2HO4A

Crystal structure of protein from mouse mm.236127
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
254
structure length
251
Chain Sequence
ALKAVLVDLNGTLHIAVPGAQEALKRLRATSVMVRFVTNTTKETKKDLLERLKKLEFEISEDEIFTSLTAARNLIEQKQVRPMLLLDDRALPEFTGVQTQDPNAVVIGLAPEHFHYQLLNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKAMVVGKPEKTFFLEALRDADCAPEEAVMIGDDCRDDVDGAQNIGMLGILVKTGKYKAADEEKINPPPYLTCESFPHAVDHILQHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase domain containing 2
publication title Crystal Structure of Protein from Mouse Mm.236127
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 70
structure length 251
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
A PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ho4A01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ho4A02
1EK2A 1XPJA 2W43A 4AS3A 1CR6A 4OHFA 5AI4A 2GMWA 4JB3A 1YNSA 4Y2YA 2W11A 2EAUA 2D2VA 3B9RA 1VFPA 4DWOA 1RMYA 3ZI4A 4E88A 5ALOA 3E81A 3EPRA 3J7TA 4Y2TA 1O03A 4I9FA 2FI1A 5ALIA 5AW3A 3L5KA 2HX1A 5ALNA 5AW1A 3MMZA 2YMQA 2ODAA 1YMQA 1Z5UA 3I6BA 2ZBEA 1Z4MA 5IS2A 4KX3A 3L0BA 4YCMA 2X4DA 4FFDA 5AKXA 4UM7A 4C4RA 5AKIA 1L8LA 2FDRA 3RFUA 1L7PA 4AS2A 3R09A 5AK3A 3U7EB 3KD3A 5AW2A 2WF8A 1Q92A 2JARA 2RBKA 3MC1A 3B9BA 4KNVA 4GIBA 3ZVMA 3WK7A 3CNHA 3VAYA 1EK1A 2HO4A 3KZXA 1QH9A 2ZOSA 3DDHA 4UU1A 2GHTA 5FP0A 1RDFA 2YJ3A 3AR6A 4KNWA 2CN1A 4DCCA 3L8HA 2ZXEA 1RC8A 4I9GA 3TLMA 3E58A 4FYPA 2B1QA 3QU2A 1AQ6A 1RLTA 5AI0A 2CFTA 3AR9A 1T5TA 1ZRMA 3WK5A 3NASA 4G63A 5AIAA 5AKJA 3W5CA 5JJBA 1Y8AA 1U02A 2BDUA 4BX0A 5AKYA 2FUEA 3PGLA 3HYCA 3UMGA 5ALQA 4KYTA 3N07A 4CF4A 2PR7A 4NAVA 1NRWA 3NIWA 4PNHA 1PW5A 4O8CA 4DFDA 2YN4A 2G09A 4CF3A 5AIBA 1YS9A 4UMFA 3OCWA 5AKGA 3S6JA 1ZD2P 3L0CA 3FVVA 1TJ3A 2RARA 1Z4LA 2MU1A 1Z5GA 2P69A 1Z88A 2C88A 1WVIA 2B82A 3BA6A 3WK4A 2QLTA 2FPSA 4EZEA 1U2SA 3AR2A 4Y3UA 3ESQA 1TA0A 2R8XA 2Q4TA 2JGAA 4UAVA 3W5DA 1L7NA 2G80A 2CFSA 2ZBDA 1U2TA 3ZTYA 5IT4A 4BX3A 1RKQA 5ALXA 2BDEA 3OCYA 5AI9A 1TJ5A 4EEKA 3AR5A 4NV0A 2YMMA 4L57A 3R4CA 3RF6A 1RQLA 4HAIA 5AW8A 1VJRA 1LTQA 3ZX5A 4J03A 4KN8A 5AW5A 3FPBA 3L1UA 1CQZA 1S8OA 1QQ7A 1RKUA 2WF5A 5AW9A 4XPZA 3N5KA 3PGVA 4Y2XA 3QU5A 5ALPA 3MN1A 4QQFA 1T9ZA 2YJ4A 4CF5A 1T5SA 5ALSA 2ZBFA 1IWOA 5AM3A 3D6JA 1L6RA 5AW4A 1N8NA 5AVVA 1KYTA 2C8LA 3SKXA 1MH9A 1Z4PX 3CZ4A 2G08A 3UMBA 4EX7A 4QJBA 4F71A 2I7DA 3ZUPA 4OFZA 3L8GA 2YBDA 5AVQA 4Y2UA 4YGYA 5AVXA 5AVZA 3U7HB 1S2OA 4KX5A 5AM4A 4FE3A 3NANA 2JAUA 4YCNA 3QUQA 3HLTA 3WK9A 5A3RA 5ALVA 1ZRNA 1F5SA 1JUDA 3N28A 1TJ4A 5AK6A 1QYIA 3IB6A 4UW9A 4C4SA 2G07A 3NAMA 1NNLA 3IRUA 3WGUA 1J97A 5AM0A 4B6JA 3QU9A 2AMYA 2R8YA 1YJ5A 3ET4A 3FM9A 1NF2A 3SKYA 4EENA 5AI8A 1XVIA 3U19A 4RETA 3ZX4A 1X42A 3OCXA 1ZD3A 2ZBGA 4AP9A 3NRJA 3EWIA 3A1DA 3GYGA 3MPOA 3NUQA 2YMPA 5AVYA 4XQ0A 5AW6A 3FGOA 3L7YA 3OCUA 1RLOA 4Y2QA 4BX2A 5ALWA 2G06A 2W4MA 3SD7A 4UMEA 5ALTA 4Y2JA 3QU4A 5ALDA 4L6AA 4HYTA 3P96A 4UATA 4IFTA 3K1ZA 3QUCA 4YH1A 4L6CA 2YY6A 1QQ5A 4GXTA 3N8GA 2R8ZA 2EATA 4NFLA 1ZS9A 2IOFA 4ZEWA 4UASA 2B8JA 2P11A 3DNPA 3U7GA 4BNDB 4EELA 5AVWA 1XP5A 2C9MA 4UARA 3I1YA 3AR7A 3PCTA 4MUMA 5AI6A 4C4TA 1O08A 5AK5A 1Z4OA 3KC2A 4UM5A 5AVUA 2WF7A 5A3SA 4Y2VA 2WF6A 2AH5A 5AK4A 3ZW7A 1U7OA 1RQNA 2YJ5A 3M9LA 2G0AA 3U13A 1U7PA 3WK6A 5ALRA 5AM2A 5ALUA 1ZD5A 2IOHA 1N9KA 2FEAA 3IJ5A 4F72A 4NABA 4BKMA 5AKZA 3SHQA 3UM9A 5AM1A 2GFHA 5E0OA 1WPGA 2YJ6A 4ZEVA 3ZU6A 3A1EA 3ZVNA 2WF9A 3L8FA 1YDFA 2FPRA 3AR8A 2JAWA 3ED5A 1RMQA 4HGPA 5ALEA 3ZWKA 1SWVA 3OCVA 1VJ5A 3FZQA 4HGRA 5AKLA 2GHQA 1J8DA 2PQ0A 4NWIA 2C8KA 2FPXA 5AKEA 2JAOA 5T41A 2O2XA 4BEVA 3W5AA 4HGOA 2NO4A 2VKQA 3ONNA 2I6XA 4BBJA 2QYHA 2NO5A 5ALHA 2I54A 2P27A 1Z4NA 3F9RA 2B30A 3E84A 1K1EA 5AICA 1L7MA 1SWWA 3WK8A 5AVRA 2EARA 2PKEA 1ZOLA 3WGVA 4BNDA 3A1CA 3B8EA 3ESRA 2Q4RA 4RESA 5AI5A 3KBBA 1Z4IA 4HGNA 2WFAA 3ZVLA 1RMTA 4XOUA 3ET5A 3QU7A 2HSZA 3N1UA 4DW8A 3QLEA 5A3QA 3SF0A 2HF7A 2GO7A 2RAVA 1L8OA 1QQ6A 2IOFK 3BWVA 3WKBA 3QUBA 3I28A 4BYGA 2YMLA 5AKKA 1WR8A 4YIKA 4BEWA 3QNMA 2YFYA 1RKVA 3QYPA 1TE2A 3WKDA 4H1WA 2B1RA 3PDWA 5AVSA 3OCZA 3AR4A 4HGQA 1Z4QA 5ALJA 3DV9A 4UAUA 5AESA 4Y2SA 4G9BA 4IG4A 3FPSA 2WHEA 2AGVA 4UMVA 3ZTWA 2HF2A 3WKCA 2HEGA 3DAOA 5ALLA 1L7OA 2R8EA 3OPXA 5ALFA 3L0YA 2IA5A 1Z4KA 5AW0A 3WKEA 4ZEXA 2Q5EA 4JDPA 2HCFA 2HI0A 3L1VA 2G1AA 5ALGA 1WZCA 2CFRA 4Y2RA 1RLMA 2AUTA 2MSNA 2WM8A 3QXGA 2RB5A 2HDOA 2IYEA 3QUTA 1YV9A 3KDPA 4UMDA 2I34A 4CNQA 3UMCA 1ZD4A 3ZWDA 3NALA 2DQSA 3U7FB 2O9JA 3EF0A 5ALZA 5AHXA 5ALKA 4YIHA 2FPWA 4CE6A 1RPZA 1Z4JA 2I33A 3R9KA 2BY4A 3QGMA 2OBBA 3M1YA 5AVTA 1RRCA 5IT0A 5AKHA 5AM5A 4YCLA 4OD0A 3SMVA 2B0CA 2I55A 3QX7A 3OTQA 3L8EA 4MWOA 2OA0A 2HOQA 5ALMA 3SLRA 5AW7A 2FPUA 2FUCA 2P9JA 2B8EA 4OCZA 4Y2PA 2ZG6A 5ALYA 3E8MA 4XE5A 2OYCA 3W5BA 1FEZA 2OM6A 4EX6A 3EF1A 3KOOA 1LVHA 3I76A 4J2TA 3U26A 2NYVA 1ZJJA 1Q91A 4UU0A 1SU4A 2C4NA 3A3YA 2HHLA 3AR3A 3WKAA
chains in the Genus database with same CATH superfamily
