2QP4A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
279
Chain Sequence
b'SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNWKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 279
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp4A00
4JT4A 4OJQA 3UG7A 2A9KA 2G1JA 2QA5A 1XXHA 2E9SA 3DMNA 3FMFA 3QNUA 4ZPXA 2IK8A 4PX9A 2VP2A 4MGZR 1OKKD 2NZ8A 2CE2X 4Q9HA 3DHWC 2IXGA 1AM4D 3PEYA 1IXRC 1E1RA 1US8A 2HT6A 2ZR0A 2X1VA 2PLFA 3SU8A 5JHGB 1E2PA 4PPGA 1DG1G 2PMKA 3QOFA 1V5WA 3U3MA 4CYMA 4Y0VA 1CRPA 2WWXA 2J59A 3C5HA 4CEIA 1RE0A 2ZE6A 5TY0A 2ZI4A 1YZLA 4B73A 3T35A 2AK3A 4Q4LA 1FQJA 3QKRB 5GJCA 3A37A 4I1SA 3VU9A 1E0KA 4B3XA 3T1TA 3LW8A 1HURA 2QRNA 1LS6A 2A5YB 4LY6A 2QM7A 3C8UA 3UPUA 3R8FA 2OUKA 2CL7X 4P3YA 2AHOA 5DHFA 1LFDB 5IF9A 1JQJC 3P20A 1RRFA 1T5IA 5C4MA 2GILA 3ZVLA 3WHLA 2I3BA 2NO9A 2MMCA 1WQ1R 1IJFA 5AR1A 2B8TA 4YLGA 1OB5A 3OZXA 4TTRA 4R9UC 1GRQA 2VHJA 5HZKA 4WBSA 4PHFA 3IHWA 1SXJA 1AJEA 4AG5A 1SULA 2Q9AA 4R98A 4YMSA 2IC5A 4WVFA 4JMPA 2FV8A 5DSZA 2QM8A 3CKLA 1LS1A 1KKMA 2ZREA 2QMEA 1A2BA 1G3MA 2BWJA 4WZ6A 1CR4A 2B8WA 3GJ7A 3BH7A 5JRJA 3AF3A 1Z6XA 2ZRFA 1DELA 1G16A 3CR7A 3ZJYA 3A58B 1E1RD 3QEJA 1QRAA 2ZR7A 2ZYTX 2VHQA 2QMHA 3K0CA 4U02A 4QHTA 1K5GA 3TW8B 2RH5A 1II9A 1PZNA 4L9WA 4NYJR 2PBRA 1G4UR 3BRWD 1OFUX 3MWYW 4DB2A 5AUOB 4DUGA 4RZ3A 4I1VA 5DH9A 2VYFA 4ILEA 1RPZA 5FTNA 3REGA 3CO5A 3FWYA 2CDNA 4KFTA 4LUCA 2VSOA 2XNSA 2F1RA 4JVSB 1P9NA 4QGAA 5TXGA 5P21A 4DLTA 4WAUA 1UBEA 3JZAA 2QORA 4MRPA 4TWZA 2BBSA 5FUWA 4AYTA 2X77A 3AVYA 1G3RA 3LXXA 1GNPA 1N6HA 5DISB 3KTAA 5E4FA 2GEUA 3L0PA 4P31A 4C2TA 4TL9A 1R5NA 3GPLA 2LKDA 4HUQB 2EYQA 3IBYA 5FUYA 4ZCIA 4CDGA 5FTKA 1GG2A 1DAGA 1XEWX 3OE7A 2XZOA 2H1LA 1WXQA 2HUPA 1IJEA 1E2HA 4PO1A 5JFGA 3EIQA 4LHWA 1XFAA 4FW9A 3D31A 3NBZC 4DLWA 2MSDB 1TUIA 4TQAA 2VRWA 1GDDA 3VR6A 1UKVY 2JEOA 2NIPA 3LVQE 4MDFA 2R6DA 4L15A 4IOJA 4MA4A 1P7CA 2O8CB 4IOLA 3IUYA 2CJWA 4B33A 1KJYA 3U60B 1T3SA 5B2ZA 2I1VB 4IVPA 4EQ6A 3GJ6A 2RGNC 2Q9CA 3B2EA 2HYDA 3AP3A 3ZD6A 3TUIC 4IDPA 2QE7D 1GZSA 4KBGA 2H16A 1VIAA 2JIZD 2VP5A 1SVSA 3NIBA 4I1UA 1MABA 5FOSA 3IIMA 2RHMA 2ODWA 2ZE8A 5G3YA 2DFLA 2Z5FA 3SN6A 2NO0A 4W7SA 5CJ2A 1US8B 2F1IA 2CBZA 4HYYA 4RFVA 3CW2A 4LHXA 5KDLA 1E6CA 1E9SA 2GVZC 3C16C 3TMKA 4A0RA 1FL9A 1XTQA 1QHHB 2B21A 2J5XA 2QPOA 3W6OA 4CEIB 2F3TA 5LB4A 4B35A 1KK0A 1Q57A 3PXGA 2P65A 3NKVA 4HUTA 5FR1A 5HPYB 1T8TA 2IYSA 1YVDA 3VHXA 2DHRA 5DNYB 5JCPA 1N5IA 3CX8A 1Y63A 3TVTA 3B1ZA 5CIWA 5CK5A 4F7WA 2GZAA 2J45A 1IXSB 1A7JA 1KSJA 1P3JA 3OE7D 4CEHA 3DVLA 3K09A 1XPUA 4GMDA 1Y3AA 3QF7A 1ESMA 4F4JA 2QAJA 4QXAA 3DM5A 2Q3FA 2BEJA 5EP2A 4S2EA 1OIXA 4EJSB 5GVSA 3FE2A 1XTRA 3I61A 4R71A 4EPYA 4Q66C 4TT3A 2ZJ2A 4IRUB 2IYXA 1MV5A 3I8SA 3FB4A 4RD0A 4QKQA 3TW4A 2QMOA 2H57A 3B60A 4ACBA 2DR3A 3ETLA 1SXJB 3K70D 5LDDC 3SYNA 1X6VA 1YZQA 2ODNA 3GLHA 4C0BA 1R0XA 1YKSA 2FH5B 1D5CA 3NH9A 2UKDA 3UWKA 1YHNA 4GDFA 1F60A 1QHYA 1SVWA 2AR7A 1L8QA 3ND8A 3HWSA 3N2IA 4PSKA 3AGQA 3LV8A 1V43A 5HCNA 4C0AC 2RHDA 2C99A 1G6OA 2B7BA 2F3RA 4BLQA 3AM1A 4PC6A 5JWHA 4ZDJA 1VG0B 1T3HA 4MRNA 4AYWA 3UMFA 2CCJA 2CHVA 3A1VA 3KQUA 4RVCA 1AS0A 2ZI5A 3NBXX 5JJLA 2VP9A 3KDSE 3ADBA 3ZLJA 1OXVA 1DAIA 2GF9A 3P32A 3AB3A 1Z0AA 2YOGA 5BWMA 1E0AA 3BOSA 2C96A 3T61A 4ACAA 3EX7C 3KKOA 3QXCA 3KTAB 4C0LA 4IFEA 1ZUHA 2BKUA 1VYUA 4Y0AA 4M4SA 2BCJQ 3W3AA 1NSTA 2YC2C 1GVNB 1KMQA 5JS7A 2ERYA 4LJ9A 1XEXA 1R0ZA 1BO6A 3LNCA 5FPSA 4C9BA 4TYWA 2AXPA 3ASZA 3DPUA 4TT3D 4LBZA 4JVLA 1E2EA 4BFUA 3VMFA 1Z2CA 2YC4C 5C46F 4TL8A 1G9XA 3IHLA 4R2HA 1PVOA 3KKNA 3Q85A 3ZS9A 3QXXA 2QGZA 3LD9A 3W5IA 1W4AA 3GLFA 5CLQA 3IIKA 1NJFA 4H9GA 1NN0A 4KYUA 1Z28A 4IEEA 1KMHA 5B30A 1R10A 4LBWA 2C95A 4ON9A 5J4LA 4Z8YA 1EFUA 1UPTA 1VDZA 2YOFA 4PQYA 2RCNA 4EQ6B 2D06A 3K0FB 4UQOA 3I5YA 4AD8A 2KWIA 2X19A 2C9YA 2XOKA 3I73A 2CLDX 4AG6A 1W4BA 2AK2A 3GLIA 2LCFA 4QBHA 4JS0A 5LBIA 2O5VA 1CF4A 1G3UA 2G77B 1E32A 5HE8A 1E9FA 2B6HA 4OI0A 1SHKA 1AN0A 1P5ZB 2V55B 4EAQA 3PEVA 3T1QA 3W5JA 1UKYA 2F9MA 1S1MA 1U94A 2P5TB 2JLVA 5GJWC 1TU4A 3GEHA 4HSEA 3DZDA 2D2EA 4DEYA 1II8A 5EXPA 4BFTA 2QG6A 2XXAA 1Z47A 3PUXA 4V02A 1IN5A 1N6OA 1P2UA 2WWGA 3F0TA 3MJRA 4KHZA 4A2WA 3BD9A 2OV2A 3KX2A 3RABA 2G9NA 4HLCA 3EARA 2ZEJA 3PENA 4FINA 4KLNA 4UKDA 4DB4A 4BLOA 1D9ZA 4PTLA 2J9RA 1P2SA 3Q8XB 2HXSA 4F91B 1LV7A 4OI4A 2QP4A 3DOEA 4M1OA 1XX6A 5CK4A 3SOPA 5HCIA 1FUKA 1R5OA 2AFHE 4TYQA 4HAZA 5J4KA 4QHSA 3L0OA 5KPJA 1FMLA 2RGEA 3RANA 3QPUA 1HH4A 3K70C 1LNZA 3KFVA 1XD9A 3L43A 1C9KA 1SHZA 3A4MA 4E07A 3VNUA 1NRJB 1EFRD 2ZJAA 2VF8A 4CZ2A 4QGGA 4EPXA 4DDVA 3NVAA 4LWZA 3BFVA 2HV8A 3AKCA 4M9XA 3GLHB 1I4LD 3EZFA 4RJLA 4LGMA 2VP0A 4UXJA 4URXR 1MKYA 3GLGA 1GNRA 2XOKD 4JBWA 4MKHA 4F4IA 2GXQA 1KI3A 4B34A 3PVSA 1S2MA 2VSFA 3BIFA 4Q9JA 2HF8A 2ZRDA 1RJ9B 2ZI3A 2ONKA 1KKLA 5BXQC 1AK2A 3RSOA 3H4MA 5EP1A 1NMXA 2FSIA 1ZU4A 2W0SA 4LK2A 1VECA 5KNBA 5DI3A 1Z29A 2BDTA 5E3HA 1DVRA 1U99A 4P0TA 4TLCA 4AKHA 4L4UA 2W58A 4O2LA 1AZSC 1CR2A 3KQLA 2JDID 4FCWA 3LAWA 1U0HC 3PIRA 3ICQB 1W0KD 3BH6A 2OBMA 1AS2A 1YZTA 1Q1BA 3K09C 4TYNA 4NCHA 3K1JA 1F3OA 1Z5ZA 2QAGA 