2HO4A

Crystal structure of protein from mouse mm.236127
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
254
structure length
251
Chain Sequence
ALKAVLVDLNGTLHIAVPGAQEALKRLRATSVMVRFVTNTTKETKKDLLERLKKLEFEISEDEIFTSLTAARNLIEQKQVRPMLLLDDRALPEFTGVQTQDPNAVVIGLAPEHFHYQLLNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKAMVVGKPEKTFFLEALRDADCAPEEAVMIGDDCRDDVDGAQNIGMLGILVKTGKYKAADEEKINPPPYLTCESFPHAVDHILQHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain containing 2
publication title Crystal Structure of Protein from Mouse Mm.236127
rcsb
source organism Mus musculus
total genus 70
structure length 251
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ho4A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ho4A02
4UW9A 2GMWA 5ALJA 4NWIA 4O8CA 5AI5A 4CE6A 5ALWA 4RESA 3FVVA 1TA0A 4CF3A 2YJ3A 2MU1A 3W5DA 2JGAA 4C4RA 1QQ6A 3I28A 1RPZA 1J8DA 2YMPA 4EENA 3SKYA 2ZBGA 1SWVA 1YDFA 3N28A 3I1YA 3PDWA 1RKUA 5AVVA 1N8NA 1Z4LA 2GHQA 1Y8AA 1TJ5A 2FUEA 3M9LA 4UAVA 4Y2VA 4E88A 3ZVNA 5AW4A 4KNWA 3NIWA 2HOQA 4JB3A 2BDUA 4HAIA 1T5TA 2HX1A 5AK3A 1QQ7A 1YMQA 3WK9A 2OM6A 1Z4IA 4HGPA 2HEGA 1O03A 2AH5A 3ET5A 1QYIA 5ALNA 3E8MA 4FE3A 4DFDA 2P69A 2RB5A 3AR8A 4KX3A 1RQLA 2QLTA 4Y2XA 4HGQA 2B1QA 3D6JA 2CFSA 3DV9A 5AW5A 3ZWKA 4MUMA 5ALXA 3HLTA 1ZD2P 2HHLA 1RLMA 3FPBA 2WF6A 3L0CA 2RARA 3QNMA 3WKDA 2YJ6A 2YFYA 2OYCA 4L57A 3OTQA 3N1UA 5ALTA 2FEAA 3W5AA 3A1DA 3RFUA 3L1VA 2Q4RA 4BX2A 3NALA 3L5KA 3AR2A 4BNDB 5AVTA 3HYCA 3ESRA 5AKIA 5AW6A 3ZU6A 4C4SA 2NO4A 5AESA 4L6CA 5ALQA 1TE2A 3OCZA 3L8HA 1Z4NA 3VAYA 2G07A 3KC2A 3ZTWA 1WVIA 5AW1A 1U7OA 4CNQA 3SD7A 1O08A 5ALZA 2DQSA 5E0OA 1T5SA 4Y2QA 5ALKA 4ZEXA 4NAVA 3SHQA 2ZXEA 3UMBA 2AUTA 2HI0A 3PGVA 3MPOA 5FP0A 5AVYA 3MN1A 5AIAA 3U7FB 4FYPA 4UU1A 3N5KA 4F71A 5AVQA 1YNSA 2R8YA 3UMGA 4XOUA 4NV0A 4UASA 5AHXA 4CF5A 4DWOA 3FM9A 1Z4PX 3ET4A 5A3SA 3U26A 2HDOA 3S6JA 3L0BA 2R8ZA 3L8EA 2ZBEA 2P9JA 2C8LA 3QU2A 5AK5A 5AK6A 4YCMA 2I6XA 2FPXA 2JAWA 5IT0A 3J7TA 1Z5UA 4OCZA 4UU0A 2AMYA 1IWOA 2WF9A 2FPWA 3NANA 5AI6A 4AS2A 5IS2A 1N9KA 1ZD3A 5ALFA 1EK1A 5AW3A 2IOFK 4Y2YA 4BBJA 3B8EA 4C4TA 1XVIA 1RLTA 3NRJA 4UMFA 5ALUA 3M1YA 5IT4A 2FPUA 3KBBA 4BYGA 4Y2RA 4NFLA 1WZCA 3IB6A 3SF0A 2C9MA 3L1UA 4HGNA 1U2SA 3N07A 1RRCA 2AGVA 4YH1A 3B9RA 5AKYA 2I33A 5AW8A 3KZXA 3ZX5A 2FI1A 3QUTA 5AVSA 3QU7A 4AS3A 2CFRA 3PGLA 5ALPA 5AKJA 2ZBDA 1K1EA 3UM9A 3QUQA 3K1ZA 2WF8A 3FZQA 3UMCA 3OCWA 4UATA 5AI0A 4UMDA 5AVXA 2JAOA 3L7YA 5AM5A 1CR6A 1QH9A 3U13A 3U7GA 1L7MA 2OBBA 1Q91A 4KN8A 4OHFA 5JJBA 3KD3A 2FPSA 4NABA 3SLRA 1F5SA 3NUQA 1L8OA 1Q92A 4YIHA 1L8LA 2EARA 2HO4A 2Q4TA 3AR6A 5AVUA 1ZS9A 2I7DA 1WR8A 3ZX4A 1XPJA 1Z4OA 1KYTA 3L0YA 2PR7A 3A3YA 2GHTA 2I34A 4J2TA 1L7NA 2P11A 2YMMA 3A1CA 1VJRA 2RAVA 3W5BA 1YV9A 1ZJJA 4BX3A 4BEWA 1J97A 2R8XA 2WF5A 3BA6A 4YCNA 3W5CA 5AKZA 5AW0A 3R09A 4DW8A 3AR9A 2B0CA 3QU5A 3KDPA 3QLEA 3R4CA 4YGYA 3ESQA 3ZVLA 1Z88A 4ZEWA 4YCLA 3NAMA 2Q5EA 1MH9A 5AVRA 2IYEA 1Z5GA 3WKEA 3QGMA 2NO5A 3WK7A 3NASA 1YJ5A 1EK2A 2IA5A 2YN4A 2ZG6A 5ALYA 4QQFA 3CNHA 1RDFA 4RETA 2NYVA 5AKLA 2O2XA 1Z4KA 2O9JA 4EX7A 4Y2SA 3ZW7A 2HSZA 2CFTA 2W11A 4GIBA 5AI4A 4UMEA 2C8KA 5AW7A 2I55A 3SMVA 5ALLA 1NRWA 2FDRA 3FPSA 3FGOA 4I9FA 5AIBA 3A1EA 4Y2JA 3QU4A 2RBKA 3EPRA 1L7PA 4BX0A 2ZBFA 1ZD5A 2WHEA 5ALIA 2W4MA 2IOHA 3TLMA 4MWOA 2JARA 2G80A 3R9KA 4UARA 3WGUA 3WK5A 3N8GA 3ZUPA 5T41A 2D2VA 2EATA 4HYTA 2G06A 2YMLA 2W43A 3E84A 2QYHA 3ZWDA 3BWVA 3AR4A 5AM4A 2YJ5A 5AKKA 1L7OA 2EAUA 3DDHA 3ZVMA 1SU4A 1ZD4A 1JUDA 2YBDA 5ALSA 5ALRA 3PCTA 4BEVA 5AM1A 1L6RA 3DAOA 1S2OA 3EF0A 4KNVA 2B1RA 5ALMA 1RKQA 2HF7A 4L6AA 5AKEA 4Y2PA 2WFAA 3RF6A 3U7EB 4KX5A 2FPRA 1QQ5A 2R8EA 1RMQA 4OFZA 4PNHA 1PW5A 2X4DA 1AQ6A 3OCXA 3P96A 5AI8A 3GYGA 2B8EA 5AM3A 4XE5A 3WKBA 4BNDA 4CF4A 2JAUA 3IJ5A 1S8OA 3L8FA 1NNLA 3AR5A 4EZEA 2FUCA 2I54A 2YJ4A 2C88A 1RQNA 1ZRMA 1RKVA 2CN1A 1Z4QA 3WK8A 5AW9A 4AP9A 2GO7A 2PKEA 4UM7A 1RMYA 5ALDA 4J03A 4Y3UA 3E81A 2G09A 3E58A 4G9BA 4HGOA 4JDPA 1RLOA 2VKQA 3L8GA 4YIKA 3OCUA 2BY4A 4H1WA 2C4NA 2HF2A 4GXTA 1NF2A 2MSNA 4KYTA 3EF1A 4UMVA 5AI9A 1Z4MA 3WKAA 3QU9A 4XQ0A 3AR7A 4Y2UA 3WK6A 3QXGA 1TJ4A 3QUCA 3ONNA 2WF7A 3ZI4A 4XPZA 4IG4A 3KOOA 1LVHA 5A3QA 4OD0A 5AM2A 3SKXA 4ZEVA 4DCCA 2B30A 3CZ4A 4EEKA 5ALVA 2WM8A 2B82A 4F72A 5ALOA 4IFTA 3ZTYA 1XP5A 1U02A 3I76A 3IRUA 2B8JA 5AICA 4I9GA 2BDEA 2ODAA 3MMZA 4EELA 1YS9A 3MC1A 5AM0A 1FEZA 3B9BA 2OA0A 2YY6A 3OCYA 1TJ3A 1VJ5A 3ED5A 2G0AA 3OCVA 4B6JA 1ZOLA 2GFHA 3I6BA 5AVWA 2PQ0A 2HCFA 3WGVA 5ALGA 1LTQA 2ZOSA 5ALEA 4UAUA 5AK4A 5AVZA 1T9ZA 1CQZA 1RC8A 1U2TA 3EWIA 4FFDA 2G08A 5A3RA 3QUBA 3F9RA 2P27A 3WKCA 1RMTA 2YMQA 4QJBA 5AKGA 4EX6A 3U19A 3QYPA 3QX7A 5AKHA 1U7PA 4HGRA 3U7HB 4Y2TA 5AW2A 4UM5A 4BKMA 1VFPA 4G63A 1SWWA 2IOFA 3DNPA 1Z4JA 1X42A 3AR3A 1WPGA 5AKXA 1ZRNA 3OPXA 3WK4A 5ALHA 2G1AA
chains in the Genus database with same CATH superfamily
