5IN4A

Crystal structure of gdp-mannose 4,6 dehydratase bound to a gdp-fucose based inhibitor
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
355
structure length
355
Chain Sequence
LYFQGRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVHADVELMRTNPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/inhibitor
molecule keywords GDP-mannose 4,6 dehydratase
publication title Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
pubmed doi rcsb
source organism Homo sapiens
total genus 130
structure length 355
sequence length 355
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5in4A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 5in4A02
4NQZA 1HSOA 4LCEA 1U2DA 1GFSA 3SLKA 1DLJA 3IUPA 3W4IA 1VL0A 5BSFA 1ISFA 4FBGA 3D0OA 3IJPA 4XQEA 5JXWA 3MJEA 3JQFC 3H9JA 5JCJD 1XSEA 1J6UA 5GMOA 5EJ2A 4EUEA 3G3EA 2V65A 4GPD1 1MC5A 3GG9A 3WWZA 5TRTA 3P19A 3AI1A 4BNIA 1QYVA 3H2SA 1E7RA 2B4QA 1DHRA 1YL5A 4NDNE 3JSAA 2C0CA 4KP7A 4ALIA 3H65A 3QWHA 1GZ4A 2FY8A 4IJUA 3PHJA 1EZ4A 3VH1A 3PQFA 1T25A 3GNTA 4WCFC 3E5MA 3Q6IA 2XOXA 1ZNQO 1E5LA 2YV2A 1JTVA 4TRRA 3RUCA 3BIOA 2XF8A 3SX2A 3PK0A 3U9LA 4PLYA 2ZTLA 3PVZA 1K89A 1Z7EA 4BNHA 4HFMA 1SOWA 1F0YA 3H5NA 4PLGA 1QYXA 4TRMA 3U4HA 1MG0A 4BNWA 1NNUA 4MKRA 4XB2A 1WZIA 1QP8A 3AY3A 2ZB3A 5IG2A 1O6ZA 4WLOA 2VTDA 4EGFA 2LDBA 4LMPA 3JQ7A 4XDYA 5K9ZA 1NHWA 4TVBA 1YOVB 4I5FA 4DBZA 4J1TA 3U4CA 5C7LO 2WEKA 1IZ9A 3ZV5A 3BMOA 4PGFA 3GEGA 2HMWA 2VZ9A 4GGPA 1PJBA 1JQBA 2Q99A 2B4RO 1Y9EA 4MVJI 3ZHZA 3TJRA 4PVCA 4HX5A 4KTTE 2AMFA 4XA8A 1PSDA 3TZCA 4R9RA 4BO8A 1X14A 4YTEA 4CM8A 4R1SA 1UH5A 3IC5A 2HO5A 2OP1A 3QQPA 1V6AA 1VC2A 3VH2A 4NPCA 4MKZA 4I8XA 1QLJA 2NACA 4RPHA 3INGA 4NZ9A 1Q2XA 3JQ6A 5JO9A 5AQ1A 4IDFA 4PRKA 3HSKA 4PG8A 2B0JA 3MJCA 1PS8A 1QXSA 1E7MA 1N2SA 2W2KB 3JQAD 1Q0QA 4YQYA 5I9MA 3H3JA 1H6DA 3JQAA 1AXGA 4HFNA 3LSYA 1C0IA 4DL9A 2ZIZA 3T4EA 3WYCA 1LTHR 1GUYA 1U3VA 3DBRA 5JLAA 4A73A 4BO2A 5HTOA 4RPLA 3GGGA 5IFLA 5KVQA 3HN7A 1QV6A 1EDZA 4ID9A 5TLSA 3Q2KA 4GX1A 2ZB7A 5CDSA 4JXKA 1P1HA 4ZQEA 3KV3O 3EYWA 2I66A 1WMBA 3RSHA 4DREA 3H9GA 4EZBA 2FPPA 1UZMA 4DIFA 2V6BA 3LT1A 4CMIA 3C1AA 1GAEO 1E3JA 1NFRA 1ZUD1 4XWYA 4HADA 3ZHYA 3WBBA 4DQUA 4Y67A 1DSSG 4QFCA 1QLHA 4DIBA 3HFGA 2Y99A 4Q39A 4EJ0A 3A4VA 3BZUA 4NHEA 1KEWA 1JKIA 2RHCA 4ZGWA 5COQA 3CZRA 3OM9A 1FJHA 1ZEMA 2DVMA 4E12A 3PZBA 3UKOA 3LC1O 4II2A 1EEHA 3H3FA 1AN9A 2Y93A 1HZZA 1RYDA 2JFGA 1HDYA 4W82A 4Y6RA 1ONNA 4E5NA 3RUHA 3RASA 1NPTO 1LC3A 3G0OA 4U6SA 2NV6A 2VN8A 2VZ0A 3RJ9A 1UXKA 3DOOA 3VPFA 4BNJA 1MLDA 1P0CA 3FNHA 5LDGA 3G49A 3WGIA 4BO4A 5TJ9A 1GUFA 2VYVD 1XCBA 2CDAA 1E3LA 2Y68A 3C24A 3PEFA 2D5CA 4BNYA 1QORA 2VYVA 3FSRA 2PKQP 1ML3A 1HDOA 2QYTA 4IQ8A 3NRCA 5KJCA 2ZK7A 3F46A 3CUKA 3V1YA 3ETEA 1FK8A 2PR2A 1B15A 4YRBA 4C7KA 3VTZA 1DJNA 1WMAA 2XXBA 2DUWA 3DQPA 3DO5A 3LDHA 1O95A 2X8LA 2NADA 1C0LA 4L4XA 1NM5A 3RFXA 1E7SA 3LT2A 3NGXA 6LDHA 2BGLA 8ADHA 2YQ4A 4EDFA 3RI3A 3BAZA 1RWBA 2DKNA 2NTNA 2HRZA 4FFPA 3R1IA 3KSZO 1RKXA 5IJZA 2YY7A 4RZHA 3DBLA 3MZ0A 3UHAA 4ILKA 4CM1A 3RU9A 2CNBA 3LC2O 1ONPA 1YOVA 3ADOA 1IOLA 3H9QA 4OOEA 2JAHA 4KWIA 2VZ8A 2WSBA 2DT5A 4N7RA 1OOEA 4IBOA 4CM7A 2C20A 5F1KA 4MINA 5ES3A 2C82A 2RIRA 4YJHB 1U4OA 3DZKA 4YBZA 3S2EA 2RH4A 4FN4A 2AW5A 1GCOA 3D4NA 4BV8A 1PJ3A 4N5LA 3ZWVA 9LDBA 4M1QA 2O7QA 1HE2A 5CAEA 3MJSA 2IZ0A 3LYLA 3V5NA 1VJ1A 2ZTVA 5HS4A 2X4GA 2X7HA 1PQUA 2AEFA 3RIHA 3UH1A 2HRBA 1LSOA 1Z73A 4CM4A 2EKPA 2AQKA 2VNAA 3LT0A 1MFPA 3FWZA 2JHFA 5EQFA 4R4JA 1B14A 2A35A 4Y9DA 4DLAA 5BSGA 1F12A 2EHDA 1RM4A 3WIEA 3ASUA 2SCUA 1G6KA 3DZBA 3OJEA 1BVUA 4NNJA 2ZB4A 2DC1A 3WMXA 2ZCUA 1Q0LA 3DHNA 1K0UA 5IZCC 2FZWA 4ZRMA 1ZCJA 3CPSA 3M6IA 3DMYA 1XELA 3GEDA 1PS9A 1W6UA 1Y8QA 3GDOA 3I9MA 4FS3A 2OP0A 2YDYA 3NT5A 4BV9A 4KUEA 3P7MA 4J4BA 3DAFA 3H2ZA 2Q46A 1WZEA 1HXHA 5CDTA 3UN1A 2VRCD 1KS9A 1P45A 1T4BA 4DUPA 3B1KA 3S2FA 2PV7A 3JD4A 3MWEB 3AUAA 4U7WA 4IDCA 1I2ZA 2EIHA 4NBVA 2NU9A 1GCUA 5F1OA 4UUOA 3KLMX 5B4TA 3AJRA 3QW2A 4ZJUA 4FJ1A 5KIAA 1WPQA 1UDAA 3PWKA 4BGVA 2BLLA 1JAXA 3QHAA 3ROMA 4P8RA 2P68A 3TF5A 3GVIA 5DBGA 2O7SA 3QJ5A 3RFTA 3GR6A 5HM8A 1PZHA 3F47A 1S6YA 1YO6A 5H83A 1ZEJA 3KYDB 2X58A 2ZB8A 4D44A 1V35A 3PFFA 1YB1A 1PGNA 4J90A 4FFOA 1PR9A 3OFSA 3LF2A 3OIDA 4D7AA 5JYEA 4D41A 4PG5A 3E9MA 1TT7A 3I52A 4XZ3A 1DIRA 3QWFA 1YH3A 1DOHA 4KUGA 3ZV4A 3ZU3A 4QT0A 1AE1A 5GZ1A 3DBVO 3AU9A 3MOIA 1CJCA 1UXJA 1ZJYA 5TIIA 1GEEA 1YQGA 3LZ6A 4YJGA 3ZH2A 3ZN2A 1JA9A 1EE9A 1Y7TA 4BKQA 5CDUA 4DLBA 5TT0A 1GTMA 4RLSA 4MIEA 1MC4A 4XIJA 4IDEA 1F14A 4RZIA 1O0SA 4JGBA 5DNAA 4I1IA 2AEMA 3QVXA 3H9EO 4IZIA 1LRLA 4CM9D 1Q0HA 4O1MA 3OICA 1U1IA 3ZWOA 2GF2A 4A03A 2FP4A 3O8QB 3OETA 1PGJA 3RU7A 4M55A 3WR5A 5CDYA 3W4KA 4WCFA 1DLIA 3AW9A 2DU8A 4DBVO 4ITUA 4XGKA 4UVHA 3PIIA 4XYLA 3DR3A 3P5SA 1YVEI 2D4AA 5G2OA 1K6JA 1HSZA 4WASA 3UOGA 1KERA 2IYPA 3VDRA 2P9CA 2Z95A 2GN6A 1LDYA 5CG2A 1NBOA 5AXBA 4GGOA 3KZVA 2FPIA 2JFHA 2YHUA 3WFIA 2DUUA 3W6UA 1GQ2A 1KVSA 3EVNA 1DPGA 3JQDA 2A9FA 1IUKA 1VSUA 4TVOA 5KVVA 5G0UA 5JY6A 2GR9A 1R16A 2WTBA 3LLSA 4FFRA 4LK3A 4E3ZA 1PU2A 1AHHA 2R2GA 1U2GA 1J5PA 3EGOA 3K5PA 4MIYA 1QMGA 4EEZA 