XD8A 3E1SA 3WRYC 4BFVA 1SVIA 1WF3A 1GKUB 1EG7A 1E9DA 1AQYA 1E2JA 2R6DA 4LC0A 1PLJA 3WHLA 4L9WA 3P26A 4NP6A 3RRNA 2WWGA 4DCNA 1E9EA 3KQNA 1NLZA 4X8MA 5EXTA 2FNAA 3AUXA 3DKPA 3ZD7A 3EG5A 2YC4C 1N25A 2WMNB 3UWOA 3B1XA 2QENA 2XGJA 1KOFA 1XMSA 2OE2A 3AVOA 4M1KA 3ND8A 2DWQA 1ZNYA 4O25A 2JLQA 3PEWA 2FG5A 2ZYTX 3LVRE 2A30A 1E2IA 1SXJA 2QQ0A 3MLEA 4QGAA 2DFLA 4OJQA 2H18A 1DVRA 1OFTA 1ZCBA 3BOSA 4A0FA 5AUNB 1NBMD 5JWOA 4B3FX 4JLPA 2GA8A 2QRZA 4Q7LA 3LV8A 4F7WA 4DC9A 3VAAA 3KKNA 3OIYA 5AJYA 3W5JA 1ZNXA 1CR2A 4LJ9A 4ZCIA 4R9UC 1A4RA 1X6VA 1N6IA 3CM0A 2ZI3A 1VDZA 2XAUA 1E69A 3VFDA 2H5EA 5BYJA 3OAAD 4XSHA 1BS1A 1XMVA 3L8ZA 5FL3A 4QGHA 1CBUA 2W6JD 3L0PA 4CEIA 2IYQA 3AB3A 3PUWA 1DG1G 4A2PA 4DLUA 4BLPA 1YZLA 4B34A 2OCPA 4Q1EA 3J81k 2B21A 3DKVA 3LD9A 3K0FA 1JXMA 4ILEA 2IS1A 1ZD8A 4PPFA 4UNRA 2OXRA 4LGMA 4V03A 3I1FA 3WMEA 1VYTA 1PZNA 2P6UA 1RJ9B 1UBCA 5HR5A 1SGWA 2GF9A 2PMDA 4URWR 2CLCX 2VA8A 3B2EA 3EA0A 2IUTA 2VL7A 3ONWA 2JA1A 2MMGA 4CZ2A 5HTKA 3UMSA 2EFGA 1RYHA 2ZSEA 1GDDA 1CLUA 4DLWA 3F8TA 1IXZA 2N46A 2EU8A 3NH6A 2OCBA 1VYUA 1GRQA 2PEZA 5GJCA 2R6FA 2XNDA 2NIPA 2R8RA 1S8FA 2V54A 3TQCA 2VP2A 4C2UA 2QAGB 3AP3A 2EQBA 1ZW6A 4TMWA 1QDEA 5JRJA 4Q4HA 4Q7KA 2GJAA 4LC1A 4QRHA 2XZOA 2VPPA 2V8OA 2AFHE 1MO4A 3VU9B 5JS8A 5K8UA 1KK1A 2NZJA 2I4IA 2HUPA 1XP8A 3FPAA 4GRAA 4K8OA 5JEDA 4Z1MD 2ZJYA 2ZYUX 4YLGA 3B6EA 3CF2A 4IVPA 1FTSA 3A4NA 2CK3D 5CITA 2QG6A 1E2GA 4XD7A 1P9NA 4D2IA 1CTQA 2ZAMA 4NYIR 3K70B 1NSTA 3N5CA 1BMFA 3VHXA 2WICA 3AP1A 3OE7A 4M1TA 3RS7A 2A78A 2WOJA 2AKYA 4GL2A 4K46A 1NKSA 3SEAA 1G4AE 2IWRA 3M4YA 4V02A 5AWFC 1KSGA 4WOPA 2W0MA 4Q4AA 3EPJA 1W5TA 4C7OA 3ZVRA 3H1TA 2P2LA 3W6PA 1E2KA 4RZUA 5KPDA 1NVUQ 3CZQA 5J5CA 2O8DA 3QJYA 2FZ4A 1W0JD 1DELA 2OHFA 1UDWA 5CLLA 5EE9A 3T61A 4ACBA 3L8YA 2PLRA 1TEVA 1J2JA 2X77A 2ERXA 2OILA 2QNRA 2IYTA 3KB2A 3U61B 1GL7A 2GCOA 1M8PA 2ZJ8A 4LJ4A 2ZJAA 1LS6A 3EPKA 3REGA 1XFAA 1FPMA 1N6RA 2E87A 2NMVA 1ZM3A 3CX7A 5FR1A 3KX2A 2CNWA 4LYHA 4DEYA 2IA5A 4Q9IA 4DLYA 4OHYA 1E3MA 4DT1B 2VF7A 1YR8A 1JPJA 1I4DD 2IYVA 5EQTA 1Q44A 5JSZB 3BH7A 4NYJR 2KBFA 4IEEA 5ELXA 1NY6A 1TQDA 4AD8A 2FA9A 1JR6A 1EFTA 2JLYA 3GD7A 2KJQA 3EARA 4TTQA 5JFGA 1H8HA 3EWAA 1XCMA 3NVAA 3GLGE 1FTNA 4IVQA 3U3MA 1I4LD 2N42A 4Q9LA 4KYIB 2FF7A 4P3YA 1BYIA 1N5LA 1X3SA 3AM1A 2OBMA 4ZIRA 3K9NA 2ZREA 4MGIR 4NKRA 3KQKA 1NSFA 1JI0A 2ERYA 2QMHA 5P21A 4GP6A 3LA6A 4EQ6A 1HQYE 4BE7B 4QHYA 2CLDX 3KDSE 4BFWA 4FCTA 3RS0A 3AVXA 5DN6A 2BC9A 3IBGA 4I99A 3DPUA 2EVWX 3BFVA 2V6IA 3BH6A 3FGNA 5DISB 3RABA 2JIZD 4D4JA 1IONA 3C15C 1D2MA 2B7BA 1XD9A 3W6OA 1DBSA 421PA 1D8TA 2W2XA 4IEIA 1G18A 4AYWA 5E3HA 4LK2A 4PX9A 1G16A 1R5NA 4ZI2A 1KIMA 4Q9JA 5C1BA 2WHXA 4TMZA 3EXAA 2VTKA 2J5XA 2R6CA 4G5OA 4OJKA 2V3CC 1RZ3A 3H0KA 1OB5A 2F7SA 1EK0A 2KWIA 1ZNZA 3NC0C 1LTQA 2RGNA 2QP9X 3SQXA 2RMKA 1G5RA 1UFQA 4X8LA 4EPRA 5CIWA 2ZJBA 2ECKA 1NI3A 1G17A 3GLGA 3LW8A 4JLAA 5KHOC 1FMLA 1TUEA 2J9RA 1XTRA 3GJ4A 5DHFA 5BN4A 2WPDD 2NZ8A 3NBFA 2O8BA 4G5QA 1NVWQ 1T5IA 4M8NE 3NDPA 1NVVR 3FB4A 3R8CA 4KLZA 5CJPA 2DPXA 4L5BA 1IY1A 2OAQ1 1NBME 5DGXA 2AFIE 4NCHA 4Y0AA 1YZQA 4W5JA 5M04A 2AR7A 3FTQA 1NG9A 3ADBA 1CR4A 2Z4SA 3ASZA 2QTVB 4HZUB 3VNUA 1S9DA 3SFZA 2QE7D 1VTKA 2GZHA 2J41A 2R6AA 2ZR7A 1V43A 1N5JA 1YZKA 3R7WA 4DLTA 2QROA 1SULA 4Z8XA 1N6HA 5KOYA 3A8TA 4OI4A 3N2IA 2H92A 1F3OA 4TLDA 2O8EA 1T6NA 3K70C 2MMCA 1EX6A 3PQCA 5IHPA 1TU3A 1U98A 3PITA 2X1VA 2C2HA 1OH8A 1OYWA 1GNPA 3VR6A 2YZ2A 3W8NA 1N2CE 2CLSA 3PG5A 1KI8A 1T9HA 3VR3A 1YE8A 1IHUA 2NO0A 3T1OA 1CJVC 1ZUHA 4HATA 4HAZA 3AKYA 2ZRHA 2F1IA 3NKVA 3H4MA 3KB1A 4ZCLA 5IF9A 3H2YA 2HLDD 1XTSA 2OLJA 3AVVA 3NTUA 4I1UA 2Z43A 4BQSA 4II7A 2ZU6A 3DMDA 3P4XA 2JJ2D 2F1RA 1Z0AA 2E1RA 3O8DA 5FOWA 1Z5ZA 1N0UA 1SKYB 2A5GA 3C8UA 4TLCA 1EFHA 3AKEA 1NBMA 1C1YA 2XNSA 3AP2A 2YV5A 1LF0A 3CRMA 4XIGS 2V1UA 1U0HC 1LVGA 4XWOA 4HUTA 1AM4D 2ZXUA 5AK0A 2IEZA 4PC7A 1AGRA 4R98A 2FU5C 3DOFA 4MKGA 3NBXX 1W46A 4EJSA 2IC5A 3OAAA 2CL7X 4NCKA 3BB1A 4V0KA 2XB2A 1P9RA 2AD1A 4IRUB 4PQYA 1V5WA 2W6JA 1U8AA 1HV8A 3TE6A 5A4JA 5FUVA 2YKGA 1ZU4A 3G0HA 1XPRA 3KJHA 4DIDA 2WBLC 3THYB 2QPOA 3QY0A 2ZI4A 4UXJA 3FE2A 3TMKA 4DSTA 2G1JA 2DCUA 2J3EA 5KTYA 1NN0A 1XX6A 1BO6A 1E1QD 1SXJB 3E2IA 4EPXA 4ZCMA 4Q1AA 4A15A 4O0MA 4GT1A 2C5LA 3CRVA 2FWRA 3QKTA 5LD2B 2J59A 1Z22A 1DAMA 2ZYWX 3EA5A 4RD2A 1OIVA 5FTJA 2QL6A 1E98A 1JQJC 3FHOA 3IQWA 3DOEA 5BQ5A 1EFUA 3E5HA 3U3JA 3ADDA 3IEVA 1PV4A 4BASA 1AIPA 1QRAA 2FJUA 3NEYA 1KAOA 1G3UA 2G3YA 3GEEA 2BBOA 2J0SA 3ASYA 4AWXA 2WKPA 2PCLA 3MJHA 4G5GA 3U7EB 1NMYA 1XPUA 1VMAA 3EAQA 4OHWA 4JLDA 1P62B 1DOAA 2VHUA 1E2NA 1CJUC 2LWIA 