5IN4A

Crystal structure of gdp-mannose 4,6 dehydratase bound to a gdp-fucose based inhibitor
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
355
structure length
355
Chain Sequence
b'LYFQGRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVHADVELMRTNPNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-mannose 4,6 dehydratase
publication title Facile Modulation of Antibody Fucosylation with Small Molecule Fucostatin Inhibitors and Cocrystal Structure with GDP-Mannose 4,6-Dehydratase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase/inhibitor
total genus 130
structure length 355
sequence length 355
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5in4A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 5in4A02
3L0DA 1T25A 4N5LA 3L6EA 3A4VA 4GI2A 4CR7A 5IZCA 1ENPA 4CQMA 4J0FA 1PJ3A 1YVEI 4E6PA 2PFGA 1QSGA 3DAGA 4U7WA 3UCXA 4BGVA 1I2ZA 2CY0A 3ROKA 3JD4A 2CDAA 5G0TA 5KJ6A 3S2IA 4BO5A 3U9LA 3L4BC 1TT5A 3H4VA 1HYHA 2CF5A 3QSGA 2Y93A 1S6YA 2X0NA 4E32A 2B35A 2UUPA 3RC7A 4ND4A 1ONPA 2VWGA 3GT0A 3FNHA 3HNPA 5A9TA 2XXJA 2WEKA 3JTMA 3NTQA 4WPGA 5L53A 1KVUA 2NTNA 4RGBA 3JQGA 1H5QA 1PS0A 2UDPA 3QY9A 2NVUB 2X5OA 2CMDA 1O0SA 5HBRA 1VJ0A 2AEJA 3R3SA 3ZHZA 3VTFA 1A71A 3X2EA 5JAZA 3PIIA 1G1AA 4AJIA 4AJ1A 3A1NA 4Z3DA 3I9MA 4BQRA 3ASUA 2VYND 5HA5A 1TI7A 4XYEA 2V7PA 4EEZA 5DBGA 4L0QA 4FC6A 1MP0A 3BXXA 1V8BA 2AE2A 2X9VA 4CV2A 1TVEA 1VPDA 1DLJA 2Q1TA 2PR2A 3GEMA 3H9GA 1H0KA 4BB6A 5FI5A 3WFIA 4A2CA 2VRCA 1JW9B 3GG2A 4BQPA 1YOVB 4IIUA 1GZ6A 3KSDO 3OEYA 2VWQA 3DZFA 3ZWAA 2Q99A 4J90A 1ADFA 1GYQA 3ETEA 1RM5A 1AXEA 3WNVA 3DL2A 2G5CA 1HE2A 2X0IA 3T4XA 4BVAA 5H83A 2DUWA 3RC2A 1MB4A 4UREA 2AXQA 3ETDA 3MCVA 5DULA 1A9YA 4J1QA 5T8KA 1KIFA 2HJSA 3QVXA 4O59O 1YE3A 2BFAA 1GU7A 1MFPA 4M1QA 3TOXA 1TEHA 2HDHA 4DREA 1ZMOA 2H63A 2NVBA 4NJMA 4KWIA 3AY6A 4KZPA 4WGGA 4E30A 3MZ0A 1JTVA 1U4SA 4WCFB 3DBHB 3GQVA 3H5NA 4FFPA 1LU9A 2FP4A 2PY6A 4UUNA 4XJSA 4R68A 2P5UA 4YT2A 3LLSA 1CWUA 1S7CA 1QV7A 3DTYA 3Q0EA 2HRZA 2WYUA 5F1OA 2LDBA 1JN0A 2O7QA 4IS3A 4EJ0A 2NV6A 3DOJA 1IULA 2Y66A 4J43A 3P2OA 4YJFA 1HEUA 1A9ZA 4PZDA 1IPFA 3JQ8B 2PA3A 5JAMA 2OO5A 3GEDA 4J9VA 5IDQA 4FFLA 2OBNA 3WYCA 2O4CA 5IXSA 1LUAA 2JKVA 3E9NA 3ZU4A 1LC0A 4BNLA 4BUCA 5K6AA 1IY8A 2ZJ0A 3QE3A 3N58A 2JHGA 4PN3A 1F8GA 3G1TA 2HJRA 1ZKMA 3LK7A 3FTPA 4CUZA 1KETA 3IQDB 4W7HA 5GY7A 3JQ7B 1EK6A 4I1IA 1MUUA 1U3TA 2YW9A 3U5TA 1LQUA 2HCTA 8LDHA 4OOEA 1NP3A 5IN5A 4B4OA 2AQKA 4EJ6A 1T1SA 3I4CA 4XX0A 1ZIDA 4LMRA 2JD1A 1GAEO 3JQ6A 3ZWYA 3LC2O 2D1YA 4M49A 4YWJA 1RYDA 4LCJA 1GCOA 1LTHR 4X54A 1XG5A 2G17A 4BKPA 3PFWO 4B7XA 3FWNA 4HADA 1I33A 1LBEA 2VOJA 2A9FA 2V6MA 3VH2A 1JVBA 2EXXA 5IZCC 5HRUA 2P2SA 2AG5A 1CQJA 4CL3A 4AJKA 1VL8A 5FI3A 3O38A 2UV8A 3H9EO 4TRJA 1K6JA 3JQAA 1WPQA 3AI2A 3ONFA 4D0SA 1YO6A 3AUUA 3DQPA 4TKMA 1BXKA 3C8MA 1HYEA 1U4OA 4CM9A 5JE8A 4QFCA 3O8QB 1QYCA 4DWVA 1HZZA 2V6GA 4UEKA 3SEFA 4PG7A 4L8VA 3EVTA 4LN1A 2R6JA 4R1SA 4RL6A 5L7WA 4IQ8A 2RH8A 3H2SA 5EL0A 3W8EA 4YA6A 1Y6JA 3HJAA 2NU8A 4XQGA 2VT2A 5CDUA 3B70A 3GC6A 1PJTA 4R16A 4CQMD 1ZNQO 2CNBA 5KKAA 3OEWA 1ULSA 2Q50A 1AHIA 3PHLA 3GZNA 4H7PA 4Z9XA 1I24A 1VM6A 5MDHA 5G4KB 4YBZA 2C20A 1JAYA 3ANMA 2BI7A 4IPTA 3ZHYA 1O8CA 3RI3A 4BNFA 2HMUA 1UAGA 2HLPA 1HSZA 1MX3A 2QHXA 2AHRA 3E9QA 4E2WA 3L9WA 4GMGA 4FR5A 3OF2A 3JYOA 4MVJH 4F6LA 4ND3A 3BHJA 3H3JA 1YONA 4F3YA 3LC1O 2VTEA 2B83A 3ROQA 4BIIA 3RD5A 4U8GA 3EW7A 3GMDA 4CR8A 4DIBA 1SB9A 1JLLA 3WGYA 2YHIA 3NTRA 2DBQA 3H65A 4I5EA 1HRDA 3DDNA 1G6KA 3E1KA 7ADHA 1LDEA 1P0CA 4ND5A 4U6SA 2VCYA 3KSUA 3WB9A 4NZ9A 1V35A 3GNTA 4JQCA 4WJZA 2GUGA 4BNXA 4P4NA 4KUGA 2Y1OA 1E1NA 1PJSA 1E5QA 3OJ0A 1BMDA 5BNTA 2NU9A 4CV0A 1O5IA 2DBZA 1H6CA 3GGOA 1PJLA 2H5LA 1Z6ZA 2DM6A 1QYVA 3OH8A 5ILGA 4RV9A 1ML3A 3GRPA 3T7CA 2YJZA 3BA1A 4B3HA 5I7VA 1PZEA 1CYDA 1T1RA 1WVGA 3IOYA 3UOGA 4IDCA 5JDCC 2VRCD 2J6IA 1NBOA 1JVSA 5TSDA 2PTGA 3BZUA 4QSMA 4GSLA 5JCJA 4N54A 4ALIA 3K8ZA 3PYLA 2D0IA 1LSSA 2IYPA 4A7PA 3ZWMA 4BKRA 5JY1A 5BQFA 1HE5A 3C24A 2W2LA 2VTDA 3D3WB 1SB8A 2X0JA 2Y67A 1T2EA 1XU7A 1FJHA 1X1EA 4XZ3A 5K0ZA 4KTVE 2V6FA 4I08A 5CG1A 4FDAA 1A4IA 3IUPA 4PLWA 4XRGA 1B15A 1YQXA 2C29D 2O48X 4QO7A 2BMAA 1KC1A 4CUKA 4YAJA 1QYWA 1NPYA 3HB5X 4FD3A 1B7GO 2P91A 4BOYA 2X5KO 4CMHA 1V9LA 3FD8A 4A10A 3QJ5A 4YVFA 4CM4A 4BKUA 4BNUA 1XA0A 2JAPA 4OOFA 4XKJA 1DRUA 1PIWA 1I3KA 5TC4A 5TX7A 2A35A 4TVBA 3KOUA 1BRMA 3K6JA 5ENDA 4FFRA 3GNSA 1FDTA 1BW9A 2RBEA 3GOHA 3ZWWA 1W73A 1ISIA 2YDXA 4FSHA 1DHRA 5L4LA 1E1MA 1HDGO 1VLLA 3HDYA 4WE3A 2P9CA 5JMPA 3HDQA 5CP8A 1IE3A 2BD0A 1M67A 3QRWA 1KEPA 3GVIA 4A26A 1GCUA 4NPCA 2O50A 2PD4A 4NFHA 4R1UA 1VSVA 1NHWA 3LT1A 1D7OA 4JLWA 4IINA 1Y1PA 2ET6A 3JQ9A 1PQUA 2AEFA 1OFGA 2G1UA 5DP1A 1D3AA 4BNVA 1UUFA 3C7AA 1EEHA 1ADBA 2DBVO 2YV2A 4NK5A 1DFIA 4IQ0A 5HS6A 1IL0A 1Z75A 3E5RA 3QWAA 2IE0A 5I7SA 1BGVA 1Q2XA 4MVJG 4OO3A 4AJ4A 2AMFA 5A9SA 4GLOA 1SAYA 4M8SA 4NG5A 3ZWBA 2EP5A 2SCUA 4LSMA 4PLHA 2VOEA 3IL2A 4NBRA 3UHAA 1F06A 3JQFA 4FJ0A 4XD2A 2RHCA 2VRBA 3BMQB 5L7TA 2GZ3A 2Z5LA 3UICA 4D42A 2J5QA 2CVQA 1B14A 1L7EA 1XGKA 4O1MA 4YEDA 2RAFA 4WASA 3QVSA 3EAGA 4G2NA 4RQUA 