2C59A 4PZEA 1AXEA 1EVIA 1Q7BA 4I5EA 3AI3A 2NVUB 2BH9A 5CPFA 4GX5A 4NMHA 1HDXA 5CDGA 1DIHA 3RKUA 2IDZA 2BGMA 3HN2A 4XRRA 1SBYA 5L4SA 2DFDA 4E2XA 3DZFA 3JQBC 3GHHA 3CKYA 4UUMA 3RFVA 1QV7A 3O4RA 5JC1A 2I9PA 3RBXA 2R00C 3GVCA 3K92A 4ZRNA 4JIGA 2QRJA 2Y1GA 4AJ1A 1M2WA 2QZZA 1ZBQA 1T2CA 3KEQA 2IZZA 1JWBB 2X9GA 2DBVO 4NBUA 3W6ZA 3V2HA 5A3JA 7MDHA 3DZHA 3KYBA 4D3FA 5K6AC 2W98A 4FFNA 5DN9A 3E03A 3ZNPA 1Z75A 1WAMA 3PI7A 3QSGA 3FNGA 4YAJA 4YAEA 2BF7A 1J49A 4LCJA 3Q9NA 3NJ4A 4D46A 4AJJA 5ENDA 5CEFA 3A14A 3E1KA 2B69A 1WDMA 4DXHA 1I36A 3JD1A 4EUHA 3NTOA 4OJNA 5L40A 4BKUA 2D5AA 3MOGA 2HU2A 1PGPA 5G0SA 2A4KA 1RJWA 2EP5A 3GQVA 3KYDA 4WEQA 4CMJA 1YQXA 2VUUA 4E0BA 1VLLA 3VH4A 5A03A 3BTUA 3R3JA 1BDBA 1TA4A 3FN4A 5F21A 2PNFA 1GADO 1GPDG 2DBQA 5C7IO 5C7OO 3ON5A 4CLHA 3RUAA 3QY9A 1C1XB 4R54A 3L9WA 2HK7A 4EJMA 1YB5A 2DLDA 3JQ8B 1AHIA 3LK7A 2G1UA 3ZU4A 4IS3A 5KTKA 2I67A 4TMFA 5A4DA 4J0EA 5L7YA 4GVXA 1T2FA 4NBTA 3WLEA 3UF0A 3D5TA 2XPCA 1GPJA 1T24A 1ZIDA 1Y9AA 4NG5A 1LQUA 1E3WA 3I5MA 1PJ4A 2OORA 4IXTA 1LEHA 4R3NA 1CQJA 3DFZA 2CMDA 3K96A 3CEAA 3ZHXA 4BB6A 2WYWA 4ND1A 1GR0A 5BNIA 1Y5RA 4FFLA 3BTSA 1OMOA 4MVJG 2OXIA 2VT2A 5BNFA 4JCOA 4XRGA 1ARZA 3UUWA 3WJAA 3F3SA 4YACA 3MJ4A 3D64A 2C5AA 1LA2A 2HMTA 3FD8A 4MP6A 4HBGA 2WD8A 2DFVA 2V7PA 1E6UA 3IDSA 4OXNA 3WX0A 1YXMA 3C1OA 4FQ8A 1KIFA 3E18A 3WGYA 3O03A 2J3KA 3GNSA 3MWDB 5TC4A 1MV8A 3RUFA 3KXDA 3X2FA 3L4BC 1N7GA 4UEJA 1P3DA 1QG6A 4E32A 1EK5A 4NJOA 1RYEA 1SEPA 3CSDA 4QO7A 1HZJA 1GL3A 4DMLA 4R51A 2AE1A 3C1TA 3D3WB 4W4TA 1ENPA 1BW9A 5A06A 1M66A 4IDDA 4UVEA 3KUXA 4L4RA 5CEJA 4PLFA 4MKXA 3FTNA 1LDGA 2DTXA 2PD4A 3GUCA 1ISGA 4OXYA 3TPCA 1B16A 3I9OA 4KUHA 3RJ5A 2ILTA 3D7LA 4XYEA 3V8BA 1JDJA 1QYWA 3VZPA 1JN0A 1HE4A 2V6MA 3HB5X 3NKLA 2PGJA 2YFQA 3JYNA 3JQ7B 3ZNOA 5BQFA 1JVSA 4ND4A 1PL7A 3FBGA 1GV0A 1H9AA 4U5QA 5EPOA 1P1KA 1IL0A 2CFCA 1Z45A 3JD2A 1EE2A 3AFNA 2PZJA 1XLTA 3PHLA 3AM5A 3L6DA 1KEVA 5EIOA 5FF9A 3VPXA 4UVIA 4C7JA 5IZCA 2VNSA 1S7CA 3KVOA 5DOZA 1NWCA 2BFPA 4JJFA 4OHUA 4PIVA 1N5DA 5H82A 1R15A 4CM8B 2D8AA 3TL3A 1D3AA 3ETDA 4TKLA 3SJ7A 2IRWA 3MTJA 4DIOA 1ISHA 3PTZA 4BGUA 4CMCA 5EESA 3WS7A 4AJPA 3ETGA 5I8WA 3I3OA 3AUUA 4RLHA 4L0QA 4B7XA 1C1XA 3VVBA 2J8ZA 2D59A 1LNQA 3JQ8A 4IGFA 2EGHA 4GX2A 4M8SA 1W0CA 4PG4A 4XEHA 4CLRB 4DVJA 4HP8A 3VKVA 3LQFA 2GERA 1DIBA 2Y1FA 4RF2A 2VWPA 4GVLA 3DBRB 2WE8A 4UAGA 3QVSA 3R3SA 3NYWA 4B4UA 3N74A 1I2BA 3RC9A 4U6QA 4IIVA 4DLLA 1YS4A 1JU9A 3UXYA 4XGIA 4RVSA 5JO0A 4XQ9A 2DTDA 3JTMA 1PJLA 2OGUA 4MVJH 4YPOA 2P9GA 3GNQA 3BMCA 3QWBA 4JLWA 4MVJA 1L7EA 2O3JA 2H9IA 4B3IA 1C0PA 3FF4A 5I7EA 3ORFA 2D3TA 4P4NA 1ID1A 1GQQA 1WW8A 3TOZA 3WBFA 1YQDA 2YDXA 1XR3A 5FI3A 2QHXA 4L4SA 1DFHA 5DBIA 1BTOA 4XD2A 3RBVA 5AXDA 1UP7A 3T7EA 3INRA 1Z7BA 3C3XA 3OBBA 1PJQA 4FC6A 1UZNA 1M6HA 4B4OA 1GYPA 5LDHA 1EBFA 1EVZA 2HUNA 2VHXA 5JDCC 2V6GA 5L4NA 4A7PA 2O2SA 4OQYA 4Z9FA 3ROQA 3U0BA 2PWZA 4E5KA 3GZ4A 4J7XA 5C3MA 3ZNNA 2X0RA 1P74A 3KOUA 4GMFA 1MB4A 1OC4A 3D3WA 1GD1O 2BHLA 4AG3A 3AOEC 5FI5A 1X7HA 4PLCA 4RVHA 2X9NA 3DFUA 4DRYA 5DP1A 3NTQA 1IPEA 1E1NA 1U5AA 2UUPA 1C14A 1LRKA 1N9GA 3VPHA 2HAEA 1PIWA 4J9VA 2Q50A 3BXXA 2RHRA 1ZK1A 2WE7A 1NQTA 4L8VA 4WLEA 2QRLA 3DBLB 2NSDA 1KVRA 3BMQB 4YJFA 2P5YA 1CEQA 4OGWA 2Q1SA 3C7AA 3FNFA 4NK5A 1FDVA 1SPXA 3UGKA 5ADHA 3FWNA 1I3NA 1ISJA 5HA5A 4TZKA 5IDQA 3ADPA 1SB8A 3I9KA 5JAQA 4NFSA 1VL8A 2W8ZA 4M49A 4UUPA 2D1YA 2R00A 2D2IA 1QKIA 1V0JA 4PLZA 2OOSA 3PFWO 3ZW9A 4IINA 2PH5A 4DPKA 2FPGA 4FOSA 5K6AA 1ZK3A 5ICMA 4XGNA 4BO0A 2Q49A 4KWHA 1R0LA 3X2EA 3JQEA 4PLPA 3ZV3A 3MCVA 1GY8A 4NBRA 4CM4B 1Q1NA 3ZGYA 3L77A 2FHSA 3F1KA 4CMGA 3AM4A 3JV7A 4CLRA 3M2TA 2CF5A 1BXZA 1LDMA 1ZSYA 2FR8A 3GGPA 3GVXA 3IP1A 3W8FA 3DZIA 4OKNA 4GX0A 4ZHSA 1HF3A 2R6JA 5G0WA 4MVJM 5DZSA 2I76A 5L95A 1R6DA 2QW8A 2X5KO 1A72A 3HADA 3L6EA 1Y8QB 2GNAA 4ZA2A 3TRIA 4DPLA 4BKOA 4Z0TA 4BQRA 1I5RA 4U8GA 4MJLA 3KTDA 1XKQA 2HMUA 3WTBA 1R4NB 4RVFA 3ZU2A 2A94A 1IHXA 3EUWA 3FHLA 3QIVA 3VOSA 2PLAA 5L4LA 3C85A 1A4IA 3FRJA 4WLVA 4CR8A 1ADCA 1RM3A 2FOIA 1Q7GA 2X9VA 1NVTA 2JCYA 1GQYA 1CF2O 2Y0CA 4R9SA 3R6DA 4CV0A 1ZSNA 2GO1A 5IN5A 3E8XA 4YR9A 3Q9UA 3TZ6A 4R69A 4QXMA 4FJ2A 5A5EA 1H2BA 3SBOA 3OQ6A 3F1LA 4J4TA 3I83A 3ULKA 2Y1DA 4IY1A 4M87A 4XX0A 2TMDA 2HCTA 4GL4A 1V3UA 1I0ZA 1P1RA 5EMHA 1TVEA 5IN4A 2Q3EA 3EZYA 1EUZA 4FOOA 3S55A 2NU8A 5JCXA 5U1PA 4K1LA 4TKMA 3W1VA 1PQWA 3I9JA 1E3EA 5CFZA 5KVSA 4E5YA 4YJGB 3DB2A 3V2UA 3PJDA 4BNXA 4PCVA 1DB3A 4QFDA 1A5ZA 2CZCA 5DCYA 4R16A 2QIOA 4IIUA 2AE2A 1C1DA 2WYUA 1LLQA 4NH4A 5A04A 1YDEA 3IS3A 1U3WA 4GLOA 3CZMA 1NFQA 2C7GA 4LW8A 3A06A 5U4QA 1E7WA 2OL4A 1KETA 4Z3DA 4A2CA 4IJVA 3DTYA 3WGHA 4B8WA 1D8AA 4Q3BA 3WMWA 3ICPA 4KQXA 2GRAA 3U3XA 3SJUA 4DQVA 5BNTA 1LQTA 1XU7A 4WCFB 4XYBA 4F46A 1GZ3A 4ND5A 4IDBA 4I08A 2WJPA 3BMQA 4GKBA 3TL2A 1ZMOA 4BGEA 3B70A 1U7HA 3S1LA 3LLVA 3H5RA 3ENKA 3WGQA 2GGSA 5KNLA 2OBNA 3PDJA 2YYYA 4EEXA 3VPGA 2HLPA 2NTVA 1ADGA 3KM0A 4OOFA 3PZRA 4ALJA 1OFGA 1IB6A 5G0TA 1FDWA 5A02A 4FGSA 3F4BA 1ZSVA 2O50A 3IOYA 3ANLA 3C7DB 4F3YA 2GYYA 3AY6A 3H6KA 3OA0A 1HTBA 4OO3A 2G17A 2ZTUA 2XAAA 2NNLD 4NU6A 3ROPA 3HJAA 3UAGA 2CVZA 2ZCVA 