1T91A 4DRZA 1ZC4A 1ZJ6A 2V6JA 2YZ2A 5FI1B 1W36C 1NLZA 2OBNA 2FA9A 1PJRA 1I2MA 3CH5A 2RKOA 2RGGA 3JVUA 1S9DA 4HB2A 2GEVA 3C7KA 4DSUA 4PPQA 4YMVA 2H8KA 1HYQA 2J1LA 2YWHA 3FHOA 1S9HA 3O8BA 1P61B 3L0SA 1TQ2A 4D25A 4BFYA 1OFHA 1NI3A 1P9RA 2KSQA 4GPTA 2WPDD 3THOA 2NPIA 1IONA 2NO1A 1L2TA 3VKWA 4EUNA 3REFA 4BECA 2ZRKA 2NQ2C 4ASUA 1CBUA 4YMWA 1EFHA 3EWSA 1KMHB 4GOJA 2ZAMA 2QPTA 2PX0A 3IPXA 1YZUA 4ERNA 2WAYA 1TNDA 4IFBA 1W44A 1EK0A 2NGRA 3AVVA 2IUTA 5CDFA 1SGWA 2ZUCA 1DBSA 4HDOB 2IEZA 3SI7A 2RGCA 4BZQA 5EZ5A 3D3QA 3EA0A 1JR3E 4OQFA 6Q21A 3K9LA 2ZS8A 2IEYA 1XB2A 5CM9C 3PUZA 2VBCA 2E87A 4W5WA 5EE3A 4QJ5A 2VHCA 3QKSB 3B82A 4BUJA 4KAXA 4NYJQ 1Z6AA 1UAAA 2IS4A 5ELXA 1U90A 2DFKB 4W5HA 5AUPB 4YMTA 2X2FA 1COWA 4HZUA 1DO0A 2XJ9A 3B13B 2NZJA 2DB3A 1OXXK 2VQSA 1QBKC 1X1RA 2OFWA 3L82B 5JLJA 1FW6A 1VHTA 4D4LA 2H5EA 3LW7A 4XTCS 5CJPA 2DY1A 2OESA 3QG1A 2AFIE 1HE8B 1W7AA 5HZHA 3LBIA 4US0R 3KQKA 1FP6A 1XD2B 3IQWA 3ADDA 2GZDA 3K0EA 1X3SA 2B92A 3E2IA 2WIBA 1CRQA 421PA 1JPJA 3NEJA 5TDHA 5FR2A 4ASUD 4BLSA 5LD2B 2IT1A 4PHGA 2ORVA 1A5TA 2ZR9A 1JALA 4NU0A 3CWZA 1ZC3A 3TSWA 3VR4A 1YR9A 4B71A 4N3NA 3DM9B 2BMFA 4C0KA 2OAP1 3KZ1E 5E95A 1UF9A 4A0FA 3GLGB 1JJ7A 2ZI7A 1TEXA 4B75A 2J0UB 2VH5R 2VL7A 2QT0A 4HATA 4HLUC 1IBRA 5HTKA 4NONA 3R7WB 4DCNA 4DBLC 2ZRIA 1YQTA 3QJYA 3WNCA 1OT3A 2ZETA 2WJVA 1II0A 5D3MB 5UKDA 3SBDA 3ADCA 4G5QA 4BQSA 3FHCB 3BXZA 3HR7A 4AWXA 5FTMA 1E2FA 4BRWA 4NL4H 1U98A 1COWD 4BEJA 1S4QA 3SBEA 4ZI2A 1T3LA 5J4YA 3THWA 3MLEA 2REBA 4LHYA 1M8PA 4CT4B 5C4GB 3HU3A 3KJEA 4DCTA 1R4AA 2C9CA 2A5FA 3RS3A 2PZFA 5A4JA 2HCBA 3HYTA 5FL3A 2Z43A 3U6KA 4C0JA 2XZLA 1KI9A 1G8HA 1ZD1A 2YWEA 2EFHB 2EFGA 1G41A 3PEWA 3WHKA 1P9WA 1FFHA 1KI8A 5F9HA 3K0AA 1F6BA 2ZI9A 3WYAA 3KQNA 4YONB 1TUEA 1G8YA 1NVWQ 5K8LA 4F38A 3B9PA 4M1YA 2ZU0C 4JLBA 2QTHA 2KBEA 3QVUA 2JJ2D 4MYHA 1UEIA 3UG6A 3FGNA 3NDBB 4A8JB 3RRZA 1T5LA 1KNXA 3K8YA 2RGNA 1JAHA 2P5SA 2GWHA 3BB3A 2P2LA 3O47A 2FJUA 3CM0A 3L8YA 1W2HA 3B5JA 4Q4JA 4TL7A 2Q0HA 3P27A 4JLOA 2ZE7A 1NBME 2QUZA 2WM9B 1X8JA 4LBVA 4FMDF 1W2GA 1Z8FA 2YJTD 3TH5A 4M1KA 4GRAA 4D4KA 4PC2A 5J4HA 1E2JA 4Q1DA 1P2TA 1EGAA 3WBKA 3E5HA 4B3DA 1KI6A 2TMKA 2N46A 2ZRGA 5DYGA 1G3QA 4B2PA 4TMTA 3P4YA 2PJZA 2VEDA 3JZMA 3SHWA 3PEUA 3WNBA 1KJWA 3EIEA 2EQBA 4G0NA 2AWOA 3QE0A 3FMPB 2ATXA 1TAGA 4QG7A 4P4SA 1FX0B 1YR6A 4OI2A 4A4DA 4QM6A 3LRPA 2CE7A 1IN7A 4ESHA 3AH8A 2ORIA 4KSBA 2C2HA 1TF7A 1XU4A 5GADl 4JKYA 3BFKA 1UFQA 2PL3A 1XDBA 2C03A 4DSTA 5JWOA 2PZEA 4GNKA 4XWKA 2WHXA 1ODFA 4FI3C 4BZPA 2EVWX 2QRZA 4PZYA 1E2MA 5AJVB 2OG2A 1F2UA 2ODBA 1W46A 2XEXA 3DEFA 3CLVA 4PC7A 5KUTA 4FWTA 2ANBA 3BERA 3O8RA 4TTQA 3VFDA 1AS3A 2X8AA 4EIWA 4OKSA 4WIAA 2GCOA 1Z0IA 3SEAA 1QG2A 4TMWA 1VCMA 4HB4A 3T1OA 1DO2A 2ZRJA 1CTQA 1E3MA 2D4HA 3TAHA 3QSYA 4AC9A 1KI1A 3EPHA 2J0VA 3AVOA 1KO5A 2Z0MA 1GM5A 1QZXA 2OEPA 2GJAA 3DOFA 2GKSA 4EFLA 1HT1E 5CB8A 2F43B 4Q18A 1MH1A 1UDWA 4Q1CA 4RD1A 521PA 5JJIA 4CRWB 4URWR 3B7GA 3U44A 1M34E 2K5UA 1NVVR 3CRQA 4LJ8A 1F48A 1IY2A 2CEAA 1NY5A 3I4LA 4V0OA 4Q19A 3THWB 4ZIRA 2ATVA 4GP6A 5EE5B 1X8LA 1SVKA 1TU3A 3FKQA 4NCJA 4XSHA 5EP4A 1NLYA 3B6EA 3IDQA 4XVRA 3AUXA 2YHSA 4DWJA 4US1R 1R5BA 1LF5A 4D2IA 5D3QA 3RVBA 1Z63A 4KO8A 5CYPA 5M04A 4KFRA 2GJ9A 4TTPA 1KI7A 2FX3A 4JIMA 5EXXA 2W00A 4CEJA 4AURA 1ZM7A 4MH0R 4B3FX 3A6PC 4OHYA 4PSAA 4LI0A 5IK2D 4PFSA 3S1AB 4BFWA 2IX3A 4NHOA 1AZTA 2P67A 2JLXA 1NP6A 1W49A 2V1UA 1PUJA 2BHRA 1Z6YA 2BCGY 2XITA 4V0ME 1G7CA 2ZJYA 2V1XA 3QQ5A 3OIVA 4Z51A 5EP3A 1JEEA 1ZW6A 4XVUA 1G7RA 2QE7A 2KJQA 3U2QA 3W8RA 2JIZA 2BC9A 2XTMA 3EZ9A 2Q9BA 1XZQA 4MRSA 2PT7A 4URYR 3E1SA 3I72A 3WMGA 1LY1A 1M7BA 4MYUA 3X1DA 2CCGA 2FF7A 3BK7A 2ZU6A 4LYFA 2WBLC 2UZ3A 1EWQA 4GSYA 1WA5A 3PITA 1K5DA 4D82A 4O25A 4YQFA 3NXSA 3TK1A 1P75A 2FG5A 5FTLA 2R6GA 4FMDB 1ZVQA 3OEEA 2FDCA 2ZPTX 2OCYC 1EX6A 1GL9B 5FBRB 4GZMA 2D74A 1FTNA 2CVHA 4DKXA 2ZI6A 3TVDA 4DCUA 5KTYA 1R6BX 4Q4AA 1VKJA 3FVQA 4G01B 5JS8A 2VP4A 4Q1AA 1OH6A 3C5CA 3RDPA 5C1BA 1QHNA 3K53A 1LF0A 3DO6A 2FGJA 2RMKA 2IYYA 2J41A 4M1SA 5DI9A 1OYWA 1M7HA 4MUAA 4NYIR 2OAQ1 3TLXA 4LSGA 3SQXA 3MRSA 2XX3A 4V03A 1SQ5A 1NL3A 2F7SA 4QL3A 5JWRA 5KNCA 1XXHB 1NMZA 2IBMA 4LYAA 1GP2A 1IN8A 1DS6A 4TQUS 3RRYA 4BFXA 4F92B 4LV8B 3Q5DA 4DXAA 1GL6A 1XBTA 5FBWB 1KZGB 5KHOC 1XF9A 1U0LA 1GOTA 2R6CA 1T0JB 3X2SA 4GMXA 2VA8A 1XCPA 2ZYVX 1MO3A 2HEIA 2GCOB 4B3CA 1F5NA 1DE0A 4O0MA 1P72A 1WRBA 1GRRA 5FPHA 1Z83A 1DARA 4LJ5A 5AJYA 5DHAA 2BV3A 2V8OA 4L9SA 5IRCD 1D2EA 5AUQA 1A1VA 1O87A 3QKUA 3VU9B 3EA5A 3OEED 2H7VA 3T5GA 3IEUA 4RKEA 4RCYA 3D7MA 4F93B 1KIMA 2QT1A 2IYRA 1E2IA 1ZIOA 2OCBA 3F5FA 3OFNA 2WKRA 3LDAA 5EQTA 1TQDA 3SS8A 2GTPA 3VR3A 2ZVPX 3SHFA 1JPNA 4A15A 1XWIA 4FIDA 1KI4A 2CMKA 1ESNA 3A4LA 4ZIRB 2OE2A 4M9SA 3RLFA 4E22A 1E2GA 1E1QA 3IO3A 1KDRA 3KKMA 4NYMR 4TMKA 4EPTA 1CP2A 4GZLA 5G41A 1W1WA 1P73A 1XD8A 4PSVA 3MAAC 5DIFA 1E4YA 2A2ZA 2FPKA 3EWAA 2HT1A 4BLRA 3L0IB 3SFZA 5CB6A 1DAEA 5E7MA 2EW1A 1OH8A 2N42A 4M8NE 1QHGA 1N6KA 2ZROA 3MCAA 4UNRA 3A1UA 2ZSBA 4HB0A 2WOJA 5E7IA 3VAAA 1H8HD 4RZUA 2G0NA 2EYUA 4G5OA 4MKIA 2VIIA 3NTUA 4LPKA 1JR3D 