2QP4A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
279
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNWKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 279
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp4A00
3PITA 2NPFA 2ZRNA 2CNWD 4HI0E 4OBEA 1M2OB 1E0AA 1X1SA 3QE0A 5DIFA 4FWIB 5HE9A 3C7KA 3N2EA 4N0DA 3ZH9B 2A9KA 5DGXA 3TVDA 2CE7A 4YMWA 1EFRA 2H92A 3PUXA 4US1R 1OH6A 1II0A 2QMHA 4QL3A 4FMCF 4QHYA 1QZXA 1CTQA 4BRUA 1NN3A 1OIWA 2KE5A 4HDQB 4IDQA 3GJ8A 2IS6A 5HCIA 4NL4H 4Q4HA 4CZ2A 1G3QA 2QL6A 4JL5A 3ZVNA 4AIIA 4H1UA 1AGPA 3MSXA 4JLDA 4R98A 1CLUA 5EZ5A 2NO9A 1MO5A 2Z83A 4BLOA 2PEYA 2QN6A 1KYIA 3CPEA 3D7MA 2HJVA 5DE3A 5J40A 2IYUA 4DCUA 1DOAA 1N0VC 2QZ4A 4KAXA 3THXB 5DI3A 1IHUA 4ZKEA 5HZHA 5EE9A 2ZRPA 1RRFA 1J8MF 1BO6A 4KBFA 2JLVA 4I81A 2BBSA 1J99A 2ZR9A 4NYJR 1ZNYA 2A3RA 5L3QB 4LHVA 4TQAA 4DLUA 3CRW1 2YVUA 5EP2A 2P2LA 2ZU0C 4JL8A 1P2UA 1ZM3A 2HCBA 5J5CA 2WJHA 4B34A 3QI2A 1B0UA 1NLYA 3GJ6A 1GP2A 3C8UA 2FPKA 2IYZA 2XOKD 3IILA 4LJ9A 4TTQA 3B8HA 1RKBA 1IJFA 1R6BX 2B8WA 1E2IA 4JLMA 4F91B 3UPUA 5EE5B 4KVAA 4XWKA 1KI3A 1XEWY 1MRNA 3W90A 2A30A 2VRWA 2VYFA 3IHLA 3KX2A 4DLWA 1G19A 3C5CA 2QT1A 1XJ0A 1K6MA 1TAGA 3QXSA 2HYDA 2KBEA 3TLXA 1GKYA 2I1VB 4BFUA 1NVVR 2OCBA 4BFZA 3N5CA 3LX5A 3EZ9A 4F92B 3AKDA 3FMFA 3SJCA 4PPNA 1XTIA 2ZRCA 2ZSDA 4OYHA 4BFSA 3AVYA 2ZJ8A 1CR0A 1VCIA 4F4CA 4OHXA 3ZS8A 1YZTA 4DIEA 1G7CA 1OFIA 1UKZA 4V0KA 1UPTA 3CF2A 4HZUB 3W3ZB 1LF0A 4XOIA 4ASUA 1DADA 4QGHA 3SS8A 1ZM9A 3IKJA 3BOSA 4Z8XA 1RC8A 3Q9LA 3CB4A 2ZE6A 2X2FA 2O8DB 2OO7A 2XSZA 1K8RA 2WZQA 3D3QA 1DVRA 1OXUA 2WMNB 2AKYA 2ONKA 5DO9A 1D9ZA 2ANBA 1SXJA 4WIAA 2GKSA 1K5GA 3GJ7A 4DB2A 2FEOA 2J3EA 1H8EA 3A1UA 4K81B 1CR1A 2G9NA 1G6HA 4RZXA 3AKYA 3D6TB 1ZYUA 3QKSA 1A5TA 2RHDA 3A8TA 4PZYA 2EFDB 1VIAA 1X6VA 221PA 2RGCA 1M7GA 3UMRA 1RRCA 1HUQA 4LPSA 1CULC 1XZQA 4FINA 4EFNA 1TQ4A 1DS6A 3TQFA 3BXZA 3RDPA 3HP1A 3IEUA 1W36C 2IXFA 4Q19A 1Q3TA 3GLGE 3T34A 3K0SA 4EPWA 2YWGA 5HZKA 3B1WA 3NVAA 2OBLA 1XB2A 4B3CA 1KO7A 1NVVQ 2VF8A 3NC0C 3W3AA 2RAPA 1E2KA 2ZM5A 3KJGA 2VO1A 1N0UA 3X1WA 1Z3IX 4HATA 2VBCA 2RGXA 4EPTA 1DAFA 1T3HA 2QUZA 5FR2A 3MWYW 2ZQ5A 2WICA 1FNNA 4B2LA 1HQCA 2OLKA 5KSOA 1R4AA 3DO6A 4DSTA 4TWZA 3GLHE 2B7CA 5FI1B 2OEPA 3ZLJA 4PPQA 4DCNA 4UJ3A 5BYJA 3I73A 3RRZA 1MR3F 4NYMQ 4Q4AB 1UBEA 5AJYA 4FMBB 2HF8A 5GJBA 2O5VA 2R62A 5B30A 5BN5A 1VTKA 3AF1A 4G5GA 4TQUS 3LWNA 1JJ7A 5LPNA 4WA7A 2ZR7A 2D2EA 2J45A 4DLRA 1WQ1R 1ZIPA 3TW4A 1KJWA 1S9HA 4BLPA 3IBYA 5JFGA 2ZVQX 3NXSA 3U44B 4TLEA 1Z6YA 4YXWD 2PL3A 3OFNA 3SFVA 4ABYA 1XTSA 3Q72A 1XEWX 1EWRA 3B2EA 1AK2A 1I2MA 1M34E 1VHLA 1E4YA 2HT1A 4KLZA 5GJCA 1I4DD 4JYBA 4Q5IA 2CJWA 3UATA 1YZLA 1JQLB 2QORA 5FOUA 4YDHB 3RC8A 1CJKC 3AM1A 3A4MA 3REGA 4HB0A 2IF2A 2NQ2C 3E2IA 3T1OA 3OHMA 2IYWA 3O47A 3PUYA 3PEYA 2ZE8A 3QXXA 1U90A 1SVOA 4K8OA 4LC1A 4Q9LA 4KVGA 1GILA 1N25A 3NKVA 1Z83A 3MD0A 3A36A 1TF7A 4JBWA 1ZNZA 4PC6A 1RE0A 4D0NA 3RANA 1QVAA 5D3MB 3L8YA 1G8HA 1UKVY 1AS2A 1OFUX 2GA8A 4W5WA 4PSAA 2ZUCA 4IKEA 4LX0A 3VR6A 3VR4A 2VP6A 3GFOA 5DISB 2AX4A 2ZRBA 1II8B 4UKDA 1SQ5A 1ZNWA 4L9WA 3B1VA 4TMKA 1QHSA 2F1IA 3BFKA 