1AS0A 2QTFA 4RD1A 3FKSD 4D0GA 3LW7A 1W4CA 4QBFA 5J4KA 4IXNA 1S4QA 4EUNA 4C30A 2F9LA 2W0SA 5DE3A 1KKLA 1ZAKA 4FWIB 4MQBA 4CEIB 1R4AA 1E9CA 1MV5A 1FQJA 2GKSA 1TNDA 3MRSA 2HDNB 4UXIA 3B9PA 2OV2A 3FMOB 3K9LA 3W34A 3L0IB 4N0EA 4DZZA 1E2PA 3CR7A 3K0FB 2WJIA 3CX8A 1AA9A 2ZI5A 4EDHA 4M53A 2H1LA 2QGZA 3AF2A 4TL6A 1HQCA 3SS8A 1AJEA 1KK2A 721PA 1G8FA 4KYUA 2ZPTX 4ZPXA 1Z2AA 4LOAA 3AKCA 5FOTA 3P32A 3UXMA 4DRZA 1P2TA 1E9FA 3PIRA 1G3QA 2C99A 3D7MA 2CVFA 3QG1A 4LX0A 5KUTA 1FW6A 4CEJA 1P60A 1G6HA 1AZSC 2PMKA 1WP9A 2HF8A 3GLHA 1Z6XA 1GG2A 3EWSA 4MRSA 2JLVA 2Z4RA 5FOVA 1KI6A 2FN4A 2WKQA 1Z6GA 3EZ9A 4DIEA 3WY9A 3BAFA 1Z0FA 1Q3TA 2N1BA 2ZSDA 2QM8A 4QM7A 2QBYA 1FQKA 3BGWA 4H1VA 4PHFA 2OEPA 2GBLC 4MUBA 2VQSA 2PLFA 1UJ2A 4Q4HB 2XEXA 1W0JA 1OXXK 3ZS8A 1KYIA 4YMWA 2GVDC 2WZQA 1N5IA 3HR7A 1DG3A 2CE7A 3CZPA 3I72A 4OHZA 3WYGA 1NLFA 1ZP6A 2OLKA 3OF5A 5TY0A 1W0KD 1A2KC 3VR4A 4CVNA 1F5NA 1Q21A 2R9VA 3AVYA 1XBTA 4KXFB 4OL0A 3Q85A 4JMPA 2AWNA 4B35A 2AN9A 1YJ5A 1FOEB 4HLUC 1HH4A 3A58B 4PQFA 4K81B 2DY1A 1VIAA 1COWD 3T06B 3CW2A 4X8HA 4HSEA 1T3SA 3A1TA 4XTCS 3RS4A 2BMFA 4NCIA 3X2SA 4DUGD 4L8GA 4Q4AB 4PO1A 1J8MF 1X1SA 4OKSA 4TT3D 2GXUA 4WIAA 3K53A 4XTRA 4IOKA 4C7OB 4UNQA 4JS0A 2FV8A 2I1VB 1XTQA 5KO2A 4CEHA 3B13B 1JAHA 3SJAA 1TQ2A 1N6NA 4PSVA 2ODNA 4DDTA 1G7CA 3W5IA 4E03A 2O8DB 3Q5EA 1G1MA 1LNZA 2QEQA 3C14C 1M7GA 1W48A 4U7DA 2LKDA 3MWYW 3HJNA 4C0KA 3ZVLA 4X8OA 4NE2A 2H8KA 4CF7A 4I1SA 3B60A 4Q4JA 1KDOA 2GXSA 2V1XA 5F98A 2HJVA 3CUEF 4PAMA 5H68A 1SQ5A 2WTUA 3THWA 2KSQA 4PHGA 3BFXA 1IM2A 3HR8A 1SVOA 4LYJA 2NG1A 4V0ME 4XVRA 4RFVA 2UVQA 4QBGB 1P9WA 1YU9A 3WYFA 4GSYA 1UBFA 3DM5A 1KMQA 1VCIA 1NIJA 4GP7A 4AYTA 2CHGA 1AS3A 3IO3A 5GJWC 2ZM5A 2PL3A 3QPUA 3NXSA 3QVVA 1UEJA 3C4JA 1IXSB 1UPTA 5KDDA 5KSOA 2VP5A 1Q1ZA 4M0LA 2WWHA 1D6JA 3MJRA 2W58A 4HLDA 2GBLA 3MGCA 1T8TA 1YR9A 4JL8A 1II8A 4P33A 2QA5A 3NHAA 1P5ZB 5LPNA 1ZJ6A 2NO1A 1SXJC 1IN8A 3GJ3A 3SJBA 2WKRA 1W2GA 1KDRA 2PJZA 4RZ2A 1F6BA 4ZIRB 4FXPA 2XSZA 5LD2C 4QHTA 4MRPA 1R0YA 5FR2A 1KSHA 4PC3A 1D5CA 3I4LA 3BORA 1UKVY 2WOOA 4JKIA 2WPDA 4EQ6B 2C98A 1Z29A 1WMSA 4CRWB 1GL9B 2V4ZA 2J7PD 1Q1EA 5BYKA 1XEFA 4M9ZA 1K5DA 5UKDA 2KB0A 4ITRC 2QMOA 3SE0A 1NG1A 2QU8A 4TLEA 3SOPA 5E7IA 2VP9A 4PZZA 4C2TA 1NN3A 3K1JA 4XJXA 4BEBA 5HKKD 1EFCA 5EXSA 3UWKA 4V0MA 3RC8A 3CPHA 3VKHA 3CNOA 3SJCA 4RKFA 1UBGA 2W83A 4NHOA 1EWQA 4OQLA 2BWJA 4A6PA 5E7MA 2RGBA 1RW4A 3TVTA 3QOFA 2BKEA 5FOSA 5G3YA 2DR3A 3VR5A 4KSBA 4US0R 4WXPA 2CVHA 1Z6TA 2VP4A 4GOXA 2VF8A 4CT5A 2JEOA 1J70A 3SYKA 1NRJB 2O0HA 3C16C 2HXYA 1OKKD 1JNYA 2GTPA 3GLGB 3JVUA 3A1SA 1R5OA 3MG9A 1HUQA 3H84A 3RWOA 3I8SA 4NTZA 2GHIA 4A9AA 2GXQA 2OBNA 4ESVA 4EPVA 3B1ZA 2HLDA 1UF9A 1C4OA 2RCNA 4AK9A 3ADCA 3UPUA 3HPQA 2GRJA 1OFUX 1XMJA 1K6MA 1HYQA 1P2SA 2NO6A 4OBEA 4QFMA 4BFUA 2JJ2A 3RLFA 2B92A 2QN6A 4D4KA 4DDUA 3ZVNA 2RH5A 3FWYA 1JECA 1IXRC 1J8YF 4JVSB 4TZ6A 2VYFA 1OIXA 4PAQA 4M4SA 1W2HA 4CDGA 4LWZA 3R7WB 2JLWA 2P6NA 1HT2E 1VG9B 2IYLD 4I1VA 4M2LA 4RKEA 4ZKEA 4Q21A 4M9SA 5AJVB 3X1ZA 4IDHA 2O8EB 4O2RA 1P3JA 1DARA 1FNNA 5K8LA 1NN1A 3THXA 3RANA 4Q02A 4HB0A 1W4BA 4JLNA 2A5YB 5JWHA 3LNCA 3BD9A 3E70C 4TYYA 1XB2A 5H8WA 4O3MA 5G40A 1VG0B 4GDFA 1RC8A 1CS4C 1KK0A 2H7VA 521PA 3P4YA 2NO7A 1U9IC 1GILA 3VMFA 4DHEA 1VYVA 2WJHA 1W5SA 2ZRDA 1CF4A 2J45A 1Q20A 1Z83A 2ZEJA 1HA3A 5EP1A 3PJRA 4QJ5A 3ZIAD 2BBSA 1JJVA 1KI1A 2C9YA 3GFPA 2FMXA 1N0VC 1IAQA 4PANA 4QC2A 1W36D 3U5ZB 1E1QA 4QJ3A 4JSTA 3BERA 1N6KA 3T35A 2XXAA 2ZROA 2IBMA 3PUZA 3AVPA 3NHBA 5JHGB 3OHMA 1XNJA 221PA 2FGKA 2G77B 4B71A 3TK1A 4QGFA 3EC1A 3SNHA 1GVNB 3I5YA 1KO5A 2B6HA 5JWRA 1NP6A 2QP3A 4B32A 2TMKA 4DXAA 1VCMA 4QNRA 2H16A 3AGPA 4EJSB 1E6CA 3AUYA 2Q0HA 2DB3A 1CRPA 2XOKD 5H1YA 2NQ2C 1LV7A 3FKSA 1EESA 3TIFA 2OO7A 2PBRA 5JRZA 4DB4A 3GJ6A 1M1YE 2Z6VA 2A5JA 1G3IA 4PHTA 1PLLA 3CX6A 1E2MA 2X2EA 1W4AA 4FCVA 3PVSA 5KDLA 5F9FA 1K5GA 1Z6YA 4QOSA 2ZSAA 1GNRA 4AURA 3EIHA 4TL8A 3NWJA 1E0JA 1FUUA 2IS4A 5C4GB 3R9XA 1XEWY 1U81A 3DMNA 3HP1A 4YMVA 3SHFA 3K09C 5EE3A 2GZAA 4B76A 5C46F 4IOJA 3TH5A 3VX4A 2O8FA 4XH9B 1OHHD 2R62A 1KNXA 3W8RA 1UAAA 1P75A 4TN1A 3AVTA 2O0JA 1JAIA 1XPOA 2O52A 3CO5A 4YONB 3GQBA 1HURA 2EFEB 2IX3A 3T1VA 4Q9KA 4ZKDA 5GADl 3WRXC 3IBYA 2NOAA 2VHJA 2GJSA 4RZ3A 3TLXA 2DWOA 2GEUA 4XWAA 1TF7A 1Q22A 4BFTA 2G0TA 1U9IA 2ZJZA 621PA 1OXVA 4C0JA 2CDNA 1F2UA 2QP4A 3CLVA 3NC1C 4HI0E 2XTNA 5SZKB 4HAYA 4IW3B 4NDZA 1QBKC 4YDSA 1PJRA 1GSIA 3AF0A 4M21A 3CH5A 2ZRLA 4OQXA 2BEJA 2JASA 4OI2A 2QQEA 1ZC4A 3GLFE 4UNNA 1HTWA 2JAQA 3DVLA 4BZXA 1ZIOA 4EIWA 3IHLA 3FFBA 5DIFA 4KV9A 4DVGA 1F60A 1W0KA 3PUVA 1W47A 2IYWA 2OESA 4FN5A 