2QP9X 4N0EA 3KUDA 3W9YA 4BFZA 2FFBA 4D81A 4PPFA 4D0GA 3GJ3A 5KDOA 3D6TB 3THXA 1G5RA 3BE4A 5GVRA 2WJIA 3K0SA 4WXPA 3GFPA 1B23P 2R44A 1XMIA 1E98A 4MGIR 1S1CA 4ITRC 1OFIA 4HDCA 4JLNA 3U61B 1OE0A 2RGBA 3KL4A 4FD2A 1GKUB 4RY2A 1BYIA 4GOKA 1CS4C 3EC1A 3R8CA 4L8GA 3AVQA 4YC7A 4B3GA 5GJBA 2WICA 3SYKA 1E9DA 2Q6TA 2CK3A 2W2VA 4QNMA 4BEBA 3IIJA 1OFTA 3OFND 1BMFA 3CZQA 1GAJA 2D2FA 2CL6X 4OQXA 1Z0DA 4XOIA 3PJRA 4AKEA 2JAQA 2CVFA 3KKQA 2A5JA 5B64A 1G8GA 1FNNA 1OJLA 2JASA 5TARA 4D26A 1W36D 3NC1C 4XD7A 2GXUA 3GFTA 4OQNA 1N0VC 3NDPA 1ZD8A 3T15A 1E1QD 5JRZA 1I4DD 4Q9LA 3AEZA 1L4YA 821PA 1N3BA 3OEHD 4IDQA 2CXXA 4Z54A 3AV0B 1E9BA 1G3IA 3U7EB 2HF9A 2QEQA 4OQMA 5B57C 5LPNA 2PJRA 1XJCA 1N25A 5H68A 2FFQA 5K8UA 4DLVA 1IOZA 1E9EA 3UMSA 4P32A 2ANCA 4UNQA 2J7PA 3FMOB 5L8VA 4EJSC 2YV5A 1KSGA 1DTSA 3X1WA 4M2LA 3RYTC 3KB2A 4DLRA 2FOLA 2IWHA 3ZIAD 1EFRA 2CJWB 4URUR 2P6NA 3CRVA 4URVR 3K70B 5F9FA 2P3SA 1HE1C 3WYGA 4ZI3A 4U5XA 4LBYA 1XCGB 4XTRA 4BFSA 4A0HA 3SFVA 3MGCA 3LO5A 4POAA 4RFSA 2VLIA 1NBMA 4BPBA 4H1VA 4UNNA 3WP0A 1MABB 4TMXA 1YRAA 4Q21A 4QFMA 3FKSD 1ZBDA 4Q47A 2QTVB 2GETA 2DWQA 1AGPA 1ZU5A 2F9LA 2FMXA 2KB0A 3C4JA 4OJKA 4RD2A 4UJ3A 1RRCA 4HLUA 3BGWA 2V3CC 2WOOA 1VYVA 4R2IA 2BM0A 3NC0C 4V0NA 1XXHE 2W6JA 3UANA 4RCZA 1MRSA 2CK3D 2BOVA 2WJYA 1ZYUA 1VG9B 2ZSDA 1BMFD 3OESA 1FZQA 1AIPA 4M1TA 1KDOA 1HA3A 4IOMA 2R62A 4FWIB 1A82A 3UK6A 5CIQA 2VHTA 4KVGA 3TR5A 5EJEA 3O8CA 2JDIA 4XD7D 4MUBA 1G7SA 3WRXC 4AY2A 1W0KA 1F2TA 2A7QA 3EXAA 4I81A 5DN6A 3B1WA 3OIYA 3B1YA 1G17A 4QBGB 4LPSA 4B6EA 4CEHB 5KYKA 3PUWA 1TADA 1RYHA 4Q03A 3EPKA 2XSZD 1E9RA 2DYKA 2R65A 2XNDD 1XMVA 1WCV1 2FZLA 3F8TA 5JBQA 1Z08A 3PFIA 1IN6A 3HDTA 2AKAB 1FPMA 4KLZA 5CITA 1UDXA 4O3MA 2AL7A 2J7PD 2PCJA 4K81B 2QL6A 2G88A 2W0MA 1KDTA 1YR8A 3CH4B 5E7JA 1FQKA 1G6HA 3QXJA 3PV0A 5C18A 4IOKA 2D7DA 2WPDA 3Q3JB 4JBXA 4JL6A 1LTQA 3AVTA 4EDHA 1VCIA 1Q1QA 4BZXA 5KSYA 1DAKA 3NG1A 4JL8A 3LX8A 4TQ9A 1E0SA 1NBMD 5J5CA 4BFVA 1FP7A 2OCPA 3IILA 3T34A 1SXJE 2GDJA 3P26A 2IYQA 5KSZA 2IF2A 3THXB 2F1HA 4NCNA 2W6JD 4RD3A 4JLMA 5SZIA 2DWPA 2PH1A 1PV4A 4B74A 1J70A 2ZE5A 3I62A 4LJYA 3CB4A 1XJ0A 1ZD9A 1VIYA 4XH9B 2OFOA 1ZNZA 5AJZA 4DDWA 2NOAA 5L3RA 4Q4HA 621PA 3TUJC 4JLAA 3GJXC 4IDHA 5FL7A 5DN6D 1RYFA 1ZINA 4DZZA 3LBNA 3LFUA 4HLQB 4PZLA 2P0EA 1QF9A 5KOYA 2ZRNA 1C4OA 1LB1B 1XEXB 3T5DA 1NVVQ 4WOPA 2GCNA 4B3BA 2JATA 2P6RA 1Z07A 2EWWA 2WIAA 1VMAA 1D9XA 2BVNA 5JEEA 5JMTA 1SKYB 2YWFA 3LXRA 3QKTA 5EUQB 3MD0A 2ECKA 5JEDA 1M74A 3GJ0A 2IWRA 3VR1A 1ZAKA 1XNJA 3GLFB 2XTZA 1VCNA 2O52A 3ND9A 3I3SR 2J0QA 4A36A 1FOEB 2G83A 1HQYE 3QF4A 4HAUA 4MQBA 2OILA 4DT1A 3TBKA 3J81k 1LVGA 3U4QA 1FTSA 4HB3A 3KFXA 3I92A 2GJ8A 3B1XA 5H1YA 2RGAA 2XJ4A 2GVDC 3UXMA 1N6IA 3RWMB 4H1UA 3ZGXA 1G64A 1KDPA 3GQBA 5G3ZA 1G18A 3TSOA 2YWGA 1XTIA 2WWIA 4TZ6A 1XMJA 2O8DA 4MRVA 4EPWA 1LW7A 3FHTA 3GLIB 3N70A 1IHUA 1IXZA 1VHLA 1IQPA 4DLUA 1B0UA 4KXFB 4C7OA 5L3VA 3I5XA 2QQEA 2FEMA 2Z4RA 2YKGA 2QTFA 1M7GA 1VG1A 1DAMA 1CR1A 2JLYA 3WNDA 3FPAA 2I1QA 5FL7D 4ZV4A 1CKEA 1W0JD 3OHMA 3OIUA 3QG5A 2CHGA 2QBYA 2IS2A 1II8B 1IAQA 1XTJA 4G5RA 2FFAA 4L5BA 2XXAB 3P4XA 1YZGA 3NBYC 1CJUC 2GJKA 1KSFX 4Q1EA 1UEJA 1F2TB 4G3XA 1Q22A 4DVGA 3AKYA 4JSYA 5FUXA 1ZUIA 3PUYA 1X1SA 1Z3IX 3V00A 3WMFA 5GJVC 1N6PA 1C1YA 3C14C 4B47A 2FN4A 1TF2A 3GCGA 3GEIA 4FCVA 2CLCX 4P4TA 1IY1A 1CJKC 1Q12A 1Z6GA 3ZZUA 1AGRA 1GWNA 2GBLC 1GL7A 2JJ2A 4ABYA 3W6NA 1E2LA 5FOUA 3CONA 1ZM9A 4PZZA 2ZS7A 4LYHA 2KE5A 3QPVA 5DLQC 1KO1A 2D7CA 2WSSA 3ICEA 4NYIQ 1CLUA 5EZ6B 2BBOA 2DCUA 4Z8XA 1JQLB 2ZRMA 1OLOA 1KO8A 3O8DA 2ZS9A 3CF2A 221PA 3CRMA 3KB1A 3RSLA 2VTKA 4JT2A 1Q1EA 1G20E 3GLHE 4ZDWA 3ZD7A 4WA7A 4C30A 1VPLA 1NG1A 3TQCA 4D0LB 1SVMA 5DI3B 4WW0A 4KSCA 4DEXA 4DCSA 5H8WA 5FH9A 2A78A 4CT5A 4LJ7A 1KAGA 1SKQA 1Q3TA 2ZITA 5SZHB 4RSGA 2FPLA 4GL2A 5DGXA 2W2TA 1HQCA 3EIHA 1RRGA 2ZQ5A 1S0UA 5J40A 2XTNA 2JLQA 5FUVA 3VKGA 2NO7A 2QAGB 3EZ7A 4JL5A 3UATA 5L3SA 4NZYA 4RD4A 3FTQA 1R0WA 1WDTA 1HUQA 2PMDA 3U3KA 4ZKDA 3QUSA 4JLDA 1U9IC 2IYLD 3SE0A 3ZYCA 121PA 2CNWD 3CZPA 3KXLA 1MOZA 2FWRA 3QY0A 4UXIA 5BYJA 4Q01A 1UKZA 4A92A 1J7KA 2PEZA 3K9HA 3EPJA 1WBBA 3EPLA 1TQ4A 2DFTA 3MUFA 4YMUA 2QMUA 2OLJA 4NYMQ 2P6UA 4OHXA 1GIAA 1G7TA 2WSSD 1P2VA 4XSGA 1HTWA 1SVOA 3QF4B 2ZSEA 4DLSA 4PANA 4TL6A 1OYYA 2OM2A 3CPEA 5A5GA 3ZQ6A 1KGDA 3R9XA 4QRHA 1UADA 1N5JA 2D3WA 2VHUA 3UWOA 3AVXA 1BKDR 4TMZA 2IF0A 3W90A 3GFOA 5AUNB 5LD2C 1MO6A 1M1YE 2OXCA 2O8BA 5B58C 3TR0A 3GLFE 1EXMA 3BB4A 4DLZA 5FPKA 2J0SA 5FTJA 1KOFA 1IM2A 1HV8A 1RW4A 3TE6A 3KJHA 3H84A 4B2LA 2AWNA 1QHIA 2REOA 4PAOA 4PAMA 3TIFA 2ZRHA 1TTTA 3VR5A 4PC3A 3K9NA 4FMBB 2IYVA 3EAQA 3MWLA 4N1AA 3VR2A 3BAFA 4QJ3A 1ANKA 2C78A 3LLUA 1JXOA 2IXFA 1VTKA 3VQTA 4ZKEA 4P4UA 4NKRA 3GLIE 4HZUB 2QBYB 3X1YA 1SVIA 4X8MA 4NCIA 1S96A 5FI0B 1G291 2FEOA 3EW9A 1AKYA 4V0LA 2H92A 2ZIAA 2JLSA 1DEKA 2Q21A 4YXWA 1TEVA 1E2NA 5G40A 3HU2A 2ZRCA 3SC3A 1TF5A 2F1JA 4HUQA 1AA9A 1WP9A 1CR0A 2WAXA 5FFMA 3DKVA 3KKPA 1AQYA 1NY6A 2IYZA 2WZQA 4Z1MD 4JJKA 4HI0E 5KU1A 3B78A 4B2IA 3RC3A 2R6FA 1CIPA 3EASA 3QEOA 1E96A 3WXMA 5IK2A 4AKIA 