2HO4A

Crystal structure of protein from mouse mm.236127
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
254
structure length
251
Chain Sequence
ALKAVLVDLNGTLHIAVPGAQEALKRLRATSVMVRFVTNTTKETKKDLLERLKKLEFEISEDEIFTSLTAARNLIEQKQVRPMLLLDDRALPEFTGVQTQDPNAVVIGLAPEHFHYQLLNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKAMVVGKPEKTFFLEALRDADCAPEEAVMIGDDCRDDVDGAQNIGMLGILVKTGKYKAADEEKINPPPYLTCESFPHAVDHILQHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Protein from Mouse Mm.236127
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain containing 2
total genus 70
structure length 251
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ho4A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ho4A02
4UMFA 5AW5A 3KD3A 4UU0A 4BEVA 1N8NA 4L57A 2B30A 4AS2A 3PGVA 2Q4TA 2CFSA 1WPGA 2BDEA 3ESQA 3PDWA 4BBJA 3FVVA 3K1ZA 2I33A 2IA5A 2IOFK 5AVQA 5A3RA 2HEGA 4MWOA 4UW9A 2PQ0A 4O8CA 2P69A 2AUTA 2YY6A 3N5KA 5ALMA 4HAIA 1RQNA 1WR8A 2NO4A 1RPZA 3R4CA 2GHTA 3QXGA 1RMYA 4FYPA 4Y2RA 4UMEA 3L5KA 4YH1A 1J97A 2FUCA 4KX3A 3ZVLA 2W43A 4UMDA 5AI9A 1S8OA 3AR6A 2HDOA 3DAOA 3N8GA 4BEWA 3A1EA 3DNPA 3EPRA 4DCCA 3ZVNA 4G63A 5ALEA 2YJ3A 2FPUA 2DQSA 1ZD3A 3DDHA 5ALIA 5A3SA 2YBDA 3L0CA 2P27A 2YJ4A 3TLMA 5ALVA 4Y3UA 4Y2PA 2PR7A 3QUBA 2C8LA 3NAMA 4UMVA 4HGNA 3L0BA 2HHLA 2WF9A 3NASA 3L1UA 4Y2XA 2JGAA 4OCZA 2RAVA 3N28A 5AKJA 2FPRA 1Z4LA 1T5SA 2AH5A 4DWOA 1L7PA 1Z4NA 3U7EB 3D6JA 3QU4A 1Z5UA 1Z4JA 2FDRA 2ZBEA 3ONNA 4HGRA 4CNQA 1U7PA 1TE2A 1L7MA 4Y2TA 5AESA 2WHEA 4UAUA 5AW7A 2G80A 5AK5A 3A1DA 5ALOA 5AK6A 2C9MA 4HGOA 3E8MA 4EELA 3QNMA 5ALKA 4NV0A 2FI1A 1SWVA 1Z4IA 2HOQA 4JB3A 2JAOA 3OCZA 5AK4A 3CNHA 3MC1A 3OCYA 2Q5EA 1L8LA 2HF7A 1YS9A 4QJBA 4UU1A 2HI0A 3HYCA 1U2SA 3FZQA 5ALLA 5ALNA 1CR6A 3WK7A 3I28A 2YMMA 3NRJA 3R9KA 4ZEVA 3J7TA 5ALSA 4NAVA 3WKCA 4OFZA 3WK9A 3QU7A 2R8EA 3N07A 3ZWKA 1Z88A 2FEAA 4Y2JA 3WKEA 5AVXA 4HYTA 5AHXA 5AKIA 3L0YA 1Z4QA 3OCWA 3GYGA 3W5AA 2OYCA 1QYIA 3HLTA 1AQ6A 1MH9A 2B1RA 4NFLA 1RLOA 1Z4MA 1L8OA 4UAVA 3QLEA 4C4SA 5AIBA 2FPXA 4QQFA 2PKEA 2AGVA 1O03A 2GFHA 2G0AA 4IG4A 4Y2UA 4CF5A 2CN1A 4Y2QA 1QQ7A 2GHQA 1PW5A 5AI4A 3U26A 4UATA 2G1AA 5AKLA 2JAWA 2W11A 1K1EA 5AVSA 3IJ5A 4MUMA 2D2VA 2G07A 3U7GA 5ALRA 3QYPA 4EX7A 3A1CA 4KNWA 1U2TA 4E88A 2WFAA 3R09A 3WK5A 5JJBA 1RDFA 5FP0A 2W4MA 4FFDA 2HF2A 1NNLA 3NIWA 3W5BA 2ZXEA 2GMWA 4IFTA 5ALYA 3SKYA 3SKXA 3WGUA 2C8KA 3L1VA 4KN8A 3W5CA 2B82A 3ZVMA 1QH9A 2BY4A 4KNVA 2YFYA 5ALGA 2R8YA 4H1WA 3PGLA 4Y2VA 3L7YA 1XPJA 1L6RA 4YIKA 2RARA 2I6XA 1Q91A 4HGPA 3WKDA 5AVYA 1S2OA 3DV9A 2YMQA 1XVIA 3SD7A 5AKZA 3ZX5A 4YCLA 3L8HA 3MN1A 2NO5A 4UM7A 4Y2YA 1ZD4A 1TJ4A 2B8EA 1RMTA 3AR4A 2YMPA 4L6AA 4XE5A 1SWWA 5AW8A 5AI6A 1Y8AA 3ET5A 5AKKA 3MPOA 5AM5A 1O08A 3IB6A 3B9RA 1ZRMA 4DFDA 3KDPA 3NANA 2MU1A 4XQ0A 2B0CA 5AVWA 1LTQA 1KYTA 1ZRNA 3RFUA 3NUQA 2EATA 2MSNA 5AKXA 5AKGA 3AR7A 1Z4KA 2R8XA 5AM4A 4J2TA 2HSZA 4AP9A 1FEZA 4UM5A 4OHFA 4FE3A 3FPSA 4Y2SA 2WF8A 4OD0A 1SU4A 1RC8A 2IOFA 5AKEA 3ZW7A 1NF2A 2RB5A 2YMLA 1VFPA 2HO4A 5AVRA 2ZG6A 2ZBDA 5AK3A 2X4DA 3WK4A 4XPZA 3W5DA 2HCFA 1RKUA 3FGOA 2JARA 3B8EA 5AICA 5AI5A 5AW6A 4BX0A 5IT0A 1LVHA 3KBBA 1JUDA 3B9BA 3AR3A 3ZTYA 4CE6A 2HX1A 1QQ5A 2OA0A 1J8DA 2WF6A 5ALFA 2P11A 3AR5A 3OCUA 1U02A 5AW3A 4BNDA 1ZS9A 3I6BA 3NALA 4ZEWA 4UARA 2C4NA 5AKYA 3ESRA 1Q92A 3F9RA 2EAUA 1VJRA 3UMBA 5AM2A 4EEKA 2C88A 4RESA 3WKBA 2FPSA 4YIHA 2B1QA 1NRWA 3QUCA 1TA0A 3QUQA 4GXTA 5ALJA 3E84A 4YGYA 2I54A 3OCVA 5E0OA 2AMYA 1YV9A 4AS3A 4F72A 3IRUA 5AIAA 3EF1A 5AW0A 2G08A 2NYVA 5ALXA 3U19A 4DW8A 1YMQA 3KZXA 1U7OA 3L8EA 4BX3A 1ZD2P 3N1UA 3WGVA 3UMCA 3SLRA 5AI0A 2P9JA 3WKAA 4EX6A 4ZEXA 4C4TA 3ET4A 1RLMA 4KYTA 3U7FB 3QX7A 1YJ5A 3E58A 5AM1A 2YJ5A 5AM3A 2ODAA 3KOOA 3VAYA 5ALTA 5AVUA 2OBBA 3WK6A 3OTQA 1RKQA 3OCXA 1RRCA 3QUTA 1RLTA 2O9JA 3SMVA 3ZWDA 2JAUA 3MMZA 2FUEA 3SHQA 3U7HB 3ZU6A 1RQLA 3L8FA 1VJ5A 3QU5A 3QGMA 4I9FA 3P96A 5AM0A 2ZBGA 5AW2A 1T5TA 1TJ3A 5IT4A 3ED5A 1QQ6A 5AKHA 2EARA 1YNSA 2OM6A 3CZ4A 4XOUA 3E81A 4C4RA 3FPBA 4RETA 3ZUPA 2Q4RA 5ALDA 5ALQA 3I1YA 3M9LA 1L7NA 4HGQA 4BKMA 2IOHA 1N9KA 1X42A 3AR9A 2YN4A 4I9GA 1IWOA 2CFRA 4BNDB 3BWVA 3OPXA 5T41A 2I34A 5ALZA 5AW4A 3EF0A 4NWIA 5ALHA 1TJ5A 5A3QA 3M1YA 2ZOSA 4YCNA 1WZCA 2GO7A 2IYEA 4L6CA 3U13A 3ZI4A 1Z4PX 4B6JA 2WF7A 4NABA 4YCMA 1CQZA 1Z4OA 4EENA 2O2XA 1RKVA 2CFTA 4UASA 4BYGA 4BX2A 1Z5GA 5AVVA 2QLTA 5AW9A 5ALUA 4JDPA 1ZJJA 2G09A 3QU2A 3KC2A 1ZOLA 4CF4A 1L7OA 3EWIA 3L8GA 3QU9A 5ALPA 2QYHA 2FPWA 3FM9A 5AI8A 4KX5A 1T9ZA 3SF0A 2VKQA 3WK8A 5AW1A 3AR8A 2B8JA 1XP5A 2ZBFA 2I55A 1EK2A 3I76A 5AVTA 2BDUA 2RBKA 2G06A 2WF5A 3ZTWA 4EZEA 3UMGA 2R8ZA 1EK1A 3A3YA 4G9BA 1RMQA 3RF6A 3ZX4A 4J03A 4F71A 1WVIA 5AVZA 1F5SA 1ZD5A 2I7DA 4GIBA 3PCTA 2YJ6A 5IS2A 4CF3A 3AR2A 1YDFA 3BA6A 4PNHA 3UM9A 5ALWA 3S6JA 2WM8A
chains in the Genus database with same CATH superfamily