2YUTA 5IJZA 2AW5A 3RROA 3JQAD 4JNKA 2G76A 3WMWA 4CLOB 3NT2A 4CM9D 4PLZA 3FR8A 5EQFA 1E6UA 2IXBA 1OMOA 1T2DA 2B5WA 3RBVA 1Q1NA 1DAPA 3M2TA 4JN6B 1DIHA 1BDBA 1R0KA 3DBRA 6ADHA 2JFGA 5EESA 4L9RA 4R5HA 1C1XA 3L07A 1ZSVA 4G81A 2Y0CA 4K6FA 4N5MA 4ZD6A 2CF6A 3TPCA 2A94A 4W99A 4C4OA 1I2CA 3IS3A 3Q9UA 4YT8A 1A4UA 4J9UE 4J7XA 3D5QA 5CPFA 1KY5A 4R9SA 2Q1UA 4HP8A 4DVJA 5K6AC 3G49A 4EW6A 1DIGA 4XYBA 2Y0DA 5DT9A 1DDOA 3GEGA 4DGSA 1AN9A 3OIDA 4JCOA 4RPKA 1MC5A 4MDHA 4TQGA 5JY6A 3L9XA 5I8ZA 2RIRA 1I8TA 3ZZNA 5B1YA 5IF3A 3TZHA 4BGEA 4EYEA 2FSVA 5CG2A 1ZH8A 3I9JA 2ZTLA 3GAZA 4Y98A 3PLNA 3WBBA 4OGWA 2YFHA 1O89A 1K89A 1P44A 1P1FA 4I5FA 4OH1A 4RO0A 2BGLA 3GNQA 3KLMX 2YDYA 1YJ8A 2O7SA 2NQ8A 3CTMA 1BXZA 3SC6A 4FFOA 3VPFA 1BVUA 4RVGA 1B26A 3GHYA 4JK3A 4F46A 2F00A 2H9IA 1LEHA 3BHIA 3KZVA 1V0JA 2EWMA 3EZLA 3PYMA 3U4IA 4GH5A 4UUOA 3RUIA 2XXBA 4P8RA 4OHUA 3PHIA 4TKLA 4ZICA 1WDMA 2ZTVA 1DHTA 4R5MA 2EKQA 4MVJE 3S2EA 1ORRA 2DFVA 1XR3A 4IS2A 1U8FO 3GLQA 1RKXA 1WDLA 2BH9A 4QXMA 3Q6IA 4R3WA 3OHSX 3HWRA 1BTOA 5JCJD 1E7SA 2Y0EA 2E49A 4CMEA 1J4AA 3FRJA 1NXQA 3MJSA 4YB8A 3VZPA 2VWPA 5G0WA 4RQTA 2W2LD 3INTA 2OHXA 1Q0LA 5A3VA 3V1TC 1B8VA 1GPDG 1LDBA 4J16A 3E18A 3QVTA 3VHRA 4KQXA 2FR8A 1XELA 3ZV5A 3K30A 4XIJA 1SC6A 3NEPX 4P4GA 4UEJA 1HDOA 3UH1A 3ZHBA 2Y99A 3IJPA 3GGGA 4PGFA 1JKFA 3JSAA 4ZRNA 4BO6A 5C5IA 3E5MA 5L3ZA 4OMUA 1B8UA 2R00A 4JJGA 5KJFA 4YJHA 4D7AA 1JDJA 4Z3KA 1E6EA 4Y6RA 5KVSA 3IP3A 4N5NA 1Q0QA 5AQ1A 3N74A 2E6UX 2BI8A 1ISJA 2VHYA 3SBOA 3CE6A 2HMSA 4TZKA 2FPIA 2D5AA 2HAEA 3TL2A 4KP7A 4B7CA 1SOWA 4GKBA 1ZJZA 2GO1A 3EMKA 8ADHA 4FQ8A 3NDIA 1EE9A 1GQQA 1UXKA 1O94A 4BMVA 3F3SA 4M87A 2WDZA 5G4LA 2GN8A 7MDHA 4BNKA 3GZ4A 3KYCB 5GZ6A 5AXBA 4JGBA 2GYYA 3PDUA 3QWFA 3BIOA 2UAGA 2Q46A 4RZHA 3FBTA 4E3ZA 1KVRA 1LQTA 4YRAA 4ZQBA 4KTTE 3WSVA 3GY0A 4NU6A 4IZHA 4DPMA 3AM4A 2X6TA 2B36A 3CIFA 1EBUA 4AJPA 4CMGA 4R3NA 1R4NA 2DTEA 1IB6A 1YKFA 3X2FA 3AUSA 1ZXBA 4TVOA 5C37A 3AY7A 4CM1A 3LZ6A 3ZNNA 1M6HA 1ZCJA 2H6EA 2HK8A 3F9IA 4JP2A 1VKNA 5FFFA 2BHLA 3RQSA 5HWSA 1NQAO 5TJHA 4K9DA 4GQAA 2GN4A 4HY3A 1GUYA 1E1LA 3BMOB 1EDOA 1FF9A 3R3JA 4D0RA 1NQ5A 1HE4A 1E3WB 5EN4A 4MP3A 4IJWA 3P2YA 2IEDA 1PR3A 4BNGA 2O3TA 5A1TA 1LC3A 1WWKA 2P9EA 1UDCA 3DO5A 4E2XA 4DMLA 4CM8B 3KETA 3WYEA 4YRDA 4DPKA 5JXWA 3F4BA 2R2GA 3MJTA 2PD3A 1ZK1A 2GCGA 5DBIA 5DNAA 2WD8A 3ADOA 3KYDB 5TT1A 3DZGA 1JQBA 3UGKA 1CQIA 2PGLA 2ILTA 2QRJA 4U0JA 3INRA 5I9MA 1A7KA 3MJ4A 4NBWA 2YHUA 4E5MA 1GEGA 4J49A 1E7MA 4RVDA 4EDFA 5DOVA 3I6IA 3MOGA 1ZJYA 4A03A 4CLHA 1QYXA 3A06A 1RJWA 3HE3A 4FOSA 3EZYA 1WZIA 4GMFA 4EGFA 2P4HX 2DVMA 5U1PA 4CLDA 3DZJA 1JU9A 4QX6A 1PZFA 3FNGA 3FNFA 4FBGA 1BXGA 2BGKA 2P68A 1VRWA 4HXYA 3RFTA 3UAGA 4CLRB 3IJRA 3GN2A 5DCWA 4FOOA 1K5HA 2BF7A 2HU2A 1TXGA 2WMDA 4YQZA 2WJPA 1N7GA 3DAFA 3ADPA 3C3XA 3KYBA 2W2KB 4ALKA 4HBGA 3W8DA 4Z0PA 4PFJA 4Y67A 3N7UA 5U4QA 1N5DA 2GRAA 3PTZA 1UXJA 3R1IA 4YJGB 4HFMA 4E5KA 1GADO 1EUZA 2G82A 4RVHA 4AJ2A 5JDIC 4GWGA 1DXYA 4CJXA 5AOVA 5BSFA 2A4KA 2VUUA 1JWBB 3ON5A 3AOEC 2VHZA 1UP6A 2WSBA 1ZSYA 3D4OA 4YT4A 2NVUA 3ZNPA 5ENVA 1DIBA 1MFZA 3AWDA 1H93A 4ROSA 1YBAA 2IXAA 3RJ5A 3V2HA 1NNUA 4J4BA 3VOSA 1EQ2A 3DTTA 1Y8RB 3D0OA 3TJRA 2HO5A 4UVGA 4BNYA 4J1SA 3GHHA 1MG0A 2D2IA 4ITUA 3WJAA 4ALNA 4LRTB 1GY8A 2P4QA 3VZSA 1EZ4A 5I7EA 3GDOA 4BO2A 3DMTC 4IMRA 3C7DB 3FNEA 1ARZA 3SJUA 2CUKA 5ITVA 1U3VA 2PKRA 4KUHA 4NBUA 3PWSA 5EMHA 1EK5A 2NNLD 4RVUA 3K5PA 1YOVA 3E03A 3L6OO 3DFZA 1P1KA 2Q2QA 1U8XX 1NPTO 4UVIA 3A28A 3HSKA 1OBFO 3WG9A 3BMCB 3HDJA 1N9GB 2AQIA 2JD2A 1VL0A 1C0PA 5DCYA 3UKOA 5EQDA 4PG6A 3WIDA 1ZK3A 1F14A 3CZMA 3D5TA 3AM3A 3GUYA 1WMBA 3ICPA 2FN7A 5L40A 3ZN2A 3ZW9A 1HYGA 3OM9A 2FY8A 3DBLB 2QZ9A 1Q7BA 1U7TA 4ZU3A 4CV3A 4OSOA 4EUFA 4GSKA 5JLAA 3DOOA 1C14A 3FTNA 3SC4A 4L4RA 3VH4A 2HMWA 4WCFA 1HL3A 3DBHA 3OMLA 5A02A 3JQBC 3DMYA 4B4WA 1R66A 4KQWA 5ER6A 3VC7A 2QZZA 3ULKA 4BV8A 4Y6SA 3KXDA 2PKQO 2DU8A 1NFRA 3S2FA 1E3LA 5B4VA 5KCZA 4W9NC 3I52A 1YDWA 2C2XA 1YDEA 5F1KA 4URFA 4Y9DA 4UULA 5TJ9A 4CODB 4WLEA 2I6TA 1XCBA 3BMNB 2O3UA 3JQ8A 4BO0A 5CEEA 3VH3A 3HN2A 2XAAA 1M6WA 1NR7A 2EHDA 1CJCA 4MIOA 1GYRA 4ZRMA 3GPDG 5THQA 3LT2A 4PRKA 1E77A 1P1RA 3MTJA 2VHVA 4YXFA 3I9LA 2AEMA 3OQBA 4XB1A 3TNLA 3WR5A 1I3NA 3GMSA 3ZCXA 1ISMA 2CDBA 2VNSA 3GK3A 1Y9AA 4DTIA 3UF0A 1GQ2A 1G0OA 2PV7A 3KHUA 4L74A 3GUCA 4D79A 1K2WA 3WIEA 2W4QA 3JYPA 4AJLA 2ZJ1A 2O3JA 3JQ7A 3RUDA 3VKVA 3PQDA 1FDWA 2X23A 4H16A 4BB5A 4YPOA 4WOJA 4FGWA 3WS7A 4QQRA 3U49A 1D1SA 1BSVA 3NX4A 3PJFA 3TOZA 5K9ZA 3HFGA 3TFOA 4GGPA 4AJJA 5CDTA 1EUDA 5AVOA 3D64A 1HDRA 4BKOA 5JO0A 4ZGWA 3PK0A 3ANLA 1DC5A 1AHHA 3PI7A 4UVDA 4CPDA 1PL8A 5FF9A 4R54A 4BO3A 1ZXLA 2CFCA 4Z0TA 4BHTA 2E4AA 3S55A 2D59A 2GR9A 1SBYA 4YDRA 3WFJA 5KVCA 2PGJA 1PL7A 4PG5A 1E7RA 1SEPA 2QG4A 3GVCA 2ZYAA 2J3JA 1ZZEA 3I9KA 3OA0A 4R9RA 2JFFA 1YWGO 4IQGA 3VDRA 2XF8A 2ZQZA 4NFSA 2VQ3A 3BYZA 3KEOA 3HFSA 1XSEA 2FRDA 3JD2A 3IKVA 1UZNA 1NM5A 2GLXA 4MOWA 3NJ8A 5F21A 2DTXA 1MXFA 3O8QA 1C0IA 5DF1A 5CDSA 5A9RA 5KVVA 2GPTA 3R0IA 2VN8A 3C7CB 2JL1A 1NAIA 4D3SA 3WX0A 5EPOA 4CQLB 5U9CA 3Q1LA 4TZTA 1N1GA 3RUFA 2BELA 2QRKA 1IZ0A 2DPGA 2ZCUA 1DB3A 4B8WA 1J0XO 