4M9ZA 4PPNA 4I1OA 3RHFA 1WB9A 5EXTA 1U0JA 4Q7JB 4PAQA 2WKPA 1PLKA 3BFXA 3UKDA 4C0SA 3AVUA 2DWOA 1NKSA 1QDEA 1VYTA 3BC1A 1JECA 2GHIA 2O8CA 2GAAA 2JLUA 4JLJA 4MRRA 2IYTA 4A8JC 1XP8A 3SJBA 1G1MA 4JJZA 2W6IA 2ZAOA 1YR7A 3LWNA 4ESVA 5AWFC 3ZQJA 3CX7A 3VX4A 2VO1A 1E2KA 3KJIA 1UBGA 3KXIA 1T4GA 4IDNA 2IXEA 1U8ZA 3IQXA 3GLGE 3NBFA 4LX0A 4DC9A 5FOXA 4Q02A 1IY0A 2R8RA 2RGXA 2E1RA 4IVQA 4QOSA 1N0UA 2JGNA 4E09A 2AKYA 1OIWA 4ZO4A 2SHKA 1QHHA 4B6FA 4CGZA 1E69A 2DPXA 3NWJA 5CM8B 4AI6A 4XWAA 4PQRA 2GRJA 4JZKA 4ZCMA 2YNMA 2QP3A 4W5JA 3X1XA 4YXWD 1OW3B 3NH6A 1GILA 1XEWY 3W34A 5L3SB 1EFTA 3RS7A 1JAIA 5KSOA 4I4LA 4LJ6A 5FPTA 3U3RA 1NF3A 3TSZA 3R20A 3CRW1 1SVLA 3K0AB 3MSXA 2FZ4A 4LYJA 4C0QC 2JCSA 4LOAA 4Q7KA 3RS0A 4EJSA 1XCMA 2HXYA 4NCKA 2WWWA 2L0XA 3UMRA 1QVAA 4PHHA 2ONJA 2HLDA 4IHQA 3TJZA 3SDZA 4FMCB 3CUEF 4W9MC 1E79A 4IKEA 4Q4JB 1H8EA 1T0HB 2O8FA 2W6ID 1NNEA 4TLAA 2ZRBA 2IUSA 2OCAA 1M6NA 3ECCA 2MSCB 4BE7B 2YOHA 1OB2A 4FCTA 4LHVA 3W8NA 2O8BB 3AF0A 3QBTA 1N0WA 2GESA 1G8FA 1NLFA 3SJAA 1OV4A 4OL0A 1KZ7B 1DOAA 2J46A 4G5GA 3GJ5A 1KI6B 3KXKA 4TN1A 3FFBA 1TX4B 4HEJA 5CDFE 1D2NA 1J8YF 4M22A 1NMYA 2QZ4A 1EG7A 1U81A 3IBGA 1JB1A 3RWOA 1TPZA 1R7RA 3CRRA 1Z06A 4KCGA 3F3YA 2NG1A 5LB2A 4P4SB 4EPRA 4QGFA 4OK5A 1RFLA 2KBFA 4PO9A 1N6RA 2ZM5A 1OH5A 3HPQA 1W4RA 4U00A 1N5LA 1ZM2A 1NKTA 5DYIA 4Q9IA 3M4YA 5TB5A 1W4CA 2ZTSA 1ELOA 1TQ6A 1KTVA 2ZRAA 3VX3A 2ZJ5A 3I1FA 2RB4A 1DAFA 4MDEA 2I4IA 2O0HA 1UBCA 1KHTA 2W2XA 4NPHA 1E99A 2FNAA 2MMGA 4LV6A 2GJSA 5J4VA 3GJ4A 1F2UB 5AK0A 3FYHA 4MKFA 2HLDD 3QXHA 1SXJD 1Z6TA 3U5ZB 3AVPA 3Q5EA 5EE0A 1E79D 1NN1A 2GAOA 1H8HA 3LY5A 4GFDA 1H8ED 4A2QA 4Q9KA 3PR1A 3CF6R 4DHEA 4BWYA 4YDHB 2OHFA 2V54A 5BYKA 1JR3A 1GKYA 1L7VC 3RAPR 5FBQB 1CEEA 3AUYA 4XIGS 2WWFA 4A2PA 2O0JA 2BBTA 2WWYA 4Q1BA 4DCVA 1OXSC 2EU8A 3N2EA 3AVWA 3A1WA 4KI0A 4XVQA 2X2EA 3K0FA 4A82A 1TL7C 5J47A 2CCKA 1K6MA 1J99A 1H65A 2J7KA 4DUGD 3U44B 2O8EA 1BS1A 3AP2A 4QHYA 1L4UA 2FPMA 1A2KC 2QPAA 5H70A 4D6PA 8OHMA 2Z6VA 4US2R 1E2QA 4LHZA 3B1VA 4JLVA 2G1KA 3H86A 5EXSA 2J87A 1ETUA 4I99A 2ZSAA 2VP6A 5AJWA 1FMJA 1S8FA 1MR3F 2V7QA 3MG9A 3WYFA 1YE8A 1OXUA 4E03A 1ZP6A 3EZ6A 4HAXA 4DDTA 1ZNWA 1R8QA 2WMNB 2CHQA 1JEDA 4WZAE 1CXZA 3TQFA 3OEHA 2ZVQX 2AD5A 4IDOA 4QNRA 3SJZA 2A5GA 3AP1A 721PA 2O0KA 3DKPA 3PG5A 1U8YA 4OK3A 2C04A 1ZRHA 4UJ5A 5HR5A 5DE3A 2WV9A 4CEJB 4L16A 4HZIA 3A4NA 3X1ZA 1G4AE 3G5UA 4DSNA 2WVJA 2REXB 4X8OA 3OAAA 3A1SA 3LLMA 4HAYA 5KO2A 4LZZA 4X8HA 1M2OB 4G5SA 5KSPA 2FU5C 3DMDA 1GITA 2GNOA 2UZIR 5IDVA 3RC8A 3ZIAA 1W5SA 1OH7A 4QGHA 2OZEA 1NJGA 3AF2A 4B48A 4TLBA 1JR6A 3BB1A 4Q00A 2NTYC 3CX6A 5JJKA 3TAUA 5TMPA 5EUMA 2O8FB 1JNYA 3FKSA 3PCRB 3T1VA 3HJNA 1XRJA 3CPHA 4Q48A 4MGKR 2WSMA 1OF1A 3HPRA 1ZM4A 2AXNA 1NIJA 1G5TA 4G1UC 3MWJA 1NG9A 4EFNA 1D6JA 1U2RA 5FBVB 3LBHA 1XPOA 4FXPA 1RJ9A 4JVNA 4TLEA 5JI2E 1XTSA 3M0EA 2ZXUA 3ZVNA 2IYWA 5BW8A 1N5KA 2CLSA 4BGDA 3R9IA 3TUZC 3UIEA 2XB4A 2V7QD 2ORWA 2ZUBA 1T6NA 2V6IA 4Q7LA 2WMOB 4GP7A 4D80A 2V4ZA 2JLZA 3BORA 2FFHA 1R0YA 2B7CA 2J3EA 3BJIC 4Q4AB 3W6PA 4PC1A 2A30A 1JBKA 3CNOA 1WBDA 3ASYA 5BN5A 2XSZA 2XNDA 2IYUA 3PUVA 2QN6A 3LH5A 2ZRLA 3I8XA 1XPRA 1RIFA 4OK6A 3FDIA 2HJGA 1XZPA 2MSEB 3OAAD 3VNVA 2Z83A 5SZKB 3WBJA 1KY2A 1E94E 1O3YA 1Z0KA 2BM1A 4QJ4A 2QY9A 1RC8A 3DDCA 2GXAA 1Q44A 1KSHA 4BASA 2GBLA 3DZ8A 2N1BA 2ODEA 2HCJB 2G0TA 4U7DA 3JVVA 4PO8A 1NVUQ 2QSYA 4D0NA 1SXJC 1BH2A 1YJ5A 2VSXA 1KI2A 4OYHA 1SZPA 2C8VA 2IL1A 1G8PA 1KK2A 3CIOA 1ZCBA 4TYPA 3V4FA 1ZM3A 3HYRA 2IA5A 1RVDA 4B76A 1D8TA 4LRWA 1UM8A 3I32A 4XJXA 4K8OA 1GKIA 2JLRA 3HR8A 1U8AA 3CPJB 3KJGA 1NIPA 1YRBA 3MMPA 1BYUA 3CNNA 4ZDKA 3ADKA 2EFCB 3K0CC 3LQRA 4OHVA 5JI3E 1T8UA 2ZRPA 2FSHA 5HKKA 1VCOA 4XWOA 2NPFA 3TKLA 2ZYWX 1G19A 3E70C 2JA1A 3ONWA 3AF1A 3QI2A 2O8EB 2OLKA 3BS4A 3N5CA 2ZJZA 4AIIA 4HDQB 3SJCA 3AGPA 1YZNA 3ZVMA 5DO9A 3QKSA 3R9WA 1N6NA 4JYBA 3VTKA 1J2JA 1K8RA 2GF0A 2QU8A 3CR8A 4IW3B 1W36B 1DG3A 2BMDA 5L3QA 4E5UA 3U6BA 4AKGA 4NE2A 2DBYA 1XJQA 4M1WA 2F6RA 1N2CE 1U9IA 2WKQA 2IS6A 3THYA 1CJTC 3MWKA 1GSIA 3IO5A 1Q3HA 1OIVA 3SR0A 3SYLA 1P62B 4TYYA 4LCBA 4DLYA 5BN4A 3AQ4A 2QGNA 5SZJA 4ZDIA 4IVRA 1P4SA 3WRYC 3L2OB 1XD2A 4NH0A 4N0DA 1GNQA 4QC2A 4DJTA 1PLJA 5CLLA 2HJVA 3HP1A 3NHAA 2Z4SA 4M53A 2Q3HA 1CULC 1EFCA 4OQLA 3EC2A 1OPXA 4KODA 3ZDQA 4DSOA 1G21E 4II7A 4J0QA 4PQFA 2OBLA 4JVMA 5FPYA 2BMJA 2WJHA 5TV2A 1OHHA 3QPWA 1OXTA 3FFAA 1DPFA 4O2RA 1W5TA 1S3SA 2BKEA 3IPYA 1E9CA 3T12A 3W3ZB 3VKHA 1CU1A 2AN9A 3SQWA 1KAOA 1X8KA 1J90A 2ZJ8A 4LV5B 5HKKD 5IT5A 2QROA 1ZUNB 2Y8EA 5JSZA 5F3WB 1ZMXA 1HT2E 2J0UA 2KI5A 2RGDA 3EG5A 3GMTA 2FE4A 3RS4A 1KNQA 3QBVA 1W0JA 4RD6A 3R7WA 4DIEA 3CWQA 1ZCAA 3A1TA 4RZ2A 2ZUDA 3ZVRA 2VF7A 5A0FA 3SZRA 5D3MA 4M0LA 1EESA 4BRUA 2PCLA 1CJMA 1FNMA 1HY3A 1KO7A 3EZ2A 4NBSA 1UJ2A 4C3ZA 1YU9A 2IHBA 3A36A 2JJ8A 3GEEA 1WF3A 2WJJA 2A5DA 3U7GA 2BBWA 4QBIA 1NSFA 2BIFA 2NMVA 1Q21A 3BH0A 3Q7QA 5BN3A 1UBFA 1ZIPA 2FSGA 3TNFA 3C15C 5JCZA 2NO6A 2FGKA 4Q1FA 4JKIA 1DAHA 4UXHA 1UKEA 1BOFA 2W83A 2QNRA 4V0MA 2GA8A 3WMEA 1JJVA 3CF0A 3M1IA 1XMSA 3V4RA 4KFSA 1JXMA 3U3JA 3RRNA 2PLRA 3AF4A 