5CLLA 1YZGA 1W0JD 1GL9B 3K0FA 3RS4A 5DLQC 3TUIC 5JI3E 1TADA 4A2PA 5KUTA 4LSGA 4HLUC 2J5XA 2R44A 4NCIA 3LA6A 2YKGA 2QMUA 3TSOA 3PR1A 2C78A 5KDDA 2IX3A 2X8AA 3L82B 5GVRA 4U02A 5H70A 2VP9A 2ZRAA 4YMTA 4AKIA 4JMPA 4NDZA 1E0KA 4BPBA 3L0PA 4NTZA 2ZR0A 2IHBA 4Q4JB 3U3OA 1F3OA 4PC3A 1KMHA 1FW6A 3B9PA 1AZSC 2G83A 4A15A 4DC9A 1FPMA 3GJ4A 3FTQA 4BGDA 2GF9A 4B6FA 4OQMA 1Z47A 4NZYA 1Z0KA 3CIOA 5FL3A 4WXPA 1KO5A 3R7WB 5FPKA 5FPYA 1FTNA 1JR3D 3GLFB 3SN6A 1XU4A 3RLFA 5KNBA 3KXLA 4LYHA 1W4RA 4B3FX 3QPVA 2PLFA 2QM8A 3SOPA 2QPAA 2UVQA 4P31A 2HYIC 2FN4A 2EFEB 1ZC4A 2HUPA 4B32A 5FOXA 4M1OA 2RGNC 1BOFA 4P3YA 3G0HA 5JJLA 3B60A 4M1SA 2QNRA 3GEHA 2ZREA 3EXAA 4IW3B 1KI1A 2W00A 2ODEA 2YZ2A 4FWTA 3U7HB 2H18A 1KI6B 2C8VA 4US0R 4UNPA 3GFTA 2V4ZA 4IDHA 3R9WA 2PCJA 2IS4A 4AI6A 4TSFA 1OF1A 1BKDR 1AZTA 2NIPA 4RSGA 1P75A 2OFOA 2P0EA 4TYPA 1L4UA 1U9IC 2ZRHA 1CBUA 2W2XA 2CHQA 2R8RA 4GZMA 4NP6A 1E2HA 2FSFA 2OT3B 1XD8A 4D81A 2BBOA 3VKGA 1G8PA 2FFHA 4B47A 3FMIA 3HPRA 4HAUA 4UNNA 3K09C 2H8KA 4US2R 4H1VA 5HTKA 5SZIA 3EPJA 2FWRA 2HF9A 1Z5ZA 2E9SA 2EFGA 5CK4A 2VH5R 4DKXA 2W2TA 4HYYA 1KDRA 1ZUIA 2BCGY 3AKCA 2Z0MA 4JLBA 2GK7A 4AYXA 5K8LA 1NJFA 3V4RA 2A2ZA 4RVCA 4UXIA 3F8TA 5FFMA 1P3JA 2IYYA 4OHZA 3EIQA 4QOSA 1O87A 4M1TA 3EW9A 2WKQA 3DPUA 3QBVA 2KB0A 2VHQA 3K0AB 2XXAA 1E1RA 1NVUQ 3SR0A 1KK0A 1KJYA 1NMXA 2XX3A 3SE0A 2VSXA 4NMMA 4JSYA 4A8JB 2CEAA 2NO7A 3PUZA 3A37A 3OAAD 4QFMA 1D5CA 1QG2A 2DYKA 2FH5B 4PR0A 5AUNB 3LLMA 3SYLA 4Q18A 4FW9A 4EPRA 1GG2A 5EXTA 2W6IA 3NBXX 1E79D 3U3MA 3VKWA 1E9RA 3THWB 1T5IA 3WHKA 2XGJA 4XTCS 1JECA 4B33A 5JECA 2OFXA 5FBLB 1JB1A 4KJZA 4QHSA 2YC4C 2BOVA 2CK3A 2W6JA 4P4UA 2D06A 1W2HA 1HEIA 1S9DA 4DSNA 1MABB 2FZLA 2EFCB 3EPKA 3I61A 2LKCA 1YZNA 1ZCBA 4IVQA 2ZI4A 1ANKA 4C3ZA 3ICQB 1ESMA 1K5DA 4IDNA 3RNLA 3K70C 3KKQA 2KJQA 4NE2A 5SZHB 1Z8FA 3AVPA 3K53A 5FL7A 2IF0A 1YR7A 3B78A 3DDCA 3QUSA 4JSTA 3SNHA 3EPLA 2ZEJA 2G6BA 4DDVA 1QF9A 2V7QA 3LD9A 4M9QA 4KODA 4DVGA 2B7BA 1XFAA 1Z0JA 3IPXA 3T06B 3AGPA 5FUYA 3VFDA 3A1SA 3AKEA 4R2IA 4QNRA 2IYRA 2ZRFA 1G41A 2CE2X 2R6DA 2QROA 1G5RA 1UADA 2WJJA 3IO3A 4AC9A 4Z1MD 3S1AA 4KSCA 1VIYA 2QAGC 3PXGA 2FZ4A 4W9MC 3JVVA 3QEJA 1ODFA 5CJ2A 1XCPA 2FSGA 2ZPTX 4HAWA 3VR1A 2X77A 3ASYA 1R0YA 4TT3D 1A2BA 1HURA 1UM8A 4ITRC 4WXRA 1SVKA 1Z06A 2PZFA 4MKHA 1CJUC 5DH9A 1ONBA 1OV4A 1WMSA 2Z5FA 4ZV4A 2JCSA 2QQ0A 2FSHA 2RGEA 3B1XA 3I5YA 3AVOA 2BJWA 4IFEA 4XVQA 1H65A 4GNKA 3Q7PA 4JVMA 2CVHA 4BECA 2CXXA 3I32A 5AJXA 3MMPA 3BH6A 3RS5A 1RYHA 1UBGA 4NYIQ 4HDOB 2WKRA 4IRUB 2JIZD 3TNFA 2F1JA 2OM2A 4XD7D 1W1WA 5HPYB 4E22A 4O0MA 1Y63A 2AD1A 1B23P 1KI4A 5K8IA 4DB4A 2AK2A 5JEEA 1OB2A 1E2DA 2J7PA 3IPYA 1N6KA 4X8LA 2AFIE 4HLUA 2Q0HA 3V4FA 1GKUB 2FV8A 3OESA 5DI9A 3DHWC 4R71A 4G01B 1F2TB 3WHLA 1SZPA 2CLCX 3PFIA 3KZ1E 3MWLA 2OBNA 2VTKA 1JEDA 3I4LA 4A2QA 2PZGA 1WDTA 4A2WA 1S1MA 4Z51A 1JEEA 2BVNA 4L4UA 2A5DA 4GL2A 3MWKA 4LBVA 5GADl 2BIFA 4ZCMA 5DNYB 2ZANA 1Q12A 2FDCA 2JJ1D 4XH9B 3QKRB 3CUEF 2WSSD 1VYUA 2QP4A 4EUNA 1M7BA 3E1SA 3TR0A 1Q22A 2I4IA 3T61A 2BHRA 1G4AE 3AUYA 3SYKA 2GCNA 4JLPA 4JBXA 1JQJC 1W7AA 3A4NA 4PHGA 4BLTA 4QM7A 4RD2A 1W47A 4O3MA 1GDDA 