1QOPB 2BGJA 2ZJ4A 2RMKA 4TTTS 1LGYA 3K4QA 3ZHOA 3KD3A 3HO8A 1AKUA 1NSTA 3O0DA 4P84A 4L57A 4C29A 1WULS 4V0NA 3DPSA 3EPHA 3WFZA 4JIGA 1TZCA 2E5LB 3PQCA 3HCDA 3PX2A 2YYSA 1SHJA 4DLUA 2OMEA 2ZP1A 2HW8A 3K72B 1ZI9A 3C7AA 4RZHA 3PDWA 1EFPB 1ZUNA 1IEWA 2WIFA 4QFBA 4R2XA 3LZCA 1UKEA 4ARUA 3FR7A 5A4MS 3V1LA 1YZGA 4BFWA 4X1IA 5L7YA 3KEQA 1J39A 4BNTA 2DULA 3C45A 4O2LA 1WETA 1M8PA 1YQDA 2VZEA 3RVBA 1RAIA 3FVTA 3D7KA 5IJ9B 3NHRA 1W49A 2HZ7A 2VJBA 3EZNA 4M0UA 3T6KA 2YXBA 3C4JA 1T4GA 1X1DA 4BB5A 1CT9A 3VPXA 3OP4A 4XGQA 2GHTA 1PJ3A 2PV7A 5LUBA 3VU9B 1TTHA 2HK7A 2Q49A 3LUAA 4XYMA 4CUJA 1YTUA 1PCXA 1TYBE 4G0YA 3ZNQA 5I7WA 3WBBA 3ZLVA 3U40A 3ZWWA 4EYEA 1RIFA 3A6DA 1KJIA 4JR1A 1ECLA 2QIPA 3K8QA 2XYVA 5MGBA 1LTKA 3QA9A 2J3HA 2QX9A 2XDAA 3SGLA 1C3OA 4DHEA 3S44A 1B0ZA 1VIVA 1DIOB 3AFHA 4OAPA 4FGZA 1AS0A 1AXEA 2DY1A 2FCRA 1UFRA 3RTCA 3GCDA 2F1JA 4IIXA 1BC5A 1E9SA 1TCUA 4CM8A 3A58B 3OLCX 2IHVA 4BUCA 2ASEA 2RG1A 3KWFA 2YN2A 4EQ6A 3I1FA 4YJGB 2B2NA 4Q82A 4X7PA 4OPMA 5IKOA 1B00A 3BB4A 3L1UA 4CODB 1YQQA 4Q48A 5DKFA 5JBIA 1QH8B 5A1JA 4JELA 1LLCA 1BE8A 3IBYA 5K2OA 4MNTA 4O2AB 2OYRA 4U7WA 1EG7A 1FSFA 3RJZA 4B35A 3K9LA 3RIHA 1U7PA 3DE5X 2UZ3A 3TYXA 1KSJA 2O14A 4Q6BA 4DNPA 1L7MA 1NP6A 2YR0A 1IN5A 4L16A 3ZE7A 2G4LA 3R6WA 3QVMA 4ETWA 3T61A 3NAZA 3A25A 3GLVA 2JD1A 3Q6MA 5DBEX 2B3TA 5T3YA 2OORA 3M6UA 2AC4A 1G5PA 3D81A 1RJGA 2R4QA 3AETA 3AUKA 3SMVA 4UHEA 1XTUA 3PT5A 4WXEA 4LKOA 4ZQBA 9LDBA 3F3KA 2X13A 3JTMA 2IYVA 3TXYA 3H5OA 1TK2A 2FWIA 1M1YB 3GUHA 2RH5A 3FMFA 1M1NB 3GUZA 3LGAA 1ZSVA 1N75A 4HI0E 2QR3A 4QYMA 3GNSA 1P4RA 1WE2A 3NI2A 2XUFA 4LJAA 4Y7DA 3MS2A 3V1NA 2CNDA 4H60A 1ISPA 4CMEA 3PHIA 4I9UA 3G6KA 1IN8A 4C07A 1ZJYA 4C0SA 4MJLA 4K9RA 4G1FA 1PBNA 5JS2A 1L4HA 1TPYA 3EFEA 1OIXA 2XUIA 3O90A 3EFBA 4WH0A 3ZPXA 2OFPA 1BYIA 1KARA 2P9HA 1N6KA 1YZQA 3DQZA 2AZMA 4D8YA 1DKNA 3LDGA 2PS3A 1JHPA 4HWPA 4F5WA 4HWTA 1ZPDA 3FPFA 1A1VA 4WESA 4J7AA 3SCZA 1G6OA 2AE2A 2L2QA 1WP4A 4X44A 3IMGA 3WAKA 4RTPA 1AC5A 2GAIA 1Z0UA 3M82A 5FDFA 3NU1A 3JQQA 1KPGA 1XE3A 1IIBA 3EG9B 3O4FA 4U7FA 1DXYA 1F6DA 4WLVA 2D1RA 3LLUA 1PP4A 4QU0A 1VI6A 2G25A 4NYMR 1PL7A 3GP3A 1TJNA 2A5LA 3FNFA 3Q4GA 2HEIA 3FOBA 1O6GA 3PWKA 2NUTA 4JJ8A 4NCXA 1BJRE 4RVNA 1SK8A 5FQNA 1YBHA 1WIWA 5CG1A 1QU3A 1LI4A 1D4FA 1SXJC 2X9QA 2NIPA 2QI9F 1J6UA 4LYHA 1V7PC 4MWDA 3LXXA 3ZH2A 1V3TA 2PX2A 2ZBQA 1QQ7A 1CUZA 4V24A 2BZ1A 1Q11A 1JAIA 1Z28A 5DK4A 1OVMA 3I1JA 4Y0NA 1I2ZA 1I32A 5KOHA 5J2TB 1K6XA 1QZUA 4Y2HA 5L3QB 4G4SO 4TMWA 2CNKA 5JXHA 2P9ZA 2XJ4A 4DKXA 5ENZA 1WHSB 2DWOA 1Y1TA 4ALNA 2I62A 1U8XX 1J07A 5DW3A 3Q2KA 1CJKC 1WDLA 1KI9A 2I2AA 4I55A 4IDAA 1G291 4L0CA 4ND1A 3VA7A 4FEGA 1QKIA 2GPJA 4H7HA 3LYHA 3N05A 3NRBA 3NWOA 4EO7A 1UPAA 3UBMA 4J7CA 3ITDA 3CN9A 4PYNA 5FFMA 3SBOA 3NEJA 1QTRA 3GLHB 3WS7A 5ALRA 5LZ9A 1K8RA 3CTMA 5HUJA 1G5FA 3CLHA 3QYPA 4YROA 1ZR4A 1M5UA 5KJFA 3AW9A 1JX6A 1PKXA 1VCIA 3L18A 5JJBA 5ESWA 5CUQA 1RAEA 2RGBA 2RH9B 3Q7RA 4J9VA 3E9RA 3HO6A 1PGJA 2IPMA 3R8CA 3BGOS 4GE3A 2H85A 1IMOA 3GJYA 4RCZA 2DYKA 2Z43A 4D9NA 4NG4A 3L1VA 2IHTA 1GRQA 1C9JA 1V8ZA 4KQFA 1UMDB 4AXXA 3EVEA 4R2HA 3RFFA 1F12A 3OD1A 1LZKA 3ZCXA 4Q7EA 4LJRA 4Y2VA 3PIIA 1RKXA 2OKGA 1MZVA 1HT3A 1KK3A 3DZCA 2A1TS 1B1AA 1RVV1 1D3AA 1SAYA 3G8AA 1UXGA 1MAHA 5C31A 2VZLA 3BERA 1M6WA 3IP8A 5HFNA 4B3CA 3E9QA 5BUSA 2IWHA 4IDCA 3PFHA 1YVEI 4FOPA 2UYOA 5CLIA 2OXIA 3WDKA 2PS1A 5C80A 1NWCA 4H0NA 4Q9DA 1MV8A 3H1FA 1W0JD 4E07A 1BN6A 1K92A 1OR8A 4PLWA 1BD3A 2GJ8A 4A2PA 2A5DA 3KQTA 4FNGA 4HLQB 4JDUA 4Q3EA 2FN4A 3QVTA 4UM7A 4WINA 3O93A 3JWGA 4ZEMA 5M29A 5I9NA 2FX3A 4KXWA 2RAPA 4K5QA 4RV9A 5EZYA 3SJCA 2UUAB 1FMLA 1I33A 1U1EA 3R7LA 1QUFA 4DMLA 1G2IA 4YQFA 5IJ0A 3NJ8A 3RBAA 5B4UA 4K26A 4OSPA 4H08A 3ONDA 2Z9CA 4I2VA 5E4TA 4RJLA 4DDTA 1KMCA 1O6CA 1THGA 3KR0A 5JPIA 1XFDA 3L7JA 3GO4A 5FAKA 1DHTA 1TO2E 2F90A 1U9JA 1T9KA 3PFWO 1CVLA 1Q44A 1S2DA 1PFYA 1PSWA 3VO8A 4EY3A 3VMFA 1G66A 2H7VA 3T99A 2B0JA 3OJ0A 5DTJA 3AUYA 5BSEA 4C7OB 2P8JA 4JOQA 2IXFA 1K75A 2WWFA 3JYLA 4N49A 3V5NA 1GILA 3M1AA 5JO9A 3FVRA 1KK2A 2Q7XA 4Q3KA 1RQ2A 1LCIA 3BX1A 1KAOA 4E5DA 4CTMA 3RRZA 1TZ2A 1D1QA 1NQXA 4EUKA 4UM8B 4QPDA 4TVSA 1YC2A 3MOIA 821PA 2I3GA 2HK9A 1KVUA 5FORA 3TX2A 4YMTA 2GA9A 1YVPA 1MJFA 5G3YA 1A9PA 4YYZA 2OAQ1 1KDOA 2GYVA 3IVMA 1V1RA 2H4JA 3IKJA 3CB2A 3D2BA 5K3FB 3E7PA 5TEVA 3LY8A 1VJCA 2SECE 5EJGA 3N75A 4MEJA 4BO4A 4E3ZA 5A0TA 5FEMA 2I7CA 4BJ6A 1HYQA 2CJFA 1IZ9A 1JQJC 1KXJA 3FWKA 3NHFA 3O4GA 4UOQA 1RKUA 2Q6KA 4A6XA 1Y3IA 4G6ZA 4KKXB 1E32A 2PTGA 4I46A 4BY9E 1EGAA 4QUKA 3O91A 4ENTA 4BYMA 4IMRA 1LVHA 3CRRA 5KREA 2BEUB 4YN3A 2Y2UA 1SQSA 1IEVA 5CEJA 2WVHA 3AHEA 1WV0A 2YH2A 1YA6A 2AHOA 1ADJA 2IC5A 2PMBA 3HU5A 3IQZA 2QBYB 2EQ5A 1BEZA 1QV7A 4IP0A 1U02A 4N47A 2DFLA 3G82C 4B4OA 3MMNA 1UZMA 5EJ5A 4UPDA 1E0AA 3E8XA 4EY5A 2ZW9A 2GEVA 1I0IA 1Q0QA 5GADl 2IIBA 1MX3A 4HNAB 4N7RA 5KHLB 3FSEA 1A7KA 1Q0SA 3WL6A 4BATA 1B8UA 1UKBA 4MYDA 3S29A 4WZAB 2A0YA 4C04A 4Q7KA 5JBQA 1XQXA 4HAOA 4L8VA 1G64A 2LGJA 1B8PA 2JEZA 5IM4A 3CWCA 4LDPA 4NZMA 1MW8X 1E6EA 2P3SA 2C2ZA 1T3GA 1R3DA 4C0KA 4G4SP 3RUPA 3O94A 5KDDA 1SBNE 1SHLA 3DWFA 5I8WA 1FFBA 3IP3A 5IC4A 3ULKA 4B8YA 4CF7A 3GFRA 5HZHA 2JG3A 1K3UB 3AZOA 3MFYA 4BQNA 2R97A 2YCBA 2ZB4A 2Q1TA 4YJ2A 3DZ8A 1WZIA 4N01A 1R0BA 3OIYA 1QP0A 1O4WA 4H31A 3RUCA 2PX8A 3GGJA 4NBTA 2HBRA 5JQWA 5KYYB 2J32A 2BMFA 1ZD2P 1TK3A 1DPGA 4NS1A 3U3KA 2QAIA 4Z4HA 1CYDA 3UMCA 1T1IA 1N9GA 2IZZA 4DA8A 