3PQCA 3Q72A 4JLKA 4GBMA 4R7ZA 3KQHA 4GI7A 1CJVC 4A0GA 4CIDA 4Q5IA 5F2EA 3ZH9B 3U7HB 4C0HA 1RKBA 1KJZA 2OFXA 4RFSB 2QQ0A 3FMIA 1OHHD 2IS1A 2R9VA 4M1MA 4TSFA 1DADA 4NMMA 1NN3A 4A6PA 4JYCA 4A8JA 1HEIA 2R2AA 1XTKA 3AKEA 2VPPA 3OIWA 4PR0A 5AJXA 1Q0UA 3M6AA 3P1JA 1KY3A 2ZSFA 4RZXA 5IHPA 3IEVA 1WE2A 2PZGA 1T9HA 3TGPA 4M9QA 4B32A 3RRMA 1EWRA 4OBEA 5FOVA 3ZZ0A 1NVXQ 3MJHA 2A3RA 1W47A 2XGJA 2GXSA 4ARZA 4TZ0A 3B8HA 4D4MA 5JECA 4PHTA 4AYXA 1RZ3A 4D4JA 3MFYA 4QBFA 1GUAA 3Q7PA 4JLPA 1S3GA 4KYIB 4PXAA 2EFDB 2ZANA 3GJ8A 4EKDA 1KK1A 1Q1ZA 4QM7A 3GD7A 2OO7A 4KFUA 4DDUA 4X8LA 1Z22A 4IJMA 3RS5A 1I4TD 1WMSA 5L3QB 2H18A 4KBFA 4OI1A 4B44A 2CNWA 4IEIA 4KITB 1FX0A 1VG8A 4GT1A 3CNLA 3THYB 4HAWA 1E9AA 4DLXA 2G6BA 2OXRA 5ANRB 1P60A 4LC1A 1QHXA 4LJAA 4AK9A 3IKJA 2BEKA 2JJ1A 2V9PA 2WTUA 3NEYA 1ZNYA 3ZZTA 1D2MA 2IHYA 1KYIA 4KJZA 1R8SA 1XEFA 3L8ZA 1J8MF 5CYOA 4NDZA 5JZVA 5JHHB 2D62A 4UNPA 1KK3A 2PEYA 2R6AA 2G3YA 3Q9LA 5FOWA 3QXSA 4NTZA 4TSFD 1GTVA 2YINC 4JSTA 3C41J 2RAPA 4A1FA 2EWVA 3VHLB 2BMEA 2HDNB 2IUUA 3KUCA 4BLTA 3QIAA 1OSNA 3LA6A 4RKFA 5JSZB 4M21A 3LVRE 4Q4HB 3G0HA 1P6XA 1Q20A 2BJVA 1MO5A 1Z0JA 3GP8A 2WWHA 2YYZA 3QKRA 5BQ5A 1GFIA 3T06B 3WY9A 1Z0FA 2F43A 4ZCLA 2AD1A 2QENA 2HYIC 3LQQA 1GRNA 4K46A 4HAVA 2GK7A 3QVVA 3B85A 3A8TA 4LJ4A 5F98A 3U3OA 2IW3A 3CBQA 2PT5A 2YVUA 2C98A 1TMKA 1ZNXA 4FMCF 2ZJOA 1E0JA 3HU1A 4TLDA 3ZS8A 2QSZA 2ERXA 2JJ1D 1G5PA 1BIFA 4S35A 4KU4A 5G53C 4URZR 4Z1MA 4B43A 1E4VA 4OHZA 1MRNA 4Q7MB 3H1TA 4YDSA 5EE9A 4DIDA 2XZPA 4LDJA 3QENA 4DT1B 3U4QB 3RS2A 2GEDA 2OT3B 4EPVA 2F55A 1NN5A 1SKYE 5KPDA 2GCPA 2GZHA 1Z2AA 1QG4A 3WP1B 3NHBA 1I2DA 2AX4A 1MT0A 2PX3A 3LX5A 3SNHA 4MGYR 5C2JB 4FN5A 3S1AA 1PLLA 3IGFA 2QI9C 3D8BA 4V0KA 4C2UA 2O8DB 2LWIA 4TMVA 1QVRA 1E2DA 2Q3MA 2DFNA 3H2YA 1PUIA 1QHSA 4C7OB 2GK6A 2C9OA 4GOXA 4OHWA 1N6LA 3RNLA 1OKKA 3OF5A 1YZKA 4IXNA 4BLPA 2FSFA 1X86B 5KDDA 2C5LA 1A4RA 1R2QA 4HLDA 1MO4A 2ASEA 4WZBE 4CF7A 2C77A 2ZJBA 4MKGA 4F4CA 5FOTA 1W48A 2EFEB 4ARZB 4EFMA 2JLWA 4KVAA 4IXMA 3FOZA 4C4PA 1JI0A 4A6XA 2WJGA 5EE1A 2OSBA 2BJWA 4MYTA 4LC0A 4CVNA 2H17A 1AKEA 1KO4A 1IN4A 3TRFA 1RRPA 3B9QA 2XB2A 3V9PA 3AKDA 4CW7A 4MITA 5K8IA 2QAGC 5FBLB 4MYCA 2CL0X 1ONBA 3DL0A 4P33A 1FUUA 1AQUA 5HE9A 3G82C 4KV9A 4NP6A 2LKCA 4JBYA 3U7FB 5KNDA 3BBPA 3H0KA 4UNSA 5TVKA 4A9AA 3K9GA 1EX7A 2UVQA 2ZYUX 4WXRA 2XAUA 5K8TA 3BWDD
chains in the Genus database with same CATH superfamily
4G5XA 3EVTA 3TTWA 3KUKA 3UG7A 5AI4A 4XZ3A 4F2WA 3ZJVA 5LQKA 2QRVA 3R0ZA 4BUCA 2ZWOA 4NABA 2JKYA 2QX8A 4ECAA 5H7XA 2WI8A 2VP2A 4EGAA 3NWBA 1KH2A 4MVJI 2QL5A 5LMZA 3JQPA 4GBED 3DHWC 5CVVA 1AM4D 1EP1B 3PEYA 3RG8A 2HT6A 5C5CA 1FS4A 4IHKA 2VTEA 3ER6A 3IYLW 4J76A 2G9ZA 1E6UA 4WBNF 5JDIC 3PDIA 4BQOA 1RE0A 4BKRA 4CKCA 3EMKA 2G4VA 1I13A 3IQIX 1FRVA 2ZI4A 1YZLA 4JJGA 1R27A 4GWLA 3T35A 1KAEA 1C1XA 2AK3A 3ZHQA 4EVQA 3QKRB 4I5GA 4FOSA 1M72A 2POCA 3HLYA 4A7PA 3A37A 4C5BA 2J3IA 1LPOA 3IMEA 4PIMA 4YAKA 5HWSA 4QWMA 5A0TA 3EN0A 1LS6A 4POOA 3C8UA 5L40A 1T5HX 1A4IA 4ZVUA 1DIRA 3ER9A 2O59A 1SH7A 5KJEA 1C7FA 1JHMA 3EGOA 4XGRA 1ZVKA 4XQCA 3O0DA 4ALMA 5I9TA 3CBGA 3K9CA 2ZBDA 5C4MA 3IP1A 4UMFA 4XQEA 4W82A 1NW4A 1GU1A 1A8SA 2VWPA 2I3BA 2QX4A 5A7HA 3WHLA 3LQKA 4ZOLA 1FFGA 2NT3A 3BXFA 1IJFA 3PJEA 3RS9A 1Y3HA 3SWWA 1QOPB 5K03A 2B8TA 1OB5A 4D9CA 3QU4A 1EBFA 1IZ0A 4G8DA 5CA0F 1GRQA 2VHJA 1U8FO 2CL5A 1TA4A 3G8BA 4RETA 5LC1A 5AH0A 5HZKA 4AJHA 2AMYA 4PHFA 2NZYA 2VSNA 4TV9B 5DDIP 3NGXA 3E2MA 5ALYA 1AJEA 5ITSA 1T2VA 4AG5A 2AF3C 1DWUA 1EVYA 3L41A 4YMSA 2IC5A 1LSJA 2HWUA 5K3DA 3QA9A 2HSZA 3EPPA 3EG9B 3LPMA 6PFKA 2ZREA 4L8FA 4ILKA 2QMEA 4UOEA 1A2BA 4J3FA 5IAAA 3L6UA 2BGNA 4Y2TA 3C1OA 3KBBA 1G16A 2X9VA 4H31A 1S7GA 2IQIA 3S6JA 4J0IA 3SXJA 2G28A 1O9GA 3VSAA 1RQXA 3HCCA 1E1RD 1TQHA 3Q9NA 3QEJA 5JCJD 5CFOA 1HYEA 2ZYTX 1GUFA 1OVMA 4U02A 4QHTA 4Y1FA 1L5SA 1II9A 2X9GA 1ZONA 1J33A 3MWYW 3MOGA 4RZ3A 5F76A 4YYEA 2YWJA 1TYEB 4UFOA 1S8NA 4LRTB 3ZXXA 2VDJA 4HRYA 3ML1A 5FTNA 5I01A 2IIBA 3GVXA 3OF2A 4TS9A 3MWEB 5DT9A 4F4FA 1TAUA 2F1RA 3F6RA 3W04A 5TXGA 1P18A 1V25A 3KYBA 1SELA 3BXHA 4K9MA 3MTAA 2BGMA 4LOHA 3WKAA 1V96A 3IE1A 4MRPA 1FMTA 2BBSA 2C97A 4AYTA 2X77A 2UUCB 4HNAB 5LA6B 1ZHFA 3WGNA 1U1EA 1I33A 4G8CA 4J2HA 4LSMA 5DWVA 4TL9A 1CQWA 1M2VB 2VZ8A 2PUDA 4HL6A 3GPLA 3KYDB 1GYQA 4HUQB 3OZBA 1NI5A 3K15A 1FDIA 5GP1A 1GG2A 2WKSA 1HXHA 2K2WA 3GBVA 1KPGA 5B53A 3DXXA 2O3RA 1WXQA 3KYIB 5P8WA 4U7JA 1Y6ZA 2X1MA 3WGTA 5JFGA 1UXGA 1X1TA 2WUVA 4NEQA 1IUOA 1UXKA 3B6MA 3VSEA 5D84A 3MK31 1H23A 5GQSA 4KX5A 4MJ7A 4CLOB 2MSDB 1Y4UA 3WLOA 3AX6A 2QZZA 4MKRA 5KB3A 2JEOA 1ZCFA 1QUEA 3LVQE 3M5CA 1MB4A 4O4IB 1XCBA 1C4WA 5D3ZA 3WLHA 3NRBA 4N5HX 3S3TA 4AJ4A 2YIJA 1G1AA 2BD0A 2XT9A 3DYBA 1T3SA 2I1VB 3PZBA 1SQ0A 3P9XA 3LL4A 4EJ6A 4EJ0A 2RGNC 2GBPA 2Q9CA 3AP3A 2CLHB 3IT2A 1HM5A 5ELMA 5HIIA 5EA2A 4QECA 3PTAA 1GZSA 2FPXA 3AOEA 3KG2A 2JIZD 1QBGA 2AYZA 1SVSA 2VP5A 3O2NA 3H1PA 3O95A 4TT8A 3TLMA 5FOSA 3W4KA 3HM9A 5JMWA 4KPFC 2Z5FA 5CJ2A 4L51A 1NE2A 1KF0A 2BEVB 2CBZA 2L2QA 3CW2A 4Q3BA 4RFVA 1E6CA 3HWRA 4N7RA 5EXDA 5T3YA 2PKRA 3N0VA 3PNYA 1ZN2A 