1LV7A 2QTHA 2YC2C 2GJSA 3AF4A 2CL7X 4LOAA 3RRNA 2QRNA 3I5XA 4DCVA 1QHHA 1IN5A 2HT6A 2PMDA 2HLDD 2RGBA 3BH0A 2RGNA 1ELOA 3IIMA 5FUVA 2BDTA 1XEXA 3QF7A 1JALA 1COWA 1FX0B 4LJ7A 4OJQA 2F3TA 5B64A 3A4LA 1KY2A 5TDHA 2QE7A 2GDJA 3K9GA 5E3HA 2IS2A 1FZQA 3R20A 3QOFA 1U0HC 3TIFA 2CCKA 4OI2A 3K1JA 1SVLA 4JVLA 4TMXA 3W5IA 4ZO4A 4BFTA 1MV5A 1W36D 4DSUA 3CR7A 3TSWA 2QSYA 1U9IA 5DHFA 3LBHA 4PZZA 4URWR 4JIMA 3A6PC 3QNUA 4PO1A 1E9AA 1VYTA 2AWNA 2BJVA 3KQLA 2GCOB 3SEAA 3TH5A 2BKEA 4P4SA 5D3QA 3UIEA 1PV4A 4GOXA 2OAP1 2QEQA 1HTWA 3K09A 3SDZA 1G4UR 3GMTA 5HE8A 3TRFA 4BFVA 4EDHA 3KQHA 4PQRA 1U8AA 1BIFA 2IYQA 4A9AA 3KXKA 1VECA 2OSBA 3MLEA 1P72A 3V9PA 3DMNA 2O0HA 2UKDA 4KYIB 3B7GA 2ZAOA 2OV2A 3OEEA 4K46A 2F9LA 1NP6A 5CIWA 4TLCA 1EFTA 2WMOB 3FDIA 4QC2A 4OK6A 2C77A 2X1VA 5AJZA 2ORVA 2W83A 2H57A 1NY6A 2ZYVX 2V1UA 2F3RA 4FD2A 5EP3A 1Z07A 3OE7A 2YOHA 3JVUA 2V55B 2VQSA 3O8RA 4ZIRA 2HV8A 1Q1EA 2B92A 4LJYA 1R8QA 4ZDKA 4Q1BA 4QJ5A 4HLQB 4QHTA 4KFTA 3VKHA 2O8FB 3U7FB 3QKTA 4QM6A 5TARA 1QG4A 1T8UA 2HXSA 4D0LB 5IHPA 3KL4A 1VG1A 2LKDA 5JLJA 2OG2A 1XNJA 5J4VA 4G5QA 2ZE5A 1VG8A 4JJZA 2DFNA 3QEOA 4WAUA 3CWZA 1G8YA 4IXMA 5IDVA 3CX6A 3WNDA 4A82A 1UEJA 3BWDD 1UJ2A 1NBMD 3CO5A 3WRXC 5C18A 1EG7A 4KBGA 1W4BA 1XTQA 3HU2A 5EUMA 2C03A 3ADCA 2ZJ2A 3UMSA 2O8BA 2GRJA 1SULA 2AXPA 4GI7A 3KB2A 4XJXA 2AL7A 2PH1A 1OYWA 2A7QA 1F6BA 3GLGA 1TU3A 1IY2A 2GTPA 4EJSC 1EX7A 4OK3A 3A1WA 2QAGA 2R6FA 2VIIA 3CF6R 1D2NA 3GCGA 4JKIA 1NMYA 4CRWB 4DCTA 3BC1A 3DOEA 5BN3A 2DY1A 5AUQA 2FG5A 3H86A 4DLTA 4WBSA 3TAUA 1N6LA 3GLHA 2XTZA 2AK3A 3W8NA 4ARZB 4V0LA 3RRYA 3FFBA 1T9HA 3U2QA 2GZDA 1OKKA 1JXMA 1NG9A 5CB6A 1JAHA 4BZPA 4DWJA 3QPWA 4RD1A 5AUPB 2JLUA 2QRZA 4LBYA 2ECKA 2PBRA 4OL0A 5TVKA 2GILA 2DWOA 2ORWA 2VA8A 3Q5DA 3ZQ6A 5CYPA 1HH4A 3ADBA 5J4KA 2PLRA 3T12A 4N3NA 1G7RA 4C0JA 2OE2A 4CF7A 1G3MA 4BRWA 3RAPR 2QG6A 4IDPA 3CNLA 1JPNA 3IQWA 4C0AC 4IOLA 5EJEA 1OW3B 2EW1A 2O52A 3BS4A 1UEIA 3FVQA 1SVWA 4PAMA 4OQLA 2JLZA 3MGCA 3VMFA 5CLQA 4V0ME 2X2EA 4TL7A 1FQKA 3EZFA 4EAQA 4LDJA 2GVDC 4JT2A 4LRWA 1DAEA 4D2IA 3PEWA 4GT1A 4MITA 2IWHA 1PUIA 2OBMA 4S35A 3OIUA 1N6HA 1U8YA 5C2JB 4Q66C 2EYUA 3U3KA 3QENA 4U7DA 5JWHA 3A58B 2D74A 1BYIA 4LBZA 2CLSA 5DSZA 2IK8A 2WSMA 5C46F 2KWIA 1H8HA 1KI7A 2BM1A 2B6HA 1NSTA 4RKFA 4Y0VA 1Z08A 2QTFA 1WCV1 3EA0A 4FMCB 3NEJA 1RIFA 1KZ7B 1GUAA 2GXSA 4NCHA 4MRVA 1VG9B 2WWHA 4Q4HB 4Q4LA 1DARA 3TSZA 5FTMA 3LDAA 1M8PA 1XMSA 1JR6A 4CT5A 4AG5A 1OXTA 2WPDA 3L43A 5L3RA 5EE0A 1FNMA 3M1IA 3PG5A 5DI3B 2RH5A 4CYMA 4FCTA 1HE1C 1CRQA 2FA9A 3HPQA 1R5BA 2XJ9A 4XVUA 3I1FA 5FTLA 3GEEA 3X1DA 4F7WA 5EXXA 2WWFA 2CBZA 3CNNA 5F9HA 4TL6A 1AN0A 4B73A 3VR2A 2AN9A 1XRJA 1G9XA 4LHWA 4ESVA 3CH4B 1OSNA 1VCMA 2GAAA 2AD5A 2GJKA 1X1RA 3NBFA 4GOJA 4M53A 3U5ZB 4URZR 2G77B 2ZRMA 3MFYA 5J4LA 1E2EA 5IK2A 4TQ9A 4G3XA 2EU8A 3W6NA 5FOSA 3AF2A 2JJ2A 3LXRA 2EYQA 4R7ZA 1ZP6A 1U2RA 4NYJQ 2Q6TA 3DMDA 3LX8A 5LD2B 3AVVA 3BBPA 4I99A 1G7SA 2CCJA 2P3SA 4BFYA 4Q9KA 1ZVQA 4LPKA 3PIRA 1ZM2A 5EXSA 3ZVMA 4D4JA 2ZYUX 4EIWA 4UNRA 2ZJAA 5KO2A 3VNVA 4AD8A 1E4VA 1P2VA 1ZJ6A 4S2EA 3OEHD 1XXHE 1SHZA 2RKOA 4I1UA 4ON9A 1C9KA 5FUWA 3K0EA 2VSFA 