1WJGA 3AGQA 3GARA 1MGPA 1G4AE 1NR1A 4MWEA 4C4TA 1L4LA 4D42A 4ZYLA 1ZR2A 4HDNB 2P78A 3UJAA 2HIAA 2FW9A 4E5UA 3LTNC 2D0IA 1T5IA 1DC4A 1FMTA 4IKEA 2L17A 4AS1A 1ULZA 2A1UB 2CHFA 2GM9A 3P0HA 4UNSA 4YDRA 3CONA 2NSHA 4O2BF 2QRNA 1A9OA 5BXYA 5IM4F 2G9UA 3HVIA 3UJDA 4A0RA 5FWXB 4W5RA 1JDTA 2CMDA 1WUTA 2PLAA 4MV4A 1XCOA 3S8EA 3T35A 2HFKA 3RANA 2IHYA 3FYCA 1SB9A 1W5SA 2ZETA 2PMFA 4JA2A 1F8GA 1L9XA 1N92A 2XBUA 3QGMA 4CIVA 3C14C 1UMBB 2APJA 1YR8A 3CUVA 3H6GA 3N8HA 3TX6A 4DLKA 2AJBA 1KEEA 5CAEB 1M9NA 3U37A 3OM1A 1AURA 3L7IA 3QQPA 1BQEA 4TKVB 5AW2A 5F9HA 1X1AA 2V7XA 4IFBA 5CFLA 5IM5A 1QRAA 5U9CA 2N1MA 4Y2GA 2R68A 4OBBA 1FUIA 4H77A 1YIOA 4P32A 3EXFA 3F74A 3BICA 3PLRA 3HB9A 1P9LA 3UMSA 4PQFA 4QDZA 3G8DA 3LDFA 1OFUA 4HMPA 5GWXA 4ENUA 1UK8A 2M32A 2R6GA 3MUOA 3NBFA 3IR5A 3Q0TA 3QLJA 4HWRA 5EZQA 1OW3B 2DERA 1E4EA 3QLUA 3LX4A 4GOMD 4IM7A 3O95A 5L3VA 5D85A 5KSOA 2X42A 5FNZA 1ISSA 2B7BA 4FGJA 4R9UC 4C76A 4JJKA 5F77A 2WVJA 1VL0A 3FRIA 3PD0A 2C1ZA 1OXVA 2H1FA 2JIQA 1GA6A 1SZCA 2ZKLA 3OPXA 4M86A 4YECA 2X41A 4MAFA 1QXSA 1US8B 3L0IB 1D09A 1T1SA 2VAPA 4TLCA 5REQA 2FETA 3M1YA 4Y6LA 3TRDA 3W2GA 4MS3A 3A6FA 3HVKA 4IV5A 4WMLA 1NLMA 3V1UA 5LYJF 2CW5A 2VSYA 1XV5A 2NUPB 3Q3VA 2O2IA 1UM8A 4D46A 4B6JA 5JH7F 3NWEA 4RPLA 3JAWA 2GN2A 5EIAA 1JHVA 2FNAA 3QVUA 3PFFA 4A73A 1P5FA 2N9UA 1ZRHA 4OL0A 2BR5A 4FSXA 2J0QA 3I0MA 3HWRA 1BHJA 2WABA 3FLAA 3ZY4A 4TKMA 2HSEA 3PEWA 1CULC 2D8MA 4GYYA 4EPTA 3U2QA 1RHMA 1C7JA 4ZI2A 2P1ZA 1VPDA 4EL0A 3ZQKA 2A9QA 4J0CA 1EP1B 4QPPA 3ENZA 3RC8A 3HY3A 1U8CB 3DL4A 1UKYA 3O8OB 4PAQA 4F4CA 5B1YA 1X77A 1SQ0A 3IDFA 3I9MA 4JI6B 3SEFA 3UV3A 1IVNA 4E08A 1FLNA 2R8PA 3FNQA 1QC5A 2FPOA 4XSGA 4FMCF 2P5UA 2VOJA 3ZYZA 1FFGA 4F4HA 1POXA 2BGUA 1KBQA 2OLEA 2O8DB 2O2DA 4AJ1A 1LY1A 3HKBA 5A5EA 1DIHA 2Q3HA 4X3OA 3KRTA 3T9EA 4MW0A 4HUJA 3KD2A 4LRSB 4RFSB 1DHRA 2YHIA 3AJ9A 2WD7B 3FA2A 3WRWA 4ITUA 3I1IA 5B1EA 2A4KA 3BULA 4OB6A 3VPCA 4Y6GB 5DHUA 2BT4A 3SR0A 5IU6A 1O3YA 3WI7A 3RI3A 3VZRA 2IXDA 3CLRD 3BWBA 1CEEA 4W8GA 4Z2AA 1B6RA 3I32A 4GUAA 3VJMA 3TUZC 4FFNA 4Z7QB 1E3SA 1Q5PA 4A8TA 3U5TA 3O2SB 1PG0A 2WQ7A 1YIAA 1TK9A 5DN9A 1YK1A 2DBQA 5L3RA 3ECSA 3K09C 2VDWA 2VRBA 4LZAA 2JFVA 2PZEA 4F2GA 4Y1RA 4B2YA 4MCAA 5BR4A 5B7PA 4EJ6A 1ACLA 1KZ1A 2P2CA 2WQZA 3HJNA 3K1TA 4G1UC 4HAUA 4IF6A 2EIHA 2CK3D 4S1WA 5SICE 3VR5A 3JTEA 4GGOA 1GFSA 1OF1A 3H2GA 1LBSA 3DD1A 4JR0A 6REQB 3OZRA 4ZU3A 4QOJA 1NBME 1YDGA 2A58A 3JAKA 4MUHA 2Q7DA 3I9V6 3VOSA 5FBKA 2AR9A 3ZUGA 2QGNA 2K2QB 2Q9UA 4HZIA 3RT7A 4BGEA 2QQ0A 3RFTA 3ADBA 2I33A 4EABA 5AVQA 3V4LA 2MWMA 4AM8A 2VH5R 5HF9A 1UMCA 2C7RA 2XXBA 3C4VA 1LSJA 1GXSA 3IUPA 1H69A 1FDRA 3L46A 2BUCA 1QCCA 4XQEA 1STOA 5LWQA 2VPIA 1MQAA 1X7ZA 3H1BA 2V5VA 4XM1A 4MLDA 5FTNA 2D1FA 1YACA 4Y2RA 3UT5A 2AYZA 1TT5B 5EY5B 2PMCA 1KI6B 2PANA 1LC0A 3PUWA 2JIZD 4UHJA 3DAFA 4ER5A 5HRCA 1AUQA 5E7QA 1V9LA 3AR6A 4HRXA 2HDOA 3R7SA 4OSOA 2WMOB 3A1EA 3DNPA 4UQLA 2DUMA 4OYHA 4XIJA 4ITVA 3BFJA 3I01M 4KTTE 3I9V1 1CQIA 2BEJA 2GCPA 2WYHA 1O58A 4X92A 4BC1A 3PG5A 5JSQA 1G6Q1 1R5OA 4HSGA 1HUQA 5BN4B 7REQA 4LIPD 2FAXA 2OG2A 5HXAA 3JQGB 5L45A 1I6WA 4PIVA 1HURA 4FJ0A 3K3PA 3DVAA 1XN1A 1QHGA 5D5QA 1GQSA 5IAJA 1XQVA 2AZXA 1NTRA 2YJ4A 4KE8A 4WK2B 1ANKA 1XNJA 3GLIA 5IUJC 1R9GA 2FH5B 3IAS6 4Y3UA 3JYQA 4KWCA 1KVTA 1PNVA 4WADA 1JG1A 1PZNA 2CZQA 4HLCA 4D9HA 2QRHA 2JRCA 3PQ5A 4D9KA 4TXMA 1QP7A 4EA6A 2ZVDA 3RYCA 4A6DA 3LQ2A 3W05A 2AN3A 1EEXB 4QDOA 2UXBB 1MFPA 1UC4B 2UVPA 1G42A 1HEUA 3V42A 4A27A 1IXYA 3NIDB 1LDEA 2XBMA 2J87A 2R6HA 4F2HA 4CNQA 3ONNA 3BGIA 4GLLA 5G0UA 1X14A 3JASB 5K3BA 3ZCPA 4IIGA 1NMSA 1S1MA 4WBXC 5F78A 1TJYA 2VWHA 1TU3A 2ZE8A 5F33A 2WOOA 4UZEA 3NFRA 4UFOA 4FQ5A 3EXHA 4EL5A 5DN6D 3W3AA 3K0CC 1GQRA 2C9MA 4YJ2B 1XT6A 4KXNA 1XTBA 5CT4A 2CBXA 4RANA 5HQJA 3RRNA 4EW3A 4DUYB 2QGFA 1KP2A 4G8DA 4TZTA 4YRRA 4G0UA 1TXGA 4Q4DA 2QE7A 1MCZA 1RQ7A 2GN9A 1P3JA 2IIQA 1ZU5A 3PJGA 4WEQA 1QHSA 1YR2A 3KEMA 1W88B 1N33B 2CVZA 2PSJA 1XEFA 1JHYA 1WQ3A 2QVBA 3GW8A 3GFVA 2BGKA 1COWD 2QZSA 2VYVD 3A9SA 3ECAA 4ZOBA 4HAXA 1AQJA 1PZFA 2QRZA 1ADGA 1SKYB 1QH1A 3FYUB 2FP4B 4WKGA 3O47A 2J9FA 1R0ZA 2Z5GA 4GEGA 4S2EA 3I83A 5AJWA 2YIVX 3MJVA 4X7MA 3MGBA 4HAZA 4QJ5A 3TAUA 1H8HD 3WTBA 4ANFA 2AG5A 2Y1KA 1R4NB 4M0MA 3EDCA 1X70A 1W93A 1OI4A 2AL7A 2GCEA 2YWRA 4U00A 5I5EA 3E3AA 5IVIA 3O8CA 3HNPA 1F2UA 5JJIA 5KS2A 3DE4X 5IVKA 1HDXA 4QTYA 3TBKA 3BWXA 5AHOA 5KOJA 4YP0A 3C41J 3PFGA 3EC2A 1RYZA 2QQEA 4DXDA 4UFPA 2HJRA 5HBRA 3RWMB 4ER3A 4YPOA 2OAEA 5AVXA 5CPFA 5KNCH 1ZZEA 1L1RA 2NVOA 3UJNA 2GKGA 1H4SA 1R88A 1T4CA 2GF2A 2JCSA 2TRSB 3CIOA 1EXWA 1FY2A 1SG6A 3DULA 4XKJA 3RSZA 4DQXA 2F3UA 1XA3A 3EK2A 4U39A 4BBPA 3OQHA 4V03A 1L8OA 1N5RA 3QLEA 1HLGA 3WQHA 4OQPA 5JYCA 4WOPA 1G3RA 2PZKA 5BSFA 3CQ9A 3TN7A 1V43A 1J2JA 1FP4B 4JR2A 1YZYA 1ZGHA 4K6CA 1N6IA 3OZDA 1ONNA 1UDRA 13PKA 1XLVA 2P7HA 4HAWA 2ZJOA 4HJRA 3TIFA 2IYXA 4J29A 2ZIAA 3NT2A 1TAUA 2OHVA 1GXSB 2QRVB 2JK0A 4L8WB 3E18A 1NQUA 4BXOB 1TRHA 1NV9A 1YFLA 2XBLA 5KWEA 2WG1A 4BNLA 2X8JA 2Z57A 3WLNA 2AEEA 2GCNA 5AJXA 1Y6JA 4O0LA 3N8DA 2W11A 1Z6TA 3RD5A 5DRYA 4BN4A 1G3MA 3IT2A 1LJUA 4E1VA 5HSGA 3HDVA 4KPGA 1T5LA 1JSRA 5C8YA 