1WQ3A 4LOLA 4UBLA 2BFMA 3O91A 4NCNA 5JSQA 1LC0A 3F3KA 4QDUA 3H5AA 5I9TA 3ZXYA 5LSAA 3H87A 4LI3X 1M72A 4WA8A 3NYWA 4YX9A 4Z3OA 2A1UA 2W11A 2EAUA 3O3NB 3FAKA 5EWLB 3FTQA 3FWHA 1NDUA 5IMBA 1NBEA 4F85A 2ZVJA 4L4UA 4QXRA 1UQUA 1OXTA 4W1RA 5BPFA 1F7UA 3VPXA 2ONZA 5A02A 4YASA 3O3MB 5ALIA 4K9QA 1R8JA 5ALNA 3R0XA 4WL0A 1ZC4A 1IEVA 3IO3A 3MMZA 3UJ7A 2A4MA 2A33A 1BS9A 2TMDA 2HDWA 4II3A 3IEXA 5CT6A 3U48A 4RTPA 1RHJA 2VA8A 2YXBA 5IABA 1S3GA 2N75A 3IR5A 3P32A 4FFDA 3VR3D 1ZSVA 2H4WA 5P21A 1SC1A 4NJEB 5ICCA 1LLCA 3BRWD 1JU9A 3IMEA 1P0IA 1D2MA 1TCUA 2HJVA 1KTVA 1PZGA 3H9EO 5I9MA 1IXKA 2D0DA 1LWNA 5FUBA 4HZIA 4KZPA 1KY5A 1FJXA 3OT1B 1NM5A 2QX8A 3MTBA 3FG9A 5FOSA 2BFPA 1NM5C 3NTQA 5BSKA 4DBLE 4F45A 3WB1A 2GYVA 4DV2B 2RHJA 4IJWA 3ZGLA 3GLGA 1AKRA 4R40A 4JT4A 1B76A 2JF0A 4LA4A 3RABA 3SBDA 2V8OA 3P9NA 2H16A 5F7XA 3QSGA 4YAOA 3LF2A 4JJ4A 1V4VA 4KHZA 2IP2A 2VTVA 2WQZA 3NGXA 5CYFA 3KFVA 1GG5A 1SOUA 4OHRA 1AGRA 1T6XA 3PPXA 3AJRA 3DAPA 3KSAC 1U3VA 2DFTA 1AUQA 2O14A 1WUYA 3MW8A 2H17A 3A2MA 3OTOB 5KSYA 3AR9A 1EP2B 1TVMA 3WL6A 3T1OA 2J0VA 1J20A 1C7IA 3PNYA 5EMJA 1A8HA 2ADMA 4UNRA 5K3AA 5F2NA 2B35A 5ESXA 4MVJH 2BDUA 2F9MA 4GX0A 1FX1A 4IHJB 2BFOA 3K9NA 3TQHA 1T6NA 1ZK1A 3WLLA 1CR4A 3OA0A 1R3DA 5FORA 1TUEA 3U1BA 2DBVO 3SN6A 4JLSA 4G4JA 3C3BA 2HJSA 1M0TA 4TT3A 1OASA 5ILGA 1G21B 1VYTA 1UBFA 2XMDA 4X8MA 3G8AA 1BHJA 1IZ8A 5DPMA 4U7WA 3GT4A 4JELA 5EE5B 3LPMA 2HC9A 3OCWA 4EKGA 5JYDA 1DJOA 4K9NA 5C1DA 1M1NB 3HB7A 3NC1C 3A1UA 2W2KB 5CFPA 3A0RB 2J32A 5CXQA 2GPWA 1HT3A 4U2GA 2CHQA 2OHGA 1CRQA 2GPNA 4XYEA 5HJ7A 1BMDA 3F9CA 1N0HA 2B82A 2XWSA 1QHHB 4FN5A 4XX0B 1R15A 4XR9A 3VTKA 3ZY6A 1G9XA 3TFOA 4JXZA 1TVKB 1UJNA 3W05A 4AUKA 1OWLA 2FPSA 2OQ2A 3OOYA 1SKYE 2HO5A 2VTBB 1K89A 1G8AA 1OXUA 2O05A 3RJ5A 3LCRA 1N6RA 3GEGA 3QVMA 5EWJB 1WQ4A 1L7NA 2PUHA 3M6XA 4B6PA 3ILSA 4YGXB 4FONA 3GRCA 5CCEA 3ZWBA 4O4JA 2XRZA 1WU7A 2VJBA 4DC0A 2GF9A 4Q9AA 2H7XA 4FKZA 3NYQA 1ZINA 3WRYA 2BDEA 4GI7A 3OCYA 4LRTB 5GVSA 5EQDA 4DT1A 1YS1X 1QHXA 1FXUA 2PSFA 3A3PA 4C5CA 4EEKA 4FI3F 3OIFA 2PT7A 2NSLA 4HPJB 2R7LA 4JXXA 4ERNA 2ENWA 3IUSA 3KJIA 3Q6MA 2W90A 3QHAA 1CZNA 3C4QA 3B3JA 1LTHR 3TSOA 1UKYA 1NQWA 2IEBA 1QIDA 1AQUA 3FNFA 5DCUA 3V42A 3QVWA 1P4GA 1PZEA 1CQZA 2C2WA 2R6GA 2WSBA 4FHFA 2TECE 4Q18A 3X44A 1F06A 3GDOA 2OQIA 3HJGA 1E9RA 4PSCA 3RH0A 3UICA 4D3ZA 3TECE 1BGXT 1GKIA 1ZX1A 3HCPA 2ASEA 4Z3DA 3N5KA 5JAOA 4QXAA 4ZPXA 3ESCA 1J7JA 1XDSA 3DXZA 1C7FA 2IUTA 1YR6A 1BA2A 1A1SA 5COQA 5HK9A 4FXPA 4XM2A 3WICA 1DUVG 5IF3A 3P4XA 2OBFA 1VKNA 4RWZA 1LW6E 1XA0A 3NIGB 2QZ9A 4DCPA 4S04A 3WYAA 4HTFB 1J00A 1X14A 4D98A 1MVLA 1R4NB 2CYAA 4AN0A 4BBAA 2RHGB 4FDTA 4L75A 5SYMA 1S0UA 2FPIB 3TRJA 2ODNA 2PRKA 1E3WB 3H2YA 4QTTB 4AY5A 4JJZA 5BMVA 2E55A 3KHKA 4QJ3A 4HNVA 4LZLA 4B83A 3VVLA 3PLAE 3K5HA 5AM4A 4EF5A 4Q1BA 3PCXA 4B5KA 2O0JA 1GL9B 1SU8A 3HCDA 5AJUA 1KZ1A 1FMJA 4JU8A 3M81A 4R41A 4TV9B 1U7WA 1CNFA 2OAEA 1O2DA 4R1NA 2EQBA 4ZO8A 3WX0A 4BLRA 2QOEA 4EARA 4PG8A 1V8DA 3UJNA 1Q19A 1TO2E 5FI0B 2PBRA 4JYZA 1FNCA 3HBAA 4OH7A 4XDGA 5CT8A 4BATA 1XMJA 1M2WA 5B7GA 2DWPA 3HWRA 1BJTA 3PV0A 3EXIA 4ZO9A 3QYAA 5KKNB 5K6AA 5C52B 4KYIB 2XMPA 4N9QA 5B5SA 4G0UA 4C3VA 2O8BB 3OFJA 3ZKWB 2NSDA 4M3NA 4B6JA 2G0TA 3WMFA 4G8BA 2ZDHA 3Q5GA 1QG6A 2A1IA 3EXG1 4BZQA 3RYTC 1G5IA 1V5EA 4CU2A 3P5SA 3RYFB 3UBTA 1XVIA 2AD5A 2NM0A 1X9IA 4KO1S 4MIYA 1ZRSA 3EWIA 3AVUA 1XXHA 2AZDA 2VHUA 4R1MA 1JQEA 4KNYA 1J09A 5DX1A 1E2GA 3M4ZA 1WVMA 2VI5A 1PL0A 3RIXA 5FOTA 2GVDC 4J7AA 3V8PA 2VKTA 3BN3A 1CIJA 2VQSA 3D59A 4RIGA 3TZEA 2OO3A 1HKUA 4QQKA 4Y2QA 1LDEA 4OU5A 3CPHA 4P35A 4JBGA 4ZP1A 2J5KA 1DMRA 1NBIA 3NBKA 4ZZ3A 1JEOA 4R83A 1N57A 1TUIA 2B1JA 1N5LA 1EFTA 1HYBA 2F1JA 3MJRA 4Y1GA 4IX1A 3PWZA 3VR4H 4ASUA 1II0A 3TTXA 1T10A 1MQ9A 5DZSA 5C7YA 4M1KA 5C34B 2QTAA 2EW8A 5B4UA 4NNOA 2EDCA 3OP1A 3PUJA 4FWIB 2BEVB 3OZFA 4L6AA 4FXOA 5J2UB 3FOBA 1FYFA 221PA 5GQSA 4CFYA 3ORYA 4CQJA 5L3QB 3TUZC 4UATA 1KEWA 1U8TA 3WYFA 4YH1A 5LYYA 4QG3A 4BGDA 5FPKA 4MVJE 2PZGA 4EABA 3EA0A 3T3GA 4MO9A 4DJTA 3GGSA 3O2SB 4XCXA 2XECA 3K5PA 2NTEA 1D2EA 4KIFA 1YUNA 3LF1A 3R5SA 1GG9A 3VR5D 4H3HB 4EGFA 4MHSA 3SP1A 2XCTB 2ZS8A 3HI4A 3HG7A 1E1RD 3TOVA 1OX6A 3DNPA 4ALIA 1ODTC 3JTEA 4IUCS 5B30A 5HZKA 2LDBA 5FWAA 3L02A 3ZZ0A 1I13A 4TKLA 4KWEA 1R7RA 4UARA 3UJDA 3LDFA 4IW3B 1HEUA 1XELA 1F4PA 4C4TA 3QVJA 5EXXA 4D4JA 1LK7A 2ONYA 3SQOA 3SK0A 3ZYCA 5K0SA 4BB5A 5EMKA 3ZIDA 1DFIA 3B36A 5KU7A 3CJQA 3GNQA 1NC1A 3H8VA 5DMXA 1YJQA 1PL6A 4O02B 2HMSA 3ON5A 1L4LA 1A2OA 4FHEA 3B78A 4YJ3F 5EIEA 5D5QA 3A6LA 1U7PA 1AF4A 3B6MA 3RJMA 2B5OA 2WA2A 4I9UA 2ID8A 4INAA 4L9WA 1G42A 3T3HA 3VISA 4DANA 2HU7A 1M2JA 2F67A 3UQYS 1XVVA 2A7XA 2QUHA 1OLXA 1JAZA 1MN6A 3KB1A 1BW9A 3TM5A 1N9KA 4F3KA 4MGYR 1C30A 4NABA 3D7SA 3UO8B 4KE8A 3BL8A 1IHDA 5GM1A 3ELDA 1LLQA 1DO2A 3IEPA 4NMXB 3G68A 4G5HA 4WZZA 5E7MA 3FLAA 5K51A 3WFZA 3EIXA 2VQFB 2UZ1B 2X2EA 3BXZA 3K32A 4KQWA 1U8EA 1FIUA 5GJWC 2EX4A 2IE0A 5CX1B 3MJVA 3F71A 3FCSB 4RIFA 4DE5A 3Q7EA 5CDHA 5HPYB 5DYNA 3TF5A 4BV9A 3ECSA 3FOZA 5LLTA 2CK3A 1PYDA 3BXHA 2C57A 3DBHA 5AKEA 3VYWA 4QTXA 2HGSA 2JAOA 3T7RA 2PSJA 3AHFA 3D7RA 2I2DA 3O7MA 4MA4A 4Q3NA 1NTRA 3H4TA 2Q07A 3PJFA 4FQ7A 4XARA 2A14A 2R44A 3S2YA 1PTKA 3SJAA 1SIBE 3MTIA 4DWVA 4YPOA 5CDTA 3STHA 5CA0B 2EZTA 4DEYA 1GQYA 4ND2A 4WNIA 2E0IA 4DTIA 1VZ3A 4HFJA 1YS4A 1QVAA 2DAPA 1WW3A 