2O3UA 2EERA 3DAPA 1RM5A 2BI8A 1ZK2A 2PKRA 4HNHA 4PLHA 4B3JA 1YRLA 1ENZA 1ULSA 3BHMA 2NU7A 2B35A 1LDBA 1T26A 1UP6A 2B5WA 4CMBA 4LN1A 4Q9NA 4FC7A 1XEAA 3PQEA 1SOVA 2DBRA 5TS3A 1I10A 4ZVVA 3D3EA 1NYTA 3A9WA 5HRUA 3TFQA 2GN4A 2B36A 3P2YA 1PL8A 5C37A 1ULUA 3VH3A 1IY8A 5L9AA 3WYBA 4DGSA 4JBIA 4P4GA 5COBA 3CTMA 3KB6A 1DRUA 4XQGA 5I9NA 1B2LA 1U7TA 4WECA 5MDHA 3L0DA 3HFSA 1VM6A 4UUNA 2BKAA 4D45A 3WQSB 4WPGA 3W8DA 2QG4A 3BHJA 1R4NA 1B0AA 4GSLA 3LVFO 1DAOA 3IMFA 4A10A 5KWEA 4WJZA 4E4YA 2J6IA 4PLVA 3ONDA 1O89A 1I3KA 3NEPX 3KRTA 3F5QA 2H5LA 4D0SA 3WLFA 1N1EA 2UUOA 3HDYA 1KVTA 3MJVA 5A1TA 1M6WA 4BVAA 4B7UA 1KVQA 2X0JA 1YDWA 2IZ1A 2E48A 4AJ2A 3ZWNA 2O23A 4XIYA 2VRBA 2AG8A 4FR5A 3EW7A 3C7CB 5JDIC 3ZCXA 1FDSA 4UEOA 3VVCA 4CJXA 1CYDA 1H94A 4J7UA 1KBZA 2E82A 2X86A 1MXFA 3V2GA 3I9LA 1SO8A 4E33A 1O94A 1VSVA 4DWVA 1DC4A 1NP3A 2UVDA 4CMEC 2Q1TA 3OH8A 3GN2A 1ADFA 1JVBA 4L9RA 5THKA 3WYEA 3C8MA 3COSA 3GPIA 3DTTA 1CQIA 2C07A 4JJIA 2WD7A 4NFHA 1B8PA 5T6BA 3T7CA 1E0DA 4BO6A 3JQFA 3CE6A 4INAA 1U3TA 4CLOB 2LDXA 2Y1EA 9LDTA 2F00A 5ITVA 1MXHA 1PJTA 1E3WB 4OM8A 4NIMA 3PXXA 4OIMA 4LRTB 1WNTA 2J3IA 1E7QA 2CY0A 2NUAA 1D4FA 3MEQA 2P5UA 1CWUA 4YAKA 3Q1LA 4OQZA 4ALKA 5CHEA 3WJ7A 4OAQA 3ZV6A 2IEDA 1O9BA 1CERA 3HB4X 3BTVA 4DMMA 2YV3A 4NFYA 3VAZA 3CMCO 3KSUA 4DC0A 3ASVA 2GCGA 1EQUA 1MUUA 3M1AA 3AOEA 5EN4A 4BO5A 3OQ1A 3SLGA 1U3UA 3EAGA 4J0FA 2HMSA 1N7HA 3I6QA 5TNXA 5K0ZA 4PG7A 4E2WA 2TMGA 4WCDA 1P1JA 4AJLA 4ALMA 1DRWA 4RL6A 4DA9A 1JLLA 4RV9A 4BNLA 4LMRA 1ISIA 4QEDA 5KVCA 5IDWA 1IHYA 2AEJA 1H6BA 1Y1PA 5JFOA 3NDJA 3DC2A 5KJEA 4JJGA 4J9UE 3GLQA 1X0XA 4B4WA 1QSGA 5JS6A 4J49A 2GZ3A 5KOIA 4CPDA 3KEOA 3GH3A 3NJ8A 1OI7A 3G1TA 4OSPA 2VOJA 4RF3A 4F6LA 3ZWCA 1HDGO 2Z1MA 4R3WA 1T4DA 5IDXA 3BYZA 3IIEA 1OBFO 1YL6A 4K26A 1BW9B 3AWDA 4OKIA 2Y66A 2J5KA 4Q3EA 3DBHA 4NBWA 1L7DA 2EG9A 2GZ2A 3PWZA 3FR7A 4M54A 3WGTA 4EW6A 5TT1A 2OUIA 2P2SA 3KYCB 3KLPX 1IYZA 4J91A 1E92A 2GN8A 1JKJA 1LLCA 3ZZNA 5A9TA 2NU6A 1GZ6A 4AL4A 5TGDA 3VTFA 5G4LA 3VC7A 2JCXA 4BHTA 1Y8RB 2JL1A 1PX0A 1KOLA 3E5RA 2G0TA 4YT4A 3RQSA 1A7KA 3GMSA 3GZNA 4FFMA 3AU8A 3DAGA 2OZPA 2PZLA 4EI2A 3JYPA 1RM0A 2FSSA 3GK3A 2YJZA 1TT5A 5BR7A 4RORA 2NLOA 1NX6A 1LLDA 2YQ5A 4BMNA 5DF1A 2IE0A 4RF4A 3HWRA 4RO0A 3IKTA 1J4AA 4WUVA 3DZGA 5HWSA 1YJ8A 5KJFA 4WLNA 2Y0EA 3JYLA 2HDHA 5DCUA 1LSSA 1FF9A 3QWAA 3OQBA 1EVJA 1VKOA 2QX7A 3FPCA 4J1SA 4WOKA 1LDEA 4KDEA 1EQ2A 4ND2A 4RCVA 5LC1A 3UFXA 4BIIA 2A92A 4MVJE 1Z82A 4DYDA 3F5SA 1DRVA 5EERA 1JAYA 1FMCA 2VWGA 1LI4A 2ET6A 4RDHA 1XIVA 2NM0A 3R0IA 2B4TO 4CLOA 1ZH8A 2JD0A 2X6TA 3P2OA 1NAHA 1ONOA 5GY7A 2VYNA 1TLTA 2PD6A 4FIZA 4D0RA 1U9JA 4TQGA 4CM6A 3UW3A 1I24A 2FRDA 4PG6A 1K3TA 1IULA 4BNNA 4DPMA 4U0KA 3BMCB 3ZHBA 5J23A 3FBTA 2NWQA 3B6ZA 4K28A 4J3FA 5JW6A 2G5CA 4QQRA 3KSDO 4MP8A 3FI9A 4CMKA 4CUZA 5CPBA 1M67A 3K9QO 1OC2A 3GVPA 3NDIA 4IGEA 4IPTA 1WP4A 2DQ4A 2FMUA 4CL8A 2BFAA 1BDMA 4G5HA 1MGOA 1PWZA 2DTEA 4BO3A 1J0XO 4PN3A 3STHA 4J1QA 3BA1A 1XG5A 4MVJP 4KTVE 5JMWA 4H3VA 4OYRA 4J2HA 1GUZA 4YQZA 4E21A 2VHWA 3DOCA 3RVDA 2GASA 4NK4A 1UAYA 3WNQA 1EFLA 4E2ZA 1PJSA 4PZDA 2YFHA 4RVUA 2O3TA 4WOJA 4Z0PA 5T57A 4KQWA 3WDSA 3JD3A 4EUFA 2QZ9A 5AYVA 4J7CA 2X1HA 1YJQA 2P4QA 1SB9A 2C2XA 5IAAA 3GGOA 2GN9A 2AQ8A 4HNGA 2J3HA 2AHRA 3H7AA 4CMHA 5KKCA 1LDNA 3O26A 4R41A 4TRNA 1PS0A 1N9GB 3QLJA 4IS2A 1ORRA 2GPTA 1VE9A 3KYCA 4BKPA 3QVOA 3I9NA 3FTPA 1OAAA 1U28A 1UXGA 2OO5A 4J43A 4W9NC 4YT8A 4HWKA 3WGZA 3PIDA 4QX6A 2P9EA 4YJFB 1K5HA 4JK3A 2YV1A 3GEMA 3Q0EA 3HDHA 5U9CA 1Y8RA 1P77A 6ADHA 3WOHA 3PWSA 3Q2IA 1DBVO 4TWRA 4UREA 4YYZA 1A27A 1Y6JA 4JNKA 4LVUA 5GZ3A 4MPDA 5EL0A 4BO7A 1BXKA 1ENYA 3WWYA 3NX4A 5A9SA 2CVQA 1H93A 4CUKA 2PKQO 4JBGA 2VQ3A 4PLTA 2CDBA 2Q45A 2FZEA 4WKGA 5EQDA 1P1FA 2WM3A 3OSUA 1EVYA 1DC6A 3RUDA 3OA2A 4BQPA 4FD3A 5MGBA 1LRJA 3VZRA 3HZZA 4YJDA 1E6EA 2IYOA 5DOVA 1ZK4A 3EZLA 2RBEA 1Q7CA 1G0OA 3QV1A 3L4SO 1UJMA 3ZW8A 4B8ZA 4AJKA 1YBAA 4Q3AA 4JX8A 5DT9A 5KJ6A 3I4CA 3VPSA 4BNVA 3K31A 1Y81A 1A9ZA 5L3ZA 3I6IA 4LRSB 2ZATA 3JD0A 1HE3A 3GUYA 2C29D 4OL9A 4RJTA 1DFGA 2PGLA 2Q4EA 5JDIA 5T67A 3LF1A 3PRJA 4HUJA 4J2OA 2ZYGA 1EUDA 1DHTA 3DXFA 1Z74A 1BVRA 2Z5LA 5B12A 1R12A 3WFJA 3W8EA 4ZN6A 4G2NA 5AOVA 2GLXA 1UR5A 4LSWA 2VUTA 4CMEA 2Y05A 1OZAA 4QO8A 1H9BA 5I7SA 2VWHA 5KCZA 1QYCA 4FW8A 4MVJD 1LSUA 1ZZEA 3HE3A 3KO8A 5ER9A 1P44A 5L51A 5FYDA 2W90A 3QP9A 1FDUA 5B4VA 4I9NA 3ZWXA 1P33A 4N54A 3V1UA 4O59O 2DM6A 2UAGA 5TQVA 3PPIA 5JAIA 5EINA 2UDPA 3NT4A 1GYRA 1R4MA 3OIGA 3OJLA 4TRJA 1T1SA 3U4DA 3WGOA 3Q3CA 4GMGA 1C3VA 3BMNA 2Y0DA 3I1JA 1PWXA 4HFJA 1UAGA 4YXFA 3AK4A 1PGOA 8LDHA 3OJFA 1XQ1A 4B79A 1DIGA 1H6CA 1NPDA 3G1UA 2X0IA 4PZCA 1BHSA 2QYSA 4D3DA 1XQ6A 2PK3A 3K6JA 1W73A 2UYYA 1HE5A 5IF3A 1TEHA 1MX3A 3EHEA 2PD3A 2EXXA 2Y1OA 3E82A 4EITA 2FR0A 2I6TA 1DXYA 1V3VA 2X0NA 3IQDB 2PH3A 1W4ZA 1C1DB 4OH1A 4ZQHA 5JCJA 3H5AA 4P22A 4GLLA 3AOGA 4B4VA 3I4FA 4XJTA 1PZFA 1WDLA 1KEUA 4ESOA 1EUCA 3HNPA 3TOXA 4AJIA 3GG2A 3CH6A 4L76A 4GAEA 1N1GA 4S1VA 4G65A 4GBJA 3WSVA 3ENNA 1PR3A 3WICA 4K9DA 3ICCA 3I23A 3ZWBA 4XR9A 3SC6A 2Q2WA 4DYVA 2EKQA 2I3GA 3GA0A 1D7OA 1V8BA 4IUYA 4AICA 3OECA 4IQ0A 