3MMPA 4XYLA 1OYWA 4RHXA 2OAP1 1NAHA 3B6JA 1OA1A 4OBEA 4OHUA 4QBGB 1TF5A 1UQRA 2XUJA 3G2LA 3F1KA 4FBGA 2D8AA 3G8BA 4DT1B 2VP5A 1HFWA 4MCJA 4KBYA 3SM9A 3IMKA 3K1JA 5EESA 1WUYA 2CXSA 4ZU1X 3M2TA 1MG5A 4AZVA 1RM5A 2YKGA 1JSXA 1L7BA 1UF9A 4XW2A 2K7FA 2Y0BA 2FKNA 2BKVA 1BRTA 1YB1A 1XU4A 1XRPA 5AWFC 5INTA 4P92A 4P0TA 2DF8A 2AKYA 5ARBA 3D7LA 1FRQA 2H5IA 2Q2VA 4R5MA 5G53C 2WSYB 3IOYA 3A04A 1NMYA 1VKRA 4YP9A 4LWOA 4WACA 3C7DB 1E61A 5EZYB 3PZRA 2I99A 3E9MA 4LF9B 2DBZA 4MI6A 4MGEA 4FJ2A 4GAEA 1C0PA 3GH3A 3WQBA 1LDBA 1DXQA 1QTNA 1QJCA 4OYLA 3MINA 4Y9DA 2TMGA 1OWNA 4YXWD 4BO0A 1HZZA 3KCNA 3ILYA 1G3QA 2ZYSA 4FDLA 4IH1A 4KH1A 1KC1A 5EJMA 3U60B 4PGFA 1Y8ZA 3U5ZB 2QZPA 2KS6A 3PPVA 2FWRA 1U9ZA 3P4YA 2LKCA 4YPFA 1M66A 3ZIAD 3ASYA 3ZLJA 4HNRA 1U7TA 2HH9A 3L84A 3W5IA 4BWFB 1ZU4A 2X14A 3UFBA 1MGOA 1E9AA 3AR4A 2Y93A 4G0XA 2D5BA 4WLFA 1KZ9A 1XRRA 4YAUA 1E9BA 2BV3A 1VMEA 2G9ZA 4XDGA 1CQWA 1DDIA 1ZIOA 1OC2A 3CPEA 4U2KA 4ZVOA 2CGEA 3WC4A 4A0HA 3LCRA 2WUVA 4KITB 4KGVA 1NF3A 3OPMA 1ABBA 4EHLA 2LTAA 4C89A 2I80A 3UMFA 1TKBA 4F2DA 1FFAA 2QRLA 2SCUB 3OO1A 1GTRA 4J07A 2NVUB 3N59A 4PVDA 4IRMA 1E5VA 3SZUA 1HQYE 1QK5A 5C32A 1S3GA 1UR5A 5F5NA 2Q5FA 3JATA 3RFUA 3LYAA 5H1YA 4DWWA 4ETNA 3I92A 5BORA 1J0CA 2I2DA 4LXIA 4Q47A 2PGNA 3VKFA 5JYDA 3EEYA 2AFIB 1AHPA 5AM4A 1YZNA 3KKPA 3ME5A 5BOSB 4UUAA 2HXYA 3IBFA 1H5NA 1PX0A 3DONA 3FBGA 3C70A 3LHDA 1V9SA 4JMPA 2C9BA 2HA7A 2IHZA 3LX5A 5F1YA 2O8BB 1SCBA 5KIAA 1I2DA 4D4LA 4JGBA 4P22A 4AURA 3FPKA 2D5LA 1GNRA 4O3FA 2ZIZA 5C51B 3N53A 1RRVA 4LCBA 2FLKA 2AWOA 2GJAA 2MSWA 1J5XA 3ENNA 3MCTA 3MIZA 1ZFNA 5LA6A 3AM1A 1N2HA 4E12A 1YR7A 3MBKA 4EO9A 1N3YA 5FEUA 1NVEA 4CQNA 3LP8A 5J4VA 1ULBA 2C97A 2FPKA 2ONYA 4OOFA 5EUBA 2CV1A 2QX8A 4OVKA 2AXEA 2F6RA 1QJ4A 3WLLA 1AG9A 4DIOA 2WWXA 4AVYA 2CZCA 5G0TA 1UAAA 1B8VA 1CWUA 2HCRA 3G0BA 5FB3A 3VHXB 4A0GA 4B33A 3FCCA 2P9FA 3A4TA 3EGIA 3I5MA 1PR5A 3OICA 4EATA 1ULSA 2HA3A 4BDTA 3WIOA 3JZFA 1AS2A 5T67A 5EYPA 5HIMA 3ABOB 1CUBA 3L6EA 2J6BA 2NTJA 4CKBA 1YRYE 3OQBA 3PNKA 2FFQA 3BCRA 2A86A 3U09A 3ABQB 3LAWA 4M98A 4AICA 1HEIA 2ZJAA 4QYTA 3F9RA 4QHSA 2OQVA 1QBGA 3E3OA 1UDXA 1TZMA 2ZQZA 5L53A 1FIUA 2B7LA 1KEEB 5E38A 2B37A 3IIJA 4ZTUB 2W6PA 2WWRA 3KB8A 1NN3A 5AJYA 3EN0A 2HNBA 2GBLC 1Q1NA 5EWLB 3M3DA 4DUGA 2ZUEA 3EXHC 1D6SA 1U9YA 2GEJA 2EF0A 4RQUA 3ZWOA 3T1OA 4DV5B 3BC1A 2FMTA 4RKWA 4OQ4A 2VWGA 2OGTA 3NH6A 3OZ7A 4MR7B 4BMZA 3O0TA 3E84A 1QIIA 2W6ID 5A03A 2I54A 3OZUA 1OHHA 3HBMA 5I01A 1N9GB 1JEQB 4YLGA 5J5VA 4BB6A 2FV8A 3KDAA 1PQWA 1UJNA 1DKPA 2WK1A 3OE5A 2QXYA 3KAJA 1U7DA 2G9QA 4HN2A 2XWPA 3EVCA 3IRUA 4JHXA 3NMUF 3REFA 1XEXA 2Z6UA 2R5FA 3CNEA 2M6LA 3C43A 1RCTE 4GXRA 3TD9A 4E5MA 2O7RA 3GRUA 2C3UA 4UU8A 4ZOLF 2VP0A 1WZNA 1RNLA 1WRBA 3K0HA 4UCWA 3REQB 4BX3A 3CPJB 1L4UA 3MWDB 3OFJA 3OU6A 1MMFB 4QUIA 2EFHB 1WKBA 3K70D 4LJSA 2XWQA 1GN9A 4PZAA 4ESOA 2NO9A 1GUFA 3ZW8A 4NBRA 2CDNA 5TSDA 4KN9S 1LKZA 3BOSA 1QE3A 2IH4A 3DBOB 2XUKA 3N2LA 2P1DA 1E1MA 4ZHQB 2Z08A 4UBLA 3ORFA 5AVUA 5DM70 4U63A 1Z75A 2Y8EA 3MBOA 3WQRA 4EB3A 5F7XA 3TQIA 3PUYA 1FYXA 1H0KA 3FFTA 3OCXA 3PPYA 4LJLA 3QBEA 1JLMA 5KTTA 2XUZA 1FFCA 3KO8A 1RI3A 1WVGA 3FH0A 2NTVA 2PO7A 1QG6A 2UUOA 5CG2A 2ZJ2A 5FTWA 4EFDA 2C7OA 4TYWA 1RXIA 2GK7A 4XM2A 1EIZA 1TDJA 1XLTC 3CIFA 4MINA 1DAMA 3VDRA 4CMIA 2YS7A 3I30X 2ZCVA 1BTOA 4N7MA 2C2KA 1PFQA 2DTDA 4Y6QA 1QIDA 1SVIA 3LP5A 1T0UA 4H6WA 3ZYCA 4MVWA 4BE9A 1EBFA 1HH4A 3VM6A 1NUTA 1IJKA 1ILWA 2PA3A 4L4UA 5EJFA 5A05A 3LC2O 4TT8A 4CKWB 1LDYA 4TRMA 1IBSA 5FLYA 2B78A 1U0HC 2ZT5A 5IYZA 4KK3A 3FWPA 5LLDA 2A35A 1VE9A 2PWPA 4XB6B 3L4BA 4OGGA 4M36A 3GIWA 2I67A 4ZGGA 2M9MA 2F55A 2BI4A 4K6FA 4LG1A 3G0HA 4OP1A 2C5SA 3LV8A 1GY8A 2VUSA 4M1SA 5DNCA 1L7NA 3RYHB 4G37A 3KYDA 3I9OA 3FJ1A 2O5EA 2XDWA 1J9GA 4H6XA 2FU5C 3HRKA 3JAWB 3K09A 2COUA 1Y3FE 3VKUA 1X42A 3H2JA 3P9QA 4MIOA 4MV8A 4N0QA 5AVOA 2EJWA 1UKVY 1Z06A 5I7AA 3VU1A 3W90A 4UM9B 5KTMA 1RE0A 4AO7A 4AZWA 3C8DA 2IS4A 1US8A 1E79A 2HJSA 3SQNA 2CNWA 3BF8A 5A3QA 5EZYF 5KBYA 3D4NA 2C0PA 3RRXA 1IY9A 1Z74A 4H27A 4DCSA 2H8KA 2PUEA 3CEJA 1KEZA 1OAOA 2AXQA 5JS7A 4V0SA 5KTKA 1K6EA 3WWEA 4IICA 2LD4A 1XRQA 4Y9SA 4DIBA 2VKTA 3IA2A 1LQ2A 1KVRA 4QUJA 3ZBQA 4RQBA 3BYZA 4Z9FA 5FA5A 3RBZA 5EXTA 2NYUA 4FJ1A 4LE2A 1JU9A 1OBHA 4Z4CA 1FU7A 3M83A 2A0UA 5FOWA 3FAKA 1KJZA 2NV6A 3SJ7A 4C9BA 6YASA 3DO5A 4L3OA 3CRNA 3HDJA 2CXXA 4K0RA 3GGCA 4B5KA 3EIEA 1KI3A 2NU6A 2ID8A 3MWKA 4IJ6A 4R2WA 2BMAA 3M4NA 4HWGA 3U39A 3ZY6A 1NHWA 2GKSA 4DARA 2WWYA 3A2KA 5KYNA 1OT5A 2VC2B 3FKSA 2HLDA 5HKBA 2JCVA 3QLTA 4UVIA 5EA2A 3SF0A 3PPWA 1FP1D 4EFKA 3B6ZA 4Z53A 1Y3AA 3A1VA 3UHOA 4RPIA 5E7IA 2I55A 2XYRA 4KW7A 2AA3A 4CM5A 4LQDA 1NBWB 1VOTA 2IE0A 4LPSA 4OLJA 3MNFA 7ADHA 2HTEA 1EH5A 2C1XA 3V1YA 8LDHA 1FTGA 3KIPA 2G5TA 3LKDA 1YULA 4RH1A 3UXHA 1F17A 3NDBB 3DZIA 3GDOA 3QVOA 4KAAA 2EKDA 3W7VA 3K9GA 1HQDA 4HK4A 3PKZA 3AWIA 3OURA 4GIBA 4BKOA 4WSOA 4LTMA 4BFTA 1X7WB 1HYHA 3UIEA 3WYGA 1OFGA 5BWCA 2ZSKA 3W2HA 5GJWC 4Z9XA 2BMVA 3AR2A 3LPDA 3UAXA 3BA6A 3HDGA 3L1KA 3GLUA 4MKRA 2R6R1 2V9ZA 2MSDB 2C95A 4H4DA 4R05A 5KNCD 1KMHA 4YRJA 2H63A 2CHEA 3E9NA 1NR5A 4B80A 3G2PA 4FDUA 4WGFA 2XGOA 1XB2A 