3X3HA 4QOEA 4A0QA 1QB7A 3BM5A 5IVPA 3KVVA 4HAYA 4NU8X 2NMVA 1RQRA 3TINA 1FLVA 1FY2A 3VR6A 2ISSD 4AIRA 4JLBA 1YB4A 4RPGA 3P9PA 3VUEA 1QGUB 3D8RA 1TMKA 4WZBE 5TPZD 5BNIA 2PG3A 4RHXA 1BZYA 5IYZB 5IANA 2O1EA 1VPTA 3DXYA 1T6BY 2H85A 3OC0A 2I29A 5ULLA 5IASA 2PL3A 1GKUB 3TFQA 1PYGA 2HSZA 4ND8B 5LMNB 1T3SA 3TOXA 1PT5A 3L8MA 5CMLA 3EYAA 2W0SA 1E1QA 2HF7A 3PQEA 2QS9A 1WY5A 2A0WA 3PFBA 2X0EA 3NORA 3R7BA 1VKJA 4G4SO 2O2JA 4MKFA 3I2IA 2WFLA 3N53A 3NDBB 1MEOA 1H4VB 3TIXB 1UBNA 5JPIA 3DTTA 3QUBA 2MSEB 1T1IA 3SF8A 2UYYA 4LV8B 3BC1A 4DMMA 4MUGA 2AR0A 3DBRB 2FW9A 2IS1A 5LIPA 1EZZA 3R0QA 3QH4A 3T9BA 3TW8A 1USIA 2PRYA 3FB4A 4BMVA 1ZR4A 1QVRA 1CDDA 1TEXA 4F5WA 5K3FA 2HQOA 1QPZA 5AVSA 1Z83A 3LOPA 3DTYA 4KSYA 5CIYA 5G1OA 1Z4QA 5EYPB 2OB1A 4ZJZA 1RRPA 4C43A 1HT0A 3W8EA 4P7FA 5A1TA 1EHIA 4M9UA 1GAEO 3MMXA 1JTVA 3HDVA 4JU9A 5G4KB 5K2MA 1K7SN 1QH8A 1SK8A 3NUGA 2VWHA 4FQ5A 1SQ5A 1WKVA 4K5QA 3NW9A 3V8EA 3O82A 2XA2A 1V16B 3E70C 1DKUA 1YL6A 1UMBA 3LRTA 4P3KA 2I1WA 1Y3CE 4NOLA 1YQ9A 4PPNA 1T25A 1Z6GA 3IVRA 1WZCA 2AUTA 2FEMA 4YP1A 2F43B 2BHLA 1LPOA 2P9HA 2ZYRA 3NWOA 4NS1A 4EZBA 4HT3B 5D3MB 1GCUA 1PLKA 1SUPA 4FJ1A 5B58C 2AEMA 2F3RA 2FWRA 4O29A 1AMOA 2X15A 3G2PA 3D6NB 4J29A 4LBZA 4IINA 5A04A 2FSVA 3JQGA 1KK1A 3PB3A 1SHJA 1K27A 3P0EA 2FSVC 3HI6A 3RS0A 4YUVA 3K9HA 2ERXA 2BSXA 2FMTA 1CQIB 3HHPA 3JQ7A 4URVR 4MDFA 2ZPTX 1TM7E 4KLNA 3ZXUB 4D3DA 2PO7A 3QVKA 3CKYA 1M1YB 3G2HA 4AQ7A 4ZCLA 3I1JA 3W8FA 2Q9AA 1TYBE 4F3CA 1UDBA 3CLSD 1B2RA 2WT4A 1HDEA 5EFOA 3OICA 1KIFA 1ENPA 3I45A 4OV6B 3W5JA 1VGRA 3T5PA 2OA0A 1YXMA 3VPFA 3COWA 1KQ3A 3B6EA 4RJLA 3VKGA 4MK4A 3QEKA 1X94A 1WCV1 4N7RA 4LDRA 1U0NA 4TM8A 4ZREA 3UGTA 1XPUA 4LVNA 6LDHA 2HRZA 1BDHA 3GARA 3SIPA 5DP1A 1YWGO 4JD5A 1DQYA 1U0OC 2X41A 3TTTA 3I0MA 1GNSA 1P8AA 4M1QA 2GCNA 2B9VA 3IKLA 4XFJA 3SE7A 3PGJA 5LJIA 4BVHA 4Z4IA 1QORA 3FROA 1H4QA 3DD5A 4BLSA 3HUUA 3DB1A 4JKYA 4CM8A 3A3OA 1J25A 2WIAA 4F84A 3RHSA 2C77A 3D6TB 4XDHA 3R75A 4DCVA 1SCNE 3EX7C 1W0JD 1P31A 3I05A 4MRMB 4JI1B 1YAHA 1EE9A 2WU0A 5E7IA 1YR7A 4QUHA 1XZQA 1XQYA 2WP8J 3BEOA 3AR3A 3RGWS 5F76A 3K3PA 5IRCD 1UT6A 4Z1OA 3S8MA 3Q8MA 3CPSA 1WXGA 1YNSA 2YZ2A 4JLUA 4HDNB 2W8BA 4HS9A 4ZYXA 4TLMB 2ZRJA 2MCFA 3NVAA 2B6NA 1W2WB 2GRUA 2V4MA 3EUAA 4M55A 5SZKB 3T4UA 3J7TA 1NVBA 1BCSB 1U7HA 3KKLA 1O03A 4G37A 4ZA2A 2WYHA 3IHTA 5FQOA 4ARSA 5HIAA 3VNQA 2H7VA 1FS5A 4RD2A 3CF4A 4FEEA 2HSJA 2O3QA 4TS1A 4AY3A 1GPAA 4CM5A 1RTKA 4W9RA 2VJOA 4PSUA 3HHEA 4YAJA 2XKKA 3RSCA 2WYIA 1UFVA 1XVAA 4DCSA 5HIKA 3PL1A 1LH0A 1NT2A 1GT6A 4Q9LA 1CFZA 1D09A 4D7AA 3R3ZA 1AKEA 1JYFA 3V9AA 1GIAA 2ZWAA 1XNGA 1GTL1 2B78A 3E2IA 1Z82A 5CK4A 4KO8A 4QZVA 5JNUA 2XMGA 3DONA 1XJCA 3OC6A 4ZCIA 2SNIE 1SGWA 1ORHA 2XDAA 1JDSA 3TMYA 5CGZA 5FUQA 4P58A 1W6RA 3RVDA 5TMEA 2DKFA 3BWBA 3K71B 5LOVB 2CXRA 3KLBA 3GVHA 3OZ7A 3GY0A 3QPVA 3LA8A 4RVSA 4ZKDA 1NI4B 3PPVA 2X40A 2Y0EA 4UUQA 2JVJA 3A0UA 4BVJA 4MZXA 4JMLA 3C24A 1TJNA 4BJ5A 2V0NA 2QRKA 5BYBA 1QFMA 1S5PA 3OE7D 4WNCA 2WUEA 4N41A 1RPTA 2OXEA 1TEVA 1JDBB 3UCXA 2WMDA 1J8YF 1EQUA 3DMYA 2RGEA 4IFIA 1QK3A 2JL1A 5TR9A 4NK5A 3VKWA 2C8JA 5AI0A 4IHQA 1QG4A 4ZCRA 1G0NA 3LFHA 1F0KA 1J99A 3OAAA 3PEEA 4D56A 1ADJA 4DJAA 1CF9A 521PA 3R24A 1OI4A 5I7EA 2ZWMA 3I2HA 4LHSA 3EVEA 2X5NA 1PG2A 3AKDA 1FSSA 4R2XA 2P9YA 5AKYA 5JHGB 1GDTA 4HGYA 3SZUA 4PN7A 3PC6A 3JWHA 2ZT6A 3N07A 2EX1A 3FYHA 2VXCA 3BWYA 5TEWA 3SXUB 3DNFA 5K03A 5CD1A 4PNHA 2P2YA 2YQZA 3H1FA 3QKSB 4L8FA 4LHYA 3VH3A 4HRVA 1YFKA 3U3OA 5KC8A 3EGXA 4FMBB 1L4KA 1LPSA 4K0KB 1KY4A 1TJ3A 2EWVA 1V0JA 2WA1A 3CG0A 3NBZC 1LA2A 1Z7WA 3P52A 4B44A 2DPHA 4BU1A 4JZKA 3ZHTA 3CN7A 3H1BA 3RBVA 3ZXIA 1QX4A 4UNPA 4JC8A 1CRPA 3CONA 5LWHA 1NYTA 3CX4A 4NH4A 2ZE8A 6ABPA 4BTEA 1WU8A 4PFKA 4C7KA 4KQ9A 3PDJA 2ZVPX 2VH1A 3H2KA 1SQSA 3L07A 4NS4A 1WY7A 4AW9A 4KXYA 1GU7A 2AOUB 1U9YA 3OD1A 1NKTA 2Q4TA 2JGAA 2G70A 3GEDA 5K45A 1EWTA 2PVSA 1JHAA 1C0PA 2FU5C 3GNSA 4LQLA 2FGKA 3AB7A 3EVFA 3L1JA 1WHSA 1AIPA 2XYQA 1RAIA 2CMHA 2HAEA 5FYDA 5T57A 3NHBA 3AV0B 3I9V6 2EG9A 1RKQA 4FDLA 4U8GA 4ZGGA 2EJVA 5ALXA 3ELBA 1REQB 3AF5A 5C51B 4C0HA 1B4DA 3A2NA 2CLLB 2P30A 3PDIB 1YZ3A 2AZMA 2OP1A 3PKIA 1OR8A 2BC9A 4LTDA 1PZNA 4B48A 5JWRA 3R8FA 3USCS 1NV9A 1HDCA 1BMFA 2HLNA 4RZ3A 4GVLA 2CB9A 5EJ2A 1IG0A 1AKMA 2OQRA 2O8DA 3AEQB 2EP7A 4OAOA 1AGYA 1S8OA 3ZJYA 1Y5IA 4HOYA 3CUTA 2YHUA 5I7VA 5J4VA 3T38A 3SQMA 2H7YA 2ZRFA 3N2EA 2Q21A 2WWIA 2Y67A 1SXJD 2LGJA 1XZJA 3JVIA 4GE0A 3EEIA 2GUWA 4KFRA 3ZDEA 4EATA 5BUZA 4ROTA 3LQKA 4D46A 3AI1A 2OORA 4M9RA 2QBYA 2GEKA 2CY0A 3CW8X 1X8JA 2OORC 4MRVA 2WT8A 5HMMA 4RCYA 2ZBFA 3N59A 4R3UC 4WXYB 4Z8XA 4DYDA 1A8UA 2GM5A 3MINA 3O93A 4ER0A 1P7CA 1TU4A 1CB7A 1XFAA 1P1CA 1HPLA 4H60A 4P0QB 1QP8A 1GNPA 3A36A 2CMDA 1DE0A 1HQCA 2OD9A 3CF2A 2XQGA 3D0KA 4FR5A 4C7MA 2AJLI 3EF3A 3OZAA 4AL4A 3IEUA 3VBCA 1J23A 5CH8A 4XQGA 1H23A 3H9JA 4HLNA 1E7SA 3DLTA 1VBKA 1U5AA 2FLVA 3BIWA 4H7PA 4OAQA 4RIEA 2DQZA 5FPSA 3T95A 3TFWA 3SJBA 4GWLA 3AI2A 4ZVNA 4LC1A 2QVBA 4TTAA 2B4YA 4ZQHA 3O38A 1ABEA 4R4JA 3L8YA 3UH1A 4D2IA 1QOPB 4MUHA 2LXNA 2XVYA 1HX7A 5A3RA 1CUYA 1PV1A 4HADA 3CRRA 4R3NA 2JFWA 4NV3A 5H83A 3RC7A 1OX5A 4NJMB 4RACA 1PU2A 2WSLA 