3NGLA 3JCZA 2E37A 1VL6A 3JYQA 3EY4A 5THQA 2DPGA 1CDOA 2ZJ0A 4Y8VA 1U8FO 4IZHA 3JQBA 4NI5A 2FSVA 3E48A 4A27A 4Z6KA 4R5HA 3PYMA 5FWNA 1PJCA 1I30A 4G81A 2O4CA 1BXGB 3DMTC 3PLNA 1E6WA 4Q3NA 3BHIA 2OMEA 1E5QA 4AJNA 4BMVA 1X7DA 5A05A 1KEPA 4R1UA 2G82A 4UULA 4WLFA 1B3RA 1U8XX 4TSKA 4CUJA 1F8FA 1YBMA 4CQMB 5A3VA 3G17A 1G0NA 1ZK0A 3DOJA 4F45A 1SC6A 1LJ8A 1M75A 4PFJA 1T2DA 5JPIA 4DTIA 1NR1A 3AI2A 3RC1A 5JAZA 1NXQA 1O5IA 1PTJA 1XWFA 4GSKA 3ST7A 3VHRA 2FWMX 3E9QA 4YRDA 1YB4A 1AGNA 1V3TA 2E6UX 2ZJ1A 3JQ9C 4JQCA 2O2YA 4PRLA 1UUFA 3V1TC 1UXIA 3WB9A 3TZHA 1YGYA 2DPHA 4L75A 5F5LA 5LCXA 4BNTA 5ICSA 1YBVA 3DWFA 2Q1WA 1E7YA 4I5DA 1NAIA 1I8TA 3ZWAA 5JNLA 2Y1CA 4ZQBA 3N7UA 3QVWA 4NU5A 3GY0A 1HL3A 1NR7A 1MA0A 2BRUA 3TDKA 4H7PA 1T1RA 4RF5A 4BS9A 3HDQA 5I9LA 3PHHA 5IDYA 4OXKA 5KKAA 1SAYA 3FNEA 4WNCA 1U4SA 2RH8A 5BSHA 2PY6A 3PGXA 3PYLA 1WXDA 1LLUA 4YRAA 1UZLA 2HK9A 1VI2A 2O3RA 4I5GA 3GRPA 1A9YA 3QE3A 3OF2A 3VZSA 2IODA 5AXCA 3JQGA 3K8ZA 1DC5A 1F06A 3DONA 1QRRA 5L45A 1PGQA 3GDGA 4NJMB 4YA6A 4A5OA 1N8KA 3OJOA 2BFOA 2X5OA 1HT0A 4MO2A 3NUGA 2D0IA 2EGGA 3GMDA 2ZYAA 4BB5A 4YVFA 5COAA 2WD7B 1TI7A 1P1IA 5DCWA 4P38A 3GF4A 4WK6A 1NASA 1KC3A 1SNYA 2EWMA 2O3QA 2E4AA 4K6CA 4KZPA 1VPDA 5T8KC 4MDHA 3TZKA 4XR4A 1C0KA 4MVJF 3L4BA 1MP0A 1HEUA 3K2BA 3SC4A 4R5MA 4BGIA 1K6IA 1ZFNA 1HWYA 4WGGA 1LXCA 4XDZA 4FJ0A 2AQHA 3ZNQA 3AUSA 4O5OA 4AJEA 3CMMA 5ITWA 2VTEA 4Z9XA 1FXSA 5L7TA 3B1FA 3CIFA 4CODB 1DEHA 1MG5A 1FDTA 2CD9A 3OJ0A 4IQGA 3H4VA 3WXBA 4FDAA 2PFGA 2Y67A 4MP3A 2BFMA 1ZO8A 1MFZA 3EVTA 1BXGA 4E5MA 3GC6A 4TZTA 4AVYA 4IMRA 3GDFA 3AM3A 5HS6A 5IZ4A 2J5QA 1A4UA 4W9NA 1X15A 4GKVA 3KHUA 4II3A 1LSJA 4E5PA 1B8VA 1LX6A 4FSHA 1LUAA 4CQMD 2JJYA 3PHGA 2JCVA 1JWAB 1R0KA 4CQMA 5BSEA 2HSDA 5CEEA 4BO9A 4URFA 4EBFA 3OIFA 1F17A 3U5TA 4CL3A 2J5RA 1I32A 4E31A 5L7WA 4LGVA 3NT2A 1T2AA 4XJSA 1Z6ZA 4GQAA 5B37A 4FB5A 5B4UA 2O48X 2GZ1A 3ROKA 3DBHB 3QRWA 4L73A 1NQOA 5JAMA 1SCUA 1DAPA 2NQTA 1CETA 5HBRA 3T4XA 3U49A 4WE3A 4FGWA 2PA3A 3ZI0A 4JROA 3UCFA 3GOHA 2I99A 4YT5A 2C5EA 4BOYA 2AXQA 3D1LA 1WVGA 2Q1UA 3FPLA 5T64A 4HFRA 2ZTMA 3FR8A 2PZMA 1PZEA 2W2KA 4XCVA 1I3MA 2P4HX 4Z0HO 3GZNB 5BT9A 1WDKA 4XYMA 1UDCA 4XB1A 2EF1A 1TT5B 2WWRA 4NR0A 4CLDA 4W99A 2EW2A 4MIOA 4ND3A 3TFOA 3RAJA 4IJKA 1DFIA 1XYGA 2QQ5A 1W8DA 1DJQA 4CLXA 1I3LA 2VRCA 1EK6A 3VZQA 3L6OO 3M2PA 3ONEA 4CQLB 2GUGA 5IXYA 2YHIB 1X1TA 3VKUA 2I3AA 3TZQA 3SXPA 4GH5A 1DDOA 2HK8A 3ZU5A 4OSOA 2YZ7A 1Y5MA 4MOWA 2JHGA 4R01A 4NJMA 5ILOA 2HJRA 5I7VA 4Z9YA 4M89A 2FR1A 1BWSA 2H6EA 2RCYA 2OFPA 1DIAA 4LISA 3AY7A 1K6XA 1B7GO 2W4QA 1UXHA 2G76A 5JC8A 4RDIA 5DP2A 4YT2A 4N5NA 1H2HA 5FEUA 5JDCA 4YWJA 3D4PA 2JD1A 1VJTA 1DO8A 2HJSA 4B7CA 4CR6A 4E6PA 1HYEA 1BSVA 4N18A 3D5QA 4YEDA 2AQIA 4QUKA 4IMPA 2EEZA 3LU1A 4YB8A 1U5CA 4XYGA 4C4OA 3ABIA 3GVHA 1G1AA 1I2CA 1VKNA 1XGKA 4KOAA 4WEOA 2EKLA 3RBZA 4CMAA 1WLYA 3F6YA 4W7IA 4CM9A 2BI7A 5AXAA 1KY5A 1RPNA 1HLDA 4BKRA 4D42A 4R1TA 3DEYX 1NWHA 5H81A 3OHSX 3PLRA 1BRMA 1EDOA 5TX7A 2PZKA 1ZVMA 1H6AA 2CSUA 5CP8A 5JE8A 2H63A 3QA9A 5ILGA 5JBIA 2FN7A 4QECA 4FCCA 2BELA 2VCYA 1UDBA 1YONA 3CINA 2VT3A 1TXGA 1NVGA 3IP3A 2HKIA 3F4LA 3ZDFA 5IXSA 4RQUA 4M86A 3ITKA 3DMTA 3TQHA 3K73O 5CG1A 2NVWA 5DULA 5I8ZA 4GI2A 1TB4A 4RPJA 4YJHA 1NQ5A 4IDAA 3RC7A 5JY1A 3IUSA 2CF6A 5F5NA 3S2IA 3WG9A 1BG6A 1CRWG 2VOEA 4E2YA 3GAZA 3MJTA 4UVDA 1HYHA 2ZQZA 5TF4A 1IPFA 2VHZA 3NDRA 2PGDA 3O38A 2JFFA 4R1NA 4D79A 2GSDA 3S8MA 1I01A 4UEKA 1PJ2A 4BNZA 3F9IA 3IKVA 3QWIA 4R68A 2UV8A 4DC1A 1NHGA 3TSCA 5JMPA 3ZWPA 3WIDA 3E6AA 1KYQA 1PZGA 4JBHA 2ZKLA 1GU7A 2CDCA 2W2LD 5G4KB 2BGKA 3IJRA 2E49A 2W2LA 2AA3A 3IAHA 4HKTA 1B8UA 5A9SB 1HDCA 1X7GA 5F3RA 4LSMA 3KBOA 4P4LA 4CM5A 5JSFA 1D1TA 3JQ9A 2ZYDA 4ZU3A 1R0SA 2HMVA 1PEDA 3PQDA 3SVTA 3TNLA 3NTRA 4J6FA 1PQPA 4PVDA 1HRDA 1ZW1A 1ZKMA 4H15A 5TSDA 2YHIA 1P9LA 1I33A 4CQLA 3RUIA 7ADHA 3U09A 4CR7A 3EDMA 3OEWA 4IM7A 3UCXA 4E30A 4CLEA 4F6CA 1XU9A 4IJWA 4W7HA 4IXWA 3K30A 3LC7O 1E1KA 4BNGA 2B37A 3B20A 2X5JO 2CUKA 1R37A 2NTJA 3EMKA 1HDRA 3H9UA 1GEGA 2YW9A 1GDHA 4YDRA 1XDWA 3WTCA 1X1EA 1JKFA 3GPDG 4PLWA 4WLUA 3ANMA 5C5IA 2VYND 3GAFA 1D1SA 3RCBA 4BMSA 4CV3A 1ZMTA 3ZWMA 1HDZA 1E1LA 2GD1O 5L53A 3K2EA 3WQQA 1E3SA 4QTZA 5G0VA 1SEVA 3ITDA 1ZJZA 2C2YA 1HLPA 2B83A 2Q4BA 1GV1A 2ZQYA 3O9ZA 3RC2A 2RAFA 4JN6B 5B1YA 4RQTA 3VDQA 4RGBA 1LC0A 2Q2VA 4ONEA 1YL7A 4FPXA 3U62A 1NTOA 2P91A 4BNMA 5I7FA 1YWGO 3ANNA 3ZWYA 2JAPA 1ISMA 1ADBA 4CV2A 4B3HA 3HUDA 3UICA 1HETA 4BNUA 1R66A 4CV1A 5ENVA 4AJHA 1NVMB 5T8KA 5ER6A 1NFFA 1R4MB 2HQ1A 3PDUA 4BL5A 4RPKA 4AFNA 2EV9A 3RWBA 3U4IA 4W6ZA 3RUEA 3BMNB 4U0JA 4J16A 1EMDA 4RVGA 3SEFA 2I5PO 1LBEA 5A5FA 3O8QA 1KY4A 2DAPA 1KC1A 4A0SA 4RVDA 4EJ6A 2EJWA 3GHYA 4Q3CA 2EW8A 3L9XA 3NV9A 4WNIA 1NPYA 4YCAA 4RPGA 3HHPA 3GFGA 3M1LA 2WMDA 5TJHA 1H0KA 3JYOA 2C54A 1HKUA 3A28A 3JQCA 2X23A 3N58A 2WYVA 1E3IA 2EJVA 3B1JA 3PHIA 4BUCA 3WNVA 3HQ4O 4YAIA 2JKVA 4O63O 2OBYA 5KJ1A 3LT4A 4K6FA 4BNKA 1B3BA 3HDJA 1E1MA 4GWGA 2OHXA 5A9RA 4LVCA 2POQX 3GN1A 3MTGA 1QR6A 3DZJA 4HY3A 4TROA 4HV4A 1WWKA 1H5QA 2WDZA 4BNFA 3GRKA 5FFFA 1LU9A 1XA0A 5DBFA 1X0VA 1V9LA 4IDGA 2JD2A 2NVUA 2XXJA 3AFMA 