1DPGA 1ID1A 1EVZA 1GQYA 1I36A 4CMIB 4EI2A 1YL7A 1E7YA 1E3EA 1QORA 2GD1O 2OBYA 3JV7A 4WLNA 4IDBA 5G4KA 2EKPA 3MOIA 2Y1GA 3RAJA 3AK4A 3OJEA 4G5HA 3LF2A 1UDAA 3AFNA 1CEQA 5IDWA 3E9MA 5F3RA 4MKXA 1P74A 1NQTA 2X5JO 2DTDA 1YQGA 2TMDA 3WQRA 4WCDA 3V2GA 2VNAA 2X4GA 3OJFA 1R4MB 2ZTMA 2PD6A 2Q4BA 4I9HA 4IDEA 4B3IA 3LT0A 1FMCA 5T8KC 3AJRA 3Q2KA 2HSDA 4E21A 3SVTA 3PQFA 1CF2O 4QT0A 1PTJA 5THKA 4Q3BA 1VKOA 4WNCA 1QLHA 2EIHA 3OICA 4CMBA 2JAHA 4J3FA 1UXGA 1ENOA 3HN7A 4HNGA 4YRBA 5EERA 3ZI0A 1R16A 1YB4A 4OXYA 1FDUA 3DXFA 3TZKA 3DBVO 3LDHA 1EFLA 4BNJA 5DP2A 4DUPA 1R15A 2ZYGA 1I10A 2C0CA 3H5AA 4B4VA 4BMNA 2JCYA 4YQYA 1LSUA 1ZSNA 4AICA 3IIEA 4GPD1 4ZJUA 1ZO8A 2Q45A 2C59A 4XCVA 1KEUA 2X86A 4S3MA 4Z9YA 4I5DA 2XOXA 1O9BA 1U9JA 1Q7CA 5FWNA 1EFKA 1I3MA 3ONDA 2POQX 3V8BA 3KEQA 3ZU2A 4F45A 4LISA 4IXWA 4Q3NA 1EVJA 2WE8A 3RUEA 3CZRA 1U5CA 3OFSA 2ZTUA 3WWZA 2QIOA 4DLBA 4AJHA 1CIVA 5HS4A 1P1IA 3FR7A 3EYWA 4W6ZA 3G1UA 1H6BA 2E48A 3D3WA 3QHAA 2IRWA 4IIVA 2CDCA 3FCOA 3CUKA 2O2YA 2PH5A 4BNHA 2JHFA 3O4RA 3OBBA 1GDHA 4J2OA 4YAKA 4IUYA 4RF2A 2DPHA 1PJ2A 1XQ6A 1WAMA 4LMPA 3WDSA 1X1TA 4BKQA 4CLXA 4D41A 4E33A 4HWKA 3LYLA 5A5EA 2D3TA 3LSYA 2I5PO 5BNIA 5G0SA 4NU5A 5C7IO 5ES3A 5IXYA 4GWKA 4ZVVA 5CDGA 4I9NA 5KVQA 3B1JA 1VJ1A 2GF2A 2EW2A 5JSFA 2UYYA 3CINA 4J1TA 3WGZA 1MA0A 3DZBA 2J5KA 3AY3A 4CMAA 4ZN6A 5AXCA 5IDXA 2RCYA 1T4DA 3RU9A 1GEEA 1SO8A 3KRTA 4ZQHA 1ADGA 4XIYA 4CV1A 3IMFA 4HUJA 1WZEA 1W0CA 2EF1A 1NQOA 4XA8A 3NV9A 3EY4A 1BHSA 1P31A 4ZHSA 2NVWA 2UVDA 3RBXA 1YJQA 4KMSA 3H9JA 2V6BA 5A05A 5LDHA 3MJVA 5MGBA 5KTKA 3TN7A 1QYDA 4J6FA 1LRKA 4NFYA 1C0KA 1SOVA 1OZAA 1QXSA 1VE9A 2QQ5A 3F46A 3GR6A 3RUCA 1HT0A 3EVNA 3ANNA 1P45A 3NJ4A 3RASA 3RUAA 3RC1A 5TIIA 1NVGA 1YXMA 3Q3CA 2D5CA 3FBGA 4HFRA 4GGOA 3BMQA 4K6CA 4RDIA 3WGGA 3GVPA 5ER9A 1AE1A 1GFSA 2PZLA 3KTDA 2DLDA 3MJCA 2NUAA 1U28A 4JIGA 4PCVA 2EJWA 1ZK4A 2TMGA 1I3LA 4G65A 1NR1A 1XLTA 3ABIA 3GDFA 2FPPA 3CSDA 4IJUA 4JBGA 1HDCA 4CLEA 4CLOA 1K6XA 1DC6A 1F12A 5L4SA 1GZ3A 5KKCA 4PLYA 4PLVA 4IDAA 4J7UA 5ITWA 1AUPA 3HHPA 3TQHA 3I9NA 2I99A 2OP1A 4PIVA 3GFBA 4NR0A 2X22A 2GZ1A 1EE2A 1PZHA 3E6AA 4Q9NA 4XEHA 1H2BA 4H15A 1IPEA 3PIDA 4AJNA 2EGGA 4N7RA 5GZ3A 3D3EA 4AFNA 2CZCA 3LT4A 1N92A 1DC3A 1FDVA 3CH6A 3VZQA 1ULUA 1YGYA 3QW2A 4HV4A 1A5ZA 1ZEJA 3HQ4O 5A3JA 1HLPA 3ENKA 3W8FA 3IUSA 1KERA 2ZATA 2B37A 2ZB3A 5FYDA 4OIMA 3RVDA 1QMGA 4RPGA 3ITKA 3K31A 1Z74A 4TROA 3IAHA 4TMFA 4ZQGA 4ALLA 1PX0A 3H7AA 3UN1A 4ZQFA 2OMEA 3DR3A 3OSUA 1ONNA 4PLPA 1N8KA 1Q7GA 3U4DA 1X0VA 3L4BA 2UUOA 1XIVA 2ZYDA 1KC3A 3PFFA 3QVOA 3G17A 4OAQA 2PKQP 1C1DB 4UEOA 1TLTA 1IZ9A 2J5RA 2QW8A 3P7MA 3DAPA 2V65A 2EP7A 2HKIA 3EGOA 1SNYA 3UW3A 2FR1A 3RJ9A 3BTVA 3E48A 3F47A 4CMCA 2YFQA 3PQEA 3RIHA 5DDIP 4B3JA 4BL5A 2HQ1A 4FW8A 4FGSA 1RPNA 3W6ZA 2YQ4A 5JMWA 1ENZA 1PSDA 4U0KA 1BWSA 1YB1A 4IJKA 1U7HA 4RF5A 2HMVA 4BNTA 1DJQA 4YT5A 1LXCA 3DFUA 2DBRA 5HM8A 1MG5A 1V3TA 5A06A 4GLLA 3KB6A 1U2DA 3DHYA 1PJQA 2WD7B 2WYVA 2HRBA 5AXDA 4R51A 2ZB8A 2PZJA 4J7CA 2AQ8A 4PLGA 1LDGA 1P9LA 3Q11A 4WLOA 2AG8A 4MVJP 2OOSA 3EC7A 1ZW1A 3NDJA 3ZV3A 1SPXA 3VAZA 2IZ1A 1UP7A 3RUHA 4B8ZA 4IDDA 4DQVA 3GA0A 3JQ9C 5AYVA 3U4CA 3ONEA 5JS6A 2X7HA 4ONEA 5BT9A 3RWBA 3JD3A 1QKIA 3V1YA 3IDSA 4Y8VA 4OXKA 3NT5A 1GPJA 2DAPA 3P19A 1H6AA 2PK3A 4J91A 1AXGA 3ZWPA 2Q3EA 5KJEA 3AI3A 4BNMA 1NTOA 3JQFC 4CM7A 4W82A 5TRTA 3HADA 4I8XA 1NVMB 3AUTA 1WMAA 3ROPA 2I67A 4PVCA 3E8XA 1ZEMA 3NUGA 3KV3O 4XDZA 2VHWA 3QIVA 1EVIA 3VVCA 1D4FA 2EG9A 3NGLA 2GNAA 1LSOA 5CEFA 5AXAA 4ZA2A 2FWMX 3F1LA 3QWBA 3ETGA 4DPLA 2XPCA 4OM8A 1AGNA 3LU1A 5G0UA 4B79A 5ILOA 5A4DA 2Q49A 4DIOA 2B4TO 5BNFA 3ZU5A 2EV9A 1F17A 1FK8A 2ZK7A 3OQ1A 4RF3A 3TWOA 4IMPA 4DXHA 4DA9A 1KY4A 4PG4A 4NNJA 3JYLA 1N7HA 4HKTA 4KWHA 1LX6A 4EUEA 1E3JA 2NSDA 4DRYA 2OORA 3L4SO 1NVTA 4E31A 3TZQA 3I3OA 1LLDA 4D3FA 4BO8A 1C0LA 2J3KA 2O23A 3F1KA 4AL4A 2WM3A 3HDHA 4PLCA 5L45A 1Y81A 1GL3A 3WOHA 5A5FA 4DMMA 1E3WA 3WBFA 1LDYA 4WNIA 1B2LA 2Y1CA 5CAEA 4NMHA 2B69A 4XJTA 1V3VA 3LLVA 3RFXA 3WJ7A 5L51A 1ISGA 1T2CA 3PGJA 4Q3AA 1NFQA 5EJ2A 1Y8QB 1OOEA 4AVYA 3DEYX 1QLJA 3JYQA 4CM8A 3B1FA 4LVCA 5FEUA 4MPDA 4BNIA 4YYZA 3KYDA 2FMUA 4INAA 4CQMB 1JWAB 3HZZA 3JD1A 4IM7A 3COSA 2QYSA 1U3UA 1Y9EA 5TT0A 2RHRA 4GX1A 4JX8A 3F4LA 4FS3A 1Z82A 4U5QA 4BV9A 3MWEB 4NK4A 1DEHA 3PYXA 3ZGYA 3RBZA 4O0LA 4IDGA 4IZIA 1PEDA 1TT5B 4LCEA 4S1VA 5BR7A 2NWQA 4XB2A 4JP3A 2X0RA 3WICA 5JCXA 4Z0HO 3QV1A 3W4JA 2J3HA 3PJDA 2OGUA 4C7JA 4IBOA 2OXIA 3KUXA 2X9NA 4H3VA 2PH3A 3I6QA 3WQSB 4J4HA 1X15A 3CKYA 3E82A 2BRUA 3JQGB 4IDFA 1X14A 3PRJA 3PZBA 1M2WA 1P1JA 4XQEA 3W4IA 3I83A 4UUMA 4CLRA 1L7DA 1IHYA 2VZ9A 2X9GA 4W7IA 3AUAA 1A72A 1ZFNA 3H5RA 4E2YA 2CSUA 3PJGA 1XHLA 4AJEA 4BNZA 2NU6A 3O9ZA 3C1OA 1ZUD1 4GAEA 3JYNA 2W2KA 1P33A 3AU9A 4M89A 3PWKA 1MGOA 3NYWA 2Q1SA 1HDYA 3DZKA 4L73A 4CMEC 1KVTA 5KJ1A 1Z45A 3GN1A 4DC1A 2Q2VA 1ADCA 1DFHA 2IZ0A 4WK6A 5TLSA 4XYLA 4KDEA 2VYVA 4WECA 1ONOA 4YJGA 4XYMA 4D45A 3DHNA 4BMSA 1DIAA 3RC9A 3ZHXA 1ISFA 1PQPA 4E4YA 1WNTA 1K3TA 3ZV4A 3BAZA 1R6DA 1LDNA 2H1SA 4II3A 3Q9NA 3TZ6A 3FHLA 1XDWA 1YL6A 1LLCA 1PS8A 3JQDA 5T67A 3U0BA 2GERA 1LLUA 2R00C 3M6IA 4DL9A 4P22A 