1QFZA 2DHRA 2I3DA 4H4EA 1JWLA 2H2GA 2XQFA 1WMEA 2O07A 3IODA 4A3SA 5E2AA 5JH7B 4CEHB 4ZD6A 1FP4A 2PEYA 4RJ2A 4LJAA 2H2AA 4MB2A 2UVQA 5JALA 4XUEA 2QRPA 3I12A 4ARCA 1G20E 1EQ2A 1VYHA 2YXLA 5T3UA 3LIPA 2WOOA 1ZCZA 3CZAA 1JFTA 4AZ0B 4DBLC 4M1SA 3ZX4A 5ADVA 4G0VA 4EG8A 1C0LA 1LSJA 4LBWA 2BELA 3GEEA 4Q1CA 2OHXA 5GIPE 3KQLA 3C15C 2J46A 3DE3X 3FDXA 2BRUA 1B0ZA 2HV9A 3QXCA 4ZWNA 1HLGA 4HZUA 4C30A 1ZGBA 1JG2A 4D1YA 5B12A 2BRUC 1ONSA 1CS0B 1P8JA 1UH5A 3CZQA 4MW7A 4FOTA 3BMOA 3A3YA 5B4TA 1W87A 3R2JA 5EGNA 2R11A 4GZMA 4TYNA 5CAEB 2WT9A 1UC5B 3Q7IA 1DEHA 1EPUA 2XCQA 3MUEA 1FS6A 3HBFA 5INTA 1BDMA 1ZNYA 4NBKA 3VHLB 2AWNA 4FTWA 3DLHA 3GFVA 4O1HA 3TQQA 4OB8A 4H3KB 3PQ3A 2Q1YA 3D3NA 1KI4A 4IG9A 1W4BA 3G2MA 5JVDA 4DLLA 4KU4A 1VCHA 5J9FA 4E5VA 2MR6A 1FNSA 1L5MA 5HKAA 1QNLA 4B0OA 2X5OA 1RXIA 2KW5A 4YRCA 5A5DA 5IEBA 4R5MA 4ZI7F 5BMVB 2WAXA 2IYUA 1PJLA 3I37X 4I5DA 1BHQ1 1M2KA 1AQJA 3IDZA 5GJVC 3QMPA 4HJRA 4UNQA 4GYWA 1B1AA 4J0EA 1FFEA 2EU8A 4J0DA 3A32A 4WDRA 3LT5A 2I6QA 3UJAA 2OKGA 2QL5A 2BR3A 4E6PA 2WMOB 4LDAA 4MV4A 3MWEB 2X0IA 1PJ4A 2OEPA 1XMOB 4D5EA 4JMPA 2PSHA 3W2GA 4RH0A 2NVWA 1VI6A 3ODGA 1EXWA 4F92B 5MN6A 1H8HA 3ZDAA 5JCOA 1WD7A 3KJGA 4B4UA 2GJ8A 1BH6A 4B3RB 4F8YA 1C7EA 3M0EA 3PTZA 5E2BA 5JCOC 3FF4A 3FI9A 3KALA 3PCTA 2AG0A 3G9TA 5E0KB 3KQTA 2E85A 1X7ZA 1RVV1 1U8UA 3I6YA 3UAZA 2W2LD 4DNXA 4Z99A 5EHGA 4DUPA 1NKVA 3CUEF 5CVEA 4Y2VA 1QIGA 1Y9DA 3A11A 3OMWA 1VRCA 1VHWA 1W2HA 4LDZA 3DV2A 1I2CA 1Z7GA 3HM2A 2I6TA 1U04A 1XKQA 2G0AA 3ZE6A 1FNDA 3GPLA 3I58A 4AAYA 1IZ7A 1LZLA 2A84A 3EPPA 1E2BA 1VIYA 1NR5A 1UPAA 1C3VA 2VK1A 3TCNA 5LDGA 5KTTA 4YP5A 1NP3A 4BNHA 3OLXA 4CLRB 1SXHA 5FA8A 4JEIA 4R7GA 1OYVA 4AF8A 1N6PA 3U37A 2DPMA 2VNHA 1BFKA 5CJJA 1COWD 1FJHA 3S5UA 4PYNA 3TQFA 3KOYA 2PGDA 4LY6A 2AS0A 1JFLA 2NVOA 3HO6A 3KXDA 4FFOA 4O4IB 3ZGVA 3V4RA 2QLJA 3BAZA 1F4VA 5FI1B 3BHIA 1TKAA 3FTDA 4GFDA 1LY1A 4EGJA 5IJWA 4ZYZA 5KAPA 4F4IA 1GRRA 3SOPA 2CMFA 4OGFA 3CWQA 3PPYA 1M6HA 1XQVA 1Y1RA 3DJYA 5HS4A 3CBGA 3VC1A 2CJXA 1WABA 2WJPA 1SPBS 2QYHA 3R7WB 4MJXA 3DL4A 4W5HA 4P31A 3RFXA 2FYTA 2W93A 2DWCA 5DHPA 5DDIP 3AILA 1DKMA 3DUWA 2VP6A 1KYVA 1D1TA 2EFEB 3LO8A 4LXYA 1T5HX 4JIMA 3G13A 3CTPA 4LFBB 4JDUA 1R4ZA 2AA3A 1V3UA 1UFOA 3G17A 4FD3A 5K0JA 1XNHA 1WJGA 5AVRA 1DRVA 3SEQA 4L28A 1EGAA 3M34A 4BVGA 4JCCA 3F6BX 2IL1A 2XADA 3FBWA 5D85A 5EIHA 4Q16A 3WSVA 3ETJA 4LQDA 3UB2A 3PRYA 5BV7A 2BE7A 2OG1A 2Q4RA 3SS9X 2ALJA 1JHOA 1KEKA 1LPAB 4KCGA 3VO8A 2XJ4A 2Q5IA 4PZPA 2C0CA 2H4JA 2VHWA 1Z0DA 1OZGA 4FSXA 4C5BA 4BV3A 4TQAA 4YRQA 2E5LB 3P2KA 3TTVA 2NXWA 4OXRA 3RRXA 3JQPA 1Q3TA 1Y3IA 3O4JA 4EECA 4RFSA 3ZVKA 2GO7A 3PEWA 1MOPA 3CRW1 3T3MB 2AG6A 2JCXA 2OQVA 3VNRA 4COOA 1AKUA 2JI9A 5FOUA 2FQQA 3RG2A 5L4SA 1I4LD 3DJFA 3TEMA 1KAGA 4B74A 2R85A 3LQYA 2R7MA 3QKWA 4QTUB 1B3BA 4KUHA 1J0BA 2WKSA 5AUNB 4RL4A 3VH2A 1N1DA 3U4QA 3RVKA 1E7QA 1YTLA 2XE7A 3T9DA 4KH1A 4PTLA 4C03A 2BN4A 2ZREA 4DG9A 1I0LA 2AW5A 3M1IA 5JC8A 4DGSA 3EZNA 1V7ZA 3HKCB 1V5IA 4RHUA 2YJGA 4U63A 1UZAA 3NBQA 5FPQA 3FPSA 4IOMA 1CJBA 4F5EA 3VO2A 3CB2A 3FCOA 4F12A 3OUUA 2P90A 1UP4A 3DAOA 2FMUA 3KB6A 4LEIA 3SVZA 1WMBA 3HADA 1DOHA 4F1WA 5C37A 1FZTA 1R18A 1RCUA 3KU4A 3AUYA 6PFKA 3QLVA 5FO1A 2EHDA 3D4NA 5KAMA 1SUSA 3EN0A 1R6XA 3OETA 4QHYA 3DULA 1V8OA 1M67A 3JVEA 3QLVC 4R1OA 4XXHA 3TIVA 1XI2A 4W8GA 5EZQA 4ARVA 3ITKA 2BKVA 4BNUA 4EQZA 5TMDA 1RHRA 1RLMA 3DFUA 4GMFA 2W6PA 1S1CA 1YIAA 1A9RA 4MVJA 2OM2A 4UUMA 2J1LA 3WGGA 1XF1A 2WMNB 1YV9A 1F8YA 3LUGA 2F62A 1J9GA 3FNIA 3ABSB 4ROSA 1YBHA 1PT7A 2HKIA 2ZRMA 4EA9A 2A88A 3II6X 2H2WA 4GYJA 1DQNA 2X3UA 2YC2C 4AMZA 4BE4A 4EIWA 2G0NA 4G5FA 5ALKA 1AUOA 4ND6A 4DPLA 2H9YA 2NT4A 3NRCA 1QYXA 2I2CA 4XSGA 3CZPA 3G7UA 1V35A 2FUG1 5REQB 3M1YA 1V71A 1I8TA 3QYJA 1UPFA 3OT5A 1DCKA 2VTDA 3HBMA 2HEIA 3K31A 1LDGA 4KQEA 1SUEA 2QENA 3NM6B 1ZDMA 3CX7A 3EISA 2DFVA 3IOEA 4QKQA 4GL2A 4U9HS 2YWBA 2H18A 3JWIA 3L8EA 1W9MA 4JUAA 4US0R 3AOEA 4IZ6A 4ARBA 5C18A 4QXOA 3NEAA 4DR7B 2GZRA 4J07A 4TLDA 3AOEC 4YT5A 3VU9A 1Z0KA 3F7MA 3H18A 3IAHA 4US1R 1JB9A 2H9AA 1TJPB 3RTGA 1ZZGA 2Y27A 1WZ2A 1DBQA 1DLJA 4CEIA 2R5NA 4G5YA 4BMSA 3ZDBA 1YTUA 2QORA 4KBYA 2J59A 3EMKA 3PJDA 4NFSA 2LNDA 1V7PC 2JLCA 3VR2D 2W70A 1RTTA 1Y48E 1VBFA 1W4ZA 1VE6A 4NG5A 2Y0CA 3I2JA 1J8FA 1GGKA 2P9CA 3FUXA 5AK0A 1K4KA 4TVSA 1F3LA 4BE7B 3NT5A 3ETCA 2VUUA 3RASA 1CZUA 5BORA 5KOHA 2GWRA 3V4VB 4AYTA 5B4VA 5C1OA 1KE1A 3EVTA 4Y6LA 3CCCA 4RAQA 3DFMA 3SJZA 1XPJA 2W43A 1RI2A 1LQ2A 3JZDA 4MW5A 2FZKA 3WJAA 3I34X 1USUA 4OMCA 5AJVB 4FFPA 1O5OA 2YVUA 4IQ8A 3G82C 4UM8B 2X86A 3T41A 3ZD7A 3HWX1 3HU3A 4RHCA 3NBYC 2IOYA 5GZ6A 4CHGA 3L8CA 4Q9DA 4HPWA 1SQFA 4TMWA 1AN9A 5FPYA 1NNSA 1L5NA 3R9XB 2IYQA 2WHPA 3VSEA 4X7MA 3BEDA 3QRWA 3OY2A 1RADA 2PLWA 1K5GA 1TC2A 4J0CA 4RPLA 2OAGA 3JARB 5KC9A 3AIOA 3H2SA 3QXHA 4IDGA 1YMQA 1L4FA 1SIOA 1Q57A 1OXBB 2Q6LA 3E1KA 4H6XA 4U4AA 1EUZA 4LE1A 1OREA 1N5MA 3SICE 4F91B 4WZBA 4EJ2A 4BTLA 4A6DA 1OXSC 1T3TA 3DF9A 1L8LA 1KZ6A 4KC0A 1TU0A 1GAXA 1NUPA 1Q17A 2AEFA 3G2QA 3HC7A 4O1IA 4XVHA 1R00A 4BO4A 1UMCA 2IIBA 3D2LA 4QRHA 4R2JA 1DHTA 3A9SA 3M82A 3R09A 5F21A 4UTXA 3SX2A 4AG3A 4CHTA 3K72B 4RKFA 3PQ2A 4G89A 1V11A 