3OIWA 1ZIPA 3OZXA 3LQQA 2RGNC 1XD2A 2CL6X 3KUCA 3ICEA 4Z54A 1VCNA 1A82A 2FOLA 3HYRA 2P5TB 1G7RA 3QQ5A 3QF7A 1COWA 4BRUA 4YXWD 1Z6AA 2RAPA 1NMZA 1W7AA 3U6BA 4QJ4A 4UNSA 1FP6A 3IHWA 3QBTA 3R20A 4RD4A 2C03A 3NH9A 1DADA 5KNBA 4DUGA 2YOHA 4CEJB 2ZR0A 2AKAB 1DE0A 4F92B 2K5UA 3HU2A 3GLHB 4CIDA 4TT3A 4PC2A 2ONJA 3KTAA 1GZSA 1BYUA 4QG7A 2Q3MA 1KI6B 4MDEA 5SZIA 1XTIA 1M6NA 3PCRB 3QKRA 2AD5A 1XF9A 3LX8A 2YOFA 2EYQA 1QHHA 2OFOA 2PZGA 3B9QA 3Q72A 2W2VA 2PCJA 4KBFA 2BV3A 2QBYB 1OJLA 4PXAA 4C3ZA 4D0NA 1G291 2W2TA 5KPJA 4NONA 5CIQA 4KJZA 3IIKA 1BIFA 1G8GA 1D2EA 2AL7A 5CB6A 1Z06A 3VNVA 1E2LA 1G8HA 1GRRA 1KO8A 2UZ3A 1X8JA 2ZJOA 3KFXA 3NEJA 3FHTA 4Q7JB 1Z8FA 4DSOA 2C04A 2IYXA 3K09A 4NYMQ 1JXOA 2B7CA 3LBHA 1DAGA 4GPTA 3GLFA 1ESMA 1OH5A 2ZUDA 2BM1A 4HYYA 4NCNA 5GVSA 4G1UC 2F1HA 3MMPA 2XZLA 2VLIA 3D3QA 1G9XA 1OSNA 2VP6A 5CK5A 3KJEA 5KNDA 4LJ6A 4OQNA 3ZVMA 3HDTA 4KCGA 3TSZA 3V4RA 4H9GA 2IHYA 1UKZA 2YNMA 1RFLA 4GZLA 4LBWA 4NU0A 5ANRB 1M2OB 5BXQC 5IRCD 3A1UA 4CEHB 4LHYA 5C18A 4L4UA 4HAUA 4XWKA 4DLSA 3FMIA 1KDTA 5HE9A 1HE1C 3BB3A 1JQLB 4HB2A 2BVNA 4RFSA 5JZVA 1MOZA 1E32A 1E96A 2FSGA 3B85A 1RVDA 1RYFA 2CEAA 1R8SA 3WMGA 4DLVA 3SDZA 4CW7A 3PUXA 1ANKA 1EGAA 1VHLA 2YHSA 4F4JA 5BW8A 3DZ8A 4HUQA 3CF6R 4ESHA 5AUPB 3WBKA 2G1KA 2VSOA 1SVKA 4Q4JB 5DI3A 2C9OA 2XSZD 1FX0A 2OFWA 3THWB 4KU4A 1MABA 2J7PA 3GFTA 5HZKA 2WJVA 1Y3AA 2ZE7A 2ZUCA 4EJSC 4Q4LA 2P5SA 3P1JA 1CJTC 2FEMA 3KQUA 2P3SA 1M34E 4RZXA 2VBCA 1KZ7B 2WAYA 2CXXA 5JLJA 3KL4A 3RC3A 5HKKA 1G8YA 1A2BA 1P4SA 1GWNA 4LPKA 4B6EA 2WWFA 2JLUA 4OK6A 1WBDA 3TW4A 1Z0IA 4D6PA 4D4MA 3K0AA 2GILA 3GMTA 4LJ8A 5IK2D 1SVWA 2D7CA 2VH5R 1TF2A 1VHTA 2R2AA 2ZETA 2RHMA 1JEEA 5DH9A 1II8B 4LYAA 4HAXA 3TKLA 2F43B 1OXTA 5BN3A 4JVNA 4UKDA 4BEJA 4CYMA 5J47A 2ZITA 3MCAA 1H8ED 1UKYA 2NPFA 3IIMA 1IJFA 2JDID 3RS3A 5TVKA 4OI0A 1OKKA 4BLTA 3FKQA 4IOMA 2PEYA 3D8BA 4MRRA 2Q9AA 2HT6A 3WYAA 4HEJA 4URXR 4HAWA 5DI9A 1F2TB 3I3SR 1CEEA 3IO5A 3ZS9A 4W9MC 2Q3FA 1NMXA 1GFIA 2Q3HA 4J0QA 4IXMA 4IDQA 2FSIA 2ZE5A 4IFEA 4B33A 2YVUA 4B48A 5BN5A 2QM7A 4Q00A 3K0CA 4WA7A 2L0XA 4M1OA 3GJ8A 3RRMA 4JIMA 3GJ0A 3Q7PA 1L8QA 1KI4A 1NIPA 5FI1B 1J7KA 1TU4A 3AF4A 1IN6A 1U8YA 4V0LA 1MO6A 1Z2CA 5KU1A 4Q03A 1FMJA 1S0UA 2V6JA 1TPZA 4TL7A 5KYKA 1UBEA 2J0QA 2O8CA 4HLCA 1Z0JA 1SVSA 2FPKA 2JCSA 5L3RA 1E9RA 3A1VA 3LLUA 3FHCB 3OIUA 1YR6A 2ZANA 4GOKA 4LJYA 5EE5B 4ZI3A 6Q21A 4JT4A 2C96A 2IS6A 1KI7A 1G7SA 121PA 1DAEA 4U00A 4EFMA 3B7GA 1D2NA 4P4SA 3HU3A 5FL7D 1YRBA 2MSEB 3MD0A 2ZRFA 5J4VA 1CIPA 2PX3A 3B1YA 4IDPA 2ATVA 2YWGA 3QVUA 4LHXA 2JLXA 2C95A 4IVRA 3K8YA 3O8BA 1G3RA 5EE0A 1BOFA 1NJFA 1MRNA 4MUAA 1XTJA 3LAWA 4NCJA 3ZIAA 2YJTD 4DWJA 3IILA 4V0NA 1R0XA 3AKDA 1G19A 3LBIA 2F6RA 1GUAA 2RGEA 3BC1A 1G41A 1OPXA 3IUYA 3UMFA 3I8XA 4GNKA 3CRQA 2AX4A 4TMKA 4AI6A 4MA4A 1KDPA 2J7KA 1VIYA 2D2EA 2V7QD 4PPGA 3IKJA 5HCIA 1KZGB 1E2EA 1W49A 3EZ2A 2AXPA 3THXB 4A1FA 2QAGA 1VCOA 1T4GA 3R9WA 1OE0A 5EP4A 2XOKA 5EUQB 2BMEA 3QF4A 4EKDA 2IF0A 1T91A 4A0RA 2IYYA 5FFMA 1L4YA 3EPHA 3SHWA 4QBIA 3QXXA 3UANA 3U6KA 1G5PA 1RIFA 1T0JB 3QE0A 1JJ7A 1WCV1 4CGZA 4MKHA 1SZPA 3OEEA 2HYIC 2PT5A 4Q01A 3VKWA 4LJ7A 4QKQA 1II9A 2QT1A 1XRJA 5FTKA 2WAXA 3P20A 4GMDA 3GFOA 4AG6A 2GJ9A 3TVDA 2LCFA 1ELOA 2A3RA 1DPFA 2QSZA 1MR3F 1P73A 5CB8A 3QXHA 2XXAB 1CJMA 4Q66C 4DCSA 1W1WA 2CCGA 5J40A 3U3RA 3U7FB 3RHFA 1RRGA 1XZQA 1R7RA 3BFKA 4UXHA 1OHHA 1KSJA 3OFNA 2FSHA 4KVAA 4LBYA 3NBYC 2JJ1D 3QXSA 4P4TA 2Q9BA 2BMJA 4KVGA 3OEHD 5L3QA 2JLSA 1U2RA 2AWOA 1AZTA 4YMSA 3A4MA 4ARZA 5FBQB 4GFDA 1GP2A 4KHZA 1E94E 3LXXA 4E07A 2CJWA 3TUZC 2FPLA 4AC9A 4RD3A 1AKYA 2FE4A 4RCYA 4I1OA 4FIDA 5K8TA 4JYCA 2R6GA 2GESA 2ZRCA 1LF5A 4Q1CA 5E7JA 1NL3A 2ZRPA 1AK2A 1E9SA 3I92A 3AF3A 5TXGA 2CHVA 4URVR 1A7JA 1T3LA 4F4IA 3O8CA 4TLBA 4TMVA 4M22A 1QHGA 5AUQA 4LSGA 4DCVA 2GEVA 4QBHA 2BMDA 1JBKA 2REXB 5FTLA 3JZMA 3U4QA 3DDCA 3L0SA 3LBNA 1LFDB 2GCPA 4JLJA 1WE2A 4P31A 4RSGA 5FBLB 4AKGA 3TRFA 1S3SA 2C77A 2V9PA 3LXRA 2FX3A 2BEKA 2OM2A 2ATXA 2BDTA 3EC2A 1JB1A 4YXWA 4KODA 5B30A 1KY3A 4M1SA 3Q8XB 1OXUA 2JATA 3MWLA 3WBJA 2O8FB 3PR1A 3KJGA 5EE1A 4B44A 3AF1A 3SU8A 2HXSA 3QPVA 2QT0A 1G5TA 4P4UA 5CDFE 3U60B 2ZRJA 3AH8A 3Q5DA 1US8A 2GAOA 4C9BA 2ZVQX 1HE8B 1CR1A 4TWZA 3B78A 2IYZA 4EFNA 2QSYA 4A2QA 3JVVA 4BLSA 4MYHA 4TTRA 3CPJB 4DCTA 5B64A 1DO2A 1P72A 2ZRNA 1F2UB 1WA5A 3QIAA 1G3MA 3GCGA 1XMIA 2OXCA 1CXZA 1OH7A 5JJLA 1P7CA 3QBVA 4NPHA 1NNEA 5GVRA 4JKYA 2BM0A 1KGDA 2CHQA 2DFNA 1PUIA 4URUR 3AVQA 3ICQB 1PUJA 2GCOB 4MDFA 3IPXA 1XD2B 4RD0A 3U3OA 3ZZTA 2MSCB 3T5DA 1EXMA 3VHLB 4A0GA 1TEXA 4M1YA 1T8UA 2OUKA 1IN4A 2NO9A 2GWHA 3CRW1 