1Y8RA 4XQCA 1F0YA 1GTMA 3NT4A 2BFOA 1E3SA 5JFOA 3G0OA 2VUSA 4GKVA 1WP4A 4MVJA 4A0SA 3ORFA 2JFHA 2P9GA 4CMKA 4YAGA 3V5NA 4XGIA 2QX7A 2I66A 2EW8A 3D4PA 4OL9A 4E2ZA 1EMDA 4OQYA 4DIFA 2F1KA 4BO9A 3GG9A 4L4XA 4NJMB 3QA9A 3QVWA 5I7FA 4Q3CA 1LRLA 1B16A 1HLDA 2EKLA 2Y1FA 4YR9A 4TRMA 4BNNA 4EITA 4D43A 3UFXA 2IYOA 3TFQA 4GVLA 1I2BA 3G3EA 4RCVA 3VKUA 3WMXA 1X13A 5CFZA 4HX5A 1M75A 5HTOA 4XWYA 5H82A 3U4HA 4CMJA 4YJFB 4TSKA 4DLAA 4DYVA 3I9OA 1I01A 3BMCA 1N9GA 3L77A 1BDMA 5EINA 4A73A 3T7EA 3RFVA 1UP4A 5JDCA 4WLFA 2AA3A 5CHEA 3U09A 4RJTA 1QV6A 3GFGA 3PHHA 5CDYA 5IZ4A 3ZWOA 4MVJI 3DBLA 3VPXA 4IJVA 4JXKA 4PZEA 1PWZA 3HB4X 5EIOA 5GZ1A 1E6WA 1CERA 1LJ8A 1T2AA 4FFNA 4Y6PA 1HETA 4HNHA 5DOZA 1P77A 3LC7O 4RVSA 3AFMA 3KBOA 4Q3EA 4LVUA 4PLTA 3NDRA 5ICMA 5ICSA 3ST7A 3BTSA 4QEDA 4Q39A 1E3IA 1H9BA 2C5EA 4Z9FA 5JAQA 2DUUA 2WE7A 5IDYA 4E5YA 2W98A 5T6BA 5ADHA 4IGEA 4DBZA 3BMNA 3STHA 2DC1A 5LCXA 3JQCA 2PZMA 3K73O 1EUCA 2NADA 5CEJA 5TS3A 5KOIA 4BO1A 4E5PA 1ENYA 1YBMA 4ALJA 3KVOA 4XGKA 3DOCA 2HUNA 1YH3A 1PL6A 1J5PA 3TL3A 2W8ZA 1LI4A 4D3DA 4LGVA 5L95A 2WYWA 1E7WA 3HG7A 4YAIA 5J23A 1M76A 1KOLA 1HKUA 1ZBQA 3K2EA 4MKRA 3WNQA 2I3GA 1NHGA 3IKTA 5DZSA 3WGOA 3GF4A 2PZKA 1LSJA 1SEVA 2X8LA 4GL4A 3D1LA 3P5SA 5BSGA 2C82A 4RLSA 1UJMA 2IDZA 4E0BA 2O3SA 3JQAB 3DWFA 4YAEA 4E12A 2OZPA 4YACA 1GV0A 1PZGA 3TZCA 1RM3A 1K6IA 3GRKA 4BS9A 3I5MA 4UVHA 2VUTA 1FDSA 1W4ZA 1NWHA 1Q0HA 1SZJG 2CVZA 4NQZA 1LDMA 1VC2A 3ZDFA 2P5YA 3M1LA 1IOLA 1DSSG 1PQWA 3ZNOA 1HDZA 1OC4A 3DZIA 3V1UA 4BNWA 1RWBA 2Z95A 2ZB7A 1PS9A 4NBVA 1RM0A 5A04A 1DRVA 1I32A 2IODA 3C85A 3WLFA 5B4TA 5F5NA 3CPSA 2I76A 4D46A 4FIZA 4FC7A 1U5AA 3WGQA 4P38A 2I65A 2NLOA 4XR4A 3ENNA 2EERA 3GZNB 2IZZA 4DBVO 4NH4A 3K96A 3WTBA 3C1TA 1Y7TA 3Q2IA 4M55A 5KWEA 3SJ7A 2O2SA 1ZK2A 1Y5MA 1E92A 3FSRA 4OJNA 3W4KA 4L4SA 2VZ0A 3OP4A 4AJOA 5BSHA 4EEXA 5G0VA 3W1VA 1EBFA 3GAFA 4XQ9A 3WTCA 3UCEA 4FB5A 2X58A 2GSDA 3W6UA 4B4UA 1KEWA 5IN4A 4GX2A 4NJOA 4BGUA 1XWFA 4CM6A 3DONA 1SCUA 4XYGA 4CQLA 2DQ4A 4CR6A 3IP1A 2C2YA 3AU8A 1HSOA 2PNFA 2YHIB 3MWDB 4RPJA 3U3XA 2GDZA 3H9UA 2BGMA 3EK2A 1JA9A 3ZWCA 9LDBA 3OA2A 3EUWA 4R1NA 5JW6A 2JD0A 1DRWA 2NACA 3ICCA 4K28A 4CMIA 5CPBA 2Q1WA 2WTBA 4NIMA 3GH3A 1WDKA 2WWRA 4LW8A 3WSWA 1E1KA 3FF4A 3VTZA 2GN6A 5LC1A 4BO4A 4WLUA 3DB2A 4NBTA 1TB4A 4CM5A 4YCAA 4UAGA 3L6DA 1Y5RA 2VYVD 2YQ5A 5JYEA 3LVFO 2NM0A 4PG8A 2YY7A 5TNXA 1DLIA 1HZJA 1KBZA 2EGHA 2NU7A 4ND1A 4R41A 3KSZO 1PWXA 1TT7A 3ZWXA 1ZVMA 1D8AA 1R4MA 2FZWA 1LA2A 2Q4EA 4J0EA 4LK3A 1H94A 4QO8A 4I5GA 2GASA 4BGIA 4DQXA 5I9LA 5JC1A 3WXBA 1KYQA 2GGSA 1QG6A 1VJTA 4C7KA 4MKZA 1PGPA 1UZLA 1EQUA 5F1PA 5L4NA 3WYBA 1X7GA 2PLAA 4JBHA 5TQVA 5KIAA 4WCFC 4MVJD 3PP8A 4DQUA 3M2PA 1HTBA 3JQEA 2Z1MA 3NGXA 4HFJA 4J4TA 4LSWA 4MIEA 1DAOA 3ROMA 4EZBA 4OKNA 5IG2A 4WUVA 4K1LA 4CUJA 3BTUA 3K2BA 1NWCA 1BVRA 3AW9A 4WLVA 1GYPA 3FPCA 4O63O 3T4EA 5F5LA 3U62A 3F6YA 3AOGA 5BSEA 1E5LA 1DC4A 6LDHA 4CM4B 4JJIA 3CXRA 3VPHA 4B7UA 3PHJA 3GVXA 4TRRA 1D1TA 4EUHA 2QYTA 3GPIA 4I9UA 1KEVA 3KLPX 4DLLA 4E5NA 3O26A 3SX2A 2ZB4A 3H6KA 4EBFA 3ZNQA 3AI1A 5COBA 1YB5A 2AE1A 1ZMTA 1BW9B 1T2FA 2Y05A 5T5QA 4YJDA 4FJ1A 4MVJF 1XEAA 3F5QA 4KUEA 4O6VA 3ZWVA 3KO8A 5TF4A 3OECA 1YL5A 3PJEA 3DZHA 1DOHA 3HUDA 4R69A 1IYZA 3CMMA 3LQFA 4DC0A 1OI7A 5L9AA 5JYDA 2C7VA 1LLQA 3FI9A 2C07A 2BKAA 5A03A 1RYEA 1W6UA 1HE3A 1F8FA 4MP6A 3OJLA 4NI5A 2DKNA 3DC2A 3F5SA 1PGQA 3O03A 5B37A 4XGNA 3K92A 4XDYA 3UXYA 3C1AA 1GUFA 2O4UX 5A9SB 2OFPA 5C7LO 1MLDA 1X7HA 2Q2WA 5GMOA 2PGDA 3EDMA 2JCXA 5L7YA 3GVHA 3PWZA 1W8DA 2J8ZA 1PJBA 3RKUA 5G2OA 5LDGA 5KJCA 3CEAA 3H3FA 4R4JA 1TA4A 3GDGA 2Y1DA 1YRLA 1P0FA 3ITDA 1RM4A 2ZIZA 4DYDA 1QR6A 2Z1NA 3BHMA 3G79A 2B4QA 1WXDA 4MJLA 4R01A 5IFLA 4IGFA 1GR0A 3VPSA 4R1TA 2O3QA 1A27A 1XQ1A 2FSSA 3VZRA 3FWZA 5I9NA 4OKIA 4LRSB 1ISHA 1HDXA 2DT5A 4QUKA 3DBRB 1PJ4A 4L75A 1WW8A 1R0LA 1C1XB 4OSPA 2CVOA 1PGNA 2W90A 3WWYA 3FPLA 1U2GA 1DBVO 1XU9A 1L1FA 4F6CA 1B3BA 3QP9A 3VVBA 3VDQA 2OUIA 3H9QA 1X7DA 2FZEA 4JROA 5C3MA 3A14A 4OYRA 3VPGA 3DHEA 3NKLA 1H6DA 3QWIA 4ND2A 1NASA 2IEBA 4RDHA 1V6AA 3ZW8A 3ZU3A 3S8MA 1PGOA 1B0AA 2D8AA 4E13A 1YBVA 3S1LA 3OIFA 1UZMA 4FPXA 5JC8A 4QECA 2X1HA 3OQ6A 2ZKLA 3PHGA 1J49A 1KVQA 4RPHA 4FCCA 2VZ8A 4TWRA 3SLGA 5I8WA 1NAHA 3TSCA 2D4AA 3I1JA 1DO8A 1T4BA 4GVXA 4Q3DA 2C54A 5DBFA 1IUKA 1R37A 4PLFA 3WLEA 3H2ZA 2VWHA 3PPIA 1P1HA 1M66A 1X0XA 3WQQA 1MC4A 4KDFA 2FPGA 1UXIA 3B20A 3R6DA 4UUPA 2B5VA 1XKQA 3S2GA 1LRJA 2BFMA 2CD9A 1Z7BA 1O95A 3QWHA 3IC5A 1LNQA 2YYYA 4L76A 3PDJA 1B3RA 1HWYA 1MV8A 2NTJA 3I23A 4K26A 1PJCA 4GX5A 1OC2A 3PLRA 3NAQA 4FN4A 2VYNA 3AM5A 4WEQA 2YZ7A 1GZ4A 3EHEA 5B12A 3CMCO 5JPIA 2C7GA 1DFGA 4ID9A 1I0ZA 2AQHA 1HF3A 2HMTA 2E37A 1T24A 1J6UA 4P4LA 1VL6A 4GBJA 3UUWA 1N2SA 1NYTA 1WLYA 4KOAA 4PVDA 1KVSA 4RZIA 4CL8A 3PXXA 4UVEA 1SMKA 5TGDA 3WGTA 2DFDA 3OETA 1K0UA 4CM3A 3MJEA 1DJNA 3ZV6A 2VT3A 1C1DA 1JAXA 3GGPA 3H8VA 3I4FA 4RPLA 3V2UA 5JDIA 3D4NA 4RORA 2B4RO 3UCFA 5KNLA 1CDOA 1VI2A 3AOEA 1MXHA 2C5AA 4TRNA 1I5RA 2EJVA 2RH4A 4A5OA 3BTOA 4XR9A 2B0JA 1IHXA 1VSUA 2PWZA 3INGA 3PVZA 5JBIA 3PEFA 4U6QA 2FOIA 1UXHA 3M1AA 3PGXA 4YJHB 4ZQEA 1A7AA 2J3IA 4WKGA 