2YX1A 3B9BA 3DMPA 3PITA 1EK1A 1JILA 3C8ZA 2IDKA 3QFHA 3QBDA 2RGCA 1AC5A 1SPXA 1E3QA 2D13A 3IMCA 4JBYA 3ZJ5A 5CT9A 3PT9A 3ASZA 1T9KA 4HZGA 4JL6A 4PR3A 4D26A 2H2FA 1Y33E 3Q9NA 1X38A 2IPMA 4K26A 1Y6QA 1PR3A 1WLYA 3B3QA 4O2BA 4DCCA 2K2QB 1OKKA 2B2XA 3CA8A 1HG1A 5JO9A 3CJTA 1TD1A 1QDUA 2HMWA 2IW1A 1TCVA 3JSXA 3P27A 1Y42X 4P5DA 4UEWA 5FL7D 5FA6A 3FNRA 3W5SA 4PYQA 4WX2B 4H16A 1E89A 4MR8B 3FDFA 2BBWA 1GA4A 1Y1KE 3ADOA 1MEEA 3CH5A 4EGCB 4DMUB 3RYCA 3NASA 1GGNA 2B1GA 1Z8NA 1NVWQ 1BXKA 4ZQEA 1G4AE 3N3BC 1U80A 4TZ0A 2WKRA 3ABRB 1U02A 2VPQA 3WYCA 2LP4Y 2NT3A 1WD5A 1VMKA 4HSEA 5EJ8A 4EG0A 4OPMA 2WILA 1K6EA 4K9OA 2Q41A 1EK6A 3JSAA 3M3DA 2BFBA 1QYVA 4R8KA 1NIJA 4ZVTA 1KDPA 1O1YA 1T8SA 2C5EA 3PFCA 3HE3A 4DYHA 2RGBA 5CBPB 2V8BA 3E7PA 3OX4A 3HS3A 1OZFA 1QX3A 1TIBA 1IUNA 3GU3A 3OE1A 4P2BA 1DTSA 3RROA 3U0VA 3VR4A 1ZD2P 1GUBA 1F48A 1SH7A 1UBSB 2CJPA 4OHWA 5DHFA 5AXDA 4WV3A 1U0TA 5T3YA 3KKQA 1BWPA 2WIKA 2EV9A 1W7AA 3WRWA 1F4LA 3T7KA 1GFZA 1JVNA 3HYSA 4MPDA 4ZVVA 3VDXA 3LYLA 3BA6A 4RHFA 2BKLA 1KYIA 1N2SA 2HDHA 3QKIA 4FFBB 4HMPA 1PVDA 4R1QA 1HXHA 3RVBA 4BX8A 4C4ZA 1Q22A 4FWTA 4G0OA 3F98A 2IU0A 3EVGA 4LQ4A 4DADA 3AW9A 1N2CE 2H52A 2YN2A 3EGIA 4HI0E 2GFIA 4W1QA 1K98A 2XJ9A 1AQLA 4S1WA 5ICMA 1V6SA 1W48A 2H8KA 4MRAA 5TVGA 3A6KA 3NNDA 2GAAA 3FHCB 4Q34A 4R0MA 4HUJA 4QA9A 4EKYA 2E21A 5IM4F 3I5YA 3R5XA 5C4IA 3DL7A 4BX3A 4JUCA 5J59A 3MQ2A 4MAFA 1XZGA 2VCHA 2HUNA 4M53A 3G1TA 4EFLA 2HNKA 1X77A 5EHNA 4RDCA 8ADHA 1Z8DA 3O6VA 4Y9SA 5FFFA 2ZYVX 2BFWA 4FUQA 3RF7A 1P33A 1U2ZA 5FNVA 4BGVA 3KJQA 5LYJF 2RHOA 2UYQA 3L41A 3OEHA 1CVIA 1GU1A 1JWAB 1T0BA 4L5JA 4DWJA 4V2IA 4OX9B 2YWRA 1DCTA 3OZRA 3GD7A 1RXVA 1J8MF 2HIGA 5AW5A 5ERXA 1H3FA 4RKQA 2VXOA 3AXTA 3KPVA 3O9ZA 4GLJA 2ISCA 3ONDA 4YRDA 2YS6A 3R9XA 1Q0TA 3GCGA 3QVGA 1X70A 4KQHA 2WZDA 1TUBB 4X65B 5AW9A 4JLNA 4C2UA 1WW2A 1R0LA 5ALPA 2ZATA 1N8TA 2J85A 2VBCA 1A69A 1GTG1 1UWLA 3AIIA 3HYNA 3R41A 1Z0SA 3TZBA 3WWZA 3A6HA 5IDXA 1KJQA 1T15A 1D5WA 1T5SA 3I2YX 4K9PA 5J5AA 1IWOA 4BECA 3FFTA 3QMMA 1TPZA 3K0AA 2I03A 3ZE9A 5AVVA 1NN5A 4FYHA 2ZAOA 4RKRA 4A8JA 4BFUA 1YRWA 4N3AA 1JDTA 2XE8A 3ROEA 4A26A 4LJ8A 4KMRA 7REQB 4Q3OA 3E3NA 1D6MA 3LPDA 5GVRA 3EDYA 4B3XA 2YDXA 2PCJA 5CVDA 3PIIA 1HTBA 1C1XA 2I5PO 5AVZA 3NHPA 1HLFA 3TKAA 1EFKA 3HPQA 3ZCXA 1K66A 1CE8A 3NXSA 2O06A 2Q2VA 3SYKA 2WSYB 3TL3A 4IMJB 1WDLA 3HLTA 5E1MA 2OV4A 3SY8A 4XUGB 4F93B 2VXYA 3O8OB 3STVA 1O0SA 1Q6YA 2QTMA 3VOSA 1KC3A 2WAAA 1MV5A 2ZM5A 3H6HA 3PFHA 4KXWA 1ILEA 2IBMA 1KY3A 3LAWA 1AA9A 4LPKA 3GLTA 3DWFA 4Y1EA 2I0FA 2WABA 4KB5A 3TOZA 3CZRA 5BN4B 4IRMA 4DIFA 1ESEA 4EY3A 3HU5A 2VP9A 3PXEA 3OOSA 4RZSA 3TCXB 3OWXA 3WGUA 4RSRA 1WMAA 4TT3D 5ELXA 1FQOA 3D6VA 3F5MA 3RS8A 3RBZA 4YT4A 1YR2A 2NTVA 4UEOA 1NUSA 5LXTF 3GP8A 4ARIA 4PIVA 1DBRA 4FZ3A 3SZMA 4HQFA 3GJ7A 3LXMA 5F2KA 4ZVQA 3PF9A 2JBAA 1P0QA 3MJ4A 3MPOA 4EO9A 4GKKB 2AFIE 5TVKA 1DRKA 4K1XA 1KKUA 1GU0A 4RV9A 4Q9KA 5B1IA 4F4FA 1JBQA 1H9BA 1T3LA 2V54A 1GZVA 4YMTA 1IQUA 1F20A 1PT6A 3GO4A 4G4SP 4RVGA 3OZVA 3FUCA 5BV8A 4RTKA 1MH1A 1Z73A 3TSZA 1XPRA 4BB9A 3CXRA 4X7RA 4Y9DA 4I55F 1Y3FE 4AJ9A 2VQ6A 3PENA 1T9CA 3DFZA 1XZIA 1J21A 3UH0A 3ADDA 4Q39A 1NRJB 1CJMA 5H4GA 5KINB 1V26A 2PA3A 3DDNA 3GLSA 2O57A 4B81A 3GD5A 3UJPA 1X8LA 4J3NA 5I47A 3PVSA 5JNLA 5K4GA 4OX9Y 1UBRS 5TQ0B 1DXYA 4GBED 2N3ZA 3MGBA 5HHTA 2O8DB 3O2NA 1ONPA 4GWGA 3GMSA 1FP1D 3H1AA 4CV1A 1QQ5A 5EOVA 1M6WA 3UUEA 3DAGA 1QO0A 3GYBA 2OP0A 2ZXUA 5BN3B 3AEKB 1KQNA 1LBHA 1L3CA 2J5XA 2JIMA 4X1IA 2PM8A 3ZY4A 5KYXB 4YQYA 1J06A 1DC3A 1E20A 3UWPA 1EHYA 2Q49A 3E7DA 4GXNA 2DUNA 3TBHA 2GEBA 4WOCA 4JYAB 1ORVA 5L7TA 4U2BA 5LZ8A 3CLTC 1TVEA 1VTKA 3WIOA 5IF9A 4PRLA 1KORA 3HXPA 4XB2A 2HPHA 3BGOS 4ZHQA 1XD2B 2B4AA 4NYJR 1Q1BA 1Z4OA 1KE2A 1OPRA 3C14C 1JDUA 4G1CA 2WF6A 3GJ8A 1R0XA 1SBHA 4XIYA 3V4SA 2ODBA 4LS3A 4N76A 1L7RA 4C6SA 3GMTA 2D1RA 1V47A 4IH4A 2HK8A 4OEHA 4URWR 2G5TA 3ML1A 2FTKE 2IW3A 3ZPXA 4HS4A 4OSPA 1X7XA 3NDIA 1IN1A 2GEVA 2YC4C 5AM2A 4DR3B 1CU1A 2Z9BA 4OHXA 3JQBA 3NGLA 4B3HA 3PVCA 5CLJA 4ITUA 4CQMA 3ITNA 2DBYA 4M0KA 2FEAA 3Q7RA 3JQBC 1KPGA 1XTVA 2Q0XA 2PX2A 3N0TA 4J75A 2WEKA 1I1HA 1Z0ZA 1ZIDA 1JLLB 4B5LA 1Y1QA 1PP4A 2R3SA 4HHEA 4NQRA 3LT2A 3TXXA 3E23A 4Z5XA 5K05A 3A1EA 1XRQA 4D8VA 5DNYB 1Q74A 4CDRA 4I08A 4AFNA 2Z95A 1GTJ1 1PSZA 3LZDA 1F8GA 1PTJA 5A4MS 5BQOA 1X9GA 4TS3A 4HLUA 1JX6A 2CXUA 4IIFA 1SWVA 5NULA 2N9UA 1PTJC 2PX5A 3EZYA 3NHSA 4EMBA 1DFHA 1X9HA 2X8BA 4HLUC 4OJQA 2EKBA 3HU2A 4EZIA 4ZZ1A 4QARA 3RR2A 2W2TA 3E15A 1E1YA 2QUIA 1C3JA 4UHKA 3DZ8A 1P45A 2VXBA 3LX6A 4C89A 1VJTA 1NW9B 4U7TB 3UZUA 1U2RA 2GTHA 4OGKA 4KXUA 3G0OA 1UXOA 4HSGA 3T99A 1F2DA 3F67A 3LDGA 4LWPA 1KWKA 2OWDA 3TQSA 1ULZA 4PLTA 5TJHA 2UXDB 2WU8A 3SHFA 4JLJA 3VR1A 2PWPA 2O2DA 4LKOA 4C4XA 1EHCA 2V6BA 4C4PA 1F6WA 4PWYA 4C29A 4ZAFA 3BKXA 1U3UA 2AOTA 1J49A 1K1EA 2KBEA 4BFXA 3EXAA 5CBKA 4LZNA 1DFGA 4K0RA 3CVUA 1GKLA 3IBGA 2GHRA 4ER5A 4JLPA 1SKMA 5ITVA 3VPSA 4QUDA 2O7QA 1T4CA 2RFLA 2XBLA 4BASA 2HF9A 3P7MA 5GONF 1QIMA 4RJJA 3IQDB 4WERA 4IQ4A 1XDWA 3K92A 2RH5A 2YL2A 1T2CA 1YQQA 4NG4A 5J5CA 4BBZA 1ZI9A 3QU7A 1YB6A 4V2UA 1Z45A 3MSXA 3TNFA 3AEYA 3TYXA 3TLAA 4DCOA 2PUDA 3FNQA 3CR8A 