4HNAB 2W7TA 3TTUA 3FYUA 5J1TB 1V6AA 2J5KA 3DMPA 4FWIB 1N36B 3NTVA 1XRRA 1J7JA 2NVBA 5D3ZA 4CG1A 1UJ5A 5FOVA 4QXOA 3CNBA 1C3XA 1IHUA 1RM5A 3BXPA 3JQEA 5K2MA 3BTSA 2JGAA 4ARUA 4I4IA 2O3TA 3TQOA 2R00A 4A6EA 2VWQA 3BWCA 2YW2A 2IKQA 2OC9A 2YMPA 3AUSA 4X8HA 1W25A 2LP4Y 3QVMA 1ZZGA 4RPGA 2R68A 1H0HA 3VKWA 1L5NA 1B7GO 1VPLA 2PG3A 3T61A 1SIUA 4HF7A 4B44A 4E7OA 2JLXA 2H0QA 1N0HA 1O4VA 1RLUA 2QDKA 4G89A 6YASA 1I32A 1T9KA 3A9CA 1WRBA 3GVHA 4JLVA 4KXLA 4Q7KA 4TLLB 4QODA 4RTPA 2GHQA 2R7AA 4NHEA 4QHSA 4Y2VA 4LIPD 2CJWA 4CKXA 3EK2A 1QH1B 5JCZA 2R65A 3BTVA 3PUYA 2QM7A 2P2YA 4MQLA 4YQFA 4LMBA 2RGBA 1MVLA 1JPUA 2GN8A 1OI4A 3L92A 3W3AH 3ESBA 1NP6A 5EIBD 1LVGA 4CG0A 5AK3A 1NNSA 2GQ0A 4GL2A 2HJRA 2CYCA 4W8GA 2EWWA 2XGOA 4EZIA 5JS8A 4UOZA 4KWEA 3DMTC 5FPYA 4YRPA 2DFNA 5FYQA 1QF9A 3FSEA 3M5CA 1VJ0A 1PJTA 1YVRA 1C29B 2Y05A 4KX3A 4M1TA 3I04M 3PLAE 4Z0TA 4JKYA 2PX2A 1FFCA 1ODJA 5D3KA 2LTAA 3EGDB 2Y6VA 1U7WA 3FNQA 4D9IA 3T6KA 821PA 2YY5A 2ZAOA 3A2LA 4PGMA 2JHFA 4PAQA 3M70A 5EJ2A 5CA1F 3DOOA 4UUOA 3RIXA 2QRVB 2VRCA 2TMKA 3BXXA 3F5FA 1BVRA 4MPJA 2WF6A 5EHIA 2VQ3A 1YBAA 1YKSA 2IYOA 1JJ7A 2RARA 2FZLA 2DPYA 1IONA 3FPEA 3IQGX 4PYJA 5J4YA 2JIZA 1JVBA 4ZP1A 1LW6E 5B2EA 3AETA 2ZAIA 2NV0A 2EP5A 3AOGA 3S4YA 3KZMA 1T6ZA 2F9FA 2K4MA 3QYFA 1FSZA 2O3SA 2ONZA 1B23P 3NHAA 1DBQA 3FHJA 1KZHA 1DOZA 1EHIA 4BPBA 2HSGA 1ZY2A 5FPHA 3QF4A 1QE3A 1U9JA 5KJEA 3TSWA 3BIFA 1JIVA 1W0CA 4AI6A 1YDWA 4JP5A 4OATA 4RV5A 4X61A 5CXSA 4IGAA 3CUVA 4WKOA 2CHFA 1IOWA 2I2AA 3OCZA 3P2YA 4WECA 3DBIA 4CR7A 4K2HA 2WBLC 3J7AC 1S2DA 3AUFA 2BM0A 4KCGA 3ZXYA 1E2DA 5HX7A 1IHXA 1IRXA 2I80A 5K5EA 1X8LA 4ZZ0A 2X7HA 2Y0PA 3ZK8A 4AJOA 4TN1A 4HBZA 2ZANA 4EYQA 3GP3A 2I7TA 4IDOA 4NARA 4WVLA 1ABBA 1LS1A 4YYZA 1AKYA 1EUYA 3NVMB 4IPTA 3INRA 2D1SA 4HNRA 4RMHA 4AUMA 1XZQA 5CIYA 3K0AA 4ZYLA 2P35A 2AD1A 2QMEA 1DUSA 1VSBA 3VC2A 1BIFA 1O0SA 1XTTA 2I4RA 3MPOA 5FP0A 4GOOD 2BD0A 2PS1A 3DZJA 4EUSA 1VM6A 2PH5A 3HHEA 3N5KA 2CDAA 2C0PA 1CVRA 1F4LA 5JCOA 4ZCPA 3M8KA 1S2IA 5B1EA 5JD5A 3IKVA 1XVLA 1NMYA 2VUSA 4QDXA 4J4BA 5FJJA 4AU1A 3SSAA 2ZYHA 3CLTC 3ET4A 4UJ3A 3VBEA 4XRGA 3WVNA 4KQGA 3V00A 5FTLA 3ZD6A 3GRVA 4A23A 4ND5A 2NAFA 5TGTA 2QRKA 3HDQA 2WJPA 3NR2A 3OY7A 3Q3CA 1TEXA 1CIVA 1I5OA 4HN9A 1XN4A 1H6BA 1ZN7A 2XKAA 3MS4A 5LXTB 4PW0A 4BVHA 3JWHA 2GBLC 1RYBA 1SKMA 3B3GA 2P4UA 3ROMA 1Y7TA 5JNVA 2IX3A 2AMYA 2VI5A 3DCYA 4L9WA 2WUDA 1EA7A 5FLYA 2EGGA 1JEJA 1N9KA 3UATA 3PGJA 4BWFB 5JZVA 3FR8A 4BBJA 2OKGA 5AMXA 2R6GA 4HX5A 3DKKA 2N3ZA 3TRFA 2GM4A 3JQFA 2XR1A 1ZGZA 4O2AA 4Q6WA 3GLIE 1P5FA 3R20A 3STXA 3UQZA 2FFRA 2GVNA 3CWCA 3N2GA 4BV2A 3I9MA 2VQFB 2WWTA 4N7MA 2B61A 1U8ZA 2HJWA 3HDJA 3X1KA 3H9CA 1DOHA 1YONA 3P9QA 5ITWA 5JIBA 1UMDA 2CF5A 4JBGA 2Q5HA 3BGDA 4NF2A 2DM6A 2GSWA 1KAMA 1YR6A 1ODTC 4G4SP 4QSMA 4ZT2A 5U4XA 4EUKA 1P4HA 3DVAA 5KVSA 5I7VA 3WHPA 3OP4A 2AJTA 5FNVA 1E1CA 2RHHA 3UH0A 1W2HA 1BCRB 2F1HA 3I2IA 3U9LA 1QCDA 3RFCA 5CDSA 4C2BA 2R60A 1K9VF 9GPBA 3UXYA 4YMGA 3FZQA 1KIMA 1UM9B 2R1UA 3EXG1 4W1QA 4KQEA 3QKSA 4UATA 2CV2A 1P2DA 1S0UA 2PRZA 3RE1A 4MIOA 3VX3A 2Y2UA 3W34A 3PUWA 2GVDC 3PXEA 4Y9UA 3KOZA 3NCHA 3ZZ1A 1ODLA 3GRFA 4GOXA 1RAEA 1L7MA 3E4DA 4WZBB 4ZREA 4Z4GA 3U09A 2LUOA 2VUUA 4P4GA 1SVKA 2JJMA 2BELA 1UMCA 3T3GA 3H1BA 4FIDA 5M2QA 4PO9A 2GEBA 1RI4A 2VSYA 2FCAA 2Z5LA 5IAGA 3GT0A 4LYAA 5ERGB 5BSHA 2X1LA 4KGZA 1PO7A 2QN6A 3PFCA 1R0KA 3WLQA 3IHLA 4I55B 1JQDA 1TKRA 4MTLA 4RABA 4U7JA 5U1PA 4EW6A 1ZUWA 2LDBA 4H3HB 2QZPA 2VHZA 4WOKA 8MHTA 7ADHA 3W1WA 4OTZA 2J3HA 2XMPA 1XMXA 4PFJA 1FU7A 1PQYA 5FBWB 1ENPA 2OG2A 3MWYW 3FHOA 3R3JA 4TM7A 4WI1A 1YR2A 1M6WA 3W5IA 1FTNA 2L69A 4NPHA 5LP6F 3VVBA 4IUYA 2B92A 2RC6A 2WW8A 5EXXA 4S24A 3T1TA 1VQ1A 2VNAA 4QT4A 3L43A 2CXXA 4RE6A 1ZI9A 1ISSA 4KIGA 2LPMA 2HQBA 5LQSA 2F3TA 2HD4A 1YASA 3L7KA 3FFTA 3HK2A 2VHQA 1DVRA 3E1SA 1CE8B 4YQZA 1CX9B 5E1OA 5K99A 1GGEA 3TQCA 3M7IA 2YTZA 5JSUA 1TJNA 4MQUA 2AZTA 2W2LD 2X6TA 4MR8A 3UGQA 4MLDA 2HBYA 1B8UA 1WIWA 5D7BA 4FHCA 1PQ4A 4PIVA 5TF4A 4TXJA 5CNJA 3H5VA 4NZOA 1U3TA 2PFGA 1SU7A 3LZ6A 2IYEA 1E62A 4HB2A 3DFIA 1UEXC 2HN9A 2NZUG 2YWDA 3Q5GA 5G4KB 2XXAB 5EYPB 1JYEA 4Q37A 1VXOA 1I94B 3UHPA 3EZYA 1M1YA 3CNHA 4KIUA 5IKMA 5LMZA 1N0UA 3LQRA 1LKZA 3PD7A 3EUAA 1T3TA 3FMGA 2DETA 3D3QA 2PA0A 2WU1A 1Z5NA 3ER6A 4FD2A 5GPBA 2BL4A 1VKZA 4X95A 4C4ZA 5EHNA 4UCWA 4E30A 3QE0A 3AF0A 1DRUA 4QTYA 3H19A 4HAZA 1GT6A 1M66A 1VZ3A 5EE5B 4B9EA 4XYEA 2VQSA 1NNUA 2R6AA 5KKAA 2FJPA 3STHA 3DR3A 4Q1FA 1MDBA 3RIEA 2ZIXA 1LPOA 3QNWA 4EGCB 2EFEB 1H2WA 2YN0A 1COWD 1L7PA 2VYNA 3IODA 4W8OA 3KOXA 2DPLA 4IIDA 3PGA1 5A4IS 5K8TA 2O8FB 2JIBA 4N01A 2FZWA 4NVRA 1BS2A 1UFKA 3BMNB 3P27A 3F73A 4WQMA 4CUJA 3KM0A 2W90A 3P2KA 1O6ZA 2QR3A 1IG3A 3E7PA 2RJOA 3IO5A 4MR7B 1DAOA 4MVJA 2QW8A 3SNHA 3WGUA 1YCHA 1KIAA 2V0NA 3MAJA 4CKBB 2V1UA 2EYUA 1MJNA 3MSXA 4X71A 3RKRA 2FRDA 2HT6A 2UUAB 1OX4B 1G8PA 3QY9A 4OB7A 3DDUA 4Q24A 2B94A 3EAFA 3I39X 3JQ7B 2EATA 2VDQB 1D6JA 4D9FA 1YVDA 2C5BA 5BRJA 1TM3E 4BNIA 3UOAB 4V02A 1HYEA 2GUWA 3AR4A 4OXYA 4ALLA 5EXDA 4E5YA 2B5OA 5AJTA 3FSGA 5BV1A 5HZGA 2PT6A 1EESA 1BXGA 1D09A 2G83A 5AKKA 2G9ZA 1L7OA 2EAUA 3IPXA 4DR1B 1DAPA 3RVDA 4L4ZA 1YRBA 1UINA 5I9LA 2FX2A 3TI7A 1NV8A 4C3VA 2HU8A 2NVUB 2ZJ3A 4OB8A 5KHAA 1C4OA 1GPKA 1GNLA 2ANBA 3ZHUA 3R5JA 1KY3A 4KOAA 4V1CB 4POOA 5I9NA 5JRJA 3QF7A 3UMSA 2ZRJA 3SJAA 3LWBA 1MFPA 1GPWB 1WX1A 4ITVA 1OZ0A 4F2GA 1KYQA 4MRNA 4ABTA 4IS2A 2PJRA 