2FPMA 421PA 5C1BA 2GJAA 2QMOA 4NH0A 3O8DA 5BWMA 1JI0A 4RCZA 4GOKA 3B5JA 1XJQA 4LWZA 1KK2A 4MRPA 3VU9A 721PA 4QRHA 1HT2E 2J46A 5A4JA 4M9SA 1SXJB 3NH9A 1FMJA 3HDTA 1DO0A 1TUEA 1TMKA 1IQPA 4JBYA 1S1CA 4B44A 3CRQA 1UAAA 3QKSB 1W4CA 2ZSAA 4EJSA 3ZDQA 2WV9A 1E0JA 1Z2CA 5LB2A 4BLSA 1XPOA 1OXSC 4GPTA 1S8FA 2C95A 1EFRD 1Z2AA 3Q5EA 2DR3A 2F43A 1JJVA 1JPJA 2D62A 1FOEB 2FFAA 1OH8A 1A7JA 2YV5A 4L16A 1NLFA 3EAQA 3B9QA 4XTRA 4ESHA 5KPDA 5JHHB 1S3SA 3VU9B 2IHYA 2KSQA 3C16C 3CRRA 2BC9A 5L8VA 3L2OB 3UWOA 2B21A 2G0NA 1KOFA 4EPVA 1T8TA 3LQQA 4AYWA 1OT3A 2A5JA 3WY9A 4OHYA 2DBYA 4OKSA 4B3DA 5FH9A 4DUGA 1E98A 1KJZA 5B58C 3ZZTA 1GL7A 2E87A 3FOZA 1FUKA 4DT1A 1N2CE 4AKHA 4KCGA 5FUXA 3W9YA 2OLJA 521PA 3KKOA 1R0WA 2CHVA 2WBLC 4RJLA 4ZDJA 2FSIA 4RFVA 2WKPA 3EIEA 3SJZA 5KSYA 1T5LA 5SZKB 2ZS7A 1X8LA 4HEJA 4MRRA 4A0HA 5L3VA 4FCWA 3R9IA 1CJVC 2ODBA 5G3YA 3MJHA 3W34A 1HA3A 1GTVA 1HYQA 2UZIR 4DDUA 3AP1A 1C4OA 1TU4A 2WIAA 3H2YA 2ZVPX 2ZRIA 5JI2E 3KQUA 1LFDB 1E9EA 3QY0A 1SKYB 2HEIA 2WAXA 3ONWA 5JZVA 4MQBA 2OZEA 1JAIA 1DAHA 3BORA 1Q1QA 4BEJA 1VYVA 4DDWA 3QSYA 1PVOA 3THYA 1QHIA 2GF0A 3PEVA 4L5BA 3ZQJA 1OLOA 2FOLA 1N6IA 2ANCA 2CJWB 2NO6A 5AJVB 4DLSA 4F4JA 1KIMA 3G5UA 1E9CA 2G1KA 2NPIA 3KKMA 4XSGA 4PSKA 3RS3A 1Y3AA 3NIBA 2GVZC 3BFXA 2CMKA 4BFXA 1XX6A 4Q1AA 2ZITA 4ASUD 1TX4B 3W6OA 3TKLA 5K8UA 1J8YF 5FOTA 1WE2A 4PFSA 4MDEA 3R9XA 1NN1A 4L15A 1QRAA 2XSZD 3A1TA 1PUJA 3TK1A 2WJYA 3AV0B 1QBKC 4W7SA 3KFXA 2F7SA 4DLZA 1SXJD 4FIDA 3RRMA 2W58A 2JDIA 4OHVA 4X8OA 2EFHB 1H8ED 2CDNA 2DHRA 3K0FB 1VG0B 4KI0A 5FPSA 2ATVA 3AVWA 4OQXA 3R8FA 3DEFA 4BZXA 3NHAA 1R10A 4EFMA 3I8XA 4O25A 2IS1A 3U7GA 3QF4A 4OJKA 1UF9A 5TB5A 1W0KA 5C4MA 1BH2A 1KMHB 1O3YA 1VPLA 2XNDA 1E99A 1E6CA 4EQ6A 4B35A 5JCPA 2YOGA 5BN4A 1EGAA 1J2JA 1KK3A 1OYYA 2SHKA 3EG5A 1F2UA 3D8BA 4ZI3A 3CRVA 1Z0AA 3CW2A 1MOZA 3L8ZA 5KYKA 3HR7A 2GJ8A 4RCYA 4UXJA 4DEYA 2XEXA 1NNEA 4DSOA 2GAOA 4IEEA 2N46A 4GP6A 821PA 2ZROA 3SQXA 1CJMA 3TAHA 1A1VA 1P61B 4LHZA 1OXXK 4Q47A 1WP9A 1KSFX 4NU0A 1CEEA 1E2QA 1VDZA 5JCZA 3REFA 4JL6A 4O2LA 1NVWQ 5J4YA 1HT1E 1MO6A 2GK6A 1JXOA 1GL6A 2W0SA 1JR3E 4X8HA 2ZSBA 4PHFA 1CKEA 3PEUA 4MUAA 5EE3A 1BS1A 3RSLA 1KDTA 2DFLA 3PCRB 1DAKA 2O0JA 1AKYA 2R65A 2DFTA 2IEYA 2OCPA 3AUXA 5AUOB 4DZZA 1IAQA 4D80A 4I1OA 4MYUA 5AR1A 2J87A 2JAQA 5J4HA 2IBMA 4TL8A 4PPGA 4M21A 4CEJA 2MSCB 1ZRHA 2YWFA 3OFND 1RZ3A 3HYTA 4PQYA 5DN6A 2IL1A 4EFLA 3ZS9A 2J0UA 5FBQB 5FPHA 1TTTA 4TTRA 5H68A 4D0GA 4X8MA 4QGAA 3CWQA 3EWSA 4V03A 4UXHA 4RD6A 1G1MA 2E1RA 2ZI6A 2C9OA 3KFVA 2ZJOA 4AKEA 4RD3A 3NG1A 4P32A 2QY9A 2PZEA 3PVSA 2HJGA 4PC1A 1G8FA 3UKDA 3SHFA 2XXAB 1R7RA 3WNBA 1G20E 5KSZA 1NKTA 3CF0A 5P21A 3UMFA 4B75A 2D3WA 5HR5A 5JSZA 5FI0B 3UG7A 4D26A 1YVDA 1W36B 2R2AA 3RHFA 1WBBA 4LJ8A 2IUTA 1DG3A 4JT4A 3SC3A 4ZCIA 2REXB 3RSOA 4MGZR 2RCNA 5CB8A 1E9BA 3T5GA 2QP9X 2AKAB 1GWNA 2GNOA 4KHZA 4YONB 2F1RA 4BE7B 2QENA 5DHAA 1W49A 1RRGA 5JHGB 4LCBA 4QBHA 5IT5A 3CNOA 4NCJA 5GJWC 2P65A 4MYHA 3SZRA 2FF7A 3CZPA 1KO4A 1CR2A 1US8A 2GCPA 3QQ5A 4LYFA 1KK1A 4YC7A 3ZIAA 2PEZA 5HKKA 1RYFA 4LBWA 4M1WA 5CDFE 3FKSA 5F9FA 1E9SA 3KTAA 4CW7A 5FR1A 2PJRA 5KTYA 