1HG0A 3B38A 1N2EA 1SD2A 2HLDD 2QE6A 2RHWA 3IBFA 3IBSA 5DGXA 1IVNA 2JJ8A 4NBSA 2PS1A 1OYWA 2I1VB 4AJNA 4L9AA 2HQ1A 3QXJA 1G20A 1UM8A 4AZVA 2YMLA 3GEBA 4LOIA 3UYKA 3LDUA 4TXMA 4QVIA 3PUZA 3MCVA 3RS5A 5JATA 4F60A 1TE2A 4HNRA 2A3RA 1PFQA 5HIIA 3EW9A 2W5UA 4WHMA 3TH5A 5HM8A 4RJIA 4TKVA 1GOTA 1MAWA 3SEZA 4TTPA 2ZRCA 4OBWA 1KVRA 3KZNA 4PSKA 1AOXA 4BDTA 2Q3FA 3EMDA 4WBNB 3GFBA 4GR4A 1C80A 4RTNA 2VJMB 3U3MA 2QUAA 1IHYA 1R4AA 3OI7A 4UPEA 2V6MA 1YR1A 2FH5B 3ORHA 4YRNA 1L7OA 1T0IA 2R8EA 2ZJ8A 3GA7A 4FGZA 5SV2A 1NW6A 1HGXA 2DTDA 4E70A 1LDBA 3ANSA 3LGXA 2E89A 4HRYA 3SNHA 3OCJA 3A6PC 3QEJA 2B21A 3H7IA 4YREA 1IHOA 1N7IA 1JLHA 4LZAA 2NNLD 2W4QA 2CFRA 4EQ6A 1HDOA 1Z3IX 4R1LA 2ZRNA 2OZKA 3DZCA 2Z8YA 4WKBA 1Z06A 4WN9B 3UAWA 1E4OA 5ECGC 4B43A 1EUQA 3BE5A 3RRNA 2WIFA 2L17A 2CL5A 3EEYA 4XR4A 2AQIA 2NU8B 5IMSA 3RAEC 3FXAA 5CM8B 4IGEA 5D01A 4PS1A 3IAS6 2I34A 3EFOB 5H59A 3ZWDA 5NLLA 3I01A 5CFLA 1R9MA 3PYMA 1EWKA 5K8IA 2YWJA 2ZTSA 4PW0A 1D2NA 1MOZA 2BGUA 2HH9A 2IEGA 1U31A 1RLUA 2XWJI 1P75A 1ISRA 2DSTA 4JJGA 4B82A 2JZOA 3SYNA 5KJFA 2AEJA 4PVCA 5D3KA 1S2DA 1SOWA 4IGIA 5DHTA 5C4GB 2P6MA 4M88A 4L76A 5EJ9A 3SVLA 2QDKA 3NIDB 3EVCA 4UBIA 3TTWA 2GKOA 1TQDA 1HMYA 2EFCB 3A1TA 3C6MA 3M5WA 4PCAA 3M1AA 4GOKA 2K4MA 1GL3A 2HA2A 4MGIR 2F2TA 4BRSA 1X39A 4LSWA 3VZRA 4K6OA 5UKDA 2GJAA 4MJLA 3DHEA 2W2MA 1R9JA 3LYHA 3MTEA 3JQ8A 4KL8S 3X1MA 1HYGA 2IEIA 4AJJA 2B4KA 2VWGA 4OF4A 3BFXA 1E3IA 1PE0A 2ZG6A 1TEZA 1YFJA 3P9YA 1EDEA 3K2QA 1E9FA 1YCDA 2EQ5A 1Z5OA 4BRWA 2W00A 5TARA 3FVQA 2PX0A 4BOYA 3K1TA 4FGUA 4OG2A 1ENOA 3AEXA 5HUHA 3BH0A 1ABBA 2RBGA 3H1TA 4WTOA 2P77A 3H05A 4IS2A 1IZZA 3KV1A 5DOZA 1ORTA 5H3LA 5SY4A 2V1UA 5CDUA 1Y1SA 4EJSA 2TMGA 1YVRA 3KAPA 3K9CA 2CHGA 5JUWA 3H3XA 4Y0VA 4EJSC 4URFA 2C4UA 3HACA 2VBGA 1O9BA 3EGOA 5K0EA 1FDVA 1JAIA 3UA3A 4WA7A 3IEVA 1IB0A 3ECCA 3OLCX 3W3AH 4ESEA 3AVWA 4NFYA 3ROPA 2GOYA 3FPKA 3QFSA 4GS5A 1N1GA 4URYR 3VYUB 3B9PA 4PNZA 3BMQB 4UEKA 2GK7A 1MEJA 4FE4A 2NUPA 3HEMA 4Q7KA 4Y2YA 3V5NA 2RIPA 3WA7A 1XTUA 2D2VA 3B60A 3K0FB 4I6GA 4D9IA 4ENWA 2WJHA 4DIMA 4WY5A 5EP2A 3EA5A 3ZGNA 3G9QA 4OK5A 2J3KA 3ZDFA 2DZDA 2CEKA 1T2NA 5ER9A 4MYUA 2UU9B 2FI1A 4CN9A 5AW3A 1LPPA 2IEYA 5F1OA 3F3SA 4UAGA 3DC2A 3P2JA 4QT0A 2ZYWX 4AG6A 2Z2ZA 4I4NA 4C0XA 4D8UA 3K1AB 2VF5X 2OPBA 3LZCA 3NT4A 1YNOA 2XY4A 3E2MA 4WIAA 3H9CA 5KYWA 2CV0A 1U8YA 4MIOA 4Q1VA 1G8SA 2ISQA 2JFVA 2C94A 4QRIA 4XWGA 4IMPA 3RRZA 5JQGA 3GFFA 5A6VA 3DLIA 5EXDA 4P7GA 4ZVOA 1JH8A 1RRVA 2QQ5A 2QLMA 2H1LA 1E8MA 1PWXA 1E3JA 4HWPA 1K6MA 3SSOA 5ARBA 4AJOA 5I48A 2DXIA 4YECA 5EERA 5B6IA 1Q92A 1XLWA 1EFPB 3HGQA 4PO1A 4I3GA 3TJZA 3V1KA 1HQYE 2RBKA 3L4JA 3VNUA 2YOGA 2D2EA 3ZJUA 4QGHA 3KQSA 1BSVA 3AY6A 2XQJA 3JU3A 4Q15A 3EWNA 1E63A 3MCAA 4V39A 4AJIA 2XZOA 5EMNA 4HUQB 1MRZA 2FPGA 3EIQA 1TEHA 3NHKA 1PGPA 3J81k 3I9FA 3B1YA 1XR3A 1MFZA 2AVDA 4MEJA 4W5WA 2MT9A 3SS8A 4WLOA 4UHHA 3WWPA 3D2AA 4IYRA 2BJHA 3FCYA 3GT3A 4DLYA 1CUGA 4IIJB 4WADA 4AF6A 2JGJA 3ANTA 4ZV9A 2G17A 2F00A 2GTIA 3F7NA 4HQ6A 1NXPA 4Z9YA 2WICA 5AO9A 5EMHA 721PA 2VSXA 1BWRA 3KFXA 5TT1A 4N5HX 4F8EA 1MJHA 2QP9X 4TSFA 3WK5A 1ILWA 1OVGA 1MRNA 1JKFA 1I9GA 1NDQA 3D81A 4RH3A 5A3JA 3EOBI 1N78A 2WG1A 4MJ7A 5BT8A 2X8LA 2IZ5A 4IZOA 4JLVA 3HGTA 4IHAA 2DUWA 2J7KA 2BFFB 4KQJA 4TLBA 4D4GA 1NWCA 3KSMA 3P9KA 2JLAA 4OO3A 1W85A 5MGNA 1FFCA 4C22A 3GEPA 1IL0A 3C87A 3D31A 3OWHA 4I4LA 1H65A 1WEKA 5DI3A 2YN4A 1NG1A 1Q0ZA 4FGSA 5IJXA 4G0ZA 2J48A 3Q0IA 3SIXA 4BO3A 5CYOA 3W7AA 2JVIA 3DOCA 3KCNA 1BHO1 3OJWA 4N0EA 4UMFA 5J4LA 5JASA 1QHNA 3LBIA 3FVVA 3NX4A 1MTOA 3G8DA 5EIWA 2RARA 5EJ7A 1USKA 4OHCA 4LRUA 1JU4A 1OROA 2PDAA 3ZWWA 3KQHA 1E2IA 1PR4A 3EXEB 3PU6A 3VYVA 2GH1A 3BSYA 3GJ6A 4DQ0A 2Q5QA 3AF3A 4MV8A 3T35A 2AXEA 1R88A 4UU8A 4JI8B 3V4OA 2X2PA 2PRSA 5IN5A 2QLTA 1J0CA 4O2LA 4YO7A 1FDOA 1NVDA 1Z12A 4BU0A 1UWCA 5IPFA 4NZNA 1Y1TA 1DAGA 4R16A 1YA6A 4TV8A 3W79A 1FDRA 2JAPA 3N5CA 5TPWA 2I8CA 1LRJA 3WSWA 5B7NA 1Q3HA 3AFMA 1DIHA 3EC1A 4TUYB 5TQ2B 2OCYC 5DYTA 1NJFA 1LI4A 1ARZA 3TCKA 3T3IA 4V1CB 5IKEA 5JHHB 1KK2A 4F7DA 3VTFA 1L5LA 1PR5A 2GN9A 1BS1A 2ZTHA 3DR3A 3RT7A 3RANA 1U2TA 3P2IA 3W34A 1APBA 4J0HA 1R74A 5LUBA 2RGGA 1TTHA 1DBVO 1T24A 3AHGA 3TLXA 2EL9A 2Y1CA 3HDHA 3KUKA 2WU3A 3D1JA 4RHYA 2WD9A 4LF7B 4XWOA 1OBOA 3AG6A 2OTCA 1JHRA 5JMTA 4DL9A 4QBHA 1TD9A 2BZ0A 2I78A 2KHZA 3R4CA 4E51A 4HAIA 2WM2A 3FBTA 1ZVMA 2R6R1 2ZBVA 4DR5B 1WXQA 4J03A 1QV9A 1DL5A 1JIKA 4DSUA 1GRNA 2RK4A 3V7FA 1ZR2A 3CZCA 2JFGA 3VKFA 1H2ZA 3B6KA 4N39A 3TMAA 2Y0DA 3QKTA 1L7DA 1XQ6A 4YCJA 4BO2A 2F4NA 2BTEA 1EXNA 1EVKA 1OT5A 4ZOLB 4JT8A 3THXA 3W6PA 1A9ZA 5FTWA 4DB2A 1HH4A 1N9GB 1W8IA 3ILHA 3MB8A 3W6UA 3WB2A 1UAGA 1OW3B 3AF4A 3B1VA 1XQ1A 2C92A 4IJ6A 5HGJA 2W6CX 5AVJA 9MHTA 1EFCA 2YQ5A 3ZV3A 4M98A 7AT1A 4UDNA 2FEOA 3I83A 2NVUB 3MS4A 4G86A 3WLQA 5TS3A 1XCOA 2NU7B 3OD5A 1RC0A 1JHQA 2BFCB 2F3SA 2AMVA 3NHUA 4PC3A 2GN4A 4UDOA 4B4KA 5KSWB 4ICIA 3PHGA 3MF4A 2AG1A 1TTQB 1W93A 3K8OE 3COVA 3Q7TA 4QOHA 2A6PA 2QVGA 1KZHA 1BCRB 2OG2A 1KI3A 2CXXA 2IDZA 1TECE 3GI1A 4H6PA 2V03A 2K5UA 4RTJA 2IYLD 3R8XA 4RDXA 1T36A 2A5DA 4GRIA 1W34A 4MUYA 1N77A 2B83A 5ENVA 4X94A 3PP8A 4G2NA 1W9HA 2AE1A 3BK7A 