1Z07A 3TNFA 4A8JC 2RHDA 3D31A 1G20E 5JCPA 2DWPA 3SJZA 1KTVA 2W00A 3KTAB 1IY0A 1XJCA 5FOXA 3QKRB 4G0NA 4AKHA 1KJZA 4C0SA 3ZGXA 5HZHA 5A5GA 1YQTA 5CDFA 2ZRAA 1AQUA 4D4LA 5JS7A 2J46A 3BK7A 4LPSA 1Q3HA 2XITA 4KFUA 1E2FA 4MRNA 4ON9A 2CL0X 5FBWB 3LDAA 1IJEA 4IFBA 1M74A 1U90A 4OQFA 5B2ZA 3QEJA 1NVXQ 5CM8B 5FUYA 4YC7A 2PX0A 5SZJA 4AG5A 4Q48A 1K8RA 3GP8A 5DO9A 1IOZA 4BLRA 1S96A 2C9CA 3RDPA 5K8IA 1ZCAA 4JBWA 3PXGA 3THOA 3DZDA 2P6RA 4HLQB 1U8ZA 1E9BA 2E9SA 3RSOA 3HPRA 5E4FA 2KE5A 2WSMA 1ODFA 2VIIA 1HEIA 3IGFA 4JBYA 2ZI6A 1ZYUA 2OCYC 4YDHB 4KFTA 1YZNA 5AR1A 4L16A 3W6NA 5DYIA 3TW8B 1CULC 4WZBE 2RB4A 3GLIE 1Z47A 2QRNA 1QHSA 1YKSA 2WWXA 2O5VA 1WB9A 3QEOA 2D4HA 3QPWA 1QZXA 3IDQA 1ZM4A 2V55B 5HE8A 5IK2A 2QAJA 3CRRA 1P6XA 4ASUD 3U7GA 1T5LA 2P67A 4LJAA 5TDHA 1UEIA 3CNNA 1QF9A 4TSFD 1U0JA 5JJIA 1XJQA 4RFSB 3WNCA 4JT2A 1GIAA 4GZMA 2FSFA 5FUWA 2FFHA 2IWHA 1H8EA 1J99A 1GTVA 1LY1A 2JDIA 2ZSFA 2FFQA 4H1UA 4MKFA 4TQAA 2OAP1 4BRWA 3EPLA 5GJBA 2EWVA 4HUQB 4PTLA 3VR2A 2A2ZA 2WJJA 1E79A 1KKMA 1Q57A 2XTMA 2Z83A 3IIJA 4GOJA 4C0AC 2EWWA 4HDCA 4EPTA 1S2MA 2A5DA 4US1R 1FX0B 1C9KA 1T3HA 2ORWA 1MABB 2YC2C 2GAAA 3EZFA 4R2IA 3UATA 3VR1A 3VKGA 1Z0DA 1JALA 5DYGA 4A8JA 1JEDA 1KO1A 3CNLA 1ZC3A 1DAFA 4FMDF 3TAHA 2J1LA 2J0UA 3BH0A 5JEEA 2HYDA 3EZ6A 1HT1E 3LQRA 2O8BB 4B75A 1Q1BA 4D25A 1ZNWA 3C5CA 3C7KA 4FMDB 2GNOA 3TBKA 4B2PA 4WW0A 1I4TD 2WMOB 4LRWA 3MFYA 1E99A 1PVOA 1XCGB 5TB5A 3K0AB 1GKYA 5JJKA 1MO3A 1ZM9A 4HAVA 2PZEA 3EX7C 5DNYB 1M7BA 3LFUA 1Q0UA 5FTNA 2IW3A 2YWEA 2ORIA 3GLIA 1RKBA 4BFYA 1XCPA 4DLRA 2CCJA 4G5SA 4KLNA 3CPEA 2DYKA 4JBXA 4AKEA 2XJ9A 4HB3A 4C0QC 4U5XA 4LCBA 4MGKR 5L3VA 2ZS8A 3LRPA 5FL7A 3SYLA 2Q6TA 1P61B 3AGQA 5CLQA 3WP0A 3THYA 1RE0A 5FH9A 2XJ4A 5FUXA 4BZPA 2HT1A 2JJ8A 4DJTA 1OB2A 3KZ1E 3CBQA 4NH0A 1F48A 2QORA 3SI7A 3Q3JB 1N6PA 1IN7A 2WV9A 3BE4A 4NBSA 4Y0VA 3SQWA 4PZLA 5FOUA 4F91B 2ZE8A 5B58C 2OBLA 3I62A 2MSDB 1KAGA 5D3MA 4GBMA 4R2HA 1WRBA 2J0VA 4ZDKA 3C41J 3V00A 3GPLA 1O3YA 4PC6A 3A36A 2O8CB 1XZPA 1H65A 3KXKA 2Z5FA 3Q9LA 5B57C 4NL4H 3SBDA 3DEFA 2V7QA 3RRZA 4KAXA 1XXHE 4BGDA 1CJKC 4US2R 3H86A 3EASA 1XEXA 5H70A 4KFSA 2VEDA 1OW3B 3TJZA 4B74A 2G83A 1EFRA 4LHZA 3I61A 1R2QA 3KXIA 2I3BA 1E0AA 2X2FA 3F0TA 1KY2A 3TSOA 2FFBA 4P4SB 3QKSA 5EZ5A 1N6OA 4JLMA 3CIOA 3ZZ0A 3I73A 4D0LB 2J87A 2BHRA 4DDWA 3A4LA 4M1MA 1G4UR 4D82A 5KSYA 3V4FA 2YWFA 3CWQA 1B0UA 2QI9C 3KJIA 3RS5A 3SN6A 1W36B 3OEED 1DTSA 4PSKA 5J4YA 2UKDA 3K70D 1OV4A 3LVQE 3U3KA 1TTTA 2WJGA 3SFVA 4KBGA 4B3CA 4N1AA 3FMPB 8OHMA 2IS2A 2RGAA 1IN5A 2GF0A 3O8RA 1ZUNB 2IK8A 4LV5B 1TMKA 1A5TA 1VG8A 1Q1QA 2JJ1A 3ECCA 1VG1A 4PO9A 1VKJA 2F9MA 4DB2A 1ZM7A 1KI2A 3OEHA 4TLAA 4AY2A 4LY6A 3K0SA 2AXNA 1S1MA 1KI9A 1S9HA 2PZFA 3OFND 5CM9C 5FPKA 3U7HB 1GKIA 3CWZA 2FPMA 2VSXA 4NYIQ 4ZDIA 2GJ8A 1XU4A 2C78A 3OESA 5A0FA 2FZLA 4URYR 1XXHA 1FP7A 2IHBA 3QF4B 5TARA 1KO4A 2ANBA 2X8AA 3S1AA 2BJWA 1L2TA 2O0KA 4RY2A 1DEKA 2RGCA 5SZHB 1E1RD 1WDTA 2WWWA 3NG1A 2GK6A 4LZZA 3X1WA 4C0LA 5L8VA 2ZRBA 1ZBDA 5BWMA 2OG2A 4QNMA 1DAHA 2IXEA 4A82A 1S3GA 4O2LA 3TR0A 1X1RA 1HY3A 2WM9B 2FDCA 4BECA 1AGPA 3AQ4A 3FOZA 2YYZA 4QM6A 5F3WB 4F93B 1ZM2A 3SR0A 5AJXA 1Q12A 2QPTA 4KFRA 2NPIA 3CH4B 1KNQA 4TZ0A 1ZMXA 1OXSC 3A6PC 4D81A 1SHZA 2F3RA 1X8LA 3BRWD 3SBEA 1R10A 2ZS7A 3G5UA 3OIVA 1UM8A 3ND9A 4NZYA 5L3QB 1OYYA 1TF5A 3ZJYA 2ZRGA 4LBZA 1FNMA 3R8FA 1UKEA 4PAOA 2RGDA 2OFXA 4ARZB 4JYBA 4WAUA 3BWDD 3G82C 2CJWB 4HDOB 2ODBA 3LLMA 5JBQA 2HF9A 4BLOA 5CK4A 2VP0A 5KSZA 2IT1A 4A6XA 4D26A 2IYSA 3FDIA 2JGNA 4JLVA 4JLOA 3MWJA 1NY5A 1YZTA 2GDJA 4NYJQ 3JZAA 4BPBA 1N3BA 2DHRA 3GEIA 5C4MA 4CT4B 4KITB 1WXQA 4IDNA 2BJVA 4B3GA 3Q7QA 3U4QB 4E22A 2IEYA 2C8VA 1AS2A 3K9HA 1S1CA 3QUSA 2P0EA 3B82A 4IJMA 4V0OA 3KKMA 1YR7A 4A4DA 3KQLA 1GAJA 2D3WA 3CF0A 4Q1BA 3IQXA 1U94A 3W3ZB 1YHNA 4NMMA 4Q1FA 2HJGA 2W6IA 4KI0A 2GJKA 2ZRIA 4EPWA 3ZYCA 5L3SA 4B43A 3TUIC 5HPYB 1US8B 2G6BA 1AN0A 2R65A 2REOA 2G0NA 3K0CC 4NYMR 5E95A 4DSNA 4B2LA 2KI5A 4Z51A 4LV8B 4FD2A 1OF1A 1NN5A 2AHOA 1UDXA 2PJRA 4AYXA 1VPLA 5AJZA 821PA 1E0SA 4FCWA 1OLOA 2WVJA 3WNDA 4GMXA 4ZDJA 2NGRA 1GITA 5GJVC 1QVRA 3UKDA 2QMEA 4P0TA 2ZRKA 3EW9A 5EUMA 5LB4A 2DFKB 4TQ9A 1E2HA 3M1IA 2IL1A 3LH5A 1GL6A 1ZD1A 4JZKA 4B3XA 1GM5A 4B47A 2ZSBA 5HCNA 2ZE6A 3RS2A 1E0KA 2GEDA 5LB2A 3PEYA 1QG2A 2H17A 1E4YA 4YQFA 2B8TA 3ZZUA 1SVLA 5KDOA 4FMBB 5LBIA 5LDDC 3PFIA 1JR3D 4DKXA 5FBRB 2P65A 3N2EA 1G6OA 4LYFA 3ZLJA 3FYHA 1TQ6A 2IYUA 1ETUA 3AEZA 2Q9CA 3CKLA 1D9ZA 2Z0MA 4QHSA 4ASUA 3QSYA 1QVAA 3U44A 2ONKA 1NVVQ 1XJ0A 3QG5A 5EP2A 4TSFA 2D7DA 5KNCA 1G7TA 1KMHA 2A7QA 2AK2A 5DSZA 2F55A 1W36C 3DHWC 3T34A 4B73A 1FL9A 3PEUA 1RRCA 1XEWX 1E2QA 4P32A 2FFAA 1IY2A 4Q1DA 4TYNA 1N6LA 1YVDA 5F9HA 3T12A 1P2UA 1QHNA 2X19A 4Z8YA 2ZI7A 3EZ7A 4PSAA 3U2QA 2GZDA 5KSPA 1RRFA 2QPAA 3B1VA 3ZDQA 1E79D 4GI7A 2QAGC 3W3AA 2VO1A 3MWKA 4DLXA 4E09A 3I5XA 5JCZA 3MAAC 1MH1A 5EZ6B 1MT0A 3I32A 4OHVA 4TMTA 2FGJA 3PENA 4IKEA 2UZIR 3FFAA 5JECA 4C0HA 4Q18A 2QTHA 3V9PA 1L7VC 1SKQA 2IUSA 1WQ1R 3UG7A 5J4LA 1IBRA 3QENA 3T15A 2RGGA 1DAKA 4ERNA 4PFSA 3DO6A