4JBIA 4ESOA 2NQTA 3RKRA 3PZRA 4A27A 4AG3A 3K9QO 2NTVA 2I9PA 2JJYA 1EVYA 3ASVA 2WD7A 1YS4A 3JCZA 1DIRA 4RF4A 5JAIA 1CRWG 4HFNA 3SXPA 1JKIA 4NHEA 1R12A 4II2A 2EEZA 2I3AA 1B8PA 3DMTA 3QLJA 4D44A 5C7OO 4MIYA 1JKJA 2BFPA 1V3UA 5DN9A 4PZCA 4XRRA 1ZK0A 2LDXA 5JNLA 4O5OA 1GD1O 4FFMA 2GN9A 4M86A 1PR9A 4W4TA 2ZQYA 3B6ZA 4MINA 2OL4A 4MO2A 2YV1A 3ZWNA 5T57A 3SLKA 4ILKA 1EDZA 4YTEA 2GZ2A 3NTOA 1C3VA 2HK9A 1O6ZA 4BO7A 1R4NB 1XYGA 3KYCA 2O3RA 4IY1A 1QRRA 3RCBA 3KM0A 2OP0A 1N1EA 1NPDA 1PU2A 1QP8A 3MTGA 4WEOA 4FJ2A 3OJOA 1GUZA 1UDBA 1Z7EA 2QRLA 1BG6A 3TF5A 1OAAA 1P3DA 1R0SA 2A92A 2FHSA 3B1KA 3OIGA 5COQA 2FR0A 3VH1A 3RU7A 5IAAA 3D7LA 1H2HA 5H81A 3TDKA 2Y1EA 3JQBA 3QQPA 4QFDA 4MP8A 3FN4A 4GX0A 3UVEA 1I30A 2G0TA 2YV3A 1YQDA 4NDNE 4Z6KA 1UR5A 3TRIA 2HK7A 3BMOA 4W9NA 1E7QA 2E82A 1PGJA 4J1NA 4RVFA 5B4UA 5DCUA 3MEQA 3WGHA 2ZCVA 1UH5A 3A9WA 4IXTA 9LDTA 2Y68A 4MVJM 3ZH2A 4ALMA 5T64A 4OXNA 1NFFA 1T26A 4JJFA 4N18A 4RLHA 4QTZA 5COAA 3RSHA 1U1IA 1KS9A 3NRCA 1E0DA 5JO9A 4PRLA 1G0NA 4OQZA 1U3WA 3JD0A 4WOKA 2JCVA 1CETA 3WGIA 1BXGB 1FXSA 1UAYA 1NX6A 1GV1A 2VHXA 1Y8QA 4J2HA 1HXHA 1Z73A 4M54A 4EJMA 3LF1A 2BLLA 1H9AA
chains in the Genus database with same CATH superfamily
2HNKA 1U1DA 2QMZA 2BE9A 1T25A 4MYHA 1ZHOA 2IUYA 2K2QB 1V7PC 3NIGB 4GI2A 3VSDA 3AB3A 4CR7A 4TS1A 4DBLE 1YJ5A 4J0FA 4F6RB 1PJ3A 5BUSA 1DV1A 3KU1A 3NP7A 1YUBA 1QSGA 3HACA 4LQLA 4OKSA 3ZHVA 3TDNA 1Z07A 3D9QX 4U7WA 4OG2A 4YO8A 4ZO7A 1N0WA 1FOEB 1PWYE 2CY0A 1EBBA 2LXNA 4UTOA 3FTFA 3G9ZA 4TLBA 2OHHA 2I33A 4FINA 5G0TA 1OLUA 3WLTA 1MMFB 4ENQA 4BO5A 1PFKA 5KJ6A 5BSUA 1EJ0A 1UBNA 1R6AA 4E32A 5A4MS 4DNPA 1O4VA 4ND4A 4TTVA 1Z06A 1W5SA 2CFSA 1U98A 4RD2A 5IPFA 2P9TA 3KDPA 1VLJA 4KPUA 4G1BA 3W9SA 4E1AA 3JTMA 3NTQA 4WPGA 3KR0A 2WTUA 5L53A 4BFUA 4JUFA 3BH0A 1Z0IA 3AHHA 2UDPA 5B3KA 3B78A 2QXUA 2X5OA 4GI7A 1UC4B 2GF9A 4DR1B 2CMDA 4K88A 3AFGA 5MHTA 2AEJA 2VBFA 1I6MA 1YKSA 4Y2QA 1X80B 1JEJA 5FLYA 1O95D 5LBTA 3T3OA 1WPRA 1NULA 3CO0S 1JFTA 4PYKA 3RK4A 2DT8A 3VBEA 2VK2A 4HEQA 4RY8A 3RWOA 4AJ1A 3EDYA 1JJVA 2B2XA 1UBMS 3JAWA 4UBOA 2DFKB 1M0TA 3L1IA 5DHAA 4BQRA 2QBYB 1W2HA 3ASUA 4KN6A 2AFHE 4XYEA 4L0QA 5E95A 5HE8A 3A9RA 2IY7A 3OLQA 8OHMA 4LOHA 2SKCA 4KRXA 3BJEA 4M1YA 4RS3A 3MMXA 1V8BA 5TXGA 4K05A 2JK1A 2AE2A 3COPA 3LBAA 1DLJA 2YXLA 2PR2A 4EHFA 3AEYA 1ZN9A 3U3KA 1WHSA 1X1QA 1LPSA 1IUNA 1SWWA 3H9GA 2VFAA 5IK2D 1OFHA 3QPDA 1JW9B 4F2PA 1BH6A 1I4OA 4J0IA 3DZFA 3B2EA 5LP6C 3I5UA 3ZGXA 4ICIA 1GG8A 3ZZUA 3ETEA 4NXMB 2ZPTX 4EGAA 4BQNA 3WNVA 5IKEA 1EAMA 1HE2A 1M1NB 1NSTA 2X0IA 5K3FA 4K03A 3HCCA 5KDOA 1FLAA 2R68A 4J1GA 1ULHA 3AGQA 4L72A 3N6RA 4U7HA 2AXQA 3MCVA 4OQEA 4J1QA 5DXJA 3RSGA 2Z2ZA 2WJJA 2BFAA 1W88A 1MFPA 2XDWA 1TW3A 4M1QA 1RMYA 4HDNA 2HDHA 4DREA 3THXB 2PMWB 2XB8A 3TD6A 1JFFA 2F9FA 2V7QD 4KWIA 4KZPA 4WGGA 1LPBB 1GP2A 1KDVA 1ORVA 3R0VA 4RA6B 4HR7A 3H5NA 4YT2A 1Q1GA 3KVNA 1XZEA 4F06A 5C5DA 3LLSA 3TTVA 4ZIRB 3OQJA 1IHPA 3B1VA 5AVZA 4WT7A 1JN0A 2KBEA 3EIHA 1LPNA 4QNNA 4ZT6A 2EBHX 1N33B 5TE9A 3HPQA 4J43A 4HAIA 1E79A 1TAQA 1A9ZA 4C3VA 1ZA2A 5D7NA 3IEXA 4HDRB 1TLFA 1XV5A 3O8BA 3E8MA 5JAMA 4YC7A 4I4NA 4URYR 1MA3A 2ZYVX 5EXXA 4EFNA 3K1TA 5HGXA 4JXJA 3R77A 5HSGA 1NXSA 3GNLA 4J94A 4ZT5A 3E27A 3FPHA 1N2GA 1PFWA 3VU9B 3CX8A 3IB3A 2XXAB 2CXPA 1KI6A 1W19A 3M9WA 2WW8A 4FHGA 3CY6A 4J0HA 4NICA 3T9BA 1IY8A 2X8JA 1DDGA 3N58A 4FFBB 5AHKA 3TRKA 2BHRA 4PN3A 5BUCA 1XYYA 1CR2A 3I72A 2IWRA 4QSHA 4GFDA 5SZIA 3LK7A 3FTPA 1QIEA 1KORA 3CG0A 4UTNA 1YA6A 1KETA 2AOTA 4UE2A 4W7HA 2QNIA 2HGSA 4X1YB 5IMBA 5IJ0A 3ECCA 2PKXA 1MUUA 2YW9A 3EE6A 5T6MA 4L08A 4ATNA 1LLFA 3U5TA 5IVIA 3ILSA 3KOZA 2Z04A 3U4GA 4RDXA 2YRWA 3HFRA 4EJ6A 2D1TA 2OG1A 2DPLA 4GXQA 3U56A 2JD1A 4UHDA 1CHDA 1YV9A 1QPZA 3A1UA 5LYJB 2C78A 3ZZ0A 1UKZA 2WIBA 3GRRA 2JI8A 4GLJA 2X7XA 4QPZA 1GCOA 2DPMA 1Z6TA 1E89A 3FUCA 4BKPA 2F8MA 1CSEE 3G8YA 3QKRB 1YRQA 4B7XA 3AETB 2CYCA 1OZHA 3BFXA 4FBMA 1LBEA 3USCS 4JOSA 4ZVPA 3TECE 3E22B 3E3OA 4AJKA 4URVR 3BB4A 2UV8A 3H9EO 4IL5A 5AK0A 2CMFA 2FPXA 1KAMA 4TRJA 3LBFA 3RVLA 4JHLA 1REQB 1TVKA 1NZFA 3AUUA 2GBLA 4KNYA 1J21A 1XN4A 1HYEA 3AKYA 4OMDA 2ZIWB 4CM9A 1UBJS 5JE8A 4EBBA 4V0NA 1A9TA 4KXNA 2GJAA 3HVIA 4HWGA 2YASA 4P7JA 1KXZA 1R00A 4RIEA 3Q15C 4A5SA 4AMZA 5HKOA 2F43A 2P0AA 2GK7A 2QX6A 3O47A 1RC1A 4JOCA 1NBIA 4O4LF 4PX9A 2QU8A 1SD1A 4L8VA 3JVIA 4E15A 5EXSA 5AT1A 1NYRA 1ZESA 2VXYA 4LN1A 4O2BA 3V4SA 5BSWA 2A5JA 2GHIA 4LF9B 4EA7A 4JI8B 5EL0A 3DLBA 1U63A 2AI3A 2TECE 2ZSDA 1VIDA 4HDSB 4HSEA 4X7PA 3GX1A 4UNRA 1F2TB 4K81B 1NF8A 4KPGA 2IGBA 2QP3A 1X1CA 2N3ZA 4R16A 1PJTA 3M89A 4UEOA 2R8ZA 1W5EA 4JKIA 1ZL2A 2R1UA 2QOEA 5TVKA 4H7PA 1FVOA 3OKAA 5DNWA 2IZOA 3KZOA 4LRYA 4Z9XA 4OI2A 1VM6A 3O1IC 2C20A 3EIWA 4CE6A 2DWCA 3W3AH 4I1VA 1U31A 5LQSA 2Q1XA 3ZOZA 1Z8HA 4NE9A 1XPOA 3TW0A 1C9KA 1W46A 3QF7A 4JLAA 3K4HA 4MPJA 4BNFA 4LF5B 1HSZA 2VQDA 3KTOA 1SXJE 5BRAA 5F77A 1H05A 1R50A 2O14A 4B80A 1TF7A 1MJGM 3IIIA 3SQOA 3KR1A 4K9KA 4E2WA 1IONA 1DNPA 3OF2A 3IEPA 3JYOA 5THXA 2PMDA 5AKXA 4F1KA 1O1YA 2VTEA 2WHEA 2BJWA 3DTNA 1I80A 1UEJA 1UXOA 4FEAA 4EPTA 5HKBA 3GMDA 4CR8A 4N1AA 3D7RA 4KB5A 1SB9A 4Y3UA 2CLLB 3HKEA 3WGYA 2OESA 