4X41A 1AX9A 3QYJA 3H16A 4INOA 3E8SA 3DULA 5LB4A 3DYIA 1Q57A 1JHXA 2E89A 2VQ6A 2YZGA 2FEPA 3C70A 3KHUA 3F2IA 1KXZA 4HUTA 4NE9A 1SA0B 4PO3X 3VHXA 4CMKA 2QW1A 2DHRA 3EIOA 4XCQA 2V59A 1M75A 4OSEA 4KQJA 2OZKA 2VJCA 4G63A 4MUFA 4PAWA 1N5IA 5DGCA 2LUOA 1WXFA 4UC0A 1XRMA 3BWYA 5BR7A 5CK5A 5JV5A 3LC1O 3U13A 1A7JA 1P3JA 3JASA 5FNVB 2QMYA 4ZZIA 1XEAA 5GZ1A 4CCSA 2FQXA 3DLBA 3IA7A 2BFEB 5CCEA 3OIFA 1TJYA 1NXWA 1TRKA 3PI7A 4WCFC 4WFKA 4BE9A 4F4JA 4F9GA 2Q3FA 4K0RA 5EP2A 2A1UB 1OIXA 5LLSA 3ZE9A 4EJSB 4DV0B 1EDBA 2YVLA 1N2ZA 1K97A 1VA5A 1G2PA 3LRTA 4Q66C 4EY3A 1ZK4A 3MS7A 1R6AA 5CH5A 1O0SA 1EWTA 1P8AA 2QL7A 4UBMA 3E82A 4UNIA 2DR3A 3W2EA 4ACBA 1T2EA 1SXJB 3KEFA 1CY8A 3ZEAA 2JW5A 1SOVA 1YI1A 3DAFA 1PT7A 1WY7A 5K3CA 1KQGA 1FRZA 4Q9AA 1YKSA 3MIIA 2UKDA 3JVDA 4EG0A 1F60A 4ER3A 3I6MA 1QHYA 2I65A 2WZDA 4YALA 4NEHB 4KGZA 4PSKA 5JI3E 2YFYA 4HN2A 1M1NB 4PFKA 4FYVA 4R1NA 3RFUA 4PCVA 3HM2A 2RHDA 1T3ZA 1YDEA 4D97A 2IYOA 3QU5A 3AM1A 4JT9A 4PC6A 1TZJA 3WGQA 2Q5JA 5C8YF 4BBAA 4MRNA 4PG4A 1Q7GA 2C82A 2J6CA 2B7LA 3A1VA 3BJZA 4G5YA 2ZIXB 3KQUA 4L8WB 1T1IA 4UAJA 4B4KA 1ODJA 2EKPA 3NBXX 4OMUA 5KTPA 2VP9A 4CI9A 2H1HA 3UA3A 1GRVA 4ZZ2A 3P32A 3ZKWA 5BWMA 1HDRA 3AHCA 3CNEA 1U7TA 3GGGA 4GG1A 5TPWA 3A3NA 3Q3HA 3ZXSA 3O94A 2JJQA 1Y7HA 4B45A 3KKOA 3QXCA 5K0EA 3KTAB 2P6PA 1ZUHA 1J39A 1RLMA 2BKUA 1XTBA 2G9VA 1X3LA 1X9HA 4NQRA 4QUEA 3ETDA 4Y0AA 3LPAA 3UKOA 2YJGA 2BCJQ 4D9MA 3W3AA 4C05A 3FF4A 1ZY2A 4BMVA 1GVNB 1KMQA 4LJ9A 1XEXA 4ZVKA 1BO6A 1Y6QA 5FPSA 3NV7A 2HADA 2V8BA 2AXPA 4ZQFA 4PZAA 3R76A 3MCTA 4HDMA 4TT3D 3HKBB 4LBZA 5EXEA 3RK0A 3SHQA 1WULS 3RREA 5A5EA 4X97A 4Y2SA 4A23A 5C46F 1Z4IA 4TL8A 3AEQB 3IHLA 4AZWA 5IXYA 1BEEA 1JEJA 1HGXA 3PNKA 1STOA 2IODA 3DDNA 2QGZA 3Q85A 3N0XA 3QXXA 5A5VA 3S8YA 3W5IA 3GROA 2F3UA 3GLFA 1QIDA 1WIWA 3IIKA 2MYPA 4AJ2A 5ED4A 3FI0A 4KDCA 3L0DA 5EJAA 2G36A 1WVMA 1Z28A 3KOZA 4LN1A 1KMHA 1EXDA 4CF6A 4I1PA 1J2EA 2ZWPA 1ZI9A 3HO1A 2PYZA 4ZQBA 2P4SA 3A4YA 4U2DA 5K09A 4LBWA 2B61A 1TA9A 2C95A 1JHUA 4CR7A 4DLPA 4M0DA 1ODCA 2OORA 3AJDA 1UPTA 4RA6B 2YOFA 1P74A 2D06A 3BGDA 4HF7A 4UQOA 1IXYA 4K6MA 4AD8A 1GQFA 1KFEB 3A6FA 4NENB 5K4GA 4RYLA 2DQZA 3M34A 4FUQA 1CUDA 3OM8A 2W6NA 1EP9A 2LCIA 5HDQA 1CUSA 2VF5X 2AK2A 5AW5A 4BTLA 5HQ3A 3UBTA 2G77B 1CY2A 1E32A 1IK6A 5IC5A 1E9FA 1PFVA 2B6HA 4ZV7A 5MF6A 1EGMB 3IQZA 4EYKA 5ALPA 2HRRA 1RI1A 2VCEA 1LK0A 1YUBA 4XWGA 3LMKA 2XCSB 2AHRA 4ZHQF 4H0NA 2X7JA 4XKJA 2F9MA 1S1MA 2P5TB 3NW9A 2BTEA 5GJWC 1TU4A 3IQFA 4HSEA 1R6UA 3EIUA 4PLTA 4OXRA 4QDKA 2J9FA 4BFTA 1P6UA 1FFSA 2QG6A 3BMOB 5B1IA 1M5RA 1CQIA 1N6OA 1P2UA 2TSYB 1NW7A 2VK8A 1EFVB 1N0IA 1PQWA 4G84A 4FE4A 2OV2A 4FGKA 3KX2A 1BXZA 2G9NA 3KSZO 1JEOA 1X9GA 5ES4B 4FINA 4KLNA 1EP3B 4GPBA 4BLOA 4PTLA 4IICA 5I7VA 2J9RA 1DO8A 4IDGA 3QKWA 4NU8X 4KLAA 2Y9PB 3Q8XB 1TZ2A 2HXSA 1Z4OA 3AW8A 2IP1A 5AKIA 4G8JA 1XX6A 2DHCA 4IIXA 5CK4A 1SN7A 1M6EX 3GP5A 3JQRA 5HCIA 4DA6A 3CF4G 3IE2A 4RE5A 4TYQA 5J4KA 3DCJA 3ITNA 5D51S 4G0ZA 3RANA 3QPUA 1HQDA 1V4BA 3CINA 4OQQA 4E07A 2F67A 3FFTA 3H5IA 4X6YA 3TX6A 2HLPA 2VF8A 2ZJAA 3VNBA 4A1OA 1FUIA 5DRYA 3SLRA 4LWZA 1ZH6A 1YJBA 3FETA 1W35A 3GLHB 1JG3A 1G20B 3OA2A 3I53A 4NK5A 3OOEA 1SU8A 3UCFA 1QH1B 4URXR 1MKYA 1BJTA 2JFQA 2QZSA 1GNRA 2VA9A 3QLUA 4K9SA 2BGLA 4M7PA 1V5EA 2XHZA 4UCWA 1T2FA 1HDGO 4F4IA 4NFSA 2GXQA 4XGKA 4YUZA 1FRNA 2EKQA 4RTPA 3PVSA 4YACA 4HVLA 2VSFA 1JG7A 3BIFA 3TQIA 2H1WA 2ZI3A 1TM2A 4F11A 1J25A 3SZLA 3QWFA 4B6PA 5IDWA 1J8DA 1K7CA 3WWEA 1BWQA 2GR9A 4DMLA 3I2HA 4HV4A 2FSIA 1VECA 4C2TA 5L95A 4D74A 2XEDA 1I51A 1Q16A 2SKCA 3PUHA 4HDRB 5E3HA 3IOEA 1XZBA 4MLZA 1ORTA 4PXSA 4UPEA 4AKHA 1VKOA 4K05A 5ICGA 1SWVA 4O2LA 1OD6A 3T3DA 3T1YB 1MW8X 4IWYA 1ZK2A 5E9AA 1JJBA 2JDID 4DRXB 3EDQA 3EOAI 3NDIA 1YAHA 3ICQB 3GXOA 2OBMA 2H1VA 1Y1QA 5HVNA 1DUIA 1D0IA 1Q1BA 5DNVA 4NCHA 4DV7B 3TCXB 1NOJA 1HE2A 5JZSA 4EYSA 1JS1X 1LC0A 4W6QA 1ZC4A 2V6JA 1N4DA 2JF0A 3ZDFA 2NLOA 1W36C 1WXDA 1MZPA 1KZ1A 1MORA 1NC3A 2FA9A 2RKOA 2HHHB 4RPLA 1WOYA 3CKKA 3FOAA 5DU2A 1S9DA 3AFHA 4HXYA 3U4MA 4DC0A 4HJXA 4U2BA 2YWHA 3FHOA 1XAGA 4R01A 1S9HA 2Y4NA 3O8BA 2FX5A 1UIRA 4BCCA 2YMQA 1P9RA 4U6QA 2PUAA 1LD3A 1JQ3A 3GF4A 3A2MA 3ZNPA 2IEGA 3VKWA 5ES3A 3ROGA 4EUNA 1F0PA 3NYRA 3Q3CA 3TD6A 3D4LA 1UBRS 1CBUA 2WE7A 1EFHA 1S2LA 3IOMA 2ZK7A 1PKXA 1QKIA 2PX0A 4FZ3A 5I5EA 3EZNA 5BWCA 1XA3A 1TNDA 5LMUB 1PDOA 2YY7A 4JJ4A 3LRXA 5J63A 3K8QA 1RCTE 5A1TA 2GN0A 1EKXA 1DBSA 1L6IA 3UWPA 4HWKA 1H4VB 1WX1A 2WQZA 4IQFA 5EFOA 4EGFA 1IPFA 1JWBB 1JR3E 1MIOA 1DINA 2CFSA 3OJCA 3ZV3A 5JDIA 5TT1A 5LQMA 5DT2A 3TKYA 3BFPA 2OHVA 1R16A 2HF2A 1WZCA 5CM9C 2R2GA 1G5HA 2AE1A 2E87A 1QRDA 1ORRA 1RQ2A 2B8JA 3HA5A 1GNVA 4MV7A 1XCLA 2F8LA 3V7WA 1CHDA 1T2UA 1YB1A 1XAHA 4GICA 4S1PA 3B82A 5E2BA 4ZAVA 3UMCA 3QE9Y 4M0PA 2FZ5A 5MN6A 1VMEA 1HDIA 4N41A 2DFKB 1D04A 3PGJA 4AKTA 4W5HA 1JVBA 2G06A 3LX6A 4J91A 2GERA 2XKAA 4TMYA 1BU5A 5AUPB 2H2HA 1XLWA 1DO0A 4XIJA 3H0CA 4UHDA 5AW7A 1Q2XA 1V8FA 3OSUA 1XG5A 1X1RA 3OZCA 2WU1A 4R54A 3KQOA 5C5IA 2CXNA 4D4LA 4C87A 4XTCS 1IK4A 4RK4A 5G4LA 1WY5A 5BN4B 5F7XA 1M3SA 1VRCA 2O5CA 1HE8B 1SIOA 