chains in the Genus database with same CATH superfamily
3UM9A 1DG9A 2AEJA 4R7ZA 2R8EA 4JSYA 1MX9A 4QEZA 4RV4A 4M1WA 2AF4C 2DHDA 4E7PA 3GQVA 1YRYE 4XI9A 4G3XA 5CFNA 4LKOA 1T0HB 5DK4A 4XQGA 4YRMA 4PR0A 5BV7A 4MROA 3CH6A 4YHHB 4JLKA 1PQ4A 1X70A 3ZWVA 1II0A 1FUIA 2QPLA 4ND3A 4M9XA 4AS1A 2GCNA 4KK4A 1A9RA 1KDZA 1F6DA 3CXUA 4CLHA 1MO5A 3FJYA 2GLXA 4N3NA 1XTUA 5HFJA 4AO8A 5MN4A 2PKEA 4CLRB 3H5LA 4B3BA 5K3DA 3WL7A 4XOIA 3UT5B 1GNVA 3HU5A 2Z3ZA 4QZVA 3FB1A 1FSZA 3DOHA 2HRRA 5EKXA 3RVDA 5LA6B 4WZZA 4QSMA 3Q87B 1L1RA 3WDLA 2G5TA 3ZBUA 4B84A 1DPGA 1WZ2A 3SSOA 4DPMA 1HRKA 1VSVA 4J76A 3V2GA 1RJ9A 4EHAA 2PU5A 2WZCA 3CEAA 4ICIA 3RIEA 4KOEC 4BFSA 5JANA 3KZKA 3LX5A 2R87A 5J4HA 4TMXA 2J5KA 4KSCA 1FF9A 2DLDA 2RHBA 1FMTA 2Q4OA 3FCCA 3HWWA 2F62A 2FPGB 1N0WA 4XDGA 2GCEA 4Z5XA 3I4FA 4FWTA 3E5NA 4N76A 2ADOA 1YS2X 2B83A 4MCAA 3NBUA 5MFZA 4M8SA 2JI7A 2A0UA 3BIXA 3OQ6A 3OVMA 3U56A 2MR5A 5IBQA 2QZ4A 1S2IA 3MTEA 4OP2A 1NOKA 3KS9A 4DXDA 1DCMA 1SG0A 4EO7A 4W99A 4ZANA 4MQUA 5IT5A 4EW2A 1XDBA 4HN4B 1E8NA 1BN7A 1X9GA 2UU9B 4HDMB 1QKIA 2X1LA 2IXFA 1Z3IX 2EIHA 2QTZA 5E6RB 3ER9A 2D1YA 3GJTA 3FCUB 3H0EA 3KTFA 5ICFA 4DRYA 4XVCA 1DAIA 2RKWA 3FDZA 4LA4A 1SXPA 1K7FB 2BFOA 4EAQA 3HXTA 4ZFNA 2JFWA 3PQ6A 1PJCA 4Q15A 2VT6A 3WIBA 4ACAA 6ABPA 3HN6A 3VU9A 2CDAA 4Q9DA 2IUUA 2WWIA 3LZCA 2HAEA 2GLTA 3UW3A 3BAZA 4MB2A 2SBTA 4L02A 5LQMA 2UAGA 5LWHA 4MVJA 3KKPA 1GPUA 3SG0A 2ZI9A 4PHHA 2FZCA 1GN8A 1BGWA 2IF2A 3OQJA 1QCZA 1ORTA 3WVNA 1IB0A 1NE2A 2PH3A 2H59A 1X1EA 5C7LO 5AW6A 3IQIX 4DJEC 3BF8A 4TROA 2AOWA 2PKRA 4JL5A 5GGXA 5K9ZA 2H57A 4Y6RA 5I4IA 3T1YB 4EI7A 3KT3A 1N2IA 2NUPB 1T4MA 5TPZA 3PUIA 2XZPA 5H3LA 2XADA 1RI4A 3IEUA 2JPDA 3QHQA 5G41A 4RA9A 2OXTA 1DMRA 1CUZA 3NTXA 1MQ8B 1SKBA 2D00A 4DLZA 1IFXA 1C30B 4LXIA 4DMRA 4IDOA 1KY5A 4MMXB 2PMFA 1XEXB 4C21A 2X9LA 3GEHA 2PUTA 3L43A 2G1PA 1LUAA 4UEWA 1IMJA 4J49A 2LKCA 1D9XA 2XNDD 4U7JA 3BVPA 3IPRA 3W06A 1N5KA 2JIPA 4MI3A 1ZMRA 4E08A 1YHYA 2CN1A 4INOA 1EDDA 2VDNB 4YJGB 3H9EO 5CJ2A 5CPBA 4NE7A 1CU1A 1K6JA 4P6VF 4Z1MA 1ZOSA 1E1RA 4J1QA 3UGTA 3JYHA 2XGMA 4MGYR 4EUHA 1J90A 3TNJA 2CV0A 2R44A 1W88A 1WULS 4LV6A 4Z86A 2MTBA 4QX6A 2ZYVX 5EJMA 5CFLA 1B76A 1R9MA 4MYTA 4BVLA 4KB5A 1SC3A 4B3IA 2NUBA 1VIDA 3I9JA 3T1NA 2UYOA 2WFAA 1W5FA 4LTNA 4TL9A 3HTXA 4R1QA 2DHQA 5HIAA 3C3CA 1W581 2I66A 2VHQA 1PFQA 1OH6A 2IBSA 3L0OA 1QOQB 2V74B 4CI0B 4Q7MB 2FEOA 4B5KA 4DV5B 2IHUA 1GUZA 1SOAA 1L1QA 4W5RA 1QSGA 4P0QB 3ZWAA 1SU4A 2CXNA 3ES9A 4CKEB 3P27A 1GARA 1QGZA 4Q5IA 4BIMA 5HIKA 4JUDX 4ZZ3A 1ZINA 4IX9A 1F0YA 4DR3B 3V3TA 1L5YA 1YQEA 1JZTA 5ALGA 1LTKA 2JGIA 4ARSA 1OWNA 1R0ZA 1XV5A 3CJRA 2HU5A 2PSSA 3CW9A 5TMBA 3UKJA 3GAFA 1Y8AA 4WD3A 2QV7A 3M4ZA 3A6ZA 1DLJA 3AV0B 3HJRA 1QKJA 4ZAVA 3WHKA 3ZU4A 1Y48E 3UB4A 3TAUA 4K03A 2CMDA 2XX3A 3ZQJA 2QRUA 3ETLA 3RNLA 1Z39A 2VAPA 2F2TA 5JCJA 5JNSA 4FINA 1GTJ1 5BORA 6PFKA 3BSFA 3Q9UA 4UJ3A 3NKFA 2H1IA 3RR2A 1JVBA 4HUJA 2JGRA 2OV8A 2XWQA 3KFVA 3B1WA 4EJMA 4CODB 4J16C 5BSVA 1SCUA 4LOJA 3S2UA 3WNZA 3VSAA 5ALUA 4UZEA 5KYWA 1NRIA 2WP8J 2GF2A 2ID4A 3R0VA 5G0TA 4IHQA 4LC9A 4PVDA 3BK1A 4U02A 4DA6A 2PVSA 1A1VA 1V6CA 4Y30A 4PTZA 1OFIA 3O4VA 2F1JA 1QDLB 5ER6A 3LFTA 4W5WA 1XTKA 2PAAA 4TLLB 3QYAA 3G0CA 3O47A 5AM4A 3UWPA 3GCWA 4WK0B 2BKXA 1PR2A 3AY7A 3CU5A 1OBFO 1LPOA 2I62A 4MP8A 3BILA 1LV8A 5EWJA 1C0KA 5G1PA 3WLHA 4CM5A 4L4XA 1IXYA 5G0WA 3VDMA 3OUUA 1W30A 3I6BA 5ENZA 3WMFA 1RHKA 3ZNPA 4ZOLB 5H81A 2REQB 3W9YA 2Q2VA 4AWAA 1E2DA 5IYZB 5H9VA 4BUJA 2QY9A 1GOTA 3FZGA 4O4LF 2P3QA 4XVUA 5JOQA 3ESYA 3BS4A 1ABFA 3KO8A 2WB4A 1CIJA 2QRGA 3DZJA 2WAOA 5E3JA 4I4LA 3DF9A 1OT3A 4NZMA 3FHLA 2B94A 3Q11A 2D2IA 7GPBA 4OFXA 3EZGA 3DC2A 3FMFA 3K8ZA 1QK3A 2NTYC 3L1JA 1E3LA 4CWAA 2BE7A 3GJ5A 3D0KA 1YRAA 3EE6A 1PV2A 3H9JA 3HJFA 3PGVA 1W44A 4BFZA 1XJ5A 4WUTA 4WVFA 3LG2A 4B17A 4CIVA 1AKQA 2EFCB 2YXLA 3ISTA 4PBSA 5C31A 4YCDA 4OBXA 3HUFA 2OL4A 3PQ5A 1QG4A 1I32A 3KUDA 2WD7A 2EZUA 3NIBA 3R44A 4GYKA 4JLBA 2W4MA 2ZS9A 2VHCA 4MKIA 3NHLA 1ZL0A 2YYAA 3ANTA 16PKA 3MMXA 4WJZA 5DLDA 1B74A 3WYNA 4KIGA 4DOMA 2H1OA 2QGFA 1R88A 3AJ9A 3H1BA 3HU1A 3K3PA 2VNAA 4N5MA 4PO8A 5K3SA 4DADA 1TUBA 2GXAA 1P9OA 2YHBA 3HYTA 