1A7UA 1DQRA 1NVWQ 5T4EA 4B74A 4H18A 4YRIA 2CDRA 3S29A 1H8HA 1N33B 1B8PA 3CX7A 3L6OO 3P96A 4MS3B 1E1RA 1UFQA 3PDUA 1E0JA 2AYXA 2Z43A 3A4TA 3H2IA 4O4LF 5B4TA 3PNVA 1TUEA 2IIQA 2PQ2A 2QR5A 5J1SB 3PEEA 5J59A 2WWVD 1UPUA 1GPAA 2AQIA 4OI0A 5TQ0A 3V1TC 4Q19A 2FMHA 1S89A 3I64A 3HR4A 3W7AA 4RD6A 2IV3A 4UTZA 1N78A 4MJ3A 4O0LA 4YP0A 4M7WA 1XEFA 4OX9Y 1DEXA 4OIMA 5GOZA 1OD6A 4ZU3A 4HMOA 2HQSA 1QFJA 4ZXPA 3R7AA 4CN9A 1C3OA 4UEKA 2QUIA 2YV3A 4BCDA 4BFUA 3TLGB 3Q3EA 4HVLA 2WUVA 4KNYA 4ASUA 3UWKA 4B45A 2J08A 3I01M 4RD2A 5BV2P 1IK6A 3R44A 4L74A 2BEVB 4N7BA 5BQXA 4NFSA 1B1AA 1VHLA 3FMFA 1TTPB 1UZUA 1SCUA 1DAEA 2ZUCA 3AFNA 1FRZA 3L8GA 1LBTA 4RANA 4RCZA 1SC6A 2PD3A 4KIFA 2BI4A 4C01A 4C6TB 3WYAA 5DTQA 1G8SA 1L7BA 1NF2A 2YWEA 4JJ4A 3H5LA 3BCUA 1YRWA 1D1SA 5KOYA 5KTOA 3KZNA 3C43A 4NBTA 1CEEA 1U28A 2HYDA 4EJ2A 3EZ9A 3AJ8A 2II6A 4N0DA 4AJEA 1NPDA 2AFHA 2NT4A 2Y1DA 1Q7BA 1VB5A 2IEBA 3ONNA 4ZHQF 3RJ9A 5AR1A 2X14A 1Q0QA 5EP2A 5FQOA 5TQVA 3COYA 2X4IA 4JIGA 3L4BA 2B2CA 1FPMA 1UPAA 2HK9A 2DQ4A 4ALIA 2PX3A 1E4OA 3R77A 5KQSA 3DDWA 5EXPA 1MA3A 1I8TA 2OLEA 4HHEA 1JG7A 4EEKA 2A3NA 2QQFA 2AFRA 2CE2X 3DL2A 4D4LA 4ZEMA 2FQ1A 3R6DA 1XRSB 1RYHA 5A0FA 2I91A 1TFUA 1PL7A 3LBFA 5E6RA 3ZV3A 4CDMA 1ZG3A 1KHTA 1QIDA 1NBMD 2WZQA 4OU5A 4P38A 4RIIA 2PE5A 3U49A 3GHYA 4DLXA 3QMWA 4QDZA 4D45A 1FU4A 1XRNA 4Q02A 1RHUA 3IAXA 1NHGA 4GRIA 1M6NA 3P0RA 1LDEA 5KNCA 1YIOA 3GBVA 2YV1A 3CF4G 3EHEA 1NXQA 1EK5A 1W6RA 3P9IA 1WXEA 3SX0A 4BUCA 3HRKA 2GBPA 3QPBA 1E63A 3F7OA 3WZLA 4I4TB 5JQGA 1JT2A 5I7HA 3F1KA 2MSLA 4QXAA 1Y9EA 3FBWA 3H6GA 4M0UA 4CG2A 1KS9A 1GKKA 3DZGA 4IR7A 5A4KA 4QOIA 1QYXA 3ANXA 1YMUA 4DDWA 2O7QA 1NC3A 4LG1A 1HM5A 2GFHA 3UNXA 4QJ3A 2XTAA 2A0KA 1PKXA 2OP0A 2IUEA 4NFHA 5IEBA 1KDZA 4DV4B 3MG9A 4KE7A 4H7PA 3GELA 1JEDA 2N9UA 1JEYB 4LN1A 3GGCA 2OGZA 1PLJA 5FL7D 3IC5A 1J7KA 2G9UA 5INTA 3BX1A 4BQQA 1YGPA 2XSZD 2ZSBA 1HFWA 2VH2A 5KTYA 1RZRA 3K70C 4FUQA 3RRJA 1RXVA 3I2GA 3QG1A 4U5QA 5ECGC 1L4GA 2AWOA 4B34A 5FOQA 1G0OA 2Q1SA 4BLRA 5KTKA 3VNVA 2EDCA 3MZ0A 3HCAA 5AKGA 4EHLA 4EX6A 1REQB 2GTIA 4LOKA 3IL2A 4LHSA 2DYKA 5ED0A 3LT5A 3ZXIA 2PT9A 3OO1A 1U7PA 4LRWA 3EJ6A 5B55A 2BW0A 5EQDA 1NM5A 4WJLA 5JVDF 4TMVA 3D4OA 5EMNA 4RTOA 2IYVA 1Y3HA 2CHGA 2J3KA 3IQIX 4I19A 4G63A 2WJZB 3OE4A 1CRQA 1GITA 3D1LA 4GGPA 5BSMA 2Q45A 1SPXA 3CUEF 3JQGB 4D0RA 4Z7OB 2AOVA 3RVJA 2MSCB 1HLPA 3JZMA 1O5OA 4KXWA 4RAOA 4Q9JA 5DX0A 2CKDA 1JWLA 4KXNA 5DNWA 4PTLA 3MYYA 5AI5A 4X24A 5ALWA 4OQEA 1R5JA 3MF4A 3SYRA 2VS1A 2W8BA 1BTOA 1HYGA 4PYQA 2C31A 1F8XA 1YS1X 3ENQA 4Q93A 1EE1A 4JA0A 5KNBD 1QTIA 3LQ4A 5FXMA 4ILEA 3ELBA 3PHLA 4I5GA 4YMIA 1Y7LA 3V1MA 4M54A 2ZZNA 1QRDA 3MWGA 5B6PA 1EUDB 3TOSA 1IY1A 3KQQA 4YXWD 5HSGA 1XEXA 4GDFA 1VYTA 1KFBB 4ZI3A 2VP2A 1QOPB 3E7FA 1KI3A 1VG0B 3G89A 1DS6A 5IUJC 4QOHA 4RSHA 4WY8A 4QUHA 2XIJA 4MPRA 1CS0A 2Z3ZA 1JFRA 5AQEA 1AT1A 1DXHA 2Q6LA 3DWFA 2F3SA 1P0MA 3EN0A 3NIWA 2RHTA 3R5HA 4LXIA 3TTVA 1M2KA 2OLJA 1C1YA 3CZ5A 3FWHA 3UHAA 1C1DA 3TD2A 2EV9A 3KT6A 1T5OA 2VQEB 3EMBA 3RRYA 2R4TA 4HH1A 3K6KA 1KETA 2VWHA 4LF4B 4CQJA 2Q3EA 4TYYA 3TIFA 2PX6A 2YS7A 4HGPA 5IDVA 5NULA 2GNPA 1E2KA 1B3RA 3G7UA 2PLFA 1T0JB 1PWHA 2QD3A 4Q3OA 4Z1MD 1XWWA 1N2CA 1OWMA 4HQ6A 1ZJZA 4F46A 3RSSA 1ZX1A 3C45A 4A7PA 1P8JA 3BA1A 3ZCPA 4B1FA 1OH5A 1RWKA 1A88A 4LTDA 3G59A 5HJ7A 1V71A 1SK8A 5LR6A 2FQQA 2R79A 1T8PA 2ZJ5A 3FPBA 1K6MA 1P2UA 4G1FA 3VI3B 3QVKA 4IGEA 1Z9BA 3N7UA 5EE3A 4UULA 1YFZA 1JBKA 3OWOA 1UJ2A 5JY6A 5JSZB 3A4VA 4PSKA 2CXRA 4Q1AA 3HJHA 4EEZA 1L1FA 1HNXB 3E15A 4Z0PA 1FL9A 1E9RA 2BP7B 2RAFA 3LXRA 3O2JA 4FJ2A 4J2OA 1W2GA 1L7XA 2R751 4MW6A 3MMSA 4MICA 4HS4A 4JODA 1AV7A 1G5TA 1M8JA 2B0JA 1EK6A 1JPJA 3I23A 2OK7A 5EIHA 4CR6A 2I4TA 1N8TA 4FGUA 3AY3A 2NSLA 3WLHA 2Z0MA 3VHLB 4GRAA 3RJZA 3DOUA 5F7OA 1WBBA 4N7JA 5DN6A 3FPKA 1ONSA 1PD0A 2Z2JA 2OCAA 1X1RA 2PT5A 4IX1A 4JITA 1U4NA 2NO4A 2FH5B 2VQDA 3MTGA 4HXFB 3DW1X 4WDRA 4UHJA 3I5YA 3FYHA 3L8HA 3Q11A 3SG0A 2UZAA 4F6RA 4FBLA 4Q7JB 1NNI1 4Q03A 1JR6A 3IQHX 2AK3A 1WVIA 2R86A 3CF0A 1KJIA 2JIZD 3IESA 2WFMA 5CB4B 3CX8A 4ZEOA 3RABA 1SKBA 4MRMA 4H7KA 2QTWB 4OMCA 1UC8A 2VCEA 1MB9A 3RYFB 1CULC 5E0OA 1P9NA 2ZPTX 2QP9X 2XRFA 3E7XA 2GLTA 3N74A 4HQRA 4IO0A 2YS6A 2O2JA 2DSNA 5CVEA 1R4MB 5IRCD 3DGFC 4PNZA 3K94A 4QVGA 1O95A 1YFKA 1UXJA 4NQZA 3W5SA 4S05A 4PFQA 3I9V1 2IH5A 5DW3A 5AVYA 2CNNA 1X87A 1ULSA 3GZTB 3NWJA 3PL5A 5EWMA 1UT6A 4RTLA 2ZRAA 2YWHA 2PVSA 4Q9KA 5AVQA 2BGNA 3PQ6A 4OFXA 3O47A 5AUPB 5F23A 1OI2A 2B2XA 3FD8A 1J8VA 1XK6A 5JDCA 3U48A 4IIEA 2JIQA 4NJMB 5FFMA 5HJ5A 1MRSA 1JHYA 3WB9A 1IUNA 2M1XA 3EWSA 4MV8A 3VU9A 3GLRA 1TO6A 5DWVA 3GLIB 1QGOA 3TCNA 3RKUA 2FPXA 4KE6A 3B6EA 2FRVA 4ZT3A 3HJRA 4JJEA 4N0PA 3D54D 1R18A 2PH1A 3W0LB 1YRYE 4URHA 1K7FB 3AONB 3SBXA 2OMKA 4OH7A 1ISJA 4EY5A 4LJRA 2REBA 3EXHC 2GKOA 1KFKB 5CHYA 4EG6A 3T9CA 3N53A 3KU1A 1M6YA 1A98A 3VR6H 4ESVA 3U1VA 1VKJA 1V1RB 2KJQA 1E1YA 3HGMA 2Q0SA 4O2AF 5LM3A 1GZ4A 2A14A 1PV4A 3IB6A 3E18A 3P9KA 4FX2A 3UK1A 4Y6QA 4K9NA 2B69A 4COOA 1M1YE 2I3AA 2VUHB 2DQYA 2AQ8A 2OP1A 3QV1A 4J1TA 2GB4A 3LVFO 3H1EA 2ACKA 2H4HA 3GUCA 2Y4NA 3KZXA 4MH0R 1KDRA 3K9BA 1JLRA 1GTG1 1XX6A 3I1JA 4UE6A 2WTBA 