3MWDA 5C8ZA 1DBIA 2H4ZA 3OE4A 1QONA 4OHMA 1V2GA 1KMQA 3WYGA 3DDNA 4R05A 5IMSA 2AFHB 1S2OA 1JDPA 3SIXA 4MITA 1VPVA 1OROA 4JP5A 4NOMA 1P0CA 4ND5A 4ESHA 4ETIA 4P5PA 1I4EB 4CBVA 3HPRA 4AYTA 1Y6ZA 4I2VA 3KOMA 1QHXA 1XVUA 3O4FA 1AKUA 2GMWA 3OHMA 1PR5A 2VL7A 1B23P 1FYXA 1I7DA 1E1NA 2EBFX 3OJ0A 3CKMA 3C3WA 4HH0A 3GP5A 2GB4A 4EG0A 2WIAA 5BNTA 2VTBB 4U7DA 3DUFA 2H5LA 5IUKC 1QYVA 1FUEA 2B9EA 3CT4A 4GMDA 5IJAA 3T7CA 4QDOA 2W2XA 1K2VN 3D81A 3N3AC 4X3OA 4EY4A 5K99A 1CYDA 4HJRA 4KKVA 4LRUA 3HR4A 5JDCC 1N7IA 3NBFA 2OXCA 4B4DA 5MN6A 1NBOA 3Q0TA 3T94A 3P9NA 4QSMA 4N54A 3BGSA 4ALIA 3C6MA 3K8ZA 4WWHA 5C81A 5K45A 2P6UA 2X3YA 5AKKA 1YC2A 2VHEA 2JFYA 1KJWA 1F1JA 5HQJA 4DB4A 4ZAWA 2IPAB 2X0JA 2FMHA 3EH2A 2OO5C 3DKVA 1II8B 2HRCA 1FJHA 3U4QA 1KAOA 5EWLB 5ALOA 2HQOA 3Q4GA 4FDAA 2VH2A 3K8OE 3IUPA 1B15A 2C29D 4PAWA 4YH1A 3HLYA 3O1HB 1URPA 2H06A 4QO7A 1L7AA 1FVHA 3R40A 5CBPB 1KC1A 3MGBA 1GGVA 3KV1A 4Q93A 1DKLA 1P17A 2C3MA 4UFOA 3W9UA 4CCWA 3BUSA 4WZBA 5WRFA 1EG7A 1PNQA 1N6PA 4MV4A 1C9JA 2IIBA 3FSGA 4FD3A 4GMXA 4TQUS 4JHXA 2QTLA 2DWUA 2FA9A 3LAWA 3S8YA 3E9RA 4A10A 5ICCA 1KI8A 3PU6A 4YVFA 3HKDB 1NKVA 1CJBA 3EQ6A 5ECYA 1XA0A 2JAPA 3VHQA 3YASA 4BKUA 2ZBQA 1P2UA 4A6PA 1E79D 4XKJA 1I3KA 5TC4A 2Q5QA 1VRCA 4KGZA 5CA0B 3PPYA 3BXPA 5I47A 3F0TA 3LFHA 2YNMC 4FFRA 2VZLA 1J7JA 5ENDA 1LW6E 3GNSA 1J22A 1PO7A 2VHTA 1BW9A 1P7VA 2XKBA 2OVBA 1RLJA 3FYUB 3ZWWA 2QF7A 4X8MA 4XEUA 5CNKA 5MFPA 1ABBA 3GJTA 5KNCA 1KPGA 3T9DA 3DYIA 3ZDAA 4BE4A 1P2FA 1QHIA 3KPUA 1Y3AA 4BAGA 4OX9Y 3ZE0B 1X86B 2FG7C 1Z6YA 1EKXA 4O33A 5DH9A 5T41A 5KC8A 3EA5A 4BLRA 1VLLA 3VO1A 1A5BB 2QMUA 1RRVA 3NO4A 2LKCA 4WE3A 5LWHA 4AB1A 2P9CA 1CEEA 2UZ4A 5D3MA 2RSLA 1GGKA 3PRHA 4WFKA 1CLUA 3PITA 5ALNA 5A5GA 3JALB 3QRWA 3VMMA 1KEPA 4LOLA 4F91B 5JQGA 1OZGA 4TKVB 1N2CA 4NPCA 1QH8A 4YAWA 2OPHA 1LS6A 2H52A 1H2ZA 3A25A 3EF3A 2M1XA 1JJIA 1PQUA 5GWXA 2G1UA 2QS9A 1V1RA 2GM3A 3ROGA 1YR6A 2ZANA 1EEHA 2YV2A 4LDPA 1CY0A 4H7DA 1KO8A 1DFIA 2FQXA 2V7VA 4HGOA 4W5HA 5HS6A 1IL0A 4MRMA 3H5OA 2JARA 4FOPA 3A2KA 4N8SA 4R1MA 4AJ4A 2C04A 1SQ5A 3RFUA 3IAM1 2D2EA 3D6MA 3OM1A 4MUEA 1WXXA 3M1YA 2IYZA 2VOEA 3QLTA 4NBRA 1EFVA 3TLBA 4XD2A 1Z5PA 2RHCA 3DAOA 2QPAA 4G9BA 1Z8DA 4LRXA 1SXHA 5KOHA 1Z3CA 5JAOA 3Q41A 4MQ6A 3CUYA 1B14A 1XGKA 4QYTA 4YNBA 5BW8A 3TLEA 2WT4A 5J4LA 3WXMA 1DBQA 2XSZA 4G2NA 3LPDA 4H6XA 1T2NA 4UNIA 2AW5A 5JSKA 4Q1VA 5H7XA 5T4EA 3RROA 5K8TA 2EGUA 4KZKA 3BKWA 3L8GA 1E60A 2G76A 2ATVA 3M8KA 3V3TA 4KBYA 1FDRA 2J0VA 3ZX4A 3WWEA 2WOJA 4HO1X 2BJHA 3FR8A 4PLZA 1LF0A 3HL4A 4V0MA 4CM9D 3SQLA 1F51E 1T2DA 1OYWA 3RBVA 2VP0A 4D0LB 5CFMA 4MX8A 4OUDA 3TCKA 3CKLA 1R0KA 3DBRA 5EESA 4L9RA 5G1OA 4CG3A 4NOKA 1YU6A 4Y7CA 1A4XA 1JA1A 1KP9A 3OE1A 2Y0CA 4K6FA 1UT8A 4N5MA 4ZZ3A 1AU9A 2A94A 4W99A 1BS1A 1QZXA 4DM7A 1ODSA 1N8NA 3F74A 1EGQA 4EKGA 2MSNA 3VYWA 1GL9B 2WM8A 1B74A 2PPVA 3PG5A 3D5QA 3IQZA 1QO9A 5B53A 3RSSA 5CPFA 1BCRB 4R9SA 2ZYHA 2XQFA 3VR5H 5EE3A 4JNGA 1NUSA 4BE7B 3F49S 3H8WA 3ZY4A 3DV0B 1DIGA 4XYBA 4CU2A 1BE0A 2Y0DA 3EGDB 4EW6A 1C1YA 2XH8A 3HO1A 4BBPA 4DGSA 2FWBA 1AN9A 1J8YF 1F4VA 5IXJA 2DUMA 5BSTA 5AKJA 1I5EA 2RIRA 1OH5A 2WLSA 4GPIB 2J85A 4S2EA 5IASA 3RVQA 4QC2A 5A3RA 3PTAA 1GA1A 4G07A 4P4SA 1ZH8A 2OR3A 2YJGA 3O7WA 4LXYA 3ENZA 4ZVQA 1JWLA 2ZTLA 2H4XA 4IJSA 1N0UA 1PBNA 4MYSA 4GRAA 4OREX 3AVWA 2OYCA 3L1UA 3MT8A 4I1RA 3H9CA 3PD1A 1XTJA 4RO0A 3C6ZA 5D1HA 4IO1A 3LHDA 4Z9AA 2RGEA 2PJRA 2QSUA 3OJXA 3VX3A 1V7CA 1ZMRA 2O7SA 3CJRA 4NYJR 3K3PA 4TUYB 4DR6B 2UZ1B 1PKXA 3BHNA 3LCVB 4RY0A 5HVNA 1LI7A 1XTQA 1ND6A 1G6Q1 4Q1BA 3HRKA 3GRVA 4FFOA 4MH0R 5EJ5A 1BVUA 4F46A 4KR9A 4JK3A 3CH7A 5FHRA 1J20A 1B6RA 3TMYA 2PS0A 4NZOA 2IIVA 2J4FA 3A1FA 4MQLA 4UOZA 2ZG6A 3EZLA 3P4UA 4L3VA 4UUOA 3RUIA 3IURA 4P8RA 4OHUA 3PHIA 4TKLA 1FYDA 2JFPA 1MDBA 1YULA 2O8CA 4R5MA 2IL1A 5TQ2B 4MVJE 1W0JA 4JI7B 3D7SA 2Z5VA 3CZPA 4EHJA 1ZOOA 2BOVA 3ZVRA 5C9ZA 2ZULA 1EUYA 1U1FA 4FEGA 3UAZA 3NRJA 2Z1DA 4D9EA 3OTWA 3NV7A 1S8AA 1YR2A 3HWRA 4WIAA 1E7SA 2HLDA 2WWWA 4TV8F 1DQPA 3FOWA 3PEVA 3FRJA 1KO5A 1NGSA 2B8EA 3O31A 4YB8A 3FOBA 2WUDA 3AR2A 3JRXA 3KQTA 4KYIB 4OYLA 5IJWA 2OHXA 5ESWA 1GPDG 1LDBA 4J16A 3ZG6A 1GGEA 3ILVA 2WA2A 4AY3A 1UJNA 3FUWA 5HM6A 2B6HA 2WM9B 3M0EA 1IQ0A 1C3XA 1JL3A 1YCGA 1FSFA 4KQXA 2DH5A 3KJNA 1XELA 3GGJA 4I50A 4MS1A 4RZQA 5EHZA 5E0KB 2P9QA 3UH1A 4X95A 1F0PA 9ABPA 3K20A 2Q2NA 1JPVA 1EM8A 1PJZA 4NABA 4O2LA 4MAFA 4PGFA 5LP6B 4JENA 4WZAE 2O2DA 3U81A 3EVGA 2BCEA 4DCVA 9MHTA 1S02A 2A9JA 2R00A 4JJGA 3S7ZA 2PGOA 3FSGD 1YRHA 3P5BA 3QUAA 4QHYA 1QTNA 3PUIA 4D7AA 4OHXA 5FH9A 5CVUA 4UCXA 2W2VA 1E6EA 3W2HA 5LR6A 1L1RA 4G6ZA 2OWEA 4OHRA 1FUIA 2E6UX 4MYRA 1HM5A 2BI8A 2NX2A 4Q02A 3CE6A 4U1RA 1OV4A 3M9LA 2D5AA 2P9ZA 2GZAA 3SBOA 3TL2A 3ENQA 2RJNA 4HNVA 3TQFA 3EMKA 1P91A 3G9UA 1PFQA 3AR9A 1LS1A 3GFOA 1N77A 1GQQA 3P1JA 1L8QA 3RLFA 1YS2X 3DEAA 2HWWA 4M87A 3ZEIA 3OY2A 2WV9A 4C5CA 4UXIA 4BNKA 1Y3IA 2NNWB 2XKAA 1TW2A 3GZ4A 3KYCB 3KJQA 2VF4X 3TZLA 1FSZA 1SELA 2IPOA 4RK0A 2Q46A 1EVKA 2COUA 2QSZA 3LVRE 1KH3A 5CM9C 3BD9A 4YRAA 1OILA 3M6FA 4D4IA 4LOKA 4YRGA 2Z98A 1H0HA 1YOBA 2Q5HA 3SOPA 1YZYA 4IZHA 3ZCPA 2VI5A 3IERA 1DKNA 4C78A 4MLZA 