5H16A 2X9GA 5IDVA 5K3CA 3EAGA 1BWPA 3KR9A 4YMTA 4OK5A 1JR3A 2WJYA 4IJVA 3ED1A 1J1UA 1XTVA 5DBIA 3WGVA 2GPBA 2OCAA 1WNTA 2WJZB 3BXZA 1AGYA 4HZUA 5EL0A 1KK3A 5L3SB 1EGQA 1GL3A 1E4VA 1ADBA 3PFKA 2BM9A 4LDJA 2G9NA 5CNKA 1BDHA 4B2IA 1OFHA 5C2JB 2WHQA 1DKUA 1IQPA 3NNNA 4O2AB 1H22A 1J1ZA 2WIAA 2G6TA 2IY7A 3H05A 3T9CA 4ECEA 1GCAA 3X1XA 1CKEA 2H63A 4KN9S 3MF4A 4LRYA 2FI1A 3RKUA 4BLQA 3IR5A 3WXMA 3TUJC 3KQHA 1ZCZA 4J0GA 2GK7A 5DP1A 3PUYA 2VYQA 4L8LA 2P9CA 4RZSA 5KINB 1G64A 1YU6A 4L8FA 1F2TA 1Q5PA 2GERA 1Y9EA 3QU7A 4QICA 3RAPR 1IOLA 1Z28A 5D3QA 4MYCA 3ZQ6A 1LS1A 4OK3A 2G4CA 3E05A 3W90A 8LDHA 3R8XA 1Q0PA 1JHRA 2V6GA 2HSGA 2B4QA 2V3WA 1TQ4A 6YASA 2Q4DA 3ZI4A 1W29A 2VDVE 4R0MA 1YGYA 4L4ZA 1GUBA 1XWIA 2YY6A 1RM5A 2QRHA 3K32A 5DTEA 2DEUA 3RYFB 2JGFA 1RC1A 5BV0A 2EJTA 3CJTA 1JTFA 2P4QA 2E5LB 4LHVA 5JCXA 2YOGA 1SU6A 4QQKA 4S2EA 5CR9A 1OBOA 2DBZA 1CETA 2D06A 4I08A 5B3KA 3EIEA 2AC2A 3NBZC 2XVMA 4HQ6A 3M6UA 1EFVA 1ZU5A 2IY9A 4TYPA 1FIUA 1C3VA 2D62A 5KJ6A 1VJ0A 2FK8A 1JDTA 4JOQA 4MPPA 4N7BA 3U44B 3ZE9A 13PKA 3AR5A 4CCYA 2GTHA 2W2NA 5A4FS 1D6MA 2BI8A 5CB4B 2W6ZA 5B6JA 3CVVA 3OPQA 1JH8A 2WAMA 4AIIA 5TLSA 2HQRA 1GPYA 2ZM6B 3LRXA 2F3SA 4JI4B 2WVHA 3WRYC 4OXNA 2QD4A 2VHZA 3STYA 3PRJA 1Z4PX 4FDUA 4CL8A 1AQYA 1YBHA 1FNCA 4FBMA 1HMYA 1YQUA 4A5OA 3HA3A 2PQMA 3I9NA 2YWDA 2RSLA 3WHLA 2O54A 3ZHBA 2GR9A 3W04A 1EIZA 9ABPA 1G4HA 1NLZA 3HVIA 1M0EA 5EXTA 5HSGA 2OZVA 2FNAA 2Q4BA 3AUXA 5IUKC 1J23A 4K0RA 5E2AA 3L1IA 2NAPA 3PCTA 2O4UX 3OCCA 4IDGA 1R50A 2I4TA 1HETA 3NJRA 1IIBA 3U7QB 2ATIA 1QFSA 4R0NA 2JLQA 2XCSB 2X0NA 1S02A 1O97D 2A1TR 2FG5A 2PJUA 2ZYTX 3K0KA 3LVRE 2A30A 1E2IA 1QORA 2QQ0A 4NC9A 3FZYA 4QGAA 3DG9A 4B3MB 1XZAA 2P1ZA 2NZYA 1DVRA 3C0KA 2PGAA 2BEWA 3EHDA 2ZSJA 4EZEA 1JE0A 2GH1A 5BW4A 4O59O 2SCUA 4BKUA 3VKUA 2F4VB 3O1LA 4DC9A 2HZBA 3B1FA 3V8VA 1V45E 1ZNXA 1QQBA 4KPYA 3CS3A 3H2SA 4DA9A 4K6CA 1YQQA 1KDYA 1UJNA 4K3UA 3ABZA 1SK9A 3GFBA 1IEQA 1LPAB 3OLVA 4XIFA 4MW6A 1KFJB 1N6IA 5GOTA 4ZWNA 1XZ8A 2ZI3A 5EIEA 4Q34A 1JDSA 1E69A 5DSTA 4NV3A 1NVBA 2BKLA 2QXYA 2WM8A 3CN7A 3F1LA 4P5DA 5CH5A 4KQHA 4PG4A 3KR2A 4K6GA 1GG8A 2IZOA 4MYRA 1UBJS 2G5PA 3L8ZA 5FL3A 2Q29A 3T41A 3I64A 4NZZA 3R0JA 3U80A 3WGYA 4CEIA 1IEXA 3WMWA 1DG1G 1E3QA 1PKEA 3P96A 4DLUA 4HGZA 4J0EA 1DU4A 4PX3A 1KJJA 4GPD1 3IOEA 1CVLA 2XYQA 4ND8B 1I0IA 2FPXA 3DKVA 4Q1EA 1P6QA 4ILEA 3RRBA 3V1TC 4FTWA 5B5SA 2VQEB 2IS1A 1UXKA 4X54A 2JFUA 4C6SA 1N9GA 2FF5A 3I1FA 3RAGA 3DLHA 1PZNA 2IPNA 3K31A 3OFJA 2FKNA 3C85A 1G2OA 3B36A 4PW0A 2P40A 4MWGA 4JROA 3B2EA 3W5BA 2J0EA 5BR4A 2GYVA 2WD8A 2V5AA 3PDIA 4KX5A 4M0FA 2MMGA 1QH1B 1YOVA 1JP7A 2EFGA 4FT2A 3UMSA 2ATEA 1RYHA 2JHGA 2ZSEA 4YLYA 1I51A 1CLUA 4DLWA 1IXZA 2HOQA 2EU8A 3E8MA 3CGWA 2AN5A 3KPYA 4HQRA 4O4JA 2C5GA 4WXMA 3V3KA 3ZCPA 2J07A 3K6SA 1YZFA 4KQKA 1UQUA 1K86A 5AP9A 3R7SA 1FDWA 2OCBA 3EXG1 2OYCA 1DCFA 4R8SA 2PEZA 1U7ZA 3QOYA 4B7AA 2VRBA 1RLMA 3FUCA 1JDUA 1V4NA 3BIWA 5JATA 5TRTA 3DAHA 5AVOA 2IITA 4IAOA 4LTDA 4TMFA 4YRFA 5LZ5A 1R1DA 4E5KA 4C2UA 4DTCA 2Q50A 1O1YA 2EQBA 4DQLA 1QDEA 3CC8A 1WMAA 4Q7KA 1QB8A 1X2EA 3MJTA 2C3MA 2VUTA 2V8OA 1E3WB 3DULA 2AFHE 3I2FA 5JS8A 1M6YA 3WRWA 5K8UA 1Y7PA 3GDHA 2CMHA 2HJRA 2R7NA 4K8OA 2HUPA 1XP8A 4GRAA 1Z5OA 1PJLA 3A4VA 4HBGA 4P7FA 4AJJA 1T2DA 1FTSA 2VEOA 4AQ7A 4G84A 2GPAA 3ZOKA 1IB6A 2YFYA 1NSTA 1MC8A 1UAYA 2P2CA 2H65A 3DJFA 2WICA 1L8LA 3RS7A 2A78A 2WOJA 4GL2A 3RHZA 2O3RA 3C8MA 4J3FA 1CZUA 3PDJA 4RHUA 1J07A 4RIEA 2IWRA 4N5LA 1GQ2A 3SXJA 1SUDA 3OZVA 5HF9A 1GEGA 4V02A 4X84A 4QUIA 2IDKA 5AWFC 3WLJA 2WJWA 3FF4A 1O6BA 1Z88A 2XCUA 4WOPA 2BEUA 3M9LA 4O8ZA 5GIOE 2DR2A 2WF9A 5IANA 1AKTA 4GC5A 3A1NA 2JIBA 4OH7A 2PXAA 2Z2IA 1DLIA 4PGMA 2YV3A 1E2KA 2Z56A 4RZUA 3W05A 2PUVA 4GM0A 2J9YB 2ZJ6A 4UAGA 3D4LA 3HI4A 4R7GA 1NVUQ 4QWWA 4XB1A 5J5CA 2RGRA 1ZESA 2OY0A 2IDZA 2O8DA 1DELA 4FC6A 5EE9A 4LGVA 2GFQA 2HH9A 5LD2C 1WO8A 5JSQA 3FTNA 2OILA 1XRNA 2QNRA 3OWHA 2B6NA 5BPFA 3ZV6A 1DNPA 4ZVVA 5E4YA 1M8PA 4G1MB 3UGQA 4YV0A 1Z4JA 4LJ4A 2B5WA 1K4MA 2C9DA 1V4BA 2BW0A 1QHFA 2FN9A 4DLSA 3REGA 4EX6A 2XPCA 3A1FA 1N6RA 5EJFA 4DKJA 4UDXX 3HHPA 2EJCA 1JMKC 5U4QA 2ZYSA 5IAOA 2IHVA 2CNWA 4DEYA 2IA5A 3EISA 3N7AA 4OHYA 2JKYA 1QIKA 4UU8A 3VZBA 4EY4A 1NM5C 1YR8A 2XA2A 1JPJA 1RXIA 1XLTC 3SF8B 5E6UB 2DH6A 2GFIA 1EVZA 3TRHA 3O4FA 3EB9A 4QIHA 2B4AA 3M3PA 2R751 2QN9A 4NYJR 4WT7A 5ELXA 1OU0A 3DBVO 1Q92A 5CP8A 3SCZA 2QRKA 1VPVA 5CDYA 3NMUF 1EFTA 4CUZA 2R7AA 2CFIA 4K6MA 1QP0A 1Q91A 2CT8A 3EARA 3HXPA 5HILA 3C3WA 3FH0A 4PAWA 3EWAA 1XCMA 2P7HA 1I2BA 3AWIA 1Q74A 3L07A 2C4TA 3H7IA 3IV7A 4Q9LA 2R11A 3GRUA 3JZIA 4M8IA 4RH3A 1D2CA 