2B5VA 3ZV4A 5JH7A 4FGSA 3QUTA 1ID1A 3D5EA 3D4IA 2BM1A 1K92A 2OOKA 1M34A 1N1DA 5FNVF 1C8KA 3WB1A 4AYXA 4OGLA 5C80A 3BCRA 2GH1A 1TM1E 3CC8A 4WHMA 1XCGB 1D9ZA 3DBHA 3HDHA 2L82A 4RH0A 3HCCA 4LZOA 1W94A 3JRWA 3WLJA 1EHCA 3PUVA 5ARCA 3BE6A 4FLEA 1UKZA 1DJPA 4KI7A 4LZLA 5LOVB 1BRTA 1QV9A 1JPNA 2EHJA 2HXSA 2GCOA 2JAOA 3L7YA 5K4GA 1N2XA 3V48A 3GOHA 5DJ5A 2UYQA 4AROA 721PA 1XHEA 2XWQA 4BO6A 1M2VB 1V5FA 3BMOA 4M1ZA 4OHFA 4ZVQA 4K6MA 3GJ3A 3C8ZA 2RGAA 4QWWA 3X1DA 4IDDA 2PMKA 4ZVPA 3GFFA 1QHFA 3NOOA 1P5ZB 5JXIA 3NRBA 4AKIA 2CJFA 3BYZA 2N0SA 1QC5A 1W35A 2AR7A 1C0LA 3SDBA 1IAQA 2OC4A 2ZR9A 4HWGA 1RZVA 1U3DA 5DI9A 2WV9A 3KLBA 1RXUA 1NDHA 4ZV9A 2CKMA 3BWBA 3SSMA 3C3XA 2JI6A 4UZSA 1HI9A 1WR8A 1VCHA 2EBUA 2AT1A 2HJ9A 3CINA 3I8SA 3OIDA 4RFLA 5FAXA 3RK1A 4XAQA 3A37A 3W2EA 3LBHA 5D3MA 3G2IA 4J2TA 2AOTB 5LDHA 4C87A 4QULA 5FUXA 2GXSA 3T9FA 2OFPA 2WPDA 5HILA 2H4XA 3THXB 3DXXA 4QGHA 3BREA 1MAAA 4RHYA 1HT2E 1Q44A 3NJ8A 5I9MA 1UC9A 3OFNA 1PNRA 3A11A 1CP2A 1KZ4A 4NCAA 2B1JA 1OLUA 1EX6A 3PNLA 5G3YA 3AB3A 3ZS8A 5HW0A 1X7XA 5D85A 4B9AA 3L4KA 1E1NA 1XROA 4KIWA 2JVKA 1OIVA 3R24A 4QOJA 5KSZA 2ZRLA 1SCQA 4BO5A 2FP3A 2WAMA 4JXXA 2XWPA 1NVVQ 2NO9A 2PMCA 1Z7EA 2ZR8A 3WGKA 3OE7A 1TAHA 4DUYB 1BW9A 3RUEA 4QAQA 4UHCA 2PZGA 1CUZA 3ZGLA 4L8WB 2V5AA 3DTYA 4P5PA 1GCAA 2PS3A 5E6SA 1Z5GA 2JKVA 5H4HA 1TA4A 2JCGA 3CRNA 4IM7A 4N18A 4A03A 2WWYA 2REQB 2BC9A 3CNEA 1EDOA 1YE3A 2C7RA 1X7YB 3PIIA 4DLBA 1IXYA 3AI1A 4N5IX 1B42A 3UGJA 1PG2A 2BKEA 2IZ5A 5KWIA 4G1BA 3M33A 2QRUA 2E48A 3FGNA 3Q3JB 1RWQA 4YRQA 2H63A 4P2GA 3ZIAA 2HWUA 4YRCA 2ZWPA 2DHRA 4BL5A 2R8OA 2V7XA 3PJEA 3UJAA 3BHNA 2PS9A 3K32A 5LBUA 1NXSA 3KLNA 1QJCA 2CFTA 1CY8A 5FPKA 4TSFA 4YDHB 2ET6A 3HZOA 3FI0A 3N75A 2JGLA 4JR2A 2I4OA 5ALLA 4C7OA 4JT2A 2PS0A 5DGHA 1FUUA 2GN1A 3RUPA 1YJ8A 1U8CB 2R2GA 1A9QA 4FCCA 1DC8A 3K5IA 3KS9A 2AZDA 4DQXA 1DNPA 1AXGA 2FEXA 3WV5A 3VR3A 3EPRA 3QBJA 4GOMD 1UBEA 5DH9A 1C8LA 1KSJA 1E4EA 1QKKA 2A30A 2EW1A 2HKIA 3MT0A 13PKA 4ACBA 4LGYA 1EEXB 2WT9A 2FFAA 2O1XA 4AJPA 2M6SA 1EFPA 3AU9A 4IVQA 3OHPA 5FOTA 2OE2A 1WMFA 3N59A 4MVJF 3DC7A 2O05A 3TZQA 1IEWA 3TRJA 3IUYA 5JROA 1FW6A 3TAUA 3WK5A 3DL0A 1YI8A 2PUCA 3X2EA 4BEBA 5CH5A 2RONA 4YRRA 3PTZA 3ZOZA 3MHPA 5ITZA 4PPGA 2E49A 4O59O 1VBMA 2IELA 3KQUA 3ELWA 3N2KB 3ZWVA 1WKBA 1QQBA 2O7VA 2VYND 5J4HA 2FLKA 3M5WA 5ESRA 4BATA 3FUCA 4Z4IA 3KZOA 1WSAA 2JGIA 2ETVA 1WHTB 4FGZA 1E79D 4FSDA 4J6EA 1S3GA 2C5EA 3ML1A 5EJ9A 1H3EA 3W4KA 1FJ2A 2V1XA 3DAOA 2RHWA 3FGZA 4FYXA 4MVJD 3PPXA 1DEAA 3BTOA 3BMQA 4EYOA 2HF7A 2VO1A 5FIUA 1XEAA 2Y67A 2WAAA 3K2QA 4GPEA 4EUEA 1NX9A 4ENVA 1JHRA 4PYLA 1A7AA 4GKBA 1M1ZA 5DISB 3TB4A 3QFHA 1I2DA 3OX3A 4W82A 4XQCA 1E2PA 2IE0A 2ORVA 2YFHA 4XW2A 4GPAA 3OCXA 4HLQB 5HQ3B 1VKRA 5NLLA 4M88A 5L7TA 3D8RA 3MRTA 4G9GA 5JEDA 4OYLA 3P20A 4OV6B 4JLDA 1EX1A 1E1QD 3HDTA 5JS7A 3WYCA 3KQLA 4KUHA 2OCKA 4YHBA 3CLUD 2ESRA 3OJCA 3L8FA 4RC9A 4C08A 3P9XA 2JEYA 2FHSA 2V9ZA 4JD5A 4GT1A 1LDGA 1MTZA 3P9CA 1XXHE 4FNMA 2P68A 1UDRA 1P5JA 2Z08A 4M0LA 3EQ8A 4JJ6A 3UENA 1CHDA 1Z4QA 1YOVB 5AW9A 3TD9A 3OI7A 3PJRA 1QHGA 3T5MA 1EU1A 2VLBA 5ES4B 3AVTA 1PT5A 2J3QA 5DIZA 4EF6A 2GZDA 1EJ6A 1L4NA 2C07A 2IODA 2C5HA 2QZ9A 4B75A 3W77A 4CFYA 5JBIA 4ZAFA 5EIXA 1Z18A 1E1RD 3VH4A 2CMDA 4FIZA 2G1KA 1EWKA 2CLSA 4XFKA 3VV3A 1XB2A 1XZKA 5JYCA 3CRRA 1P3Y1 3IAM1 1GAWA 3EF1A 1GTZA 4G36A 4MWCA 4UMVA 5EIAA 3CUTA 1RWOA 2P7IA 4H6VA 3RLIA 3DM5A 3RG2A 1HYHA 4R1PA 3EX7C 1NP3A 1JKJA 1DFIA 1ZAYA 2C9OA 1QBGA 4PC1A 3V8MA 4BNYA 1PVVA 3FI9A 3HRIA 4ZCLA 1A8HA 4YFVA 2GASA 3EDYA 4ONEA 3G23A 4P3NA 1WB6A 2FFQA 2F1JA 2TMDA 4G0WA 2AQKA 1CEQA 2QLNA 1SUIA 4KXVA 3BXGA 3FBGA 4H17A 1KE2A 1OROA 3JR3A 2FSVA 2RC5A 1XNJA 1PZXA 2ZB7A 3A9TA 3FSJX 3TL6A 4MMYB 5H0IA 1CUCA 2AN1A 1EBBA 3CRMA 3JS5A 3O93A 4G09A 5SZIA 1LY1A 1X1EA 2B82A 4JOQA 4U39A 4A4DA 1DX4A 3IIJA 4BAZA 2EGHA 1ITZA 1EB8A 2PGNA 4BFZA 2KS6A 3ASYA 4U7HA 1PYGA 5E3HA 3OU7A 3FCCA 4U00A 1HFJA 4W5RA 3I73A 1KDTA 2QORA 3OLYA 1DBWA 4AZTA 5U9CA 3VQTA 2WIKA 1D0IA 2B4KA 2OFOA 3DLAA 3K9GA 2Q5JA 3CMCO 3PHCA 5L40A 1CY2A 3GOQA 5K3CA 3QUAA 4XLTA 3S7TA 2CCKA 5JQGF 4B6EA 2NP6A 1AJEA 3A9SA 3UIEA 1UKAA 2W2XA 3TMKA 2IVZA 1E6KA 5H82A 1YZ3A 3C8MA 1N2CE 2B36A 1SN7A 1DCKA 1M8GA 1HUQA 3EZ2A 4DM3A 5GGXA 2EKQA 5AVWA 2HQRA 4CIYA 3AETB 4OHMA 4BO3A 3OG9A 1UXHA 2EYQA 2JLAA 3USZA 5JI3E 1NN0A 4C07A 1U8XX 1V5WA 5DOVA 1RAAA 2YWCA 2O8DA 3QMPA 5ALEA 3O3MB 3JQ8A 3PXBA 2OV8A 1H9CA 5HKOA 2A8YA 1H1DA 2GCNA 2ZJZA 3CR8A 1IY2A 5T6BA 1FFAA 3X2FA 5DNUA 3T1YB 2G7MC 4L7QA 3G7NA 4E70A 3NTXA 1HDEA 1VL5A 2REOA 4FBGA 1IUOA 4IJUA 4I2NA 4NYMQ 1N8KA 4PNPA 3PNBA 4FK8A 3KFXA 5KVCA 3L0OA 2J9RA 1HE4A 2QHXA 2ZYAA 5IK2A 2PUVA 3QXJA 1E0DA 1AZSC 1PN3A 4FNAA 4QTZA 3FAZA 2BFPA 1HG0A 2K87A 4PZUA 1N2BA 3F5MA 3PPIA 4QYTA 3VYTB 4EG8A 3HTXA 1E6UA 3QW4B 3RM3A 2PM8A 2ZRCA 4YACA 3A6JA 2O2EA 3ZWWA 4YI3A 4PYNA 1H66A 2O2IA 3HB1A 1R0XA 5K3FA 4EI8A 4ND3A 4NU5A 2PK3A 4I6GA 1EAMA 1SVSA 1NX6A 2W6PA 4BDSA 2I0FA 2BFAA 3W8NA 5LZ2A 4QKQA 2IYZA 3E61A 1C4KA 4XD2A 3I0NA 3L40A 2VJMA 3ADCA 4GKKB 1JLLB 1GZUA 2DQKA 2PUTA 4LVUA 2D0DA 4LRQA 5BYJA 3TOXA 421PA 5K3OA 2AUMA 5HS6A 1OAAA 4D3SA 2YJ3A 3GMDA 