4TLAA 2WJIA 5FTNA 1VMAA 4G5RA 4IOMA 2JA1A 2GXAA 5EE1A 4H9GA 1G17A 2JLRA 3CX7A 4M22A 4TLBA 2O8EA 1HV8A 1VCNA 2CL0X 1U81A 3U4QA 1IBRA 2JDID 2WAYA 3I3SR 3GLIA 1ZAKA 3T35A 4TZ6A 5JMTA 3CR8A 4PTLA 1PJRA 3CPJB 4CDGA 3S1AB 4IEIA 1BYUA 1ZINA 4QJ3A 1OJLA 2QP3A 2WJVA 3ZGXA 3GLFE 1US8B 1A82A 1NIPA 2JASA 2PMKA 1A2KC 2V54A 4HAXA 3RWOA 1N6NA 3UG6A 1U94A 4OQNA 1II9A 4TSFD 2GBLC 3P26A 1MH1A 2FE4A 2ZS9A 3FPAA 1KMQA 5TV2A 4C7OA 4I4LA 4PAOA 3WYGA 2GXQA 3OZXA 4A6PA 1FP7A 2A5YB 3IIJA 4AG6A 2BMDA 1AIPA 2C96A 1ZM4A 1XMJA 3GLIB 1TEXA 3VHLB 2BMEA 2OCAA 2VEDA 3TMKA 3IHWA 3C4JA 4Q7LA 4I1SA 1Q1ZA 2OXCA 2ZI7A 3EARA 4XWAA 1S3GA 3LV8A 1ZBDA 2GETA 1E2JA 2Q9BA 3CRMA 4NONA 4B74A 4HUQA 4P0TA 1NVXQ 4B3XA 3DKVA 4QBFA 4A36A 1R5OA 1UDXA 2CCGA 3THOA 4LV8B 1XMIA 4CEHA 2Z4RA 1E2MA 4WW0A 1CP2A 1D2MA 4Q9HA 1UKEA 3SYNA 3WMGA 3EIHA 1E94E 3DL0A 2VHJA 5JS7A 5CM9C 1E1RD 3AGQA 1L4YA 3LBNA 2D7CA 3BAFA 4O2RA 3TJZA 1M6NA 3FE2A 3FYHA 4HB2A 1CF4A 4F38A 3TVTA 4UNQA 1YRBA 3BE4A 3ADKA 2O8CA 1NSFA 3BGWA 1IJEA 2CNWA 4KFRA 3LLUA 3E70C 3IGFA 2PJZA 1QHYA 2W6ID 3GJ0A 4M9ZA 3C5HA 1Z29A 3SJBA 3LY5A 2BCJQ 1FFHA 1TF5A 3CM0A 4PXAA 3T1QA 1AJEA 4PO9A 2REBA 3AVUA 1QHHB 4LGMA 3AVTA 1DTSA 3B6EA 4IDOA 2CK3D 4RFSA 2B8TA 1XEXB 2W6JD 4A0FA 3U7EB 4HAYA 2OXRA 4Z54A 5KNDA 4HAVA 1CJTC 5GVSA 5L3SA 1V5WA 2H7VA 3H84A 2C99A 2DB3A 2BBWA 5J47A 3BH7A 3A1VA 1MKYA 4JVNA 1NI3A 4WOPA 4CIDA 2CVFA 4GFDA 2P5SA 621PA 1S96A 3IUYA 5TMPA 1GNRA 3MRSA 5FL7D 4A4DA 1HQYE 4ACAA 1ESNA 3F5FA 2V7QD 4POAA 4UJ5A 3CBQA 1DG1G 3UWKA 2ZIAA 1XTJA 4BASA 3TQCA 4JZKA 4EPYA 1G16A 3TW8B 4P4SB 2XZOA 2C98A 4PANA 3F0TA 3SBEA 3MAAC 4TMVA 1RPZA 1ZMXA 1XTRA 3KUCA 3AEZA 2DWPA 1LS1A 3EX7C 1KI2A 1X3SA 2QPTA 2JLSA 1NL3A 3FKQA 1M1YE 2GXUA 1QDEA 5CITA 4KLNA 2XOKA 5E95A 1KSGA 1Z63A 1TQDA 3CKLA 2I1QA 1G5TA 1IN6A 2PT5A 1GNPA 3U6BA 121PA 4MA4A 2BMJA 5FPTA 1Z22A 2IYVA 2ZI5A 3ZZ0A 4MH0R 4TYNA 1FTSA 2NO1A 1OH7A 1DPFA 2H1LA 2WM9B 3ZJYA 2Q9AA 4TTPA 1DO2A 1XXHA 2Q3MA 3DZ8A 4NKRA 3T5DA 4HSEA 5JWOA 3LW7A 4ZIRB 3AB3A 2J0VA 3QVVA 3BFVA 2ZS8A 3QVUA 5CM8B 4ACBA 1GITA 4C0LA 4ZDIA 1KHTA 4EPXA 1FQJA 3VHXA 2J7PD 2WWXA 5JRZA 1OPXA 1RJ9A 4LY6A 5BW8A 3X1ZA 5LB4A 1EXMA 3WRYC 2HCJB 2FPLA 4Q03A 1I2DA 4TZ0A 1YZUA 4YQFA 5DYIA 2DWQA 2ZRKA 3H4MA 1KKLA 2ZRDA 4LI0A 2FEMA 2FGJA 5M04A 1P7CA 1YHNA 3DM5A 5JBQA 1M74A 1G3RA 4C30A 2VHCA 5G41A 4FI3C 1X8KA 1D8TA 1KSJA 2ERXA 5IF9A 2C9YA 3K70B 1UDWA 4DHEA 1R0ZA 3GJ3A 3FB4A 3CPHA 3WYFA 2O8BB 2CHGA 1HE8B 4RD4A 2QA5A 2MSDB 4MRSA 1EFCA 1AQYA 3U61B 1T0JB 2IWRA 1XF9A 2BEJA 3GLGB 1NBME 4GDFA 4R9UC 1TL7C 3FGNA 1OB5A 2RGDA 1LS6A 4JLAA 3B1YA 3CZQA 4FXPA 1N5IA 1W4AA 2QAGB 1N6RA 4LJ4A 4C0HA 1IXSB 1G5PA 3N70A 1COWD 2C9CA 2IUUA 3PJRA 4NCNA 1P2TA 1R0XA 2VP0A 2ONJA 2QE7D 4B3GA 4YMSA 4GSYA 3KB1A 3GLHB 1ZW6A 3ZVRA 2WOJA 2GBLA 4KV9A 3U3JA 2FU5C 5KSPA 4Q01A 4M2LA 1IONA 1GOTA 3FMOB 2D7DA 3BB1A 3I8SA 2YOFA 3THXA 2WJGA 1E96A 3VR5A 4OI4A 2XITA 3ZYCA 3BB3A 3QG5A 4DBLC 3Q3JB 3WNCA 3GD7A 5F98A 2NO0A 3EASA 1TPZA 2OUKA 4I1VA 2J41A 4D82A 3EC2A 2AR7A 1X86B 2N1BA 4PSVA 1W5TA 3HWSA 1FUUA 2BEKA 4P33A 1OXVA 5L3QA 1GRNA 3X2SA 1Z28A 1E9DA 1XBTA 3UK6A 4E5UA 2DFKB 2XTMA 