5FI1B 3COJA 4MEAA 4GVPA 3MJRA 1LRKA 5K3FA 4BEVA 1KR5A 3QP9A 4CM9D 2A84A 1VB5A 3TE7A 4L5YA 3S0JA 2V8BA 3FNEA 4QREA 1SA0B 3PD7A 2YQ4A 4ZI5A 5IHXA 1Q50A 2VYQA 5EUMA 2Q9CA 5FWNA 4DUGD 4YQZA 1P4SA 4X5OA 2WWGA 4F3RA 2IXEA 3AL2A 1K7FB 3FVVA 4PQYA 1B76A 3TSOA 3N86A 1GR1A 4D79A 2CV0A 2NVUA 1Z7WA 2WG0A 1X7HA 2I1WA 4RD4A 2YZ7A 2OBLA 1U98A 2FMHA 1SC9A 2ZYAA 3JR3A 3PF9A 1A9RA 1E2GA 3W6OA 5C3UA 1M0TA 2JD2A 3OEWA 4UEJA 5ALMA 4B47A 3KL4A 2CBZA 3A9UA 1RYHA 3C1UA 2II6A 2PMWB 4DADA 5AM3A 4RF4A 3RYHA 1X1TA 3V1MA 5KQMA 3AEKA 4HZUA 5CBPA 1J97A 3QENA 4H16A 4KX3A 1G63A 2W43A 4FTWA 1JDZA 5IDWA 2BHNA 2KJQA 1I5EA 1ZXLA 3HXQA 1GA1A 2PD4A 2VNHA 1CEXA 2AB0A 3L05A 5K6TA 2OXFA 1QH1B 2Y0EA 1ZJZA 2XADA 4L5JA 1LF0A 3RHSA 1J0EA 1GCAA 2YJ3A 3C5CA 1KEWA 5FWYB 1BVHA 1I4LD 4X20B 1AZWA 3UQYS 3H17A 3QSYA 1QDEA 3F97A 4ZI7F 4W8HA 2WJYA 4FDVA 3PV0A 4N4AA 4KO1S 3G5LA 2B8WA 4RPGA 1FS6A 2BBSA 1AK9A 2DWQA 1RRKA 1LBTA 2RJOA 5PNTA 2HREA 3THOA 1GPDG 3U3MA 1J42A 4HNUA 2DZDA 3HJGA 4GMDA 1UH5A 4UMVA 1A8PA 4POAA 2JC3A 5T64A 1HTBA 4P3NA 3MTQA 1HDYA 4J2HA 4UZSA 4BLPA 3IBSA 3HJFA 4RSGA 1QVWA 2J9XB 4H0FA 3H8JA 1JP7A 4UVDA 1QE5A 1CRZA 3D8UA 3QMWA 2R60A 5FTJA 4PBTA 4O1HA 1CTQA 1UIRA 2XUDA 3RWOA 2YW9A 1EG2A 1Z5UA 1LLQA 4V3CA 3GLRA 5B2EA 1ODTC 1H23A 1PZMA 1CD5A 3EPPA 3ZE6A 4IRUB 3UT6A 1RWPA 2IEZA 2G80A 3KTAA 1Q7RA 5JG7A 4BV8A 1WMBA 4D8XA 3AEQA 5JSHA 5FADA 3R6GA 3A6HA 3GT7A 4QRIA 4DT1A 2X8JB 3TFOA 4Q01A 3H19A 5ALKA 2MCFA 2EP7A 3OQ6A 3RV3A 4BXOA 3KJXA 1L4GA 1ISIA 1SWVA 2VT2A 3BE6A 2I6TA 4I50F 2CKMA 4K9OA 1U8UA 1WCIB 3HB7A 4WFIA 2YS6A 5BRAA 3M4ZA 5DOZA 1Z6AA 2IEYA 4EGFA 1KBZA 3CLTC 4CEJB 4G5YA 4NCKA 2NAPA 1AGYA 3M9XA 4WNCA 3EQ6A 3TTUA 1ZM4A 4QNMA 3WV4A 3S2IA 1YS9A 2AFRA 2V54A 1KJNA 1N0IA 1RIIA 3SSMA 1PNQA 4G2NA 2MDTA 3OEYA 2D1YA 1WMEA 4REQB 1X1SA 2R11A 2JBAA 3QZUA 2BH2A 3F5MA 5CH8A 4QATA 3VDQA 3VR4H 5B12A 3LWZA 2Y9MB 3NRJA 4DBZA 3ZCRA 5AFSA 3P2EA 3ZOZA 3AVQA 3I9KA 4BMYA 2WM3A 3DMGA 4DC9A 3RRMA 3T3PB 1YZLA 3IA7A 4MVJF 3C1OA 2FEAA 4Y9RA 1GUBA 2Y67A 3OY7A 2JNWA 1YJBA 1T3HA 3QTTA 2J30A 3WKEA 2NACA 4KXYA 3T0GA 1BRMA 2YV3A 2H4ZA 5G2OA 1AUXA 1PD1A 2Q5HA 2ZRMA 4KYUA 3UBTA 2B1RA 2R9VA 4E15A 3RSOA 3GELA 3LC7O 3R3WA 4C4SA 1UBSB 1NYQA 1X13A 1E1LA 1O5IA 2VF5X 4OV6B 2AK2A 4GGMX 3R6TA 1VLJA 1RI4A 4EKYA 1ZJ5A 3PQFA 3D5TA 4EOGA 2NZWA 1YBAA 4U2BA 3V7FA 4Z4QA 2Y99A 2DAPA 3BH6A 1XF1A 2HHCA 2AF4C 4MAAA 1PW5A 2HAEA 2B6NA 4O5AA 5AI4A 4TKZA 2BR3A 4YR9A 3IDQA 4UHDA 2PT5A 5CNJA 5FNVA 3VNBA 4YT8A 2QY6A 1WAMA 4C5CA 1K6IA 2PLRA 5DHAA 1OYYA 1EQAA 1X7XA 1XU9A 2HWKA 1LK0A 2DHRA 4OP3A 3Q5GA 4RE5A 4W1PA 4ZCSA 5MN5A 4UBOA 2ZRBA 5KWJA 2E2WA 2WDPA 3IAS1 4FFBA 4O0MA 2F1OA 5JALA 3NDJA 2D2FA 2BFOA 2WU1A 1W44A 1Q12A 3U7GA 1CP2A 1X1BA 2CY0A 2CYBA 3HBAA 1JQ5A 4IUBS 3STXA 1EPUA 4KNWA 3TZQA 3FR8A 5B58C 4AQYB 3ZD7A 3L4SO 1KGDA 2WFAA 4KVGA 1MV5A 1RJEA 2WC1A 3LE8A 1AA9A 3OF5A 4TSKA 4C3VA 4HNTA 1XIVA 4MYTA 5CB8A 4YUAA 4MVJH 2PSFA 3A3OA 3LKZA 4IINA 4ZYTA 3OIVA 1Z37A 2JFHA 2LXNA 1GAWA 4M1EA 3ZK9A 5LMZA 3WGUA 1QKJA 1DO8A 3OIFA 3A4VA 3EZXA 3W7AA 2B82A 4HTFB 3ZVMA 4HUTA 1GGNA 2GBPA 3IE2A 2Z98A 2YFYA 3N87A 4GYKA 2R8YA 4PZLA 1SK9A 1XD9A 3KSMA 1Y4UA 2IYSA 2PUAA 4FI3F 3DE2X 4NU0A 5JSYA 2X5NA 3NBXX 4OUDB 1RZVA 4IH4A 1H8HA 3AK4A 2M98A 1KA9H 1G7TA 1GYRA 5T7BA 3KKNA 3VVLA 3EHEA 5HFAA 4IIVA 4EMSA 2QNRA 1XC7A 3AHIA 2YMQA 1TNDA 4ZKDA 3SC4A 1ZUHA 4JT8A 4NIMA 2ZT6A 1H9BA 3WICA 1IQPA 1EUCB 1GCUA 1P81A 1ZNWA 3PZBA 4EKGA 2BZ0A 4QZVA 2Q07A 1X38A 5NULA 3GLFA 4HDSA 4EKDA 1FP6A 1I2MA 5DHFA 1YZUA 4E03A 1PLKA 3F6BX 1FYVA 1JXAA 5EJ7A 2I91A 3TTYA 1EQUA 3DE3X 1IONA 2HXSA 2ZRDA 3GRCA 5FJIA 3VZQA 3TQHA 1B4DA 3KDPA 5H4GA 5K01A 3FUWA 3OKAA 1SCKA 2R65A 5DYIA 4EAAA 3ORYA 3TZBA 3TM4A 1J2UA 4QU5A 1LTQA 3G2MA 3WIDA 3I04A 1DBIA 5HA5A 3IALA 5EHZA 5AKXA 5K0ZA 1W85B 2EIXA 1JFTA 1WXHA 1TA4A 1L7DA 1U2DA 3RVRA 4E30A 2NZXA 2QX6A 1I5OA 4NSNA 3SZRA 3T9AA 3ZHVA 4ARVA 2C5AA 1BVRA 1KYYA 1NZJA 2WM9B 5TQJA 2WWIA 2VLIA 3PRYA 5HDBB 3V33A 2DFDA 3BGWA 3ESAA 3F4BA 4Z3DA 4F3CA 5BQ3A 3ADDA 4EVQA 2YMLA 4V1CB 5FPHA 1G8HA 1OXTA 2C0QA 3OT1B 2ZZNA 3EGCA 3QXXA 3ENQA 3NDIA 3NC4A 3MELA 2HV9A 5E1DA 3DDNA 1NUQA 4G97A 1YVUA 4F04A 3EXEA 4UPEA 1XUOA 2X2OA 3WZ2A 1UK9A 3DE6X 4CQMB 1WTAA 3C6MA 1BCSA 4XQCA 4BX0A 5I4CA 2DWPA 1YUBA 3FXAA 1FTSA 3K4PA 2HDWA 2HA6A 4H7PA 2M2IA 4MVJA 3AR3A 5DI3B 1JPVA 4R9VA 3V4PB 2BM9A 5BY2A 5H9WA 4RL4A 3VFDA 1P1HA 1T0BA 7REQB 1U2RA 2LRHA 4EPYA 3T95A 1NW4A 1H22A 4WV3A 1NL3A 1DL5A 2XV1A 4X20A 4NPHA 1AK2A 3I6BA 5AW3A 1KDRA 2BFFA 2H31A 2ZSIA 5EWJA 4RULA 4UARA 1M8FA 1GVNB 1UBUS 1T8PA 3D5QA 1XLTA 3PBKA 4HPJB 4RZQA 5KSZA 3AESA 2XGSA 3AHCA 3LUHA 4KTVE 5CT5A 5BNTA 1FL9A 2J48A 1J8FA 2JIDA 1XDWA 2A1IA 4PGHA 5BQOA 3C6KA 2VI5A 4LDJA 4LGCA 4F2WA 1A50B 4FHFA 4N3BA 4ZVKA 3DEKA 5JZMA 3SXJA 1Z22A 4J2OA 4FFWA 5L7WA 4Y1FA 1CJVC 4IZIA 4ZQEA 3ROTA 4C4PA 4RVOA 4QBKA 1DAFA 2Q99A 2GK6A 2ZWVA 3MCUA 3E2MA 2OV1A 2PGAA 2X7HA 3NV7A 4MI1A 4TV8A 1SXHA 3A4LA 1CKEA 4HH3C 4PHHA 1PK7A 4TTAA 4JI3B 1LPAB 4W9NA 3SU8A 3TRKA 4ALIA 5BYKA 1W9MA 1P45A 4UNPA 1P2UA 2JHGA 3DW1X 3F67A 4A1FA 5AW0A 5ALXA 4IVQA 5LOVF 3PGXA 4FN5A 4A3SA 5EKUA 4AJJA 1J24A 3L8EA 