1ZM7A 3IFSA 3OAAD 4GR5A 3ADBA 1IXYA 4ZV4A 4AKGA 3QM1A 5K0NA 2PZLA 3ZQJA 1Z39A 4TMXA 4EA7A 3C6QA 2BFNA 3Q4GA 2PSSA 3GRZA 5MHTA 1NMZA 1ZJWA 3R3HA 1ZJ6A 4G0YA 1BFUA 4V03A 1B0UA 1QRUA 2JW5A 2C4HA 2RJOA 4K9LA 4PEVA 2VEDA 3AHEA 2G07A 4RL6A 3K30A 4D0GA 5T6MA 1P0MA 1AH2A 2JIRA 4N3CA 3VJLA 4IDCA 3O8RA 1JHUA 4FE7A 4BO9A 3VA7A 1QIJA 3R74A 1A97A 2DHDA 1KYZA 2PX3A 4U0KA 5LLDA 1NYQA 1M83A 2Q0HA 3Q72A 4XYGA 2XTNA 1ONNA 2DFLA 3TZ6A 1AHPA 4UUAA 4V1CA 1X42A 3V2GA 1JL3A 3NRJA 5BSGA 1HDRA 1EVEA 2FNAA 1P2GA 2ZJ7A 3ZHZA 1PS8A 3F6CA 1GWNA 2E87A 3FYDA 2VRNA 1PQPA 2XTAA 1EZ4A 4RLHA 4ZO6A 3A3KA 2XDQB 2R25B 2OY0A 3FCAA 3KYIB 3REQA 4BP8A 1NPYA 2IZ0A 4GP7A 4H3SA 4DV6B 1XTSA 1PWHA 3V6MA 4D25A 4DUGD 4UAJA 3RIMA 1DWQA 1A4RA 3GBVA 3UK7A 1ZGZA 2EC5A 4D9FA 3IO5A 4Y2JA 2JCVA 4I9NA 1MB2A 2ERYA 3KSZO 1NT4A 4P3YA 4RVDA 3NI2A 1C3XA 3IUJA 5HZMA 5TLSA 2GZMA 3DWEX 3K1ZA 5BT9A 3V32A 5J4YA 2YY6A 2Z1DA 3AFGA 5COAA 1S01A 1C9EA 2IS4A 1W35A 3N7TA 4G23A 4HH3C 4JVNA 2P2LA 1QTNA 1G8FA 1ECCA 1TQ8A 2GVNA 4GBGA 2JJMA 3PHJA 1BMFD 4A0GA 2IYAA 2LIPA 4ZYWA 3TUIC 1DEKA 2PIDA 2XB9A 4C05A 1BWQA 2FFHA 1R4MB 3TUJC 5I01A 1WULS 2C9MA 4OJTA 3BIOA 3GUUA 5LQUA 1CP3A 1ZLXA 1W1IA 3P0FA 2R7NA 3KAQA 2QT1A 2GPJA 5LLSA 5IH7A 1N2CA 4XLTA 3G0CA 1JNXX 1MHTA 1QVVA 3OSUA 2WOJA 1P2SA 3K94A 4EUHA 1M1UA 2ZAGA 1OIWA 3PQ6A 2ZFUA 3PNKA 3RTDA 4A7PA 2G28A 4BEBA 5KVAA 4B0PA 2MSLA 3QX3A 4KVGA 4KACA 4C06A 2HHHB 2DX7A 4CIDA 3QVOA 4O4LA 2G6BA 4UZFA 3PYLA 3P2YA 3OFNA 3G02A 3WL5A 5ALUA 1CKEA 5CVJA 1SC9A 4QFCA 1U1GA 5EL0A 1S4QA 3FRHA 2VP2A 4WBSA 4DSOA 4RA9B 4FLEA 4M8IA 1VJDA 1TVCA 4I50B 3FR7A 3HXTA 2ANCA 1NC3A 5THQA 2IHNA 3FLEA 5LCXA 2ZZKA 1E1CB 1W46A 2SECE 3DP9A 4CKCB 1MDBA 3DEIA 3JQ9A 1Z2EA 2NUAB 1YDFA 2VRCA 5D7BA 3V4ZA 4B76A 3K6RA 1FBNA 3I6ZA 2XD4A 3JQ9C 4MNTA 1Z0FA 3KETA 5KX5B 1L3IA 4Y6PA 2C8KA 2H1VA 1K5PA 2NU6B 2PUVA 3B12A 3CNOA 1Z6AA 2AL7A 3P2OA 4LHXA 4UCXA 3MIIA 4E1VA 3DSRA 2GJ9A 4V0ME 2IU4A 2E4YA 4DXAA 3PTAA 3IMFA 1M2VA 1GZDA 1YQTA 2NO0A 2VDNB 3E53A 4O1MA 3WGLA 3HYTA 9ABPA 4H4CA 5IARA 3ZV6A 1N3LA 3O94A 4HDCA 3LKZA 5L51A 2BMDA 2O2IA 3G3EA 5M3BA 4JLWA 5KMGB 1E2NA 4Q4HA 5DNEA 3C5HA 1LBQA 4IRXA 1DJQA 4CKWB 4PG5A 2C2XA 1LPBB 2HNBA 1TCCA 4B8YA 4BFYA 4HMOA 2AX4A 5GINE 1CY1A 4QYXA 2PGAA 2E4XA 1KH3A 5GZ3A 4IDQA 1ZFNA 3T5MA 5LP6B 3GLIB 2Z4TA 3FMOB 4L8LA 2XA1A 5LQRA 1WWKA 1E5LA 3OQIA 4JX8A 2C9YA 4NENB 2O19A 3VPDA 1II8A 1OD6A 1GR1A 1M54A 1SNYA 4O4HB 1TT5A 4U9UA 5JG7A 3KOUA 3OLVA 1G291 4QVGA 4ZT3A 5T8KA 3L4KA 1P1JA 1TLFA 2P6OA 3OVMA 2OGSA 1N34B 5AUQA 5T8KC 1YQXA 1OHHA 4Z0NA 5BQXA 2OCPA 4D6YA 4N5DA 3N86A 4KN5A 3BWCA 3GIDA 4ED9A 2X8AA 5MFZA 1GUZA 1PL7A 1T1EA 1XHLA 3PNQA 1CRZA 4B2IA 1UK6A 5IXJA 2YCLA 1M5RA 1UOEA 4GEGA 3B1JA 5AKKA 3ORRA 1FYEA 1FTQA 4N6GA 1E5VA 4M76B 4F4JA 2BF4A 2HRQA 4U2EA 3L79A 4CM1A 4ZC8A 1L5FA 3OHSX 3JZFA 3VHXB 3ERCA 4NBRA 2TSYB 3G59A 1H8HD 4E5MA 3G7NA 2CDCA 2Z5GA 3F8WA 5KYUA 4ENVA 2HMYB 2IX3A 3LWNA 4MS3A 1E3MA 4E0BA 1CBUA 4C9BA 2WAYA 3A4NA 3VU8A 4E32A 5HGXA 5KDDA 4W82A 4KWHA 4GH5A 4I5IA 5FBQB 1VJCA 2BKUA 2I6UA 2IZ7A 1U0RA 2NYAA 1Z6YA 5CIWA 4EJ6A 2J3HA 5ADHA 1A1VA 1IBLB 2WJ4A 2Q5OA 2VNSA 4FOOA 1JH9A 4MMYB 4FGWA 1JZTA 5BNFA 5K20A 5IKPA 4ZI5A 5C35A 1QIFA 4LC9A 4C14A 1J8VA 2Q5EA 4U5XA 1Y3AA 3PEVA 3FIUA 2HCFA 4Y6OA 4O25A 1P6XA 4L73A 1TMOA 4MW6A 4P0TA 4WY2A 1K3UB 2ZTMA 4IIHA 4U5QA 2MSNA 3NTLA 3G79A 1SC3A 2P2GA 4R84A 3IP3A 4MYCA 2FJPA 2ZRQA 3CUKA 3ROZA 1MW8X 2O2HA 4DLKA 2BM9A 1P1RA 5BUSA 3QUTA 1R2QA 1UFQA 2YJTD 4J2HA 4TKMA 5CGQB 1RRMA 2GN8A 4BXOA 1X2EA 2Y71A 3AXSA 2MSCB 3EXFA 2ZDGA 3IOCA 4FDUA 1A5BB 2N1BA 3NALA 4YDRA 3FMIA 4W5QA 3FFAA 4J6FA 5ALZA 3T0GA 2KX7A 1GPDG 5FWNA 1VE7A 1HETA 1YCHA 5ICGA 2D7JA 3FTCA 3G6WA 4HX2A 4B6FA 4UFPA 2E7ZA 3HXKA 5H82A 4G5SA 5AVTA 3LY8A 3NGMA 4JL5A 2OYRA 2V7UA 2DG2A 3GRYA 3A4LA 1G66A 4B09A 3CEAA 1IQRA 2R751 1KXZA 1CHDA 4F6RA 3ME5A 3FFWA 3RC3A 2FSSA 4B3DA 3BWEA 4YAWA 3WZLA 5KTSA 1I1OA 1O3YA 1XLVA 4S2UA 3OQBA 1DTWA 1PFKA 1YE3A 4PYOA 1L4HA 4YRFA 1QFYA 2ORVA 3W77A 4CDGA 5AW7A 5IFKA 3AO0B 3D8BA 1S1MA 3JATA 2HRDA 1Z7BA 4JBNA 5JCJD 3RSLA 3HGMA 4G3XA 4YDHB 3X1ZA 1YU9A 3I1IA 4GGPA 4RK5A 1SBCA 2EKLA 2JPDA 1I2MA 1LC3A 1FEZA 1EAMA 1KEUA 2FSFA 3KOOA 1N8SA 3H3JA 2X4LA 4IQGA 1EEXB 3OFVA 4OQZA 2NQ8A 1T29A 4IDNA 4TYMA 4UOQA 4X1YA 4BMZA 1NXQA 3G1WA 2VDLB 3PD7A 1ZL2A 4Q93A 1PEDA 3V4PB 1KIAA 2ZXFA 1JSCA 1PNVA 4FCWA 2OCBA 1HMPA 4UU0A 5AR1A 2C4NA 4X63A 2JIDA 1SXQA 1XHEA 3G0BA 2GNOA 3NHFA 1ES9A 2L19A 3NHMA 3ZCTA 1S6YA 3LCCA 5I4BA 3UMMA 2F8MA 3O47A 4TV9F 3Q98A 1SJ9A 4OHFA 4NMWA 3BL6A 4Q9HA 1RPJA 2EKDA 4BN5A 1QWSA 3C41J 4FBMA 5TF0A 1SCJA 2RGYA 1M73E 1TZJA 1QV7A 1ZMRA 4FBGA 4M1ZA 3ZDZB 2BM1A 2VYNA 4DWOA 1V4NA 4E88A 3V8RA 1QMGA 4TKZA 2QX7A 1ZHHA 1EUCB 1CY0A 2VDWA 3EPRA 3H9GA 4MRNA 4X44A 2R4TA 3IUEA 3V80A 3L84A 2BYTA 2BFEB 5B1SA 5DGIA 4I5FA 2E1PA 3C4JA 2NUTB 4FYIA 2C3OA 2HA6A 4W63A 1TTPB 4AS1A 2ODAA 2ZSDA 1GHTA 1LSSA 3ADPA 2CJWB 1PNOA 3KHTA 5IUJC 1NVVR 4GC5A 4MV7A 3L0BA 1AUXA 2I7CA 3MRTA 4QG7A 1AV7A 4P86A 2ARKA 4BC1A 4BB6A 4S12A 1DEAA 3IEIA 4NIMA 5COBA 2XYHA 2HHAA 1FTGA 4PSDA 1G41A 2ZRGA 1C41A 3F90A 1SCBA 3I9LA 1X86B 4ZI3A 4MWTA 2JANA 4PQYA 3R5JA 