1LI4A 4OQQA 2X3UA 5JBQA 2OCDA 3TLCA 1WCYA 2FSGA 4INJA 2GAJA 3BG5A 2ODWA 2QRJA 2VFAA 1FNNA 1U1IA 3QNUA 4WLVA 1QDEA 4KHPB 1LNZA 1PEKE 5LQNA 4C5BA 1LNSA 4QRDA 5TF0A 5K45A 3NVKI 1FRQA 1VJ1A 2XAAA 3KSDO 1OB5A 5F9HA 2X0RA 4G1MB 2VXYA 1W7AA 2VQ6A 3IXMA 2XMDA 1DO0A 4BV9A 1ZR4A 2I9PA 1Y8AA 3LLVA 4RCYA 3AO0B 3C5CA 3N2YA 1Y7IA 2ZU0C 2FLVA 2C3UA 1ZOOA 3UHOA 3U40A 3P97A 3TOZA 4DJTA 1Y80A 1QKJA 1K6IA 4LAFA 3O8LA 2IFTA 4Y9TA 4HZGA 1T5TA 1YWGO 1KQOA 1RQGA 1V3QE 3HU1A 4O2AB 5JDIC 4G8DA 1ULZA 1ZUD1 3KUDA 3ORYA 1EVKA 3O38A 3ZH9B 4D2IA 1Q16A 4GKJB 3LPLA 3IHWA 5LZ4A 1G5HA 3L04A 2CXUA 3ZLUA 2AFVA 4OF4A 4I81A 1UMDB 1AN9A 4B09A 3MTAA 4UU8A 1CF4A 2AVDA 5FV4A 3UAWA 3R8FA 4B80A 2QLTA 4GUAA 2IPXA 4Y2XA 2QS9A 1FE8A 1TFRA 1RPAA 2Y2VA 1RYNA 3DMRA 3LA6A 4BBPA 1C41A 2CNBA 2CHUA 4MUFA 1Z2OX 1YFJA 3NHLA 1P45A 5KQMA 1FDWA 4AB1A 2WQ6A 5KO2A 2NX2A 2ODTX 4R05A 3QITA 1BWQA 4YAEA 4NK4A 2IYRA 3QKSB 1RT9A 4NAHA 4NZ9A 4EHAA 1E3DA 2DGDA 5DMHA 1H1TA 3CVXA 2RKWA 2JFBA 2YWJA 4G4IA 4V0NA 5ELLA 6REQB 5LUBA 5ALTA 4XARA 1UJ4A 1PFYA 3L1VA 4QFDA 3GRCA 3QFRA 1N2EA 2HH9A 2ZUUA 4OQ4A 4E15A 1TQ6A 1TEHA 5IJ0A 2C7QA 1AQLA 2BJHA 4TKUB 1LH0A 1R8XA 2D1TA 3STUA 3CIOA 3CONA 1U31A 1S6YA 2P8SA 4CLDA 4HFJA 4IHJB 5C0OE 5EJIA 3ZU6A 4E6EA 1T9DA 3ID6C 3CH5A 3EUEA 3PICA 1OMOA 1TE2A 4PYOA 4ZOLB 1WXIA 3TB6A 1NJ8A 1DTWA 4QNMA 1U8AA 1GN9A 2JC3A 3D6FA 4X91A 5H02A 4HV4A 5CLGA 4KRXA 4AL4A 7YASA 1GPH1 4B46A 1DKRA 3RWMB 5JS2A 1UAGA 3NX4A 4CNQA 4E5VA 5C8VA 3VPDA 2FJ0A 4DQ0A 1H5UA 2PGJA 2JA2A 4MKZA 3WA6A 3ZXXA 1T0UA 4KFRA 1AOXA 5HZHA 3RU3A 1NWCA 1UMBB 1AK9A 2C9BA 2ZXEA 4AKGA 1GU0A 2D00A 2HI0A 3ERCA 3ST7A 2YINC 4PSAA 4U8HA 5LDDC 5DN6D 2HLDD 2J41A 1HBJA 3SEFA 1C4XA 4MNTA 1IZ0A 4L07A 1ZBDA 4UBJA 4Y6LA 2CBGA 3DT8A 5HRCA 2YOHA 4JI2B 2XUIA 1XAGA 3NTLA 2UUOA 1N92A 3FUWA 3OOJA 5EE1A 2ONJA 5B1YA 4RVFA 4AT1A 1DJMA 4IZHA 3LH5A 2P75A 2ZYIA 4YCAA 2CNWD 2OV4A 2RHOA 2O5VA 4TZ0A 4UAGA 4YT4A 5SYAA 1P1HA 1Z6YA 3RTBA 3TBKA 4NAUA 3TSOA 5LQRA 4DMMA 1UODA 2X9QA 2QYTA 2YDXA 3K1AA 1O95D 4BP9A 1M1YB 3HCOA 5IT0A 1V6SA 4LFAB 1TGVA 2D7JA 3BDVA 3GARA 3GK3A 3H05A 4GM1A 5AI6A 1EUQA 1TU3A 3TOVA 4C22A 1XU7A 2H1IA 1NVXQ 1XVIA 4GMKA 3E22B 1EDBA 2P4EA 4ZCTA 5A4FS 4RKYA 2X58A 4BYGA 3TBHA 5AFSA 3W5AA 4KU4A 1CZKA 1HV8A 1ML3A 2BTEA 4PR3A 3QIVA 2NNLD 1R88A 2VYFA 5ESXA 3VJKA 5A7FA 2ZIXB 4HDOB 4AX4A 2NNWB 4LSMA 5EOVA 4LJYA 1Z13A 4K5QA 1XVVA 4YI5A 5KSYA 4N82A 1GAXA 3CJRA 1ISMA 2FI1A 2PXCA 3MWLA 4IKEA 3EC1A 4ZAGA 4M99A 5JH7F 3A58B 4HLUC 2UZ1A 3DC2A 1XL1A 5F3WB 3NVDA 4G3XA 4CLXA 3KXLA 3U9SA 5DYGA 3TVYA 3HV2A 1TKBA 3UHJA 3IMEA 1Z68A 3AOEC 3LK7A 4LMPA 3RVMA 3GCDA 3WS7A 4L4SA 2E37A 1N5RA 3KAPA 2XCQA 2Y0CA 2OBXA 2JIPA 4F21A 5HPYB 2ZI3A 4RF4A 2X8BA 3AERB 1K4MA 4E33A 3MGCA 4FDMA 3WDSA 2GZRA 3NV7A 3ONFA 3O73A 1LLQA 2XOKA 1HORA 4GX2A 5DTRA 3AXTA 4B2YA 3R3WA 4KACA 2LR0A 3HGTA 3P9RA 3DBLA 3KTFA 2QE6A 2WIBA 1BXGB 1I33A 2ZSJA 4MEJA 4N3NA 4WXYB 4YB8A 5EJAA 5JE8A 5FX2A 2EARA 1Q1BA 2DQZA 4XB6B 2WC1A 3QVGA 3WMFA 1H93A 3ZX4A 1PQPA 2HIHA 4KZKA 1NQUA 2C4HA 3L0YA 4V0MA 3L49A 2OR3A 3A3YA 4OP2A 4F38A 2I34A 1QP0A 2AKEA 2R6JA 4RTJA 3GHHA 5M7EA 3UTDA 2V7PA 4C3ZA 1JFFB 3F6RA 4CKEA 3I6IA 2ZTMA 3EG9B 1LS6A 4RHEA 2ZK7A 3PQ8A 2W2VA 1T25A 4YDRA 2DWOA 3WGNA 3GCWA 4C7KA 4PLHA 3RT9A 5B3KA 3ISJA 4J0EA 5AHWA 5EXTA 2O5EA 5IULC 1I9GA 3FCYA 2HXGA 3E48A 3PD1A 4HQ0A 4RA9A 5JC1A 3DE5X 4BMZA 1NVAA 1NDQA 4LFBB 4HWOA 4L7VA 1DKQA 1PK9A 2VPQA 3DV0A 4NNPA 4Q9LA 3GJ7A 5HQJA 2VJCA 1Y0BA 3VPXA 4O0MA 1AX9A 1UPTA 1C3OB 2G7ZA 4EO4A 5HHTA 1M2FA 4GVXA 1E8MA 4LGCA 4D4IA 2G6TA 1QQAA 1OAOA 3CT6A 4JQCA 3ABRB 1MGPA 3COWA 3DE3X 3OFND 4IMRA 3G2LA 4L0MA 3Q72A 1U8FO 4NEGA 3PKJA 5ALYA 5BNZA 4FEAA 1LBHA 4QQFA 3LVRE 2XMGA 5ULLA 1U7UA 4M1SA 3ZBUA 1JAYA 1IL0A 3D0OA 3PBKA 5EPOA 3ILYA 5F1YA 5BXYA 2ATIA 5KMGB 4G8JA 1H94A 2O9JA 1JGTA 1ZWKA 2OVBA 4MWZA 4PRLA 5THXA 2FUKA 2ONYA 4JOCA 4LV6A 4YXFA 1WMDA 1H05A 3DEKA 3UAOA 3P9PA 1XTRA 1TU0A 3HEMA 5DM0A 5F78A 1FDUA 1NE7A 4LXGA 2QGZA 2X9GA 4K86A 2Z6UA 1A9PA 5B30A 4G07A 3U1BA 4WLFA 4ISCA 4IUDS 3T5CA 4DLZA 1S2GA 3EIWA 3VUFA 2VT2A 4JEMA 1Z16A 1TD9A 2WMNB 1UDXA 5KAMA 4XWWA 1WETA 3L07A 1FLDA 2OZEA 1ECGA 1TCAA 2PYIA 3OQNA 3OKPA 5JNUA 3Q7RA 5ALIA 1BSVA 2OYSA 3G0DA 3HJAA 3BB3A 1P4AA 1CY4A 4B76A 5LQAA 2WHXA 1TQ4A 4LJSA 3KSZO 2JARA 4QUGA 4ZQBA 3VDQA 4F8YA 2F1OA 5E6RB 1YJAA 1JHMA 3JPYA 4RENA 4AJ1A 5L6MB 3S8YA 1N25A 4BKOA 5KINB 5KPJA 4YRBA 1G1MA 3I6ZA 4C4YA 3LT1A 4ZK2A 2BBWA 2NUAA 3O4VA 4AMYA 1UDWA 4D9GA 4F60A 3O9ZA 3PCXA 2NZYA 2QSJA 3CUYA 5AWFC 5ADUS 1HNWB 1Z5WA 2W0SA 1UOOA 4B8ZA 5KQRA 1XTQA 3CZAA 5ICFA 3H8JA 4EEXA 2BIFA 1GPDG 2XDYA 3UB4A 1L2TA 4F56A 3DDZX 4QYIA 5DB4A 3R5XA 3WJ2A 1T15A 4H3SA 3IURA 4P53A 5HM6A 1FZTA 1YHZA 2PSFA 5ALSA 1NW6A 3LT4A 4GPTA 2O2HA 4EZBA 1L6RA 1RYFA 4ZYYA 4CRWB 2JA1A 2CMKA 3PEWA 2YJZA 3PTAA 1ECJA 1VJGA 3OPQA 5CM8B 3VYVA 2YZKA 1M8KA 2C2KA 4HDSA 2Q3BA 3GFPA 1YRQA 1MV8A 1U8TA 1H5QA 5DI3B 1WPQA 1AK2A 3PWSA 3NJRA 1J22A 2OO5A 1CZUA 1L7DA 1WCWA 4ZGWA 1FMFA 1SHLA 1VRVA 2PX4A 3ZWAA 4DC1A 2HQOA 2NUTA 3TLBA 1DRKA 4C29A 3MWEA 3FFXA 3SE0A 1DB3A 4DILA 3KD2A 2R11A 4TT3D 3R0ZA 4UE2A 2HPAA 3WXMA 1Q3KA 2DJIA 