3FCOA 1A71A 3QVTA 1BGVA 4BO1A 2IEBA 4L74A 3PP8A 1L1FA 2YUTA 2VHVA 3TN7A 5F1PA 3ONFA 2O3SA 3CXRA 2O4UX 1JW9B 5G4KA 3HG7A 1ZXLA 1O8CA 4XKJA 3WGGA 4AJ4A 5GZ6A 4A26A 1P0FA 1VJ0A 2H1SA 4O6VA 1T2EA 2NQ8A 3H8VA 2BMAA 4XQCA 3DHYA 1ZXBA 1E77A 1M76A 3RD5A 3DHEA 3L07A 2IXAA 1XHLA 4OMUA 1CIVA 1X13A 1GYQA 4D43A 3BMOB 2IXBA 2PTGA 4ZQFA 5T5QA 4CM3A 3BTOA 2CVOA 3PGJA 5DDIP 4I9UA 4ROSA 4O0LA 2V6FA 3G79A 2B5VA 4KMSA 3RKRA 3DL2A 4S3MA 4UVGA 3AUTA 4QSMA 3GT0A 1YKFA 3D4OA 3WSWA 4I9HA 1SMKA 1KVUA 3OMLA 1UP4A 1IZ0A 4Y6SA 4N5MA 5JYDA 2F1KA 3PJEA 1SZJG 4ALNA 4GWKA 3DDNA 4JP3A 4EYEA 4ZQGA 4YAGA 3KETA 2EP7A 3TWOA 1BMDA 4Z3KA 3EK2A 4E13A 1QYDA 3A1NA 3WQRA 4D3SA 4DQXA 3Q11A 4ALLA 2I65A 4H16A 2VWQA 1HYGA 3JQAB 1NQAO 1F8GA 2BD0A 2VUSA 3OP4A 4J4HA 4ZD6A 1B26A 1EBUA 3RROA 2AG5A 4Y98A 3W4JA 2X22A 1ENOA 1K2WA 3EC7A 4HXYA 3PJFA 5AVOA 4ZICA 3NAQA 4X54A 3IL2A 1P31A 2J3JA 3INTA 3PYXA 4Y6PA 4J1NA 3S2GA 3E9NA 2DBZA 1IE3A 2VHYA 2C7VA 1PL6A 1EFKA 2QRKA 1AUPA 3UVEA 3ZWWA 1DC3A 3GFBA 2NVBA 2Z1NA 4Q3DA 3UCEA 4CMIB 1VRWA 1A7AA 2Q2QA 3JQGB 1N92A 2GDZA 3PJGA 4KDFA 4JP2A 4AJOA 3OEYA 1YE3A
chains in the Genus database with same CATH superfamily
1RR6A 1HSOA 2PS9A 2AMJA 2XOKD 1U2DA 3EULA 1MOZA 2C8JA 2TS1A 4LCEA 4DQ0A 1BJKA 1KO5A 1NUSA 1U2RA 3IUPA 1GPUA 3W4IA 4MV8A 3IJPA 1JQ3A 1FYEA 1M8PA 4P36A 4WCVA 5GGYA 3A6KA 3H5LA 3ND6A 5F5XA 1J6UA 1NU8A 4OUDA 1XZMA 4Q05A 5EJ2A 3RGGA 2IJGX 2G9VA 3FSJX 3NBQA 1I3OA 3B1VA 1GIAA 1UBJS 1ZNXA 4Y2VA 2IGBA 1QYVA 3NC4A 2F17A 3H5VA 2GT1A 1DHRA 1JA1A 5AK5A 4ALIA 3QWHA 3F5DA 2FY8A 3GA5A 1JNXX 5J1SB 1JHAA 4A2WA 2WYIA 4X6XA 4UTPA 5JHHB 5AVXA 3PQFA 4C7XA 2M9MA 3FPHA 1FUIA 3WK5A 2HT6A 4JR0A 3ZD8A 3Q6IA 3BILA 1ZNQO 3WWEA 4UBOA 1OQAA 4GXQA 4MR9A 3G89A 2COKA 3PX2A 4TRRA 1K63A 5DX8A 5JALA 3MILA 4PLYA 1E61A 1DC8A 3C3KA 3G2JA 1MO6A 4JJKA 1Z7EA 5C8ZA 5FBVB 1JXQA 5L8VA 2ZR7A 1XAHA 1R0ZA 2I6QA 4WZBB 3MWGA 2I7CA 3WLKX 1F0YA 4U2DA 2WM9B 3FCAA 4Z86A 5CB4F 4PLGA 4A3SA 4BNWA 4QM6A 2OPBA 1OLOA 3EWIA 4XB2A 2GRJA 2R7MA 2V54A 4OP1A 3VPAA 1NN0A 4KIFA 2ZB3A 3GCZA 5KX5A 1CB0A 3OZBA 4MRNA 3AESA 2AUMA 3DDSA 4I0WB 2F2TA 1UPXA 4XDYA 4LPKA 2NSLA 4DJ5X 2EF0A 3OLYA 1JFRA 3IQXA 2JBAA 4LTDA 3SE0A 4HLDA 5CK5A 3MJHA 1QQ6A 2YWXA 4LDZA 2Q07A 2VP9A 3WAKA 2QVCA 2H9YA 1PVDA 2VZ9A 5LA6F 5F4BA 1RHQA 1ATIA 2QAGB 3DOEA 5ALNA 4GQIA 4A9AA 1K3FA 2R1UA 2QRQA 1JDNA 1BQ3A 2Q99A 1VJGA 4H0FA 4JEHA 4R1MA 1ZC3A 5FPHA 3OE5A 4O2BF 5EIEA 3TJRA 5KTOA 4HX5A 2AMFA 3SSNA 3TZCA 4HAUA 4I3GA 1UK7A 4DLRA 1QQ5A 2JRCA 4YTEA 3TIVA 4BO8A 4C2BA 4CM8A 5CAEB 1HG0A 1YS7A 3NTLA 4GZLA 4I6JA 5BV7A 3AL0C 4XD7D 4HYEA 4FHCA 2HO5A 2PGXA 2AK3A 2VG8A 3AR2A 3I8XA 3QQPA 3QBDA 4FNMA 3KHTA 1D4AA 1AC5A 1F51E 4B5KA 5IU6A 2XA1A 3RVPA 3MLEA 4TX1A 3KC2A 3INGA 4Y1EA 3LQKA 3W8NA 3AF0A 3I64A 1I7PA 1Q0UA 3ZHUA 1EX7A 2QAJA 4PG8A 1BOFA 4BCDA 2R47A 3MJCA 1QXSA 4PYLA 1NN3A 1Y4UA 2M1ZA 2P6MA 2QE7A 3E35A 5IUNC 1BHO1 2ZQ5A 1VYVA 1H6DA 3JQAA 4F2WA 3EQ9A 4HH3C 4U7GA 3VBEA 1UDWA 1KK0A 1Y9DA 1AXGA 2VK1A 4O2AB 5DM60 2YOFA 4AKHA 1C0IA 1QK3A 4QWMA 2B7CA 3WYCA 2CXQA 3MMPA 3NWBA 1PWYE 5JLAA 3WYDA 1FMFA 5IFLA 4HVLA 2RGCA 1DQRA 1GSHA 2IIPA 1QV6A 1SQFA 2VDRB 3Q2KA 1EFCA 3L1KA 1Z0SA 4LNUA 4RA9A 4LX8A 1NVEA 2AR7A 2VH1A 4WNAA 5HF8A 2YNMD 3UJAA 2O8BA 2A3NA 3H9GA 3IXQA 1E2KA 1SXJA 2H0RA 3SX4A 4DIFA 1DKOA 2R44A 5K0GA 2XQVA 4IXDA 1M74A 1RXYA 4OJQA 4ZANA 3RS0A 4AI6A 5JROA 1GAEO 3GARA 4IYJA 3RT1A 3S1SA 3WLLA 3KEFA 2WU8A 2W6ZA 621PA 2C3OA 1SBHA 4Q39A 2IEYA 2Y99A 3GLGA 3KCQA 4X65B 1E9DA 5D1HA 5FPPA 2J0QA 2VDVE 2GBLC 3THWB 5E2BA 2DVMA 4ZAXA 4DLZA 3UKOA 3BD9A 1I5OA 4II2A 5LQNA 1V6SA 3ZOZA 1WM1A 3H3FA 1P2DA 1HZZA 3LXRA 1VPVA 2F3QA 4LY0A 4OG2A 1FC0A 2XIJA 3PXEA 4KDRA 4Q48A 2J46A 5DGCA 4V02A 4WJKB 3MF4A 3RASA 4JJ8A 2O2IA 4ARZA 5A4MS 3BGOS 3LHDA 2XCSB 3PA6A 4J07A 4OB7A 4JV5B 4U63A 4FT4A 3ZBPA 4UAUA 3U17A 2VN8A 3RBAA 3B38A 1UXKA 2FX3A 2X0DA 1RKVA 5AK0A 3SQWA 1MLDA 5CXXA 4MCAA 3RTAA 3WK6A 2FFHA 2IYFA 2R3SA 5LDGA 3BE6A 3G49A 1X2EA 2PZ8A 4V0RA 5JOQA 4L02A 2VYVD 3PEFA 4R81A 1RXUA 1XLVA 3LYAA 3CUEF 2XBUA 3TR5A 2XODA 2ZRHA 3F46A 5KJCA 4TSFD 3ETEA 3KSMA 5C1BA 1B15A 1GKIA 2BBTA 1Y33E 1WMAA 2XXBA 2VF8A 4KGDA 2DUWA 3DO5A 2RAVA 3QNMA 2NADA 1C0LA 2V0CA 3E2MA 4UE3S 1NM5A 1E7SA 4OI1A 2BGLA 4NABA 1NOKA 3TOVA 5LKRA 3ZXYA 4EDFA 5ALXA 3RI3A 4ZYWA 2WG1A 4XLLA 1GZDA 1YQEA 2DKNA 4PTYA 1XDUA 2BEVB 5DM2A 1RKXA 3D8RA 1DG9A 1U0OC 3GJ0A 2YQZA 1FX1A 1D04A 4CM1A 3LZDA 3UWMA 4D4KA 1VA4A 1ZJ4A 4FZ3A 4QU0A 5I3ZA 2FPSA 3SG0A 2WJWA 5JJKA 5J5VA 1I1HA 1ZU4A 5K8JB 1QAQA 3EIFA 5KU7A 3FZNA 4KWIA 2ZJAA 1LZKA 1XMVA 2WSBA 2VNJA 2C20A 1IQ0A 4AKGA 1GO2A 2R5WA 4FE4A 4M46A 5F1KA 3ESZA 3DZKA 1PYOA 4F96A 3PNSA 4BZWA 4TXMA 4E3WA 5JADA 3PR2B 3K6KA 1Z2CA 1BH2A 3ZBTA 3D4NA 4FK8A 4DANA 4N5LA 3TW6A 2EGUA 1JFLA 1PJRA 2BE7A 1DV2A 4RIFA 5F1YA 1BA2A 3ER9A 1Z07A 4N82A 3X44A 3GP8A 2X4GA 1PQUA 2AEFA 2MMCA 5EHXA 4G8DA 3RIHA 1XEXB 4WUTA 2I3DA 2R86A 3N2IA 3AG6A 3QH4A 3V8VA 5AESA 2YIDA 5DRYA 1WCIA 4QGAA 5HF6A 2AQKA 1H2XA 3H6GA 4GP6A 4GPBA 4OXIA 3T38A 2F43B 3GU3A 2COUA 4AK9A 3FWZA 1CJSA 2JHFA 1E8DA 4R4JA 1HKHA 2A35A 4YJKA 2WLSA 5EQFA 4B8YA 1EZZA 2A5LA 1F12A 