2JF0A 2H1WA 1E1NA 1ODIA 3B6JA 3R6TA 4G07A 4P3YA 1VHDA 2D4AA 3AUTA 1N5LA 3L6UA 4YFVA 5ALDA 4RO0A 3K9NA 5DV9A 1PFWA 2ZREA 4ZIRA 4ZVRA 3ZUPA 3KSRA 2YXEA 1QUFA 4NKRA 1NSFA 5AKLA 2QMHA 4RNDB 5P21A 3LCUA 1QWOA 3WDSA 5ILGA 4RC9A 5B3JC 4YWJA 3KVRA 3KDSE 3JY6A 3VC1A 1U28C 5HNKA 2J48A 4PSCA 2AC7A 1CC1S 2C2YA 3FVVA 4BFCA 4O4IA 3ORRA 4KUGA 4Y6LA 4CN8A 2B8EA 1I0LA 3WGMA 5EMNA 3S2YA 3ZX4A 4Z99A 3ZJTA 2PL9A 1BEZA 4KV7A 4M86A 4RXTA 3BH6A 3PA6A 5KNLA 2ORED 3FGNA 5ED4A 5DISB 1HL3A 2ZJ0A 1GGKA 1S3IA 2P6MA 3M82A 2B7BA 4KLAA 3W6OA 1Q0QA 2V7PA 2VTDA 3GA0A 3H3JA 4JXJA 421PA 5K7SA 5L7TA 3TL2A 1IY8A 4DV4B 2Q5OA 2PY6A 4PX9A 1D6SA 2FEKA 3ZHXA 5THKA 1L1FA 2VXYA 3AL2A 4ZAYA 1XZCA 5C1BA 3C8HA 4QOHA 4F3TA 3FNHA 4YPVA 5TGDA 4D45A 3EXAA 4YJ3B 4FSHA 3NVMB 3P94A 5CFRA 1BJKA 4EHIA 1ODSA 2HSWA 2QTNA 3W2TA 2Z6AA 3TB4A 2P5UA 3CEMA 2F7SA 3W2EA 1WPXA 2DM6A 2OVBA 1ORVA 3K9CA 1HOXA 3HN7A 4OOEA 1W6RA 4R4JA 1BHQ1 5LIRA 2C54A 1PT6A 4QXQA 5CIWA 1R6XA 3KQTA 2UUCB 3KOOA 4PGGA 1C8VB 2V58A 4M6WB 4ZI5A 2NYRA 2VG8A 5BMVB 3GLGA 3LW8A 3Q7IA 1DRKA 3ZHVA 1FYDA 2JFPA 5KJFA 1M0SA 5LXTB 1RTKA 1AVTA 4G85A 5CUQA 5BN4A 4OUDA 2EX1A 3NBFA 3H6KA 1UMCA 4M8NE 3R8CA 4FUQA 3G0GA 3ZI7A 1SWVA 3V1KA 1OWMA 2Q6OA 1Q7BA 2DPXA 1GPWB 3I5MA 4HQOA 4L5BA 2OAQ1 4OB6A 4QQ8A 3F6BX 2AFIE 5HGXA 4NCHA 4BNDB 3OCJA 4KC0A 1Y82A 5HX7A 2AR7A 3BHNA 5M04A 3L8EA 3ONNA 3FTQA 1LBQA 2BF7A 1ZI6A 1LQUA 2JLBA 3ZTWA 2X0RA 4P7JA 3AC0A 2QTVB 5FT9A 3FSEA 3HYCA 3RFXA 3L3BA 3KDAA 1MIOB 3SFZA 4EHLA 4OX9Y 4AIRA 3SYMA 1X80B 2GZHA 2R6AA 2EZ9A 3BRCA 3ZWBA 5ICCA 5JC1A 2JG3A 1N5JA 2HRBA 3R7WA 3ZZ1A 2C5BA 4DLTA 5KOYA 1QPBA 5ALXA 5D51S 4OI4A 4V0QA 1KMMA 4N5DA 2C92A 2JLAA 2QRPA 3WGQA 2H92A 5HXAA 2O8EA 1CQZA 2MMCA 3PQCA 4P4GA 1ESZA 2RJOA 4MDHA 3VR5D 5IHPA 4MW9A 1MEOA 1NDUA 4HH4A 4Q12A 4YRGA 2WTNA 3PITA 2PZMA 2E3JA 3I9V1 1ZH0A 2C2HA 1BROA 5GPBA 3TWOA 1OH8A 1E4OA 2FQQA 2X9QA 1ML4A 2YZ2A 3JRWA 2CLSA 3PG5A 2GBPA 2YX1A 4X1YB 1T9HA 3TLCA 3VDRA 4RM3A 2PZAA 2P9BA 3EIXA 3PQEA 1YE8A 4CMCA 2IRWA 2W22A 3T1OA 1UMDA 5BUQA 1GPNA 4FQ7A 2XIQA 1BE1A 3KB1A 3NIGB 2ARKA 4CU5A 5IF9A 5MGBA 1K63A 1J0DA 1CF9A 4GC9A 3FX2A 1L5HB 2GD6A 3PR2B 3TZCA 3HZHA 4O4HF 1A2OA 3TMYA 2HV9A 4BQQA 2QNIA 4OAPA 4WHMA 2Z04A 3LO8A 2F1RA 1MD9A 1SHUX 3I12A 1CRLA 3SM3A 3O8QB 1RZRD 1F8FA 5ARDA 3OQPA 1Z5ZA 2QR5A 3A10A 4M38A 4PPYA 1N0UA 4MJLA 1A7UA 3NEAA 3GC6A 4JVOA 4YT2A 1UDAA 5CEFA 3AKEA 1QS0B 4Z3OA 1NBMA 3W2HA 2XUGA 2Z8YM 3U39A 3UHJA 2JJMA 1I01A 2X6QA 1LVGA 4RF2A 5DK6A 4HADA 5H9WA 5LQJA 4IS3A 3PTAA 1XDSA 1H85A 3JD0A 1AM4D 2QQFA 4UATA 2IEZA 4HUTA 2P0YA 1OZGA 1AGRA 1RI5A 3DGFC 4R98A 3JR7A 4MKGA 1CUJA 2FKAA 3KQYA 4ZU1X 3V1LA 3R1IA 5JT1A 4NOLA 1W46A 1DMSA 4D3FA 2J3JA 2AF3C 1B73A 5KMGA 1UBNA 1I14A 1U1IA 1J20A 3RO7A 4IRUB 5GZ1A 1IRXA 4RWZA 4AQYB 3P2OA 1Z7YA 1Z4MA 2IH5A 3RVSA 1Z0SA 3OQIB 3EBLA 1N2CA 4B6OA 4L4RA 1VKNA 4Q0MA 4GGMX 3HXMA 2DFDA 3WGTA 1YB1A 2JFYA 2ZI4A 3ROFA 3VDQA 5KTYA 1ZIYA 2WABA 2ERCA 1EM8A 4E30A 1BO6A 1E1QD 5A05A 4Z4HA 1CIVA 5C8DA 1T8SA 1TYDE 1W0CA 4FHEA 3UOAB 3GEPA 2VXOA 5LYJA 1ZJ5A 1UODA 1ZHFA 2Z09A 1G42A 3EA5A 2VCHA 3RG2A 3Q41A 1UDCA 4RD2A 2XUZA 1SBIA 1OIVA 5AHXA 4JJFA 2QL6A 1E98A 1E61A 1G5QA 3IQWA 4OBBA 3ADDA 4DB2A 1QGAA 1PV4A 4BASA 2AYYA 6GPBA 3IX7A 3OZEA 1IPHA 3NPMA 1A4IA 4LZWA 1G3UA 1X1TA 2J0SA 3ASYA 4MWEA 1ENYA 3D7RA 2MWMA 1DUVG 1XZBA 3U7EB 3T1HB 4IFIA 2QLTA 3ROXA 4G1FA 4S1PA 4OHWA 1DOAA 3H8VA 1BU8A 1E2NA 2LWIA 2QTFA 2IYOA 2YFQA 2B99A 4M49A 3RU2A 5FDFA 1W4CA 2IHKA 3PXEA 2LXNA 1VYHA 1HG1A 2DU8A 1XNGA 1LJUA 3RNOA 4C30A 2F9LA 2VDMB 1MH9A 3EXIB 3DHNA 3H1EA 2NXCA 3H75A 4MQBA 2ZUVA 2KLBA 2NQ8A 3NCHA 1QP7A 4B3TB 1DWQA 1H2EA 2GKSA 1V26A 1PJSA 2H48A 2HDNB 3KEOA 4E2ZA 7AT1A 1SC4A 4J94A 3JALB 1UFRA 4UCFA 2WJIA 4YRAA 1A3CA 4M53A 2Z30A 3D1JA 2IV7A 4EB3A 5K4GA 1HQCA 3SS8A 2WZBA 1ZR4A 3E5RA 2C58A 5BPHA 3ZE7A 1RXVA 5SY6A 1A27A 4H7JA 1CZRA 1ODLA 4QD3A 1KRXA 1U4OA 4LHSA 2L17A 3DVAB 3R3YA 3BXHA 5JQGB 3N1UA 3P32A 1GTL1 1SUSA 2F67A 3GEMA 2V96A 2UZ0A 3EEQA 1L8AA 3D7MA 3PIRA 4I36A 4LX0A 5KUTA 4EYGA 4DXHA 1PW5A 6CHYA 2HK7A 5SYNA 1AZSC 3URMA 2PMKA 1XRRA 3R75A 1IBKB 3W5SA 4YAJA 2FN4A 3I1YA 4D4IA 1Z6GA 1CX9B 3EZ9A 4DIEA 1GSOA 1IUKA 3BAFA 1UAGA 1Z0FA 3DYBA 1I3NA 1Z4IA 2NUAB 2QM8A 4QM7A 5HTOA 1FQKA 1H3EA 4H1VA 1A9XA 1GNSA 4NBRA 4FYXA 1GQSA 2PLFA 3LQ1A 2XEXA 3IVMA 1VKRA 4Q4HB 4RZIA 2WFMA 1KYIA 1ZGGA 2GVDC 2R85A 2WY2D 5DNUA 3RFFA 1GTSA 2YQ5A 3VOTA 4AECA 1AF4A 4CG3A 1NWHA 3QK7A 1ZP6A 4I50A 1MC4A 1RWKA 4EYKA 1BFKA 1BX1A 4K40A 4KXLA 2R9VA 4RJKA 4FKMA 2Z9BA 3Q85A 2Z1DA 4JMPA 3RTCA 2P4HX 2WE8A 2AWNA 3AY6A 1T25A 3NT2A 4B35A 3FF1A 3RVRA 1V3VA 