3VI4B 5BSRA 1Q5PA 4FMCF 3OO0A 4UFOA 1FTWA 4A16A 1KJWA 1CVIA 1MOSA 1T2AA 1BJTA 1DKOA 3R23A 4JFRA 2FFHA 4LXQA 3OQBA 3P4XA 1PL6A 4GLJA 4D8TA 2QMQA 4WDQA 3C6ZA 2GXQA 1X94A 2GR9A 3HB9A 2VC2B 4BVKA 4JDPA 3BK2A 1BFKA 2KPOA 4ND8B 4F2HA 2W8BB 4Y6GB 4OSPA 3THYB 2EG5A 3LUHA 4G5GA 3GWZA 4LHEA 4CI0B 1NONA 4EVQA 4YIKA 2J3IA 3T7DA 3MB8A 2HU2A 5EFOA 1SEPA 5EWJA 3NBZC 1NMQA 2BUCA 4WLOA 4PZAA 3DUFA 2MSNA 2V45A 3B48A 3HXPA 3FPGA 2Q46A 1BVYF 1QZUA 4L75A 1D5CA 5BVGA 1F3OA 3AR7A 4K6CA 2I66A 3S2YA 1QO0A 1D5WA 1PX0A 1K5PA 4WUVA 3EY9A 3IFSA 3WO1A 3I2HA 2XYHA 2ZB3A 3DMTA 3NXKA 2H00A 3D3KA 1LRJA 3SBOA 4AP6A 1ZK3A 5B2FA 4YJ2A 2Q21A 4IDBA 5A3QA 3UUEA 1CS0B 3OZ7A 4OD0A 2Z8YA 5C7OO 3N2NA 3E9YA 2EJCA 3KPJA 1T1RA 1V39A 1Z62A 3N9IA 4IGFA 1UR5A 4LQ4A 2XZOA 4WBNF 4B7UA 3IKMB 1X1AA 1MJGA 2RHJA 2PFSA 4PHTA 3GUUA 4DR4B 1MC4A 3EVNA 2I62A 1FYFA 2EZUA 1I3KA 1WG8A 3U44A 4MAFA 4J1NA 1JDNA 4HJXA 4IX9A 5ALOA 3S68A 3RC8A 2HXYA 1O96B 1E8DA 4BKUA 2ZUWA 2ZJFA 5D6OA 1N2CB 2V0GA 5L3SB 1R0RE 1YL6A 1Z5ZA 4O4JA 4QATA 3NI2A 5EUMA 5E9AA 4JLNA 4KI0A 3LU1A 1VKNA 2A59A 1O77A 3R3HA 2RGGA 3FHLA 5DHFA 3G6KA 4QFBA 3HA2A 4FB5A 5AM0A 5T8KC 1HNNA 1H3FA 3B82A 5DCUA 4ZGBA 5KQLA 3LYAA 3B1VA 2XCIA 1SULA 1Z83A 3AESA 1R6AA 2PT7A 3PXGA 1BMDA 2Q07A 2O4UX 4BIMA 1KEPA 3JQAA 4U63A 1HSZA 2Z1NA 2BM9A 4JLUA 2PZBA 3EISA 1N57A 1PIWA 1WY5A 4QTXA 4W4TA 4PX2A 3H5WA 4TQGA 3PFGA 4ENUA 4JBWA 3TN7A 4WKGA 5F52A 4NENA 4MHSA 2VNIA 2AB0A 3RAGA 5A03A 3V4ZA 2B9VA 1BMQA 1UK8A 1VI6A 2Q3HA 4RZUA 2WKSA 1MNQA 1E92A 3LOQA 4RPHA 3ZE8A 4OLBA 1O2DA 2XITA 4G81A 4Y6OA 2OQRA 4AJ2A 1CQZA 1A4IA 1EZZA 2XWSA 1G59A 2NW6A 1B8NA 5IBPA 1JJFA 4JLOA 2XAUA 4BMOB 3W90A 1AZLA 1HA3A 2ORED 4KFUA 3TIXB 3NW9A 2FDXA 1Q3HA 2A7QA 2H2GA 3NBKA 3W79A 3ZN2A 4RHCA 4KDFA 4DYDA 5J4VA 2IS2A 1YZHA 5I9BA 4OG2A 4HN4B 4BOYA 2PKQP 4DBZA 2G9QA 2OUIA 3RVOA 4F12A 3Q3HA 1NOIA 5HIIA 2QI9C 1XA4A 4NBVA 4UM5A 4M9QA 3SN6A 1S5PA 1OLXA 3CLSC 3H4TA 1OYWA 4C6HA 4F9TA 3NC4A 1U2PA 2P9GA 1Q84A 5FWYB 1QFYA 2VF8A 4HNTA 3ER9A 2JGNA 3B1YA 1S1CA 1E96A 3OWXA 621PA 2GMWA 2EFHB 2A0UA 5JJCA 3RUIA 2GBLA 1TA0A 2F4NA 1JEEA 4TQ9A 2YWFA 5IMSA 4W5WA 4EG1A 1D4AA 1V2GA 4TS1A 5IK2D 3DMYA 4C4RA 3M83A 3AVYA 1T34A 2I2FA 1GZ5A 1SD2A 1NP7A 3IBGA 1P1IA 1V7ZA 3IJEB 3NKLA 4K6KA 4U5XA 4UBOA 4XR4A 3BN3A 1BHSA 3M6LA 2HMSA 1BEEA 1P18A 1RRKA 2PMBA 2CXQA 3HWX1 3IUJA 2QF7A 3FDXA 1PBTA 3MAGA 4IV5A 3PRJA 4LNHA 1JIKA 2X0NA 3RASA 1DO8A 3CFYA 3TM4A 5KYTA 1JA1A 4PR0A 3GCGA 1LF0A 2SKCA 5LP1A 3K8OE 4MYUA 4XASA 5MGBA 1N77A 1U0JA 2G17A 1EXWA 5K0CA 1AZTA 1Z4LA 3LUDA 4UAVA 1TM7E 2F43A 4IOLA 1KDYA 3PQ5A 4R7TA 4MDYA 3EPLA 3UCEA 3ZDYB 1XDBA 5E7JA 1EM6A 2AG6A 3WOHA 4U7GA 1NXPA 3OTHA 3WWDA 1PZMA 4WIAA 3UA4A 5CDGA 5BO5A 3RS2A 3I5MA 4M8SA 3HUTA 4Q5IA 4QGAA 4K9RA 4GX0A 4HN2A 2IEGA 3R7LA 1L5VA 1AQYA 1CB0A 1FQJA 3DA8A 5ER6A 4KKXB 4Z9FA 3VDMA 4EW3A 3TAHA 2QGFA 4KE8A 2NTJA 5J63A 2ZWOA 1O97D 5CBPA 2J7PD 3N6XA 3OEEA 4RKQA 4OHBA 1SUAA 1Z5VA 3V8BA 1QPZA 1GZ7A 4C0LA 2XECA 3AKCA 2HLPA 1QYRA 3D43A 2XX3A 3E35A 1Q6YA 3HLTA 4S2EA 3HQ4O 4JI5B 3GGGA 3JX9A 2FPLA 2V0CA 3OAAA 1XV5A 1Z0JA 2P3OA 3TO5A 5KYYA 4QUAA 1KRXA 2XD4A 5E1BA 1JZTA 1MA0A 1HDOA 2H17A 1Y33E 5IF9A 1RRGA 1CW2B 3FVWA 3RADC 1N5JA 1U6IA 1U04A 2XNDA 4A8JA 4B47A 1JILA 1NJ1A 3KB8A 4BFLA 3BMOB 3LX5A 4AIIA 4YHHB 1NR1A 1QHNA 4BN0A 2QENA 4MAMA 4US1R 2WB4A 2ZIZA 2CXOA 3VRHA 3SHTA 3M5DA 1AK1A 3OT1B 3TS1A 3L7IA 4PNEA 2YXDA 4BB5A 1ANKA 1QC5B 2NXWA 2OHOA 5IABA 2NTYC 4LDRA 4B17A 4ILKA 5CFRA 2E87A 3BD6A 4D3ZA 1G3RA 5TGDA 4B3TB 4OHUA 3OP1A 1R8YA 4C7MA 4RGBA 2JH3A 1GN8A 2RI6A 3DSRA 3FNFA 4MUBA 3VAYA 5A5VA 3T41A 4DMHA 1CY7A 1KZYC 1CY0A 4KR7A 1D8AA 2Q0HA 5CFMA 3OMWA 5KSWB 5J9FA 3IP7A 4GQIA 3L7MA 5FDFA 2WHRA 4KYUA 1MZPA 2QUZA 4DAEA 5ALKA 1I3OA 3NHWA 4RSRA 2EWMA 5DYYA 1XNRB 3GJ4A 3PPYA 4EK9A 1N6HA 4J91A 1JHVA 1OLUB 1IDOA 2X6RA 4LZPA 4CF7A 1LK7A 1ESCA 4DA4A 1OH8A 3DZIA 1MH1A 4HDQB 3F4LA 3MN1A 4C9BA 3QELA 5GZ1A 2EZ9A 2BKVA 2H4ZA 1CJMA 3BRWA 1BO6A 1SCAA 3OTIA 2IKSA 3DP7A 3HI4A 5GY7A 1YNSA 4TV9B 3IDOA 4XOUA 2FK7A 4BNJA 5IYZA 1BW9B 3L02A 3DKIA 1XE3A 1P31A 2ZXUA 1Y42X 3GLTA 1OI3A 4E94A 3F78A 1VHJA 3GJ5A 4WINA 2BCGY 4BNXA 1IBSA 4D02A 4H0NA 4M0DA 5CT8A 1QRRA 5CXQA 2JJ1D 3U4HA 3AY7A 1GSOA 2C1ZA 4YCMA 2C8LA 1XTJA 3RC7A 4KXXA 3ZWXA 4AZ0A 4BE7B 5B2ZA 1CV2A 1MJ5A 1L4BA 2Q5IA 5K3DA 1YA6A 4EB0A 4ND6A 4BJ3A 4EG3A 4OQLA 1WBDA 3DVSX 5ER9A 4R0NA 1DPGA 1LEHA 3C1OA 5FWXA 1QORA 1IM5A 4X1YA 2WAOA 2W8ZA 4M7PA 2ENUA 2WP8J 1B8OA 1ZLYA 5DBFA 4TUYA 1YQTA 4O2BB 3IPRA 2QN3A 1TADA 3D4NA 1EFAA 4KVGA 4NYIQ 2XPCA 1SKYE 3D5QA 3ZV6A 4TQUS 4II3A 3AXSA 1UBHS 3ZJ5A 4N47A 1LPNA 4TL6A 2I2DA 3L1UA 4RORA 3QK7A 2W2QA 2Z8ZA 4QBKA 5ERXA 1BAPA 2H5IA 1S96A 2ZRIA 3OZXA 1EE9A 1Z6AA 3K9QO 3CBQA 1SB8A 3IQEA 3OU2A 1QMPA 3KT3A 3W3AD 3SX4A 3SJUA 3IALA 4CMKA 4BVLA 2Y9PB 1Z5PA 3N8KA 3RUCA 2PV0A 3PWTA 3SC3A 3VAAA 5KVVA 1CDZA 1ESDA 3G8CA 1FQKA 2XD9A 1A7JA 2JKZA 4D8VA 2BMEA 2OK8A 4HQOA 3EBOA 3RU2A 1EFPB 3DBOB 3W6PA 4JOSA 4ARSA 4PQEA 1NE2A 1WF3A 3LRTA 1ZSVA 3H9GA 1W36B 1I2ZA 1NYTA 5HZKA 4D0SA 3K8QA 4GQAA 1QH9A 4GE3A 2ISQA 3P94A 3GRKA 4CM7A 1EB9A 3QPWA 3IOMA 4XX0A 2PEZA 2UVPA 3H9JA 5T3UA 3W8DA 