5TARA 3WIEA 4DIDA 2RK3A 1U98A 1U9IA 2FGKA 3OJEA 2X4IA 4TM7A 1L5HB 4RTRA 2ZB4A 1JLKA 1XLTC 3DHNA 5JMTA 1UBTS 3NOQA 1GTSA 1VXOA 1KI2A 3ABZA 3I9V1 1XELA 1SOAA 4HEA1 3GEDA 2HGZA 1QIKA 3I9MA 3GDOA 5TQJA 2Q3LA 4GOKA 3NT5A 1UWLA 1M1ZA 2GFIA 3P7MA 3DAFA 3OEEA 1AM4D 2Q46A 1BWRA 3JASB 2DHEA 2PKXA 4MUHA 4JB2A 1KS9A 3BGWA 5DNWA 4UUBA 4F92B 1GAQA 3VNAA 1U3CA 2WAXA 3F5FA 3LECA 4OBBA 3AUAA 5A7GA 1FFCA 3E5HA 3O90A 3OPQA 2AC7A 2ZG6A 4IHAA 4Q4HB 3RF6A 3TZLA 5A3RA 3O0TA 3AVPA 1Z13A 1CS0A 4UUOA 2B3TA 5B4TA 3AJRA 2ZUFA 4F7DA 1KJWA 1WPQA 4F2HA 4L27A 3FDJA 4AMUA 2WTEA 3T12A 3A6DA 3FMPB 1S2GA 4D3DA 2QMUA 3E7DA 2PQ0A 4WXHA 2FPMA 3O82A 3LZCA 1NRJB 2IYLD 2MSEB 5FV7A 5HM8A 3UGQA 1KPIA 1S6YA 1YO6A 3HK2A 3FRIA 3DL0A 3E4DA 3EBLA 2X58A 2NV0A 2LTAA 1NC3A 1FFHA 1UBEA 3PFFA 1QX3A 2W0MA 3WBJA 4J90A 4TKVB 4FFOA 5ULLA 3FSGA 2OQVA 3F4KA 3OFSA 4DV1B 3UXMA 3UGTA 1BMQA 1DMRA 1WG8A 1CQXA 4PG5A 1N3YA 2MMGA 4XZ3A 1V1MA 3SC2A 4KUGA 4YV2A 4V1CA 3ZV4A 3ZU3A 4QT0A 2B2CA 5GZ1A 4JIMA 2R6GA 5JZVA 2C97A 1B2RA 4GM1A 3SZMA 3UJCA 1CJCA 1ZJYA 4FHZA 4K9LA 3HEMA 4YJGA 3OD1A 1Y7TA 2FWNA 5KMGA 4DLBA 1DCMA 1ECFA 3KUDA 3EC2A 4X8LA 1GTMA 1R4ZA 2P6RA 5IYZB 2ZAOA 3EOAI 4GKKB 2SNIE 1HFKA 4CIVA 1O0SA 4LY3A 4TT8A 5FKJA 5BYAA 4D9NA 2XADA 2ZYTX 2XNJA 1VL5A 3VTKA 2C58A 3TLMA 5JSZA 1A77A 5C5DA 1Q0HA 4H1HA 4O1MA 3F6BX 1PV4A 1JSXA 2JBHA 3WGJA 4E03A 4Z4IA 4TWZA 2WKWA 3FE2A 2L17A 1E6MA 5CYOA 2HBZA 3OETA 3RU7A 5EIBD 1GGFA 5CDYA 1ORIA 4BMZA 1RQPA 4P1ZA 3LUCA 3DEFA 4A91A 2QP4A 4DBVO 4D8XA 7GPBA 5EIFA 3B3AA 3T7SA 1U9CA 1SUSA 3E9RA 4REQB 1XQ9A 5G2OA 4BN0A 5KOYA 1MV5A 5EZYA 3P2EA 4OK3A 1WXFA 3M0EA 2P9CA 2XRFA 2GN6A 4YP0A 5CG2A 3VZBA 1NBOA 2V9CA 2GMWA 2C9BA 1Q77A 3KZVA 4RTQA 3ILYA 3FFTA 1T9GS 4KN9S 2YHUA 5CT6A 3W6UA 1KRWA 4B87A 2VBGA 3EVNA 1DPGA 1HO3A 5TQ2A 5I9TA 1BKDR 4IIDA 5TE9A 5G0UA 3NRBA 1DWOA 1O6FA 4LK3A 3DXZA 3LWBA 4FZJA 2R2GA 2B0CA 1U2GA 1YDHA 3ESXA 4IQFA 1G8SA 3K5PA 3Q72A 4Z9BA 2ZYHA 2HADA 4IGKA 4MEBA 4O4HF 3S28A 5A4JA 3OCVA 4B83A 2AVDA 5FB3A 2NZJA 4I5EA 1IBLB 5L3SB 3DLPX 4F21A 2V5AA 2PAAA 3EXHA 1DQNA 1EXNA 1TTTA 3HN2A 2PWYA 5BSWA 2E4WA 3DAHA 4E2XA 3R2JA 4P86A 3JQBC 3DTVA 4IVQA 1QH9A 4JA2A 4UUMA 5JC1A 4YMGA 3DDCA 4MA4A 2QSUA 4RTPA 2FEPA 4XGRA 2JVIA 5KHAA 2OV4A 4JI6B 3WV4A 2DSNA 2R00C 3UQZA 1RFGE 4CN8A 4KKXB 3DOHA 4D1YA 1S02A 4NONA 4FYWA 1I7DA 2HBYA 4R9NA 221PA 1OKKA 2FEOA 2DBVO 2WPDD 3KJHA 3W6ZA 1TM4E 1XFDA 3AR4A 4GQBA 2CXHA 4FFNA 1TKAA 3RIMA 3E03A 1GPNA 4CKCB 1ANKA 1WAMA 2Z6AA 1TA9A 3FNGA 2AYZA 4WZZA 4YAEA 1J49A 5CGZA 4LCJA 4L08A 5F73A 4DR3B 3RRBA 4D46A 2AJLI 3DVSX 1I6WA 5ENDA 4G5XA 4KITB 3MBIA 4FX2A 3VOTA 3MMXA 2IT1A 2HPZA 1WDMA 4PR0A 1V71A 1T2NA 3LUBA 2WTAA 1PTJC 2HEGA 2FXIA 4N0DA 3HTXA 1OI3A 3WKAA 3GD5A 2D5AA 5DTQA 4B3DA 1PGPA 2E9SA 3GPBA 5G0SA 1RJWA 2EP5A 4KMMA 4WEQA 5C8YF 1XRRA 1VLLA 3VH4A 3J81A 1M7BA 2RHOA 4G1UC 5A03A 5A5VA 5KOJA 4L22A 3U3ZA 3ISJA 3OWOA 5CA1A 1BDBA 1YZHA 1CJKC 2VNIA 5K1ZA 1TA4A 1X1CA 4RD3A 5JYCA 2DBQA 3ACDA 1IZ7A 5TF0A 2CHVA 3QY9A 4B1FA 2QYHA 3SX0A 2CL6X 2HK7A 1SPBS 3JQ8B 4G0PA 1OW3B 2I2CA 1Y8CA 2BT4A 3JWPA 3LK7A 3RNOA 2W6NA 3GGJA 1SQ5A 2R8BA 4Q9DA 1W34A 4IS3A 3WGMA 2I67A 1G41A 1NIJA 1O4VA 4KWEA 4JOBA 2H4JA 2OHGA 1Q14A 4EF4A 3OVMA 5EP4A 2YS7A 3K6SA 2EZ4A 4A4DA 4N5IX 4K03A 2AFHA 2BFBB 3X1MA 1WXHA 3DF9A 2EX0A 3L0YA 4MWBA 4NG5A 1PKEA 1Y3BE 1AHPA 1K88A 1N25A 4DSOA 3T4PA 4EL0A 3I5MA 1WABA 2GAJA 1LEHA 4Y2UA 4JUCA 1NF3A 2CMDA 4RK4A 4TVSA 2WYWA 2D1SA 1KFBB 2RAUA 3GX1A 1T0HB 5BNIA 2QKYA 4FFLA 4MVJG 3QKRA 2G4VA 3W5IA 3UPDA 4N47A 3DLBA 1HBJA 2W6JD 4PQYA 3UBTA 3IO3A 4GW3A 4QBGB 3NIGB 1E2GA 2DWOA 2MCFA 3MJ4A 2Z83A 2FUCA 1TJ3A 3PD7A 2C5AA 3VR1A 2RHBA 5HKKA 4JJEA 2SKEA 5M34A 4CIYA 1KARA 1TM7E 2CYCA 2PKYX 4LGCA 2RC6A 2VNHA 2Q8NA 3I92A 4HBGA 2FFAA 2JGRA 3SQNA 2YJNA 4KQKA 4D3YA 1CF4A 3W9SA 3I6ZA 4MQ6A 2Z2XA 3C1OA 5NLLA 2D5LA 5HIKA 3O03A 2J3KA 4RKQA 3MWDB 1JHDA 4OUKX 5TC4A 3RUFA 4KE6A 3Q85A 5C5EA 3B60A 4NMMA 5LZ2A 1J9GA 1IJBA 2F3SA 1J2JA 3FZQA 1TOAA 2HJ9A 3NYQA 4UEJA 4E32A 1JYEA 3QELA 2GN2A 1ESNA 2AFIE 3EPRA 5LFAA 2P9BA 3JWEA 3FOZA 1GCIA 1YJBA 3FOAA 2ZIGA 3DDOA 1H2WA 3WKCA 1GZUA 1QTRA 1T3LA 3RHZA 1OLSB 1K08A 1TAGA 2ZXUA 2G04A 1YBFA 1M34A 3CYFA 4PV7A 4JSRA 4LYYA 1HE8B 1HQDA 3A3KA 1HYBA 4IDDA 4UHEA 2OCKA 4ZYLA 1PW7A 1J97A 4G85A 2XUHA 4MKXA 5K2OA 2Q5HA 2AFIB 3GCXA 3GUCA 3P1JA 3P4XA 2J08A 1I1QB 2LNDA 2ILTA 3CLTD 3EFBA 3RJ5A 2QNBA 4LWZA 1G8YA 1MOSA 2PM8A 1R0YA 1JQDA 1QYWA 3M6FA 4Q16A 3DV2A 3CLUC 4C21A 4HUTA 3JQ7B 1X94A 2QN8A 1GKUB 3S5UA 3UENA 3OMWA 4GYKA 3VVLA 2YX1A 4PYJA 1KWKA 3KQWA 5D01A 1YS6A 4RD2A 1PL7A 1CVRA 2OQIA 1YTUA 4U5QA 5EPOA 4OA8A 5T41A 1M72A 1P1KA 5HXAA 5L51A 1Z45A 3CRRA 2XDQA 3JD2A 1H1LA 1IM8A 1I4TD 3WSTA 5GJWC 3L6DA 1KEVA 3VPXA 5IZCA 4YC7A 4UVIA 4C7JA 3ZTYA 1S7CA 3KVOA 4MW7A 1XD8A 4C0BA 5KC8A 1P1CA 3DB1A 2J41A 4JJFA 2J5BA 4KN8A 5LR6A 2FPGB 3IBTA 4KXQA 3CWCA 4PNEA 4JI2B 1RADA 1R15A 2NAPA 5H82A 1E5DA 4I2VA 4W1SA 4AURA 2J9YB 5HE8A 2PSSA 2Q5CA 2O8DA 3GLIE 3CJRA 2VYCA 1EJ0A 3UJ7A 1G7SA 2HHCA 3PTZA 4H18A 4BGUA 1L5QA 3C3EA 3EGDB 1R0RE 3NPAA 4FNOA 4I4TB 4RLHA 4UNPA 1F48A 3LFHA 1QHYA 5ALPA 2X9QA 1AMOA 1LNQA 