3TG8A 1RAGA 1W5AA 1YA4A 1NLMA 3MQFA 4M37A 3VV2A 3AV3A 1YKFA 4FM9A 4Q16A 3DS8A 5LU9A 2XZLA 2GJ8A 3CX3A 5K0CA 5KOHB 3AY7A 4CM1A 2R5FA 2WAXA 2QZJA 2NN3C 1M6HA 2H2HA 2HK8A 2XOEA 2ZDQA 4JP2A 4NENB 4GHWA 5FFFA 4WOPA 5ICFA 3RQSA 1FBTA 2P75A 2F9MA 3H1AA 2CE2X 4GQAA 4MEJA 1EVEA 4B5LA 4DLVA 4YMUA 5L3QB 1KJYA 4Z1MD 1WUJS 2XMRA 1NVAA 4UU8A 4D0RA 2XQJA 4MW2A 1YZFA 4X00A 5CM8B 3LS2A 4J2TA 1F8XA 1NXPA 2VDVE 3HB9A 1JE0A 3OCVA 3P20A 2JB9A 4AS3A 2J5XA 1PVOA 1RPJA 2RHDA 3EASA 5EN4A 2NSLA 5AJXA 4R1PA 2YBDA 3IVXA 3A4YA 4PFSA 4I19A 1KR2A 4DUGA 1U80A 4BNGA 5A1TA 1MH9A 3GD7A 3BZBA 2HYDA 4GMKA 3WHIA 3AF6A 3OZFA 3PDCA 1RAHA 3FIUA 3RGWS 4CM8B 5B3LA 3JARB 3KETA 4L0CA 3S27A 4Z4EA 3H11B 1M33A 3W7AA 1ZK1A 2GCGA 5I4BA 2XSZD 3KYDB 1ZN2A 4JLJA 4KK3A 1G7SA 3PWTA 2QRJA 3RVOA 3LKZA 1KYXA 3LP8A 4MWCA 2R47A 4NBWA 1U11A 3CFYA 4C89A 4L9WA 3DQQA 2AG0A 2AB0A 2A58A 4JL5A 3KD2A 4NU0A 5AW2A 4CF5A 4L02A 4UNNA 4FE7A 1U2EA 3GELA 3O6VA 2XDYA 4IDQA 4LRQA 4KR3A 4E51A 4K9LA 3AUYA 3TKLA 5KVAA 2AI1A 4A03A 5KKNB 1S1CA 1A98A 1E1QA 1G4AE 2IOFK 1ADYA 1TCAA 2PYZA 2CV1A 4GMFA 1MOQA 2DVMA 3F9RA 3TTSA 1NJGA 3TIXB 3AJ8A 2GCPA 3FNGA 3Q10A 4BC1A 3FVRA 5MF6A 1KJIA 4DJAA 2ZSAA 1ZRSA 1TM7E 3EEFA 3PCTA 4UD6A 5FO0A 3EZ9A 1VE1A 4YP0A 2XHEA 3UAGA 3QEKA 3IJRA 2FE4A 5BN5B 5LWQA 4YMSA 3E8SA 3PC4A 4D6XA 3DCYA 2C61A 5AHXA 2WMDA 3RSOA 2NU6B 4YCJA 4YQZA 3MCZA 3OC0A 1RHJA 3C3XA 3KYBA 1SCQA 5TGZA 4DSZA 2FQQA 2I2FA 5EC8A 2Z2YA 4UNPA 4D4MA 4CDNA 8AT1A 4QJ4A 4PCLA 2W6NA 2UU9B 3ESXA 3UGJA 1T6NA 4M22A 3BFPA 2PLFA 4EHKA 1E1CB 1D07A 1FNCA 1P3JA 4KRGA 4LC0A 3VVMA 4IIFA 5LIPA 3R8FA 4REMA 2ZAYA 1GADO 1EUZA 4CW7A 1XVIA 2Z9DA 4RVHA 3TIFA 4AJ2A 4GWGA 3SBEA 4C9BA 2I1WA 3PL1A 1T9AA 4C2AA 1VGQA 3U7QB 5BSFA 2FZ5A 2QUAA 1Z28A 1ZCZA 3V1LA 3ZCVA 2F7SA 2AD1A 1UP6A 5I7UA 1ZSYA 3C8HA 3LY8A 2O6HA 3H5VA 4LZWA 4YT4A 2NVUA 1MFZA 5CNJA 4MR9B 3L8ZA 3IT0A 5AJTA 2AMLA 1OXUA 3QXCA 1VKHA 4LS3A 2UKDA 5JMTA 2FN4A 1QZ3A 4URUR 3LY9A 1TK2A 3QQ5A 3NIFB 4RU1A 4N39A 1ESZA 4FD2A 4BLSA 4UVGA 2G8LA 3LZDA 4A91A 1W75A 1MG0A 1Q84A 1ABEA 3HR8A 3E9CA 3VZSA 3JSXA 4AIIA 1Q0RA 5I7EA 1ZP6A 4BO2A 4CETA 3UV6A 2YRXA 1KWGA 3ZUGA 1QM5A 2Q6LA 4UNQA 2VK4A 1W0JD 3C7DB 3MCAA 3WZLA 2VG8A 2CUKA 2QEQA 5ITVA 2HCRA 4FI3F 5DMHA 3UAXA 3VDNB 4NV0A 4AKIA 3SIWA 1HKHA 1F60A 2HLDD 1T8RA 1FFYA 1RWWA 2ZBEA 3K5PA 4DSTA 1YOVA 3E03A 1XX6A 3IEIA 3P97A 4GUAA 3EG9B 3L6OO 3QFCA 3K35A 2Q2QA 1NUAA 1MO3A 2WWFA 1U8XX 3O2NA 2SKEA 4MUGA 5B58T 3QVMA 1J2TA 3IALA 5HIMA 4TYNA 3BMCB 4IIJB 4PXYA 5DX8A 3O4HA 2IYXA 1C0PA 5DCYA 1GQRA 2YXNA 4I1YA 3DVLA 2R4UA 2BDUA 7GPBA 5LVAA 1EXVA 4Z4FA 3B8EA 2AI2A 2VP2A 5DTEA 1GPNA 1O08A 3CZMA 3KXIA 3GUYA 4EG8A 3R5JA 5EIBD 4OLAA 2ZJBA 1WMBA 2OHVA 4QNRA 5L40A 3B3AA 3ZN2A 3ZW9A 1HYGA 2MR5A 1NATA 3T7DA 3BFVA 3DBLB 1U7TA 3QVUA 3WMFA 4RMGA 2J9ZB 3A27A 4WINA 4Y9SA 1L5LA 4CV3A 4GSKA 2FE1A 3MTIA 3TRHA 3I62A 1IOWA 1C14A 1UBCA 4LWOA 3F6SA 1EZZA 1NVFA 3FTNA 4L4RA 1WB4A 3ZLTA 4KRFA 4LFBB 4L95C 2ASEA 4ER7A 2HMWA 1WA5A 1HL3A 4GQBA 4KACA 4R9UC 4ZO6A 3WV5A 3M6MD 1B43A 1XHEA 3KJEA 3OIUA 4N48A 2QD5A 4CTOA 2PFSA 2QZZA 3P0EA 2OCYC 3ULKA 2UZ3A 2IFTA 5JATA 1GRCA 1WX1A 1NFRA 3S2FA 5B4VA 5H3CA 1YDWA 1LK5A 2C2XA 1L5QA 4MV3A 5TJ9A 4CODB 5KDDA 1TO2E 5JNWA 3BMNB 3EXHA 4C7VA 2QU7A 5EKDA 1D2MA 3VH3A 2XAAA 4BMPB 1M6WA 1ZJ6A 4G86A 4X92A 4C01A 1XA4A 1TJYA 3GFRA 2WTEA 3NHJA 4ZRMA 5IUJC 5THQA 3LT2A 4JC5A 5HUHA 3DO8A 4N47A 2N47A 4BEWA 3JTEA 3F8WA 2OBBA 4CVNA 5GVSA 5F2OA 2PZEA 3QPUA 4M53A 4F8YA 4PZZA 4LFAB 4RELA 3OQBA 2JFNA 4XB1A 4HEA1 1MABB 2GAIA 2YUIA 3TNLA 3HY3A 3WK4A 4G1CA 3BB1A 1H3NA 2R85A 1XDSA 1XTRA 1JHQA 3ODGA 5CNIA 2PV7A 4L0MA 3L02A 2QT9A 2C4VA 4D79A 3TJZA 1IQPA 2I78A 1OF1A 1PK8A 3EOBI 4OK3A 3ZDBA 1XVAA 1BFDA 3RUDA 5BMOA 1FDWA 5CA1A 5J58A 5KYXA 2WWYA 1L5FA 4Z0NA 3U1BA 4BB5A 1O0BA 3IVGA 4X71A 3N28A 2E1RA 4QQRA 4R1QA 3WS7A 4EO9A 3GLIA 1IXYA 2IS6A 3NX4A 2XMDA 4I3HA 4CDGA 3TOZA 5K9ZA 4YUAA 3T1TA 5DKFA 1JDSA 4AJJA 4GI1A 4O4HA 1N1DA 2WUWE 2C9OA 2D06A 2PN1A 4ZGWA 5EHIA 4DUGD 2IYSA 3EWIA 4IG9A 3V46A 2IHKA 2JEYA 4DZTA 2ZUCA 3RC8A 4DUYB 3HTXA 3VX4A 3OO0A 4WKBA 5KWIA 1RI4A 4BHTA 2F3PA 4YHHB 1CHNA 2XMGA 4PEVA 5KCMA 3RE1A 2D59A 4JVLA 4YJ3A 4B73A 4AYWA 4EKEA 4MR8A 5KVCA 2OV6A 2PGJA 3OD1A 4R8LA 3BJRA 4QPNA 2QN7A 1HT2E 4PG5A 1E7RA 3GVCA 1LGYA 1VBKA 5FTLA 1ZZEA 4HB0A 4HGRA 3OA0A 4HTFA 2JFFA 2KJQA 5E1OA 2B8NA 1N5RA 1OW3B 4NFSA 5J3JA 1BD3A 2IYUA 1J70A 3BYZA 3G0GA 3HZRA 3JD2A 3ZD9A 4WKOA 2XMSA 2GPSA 3CF6R 2FZCA 1E1QD 1V41E 4KRYA 1RBZA 3NJ8A 3PVSA 5C18A 4I4IA 1F8UA 4J76A 1NMEA 4ER6A 4Y7DA 5CDSA 1O58A 3PEEA 2FEKA 3R0IA 5HJ7A 2ZLBA 5D01A 1E62A 3EZFA 3KNZA 5E9QA 3TOSA 1EWQA 1SCUB 4OIFA 1SVLA 4AUEA 1ZBDA 2XRFA 4RVCA 4H7FA 5BVGB 2A9RA 2IHBA 4M0UA 1EP3B 3DPUA 1IZ0A 5EEGA 2CCJA 3AVVA 2AMYA 2WIDA 4OQMA 1ZXXA 4KI0A 2B8TA 4ZANA 4B40A 4X62B 3W5SA 1DB3A 4B8WA 2KWIA 1S0UA 1O9GA 4OP3A 1ID1A 4JODA 1RJ9B 2D8MA 1WQ1R 1XDGA 4YUVA 4CMIB 2BP7A 1MQSA 1NDUA 1IATA 1WXIA 2X8BA 4LWQA 4LXTA 1MAVA 4HQNA 1VI6A 3MOIA 4MPPA 1KYVA 4XLZA 3AK4A 2IZ5A 2OXFA 1N6LA 2JLBA 4FWTA 1CEQA 1D9XA 2NSJA 4TM7A 2PANA 4L0DA 5F3RA 1AK9A 3RSQA 1KJJA 1UINA 1MH1A 4E11A 2Y1LA 4KPEC 1YQGA 1XNRB 