5IC4A 1F0PA 5L3QB 4LRSB 3ZGOA 4GVLA 1J42A 2OZLB 4PRYA 4QG3A 1KF0A 1H23A 1RJGA 5I51A 3WTBA 3EH2A 3L41A 1Q0LA 3IAFA 4B6FA 2QRQA 3NPAA 3VISA 3UG7A 4D42A 3WYDA 4Z99A 3TSCA 2JI8A 4F9EA 1H4SA 4MVJM 2ZUSA 3WB2A 1IPFA 5JD3A 1JAIA 3OJOA 5AVUA 1JE0A 4RWZA 2AR9A 3JYOA 2A1TR 4WW0A 5BWCA 3KVRA 3NFYA 2JLYA 2Q29A 4OI4A 4WGFA 5JSQA 2JHCA 2QIOA 3V8VA 4D9BA 4G01B 1BMFD 4GLOA 2X77A 1CIJA 2H1FA 1YV9A 3QSGA 3AY6A 3CA8A 3UUFA 3LO5A 3PR3A 2INGX 3SIPA 2FU5C 5B12A 3I05A 1AIPA 2BZSA 2BTOA 4CL2A 3TZCA 1OOEA 1YA4A 3PE3A 3QTBA 1Q7RA 4RFSB 2KSQA 3EMDA 4GR5A 4CYMA 2BMAA 4CT5A 3FNEA 3QWIA 4AZ3B 1UMKA 4TV8A 5ESDA 3SS8A 4X1KA 1P7WA 3DPUA 4GH5A 4Z49A 1PR9A 3GRYA 2CD7A 3TTSA 3R4CA 3MGAA 1SUWA 1TAQA 2XB9A 4D92A 3LMKA 4Q3DA 4ZAWA 1NI4A 1J0DA 1DXQA 1G3MA 1RXEA 1AGNA 1OHHA 3HSSA 3TL3A 2DUUA 4KLRA 1PGNA 3BOSA 4O4HA 4DBLE 1IZ8A 2DH5A 2WJGA 1E8NA 5FT9A 4OHOA 4MUJA 1TC2A 1VSUA 2NO5A 2D13A 4UXIA 4Z86A 1QLJA 4ZVOA 3N0TA 4EL0A 3D81A 3FGPA 3K6SA 4M89A 5LFAA 1E1KA 3OJWA 4F8JA 1UIMA 4Q1EA 2ZE6A 2PZAA 4TWRA 3R75A 1U7TA 1Z74A 5JZOA 1N0VC 5AOVA 5CW1A 1RJWA 2EOAA 2QQGA 4I9NA 3T5BA 2VEOA 4GP9A 1XBTA 4FZVA 2J85A 3V8QA 4TMTA 1D07A 3HH8A 3K1JA 5FFFA 4JEUA 5AI4A 2BKLA 2XNCA 3CCBA 4KZPA 1SXJE 1KY4A 5FUYA 4EVIA 3OJEA 4JI0B 5AIBA 2QG4A 4QDTA 3FZGA 4L5AA 1PQUA 1GQRA 3ACDA 3B89A 3C7DB 3R3VA 1V8DA 3GEBA 1LF5A 3PYLA 5SICE 3TZEA 1N1GA 3OZGA 1K3UB 4FYJA 5ECDA 3SLKA 1I7DA 2Y0DA 2MJLA 3I9JA 4MUIA 4ZT7A 3TQRA 1ZRHA 2J0SA 4BBAA 3BRCA 4K0KB 3VKFA 4H1UA 2O8CA 2XIQA 4NBSA 16PKA 1G6KA 2VF5X 3C5VA 3GEGA 4RTRA 2B6HA 2GS9A 3G2PA 1C9YA 4QUJA 5HF6A 1JDTA 2WAYA 3OSUA 3ONWA 1BVHA 2ODPA 3OVMA 4H60A 2M6LA 4MZXA 5CEJA 2E6UX 2C7OA 2UUCB 2VVTA 1XTPA 2O6HA 1OASA 3VSBA 5K8UA 1U0OC 4HYTA 4UTXA 3FF1A 3HKDA 2RHDA 3T3IA 4JI7B 2Z4SA 1NDUA 4UNQA 3SR3A 3PVSA 3OQVA 2R6DA 3L3BA 5ELXA 2RKBA 2D2IA 4WK0B 2A9KA 3Q0TA 3AJAA 3A25A 3Q41A 6GPBA 3PCTA 2OY0A 1YHNA 1MEOA 3CE6A 2B1RA 2WRZA 4L5JA 3H7AA 5B58T 1G6OA 1SVLA 4O8ZA 2JK1A 4IEIA 2WFAA 4W5NA 3W8EA 2JGEA 521PA 2VNHA 1V8FA 1ZVQA 2I76A 3D59A 4LXTA 2OESA 2WIJA 4KBFA 5T5QA 4LXHA 4R6WA 1QQ5A 1G98A 1X8JA 2BUAA 2R9VA 2ZDQA 4LXUA 2JKYA 3LDUA 1PW5A 4Q4CA 4DR7B 5AOBA 1JFVA 1Z15A 4PYKA 3RRZA 2DXIA 2ZZMA 3U5TA 5AI8A 1D2EA 4X1OA 2UDPA 3ZGZA 4TTQA 1O5TA 3RSQA 1XZ8A 2HA3A 4A0HA 3Q2OA 1XZHA 2CYAA 2E55A 2P9HA 4JHXA 4IKOA 4ZDJA 4X8LA 4AJ9A 4GG1A 1UKEA 5BR7A 5TC4A 3OZRA 3RK0A 3K0FA 3FJYA 3K6RA 3KIPA 3ORFA 4AXXA 4AN0A 1LV8A 3WNBA 2ZYDA 3LP5A 1T9BA 5C1OA 1KC1A 2FB9A 1VP3A 1TT7A 2GO7A 2RG1A 2YW9A 3ZHRA 1PZHA 1Y9DA 4F8EA 1HZZC 3PZRA 4LJ4A 2YIMA 2VJMB 1YC5A 4K26A 1UDBA 3L05A 5DOZA 4KB5A 4ZMBA 2D5AA 4PIPA 5EMHA 5C32A 1AA9A 5REQA 5IXJA 2X15A 3ODGA 3HB7A 5IJWA 5A71A 2BY4A 3H86A 3PD0A 4BQEA 1RTKA 4L28A 3WGJA 1HE2A 2VXBA 3H75A 4TS9A 5E4YA 3IIEA 5EI5A 3ONDA 4AZSA 2CC2A 1H0RA 4BLWA 1C7EA 3EIQA 1PYDA 3O7MA 3T5AA 1G17A 3FLMA 3R3ZA 2X0FA 4BUZA 3GVCA 2DX7A 2H2AA 5LLTA 3PV0A 3H3FA 1WUIS 4EKDA 1SBYA 4RIHA 4FHDA 4YJ2F 2VF2A 3PF8A 1FCJA 4GE0A 1HQYE 1SQ6A 2FSSA 4PAWA 3JYQA 2O0MA 2P6OA 3FOAA 2E5WA 2WG1A 4A0QA 3UYLA 1EE2A 1W8IA 3GGSA 4GMDA 4QYXA 1E2UA 1V1MA 2WA1A 4Q3CA 4RACA 3D2LA 3RS8A 3MQ4A 4R68A 2QR2A 5H16A 5B7QA 1GA1A 5CCXA 1PUIA 3FKQA 3M82A 4F72A 4C0QC 3TE6A 1WTAA 3VFDA 1AUQA 3DZHA 1QO0D 3A3KA 5JS1A 4JCCA 2VTVA 1RC0A 1UFOA 1NVDA 4O4JF 3KOMA 4RVCA 1X15A 1F51E 1W9MA 1XTIA 3FB4A 1L7RA 4MRRA 1QVZA 5AOAA 2GEJA 4DEYA 5LNK6 5J2UF 3EW9A 3K53A 2NZWA 3AP2A 4QT0A 2XYRA 2ZTUA 3HXKA 1T2UA 3QEMB 4HAWA 4BQFA 4NC9A 4OLJA 5M5BA 3WNQA 1QHHA 1TRHA 3KLMX 5A5EA 2TECE 3AHIA 3Q98A 3RB8A 3NDIA 1V7CA 5HIJA 1BOFA 2CCGA 1LK0A 4FKZA 4MRVA 3VKUA 4BQIA 4DMKA 4ER7A 1KYIA 1T3ZA 2I6TA 4E2FA 2ZM5A 5BYKA 2E18A 1QTQA 2FETA 4CLRA 2IXTA 2HEIA 4PQGA 2PZLA 2QRPA 4FFPA 4US0R 1UBLS 4BMDA 3SBEA 2BGUA 5K6AC 4DL9A 5JCJD 4DNPA 3PRYA 1IJFA 3O4RA 3IR7A 2QNIA 2CYBA 3IPCA 1IWPB 3SQOA 4W7IA 1DBIA 3M49A 2UVDA 1TIPA 4UQLA 1SBTA 2Q5OA 3C98A 3HCNA 3CTMA 5KYUA 1SC1A 2UUPA 4YNBA 3JQAD 3RF7A 1DTWB 3QX7A 4JHLA 4IINA 2O8BA 2ZWAA 3EGXA 1G55A 3ICPA 3F5SA 4KTTE 1JJVA 2CHEA 2O52A 3ZY2A 3LUKA 3IEIA 4IIHA 4LS3A 4C43A 2Q4DA 4J76A 4BU0A 3ZBPA 5AW2A 1TQ8A 3IAEA 3LIIA 2CLHB 5BOSA 5L4LA 3I2JA 4BGDA 1Q7EA 2BR3A 3I04A 3LW7A 5FA5A 4XFJA 2ZUTA 1C3EA 2C2YA 3I4LA 5F5LA 3BILA 3FPHA 2HMAA 1R9NA 3FNHA 1U3GA 5T4BA 5JASA 3KR9A 1ZQ1A 4X92A 4LJ8A 4H7IA 4HX2A 2C7BA 2JD2A 2VZ8A 2B98A 5ENZA 5YASA 5TDHA 3RU9A 2OT3B 4R2KA 4F4UA 1B73A 1IAVA 1F8UA 4NESA 3N2LA 4QDUA 3T5DA 1ILEA 3NS7A 2P30A 2VA8A 3EXHA 1B16A 2FW1A 2GERA 4K9MA 3C4VA 2VR1A 1MKYA 2P9CA 1TI7A 1WDTA 4L5IA 1MEEA 2Q50A 4Z3OA 3CLTD 4GBGA 3VTZA 3FYSA 3EH1A 1JAZA 2A0FA 1ZN9A 2ZJ6A 3FNRA 3K1AB 2GYUA 5CG2A 5HXAA 4UHBA 3QA9A 4JXKA 1HF3A 4DB2A 2NXCA 3HO8A 2VPXA 1RWWA 4ZI2A 4R2WA 4RSGA 3ZBTA 5AW4A 5IVHA 4KNWA 2OZKA 4UNIA 3ETHA 3L0IB 3ENWA 2J32A 2JHPA 3K09C 1WNFA 5DLPA 3UCXA 3DMDA 3L0SA 1I13A 3PRKE 1M7GA 2ZSEA 4BE4A 2B8WA 2J9FA 1DU4A 4HYQA 1XAIA 3ONVA 5WRFA 4L8LA 2IW3A 1AKTA 3M0EA 1UADA 4EO7A 2I3BA 4M9RA 2X7XA 1XDZA 3ICEA 1QYIA 2PH7A 2QX4A 1AKUA 2ISCA 2QB5A 2ATVA 2QL9A 4EUNA 1PEDA 2I7CA 2QQEA 5HKAA 1NXWA 3T4EA 4IFIA 1BQ4A 3CLRC 4HGQA 3AEQB 1TF2A 2H54A 4DNOA 4WOBA 4Q18A 5U4QA 