1QB8A 2ZRCA 3T1VA 2EGHA 2V98A 5DYGA 1XD2B 4FFVA 4CLRB 4Z2YA 5CB6A 4KAFA 5FHRA 2AR0A 4E15A 1LBQA 2B9EA 4G1MB 1W0KA 2PPVA 2GH1A 4WV3A 2Y1FA 3GJ5A 4RF2A 2ZBEA 4A8PA 2WE8A 3GLIB 3HYRA 3TAHA 4AZ3A 2XW6A 2EP8A 3WKDA 4PSUA 5JTTA 4Z7JA 1LY1A 4M36A 1JU9A 3TTTA 3UXYA 5BQXA 5JXIA 3NMUF 1XKXA 4FUTA 1ZR2A 5EWMA 2DTDA 3DKPA 3JTMA 2HLDD 4BECA 1XZQA 1U80A 3QGMA 1JP7A 2Q9BA 2C4NA 2FPPB 4YPOA 5HGXA 3DZDA 4DUGA 2HCJB 1E4YA 4H59A 4HGQA 1ODFA 4FYVA 2RHTA 4TWBA 5ENZA 2DPYA 1JEQA 3NHJA 4JLWA 4MR7A 4UHKA 4B6JA 1L7EA 5HUHA 5HTKA 2ZSEA 1C0PA 4UDYX 3ORFA 1P61B 4DMRA 3FMFA 4BVKA 3NGMA 2M32A 1CEXA 1HQCA 3E3MA 1KZHA 3USES 3RYCA 3C6QA 4BMYA 3ZHOA 3SR4A 1KI1A 1Q3TA 1T4CB 3EFEA 4L4SA 1DFHA 3AKEA 1OJ7A 5JMOA 2JJ1D 4WMLA 1Q12A 1U6IA 4X3CA 1UP7A 4ZEWA 1H23A 3T1HB 3OBBA 3C3XA 4LY6A 3U7HB 4C4PA 4R2WA 1WVIA 4QICA 3L5KA 1SIBE 1QBKC 1UZNA 1LI5A 2J9FB 1AKVA 3IUEA 3RS2A 3G5UA 3OOHA 4KR0A 3ZYCA 4EPWA 2PUCA 4LWPA 4UHDA 1Q0ZA 2VHXA 3B6IA 5EHQA 3RJZA 1C9NA 2GZSA 2Z6QA 4BC1A 4Z9FA 1FFBA 1KH1A 2FMFA 3HZRA 4PO3X 4I3HA 1WCXA 3ROQA 2PWZA 3FETA 2NO7A 3R41A 2XCUA 1Q57A 4JWKA 5DK6A 3CH7A 5AJXA 2X0RA 5G1PA 3KOUA 4BFTA 2V3CC 3RG2A 1TA0A 3D3WA 3AERB 3KAKA 1RWMA 4TTQA 1GD1O 4UU8A 4AG3A 5JJ5A 5JSUA 5FI5A 4MICA 1X7HA 4P54A 2HJWA 1K8ZB 1FXUA 2WJGA 3W2FA 1QGZA 1REQA 1TIBA 3D02A 5LYJB 3OE7D 5DP1A 3GOQA 1IPEA 4QU8A 3RVNA 1RQLA 4DFDA 5BPHA 2UUAB 3HPQA 4GT1A 5EFZA 1BWPA 1FPMA 4LJ9A 2Q50A 4GM0A 1U7XA 3DT8A 4LKRA 2Y71A 1WULS 1ESEA 1ZK1A 1BU8A 2WE7A 1NV9A 3EH1A 2FGJA 1UBUS 1GDDA 1ZUNA 2NSDA 2ECFA 3BMQB 3KUKA 1SBCA 1XF9A 2EJCA 2GBGA 4GE3A 2XUGA 4B82A 1FSPA 4NOJA 1N2GA 2JJMA 4OGWA 2H1FA 4B3CA 1U65A 2AOUA 4AG6A 3FNFA 1OBCA 4B9EA 2RGRA 1W48A 1KDZA 3OLVA 1S01A 5DLDA 1I3NA 5TB5A 5BMVA 5KO2A 5HA5A 3W2EA 4ZTUB 1CVLA 3ADPA 1SB8A 5MN6A 1HH4A 4E5SA 5TGZA 4KH0A 1HG1A 2A78A 3LXMA 4RVOA 5PNTA 4BAZA 5F64A 3LPNA 4CEJA 3BS4A 2GPBA 4KJXA 1X1DA 2HXGA 2HNBA 2VQEB 2D2IA 1IDN1 3SZLA 4DA8A 3KP1A 4G36A 2XUIA 1ML4A 5IAJA 5D6NA 3H1AA 3KOXA 1AQUA 2J4DA 3STXA 1JF8A 4XGNA 4D9MA 2E7ZA 3VO2A 4G1BA 2BGJA 1TYZA 4G3XA 3FHTA 4N0PA 3MCVA 3NP9A 2Y1XA 4QUBA 4R8VA 3FNQA 4CM4B 2H16A 1Q1NA 4TWJA 2A8YA 4XOIA 4N3AA 4FMDB 3AF4A 3EMBA 1UZUA 1GNVA 4OFZA 1HMYA 2VC2B 3QENA 3B1WA 2NT4A 1OY1A 2FUEA 1BXZA 1LDMA 1ZSYA 2SCUB 3W8FA 1H85A 1XP8A 2PG3A 4MQLA 1ES9A 5D3KA 2WB2A 4OAOA 4PR3A 2R6JA 4MVJM 5DZSA 2I76A 1ZWLA 1R6DA 3L4KA 1A72A 4MW9A 4BQEA 1Y8QB 2GNAA 1RYMA 3A26A 4ZQCB 1J2EA 5J4KA 2CMGA 3MG9A 4NKRA 2E6KA 4OBXA 4PHCA 3A4NA 4MJLA 4K1XA 4MS3A 2ODBA 4U8GA 4PYMA 3U37A 1P3JA 3V55A 5BXQC 4A8JB 4EI7A 1PVOA 3ZY4A 3TLEA 2EZUA 3FB4A 4QJIA 3ZU2A 1KJNA 1NVWQ 2FCRA 3BQ9A 3PHCA 4LJSA 2Z1DA 2NXCA 3FHLA 1EFAA 1E6CA 2B8EA 5EXEA 5LP6C 3GW8A 3VR5A 1P1BA 3F6CA 2ZR9A 3C85A 5C31A 5CVTA 3D59A 5FWYB 4EX6A 3IQHX 1Q7GA 3L41A 5ALTA 3R8CA 1GQYA 2Y0CA 1T10A 1EXMA 1NATA 1GNRA 3SZRA 2DFNA 3JAKA 2WWHA 5FOVA 1T4MA 4B48A 2I4LA 3JZFA 4H7HA 5D3MB 1M0WA 3TZ6A 4DCJA 3EPHA 2WSSD 3SE7A 1CR1A 2P67A 3T3NA 1VA5A 4GZMA 2PMFA 5A5EA 4OB8A 1SH7A 3SBOA 5BUZA 4I6GA 1G5TA 3HCDA 2P1RA 3DVQX 5ALFA 2VCEA 4J0CA 2Y1DA 4ODIA 2CEKA 2HF9A 4FOLA 3EVAA 4JVOA 1NX9A 1V3UA 1I0ZA 4QELA 4A1FA 3DBOB 1VCIA 1GGNA 1TVEA 5IN4A 9GPBA 4IIEA 5KKNB 5IDVA 1IY2A 3N76A 1OFVA 3TEFA 4UEWA 3S55A 2XUKA 1CQZA 2NU8A 3LVBA 5U1PA 2V5VA 4K1LA 5JCXA 3TLGB 3ZJTA 3FTFA 3I9JA 1E3EA 5CFZA 4MAMA 1V95A 5CH8A 4E6EA 3LUJA 1A9RA 2YY6A 3V2UA 3TTUA 4BNXA 4HC4A 2CHGA 1MCZA 1A5ZA 2CZCA 2PANA 3LWNA 4U2GA 5DCYA 1PR2A 3SZGA 4BQNA 4IIUA 1LLQA 1RYFA 4NH4A 3W4KA 4DMFA 2ERXA 3CUSA 3E22A 3IS3A 2P3LA 3QUCA 4GLOA 4Q7LA 1O95D 1FP6A 2KMLA 4P3OA 1FS5A 4R9UC 5E1OA 1T8RA 3K9NA 2C7GA 4I55B 4RKYA 2YS6A 1SG6A 4Q3BA 3T7DA 4KQXA 2GRAA 1A2BA 3S2YA 3SJUA 3U3XA 1Q6YA 1VIAA 2CLSA 1G3QA 4WCFB 3UT5A 4OQNA 4CTNA 2C4WA 4KOEC 1XRMA 3LGAA 4I08A 4C3UA 4YUYA 2K5UA 4ZT7A 3TL2A 5HKAA 4BGEA 3B70A 3D7MA 4C88A 4RMNA 3OMXA 1QQTA 3C3WA 3LLVA 3TIFA 3H5RA 2BWJA 2F90A 2H7CA 2Z8ZA 1E8MA 4ZODA 2ZREA 1S1CA 4RY0A 3KWJA 1XAJA 4MV4A 1E62A 4ALJA 1FRFS 1G21B 1OFGA 2WTMA 5G0TA 4BJHB 4C05A 2UUCB 3CH5A 3F4BA 1ZSVA 3PRYA 1IG0A 2PSJA 2CKDA 2VNKA 4F3YA 2GYYA 1A97A 3AY6A 2EKZA 3PDIA 2ZTUA 4MDFA 1YZVA 3KPUA 4HD8A 2NNLD 4NU6A 2C88A 1TU0A 1ZLYA 3W5DA 4D8VA 2BC9A 3EXIB 4DGSA 1YB6A 1Y8ZA 2PMDA 2H65A 3C5EA 2O2DA 1C9JA 3HCAA 4EP1A 3EYAA 1FNBA 4PLHA 2WJAA 2PKRA 2R6AA 5B1HA 4BFCA 3AJDA 4B3JA 2NU7A 1Z2OX 1N0UA 4MRMA 3DHWC 3NANA 4DIUA 3LC0A 4XVCA 4CL2A 4ZAVA 3W5VA 1Z0IA 4QJBA 4F91B 2QNRA 1SOVA 3NETA 3PQEA 4K05A 3M9XA 4GLJA 4C0KA 2CV0A 2Z5VA 4K7JA 1STOA 2BUAA 3LWDA 2VVTA 3A9WA 3S29A 2HXSA 1KGSA 3COZA 3OX2A 3TFQA 1PL8A 1NBME 4TS9A 4MRRA 3T1QA 5L9AA 1M2GA 2O1EA 1Z7WA 4G23A 3LK6A 4GSYA 1Q7RA 3WYBA 2ZUUA 3HJRA 2F1RA 3R5KA 4YMWA 4D4IA 5COBA 4FGJA 2NZWA 5DHRA 1DRUA 1JE0A 1KAMA 1B2LA 4DSUA 4HXGA 3L0DA 2NU6B 3KR1A 4ZV7A 3EF0A 3HFSA 4DCNA 2IDKA 2GRUA 2VQFB 2UYQA 1XQVA 1UC4B 2E4UA 3ZBUA 4D45A 4RGVA 3W8DA 3CKLA 3QFSA 4XXHA 1Y1SA 3C5VA 1EXVA 1B8OA 3AR3A 2Z8YA 2FFQA 1L5VA 3CY6A 1Z39A 2J6IA 2NGRA 3GLUA 2F64A 3HEAA 3QPCA 4PLVA 5JS1A 1I3KA 4UMVA 4RH0A 2LCIA 4IRXA 2H5LA 3WLFA 4A36A 3HDYA 3EZ2A 3TNYA 5A0TA 2H31A 3QW4B 5A1TA 3JZDA 1PCXA 