4KITB 1CS4C 2FJUA 3GPLA 3L0IB 4DLVA 4LJ6A 1G7TA 3QJYA 2AHOA 4OK5A 2PX0A 5AJWA 3NWJA 3OEED 4KU4A 2IYSA 1E9FA 2IC5A 2Q21A 5EXPA 1D2EA 4MYCA 3EWAA 4YXWA 3MUFA 1GSIA 4G5OA 4PC7A 3ASZA 5ELXA 4ZI2A 1S4QA 2XJ4A 3NC1C 1E3MA 3LAWA 3OE7D 2C5LA 4WZAE 3LH5A 1KAOA 4A0GA 2GJ9A 4B2PA 4Y0AA 6Q21A 5LDDC 1E2FA 1NLZA 2A5GA 5BYKA 3MWJA 2FFQA 3LVRE 3U3RA 1PLLA 3GEIA 3BERA 3KKPA 4BLQA 4E07A 4KXFB 1J7KA 3SQWA 4AYTA 4LZZA 4NCKA 4Q1FA 3RVBA 1KO1A 4HZUA 4DRZA 4GMXA 4JLNA 1Q1BA 2F55A 3EZ7A 2G88A 2QAJA 4LYJA 4MKFA 4Q7KA 2O8DA 4D6PA 1AM4D 4D4MA 2O0KA 1DAMA 1KY3A 4LUCA 2ZXUA 5K8TA 3K70D 2ODWA 1IY1A 1P9RA 2YINC 2J1LA 2Z43A 2MMCA 3AF0A 4QKQA 3HR8A 1XD2A 3NH6A 3P27A 1W0JA 2GZHA 3VX3A 2GZAA 3NHBA 4YLGA 2D4HA 3BRWD 1IY0A 1IXRC 4ZCLA 2ZSFA 3ZZUA 4E09A 2Z4SA 2RB4A 3AP2A 4M9XA 3FFAA 3ADDA 2QTVB 1TQ2A 3GJ5A 3RWMB 1MO3A 3DVLA 1NN5A 2VHTA 4L8GA 2QBYA 1WB9A 1VKJA 2ZU6A 1TQ6A 2RMKA 4KFUA 3V00A 4A8JC 4RD0A 3LO5A 4TL9A 4NYMR 2ZI9A 3SHWA 2R9VA 1Z0FA 4IFBA 1DAIA 4HUTA 2WHXA 3K0CC 1XD9A 1JR3A 2V6IA 4BFWA 3KQNA 1FL9A 4IVPA 2ZUDA 4TMWA 1EWQA 4URVR 1OKKD 1WRBA 5EQTA 5KNCA 1PLKA 1XD2B 3KKNA 1RVDA 1E2GA 1F60A 1M7HA 4Z8YA 1T6NA 4QGGA 4AWXA 5G53C 3QXCA 2NGRA 2R6AA 3QXJA 4BWYA 3QXHA 3RS0A 2KI5A 4KO8A 1P73A 4RKEA 3ND8A 3VR3A 1XEFA 1ZD8A 4PHHA 4Q4AA 5H1YA 3ECCA 2QBYB 3SFZA 1SHKA 1Z0IA 2P6UA 2QQEA 3IDQA 3IQXA 5GJVC 5JS8A 2YJTD 4HLCA 5KDLA 3H1TA 4M1MA 1JBKA 2VP4A 4JYCA 2V8OA 4Q02A 4Q1DA 2AFHE 4D4LA 1Q44A 3U44A 3HYRA 3OIYA 2PCLA 4BZQA 3HJNA 4JKYA 4MGIR 1JNYA 4XIGS 3JZMA 2P6NA 5CIQA 4ILEA 4TYWA 1GRRA 1W2GA 1FP6A 3W8RA 1Z6XA 4PHTA 2G0TA 1BMFA 1N5LA 1KI8A 2EQBA 3BB4A 4URXR 1IM2A 3LXXA 1OH5A 1AKEA 1F48A 1KNQA 1T3SA 2QPOA 1S0UA 2IEZA 2HXYA 2H16A 3Q7QA 1T91A 3BJIC 4MGKR 4EJSB 3NEYA 3PUWA 4LYAA 3WP1B 3GP8A 4FMDF 2R6GA 4M1YA 1H8HD 1TNDA 4Q21A 2F43B 4AK9A 5FOVA 4BUJA 1XDBA 1DE0A 2F6RA 3OAAA 2L0XA 2GHIA 3K9NA 4IHQA 4V02A 5D3MA 4DJTA 2RGGA 3G82C 2OILA 2BBTA 1XPRA 1ZM7A 2WIBA 3QIAA 4JJKA 1ZUHA 1WXQA 3AH8A 4N0EA 1AQUA 1U8ZA 3UANA 1II8A 5KU1A 1E79A 4Q7JB 4DCSA 4W5JA 1C1YA 5ANRB 1U0JA 1E69A 5JEDA 1YJ5A 2BM0A 3P4XA 4XVRA 5CDFA 2WPDD 2YWHA 1Z0DA 3OIWA 3KJEA 1NF3A 4NBSA 3NBYC 1DAGA 5CYOA 2OAQ1 2WWGA 1G291 4DT1B 5FBVB 1E2NA 2D2FA 1KI9A 2JLQA 3EC1A 1GRQA 1U98A 4PPFA 4Q4JA 1EESA 4FMDB 1Z6GA 4MYTA 1N3BA 1AA9A 2FNAA 4B6EA 2TMKA 2JLXA 1IXZA 4WVFA 3IEVA 1D6JA 3OIVA 3VNUA 3R7WA 1J90A 4XSHA 4G5SA 1I4TD 5DYGA 4ZDWA 3GLFA 3LQRA 2DCUA 2XAUA 4ZPXA 4QG7A 4XWOA 1DEKA 2MMGA 1KGDA 1Z6TA 3GFPA 4DEXA 3C41J 2QSZA 2IXEA 3NDBB 3EZ6A 5FOWA 1RRPA 2RHMA 3Q85A 3MG9A 3W5JA 4C0BA 5IK2D 4YMVA 2JJ2D 3WBJA 1YQTA 4Z1MA 3P20A 3O8BA 5B57C 2NOAA 1RW4A 4G1UC 3THYB 4YMUA 3PENA 3TBKA 4TT3A 3K9LA 4YDSA 3T15A 3W6PA 4D4KA 1KI6A 2JEOA 3UXMA 1ZD1A 4JLVA 1L7VC 4QBGB 4LV5B 2V1XA 3DZDA 2QMEA 4HB3A 3IO5A 4WZ6A 5EP4A 1CXZA 2BV3A 5KDOA 2FMXA 2WVJA 2JIZA 3JZAA 5E7JA 8OHMA 1G64A 4LV6A 2Y8EA 1QVRA 4XD7A 1LF5A 4PC2A 4N1AA 4AY2A 4Q00A 3B1ZA 3WXMA 4FN5A 3ZD7A 3SBDA 1NJGA 1KAGA 2ORIA 2AXNA 4TMZA 4CEIA 5FBRB 5CJPA 3T1VA 1CIPA 2GEVA 4AKGA 1L8QA 3LNCA 1YR6A 2N42A 4GBMA 2H17A 3P32A 4PQFA 3RABA 3LFUA 3BIFA 3DKPA 4BQSA 3K0AA 4GMDA 1OFTA 4II7A 1YZQA 