2EVWX 2R1TA 4A82A 3E7XA 5FFNA 3EWNA 2A0FA 1EFPB 3OJFA 3P4XA 2Q4BA 3GGSA 1N25A 4B3IA 1DCKA 3DOHA 3G0BA 4OHPA 3RYIB 1FRVA 2ALJA 5J59A 3AF3A 1EHIA 2R5NA 2CN1A 1CFZA 3PQFA 4NG4A 4YCDA 3U7JA 1FYWA 2VBCA 3FIJA 3FMGA 5DLQC 5THKA 3TLGB 1GPAA 4F2HA 5BWOA 3U16A 4LDAA 1RPZA 4D26A 4DDUA 4V0SA 3KK0A 4ZI5A 3OICA 1W94A 2LCFA 2JAHA 2PWAA 3LYHA 2YRFA 3DTVB 3HCAA 4FGZA 4QRIA 1C7QA 1MX9A 4Z4HA 2VDLB 1CUJA 4GP6A 1A5AB 2BEWB 1J2YA 2XMZA 3HI6A 2CWDA 3N7TA 1YB4A 4KQGA 4LBYA 1UM9B 1UOOA 3DXFA 1GG9A 1JIXA 2BHSA 2PGXA 1E2KA 3DBVO 3IA2A 3IPRA 3LDHA 5DP2A 5ALVA 4ZMSA 5BV0A 1MRNA 2ZYGA 2QTMA 1P3Y1 3JATA 5CDFA 1FSGA 3QE2A 2O9JA 3L7NA 3VYVA 1WD5A 2Q07A 1LSUA 1T3LA 2YOHA 3FFWA 3P45A 3VISA 1H2EA 2F1IA 3VU1A 2FDCA 4OB7A 1K8QA 2X86A 3PICA 1VTKA 3MYYA 4S3MA 3HWSA 4LY6A 1C50A 1Y3BE 2R8BA 2EX4A 3DD1A 2XOXA 5C1OA 1U9JA 2AFIA 1EFKA 4D8VA 2YWCA 3BJMA 4FEYA 3WKDA 5HYVA 1H65A 3CSUA 4F4DA 4EGQA 1R5NA 1T3ZA 1O5OA 1JEAA 1ETUA 5DTIA 4AJHA 2H5JA 1DX4A 1H69A 3PX3A 5LA6F 1C29B 5K2OA 1P1IA 1WEKA 2HM7A 3FR7A 1JAHA 5TDHA 3EYWA 4W6ZA 2E48A 1RMQA 3RTBA 3U37A 3QEAZ 1UMBA 2O8BB 5I9IA 3EFBA 3AKEA 4M36A 4W1QA 3HB0A 3ZJVA 2QMEA 2BE7A 3ZTYA 4L15A 3HCPA 4L8LA 3PQ2A 2V58A 3R5TA 4UHEA 5K0NA 3UA4A 4KW7A 2VUHB 4B3RB 3VKHA 3HDGA 3OCZA 4FMPA 1RKQA 2ZSIA 4RF2A 5ALRA 2TS1A 2DPHA 2DQZA 1WAMA 4ZXPA 4CLXA 2BGNA 4D41A 4X6YA 1F9EA 2C4MA 2D3TA 3AEUB 1JHUA 2I5PO 1Q1EA 1TX4B 1ZG3A 4LXUA 5BNIA 4LMAA 3DD5A 2A1IA 4NU5A 4P0PB 1N2OA 1L6RA 1CEXA 1U3DA 2XCLA 5DHPA 5ES3A 4CIDA 1J8FA 3UK0A 4XARA 4BFZA 4NV3A 2C3PA 2UYGA 2GF2A 1KYZA 1W2GA 3C8DA 2EW2A 2F17A 1X7XA 4C88A 4HDKA 4PYOA 4D4LA 4CEIA 2ZIAA 4EVSA 1Q14A 3GFPA 3AR4A 3UJNA 1PUIA 4FKBA 4ZN6A 3RABA 1C9NA 4KWCA 1J97A 5AXCA 1JIVA 2RCYA 1T4DA 3H6HA 3I0ZA 4NAHA 5DBHX 4XFDA 1SO8A 3EEQA 4ZQHA 4CV1A 3TSWA 4I0WB 1NZDA 2GBLC 1HOTA 4TL7A 3I6MA 1E9BA 4JB2A 1CZLA 3EMVA 4EPRA 4PS0A 1JR4A 4IIDA 4DCTA 4YIKA 1P31A 1U6KA 1Z9BA 2UVDA 1SG0A 4IXMA 4ZHSA 4A0GA 2PZGA 2VPWA 4JI5B 4BAUA 3D4BA 2W70A 1Z5UA 2VJLA 3VR2A 5A05A 1Z37A 2XCOA 3G1WA 4D9IA 1H8HA 2W8BB 5B2EA 2HHCA 3TN7A 1QYDA 2EHJA 1LRKA 1UMCA 3OCCA 4ZVLA 1VMKA 4RZXA 5IWCA 4AP6A 1P81A 3LKDA 1V4NA 1QXSA 2GBGA 1T4MA 3LO5A 1I1NA 1C4KA 1M34E 3GR6A 2X6QA 1IXZA 2A1UA 2C7QA 3K7EA 3AVTA 5ALLA 4GKJB 5KTMA 3EVNA 4M0KA 4IZOA 1BXRB 2B7BA 3CH5A 1IJEA 4XSGA 4C6TB 5TIIA 2Z30A 2BFWA 4W63A 4JP8A 2IV7A 1QP4A 1NT2A 1D2EA 1EXMA 2FCRA 5D87A 2YR0A 3P2MA 2IDKA 3QEJA 1RR6A 5BRJA 2H1VA 5KB3A 3WGGA 3OFSA 4DLYA 4TL9A 2PSJA 1KJQA 5KBYA 1AE1A 4EPWA 3HCBA 1F7UA 4F84A 1U28A 2EJWA 1ZC4A 1YJXA 3D6FA 1T35A 3RV4A 4I8DA 3T6KA 3QMVA 3B7GA 4G1UC 4WK0B 4I4TA 1BWPA 3H4IA 4JKYA 4RHUA 1P6XA 5J2TB 2Z9CA 1P4JA 1DBRA 1NR1A 3ABIA 3Q7RA 4X1IB 4OGLA 1Z4MA 1K6XA 5FOUA 3UM9A 5ALPA 2I2CA 3K70D 5KKCA 3CLSD 1EK2A 3B6EA 3R2JA 3R3VA 3D6TB 4IIBA 3Q87B 3G9TA 3PX7A 3IUQA 1JG3A 3FLEA 2OILA 3I9NA 1UT5A 2VT7A 2OP1A 4G0QA 4PIVA 4JT4A 4Q9KA 1I6LA 5AVSA 1T8TA 2GZ1A 4GZ6A 4IGIA 2P2NA 4K2AA 5ED4A 2QX8A 3W5CA 3BC1A 3P9QA 2EGGA 2BR3A 1EFDN 2HNBA 3SK0A 3O3CA 1C30B 1CDEA 3BDAA 1G4HA 2CZCA 1ORHA 1XI2A 1NUUA 2VSFA 3PFCA 1RS0A 1DC3A 1FDVA 4LKRA 3VZQA 3CPEA 5GONA 5T3YA 4RPIA 1YASA 3ZQ4A 1A5ZA 3WGKA 4E03A 5E3IA 2IYVA 4LOIA 4EB0A 1M6VA 3WWOA 1FU7A 3W8FA 1KERA 3L46A 3R9WA 2ZATA 1IJBA 1SN7A 2OCXA 2KE5A 2P8SA 3A9UA 1YBHA 1NV8A 4P35A 5IC4A 5ADVA 3P0JA 2IF0A 5AD1A 1AGRA 3EXAA 4QM6A 2OK7A 4QHTA 1PHRA 1X8KA 3RS8A 3F97A 4PHCA 1Z4JA 2CDNA 2P9HA 4DJJA 5F9FA 5LN1A 5F2EA 1EI9A 2GFHA 2ZI3A 4TMFA 4WXEA 1NC1A 4ALLA 3H7AA 4CF6A 4YRJA 2JAOA 3JAMA 2OFOA 4QELA 3OSUA 5LM3A 1UPTA 2A1TS 3HA3A 3I2KA 2Y9MB 4CN9A 1H2XA 1ONNA 4UBLA 2Z0MA 4PICA 4O8ZA 2O8EA 1E9SA 2O19A 1N8KA 3UTDA 1Z39A 3MN1A 5C32A 1DELA 1KC3A 1N5LA 1Y5NA 1GTG1 3QVOA 1JAZA 2VQ6A 1BEZA 5KMGA 2J5RA 4Q3KA 4DLKA 2I2BA 3EB9A 1GUBA 1W4BA 1PZXA 2EP7A 2BMEA 1R18A 1U0RA 2HKIA 2W4IA 1SNYA 2FPSA 2I71A 2X2EA 3BULA 3EXFA 2HF8A 3F5FA 3RJ9A 3T7TA 3BTVA 4K40A 3SVLA 2MCFA 2O2HA 3F47A 1EGVB 3R24A 2NO0A 3PQEA 1L4BA 4M38A 2FWRA 2PH1A 4LI0A 4MR7B 1R8SA 5IW8A 3OWHA 3OZBA 3G8AA 3IHLA 4EP1A 2R8PA 3RF6A 3MIIA 2HQ1A 1SHLA 3ICQB 3BD8A 1LX7A 3F3YA 2OFFA 5JMWA 4EKYA 2QM8A 4C21A 3GROA 1BA2A 1U99A 1U7HA 2A5YB 2PLNA 3OZCA 5G40A 3VKFA 2F67A 1LXCA 4TL8A 1TLLA 4C4YA 3G8CA 2GEKA 1G5HA 2WJWA 3GYGA 1V3TA 1G5QA 4KQ1A 3AKCA 3NFRA 1ZUNA 5CLQA 3BWEA 4EMTA 5AQEA 2WD7B 3KJHA 4HWSA 3R7WA 2HRBA 5KWVA 3PLAE 2JGNA 5AXDA 4R51A 2CKDA 4ZOLF 2ABWA 1YFJA 4Z5XA 1BE1A 3DE4X 4IOJA 4ZAZA 3SSAA 3HBAA 2CWWA 3K1AA 5DRTA 3NETA 4FB4A 3L8HA 4LY0A 2ZAOA 3WRWA 2AG8A 2QTWB 1D4OA 2JIMA 3B1XA 2H17A 1JLSA 2OOSA 1ZW1A 2H2DA 4K1XA 2WZBA 5FCDA 2JGIA 3ZV3A 1SPXA 2G67A 1IFXA 4MAAA 2ES4A 5DM1A 1UP7A 3RUHA 3VAZA 2D6FA 3FOCA 4DQVA 2XGJA 1EWTA 5ALYA 3OTGA 3MD0A 5AYVA 3SZRA 3DE3X 3R9XA 3VU3A 3V1YA 3WK5A 3I32A 3WK6A 4IRUB 2RHMA 3CN9A 1J99A 3BWXA 4OXKA 3T4PA 4M8NE 1X7ZA 3HN6A 2B4AA 4KIWA 3HBLA 3TSOA 1IBMB 4ARIA 3V48A 4KQ6A 3AI3A 1QHHA 1TGVA 2W83A 2ZETA 5HZKA 3QTBA 4RC9A 5LZ9A 4DXDA 1EA5A 3ROPA 5HJEA 2I4RA 3EVBA 4PVCA 2AC2A 3E8XA 3Q8WA 2HW8A 3K8YA 3NUGA 5EFOA 1W44A 4XDZA 1QZTA 2AKYA 1EVIA 3DLCA 3CR3C 2JRLA 4NL4H 2EG9A 3NGLA 1W2WB 1AF4A 2GNAA 5CEFA 3ANTA 5EA2A 2FWMX