1GGJA 4B9EA 1E96A 3FYHA 3KQPA 4B87A 2YHAA 1ZQ9A 1K0FA 1R8JA 1KY2A 4JSYA 1DCTA 4RNCA 4DC1A 4PS1A 2CKDA 2A9RA 3H8SA 4CLOA 1XN4A 1YZ3A 3RS9A 3DCYA 3O9VA 2ET6A 3TLCA 3J81k 4U7TB 5C7OO 2FPPA 3LCJA 1W4BA 2PUGA 2H52A 1LQUA 1TMGE 1LTHR 4UE2A 3VAYA 4XTRA 1SUSA 5K5EA 4V0KA 1E5TA 1INLA 1X1CA 2WHRA 4BTLA 3I12A 1DWPA 1K2WA 2QMEA 3NDRA 4K9DA 5ECYA 1QH0A 1PJTA 2OQIA 3MWJA 3RARA 2O9JA 3TJZA 3HCWA 4QOSA 2HF9A 2YWEA 5BSTA 4BP9A 5IANA 1KRHA 4DEYA 3DV0A 5J4YA 3OBIA 4UDNA 1RWOA 1GTJ1 5LKRA 1IVYA 5LMUB 3L8FA 1CUVA 5BMVB 1WA5A 5ED0A 3WGJA 3OPQA 3PR1A 1TZKA 3WO0A 3CMCO 3AI2A 4PXAA 5IKPA 1RWNA 3TKAA 2OB1A 1ZOSA 5EIHA 2ZRLA 5CFPA 2R44A 1TLFA 5B1SA 3DE1X 5JWHA 1FDOA 4CEHA 3CZ4A 4JEMA 2J5RA 1ZMBA 3BRQA 3LPNA 1AZTA 1E2IA 1GKKA 2FA9A 4YEDA 1EJ2A 4LV5B 2P75A 4CLOB 5ALDA 2IWRA 3SDZA 2HMTA 2IEDA 1P3Y1 3F0TA 5G3ZA 3UH1A 1C1DA 2J45A 1YRWA 4ITRC 3ZGXA 5K4AA 3L79A 2GBGA 1ZIYA 3RTGA 2R96A 1SA0A 3FHCB 4YCSA 4QX6A 2BTEA 1HQCA 4I5FA 1CS0A 3C5VA 1HYEA 3K05A 1CZRA 1OHHD 4D6XA 5AW4A 2VTBB 2IVZA 4CLEA 1O5OA 4J3NA 3BIXA 2JA2A 3RJTA 3UYLA 5HKKD 2VA9A 3ILHA 4MYHA 3BD6A 4ZANA 1TZJA 5JXGA 3T5DA 4KSYA 3PUIA 4M1ZA 4DJFC 1ESCA 1HE4A 1EUQA 3E3LA 2Q3BA 3GY0A 4X6YA 4ACBA 3TKYA 1JAZA 3M9WA 3Q2OA 1HQKA 1C4KA 5KTPA 1REQB 4JL8A 4RK1A 3A31A 4BX2A 3H0KA 4ZWNA 1FBTA 1SPXA 4KQ1A 3QPWA 4Q0MA 5CA1F 2PR2A 1EM8B 5JJ5A 1QORA 4NCBA 2X0JA 3RU3A 3FAZA 5KCZA 2X15A 3X1KA 5CFOA 1TOAA 1U3CA 2QUJA 4BWGA 3QOYA 4KUEA 3L8GA 4N3GA 4X84A 1DAPA 1L5HB 2FPWA 3GA0A 4NVRA 3VJRA 4MR9B 1OXXK 2E49A 4LZPA 4BWYA 1DARA 5LSAA 4W5OA 2O3UA 1LPPA 2G71A 2Y4NA 3CX6A 3LNCA 1Z16A 3TSAA 2PD6A 2B8JA 2BGNA 1KNQA 3I76A 4PLYA 4B5LA 4HNAA 3H1TA 1YGPA 3SJAA 4JLBA 3WGIA 1YE3A 1TUBA 2P41A 4PRYA 1JAXA 1WUIS 1Z62A 2W8BB 1EU1A 2X58A 4KRXA 4YJ3A 3ZDRA 2GNPA 1QVAA 3ELDA 4TTQA 2FE1A 3RIGA 1J0XO 2VYND 2JLAA 1ZBDA 3H2HA 5DTEA 3A11A 3PRJA 1G5IA 3UB3A 5CCBA 2J3LA 1Y48E 3KB2A 3WGHA 5GIOE 3QW4B 3V9PA 1U2DC 3G2IA 2J67A 1YDFA 3KOXA 1KJWA 2BJHA 3PFIA 1Y98A 2Q3CA 1KY5A 3D3JA 3O6VA 3KYCA 3TLKA 3WL3A 1BOFA 3AUSA 3A28A 4FDAA 1LXCA 2C2GA 3GQVA 1N5DA 4JB8A 4OGWA 4QAQA 2OHXA 5FCDA 3ZVRA 2VXCA 4UXJA 1KYXA 1E2QA 1D4OA 4MKHA 4MVXA 4E7PA 4ZU6X 4YMUA 3B7WA 2ZQYA 4NNOA 4GBED 1UMKA 4OKSA 5LLSA 3TOCA 4OGFA 4EW2A 3ZV7A 4QYIB 1AX9A 4CLRA 2HA0A 2QT1A 3IUQA 2VJPA 1DAKA 1RWXA 2WWTA 3B8HA 5JZBA 1T8WA 4O4HB 3UA3A 1UPTA 4DDVA 4OX9Y 1HNWB 4ARCA 1ESNA 1NC3A 4Q24A 3HB0A 1SRRA 4R2JA 3KV3O 2XCQA 1E89A 1B43A 2PX5A 3CV3A 3NQ41 5EERA 3QKSB 2OO3A 4IVRA 3TZLA 1TEHA 3GA5A 2VHQA 3LH5A 3QVKA 1VYTA 5EJ9A 1T9GS 4AJPA 1FCJA 3FLMA 3GC6A 4XX1A 4DLNA 2HHJA 3R5XA 1QRDA 2LV8A 2NT3A 1P7ZA 2AF3C 3VGJA 3DWIA 3MTGA 2IBMA 3BHNA 5ESDA 4CIBA 4C06A 2IY8A 2JJMA 3OOWA 4FK8A 1T10A 3R40A 3KCQA 3WMWA 2XOKA 3W2EA 2PL1A 3ZG6A 1UMBA 3NNDA 3OX3A 4BEWA 1DX9A 1RC0A 2QM7A 3BWDD 1U9IA 2DR3A 3KAQA 2FSFA 3BJIC 5DGHA 3VPSA 5IJ0B 5JQGF 1GGHA 3B3GA 3A05A 1OGIA 2DQSA 1CS4C 4WLOA 3X43A 5I9TA 1FFEA 4NXMB 1K9VF 5I7OA 3PYLA 1DAOA 1X8XA 2DKNA 1TC2A 2ZS7A 4PV7A 1ZOOA 3S2EA 3MUNA 2Q0XA 2GPSA 2WKWA 2OQ2A 4QOHA 3T5CA 4Y2PA 4FSHA 5AR1A 5HILA 1A71A 3VISA 5LOVB 4CU5A 3KJIA 3IGFA 2OL4A 2C2BA 2HHLA 4GQAA 2V9CA 4KYVA 4US0R 2JCYA 2WE7A 5IAOA 2LKDA 3RIEA 3HUDA 4BQEA 1T5SA 5IFLA 4HEA6 1Z4NA 2OBFA 3VSCA 4X8OA 4NC9A 3U56A 1FYWA 1Z4JA 1G1AA 1G6KA 2ENWA 3C24A 3NGXA 3P2KA 4IEEA 3ZCTA 2ZM5A 3V8QA 1NW7A 1TE2A 1F4LA 2ZB7A 1J06A 1V8OA 4MHOA 5TJHA 4P4LA 1KOJA 1U11A 3LWDA 4TV9F 1S89A 4C1BA 3DXZA 2ZI4A 4G1CA 4KEAA 1KU6A 3BJRA 4MRVA 1YBMA 3GLKA 2NXNA 2W71A 3HHPA 5BWMA 2GZAA 1MABA 1PF7E 1BVYF 4KLAA 3RPEA 4IQ4A 4B6EA 1J1ZA 1H5QA 1G7CA 4WERA 4D4HA 2PMEA 5CA0B 2HGZA 2RGGA 1E6MA 1GZ6A 2V6JA 5KTYA 4P4NA 4RXTA 5BV1A 3KQVA 4V3BA 5JQGA 1QS0B 1S96A 1RYDA 3BGVA 1L8LA 4QJIA 2G9RA 4DLRA 5B6PA 1A7JA 5EQTA 2VWQA 3ZJUA 4TXHA 2JCGA 5ER6A 1AKYA 4CG2A 1ZWLA 5F76A 1WM1A 4F86A 4AX4A 2ISQA 3WDLA 2ZR0A 4I66A 5DNUA 4QLAA 1E1CB 2VHEA 1R16A 3MXTA 2XMDA 3IQHX 3W4KA 3ZK7A 2VHVA 1G18A 4KIUA 1VSUA 1JA9A 3G5AA 1UFQA 1DO2A 3K9CA 1W52X 3HTXA 4W1RA 4GPBA 3JRNA 3OMWA 2GGSA 1PQYA 4UPVA 2B4AA 4HFNA 4HUQB 3MCAA 2DRIA 3W04A 3QU7A 3FE2A 1Z5OA 3FRHA 1EGVB 2HJWA 1A8IA 1QHHB 1KQ3A 2BEUA 3O8QB 5C7YA 4F97A 3QHQA 2E4WA 4EMUA 2YYYA 2CNNA 4JQCA 4RDXA 3Q8LA 2ZRNA 4EPVA 1NXXA 1KS2A 4JB0A 2YVQA 1QGUB 1GUAA 1JKXA 2WJIA 1ZNXA 3KR2A 4Q03A 1QANA 2AGVA 4CFZA 2J0VA 2RK4A 1GFZA 1E4VA 1P5RA 3T7AA 2DTXA 1MQSA 4PYOA 1GZ3A 4Q15A 3HJAA 4IDDA 3CUUA 4F6RB 5JBNA 4FX5A 1D0IA 3U26A 3K32A 1V1JA 3Q6IA 5T4FA 1GKIA 3IAM6 4WQMA 2PWAA 2OORC 2PSSA 3DQPA 3H1AA 1U3FA 4S1VA 4AO6A 4DLTA 3IUNA 2X8WA 1PFWA 5FIUA 2UU9B 3ABRB 4WNAB 2BE7A 3IJ5A 5I9SA 4XSHA 1QGAA 1XZBA 3ETCA 5TE9A 2NT4A 1J70A 4L9WA 4PONA 1OXUA 2I4LA 4K9SA 2C92A 1U8ZA 2FSHA 3QEMB 1R27A 1YRQA 3NOOA 3EZLA 4OP2A 5K8LA 1TCBA 3TJMA 2AC2A 5A0VA 2EZ4A 3CYFA 3R09A 4TL6A 2W2MA 4D2IA 3R8FA 5FP0A 2NZVG 4WFQA 3RBVA 2A5GA 1Q17A 1QHNA 1R0WA 5TMPA 3V8MA 4M9SA 3TDMA 4GBJA 5IUKC 1E0SA 5JRJA 3ZDBA 1TX4B 1U6KA 2GUGA 5C3MA 4A92A 4KN5A 1L4KA 4ACAA 2GBIA 4YJGA 1WB6A 4KN6A 1OLXA 2DQKA 2GB4A 5KMGA 4KNVA 2EYUA 2Y1FA 3E7XA 4JT2A 4MS4B 2G1UA 2AEFA 1FFDA 1K5HA 2FVXA 2VJMA 2W90A 1XPJA 1II8B 2CEKA 1UXOA 2X5XA 2I2WA 1QH8A 