4DPLA 1YQQA 4Z3KA 3PFHA 2PO7A 5T7BA 1K2VN 1RHJA 2VHVA 3A6GA 3KJFA 4U8GA 5HBRA 3EDMA 1RLMA 4K9LA 4AF6A 2LCQA 4QO7A 1RP7A 1WL8A 4XCXA 3VBCA 2XCRB 4B87A 4JY7A 4LMAA 3V1KA 1B4DA 4WX2B 4QNRA 3X1JA 1E60A 2KM1A 3K0CC 1T29A 2G9RA 4CM4A 1IQUA 2GZ3A 3PS9A 3VPCA 5HBGA 5LIRA 3BQNB 3PCRB 4NLLA 5EINA 4YP1A 4O63O 4AYTA 3IUPA 3IYLW 2FSHA 1R1DA 2GD1O 4KAXA 4QQRA 1BRMA 1PX2A 1JYFA 3MJHA 4MX8A 2C96A 4NV3A 4NE2A 3OEED 2OL4A 4K6OA 1BN6A 5MN5A 5AVTA 4IICA 4FFMA 1CTQA 5J58A 1FDIA 3DBLB 4QU8A 5E9JA 3L7JA 2BZ0A 5HCIA 5EPUA 1J33A 3VYWA 1AKWA 1DDOA 1CQPA 2TSYB 3LY5A 4GKAA 4NMMA 4IFEA 3DVQX 3S8MA 3P4UA 4K8RB 5BQPA 4MLCA 3QVGB 1Z8NA 5AESA 4ARVA 2VTBB 2XQIA 1PNQA 3FTCA 4HVTA 2FZKA 1PNOA 1T0HB 3H3JA 4G5FA 2JFFA 3H04A 1J5XA 5KWSA 1FS5A 3E9ZA 3HBLA 1G2QA 1RACA 2XNDD 3T3EA 4YMLA 4M9CA 1VBKA 3HWWA 1ULHA 3UT6A 3C85A 4EA9A 4KP7A 5DBOA 3KTDA 4CKEB 2GBFA 3D7SA 4P4TA 2HA0A 4DDTA 3GNLA 4MGHA 4RK4A 3T94A 3ZCRA 2V98A 4S0XA 5CYGA 2P9FA 2HADA 5DP1A 1DPFA 1T5HX 1W5TA 3CZRA 3C1UA 3L06A 5FPSA 3VZQA 1CDDA 5T67A 1KSFX 2A88A 3G82C 4M36A 4TKVA 1O0CA 2B78A 2VK4A 4MUKA 1P7CA 4DPKA 1NQAO 1EP2B 4BMPB 4ZT5A 5ILOA 1GFWA 4KQHA 4ZARA 4UNRA 5IFLA 3A2MA 3BXZA 3MOIA 2GO1A 5IYZF 4Z7NB 5JFGA 1EKXA 5IBCA 3NATA 3DV0B 2CZQA 2N47A 4CODB 3MRXA 5EJ5A 4ZHSA 5JSHA 1L1EA 4ARIA 2WIGA 1ML4A 2ADMA 1BHO1 1SKYB 1T8UA 4A5OA 4X60A 4NULA 3AF1A 4R1TA 5FBHA 4PIMA 5M34A 3D7NA 1M73E 4R6XA 4JYAB 5BMVA 2GF2A 5DV9A 3SIXA 2H4FA 3NOQA 1SG9A 4O02B 3SR4A 4FE4A 4U7PB 1KPGA 2ZRGA 3A3NA 3OZAA 4HEA1 4MB0A 4GUDA 1J0CA 4TUYF 3DZKA 2WJYA 2YC2C 5LWHA 4RKEA 1B15A 1RLTA 2OILA 1K8RA 1O3YA 3NRJA 4OY3A 4TL8A 3WSVA 1L7EA 3RBVA 3DH0A 3KQOA 1RKXA 2ASVA 4I5FA 4ID9A 3EOZA 5BV8A 5E7IA 1I7LA 1NQOA 1ZJ6A 3L46A 1RRCA 3WFIA 5IN4A 2P90A 1ZGGA 4Q3AA 1DRJA 1ZR2A 1G19A 1K4KA 3L6BA 4HT3B 1PNTA 1KQPA 1P0CA 1XYVA 3HDGA 3FRHA 3JQBC 2BZ1A 1Y3BE 3JVUA 4DIBA 4QXRA 4AMGA 1KMHA 2FZGA 2PSSA 2WHYA 4BNFA 4W9MC 3PJFA 4C4OA 2WFLB 3DKVA 3JRXA 4P34A 1VGVA 2H9YA 4XI9A 4CT0A 1X2BA 4CKCB 4RNCA 2MR6A 3BH6A 1XZMA 4R2LA 4KC0A 1W4LA 3REGA 4EPVA 5F51A 4RPIA 4WFQA 1A7KA 2C97A 3BZUA 4D9KA 4LPSA 5KOJB 2I03A 4KEAA 5DM60 4E11A 1Z37A 2Q3CA 3V32A 1FBNA 3V4VB 3PT5A 3HI6A 2YVQA 4OHKA 3SYKA 3DKRA 2OBBA 4JI4B 5BSFA 1YCDA 2H2FA 2C7VA 2XBMA 3B6IA 4FT4A 3TR6A 1MD9A 3JZFA 5F2OA 1RIIA 2VSQA 2O20A 3V4RA 4MCHA 4GBJA 3OC6A 5AJYA 1Y4ZA 3C97A 3CH6A 4RKFA 3W5HA 4GQBA 4LY9A 4QYIB 2NU6A 3UJDA 2JIRA 5JSFA 1KK1A 3THRA 1QFZA 1N6OA 2HO4A 2Q4TA 3KB2A 3V4PB 2Y92A 5CDHA 1SHJA 3QMMA 1HFKA 1UDAA 4FYWA 1G21A 4M8KA 2I7DA 3QLTA 3B9QA 1P77A 2BFDA 3C2QA 4JBHA 3A0UA 3RLFA 1IJEA 4UHHA 5EQJB 4HVCA 7MDHA 1QK5A 5JCPA 3BT7A 3I2FA 3KOWA 3R5TA 3G8AA 1B6GA 4IILA 4RQUA 3A1CA 2AW3A 3LWDA 3LDFA 4HDSB 3HYRA 3N05A 5IJZA 4EJ0A 5TLSA 1Z6PA 3LE8A 3KUCA 4DEXA 1O94D 3ROTA 3TNDA 2IP4A 4DSUA 2NT3A 1S9HA 3VZSA 1P60A 2AL7A 4G5OA 5BSTA 5JO0A 3A1FA 1MIHA 3MWEB 3UAXA 3VZDA 4TV8F 2Z6AA 3QFSA 3I9V6 4XYGA 3TZKA 5ERYA 2DBZA 1P0IA 3OQ1A 4WN9A 2ORYA 1F14A 3O4HA 5EHGA 3G9QA 3CW2A 3TDMA 2OCIA 2OD7A 2ZIVB 4OL0A 1IZYA 1YZKA 2H4YA 4K3VA 3ZY6A 1APBA 2B34A 2B83A 4KLNA 4R1QA 1QO7A 4O4HF 2GRJA 1BH6A 3QWHA 4KFSA 1M1NA 3PQDA 3L7CA 2HMVA 3QGMA 4ID3A 4G0XA 1SXJB 1LV7A 1UBKS 4J0HA 1QFSA 2FXIA 1H2RS 3R7NA 4B81A 2YN4A 2E4ZA 4AF7A 1FXUA 4Y9RA 4RETA 1X1SA 5JY1A 5EWJB 3K0HA 4HRAA 1BG6A 3ZZUA 4Y98A 1XZJA 2PL9A 2O2XA 1Z4KA 3H4VA 2XWBF 3MTEA 4M55A 5IJ9B 3EB9A 4U7DA 4HNSA 3QJYA 2J6CA 1KZ6A 1T2NA 1WM1A 2GHIA 1S7CA 3G79A 4LJ6A 5IU6A 3I5XA 1FTYA 4DWJA 2I1QA 1SQ0A 3OIUA 1KK3A 4V2IA 1OHHD 2W11A 1Y4DE 2I3GA 1MB2A 2C8KA 2P2DA 3AEUA 1C9JA 2VAXA 4QEDA 2L2QA 4BGEA 2I2XB 3GEIA 1NRWA 4I9FA 3FTEA 2G88A 3VNAA 4IAOA 3H83A 5K1ZA 3BB4A 3V2GA 3VR6D 1FDRA 3BL6A 4HFNA 1MV5A 3P9YA 4JASB 3H16A 4IZ6A 2CY0A 2NACA 2PL5A 1G18A 1C0KA 1I10A 1EGQA 1ZKMA 4XPIB 1ZNXA 1Q1AA 1JKIA 1EXVA 1RAHA 2HPZA 3DWIA 4UVIA 2R7MA 4NBKA 2G5TA 4I1YA 1P1JA 2VT6A 3TKLA 1EFRD 4FUTA 4MJLA 4YPVA 2WVAA 2V8OA 4HEQA 4TOIA 3U44B 1GGKA 1ECLA 2WG0A 2O2SA 2XUGA 2JK0A 4W5HA 2C0QA 1JIQA 3TLKA 4C7JA 4WADA 1G2OA 1NWHA 2A58A 1XD8A 1RBQA 1OIWA 2CL0X 4EY8A 4HDNB 3UJ3X 2B6NA 2A5YB 1FYVA 3D9QX 3I01A 2XHEA 1ZJ5A 2BRUC 2DE0X 2HW8A 2OHVA 4EY6A 4NFYA 1VCOA 5A2QA 4MGKR 3MMPA 4ND2A 4JLBA 1X7DA 3VMMA 2HCTA 3JQDA 4RM3A 4DT1A 3L0DA 3HADA 1RYEA 3U37A 5H83A 2Q8NA 3IP6A 2JCVA 1PWYE 4KAJA 4RIEA 4BO2A 1S8AA 3OZCA 2ZSAA 5ALRA 4RY2A 1VPEA 1DV2A 1G0NA 1HYQA 4HNHA 2ZROA 4QASA 3JAKB 3PP8A 3Q1LA 4HLDA 1XLWA 4ZJZA 5A3JA 4XDZA 3WIDA 1EZ1A 3HFRA 3K0KA 3O2QB 4QG7A 4ESHA 5KYKA 4G84A 5DCYA 4UM9B 1QIKA 4NH0A 3I92A 4IMJB 3T7EA 1E5TA 4I08A 4JX9A 1EG7A 3TD6A 4BZWA 1JF8A 4DJJA 6ABPA 1L1QA 1XEWY 3IP8A 2JG3A 5LQUA 1AQUA 3ES9A 3ETGA 1Z28A 2Y3IA 1XPUA 3AHFA 1W9HA 1V11B 2V7QA 2WR8A 4LC1A 5L6LB 3KKZA 1OI7A 3KVYA 3OT4A 2RH4A 1F2UA 4ALMA 1ODFA 3K4PA 4NYJR 2RHRA 3PXUA 1U2DC 2L0XA 5E3JA 1RADA 5J47A 4L9RA 4L8YA 1O1YA 4ML3A 5E8JA 2CGEA 1ZVMA 4WLEA 5KTRA 3WHIA 5HGXA 1EZ4A 2YV2A 1OLXB 3RYIA 4ND4A 1N2ZA 1L5QA 1RKVA 4AQYB 1PG0A 2Q1WA 4UDXX 3GLVA 3O4IA 5CPFA 2BFFA 3WNCA 5PNTA 4MVJG 4R1MA 4J03A 4M22A 3WISA 1GO2A 3VTKA 3ZWCA 9ATCA 3B2EA 3LL4A 4MINA 3CPSA 5LD2C 3BS4A 1UCFA 3QXXA 3LC0A 4TX1A 1P0PA 4IQ4A