3GQBA 4QXAA 5B2ZA 2JJ1A 3LRPA 3Q8XB 1SXJE 2NMVA 2WSSA 3QF4B 4A8JA 3J81k 3B13B 2XNSA 1GAJA 1E0SA 1N6OA 2VSOA 3QPUA 1LY1A 5F2EA 3BK7A 1G8GA 2X19A 4DLXA 2W0MA 4EQ6B 3M4YA 3K0CA 3F3YA 4Q1CA 3P4YA 1F2UB 4QBIA 4UNSA 1WBDA 2Q3FA 2G3YA 4LHXA 4DIDA 1EK0A 2ERYA 1BMFD 4L9SA 3THWA 3M6AA 1UBFA 4Q9JA 4KYUA 1OHHA 2UZ3A 3NDPA 1P6XA 4ZKDA 3KQKA 4CEIB 2HLDA 2AWOA 2ODNA 2VPPA 3CH5A 3TUJC 1NRJB 1N5JA 1YR9A 4C4PA 4DUGD 1MRSA 3LBIA 2QM7A 1MABA 4M0LA 5BXQC 5EZ6B 2JLWA 2ZETA 1AGRA 4D25A 4IOKA 1V43A 1G3IA 3RYTC 2OFWA 4ERNA 2Q3HA 1LVGA 3MJRA 1F5NA 2QI9C 1IN8A 2FFBA 4MKIA 1LTQA 1P5ZB 4E03A 2GEDA 1NY5A 1XCGB 2JATA 2ZSEA 3ND9A 5A0FA 2JLYA 2ATXA 4AURA 3SU8A 4U5XA 3CX8A 4Q1EA 2QGZA 4B71A 2VP2A 4FCVA 3L0SA 4HZIA 3U60B 3B85A 2A78A 1Q21A 3MCAA 2ZAMA 1UBCA 3T1TA 4CEJB 2QGNA 3FHOA 1ZC3A 3CONA 1NG1A 4TYQA 1SVIA 4NYIR 3GJXC 2YYZA 2J0UB 1E2LA 2ZYTX 2VF7A 2V9PA 1N6PA 3SJAA 2BMFA 2KBFA 3KXIA 3I92A 5TY0A 3DM9B 1GZSA 1DELA 1ZD9A 2K5UA 4J0QA 3VQTA 1SKYE 2IYXA 1UKYA 1D9XA 2J59A 2CLDX 1SVSA 1E1QA 1SVMA 2QT0A 3FMPB 3C14C 4QJ4A 1TUIA 2WTUA 5EP1A 2G1JA 2BKUA 2W2VA 3I72A 5HCNA 1KTVA 1T0HB 1N0WA 3KJIA 4RZ2A 3EZ2A 5JSZB 1U0LA 5C4GB 2VLIA 5UKDA 2R6CA 2H5EA 2YNMA 4EKDA 1P62B 1FMLA 4PZLA 1KDPA 1A4RA 4C9BA 4OI0A 2JJ8A 1Z6AA 1KKMA 1CRPA 5LBIA 2FX3A 2IYLD 1YE8A 2EVWX 3AQ4A 1WF3A 2FGKA 2REOA 1F2TA 2ZJ5A 3O8CA 3LVQE 1AS0A 1SGWA 2OHFA 2F1HA 4LJ5A 5H8WA 1GKIA 3RS7A 2GWHA 2PX3A 1KDOA 1IOZA 2ZJBA 1TEVA 1NN0A 3ICEA 1NBMA 3QKRA 3WYAA 1XZPA 4B48A 1YZKA 1OE0A 2ZRLA 4JLJA 5JJKA 1W0KD 1J70A 2XNDD 2XZPA 2ZJYA 3PQCA 5E7MA 2NTYC 3KTAB 3X1XA 2XB2A 2NZ8A 4RZ3A 4F93B 2XTNA 4U00A 1DBSA 2O8EB 1X8JA 2P6RA 1KNXA 4CT4B 3VX4A 3PUVA 3U4QB 3EPHA 1XCMA 1P2SA 1W46A 1GFIA 4V0NA 4KSBA 4V0MA 4B43A 1EFHA 4LHYA 1U99A 2ZRGA 1T3LA 5G40A 4B3BA 1GM5A 1WA5A 4IXNA 2J0SA 2J9RA 1AS3A 3SI7A 1PZNA 2NG1A 2IA5A 1FX0A 1G21E 2IXGA 3WMFA 5A5GA 2V3CC 2A5FA 4JS0A 3AF3A 5E7IA 3N2IA 3TE6A 3HU1A 3AVQA 2ZJZA 1KSHA 1Q0UA 4OHWA 1OFHA 4HAZA 4QNMA 2VHUA 1L2TA 2P67A 5E4FA 3WBKA 4C2TA 4MRNA 4C7OB 1E32A 4URUR 2GCOA 1NIJA 4Q9IA 4B76A 2EWWA 4C2UA 2C04A 1OHHD 1W5SA 3QBTA 4C0KA 2WWWA 1MO4A 5DN6D 4TYYA 3B82A 5AK0A 1NKSA 2DPXA 4Q7MB 1XTKA 1R8SA 4LK2A 2HDNB 1G18A 2YWEA 2F9MA 4LC0A 4RZUA 4P4TA 4HUQB 1QHGA 3RC3A 4NPHA 3TUZC 4Q48A 3ZD6A 2V6JA 2OESA 3I62A 4CEHB 4M1KA 5TXGA 1Q3HA 4A1FA 3U6KA 4HLDA 3KJHA 1Q57A 4MUBA 4V0OA 1T4GA 5KPJA 5AWFC 1YU9A 1GIAA 4LJAA 4MKGA 4BLRA 2EWVA 1XMVA 2IT1A 3EA5A 3VAAA 1E2PA 5FBWB 1HY3A 1EFUA 1N5KA 2O8CB 5KHOC 4GZLA 5LD2C 3TR5A 2MSEB 3QKUA 3NBZC 2OCYC 2ZE7A 4R2HA 2IW3A 4MGYR 2O8FA 4A0RA 1QHNA 2IUSA 4TN1A 4BEBA 2C2HA 1PLJA 1UFQA 2Z6VA 4QGFA 1OIVA 2VL7A 3FHCB 1Q20A 1KO8A 2P5TB 3OF5A 1VHTA 1CR4A 4TLDA 4RFSB 1ETUA 2ZI3A 3K8YA 4IJMA 1LNZA 2NZJA 4OQFA 3H0KA 1IN7A 1E1QD 2ZYWX 1TF2A 1ZU5A 2Q9CA 5L3SB 1W44A 3ZIAD 5HKKD 4M8NE 4DXAA 1CU1A 1ZU4A 2I3BA 4MDFA 1ZNXA 1NMZA 1XJCA 3FKSD 4TMTA 2ZUBA 1W48A 2WOOA 4HDCA 5KOYA 1SXJC 4M4SA 4CGZA 2QU8A 2WWYA 3BD9A 3AVXA 1OIXA 4UQOA 3DOFA 3PV0A 1P9WA 4PAQA 3P1JA 3ZVLA 4C0SA 1XWIA 1P9NA 3FWYA 4DLYA 1VCOA 3D31A 3TGPA 3RS2A 4W5HA 1S2MA 5SZJA 1YKSA 3QG1A 1XP8A 4RY2A 4CVNA 1XPUA 3FHTA 1QHXA 