2A6PA 2A7XA 3EQ8A 3L1UA 4R9VA 4F56A 3UMVA 1XZLA 4XIYA 1DCKA 2AG8A 4RZ2A 1Z06A 4QA9A 5JDIC 3KJFA 1P7CA 5H59A 1VFNA 1RWVA 2H4FA 1RWXA 4QBFA 1L0BA 3VVCA 4CJXA 5KTYA 3QFTA 3HNOA 1CYDA 3M6LA 4KR2A 1TK9A 1JTEA 3JW8A 1ODLA 1NR5A 1KXZA 1NF2A 1KBZA 3AIMA 3QFCA 1Q1BA 1N7JA 4J7UA 2GK6A 4X8OA 4E88A 2F4NA 4BB0A 3V2GA 2JFYA 1SO8A 2AZDA 4NYJQ 4E33A 2G8NA 1VSVA 2QP9X 4IJMA 1LBIA 2J5XA 5EJGA 2UVDA 2I2DA 2Q1TA 2VJDA 1NN1A 1H2EA 1QC5A 1RWPA 3GN2A 3P0IA 4CKZA 2IYAA 1DUIA 3HRIA 4A6XA 1ODKA 1TF7A 2IHVA 1R5NA 2E1PA 3DTTA 1CQIA 4DMUB 4FEYA 2JKZA 4DR7B 4CU2A 2X1LA 1E0DA 3T7CA 4BO6A 2G40A 3CM0A 3S2UA 2O6HA 1CU1A 1IN6A 1F2UB 3ABSB 3GJQA 3DE2X 4LC1A 5K0LA 5CDFA 1U3TA 3DGFC 3Q8MA 1JHVA 3MUNA 3DYVA 2RI6A 3N7AA 3QJYA 4MULA 1BEEA 5ITVA 5KQGA 4NCAA 2QDXA 2O19A 4BFLA 1Q95A 3BXFA 4C3ZA 4NIMA 2IFTA 1C9EA 5ECDA 1OB5A 2FH5B 1T13A 2BMEA 1K75A 1E3TA 2J0SA 1TIPA 2MSKA 2I4OA 4CT5A 2CY0A 1TZ2A 1D4FA 3MEQA 4JDPA 2YHBA 5KPJA 1CWUA 4M7RA 3T4UA 2SICE 2WVGA 3NVMB 4OQZA 2GUWA 3N2EA 3V8MA 2WJ4A 4NVRA 2SBTA 1O9BA 3JATB 1ODSA 4A6DA 2Q6KA 3HB4X 3KKNA 2GD2A 1VRVA 1UBKS 3WK8A 1LKZA 1XYVA 2HNKA 3LUPA 1QZTA 5ALRA 5ITZA 5TXGA 1MUUA 3KQKA 1NXWA 5EGNA 1U81A 3D1JA 2QN2A 1ISRA 5C34B 3NORA 1U3UA 2I2AA 2ZBRA 3GIDA 5CFPA 2XMGA 3ZDDA 4DR6B 2VDQB 5TNXA 5K0ZA 1W46A 2ORED 2B4YA 3HUUA 2WVJA 4RHCA 3NV7A 4TTSA 2O2HA 4V0NA 5CW2A 1P1JA 3V4ZA 4YJ2A 1C3OA 1JIQA 1ZMRA 1QHXA 4G5FA 2YV5A 4LJYA 2VJYA 3RS3A 4E08A 1E0JA 1JLLA 2OXRA 4N7MA 3W5JA 3S1AA 5JI2E 1ISIA 4GI5A 4KI7A 3O8OA 4LOLA 3AJ9A 1Y1PA 2FHPA 4H6PA 4D3ZA 2G71A 4DIMA 3RAFC 3BWCA 4BN5A 3ZVNA 1B76A 3VHXB 4D97A 2UZ1A 4KNYA 2OO7A 5KJEA 2ZIUB 3CLKA 1Y82A 1RFLA 1QSGA 4QU9A 2PS3A 3HA7A 1R5OA 3KLOA 4MB6A 2SKCA 2X4DA 1IBRA 1O9GA 1QZZA 1XKLA 3A32A 1OI7A 3P20A 1RQXA 5HX7A 4OSPA 5JQGB 4JC4A 1W2HA 2R2AA 3FJOA 4S12A 3ZZUA 4AX8A 3IAAA 1T4DA 2DX7A 3ET4A 3PEUA 1OBFO 2QD2A 4C29A 4UJ3A 3MGAA 5MGNA 1T5TA 3DBHA 5E6UA 2AD1A 2X5NA 4ERNA 2GZ2A 5EYPA 2HB6A 2C0QA 1ZDMA 3FR7A 4UBKA 2OUIA 3C6BA 5TT1A 1LW6E 3W9YA 2NPIA 3IVGA 3VJMA 5EHZA 3ZE7A 1T9DA 1IYZA 4J91A 5GV7A 2GN8A 4XDGA 5K09A 4RXTA 3AXSA 1SUBA 3PLAE 1RPTA 1XTTA 1ZUHA 1EJ6A 2FMXA 3I1YA 4Z8YA 3KJZA 1BYIA 1G4UR 3VTFA 5ELXA 5IJ9B 3R7WA 4OP2A 1V45E 2BHTA 1QU3A 3CH4B 4GDFA 1FDOA 2IYSA 3RVJA 3E5RA 5A71A 1YR9A 2REOA 4LHEA 3SBEA 2X1VA 3RQSA 2GD6A 3GMSA 3GZNA 2ACEA 3AU8A 3DAGA 2OZPA 2WUFA 2XNDA 3KDPA 2F48A 5FUWA 2H4XA 1BGWA 5HGJA 2ACKA 3S44A 5BRJA 4QPPA 1RM0A 5E6SA 5KYYA 3GK3A 3QEMA 2YJZA 2G7ZA 5EOVA 1TT5A 1EWYA 2AXEA 1KHHA 2YQ5A 5ECYA 1RCUA 4QGGA 3T95A 2NUPB 5KB3A 1WEKA 2YC2C 5DF1A 2IPXA 3R0ZA 5BYKA 6CHYA 4TTPA 1J1ZA 1EFRA 1T5LA 2VDUE 3HWRA 1P5FA 4JCCA 2KBEA 3TQOA 4EZEA 4B6FA 2HWKA 3L6UA 1F3LA 4LS3A 1KTVA 3DZGA 1ATZA 1CNMA 1YJ8A 1ZCZA 2HWXA 2I80A 2JAQA 3A6LA 4JYCA 4AUKA 5C80A 2WMNB 1CCWA 2MWMA 1P5RA 2QLBA 2W2MA 4IDOA 1VKOA 3SNKA 4ZI5A 3FPCA 2IXEA 1XNHA 5ALDA 5DPMA 1LDEA 2KLHA 2QMYA 5DHPA 1A5SB 3FDFA 3AF3A 3HR8A 4ND2A 4WSOA 3N70A 2BDUA 3ZGXA 3UFXA 4BWYA 3UK6A 5CFRA 2GCOA 4YRCA 3RIGA 4BIIA 1ZVQA 1JDPA 5JEDA 4MVJE 2GBLA 2FK7A 2WT4A 3HU5A 3O6VA 1IK6A 3NU1A 1LI4A 2ET6A 5AVUA 4XFJA 3HH8A 4CLOA 1H69A 4JI0B 3P2OA 5AVTA 1HV8A 1NAHA 3PC3A 1SULA 1UFOA 2GO7A 2VYNA 3DA8A 3ZDZB 4RHXA 2XT6A 4D0RA 1BJTA 3TLKA 1WMSA 4K9SA 4TQGA 2DCMA 1U0RA 3DMNA 5FUVA 2OXFA 4KIWA 1JHUA 2CJFA 3KAQA 4TQUS 1Z4OA 2QTBA 4IXNA 5FBKA 1XI2A 2K87A 4Z4HA 3KOWA 1RAGA 1KAGA 1DU4A 1SBZA 2B6NA 3UWPA 4BC0A 4ZZ3A 4DV0B 4TXHA 4CKWB 5T6MA 4U0KA 1S2NA 5BOSB 2JFPA 3ZHBA 1YU9A 2D1FA 3FBTA 3NPMA 5J23A 1QIEA 3TM5A 4AP9A 4Y1RA 4PX9A 3FXAA 3B6ZA 3FUUA 4RMJA 2N9UA 3HY6A 4B17A 3VU8A 4NV0A 4QQRA 1M2OB 5FWAA 4ARAA 4B3MB 3Q8WA 3FI9A 3ELBA 1AQYA 4FXPA 5FHQA 5HFAA 2QN3A 4IGEA 4IPTA 4RFSB 1WP4A 4FUQA 2DQ4A 3ZIAD 4ZOLA 1A9XA 3QOWA 4EMBA 4HVCA 1P19A 2VR1A 5D6OA 3NHRA 5AT1A 1TDJA 2CNNA 2DUNA 4JVLA 3U48A 2GFHA 5C32A 4P9NA 1YDMA 4EQ6A 5INTA 3ML1A 2VHJA 1XG5A 4CQNA 2W22A 2XH8A 3MWLA 4EY4A 5K0EA 1CG6A 3S2ZA 3A3OA 4HO1X 3S6JA 3F2IA 4HYYA 3U4MA 4E21A 2QTTA 4TXJA 3O9VA 5IMBA 2ZIWB 1WXXA 1OLUB 2CVPA 2ODEA 1W87A 2PZGA 2YBEA 1H66A 2YWFA 2QRMA 3FYHA 4PZDA 3B7PA 3GJZA 2F1OA 1V8OA 2O3TA 3T7RA 1ZD5A 1UIMA 3N2GB 5T57A 4JNCA 3JD3A 4KGXA 3HCFA 3A2KA 2ZJ8A 2X1HA 4UXJA 5DKFA 4G9EA 3UT6A 1SB9A 2ACWA 2GN9A 2AQ8A 5SY4A 2C42A 3ZDAA 2AHRA 3EAQA 1MAVA 1V1JA 2XB9A 3QKTA 4C07A 1DAMA 3H7AA 1RLTA 3S7TA 3QE0A 4U9IS 3SF8A 4F3KA 5JRJA 4OU4A 3UK0A 4EMUA 3D3NA 3O26A 3LRPA 4UCWA 1NLZA 4PZUA 1ZL0A 4EB6A 5FX2A 3PJRA 3AONB 3QLJA 1Q20A 1C7RA 2BTQB 1TPZA 3A6JA 2G83A 2VSFA 4KLAA 1L5GB 3QVOA 1QTIA 2ZUDA 4RMIA 1JDVA 3FTPA 5DNVA 4LYFA 1U28A 2BFWA 3GZTB 4YT8A 1IQPA 2DHCA 2Z09A 3HVIA 2ZVQX 3K3PA 3LM8A 5KYUA 4QX6A 4YQEA 2P9EA 4YJFB 3VYTB 1K5HA 1KI3A 3JR7A 1X42A 1QHSA 2XF2A 1Y8RA 3TD9A 1P77A 3WGNA 2IUUA 2D6FA 2B34A 4IUBS 1MJNA 4DDMA 2H2WA 2ODQA 4WT7A 1E20A 2JZNA 2XT9A 5HBGA 2OZKA 3RHSA 1A27A 2A57A 4JNKA 4E46A 4ENSA 5BW4A 2X2EA 3AMVA 4LVUA 3S68A 4EG6A 3WK7A 1NI4A 1ZGZA 1BXKA 1ENYA 5KQSA 2WP0A 3P4YA 3KXPA 1EFUA 1G19A 1WKVA 2CVQA 5B7NA 3E7WA 4ISBA 3D7SA 3DDHA 4U6NA 4JI5B 2EJTA 3ZCPA 5ALVA 1M1NA 2Q3MA 1P1FA 5BN5B 4M1OA 1UDRA 3MWFA 1T29A 2Z04A 4BB9A 4FD3A 2FN4A