1MCZA 4LK2A 3E61A 1ZJYA 1JPUA 3F1LA 1QCZA 3K9LA 3IKMB 3C85A 3HUFA 3DMHA 2IHVA 3QG1A 1XZKA 4E14A 4B3SB 1DG1G 3E3OA 4FW9A 2DLDA 2IXDA 2QSZA 3Q15C 4LW8A 4LSMA 4QNMA 2HWWA 4WLVA 1Z26A 2ZTUA 2R1VA 4MVJD 3RYHA 5J2UF 2ZRIA 3VAZA 4Q4JB 1QDLB 4G85A 1HYEA 3EODA 1GAWA 3BSFA 5LZ7A 3EVDA 4DMRA 3VJRA 2F4VB 1YRQA 1GN8A 4GBMA 4B9AA 1LBTA 1UKVY 4EB6A 3L7BA 4I9GA 3RJZA 4UEJA 4DLXA 2VHJA 3AY3A 1OV6A 1YBVA 4R2IA 5IT9A 2R8BA 1RLTA 3I9V1 1JEYA 4ZOQI 4E30A 1YB5A 5KVCA 4H77A 1QFJA 4BV2A 1VQ1A 3NWJA 3WJ1A 1T5TA 3BGWA 1OI7A 2BHSA 2GGSA 2M32A 3PUVA 1GGFA 4FYJA 3HN7A 4QRDA 4WVFA 4CM7A 4B85A 4TRNA 3L82B 2FFQA 2YIVX 3GJYA 5EJEA 1IPHA 1XOIA 3MM4A 3M1LA 3HYCA 4GXRA 1NFFA 4KAFA 2P7IA 4EAQA 3CF4G 1CIPA 2ZGVA 3CUVA 2G83A 2EGHA 4J7CA 4OYYA 2W2PA 3U40A 1XZFA 2IE8A 3L3BA 5JAIA 3U5TA 1QTQA 1G6OA 2V7VA 5MDHA 2Y77A 2GLTA 1Z6XA 2AN5A 4CR6A 2P0EA 2WIBA 3MWGA 5BSUA 2CDAA 4K2AA 2OXTA 4ZT2A 5TEVA 4HH1A 1C7JA 3P26A 2LKCA 2PKWA 3FR8A 2EVWX 4ENSA 1YDMA 2CGEA 5FBRB 4POOA 2VWPA 3VSAA 4HYYA 1ODIA 2W2QA 4IL5A 1K3FA 2Q50A 1L8AA 3GLHE 3U9TA 3ZYZA 3W9YA 1ESNA 3FZEA 4PXSA 2QV7A 4YHHB 4NE7A 2P9BA 1KRXA 4K03A 2PZEA 2C29D 3UMRA 8ATCA 2VP4A 2VPZA 3HY4A 2P5TB 2EG5A 3SXJA 4LYEA 1PG5A 2CWWA 2G80A 1MX5A 2C9DA 2H5EA 1Q1QA 2ZR0A 3W2EA 5FI5A 5FUMA 2XUFA 2JKZA 4JBWA 1NNI1 1VXRA 1YZVA 2HCTA 3DEKA 1C4WA 1NSFA 3I2FA 4GSLA 4L72A 4A03A 4GZLA 1YA4A 1R37A 5ADWA 4JOQA 3BFVA 4E5SA 3JAKA 3U4HA 1P4AA 3GP5A 4MP3A 1OWMA 1U99A 4QE3A 4ES6A 1R3UA 1RQ7A 3F46A 1IJKA 4NV0A 3T1NA 1RM5A 3OTWA 3W4KA 2XVAA 2GVZC 2JD0A 2Q1WA 3EWSA 1W44A 3L4BA 5CA0F 5CFRA 2GA8A 3M9XA 1I0ZA 3LGSA 4HY3A 1I4WA 3WGZA 4PX5A 4LFCB 3L4BC 2QTHA 2R86A 3INTA 2IH4A 1RYDA 1U28A 2J3DA 3DKPA 3E3AA 3L1UA 4QO7A 3AESA 2COKA 3UATA 5IXYA 4Q7MB 5CHEA 3T9EA 1U28C 3AF2A 4NZMA 2WE8A 3GMDA 1Q1AA 1RKUA 2B99A 2BEUB 4KLZA 2P3OA 4MHOA 3ROQA 2BGWA 1ZONA 2OXIA 5HYVA 3I9MA 1UPUA 1LW7A 1QVZA 1T34A 1ORRA 2LRHA 4GQAA 3TXAA 4Q66C 4EHHA 1N2BA 1T9ZA 3T7SA 5IYZF 4E4YA 3TJRA 4M8SA 2B34A 5H81A 4GUAA 1FUUA 1CR0A 2PKCA 2K7FA 3VC7A 3ER9A 4ACBA 2C2MA 1D1SA 3DVAB 1L6RA 3HCNA 4WINA 3S40A 5AM3A 1ABFA 1N8NA 2O8VA 4CLXA 2C0QA 3JD4A 2FWMX 2C8LA 3USES 4D92A 3RFFA 2WE7A 3UMBA 2G08A 2CLHB 1M8KA 1HTTA 1Z7EA 3EC7A 4M8NE 3ZUPA 2HNAA 2BEWB 4KDEA 1EVJA 2FPPB 4OFZA 3TSYA 2F64A 4F04A 2O8CA 3C43A 2Z6AA 1OKKD 5JSYA 1KS2A 1XCPA 3UXHA 4YRGA 4WMLA 5EJAA 1B6SA 3I72A 3B2NA 3RUAA 3M6VA 1IY2A 4FE3A 4YA6A 1ZYUA 3T9FA 5CB6A 1MIHA 3KQQA 1VHJA 2SICE 3MXOA 3DFFA 1VG0B 3GP3A 2PWBA 3HVIA 4AN4A 4DQDA 3QVTA 1CEEA 2EIXA 1C7RA 2X42A 4WXPA 1C9YA 4D9NA 5JIBA 1KMMA 2ZVDA 3FWZA 2BH9A 3M4YA 4MKIA 1KEEA 1QAQA 3B82A 1A76A 3G6KA 3OCCA 2OAQ1 1YJAA 2PD6A 3A4MA 2B5WA 4FEAA 5FUVA 3UEOA 4ITVA 2EF0A 1E32A 4JXKA 3OEYA 5DF1A 5DEOA 1EE1A 1RVDA 1YOVB 3WMXA 3ZHXA 1EBUA 4MA5A 4A6XA 3FPFA 1Z0AA 3KYCA 2V9ZA 1CQXA 4LJ9A 1XTQA 3BTOA 4YN3A 4EKNB 5A5FA 5FUYA 4MWGA 4EP1A 2XUOA 1D9ZA 3N76A 3VR4D 4MVJM 1GUAA 3GJZA 1EWQA 1P5RA 4KFTA 5EWMB 3PNMA 2SKEA 1W2GA 3P0HA 1AGXA 2YMPA 1CUAA 1H0RA 1I2BA 4OYLA 5AVYA 1E0AA 3R3WA 2H57A 7ABPA 1XWFA 2IYXA 5ARDA 3LUPA 4PM4A 1IM5A 4BX2A 4PBRA 3LWZA 5AVOA 1ZNZA 2BH2A 3QKRB 1CPYA 1KJWA 1Y6FA 1VJGA 4AY4A 4KRGA 4NYMR 1R6BX 3BILA 3K4PA 2IK8A 4KPUA 2QRQA 1N5KA 2ZITA 3KKPA 4FZRA 3KQNA 1RXCA 3DPUA 1BU8A 4W6ZA 3W90A 1HE2A 4FKMA 1R0YA 3FUVA 2DYKA 1N4DA 4PQGA 5DBFA 1UQRA 1PV2A 1VPLA 1CUBA 1MQSA 3FKQA 2BPOA 3HUDA 1U3WA 1OY1A 3BFPA 5JLAA 2W98A 1M8PA 3CM0A 4BP1A 2BR4A 1GNVA 4N40A 5AXAA 4F4CA 2W83A 3BJEA 4PO8A 4GOXA 4EYSA 1W25A 3WGYA 4RGQA 1QH1B 3L0PA 4TWAA 4Q9JA 1DKRA 1JHVA 3LNCA 4UASA 1LNSA 5C5IA 1U0FA 2Q4OA 4YMLA 1JTFA 1ZM3A 3IJPA 5LMZA 5E6RA 5DN6A 3WDMA 2CV2A 3VO9A 1CP2A 3T3DA 1HDXA 1DX9A 5L6MB 2C54A 4QECA 1OUMA 4I8XA 5KYYA 1BO6A 1K8XB 3DB2A 1IN6A 2QSJA 1A9PA 4KAJA 4XD7A 1YDGA 3E05A 1ENZA 1PJ3A 1YULA 3KC2A 4XM0A 1JW9B 2PLAA 2D06A 5A9SA 1WXXA 4PFSA 5LQJA 4FK8A 2PGOA 1P18A 1N2IA 4O2AA 4MGHA 1KDTA 1KJZA 4F1KA 3T5TA 2J9FA 1JHZA 2BFAA 3R6WA 3GT0A 3MRXA 3WGKA 4ZI7B 1WTAA 4D0NA 2NZWA 2WJYA 2X58A 3LDAA 3EVAA 3PEUA 4ZXFA 3OHPA 3EJWA 3NIFB 4LHVA 3O1IC 3NEYA 4JITA 1YQGA 3L6EA 3TMKA 1A95A 4OQNA 1ISJA 1U0HC 1U90A 4DZRA 5IWAB 2EW2A 3OFSA 1YZKA 2JJ1D 3E9QA 1C29B 2VQ3A 2E18A 1QGAA 1C1DB 1V37A 4GQIA 4TS4A 3N39C 3COSA 4TXNA 4CI9A 1NW7A 2E5FA 3ZGOA 3TE6A 2QMYA 3SM3A 4DLUA 3KZ1E 1IBCA 3FPEA 5D6NA 4YJGA 2QGZA 4P83A 5A03A 2BMFA 3CY6A 4YP7A 4UM9D 3UHOA 1E92A 2PJUA 4R2MA 4IYJA 2PPLA 1N25A 4UULA 1LRKA 4DLNA 5BV0A 2DERA 4KXMA 2NQTA 3EXHB 4MVWA 3HFRA 4M9CA 3W5AA 3A6DA 5EJ5A 4LF4B 4HLQB 2NO4A 4BUJA 4R71A 1E6KA 1N5RA 3AONB 1E6WA 1UL1X 4PLGA 4TS9A 4AMVA 1SKUA 4Y9RA 3CNQS 3PF8A 2QGNA 4P3NA 3ICVA 4LAFA 3ZZMA 2CXHA 2V7XA 4AZWA 5K3DA 2DEUA 4H0NA 5KHOC 1GGMA 4O6VA 1FOEB 4WOPA 3ONVA 2YQ4A 1T3HA 1PQYA 3CUUA 2AFVA 1GYRA 3K05A 2HL6A 4ID9A 4KDRA 4U7FA 5BMOA 4KP7A 1VI5A 4WKCA 2HPVA 2E4WA 4IJUA 2IH2A 1T4GA 2ZLBA 4G1UC 2A0FA 1XA4A 3M3PA 4R1SA 4BVAA 5DK6A 1K0FA 4RIIA 4DREA 3ZK8A 5HKBA 3DWGA 2FRXA 4PVDA 3B8EA 3ESRA 3FOWA 4FR2A 5DCWA 3PI7A 2WFAA 4JT2A 1F2UA 1NQUA 2CKDA 1WO8A 1WDWB 3KOXA 4A16A 1RWOA 1UOQA 2ZJ0A 2ZJ6A 4AQDA 1PHPA 3CSSA 3PHIA 2JJ2A 3EDMA 2GDJA 4KXQA 5IAEA 3WYBA 4TMZA 4J0QA 5DEIA 4BPBA