3WZMA 2RGUA 1YJ5A 3GG2A 4AJHA 3QKIA 2B35A 2EW8A 1IPFA 3VYTB 3VH4A 1XG5A 3IVCA 5A4MS 3D2AA 3H2KA 2HI0A 2V7TA 3PLNA 2R47A 4BBJA 4X8HA 2ZXFA 4X61A 2EP7A 5EKDA 2C1XA 2ZBPA 3A1TA 1OMOA 3DDHA 3IIIA 4QWMA 5KNBD 5E1MA 2BMFA 2R7KA 1CNFA 2P3LA 3AEKB 3RS4A 3ZIUA 4DUGD 1GQYA 4OKSA 4TT3D 3RADC 1YCDA 2IUYA 2VPWA 4RMIA 3PWZA 1XTQA 1WUYA 2C0PA 3TLAA 2C5EA 4A10A 5DGDA 1S3FA 3T38A 4RTJA 2QY6A 4GG1A 1G7CA 1KEKA 3E18A 3FI0A 1VJRA 4BB0A 1EGHA 1ZS9A 1DJNA 2WI8A 3H5WA 2JA2A 2XTAA 1PQUA 1VL5A 2I4OA 3OTIA 3Q5EA 2XNJA 2HA2A 1H4QA 3AHDA 1LNZA 2QEQA 4ZT5A 1M7GA 1W48A 1KAHA 4GM4A 4IUCS 2LKDA 3MCUA 5THXA 5AOCA 1WQ3A 3EUWA 1G60A 2WIKA 3Q15C 5AW2A 5HQ3A 4CF7A 3IERA 3VO2A 3HSYA 3K30A 1ZI9A 3LY9A 3D8TA 1M2FA 3CUEF 2AFHB 4PHGA 4YQZA 4S3MA 2XUJA 5DTMA 1PR4A 5ALIA 3OA0A 2OYRA 3MAJA 4EF6A 1EUQA 1YU9A 3WYFA 5JH7B 4AP9A 4G0OA 2IU4A 3CB2A 3HUUA 1KMQA 4H16A 5LMUB 5ITWA 2HJ9A 3CT6A 4REMA 2JIOA 2I9PA 4R0VA 1YRHA 1QIFA 1CNMA 4UTZA 1UEJA 4MUKA 4MIYA 4XVHA 2WNIA 2VP5A 4AN1A 4HXYA 1PNTA 3SGLA 1YJAA 2IZ5A 4M0LA 4R1LA 4YAOA 4BVJA 2PRYA 3MJRA 2W58A 1QCCA 3MGCA 4UTNA 3TBHA 2K87A 5F7OA 2OB2A 5HWSA 1T8TA 3I6MA 4JL8A 1BOOA 1NGSA 3CUUA 3NETA 4XWGA 4KR0A 3V7FA 2QA5A 5I9LA 1C0EA 2JVIA 3D81A 1NVAA 1ZJ6A 4QQRA 5LPNA 2XRMA 4Z7NB 4CPDA 3Q88A 2B4TO 4AZ0B 1YB6A 5IVIA 1F6BA 4A5SA 1LPMA 4UCWA 2ZIVB 3ME5A 1SIUA 2XSZA 2EWMA 3KZXA 3R3VA 1VBKA 5F7JA 5GM2A 3IDAA 4KL8S 2QJRA 1D5CA 4U6QA 1T1RA 2A92A 3RH0A 4MQ6A 1N5DA 4JKIA 2WPDA 3P9CA 5IARA 2FYTA 1Z29A 5BYAA 4A9AA 1AU9A 2V4ZA 3JAWB 3ABRB 1S8NA 1TOAA 2YV1A 2WUDA 3HA7A 4IFTA 4M9ZA 4ITRC 3NYWA 3IDSA 2QU8A 2FAXA 5F1KA 3PQFA 5E7IA 5EWLA 3A9RA 4ZCQA 1A50B 5LWQA 4C2TA 1F8YA 1EXVA 1MA0A 2PGLA 1VFNA 2PSFA 4JBHA 4XJXA 4HEA1 3WGIA 4MQEA 4GKJB 3RIXA 1EFCA 4B2YA 3KHTA 5EXSA 4BZWA 4P0PB 1U5AA 1NDQA 3PDUA 3PGKA 2UUAB 2WQZA 3NHRA 1A8UA 4QTTB 3SJCA 1RI3A 1YCHA 1KY4A 3HS3A 2W83A 1X1BA 4E3ZA 1A8SA 5E7QA 1ZA2A 4JB0A 1FTGA 3ECSA 4J7UA 1QIMA 3ZGZA 3TL6A 1N32B 4WQMA 3NAQA 5A7HA 4P08A 1V1RB 4RGYA 2BKEA 3C3PA 1QR6A 1CQPA 4HNAB 4YRDA 5G3YA 5F64A 2CVHA 2XRYA 1V6SA 5BSGA 1GZHB 2FEXA 1H3FA 2O0HA 4L3WA 3DONA 2VJBA 5FKJA 1ADGA 5JJBA 3A1SA 1R5OA 3HBJA 1RCTE 3KAQA 1HUQA 1GU7A 1T0UA 4I5FA 4JBIA 3KLBA 4QXOA 5LZ7A 3RU9A 4FDTA 1JKXA 5JNTA 1YAHA 2JD2A 3R3JA 2RAFA 1DX4A 4MXDA 3EVBA 2CXHA 2RCNA 1C4OA 4R81A 4RLQA 5BO5A 5DM70 4DUYB 2XGOA 1KR2A 1VJCA 3G23A 1K6MA 2QUJA 3PTZA 1P2SA 5CBKA 3ER8A 3MLAA 3PHGA 1FU4A 1SMKA 4OBEA 3RLFA 4B7ZA 3I58A 4BFUA 1OWLA 5JQWA 5KYXB 1IEWA 5C1PA 2HO5A 1P1CA 1SH7A 4J75A 2RH5A 4LSZA 4W8OA 3T3OA 2X6TA 1J8YF 2EBHX 2XVZA 3QVJA 2VYFA 5CLFA 2A57A 2PRZA 3D5EA 3I09A 3D6FA 4FGKA 4PAQA 5IJ9A 3RBXA 3VR6H 4BNWA 4WBNB 1CUDA 3FXAA 4CDGA 1H23A 2JLWA 1VG9B 3ZPXA 2IYLD 1RKUA 4M2LA 1HLDA 1QQTA 4ZKEA 2QJTA 1L4GA 5AJVB 3RFCA 5CA0F 1BWQA 2Q1WA 4K28A 3TX6A 3QELA 1L4HA 3ZKWB 1E3EA 5EJ7A 3AZOA 5AXAA 1I1QB 3HCFA 4GM1A 3AI3A 3RUIA 7ABPA 3DMRA 1MV8A 4J0DA 1CDZA 4EA8A 2X3UA 5IDWA 2XBLA 1GUFA 2ZTMA 2P9EA 2Q4RA 2Q46A 4TRNA 3UHPA 4O3MA 3R3HA 4E4RA 1L3CA 4IHKA 4UNIA 5IHXA 4ZOEA 3TPZA 1CS4C 1S8OA 5EKTA 1KK0A 2NO4A 3MGKA 4OHCA 1JEYB 2GN0A 1Z3CA 3P4YA 5JZSA 3H5OA 4E2WA 2ZIZA 4DHEA 3AOEA 3H1PA 3HYNA 4OG2A 1N4DA 3WGNA 5AVYA 5K0BA 1W5SA 1FQOA 1TLLA 2ZRDA 1YJCA 2J45A 4ZEWA 3RKRA 2ZEJA 4FFPA 3TLKA 2HWUA 1DT5A 2QE6A 4ZA2A 1A7AA 3PJRA 3EGDB 3SIPA 5ALTA 4ZHQA 2E18A 1IAQA 4D0RA 3AYXB 4JSTA 3BERA 1MX5A 1DKMA 3T35A 4AJPA 1H94A 2DUJA 3GMIA 2CV2A 4D46A 2PS9A 4TZKA 5JHGB 4IQ4A 3M6XA 1GJRA 1XNJA 5HZMA 1T9AA 4RHTA 4G86A 5AJTA 2CUTA 4B71A 1I80A 1L4NA 1W85B 2AFIB 3D8RA 2DSTA 1M10A 4M7PA 3ZYZA 5B2EA 3T0FA 1JNXX 3EC1A 3H2ZA 3SNHA 1USKA 3GUZA 3LSTA 3BL6A 1E5TA 4EITA 4CU2A 1SQGA 5A1JA 3H1AA 1MOPA 2GHRA 1NP6A 3E9MA 3G0BA 3IT1A 4A2CA 4B32A 4EQZA 1TVMA 3I37X 1P39A 3OEYA 3MELA 3HNOA 4E11A 2DQSA 1L5ZA 4EJSB 1KVTA 3KUUA 2EJWA 4IXWA 2XOKD 4I46A 2NQ2C 2XMBA 3CUSA 5IC6A 1RTTA 3FYTA 3LK7A 4HQKA 2H5IA 4MRMA 4R5HA 3RSFA 4F3YA 2OWDA 4ZZ1A 1EESA 2PBRA 1KJNA 3MS4A 4IJUA 3JATB 4KQXA 4X1IA 4WLUA 2AR9A 2FMUA 4AQDA 3FDZB 4DR5B 1A8IA 3LBFA 2A5JA 5FA5A 1Y7TA 2VPIA 3DQZA 3CX6A 3LIIA 2X2EA 1E8DA 4FLMA 4RL4A 4EP1A 5BOSA 3GP3A 5KDLA 4V1CA 1J8FA 4QOSA 3CE6A 5TQ2B 2XD4A 4ENPA 2ZSAA 3QA3E 4MAFA 3FWKA 4TL8A 1QMPA 3H4TA 1V16A 2GO7A 3IAHA 3IFSA 3SHFA 2J5BA 2C97A 2FRVA 4B76A 1NRWA 1JG1A 5LOVA 2ZT7A 3JPYA 5B7QA 3ZWQA 1PR1A 3P2EA 2BRUC 1A9YA 1BTOA 4FFLA 3OC0A 3TH5A 5IM4F 3ENKA 1L4EA 4MVJM 3GD5A 3OHPA 5CBPB 5F2NA 1KNXA 4TPKA 3W8RA 1P75A 4CM4B 5F5LA 5BT8A 1WW3A 1JAIA 5EG5A 2ZIGA 3O73A 3H16A 2IX3A 4ZKDA 2PUFA 1UMKA 1Q95A 2NOAA 3LHIA 1D1QA 1Y0BA 4RZ3A 5CH8A 5CLHA 5AVZA 4BFTA 5KTMA