5I8ZA 4EM6A 2RARA 3E4CA 3DLCA 3GBSA 3GDHA 1UMCB 5JECA 1Q7GA 1C0KA 2ZK7A 5EE5B 3AL0C 5U1PA 2WT4A 1E0JA 1KZYC 1XTSA 3AM5A 2UVDA 2YXPX 2JS7A 1U3VA 4CQMA 3MS4A 2YVKA 2QTHA 4J7XA 4U5XA 4IHKA 1FRNA 4TPKA 4J4TA 3TNLA 1JHMA 2IH2A 4H1UA 3G79A 2CXNA 1IY1A 2PMKA 3RVKA 2I9KA 4A23A 3SYRA 2IY7A 3ANTA 4JFRA 1RU3A 3OEHD 5LXTF 1A76A 1BXRA 2EFYA 2QUKA 1QFMA 3TUIC 1RYEA 4NE7A 2OO5A 5LA6F 3OZEA 1P5HA 4F45A 4W7HA 1OFVA 4K6HA 4OREX 3K5HA 4LBWA 4MQ5A 1V6AA 2I8CA 1D1SA 4HP8A 3F6CA 4JU9A 4UAGA 1QRTA 1QHEA 4L0MA 3ODPA 5IBCA 5JMOA 4BAGA 5A4DA 3H2BA 3R7WA 3DDSA 2ZXUA 2KI5A 3ZGLA 1T6XA 1E6KA 4QT4A 2B0CA 2ASVA 1RQPA 4BNMA 3N5CA 2IEGA 3HWX1 3AETB 2WYVA 3SEZA 3DXFA 3FOAA 2YRWA 4YC7A 1JHRA 3FB1A 5JWOA 2Y0CA 3D6UA 4Q9AA 4MA0A 4NJEA 4DJTA 2FSUA 4J2TA 1QR6A 1N2CA 2H59A 1BIFA 2HGSA 1TQDA 2HSZA 2JI8A 2QYSA 2YV5A 3G23A 1GL6A 2GDJA 4KFRA 3S1SA 3ZV6A 1WX1A 1GLNA 1LQTA 2BCJQ 2FFAA 2NTYC 3HGQA 3EXHB 2QSUA 3IPXA 1ES9A 1NXOA 3JW8A 3LI2A 2W6CX 5KAMA 5FV4A 4Z0PA 5LQMA 2B99A 2B5WA 4W7IA 4KU4A 4S0ZA 3PXBA 1AGRA 4R2MA 1PJRA 1OFIA 3UXEA 1MIOB 2WTAA 3HM2A 4QQRA 1JIIA 4X1OA 5LXTA 4TM8A 1UAGA 2BI7A 4NONA 3QXJA 1DG9A 1N1DA 3HA3A 4PC6A 3SIWA 3WAGA 5EIEA 3O8LA 3OPYI 2MMGA 2H2HA 4B43A 4L8LA 4AWXA 4YUYA 4GKVA 4NZOA 1NY6A 5FI5A 5HYVA 1W1IA 4G1BA 3AOGA 1QRRA 2QD4A 4MRPA 4N1AA 1CY8A 5HKAA 3B36A 2I78A 5K8IA 4NH0A 2PM8A 4JT9A 4TVKA 4EPXA 3V4RA 1O95D 1NSYA 4IOMA 1XG5A 1J5EB 1CUIA 4B44A 2P11A 1JIKA 2HK6A 1EXVA 1SRQA 1SD5A 2CD9A 1YRHA 2J46A 5DLPA 1TC1A 1YKGA 3BIOA 4MTCA 4HMOA 2B61A 3VVBA 3PE4A 4FILA 3GCWA 5JVDB 2IYAA 2BP7A 2H4FA 3FMPB 1RHUA 2WFLA 4ZCLA 4HRVA 4BP8A 1VXOA 5KSYA 5DTQA 5AM2A 2C88A 1P2SA 2VYNA 2YIDA 3DC2A 3UENA 2V58A 1QMGA 4KBFA 3D02A 3DAGA 4BO6A 1AN9A 4UTVA 3QELA 3WB1A 3QUQA 4QXOA 1TA0A 4GXTA 4IX9A 2J3IA 5DU2A 4ZJUA 1GLGA 5JHGB 1JEYA 5DDIP 1AIPA 4DNQA 3BHJA 3I42A 1SU6A 3CH5A 1YL7A 1EFRA 4PEVA 4RJIA 4US2R 4P54A 3OF3A 4KBGA 5GVSA 1J0DA 4JI4B 5IF3A 1MPTA 2J9ZB 4YA6A 3AEYA 4RKQA 3U19A 1EK5A 1XQ9A 2ZTMA 5K0BA 2VNKA 5IXJA 3L6UA 1E2EA 1IQRA 3PQ6A 2QLJA 2DPYA 2PCJA 4TTJA 1E3DA 3LCVB 1J49A 1J25A 2JFUA 4B3TB 1C7FA 4OXNA 2FR8A 4QGFA 2YJ5A 1R8QA 4DV1B 4BMDA 5D8DA 2NUAA 4FOSA 4RA6B 1N6NA 1V6SA 2OCBA 4IUCS 4WOBA 5T8KA 3RNOA 1ZUD1 1NI4A 1QVRA 4IFEA 4E11A 3R77A 4AFNA 5JUWA 3ZZUA 3W6NA 1YS1X 3OECA 4MRAA 4EYQA 4DBLE 1DLIA 4RPJA 5JD3A 3PUZA 1UXJA 4ZIRB 1AF7A 1ICIA 2I8AA 2C04A 3H8WA 2XNCA 1ZNYA 2AJTA 3WRXC 4XDZA 3VX3A 3D9QX 1X2BA 4BCBA 5IABA 4RTSA 1KJJA 1OUMA 2G1JA 4OHVA 3UK0A 4GOKA 5C7IO 5ULLA 1ESMA 3V9AA 3LMKA 1VPWA 3GJ3A 1P1CA 3H9EO 1K7EB 3ASZA 1OASA 2H57A 2ZWMA 1NN1A 1TTQB 3G7NA 4FLMA 5AM0A 4CTKA 3DP7A 1T36B 4PC3A 3PFBA 5FBHA 1UOPA 3QJGA 5ESXA 2OHHA 3KAPA 4OHYA 3FUVA 1JKJA 3O9ZA 3PNOA 1ONPA 1LDNA 3FPBA 3HRHA 4D45A 3WJ7A 1CU1A 1FRVA 4XPIB 1GAQA 4E5KA 3INNA 1D03A 1NVVR 1BG6A 3D0RA 3LLVA 4RPHA 1HI9A 4KHZA 3U3OA 1LNQA 1ABFA 2OFXA 2HU2A 1OAKA 4G0PA 4MWGA 4BKMA 1JHOA 1NY5A 3DVSX 4MVJE 3ROXA 3RS4A 4TSFD 2IPLA 4LGVA 3PQ4A 2QK4A 2VRNA 2Q5CA 4GMKA 1J2EA 3S2GA 3MIIA 5FOTA 2FQ1A 3ETJA 1QYRA 3WNDA 3GJTA 1V1MA 4A26A 1EUDA 3C98A 3T3OA 1NXPA 3L4EA 4TVOA 1A0OA 3AVTA 3EF0A 3FZEA 4U3JB 1WSWA 3T4XA 1Y1KE 2E6UX 5CHYA 2RAUA 3JZIA 3N7TA 3RVQA 1DUSA 2IYOA 5FUWA 2OR3A 2WIJA 5KAPA 4JBLA 1RCFA 3WHIA 1VCOA 2YZ2A 1N6RA 4BNUA 2D7CA 4XAQA 1RACA 4D9JA 4YRGA 2E3JA 2WJ3A 2EW8A 4RIFA 4O2RA 5L6MB 221PA 1G19A 1MRSA 1MTZA 1Q1QA 1QV9A 1Z5GA 1I7PA 3GFGA 1HOXA 3G2NA 3I2KA 3KJFA 1CETA 2C9YA 1JR6A 4YMIA 1CUYA 1ND6A 1UL1X 3RT9A 3UJ3X 1V8DA 2UZ4A 2ERYA 3RSQA 1MQ8B 2Q5JA 1IBKB 2D54A 4IO0A 5EUQB 1L7OA 1TQ8A 3MXOA 1DC6A 3EWIA 3FBTA 2G77B 1WSDA 4MUBA 4TUYF 5CRIA 2JGKA 3SVZA 5GONA 4U2DA 2YRXA 1ISGA 2OO5C 3VYUB 5JNVA 3WSTA 2VKQA 4WECA 4LDZA 1XD2A 1EK2A 2FZKA 2HFJA 4EKIA 1C14A 1V3QE 2Y1WA 3PHGA 4QQ8A 4X7RA 3RTEA 3U62A 1QYWA 3R76A 1TVKA 3LUDA 3NWBA 2RH4A 4KQ9A 4GLFA 4J03A 3IT1A 2ZIUB 2C5LA 2PSDA 1CR0A 2QTGA 1BMFD 5KYXA 1AK1A 1FU4A 2D2XA 2I7VA 1JIVA 1NXTA 2AFIE 1NGSA 3IP5A 4M9ZA 2VATA 4UUOA 4XFJA 3RC1A 1RXVA 5M04A 3PFCA 2B4YA 3IAHA 3QVJA 3WBFA 3WWCA 1M7BA 2VIIA 2X19A 3Q2IA 4XVUA 2JGLA 2WM8A 2ZVJA 1D1PA 2PAFA 3OWOA 4MZDA 4NDNE 1DRUA 1VGRA 2PY6A 3JD0A 1OAOC 5FBWB 5D00A 4ER6A 4B3HA 1WB9A 1NVGA 2Z2JA 3V48A 2UUCB 4NP6A 2PZBA 4IY1A 3LGXA 2QG4A 4IYRA 1FXWF 4TXNA 2D4HA 1ZO8A 5EINA 1NHGA 5BR7A 4DQDA 1UT6A 4AYXA 3NGLA 1RWKA 1L5QA 3LXMA 2CVPA 2YWBA 2B1JA 3PDIA 3ZD9A 3V55A 1EFCA 3NS7A 1IIRA 2FZGA 1NATA 2FWAA 3RM3A 1NW9B 1IUPA 2EBWA 1E2PA 2H11A 2JLBA 2I4RA 2VJMB 1IHUA 1N5MA 4M1YA 3FTCA 3KT6A 5T8KC 3L6OO 4N7BA 5DOVA 1IUKA 2R7MA 3EAFA 3S28A 4Z1OA 1NKTA 3AJDA 4BVLA 2YY6A 2J7KA 1EXMA 4N8SA 2VLBA 2J3DA 1UJCA 3I2YX 4U2FA 3TS1A 3KXIA 4M53A 1UBJS 1RPZA 1A95A 2QT0A 3WRXA 1LWNA 3T3MB 1JTEA 1N3BA 1J00A 3HLKA 3MWEB 3TKLA 9ABPA 1Y5IA 5EXXA 3UWKA 1NVFA 1S8OA 1LUAA 3DAOA 2EBUA 4IIYA 1M2VA 3EXG1 4MIYA 4PSUA 5CDFA 3TAXA 2DUJA 4DCCA 3FDZB 4F1WA 5LZ7A 2ES4A 1U3UA 1JHUA 3JYHA 1R18A 1XA4A 2VBCA 2ZB8A 4NBWA 4U7GA 4ES6A 5J4KA 2FX2A 2BZSA 3UY4A 4BNWA 1XMJA 4F5DA 1SKQA 4BGUA 4EJFA 3W3AH 4H1HA 3L0CA 1DX6A 1CQPA 1VDMA 3D64A 2EZUA 4WCDA 4UNIA 4JVMA 1U7HA 6ADHA 4LOJA 2HLHA 3A1NA 3FF4A 4DYVA 5CXSA 4OQEA 5DULA 