4RM2A 1W7AA 4MV8A 3U7JA 3TQSA 1GPH1 3NKLA 5JNVA 4G25A 3IQWA 2RCYA 4G2TA 4R8KA 5YASA 2IXDA 1RI4A 3EZXA 1HLDA 2W6MA 1NXSA 1I36A 3T5CA 4B9EA 4ASUD 2WJ4A 2CNNA 2I6SA 4CHGA 5ICMA 2HNAA 3OZEA 2ORVA 4HH1A 3EMBA 3UVEA 2QTLA 3LPCA 2MR5A 2X2OA 1WM1A 2ZR9A 1F8YA 1WTAA 3CWZA 4MHOA 5J2TB 1U2TA 1N57A 2V6MA 2IZOA 2BMFA 4FJ0A 4C0KA 2Q2WA 4F3CA 1P9LA 4Y1EA 2NP7A 1EM6A 2AOUA 2LIVA 4YO8A 1DDOA 4B75A 4QPJC 4I14A 4ZGWA 3AIMA 3O9VA 4WJZA 2VL7A 2QT0A 4HATA 1QF6A 4DCNA 2QTGA 4LDZA 4G81A 4RENA 1J6UA 3MINB 4O8ZA 4EB0A 3WNCA 2HA7A 4KQGA 3M6VA 4G5QA 4KIJA 3AJRA 3BDIA 3C3JA 4BQSA 3FHCB 3BXZA 2HOQA 3MOIA 3BE8A 4XQ0A 1COWD 4D3FA 3SBEA 1KY4A 4YAOA 2CB0A 2JHAA 1JFRA 2C4VA 2GEKA 4Y7DA 3TZ6A 2H31A 1VSTA 5EUCA 5J4YA 3HS3A 3UOWA 3KDPA 4GYYA 5ALQA 4EHFA 4M9RA 5LN1A 3RS3A 2EG9A 3IMFA 4J0HA 2PZFA 2HCBA 2G7MC 3HYTA 2H2WA 3AMVA 4AMBA 3RUAA 4TKVA 2XZLA 3EXHB 1KI9A 1G8HA 1WW2A 1ZD1A 2C5GA 2YWEA 3KLPX 3EOBI 1IB0A 2CXSA 1R66A 3ZWMA 4EEZA 2AX3A 2OWEA 3RKSA 1YI0A 4CV3A 2VQDA 4OBBA 2LW7A 2ZI9A 1XI2A 5ILOA 3CZ5A 1G8YA 1W75A 5CB0A 2FKNA 3CFYA 1UINA 1VIVA 3B7WA 3P19A 3GUZA 2DX7A 3ANYB 3C3PA 3QVUA 1RMQA 2EX1A 2JJ2D 4PLFA 4QYXA 4AM8A 3GEBA 4EG4A 1UEIA 2V74B 4ROSA 2AXQA 4HQKA 1VFNA 3NOVA 3VR4D 5BOSA 3DQPA 3SYTA 1T5LA 5JD5A 2RGNA 1T5BA 1XHEA 4LKOA 1X7WB 2GWHA 3O47A 2P2LA 3OJ0A 2FJUA 1MG0A 1VRWA 3BMCA 1DDGA 3TXAA 3IL2A 1W2HA 5CX1B 4TL7A 2Q0HA 2YUIA 3GR6A 5EC8A 3C98A 4O2AA 4JLOA 2WM9B 3L0YA 4FMDF 4BO1A 3NDRA 3CW8X 2OY0A 3TH5A 1XSEA 3VZPA 3H1FA 2Z2XA 4D4KA 5KBYA 1B15A 3I6BA 1YQWA 4PC2A 1XRQA 2RG1A 3LTNC 4JA2A 1EZ4A 1FTQA 1TPYA 1ZIYA 3WBKA 1AD2A 4R83A 2GLTA 1SCDA 4I6JA 1UJ5A 4W1RA 1ECPA 1Z17A 4Y6RA 3RC7A 4B3DA 2BSQA 2ZRGA 2R1VB 4HS4A 3P8ZA 4B2PA 3ZCVA 5BY2A 2XNHA 3FVVA 4MXDA 4TMTA 2GVNA 3A1DA 1YF3A 2PJZA 1PFGA 2VEDA 3A6LA 3SHWA 3PEUA 4JBLA 2WTMA 1KJWA 4H7FA 4QU8A 3WG9A 4G0NA 2AWOA 1EP2B 2PD3A 3FMPB 3M83A 3SEZA 4HPJB 1N9ZA 3E58A 3FGPA 2Y67A 4QG7A 3T9EA 5ED0A 2YN2A 1PT6A 2ZT5A 5KAMA 4UW9A 3KJXA 4O1HA 5H02A 3RBVA 3PQ4A 2Q9UA 4WCFA 5TJ9A 4PW0A 3LRPA 1IN7A 2QN9A 2CNDA 3LQ1A 4ESHA 1UZUA 4O4JF 3B52X 4LZNA 3AIIA 5GADl 1WZUA 4OQPA 1QQ5A 1XDBA 2JLCA 2UZ1A 5JWOA 1EWYA 2H06A 3RO7A 2UYOA 3VO1A 2WHXA 3GDHA 1ODFA 2JZCA 2XXBA 2AGVA 1JH8A 2QYTA 1DOHA 2QRZA 3GGSA 2O8NA 4ITVA 1R1DA 2OG2A 4PGFA 2EKLA 4PVCA 2EATA 2ODBA 3DF9A 3UGKA 3V7FA 3M1YA 4RH1A 3OX2A 4IUYA 1NBOA 2PL9A 3QBEA 5HM8A 3OKAA 1IYZA 2B5WA 3DMFA 3HXPA 3O8RA 4TTQA 4UCXA 5AHOA 5JNRA 1C9JA 3HA7A 5TPZA 1I24A 1DQYA 2C57A 3DE2X 1CUJA 4N0QA 5BNWA 4CUZA 3SEAA 3O4RA 4N6GA 4HB4A 1W19A 3T1OA 1DO2A 3OQJA 2NX2A 2ZRJA 4L2IB 1E3MA 3WX0A 2D4HA 2NU7B 1KMMA 2I2WA 1KI1A 1G63A 2J0VA 2QLBA 3EEQA 2OQ2A 3HY6A 2Z0MA 4IQ4A 5DWQA 3DOFA 2GJAA 3N74A 5JS2A 4Z6KA 2PN1A 1HT1E 2QV0A 2JGAA 1ZSNA 2X5OA 1AUPA 4RD1A 3SGLA 5CB8A 3IP5A 1Y6JA 1K8QA 3PA6A 4Y0NA 3U44A 3FJOA 4LJ8A 4GLBA 4CN8A 1Q50A 4ALLA 1HEYA 1IY2A 3E22A 5T8KC 4FKBA 5K51A 1UMDA 1EK2A 2JBAA 5T6MA 1P44A 4BXOA 1QDLB 1W59A 3CNHA 4U2EA 5JCXA 1X8LA 3ECSA 1GQRA 4NCJA 5HZMA 2GO1A 2I4TA 2WJAA 2W70A 1E4OA 3BL5A 3HCRA 4DANA 3TINA 1CDZA 3LHKA 4LNHA 4US1R 1R5BA 4E1BA 3B6KA 1T6XA 2C4HA 5D3QA 3FNHA 3QVOA 4E5KA 5CYPA 1Z63A 4TZKA 2AFHA 3WHIA 3O90A 3IVRA 4JIMA 3IEXA 5EXXA 1H69A 1G21A 5KYXB 2GPYA 1BVHA 1CP3A 2YYYA 4TKUB 1SB8A 4XUEA 4AURA 1U3TA 1WAMA 4IIDA 4II3A 2I3ZA 4F6RB 5FV4A 4HNSA 3A6PC 4OHYA 1URPA 1VBKA 1P5HA 1VFPA 4LZJA 2Y76A 3S1AB 3NETA 2P67A 4O4LB 2V1UA 1QIMA 3UUWA 4AG3A 3LQFA 1F38A 2JIOA 3AB7A 4I1YA 3VA7A 5JH7A 4CM4B 4CMAA 1NDHA 3WNQA 2V1XA 1A9XB 3BA1A 1TI7A 3OIVA 2AW5A 5EP3A 1EUDA 5FORA 3DFUA 1FNDA 3OJEA 4JP8A 4F2PA 1ZW6A 5JJCA 3U1BA 1QPZA 1CEQA 4MX8A 3ENVA 4OP3A 5CH3A 5H4GA 5IVHA 2XTMA 2J3DA 1BWRA 1LPBB 4XSVA 4MV4A 3EZ9A 3WB9A 1VKNA 3W9UA 1XA0A 1QAOA 3KSDO 3KTDA 3AIOA 4DOMA 3O1HB 3QHPA 2CDBA 1ENYA 4X95A 2O6HA 3E1SA 4FGSA 4IQ0A 4FHFA 4NSNA 5EMJA 3VSDA 2TYSB 2ZKIA 1C81A 3ZGNA 4GKVA 4MUYA 3X1DA 3TRIA 3DP9A 4LYFA 4MPDA 2VJQA 1KARA 1TM7E 2QD5A 3AC0A 5E0KB 1EWQA 1UMKA 4GSYA 3W6UA 5F3RA 4O25A 1XQ9A 4Y18A 2XA1A 3NXSA 4ID3A 3L7MA 4OMCA 3UOAB 1V16B 3O3NB 1MQ8B 2AMJA 2R6GA 4QUGA 1UBJS 1U6KA 3LGAA 3VTFA 1RZRD 5DF1A 2ZPTX 3VPGA 3R6WA 1EX6A 3BCUA 3EWNA 4JH0A 4E2FA 1FTNA 4H60A 3VHRA 2ZI6A 3WVNA 5JSFA 3TVDA 2HJWA 4R4JA 2VJBA 5AK4A 2CFIA 1Z5PA 3BIJA 2WTEA 3RYFA 3ODGA 5JO0A 5JS8A 3L8FA 1KOGA 1QFJA 1VE9A 2E21A 3CV3A 2IV3A 3ZU4A 2JRCA 3OLZA 4RVNA 1OH6A 1O5TA 3KT6A 3MMXA 2C4UA 2ZBGA 1XGKA 4C7VA 1IZZA 4GGMX 3KCQA 3HKCB 4M1QA 2G09A 4G1EB 4KI7A 2IYYA 13PKA 4MS3A 1M7HA 1TO2E 3CWCA 4MUAA 4CFZA 4YRGA 4BIIA 1ZG3A 2QYOA 5H16A 2BP7B 1ZOOA 3SQXA 3MRSA 1O96B 4M38A 1SQ5A 1NL3A 3P5SA 3K8ZA 4S3MA 1J0BA 2C5FA 5JWRA 3BQMB 3HBJA 1GAXA 2PGLA 1DKOA 5KNCA 2QRVB 1NMZA 4LYAA 3TNYA 4C7XA 1QCDA 1ZD2P 1Q0QA 4BFXA 1E9VA 3BCRA 5LMCA 1AKQA 1V7PC 1QHEA 3V1KA 1JIKA 4IYRA 4OLFA 5HRCA 3Q87B 4NRDA 1DC6A 1J0CA 1GOTA 2R6CA 3X2SA 4HMQA 4JC8A 1CZNA 4YCDA 4HYEA 2VA8A 3O2JA 2WD7A 4YB8A 3TKAA 4B3CA 2M2IA 3T5PA 1RM4A 1DKQA 3PDIB 3P94A 1Q0HA 2I7DA 5IP5A 1Z83A 4PIVA 4CKCB 2OFPA 4TROA 1UJNA 3DBLA 1Z82A 3WSVA 1C1XB 2YXNA 3Q11A 5HKAA 3GT0A 1H3EA 4DDHA 4JI2B 1JQAA 1L5ZA 3EA5A 3BHJA 5HF6A 1SUAA 4IIJB 1QLJA 1LBEA 1KIMA 2JEYA 3F49S 3OTHA 3TNDA 3UK1A 4D6XA 2IYRA 4ZI7F 5C53B 1AMUA 3SQOA 1WB5A 2ILTA 2WKRA 3E23A 4FYMA 4OHPA 1TQDA 5EQTA 5BRNA 4AMYA 2XE8A 3VR3A 2NXNA 2ZTVA 1RQLA 2ZVPX 3STYA 1TJNA 4MVXA 4W5OA 4A15A 2CLIB 1D09A 1N5RA 3GCXA 2CFOA 3A4LA 5CFMA 2D59A 1SHJA 2OE2A 1BCRA 3I83A 3M5DA 4LECA 3GT4A 3L1KA 1YO6A 2CJFA 1Y9EA 3QYFA 4IH4A 4DMUB 5T6BA 4PGGA 5KI6A 1GVHA 3SIRA 3ZEIA 3NVDA 2R8OA 1X0VA 1P1HA 4DQVA 3MAAC 4WFQA 1E4YA 2I34A 5DIFA 4L85A 2D0PB 1U0TA 4WY8A 3OY7A 4BLWA 3EWAA 3ZWYA 3WGVA 3L0IB 4MIYA 1GA1A 2FE1A 4DWVA 5HQJA 3W4JA 1OWLA 3QTLA 5IVIA 4Z0TA 4B85A 4NV3A 5B3JC 2TS1A 5CNJA 1GGFA 2OA0A 1IEWA 2SKDA 3ZE7A 1BHO1 3QV2A 4HB0A 2WOJA 5E7IA 3VAAA 1JXQA 4RF5A 1YH3A 5CGZA 5IVPA 5KKCA 2VIIA 2IHNA 3GBSA 4NPAA 1ACJA 2CXPA 1JR3D 2F00A 1J2TA 4NU5A 5IMBA 4FX5A 3H2IA 2FFBA 4O4HA 2H8GA 4J0DA 4BFZA 5HJEA 4ENWA 1Z88A 1CJSA 1YA4A 2CBGA 3D6TB 3G5MA 4FKZA 5GOZA 5IASA 1B23P 1OBHA 4PTYA 2XUHA 1S1CA 2I76A 4HN9A 4HDCA 3U61B 1OE0A 1F8XA 4NJEA 1GKUB 4N01A 2OO3A 2G7ZA 1ILWA 3DTVD 3KXPA 2GSWA 1CS4C 3DEZA 3EC1A 3GELA 3AVQA 5GJBA 2CXQA 3T3NA 1XQ1A 3BJRA 3ET4A 3HI6A 3ASUA 5KZMB 1P2FA 3EYAA 1TT5B 4WVLA 3IIJA 1GAJA 2D2FA 4I36A 4LGVA 2X5KO 2JS7A 1UPXA 2B2NA 1H0SA 2AOTA 2CVFA 3OICA 2PQ6A 3WYEA 4AKEA 2Q29A 3OKCA 1FNNA 1ICEA 3H2GA 1XHFA 5CJJA 1MNAA 2B37A 5EWMA 3NC1C 4XD7A 3GFTA 1TM3E 1PR2A 3CIFA 3O5AA 1JB9A 1T13A 3KQPA 3NDPA 1TCBA 2O1SA 1E1QD 3ND6A 4UOZA 1J0EA 4PCUA 1FP1D 3OZDA 2DULA 2Q2VA 1N7HA 5IKXA 5ARBA 4I8IA 3T7CA 4IDQA 2GHRA 5CG1A 2CXXA 1PHRA 5FADA 1E9BA 3GGCA 1XJCA 5KJ1A 2FFQA 1WZEA 4BVFA 3BRSA 1L7XA 2AQHA 1IOZA 4OYRA 5CMLA 1YHZA 3RIMA 3NKFA 2OC9A 3TTUA 1BMDA 3NXKA 3RKUA 1SQGA 4V1CI 3ZIAD 4OFZA 2FVXA 3LBFA 4BMZA 2YV5A 3JQ8B 1KSGA 3GAAA 3PXBA 3V34A 3KB2A 5KTTA 4DLRA 4MVJA 4EW1A 3K70B 3RC2A 1PHPA 1UP7A 3M5WA 2W6CX 3DJFA 1QGAA 2JFZA 1XCGB 2JFXA 4MB0A 1PJZA 3MGCA 3LO5A 1OVGA 4Q34A 3V3KA 1XDGA 1NBMA 2X3YA 3K6KA 1YUMA 4H1VA 1WUJS 1JE0A 1Y7IA 1ZSVA 3M3DA 4TMXA 1YRAA 4ENPA 2ZUVA 3FKSD 1UBKS 2GETA 2DWQA 1AGPA 3MJDA 2F9LA 1E6EA 2KB0A 3N8KA 1AQ6A 4UJ3A 3V48A 1FUYB 2A86A 2WHYA 1MHPA 4G67A 1B2LA 4C01A 2V3CC 4R2XA 1QFYA 4IV8A 1VC2A 4V0NA 2W6JA 3UANA 3D3EA 1CQJA 1QO7A 2XIJA 3HY3A 3NHMA 3TECE 3QVXA 1KZHA 2CK3D 1WXXA 2Y1LA 1VPEA 2BOVA 1ZYUA 4XARA 4F6CA 1BMFD 1DIBA 3KT0A 4RJ2A 1DBRA 4MHTA 3V1UA 4KQCA 2PYDA 1V47A 3K16A 2PVCA 1JHPA 5AM4A 1TFUA 2A7QA 3EXAA 3KV1A 5GZ3A 4FFOA 4NV0A 2Q2QA 1RHRA 3BDVA 2AMFA 3LECA 4NQZA 3SVLA 1SXQA 3OOJA 2XNJA 2CNBA 4YRCA 4Q03A 3WNZA 1ULSA 1PL8A 1E9RA 3TPFA 2QOEA 4AQYB 5JBQA 1WCV1 3F8TA 1Z56C 3OX4A 1R18A 1IN6A 2YYAA 3HDTA 3NIFB 1D2GA 5ALNA 4O3MA 3NNNA 2C3YA 1XTPA 2JJMA 4YJKA 1ZJYA 1KDTA 2YJ5A 1VP9A 2AMLA 3HXQA 3K2BA 2X0KA 3CO0S 3LC0A 3IA2A 4RVUA 2FUKA 2OHIA 2R7MA 4JL6A 3S1SA 3AVTA 2V4UA 3F90A 2F64A 2Y0DA 3IT3A 4C14A 5KSYA 1LDMA 3ES9A 3X2FA 1OI3A 2DGDA 3F6SA 3REQA 3UQZA 3NG1A 4JL8A 4QYTA 1UQRA 1TM5E 1PUXA 3I9V6 3IILA 1YL5A 4UVDA 1B6RA 1WF6A 3A9VA 3T34A 4GGPA 1PD1A 2EZUA 2YXLA 4HDAA 2ZSUA 4RUKA 1QRTA 3P26A 2Z8YA 5FEMA 5JXJA 4JSRA 1RQNA 2IF2A 2F1HA 4NCNA 1PJBA 1PZHA 4GU5A 5BSFA 1ESCA 1ODSA 1R6DA 2ZE5A 3CB4A 3E3OA 1CUGA 1XJ0A 3QM1A 1I3CA 1ADFA 4BDTA 4XH9B 1MF7A 1P2BA 2UDPA 3D3WA 4GOMD 2Z5VA 2X86A 1KZ9A 3ZKWB 4CG2A 1TCVA 4EBFA 4DDWA 5JSUA 5TPWB 5L3RA 4Q4HA 1RI3A 2AN5A 4HYQA 621PA 2FPOA 3NTQA 5ALJA 3PXUA 3EIWA 2A33A 4J3JA 4RWEA 2GX6A 3QNWA 4WN9B 4PZYA 3NFRA 3IR5A 4L1KA 3LFUA 4HLQB 4PZLA 5GIOE 1WSAA 2WF6A 3G9UA 2HMVA 5IMSA 4Z4FA 2ZRNA 1A1SA 1JE1A 1XEXB 3MQ4A 5CYGA 1NVVQ 5KYVA 4W5TA 4B3BA 4MUKA 2P6RA 1E62A 2RKBA 2P2NA 4MQ4A 1D9XA 4YA6A 3AY6A 1Y42X 3CSSA 2PS0A 3O7WA 2IH2A 5LUAA 1ZH4A 2YWFA 1BA3A 1HMYA 1BE8A 4X7PA 1PG5A 1QP8A 4D9IA 1TK9A 3PC6A 2RI6A 4J07A 4FCCA 2GPWA 4GLFA 4YCBA 1L5KA 1M74A 2DBVO 4KB5A 3H9EO 1RBYA 4QBTA 1IZYA 1WD7A 3GLFB 1C9YA 3ND5A 1VCNA 4L3VA 4Y2HA 4E31A 1P1JA 5BV2P 1D07A 4A36A 1BVUA 3OWXA 2ETVA 2HIAA 2OILA 1XK6A 3RJMA 5CFZA 2RD2A 2QQFA 2Z57A 3HV0A 3ORFA 2C07A 1FXUA 4LDNA 2PR7A 2WJ3A 5GONA 4AP6A 2IEAA 2RGAA 3NM4A 1QK3A 3ELYA 2ZJ7A 1PWYE 2I80A 3FNGA 1YA8A 4P5DA 5AJUA 4DA9A 1N6IA 3RWMB 5CDUA 3D7LA 4FFSA 4IMIB 5K3FA 4QEKA 2YWGA 4ZU6X 1XMJA 1B0ZA 1HE4A 2JFVA 3ESRA 3I5AA 4YAJA 2PRJA 4AJ9A 3W8DA 4BLUA 1LQTA 4NJOA 3FHTA 1IXZA 5HQ3B 5DCUA 4WY5A 4DLUA 3OCZA 3HB0A 2PU5A 5L3VA 2D3TA 4ZJUA 2W4MA 2IZ1A 2Z4RA 1TAHA 1Q0PA 1HYBA 1OYOA 4RM3A 1CR1A 4F84A 3CUVA 5JLAA 3NO4A 1IPHA 1DBWA 4GQAA 3PGVA 3T3EA 4DZRA 1QFXA 2I1QA 2KPOA 4F5YA 3OQ1A 4MUXA 1CKEA 2BHNA 2ONCA 3OUUA 5FL7D 3OOHA 4I1IA 4JLSA 5LIPA 3OIUA 2BUAA 2CHGA 3EZGA 5JIBA 4UDOA 5T8KA 1IAQA 2J9FB 2D54A 2WNHA 3TXYA 2VUSA 3EVBA 1CQIB 3GU3A 1KSFX 4KQIA 3R5XA 1UEJA 3ZBQA 5HIMA 3NV9A 1CY0A 4G3XA 3L3BA 2IE8A 1PK7A 3JQBC 3T41A 4AZ3B 4BATA 4YJGA 1MT3A 2R60A 3NNDA 4C0WA 1W1IA 2GKOA 5AVOA 3PWKA 3V00A 1GNLA 1VGRA 1A9QA 5IYZF 5I7WA 3MTGA 1ADCA 5GJVC 3C14C 4BAGA 4D8TA 3VC7A 4PLYA 4A91A 1EUZA 4QSHA 5FLYA 1HNWB 2CLCX 3GOQA 1UJCA 3NBQA 4CM7A 4MV5A 1FU7A 4ZGBA 3TN7A 1Q12A 5F4ZA 1KXJA 3B8EA 1Z6GA 1N32B 3DYVA 4M49A 3L46A 2GBLC 2Q1UA 2N3ZA 5IJAA