1Y5RA 2V8OA 1ISFA 3L77A 4FCWA 4HDNA 4TZ0A 5JT1A 2QN9A 5D01A 2JGAA 1UEIA 4QYIA 4B4DA 3IO3A 5T6MA 4IZHA 2RAVA 3GPBA 5A5VA 2E4ZA 2FPRA 4PM4A 4L4YA 4BNFA 1B42A 1VKZA 1XCPA 4HV4A 2JLSA 1VI5A 3OHPA 4YRSA 3OJXA 4HDKB 3OZFA 2WUWE 4UAJA 5EWJB 2XGMA 1OOEA 2PS0A 2V3VA 3MSXA 5EE0A 4ARBA 1XROA 3EEOA 3IE1A 4QXAA 1NMXA 1G5HA 1JPJA 4Y2TA 1M72A 1WDKA 2UZ1B 1Y6FA 3SJUA 3K2QA 6Q21A 3GDFA 5AJZA 1SKMA 4LX8A 1R4ZA 2P2LA 3B2QA 3TUJC 1K8XB 1HV8A 5AK6A 4AJHA 4HGOA 4RHYA 5IJWA 1J0AA 1YS2X 4TLLB 4M6WA 3NT4A 4RH0A 5CT6A 4E31A 3ZDAA 2QRKA 2WJGA 1ZCZA 1E9RA 3RRJA 5J3JA 2HOQA 3QPAA 4F3TA 3WADA 4L2IA 2VUIB 1UJ5A 3R9WA 4FYJA 4TT3A 4ZVPA 3CNHA 1Q77A 1XF9A 2PKCA 4WZAA 1GNTA 2BWJA 1GL3A 1WOYA 3UH0A 3QX3A 3FMOB 5DNYB 2XODA 3D7RA 1B23P 3WLPA 1PFKA 4Q02A 4BRWA 3HCCA 3VPFA 1U2SA 3I53A 3SJZA 3A4MA 4LA4A 4LOAA 3WIBA 1CIJA 2X2PA 2Q5IA 2R6DA 3PENA 3I28A 4PR3A 2EGHA 1H3FA 2B25A 3GMTA 4ZEVA 5J4HA 4LI0A 4OIMA 3TG2A 121PA 4ZVMA 2P0YA 1E66A 4OFZA 2NU6B 4P82A 4XEHA 1SD2A 3MGGA 2J6IA 5E7JA 2WKSA 1V26A 5TVKA 1CZKA 2WJ4A 1W34A 4P80A 1ISMA 4M6WB 4Y8VA 4B46A 2C7PA 4C0QC 4DL9A 3OO0A 3EXIA 4IDEA 4IKOA 5DO9A 1K68A 2REOA 4BPBA 2P3LA 2NUBA 3HA7A 1FRFS 1QAQA 3RHTA 1E3EA 1E0DA 3E9ZA 3HG7A 1FUUA 1K5DA 1KGSA 3TZEA 4ERNA 3DAPA 4MGYR 4CEIA 2CMKA 2V6BA 2MYPA 1Y3CE 1FK8A 5EG5A 1DC8A 1X39A 2VTBA 5EJEA 3VAAA 2XF2A 2C3PA 1OYVA 3EOZA 4HDSB 2YXEA 3CT4A 2PZGA 1N3IA 1WV1A 3BJMA 3PVSA 1JDUA 4Q93A 1U4OA 3LC0A 4IGEA 4Z86A 2PYZA 3UANA 1GPNA 3TW6A 3LWBA 1KWKA 1QOZA 1M8JA 3FVQA 1T4DA 2HU5A 3QXSA 3UWMA 3VAZA 3EX7C 1XKTA 2OKCA 1OD6A 2WU4A 4HN4B 4XEUA 4C0HA 1EVQA 1PFGA 5K4GA 2GAJA 4Q3BA 5FUYA 3OLQA 4NMWA 1MA3A 2W42A 4IBOA 5JC8A 1DFIA 3C7TA 4FR5A 2LWIA 2JBHA 2OHOA 5K3AA 3OC0A 5E6RA 5IWAB 3AZPA 4AUKA 5KQSA 2WBLC 3C85A 1RADA 1WCXA 5A4FS 3CLTD 4KE6A 1I80A 5B7NA 4AROA 1JA0A 3HA2A 3IE0A 5A2GA 4I8XA 4BQFA 4MA4A 3KTAB 4DLWA 4BLQA 2XA2A 2NLOA 2XKJE 1WS6A 1AQUA 2W6OA 5JAQA 4LHSA 1CUSA 2ZRJA 1PHPA 4IZ6A 4TLEA 4BB0A 5HX7A 1EFUA 2XZPA 4FD3A 4Q9LA 2GMWA 2H2GA 3DUFA 4M8KA 4WZZA 1SUCA 1R3UA 3M49A 4GZ5A 3VO2A 2Y76A 4N8EA 3NWJA 1ZA2A 2FMFA 4M49A 3KU4A 3SBXA 3V80A 1G21A 1SBHA 2PLNA 3HBJA 4QTZA 3U4CA 4AMGA 1PQUA 1Y37A 2YXDA 3JU3A 3N74A 3PUXA 4U6NA 4ZC8A 2ZIVB 5KYVA 1OFHA 5CD1A 4YMSA 1W7AA 5DBFA 1RHRA 4FYWA 3JVIA 3W9BA 1ZOIA 1JDJA 1YFKA 2JGNA 4LZWA 4KIFA 1D6JA 1W87A 3EWSA 4TYNA 1M34B 1VHWA 1TMOA 2CLIB 1KQNA 3BH0A 4IWYA 4WKBA 4K8OA 4W9NC 3AF1A 2PVPA 1LSSA 3D2CA 2XE6A 3DZKA 4HUQA 4U9HS 4RDIA 1ZMXA 1R6DA 1Y1RA 1ZGAA 2ROQA 1PJSA 2C5BA 1NJ8A 3HCOA 2FMUA 6CHYA 1EJBA 2NXCA 1P74A 2ERXA 1XYGA 4MDYA 1RMTA 2O7VA 1RWBA 4G8CA 4S1TA 1M76A 3BFVA 1XXLA 3A26A 1HA3A 4NR0A 3DM5A 3G0DA 4EQZA 4PGGA 3ZS8A 4ZTZB 1B0PA 3CCBA 3D4PA 3WYFA 4A8HA 4L51A 3G9UA 3HEMA 1MEOA 1QS0A 4JI2B 3H2YA 2H7XA 3ZNOA 1KEVA 2DEUA 2MU1A 4B3GA 4XQ0A 1OGJA 1TW3A 3J7AC 3LQ4A 3ZBPA 3DBLA 1XVTA 1UXHA 3L7CA 3S2ZA 5EP2A 2XWBF 5KYUA 1LDMA 4YAWA 4RXUA 3ASUA 3P9ZA 3WL8A 1EFHA 3PGKA 5BN4A 1VB3A 3KU1A 5SZHB 1AKNA 1Y3BE 2IZ6A 1V39A 3T38A 3WBKA 1P5JA 2XEDA 3PC6A 4EKEA 4ZK2A 1PWEA 4CI9A 4GSLA 3A3NA 1PLJA 3D4IA 3O3NB 4BEBA 1PO7A 4WXRA 1DEOA 1GVHA 3K73O 5CLJA 5FYQA 3AEXA 1P3DA 1UFOA 2WJZB 1I7QB 1XU7A 1H2ZA 2RHBA 3A9VA 3PIDA 4Q3LA 4ASUA 3AI1A 1T9HA 2JFPA 1DG1G 1Y5NA 3AOEA 1SUIA 3OH8A 4TMXA 5FBZA 3SQWA 4CKEA 1HZJA 4CKYA 3VNQA 1AMNA 5LWHA 2GLUA 4AW9A 1ZW1A 3MWFA 3NXKA 1ULAA 5H80A 2O4CA 3CVJA 4RSRA 4XYBA 2FR8C 2X0FA 1VRVA 3ZHBA 1AY0A 3QKIA 4DQ0A 1EHYA 4U7DA 4ZT3A 4WNYA 3ZDQA 4LECA 4LUCA 3A37A 3I05A 1CJCA 4WHMA 3CSUA 3DLPX 4Q18A 1P60A 2JLYA 2R0QC 1KIMA 2O5VA 4L8GA 3JAKB 4NEGA 2PXCA 5DFAA 1NKSA 3ONWA 4HF7A 3IT3A 1XZLA 1I9GA 1ZS9A 3HPQA 4M22A 4CLDA 4LAFA 2JEOA 5KSWB 4K9QA 2NV0A 3UC5A 4DLVA 4P93A 5FUXA 1M74A 1ZH4A 1X3LA 4M83A 5AKYA 3UPDA 4MA5A 4PLHA 3LM8A 2XVYA 2AZTA 3VR1A 3R0VA 4DAEA 1IOWA 1V0JA 1VJRA 1WP9A 4BMSA 1ZHHA 4I8DA 3QKRA 3SE0A 4YNBA 2VDMB 4GZLA 1QO9A 4JLKA 4IIEA 2O2HA 2E4YA 3FFWA 4QU8A 1KYZA 1IRIA 1Z5PA 3JWHA 1MJNA 3NBMA 1ZVQA 4L73A 2JZNA 5A04A 1OROA 4D97A 5A4IS 5HTOA 3RO7A 2B8TA 3HSYA 2WNSA 3OCVA 2OV8A 2EQAA 1C3LA 1JJVA 4KK4A 1JQBA 4ZI7A 3PX7A 2FF7A 4X8HA 3GLGB 5IVHA 1CZLA 3Q3IA 3BWMA 1FSGA 3BE5A 2SNIE 3PGLA 3T5PA 2XCOA 5I9IA 4JEHA 3UJ7A 2JZOA 5A6SB 3W8NA 5E2IA 1KAHA 1SPBS 3HKCB 1JG2A 4JLNA 1NPTO 1ONOA 1YMQA 1XCGB 4DV4B 1QFJA 2EWMA 3RUHA 1JQ3A 3KQUA 1F8UA 1M0WA 3WZLA 1J1IA 1N2JA 4MICA 4QEDA 1B6GA 2FUNB 4BDSA 1C1YA 3U44A 1GITA 2V3CC 1D6NA 2YFKA 4FSDA 1PE0A 2QF7A 4EVRA 1SURA 1YQGA 3HYSA 3TZKA 5H02A 1QRUA 2I6UA 2K7ZA 1E3WB 3ZU5A 4TQ9A 4BO7A 1I3NA 1M0EA 1H0RA 1W48A 2ADFA 3IC5A 2XOEA 1EFTA 2D5CA 1W0CA 2RK6A 4MWBA 2AG8A 2QHXA 2HA2A 5DGDA 1DJOA 1GQFA 2PXAA 3SBEA 3ZWPA 1XTJA 4B3BA 2IYPA 2XXAA 2V4UA 2ATXA 3SC2A 3U0VA 2BKXA 2XW6A 4ZGWA 1ACMA 2QTCA 3HJTA 1DBVO 4ZA2A 2C42A 2LNDA 2ZRGA 1ZVKA 2C77A 2QJRA 4M7WA 2HCBA 2RHJA 2WHPA 2AG6A 2P2YA 2R7AA 4K3VA 1Q1AA 4PXYA 3GJ4A 3HWWA 2HIHA 4MR9A 4L4ZA 3T7EA 3UV6A 4F4DA 4F1KA 4IJKA 4F21A 4JCCA 5CYGA 3K8ZA 3EISA 1MOQA 1NBEA 1T5TA 1W8DA 1AV7A 3QVGB 3N2EA 2H2WA 3ED5A 5BR1A 1BWSA 3PNPA 4RTRA 5JJKA 3RIXA 4NENB 3OFSA 3FMIA 4I2NA 1PJAA 4J0DA 1XVLA 3UK1A 4C4RA 3I2HA 1BS9A 2D1QA 3K0AA 4OKNA