3WP0A 5BQ5A 1GVNB 3IBGA 2XB4A 4ARZA 2ZTSA 1ZUNB 2WWIA 1RFLA 1ZCAA 3KDSE 4F4IA 2IYTA 3HU3A 4PO8A 2GESA 1GNQA 2YHSA 4B2IA 2RGAA 1ZIOA 1YR8A 1G3UA 1R5NA 4C0QC 1YRAA 2CL6X 4IVRA 2J0QA 4G0NA 1R2QA 2J7KA 4GRAA 2ZRJA 1KZGB 3X1YA 4A6XA 1XXHB 3WMEA 3E5HA 2PT7A 3C15C 2ASEA 5EUQB 5CK5A 2XZLA 3K9HA 4DDTA 2BWJA 3ETLA 5G3ZA 1EX6A 1P60A 1RJ9B 5FTJA 1P4SA 2VP5A 3KUDA 1LW7A 1SKQA 3L0OA 4JLKA 4WZBE 3M0EA 4JVSB 5FTKA 2LCFA 3OEHA 4A92A 3IIKA 2JGNA 5F3WB 1I4LD 1MT0A 5JWRA 3GLIE 5JJIA 4JLOA 1LB1B 3AP3A 4HB4A 3R8CA 2LWIA 3NTUA 4KFSA 3CLVA 4IOJA 3VTKA 4OI1A 4NHOA 4PX9A 4URYR 2GEUA 3LW8A 1G6OA 1IN4A 5JRJA 5IRCD 4GP7A
chains in the Genus database with same CATH superfamily
3CLSD 4ZO8A 4JP5A 4CLOA 4HBGA 1IY9A 2IVZA 1M2OB 4HI0E 4OBEA 1E0AA 1NHWA 1U0GA 3BAZA 5HE9A 4CF3A 1MW8X 5TT1A 3N2EA 4N0DA 5KTNA 1U1EA 4CKZA 2XXJA 2Z2XA 2A9KA 1WBBA 4XWYA 2FMUA 4QTUB 1KZHA 3U49A 1XZBA 2CB0A 4CCSA 2P2GA 4OIFA 1CIJA 3A4IA 3KYDA 3QY9A 4P08A 3VPBA 4ATNA 1CB0A 3T7KA 3VAZA 2JH8A 5JD4A 1ZKMA 3PX3A 1XOIA 5AM1A 1NN3A 1OIWA 2IKQA 1Z45A 2KE5A 1W76A 5ENZA 5A2QA 5KNDD 4AS1A 4HKTA 1DPGA 3O1HB 3MAGA 4RDXA 5A4KA 3K32A 1D6NA 4W7HA 3CVXA 1JJAA 4JL5A 1VLJA 2FYTA 2XYVA 3L7MA 4AIIA 3ZVNA 1AGPA 4JLDA 5K0CA 5EZ5A 4OHUA 1PJQA 4DA0A 4ZTZB 1VXRA 2FP3A 3O84A 3A3PA 5DVZA 1U2GC 4HGPA 2IYUA 4EO9A 3PLAE 1VIMA 4DSZA 5CVCA 1YDFA 3C0KA 4B3JA 3THXB 4TROA 5DI3A 4OXIA 2ZZNA 1VFPA 4ZKEA 1X15A 2BFBB 5HZHA 5L40A 5EE9A 2ASVA 5A02A 3LWZA 1R0KA 1ZCZA 5AESA 1J49A 1X7WB 3H5TA 5TJ9A 1EBFA 1RBQA 4I81A 2BBSA 4G8BA 1RYZA 1R4MB 1ZPDA 2A3RA 3N53A 4G23A 3HO1A 1RC0A 3WLPA 3VSEA 4ZU1X 4GMFA 2JLBA 4TQAA 5LP1A 3OP1A 2Z8XA 5MN5A 4UDYX 1DBQA 1M2NA 2YVUA 4GRIA 1M1NA 3IEMA 1ZA1A 2F3UA 2J3KA 3T95A 1LBEA 4KDEA 4YAKA 1QE5A 4PZDA 3D1LA 3JYOA 4OFBA 1GP2A 3N8HA 3OZDA 4NAVA 3R7NA 4D3ZA 2XOKD 3ORSA 4PNPA 1FSPA 3GG9A 4P5PA 1QFSA 4QIHA 3ROMA 2B8WA 1FDIA 3M89A 3UPUA 4KVAA 1KI3A 1XEWY 1MRNA 1E3IA 3IHLA 3INNA 4MDYA 4K9PA 3WIBA 3M7IA 4MQ5A 3DTYA 1GKYA 4CIWA 1UPFA 1UJ4A 1KJNA 2DQ4A 3K0BA 3VC2A 4N12A 1XXLA 3LYUA 1C29B 2AE1A 2Q1WA 1RLIA 2ZQZA 2XNCA 5CDTA 1PGJA 2ZB2A 4K86A 3FMFA 2QTTA 4PPNA 2HIMA 2ZRCA 5CVEA 1S2DA 1YZVA 2JHCA 3T7JA 3WQQA 3AVYA 3PJFA 2ZJ8A 4F4CA 1X14A 3CA8A 3I6YA 4JGBA 4OHXA 3ZS8A 1YZTA 6REQB 1G7CA 1OFIA 2DH5A 4M8LA 4V0KA 1W8IA 1ZI8A 3RAEC 1JGTA 1OAOC 2PZAA 2C4KA 4HZUB 4XOIA 2LR0A 3JWHA 1MGPA 1SR8A 1RVV1 4WN9A 2Y0DA 1EAYA 1IMOA 4MEJA 1E66A 1DO8A 5AJTA 3ZLBA 2DUNA 1RC8A 2VPTA 3RWBA 4AXBA 2OO7A 2XSZA 3HB7A 2MU1A 1DOZA 2WZQA 1X1TA 1I1HA 3IKTA 1QGOA 3R5XA 3LDFA 4MICA 1RQXA 3A6GA 1INLA 2ANBA 3PI7A 1IFXA 4L07A 4YRIA 5J23A 1J5XA 4IH9A 4NMWA 4YJHB 1R4ZA 1H8EA 4K81B 5EMMA 3T9BA 4IUDS 1CR1A 3EOZA 1SA0B 2G9NA 1G6HA 3LGAA 4RZXA 4D8XA 1XRMA 2M98A 2DJIA 2RHDA 3A8TA 1Z88A 3O2JA 4K1XA 4PZYA 1CJBA 4JIGA 5DRTA 1MAUA 2H59A 1VIAA 2RHLA 3I9MA 4MW6A 4PFQA 221PA 2IYEA 1EGVB 1U7WA 3SVTA 1ORWA 2WM8A 3UMRA 1L4GA 1SC4A 3KB8A 1T4CA 1C9EA 1XZQA 4G4SO 1CQZA 5DJ5A 5DX1A 3V4ZA 5HWSA 4QUJA 3M5PA 2HC9A 3WRXA 4F9GA 4OGLA 3ZR4B 1Y7IA 3MWDB 3OE4A 5IKPA 1PNVA 4F96A 2DM6A 4Q19A 1E4EB 4CF4A 3GLGE 1LTKA 3TXXA 1HTTA 5JNWA 3PE4A 4RSMA 4HG2A 5CLIA 5ALIA 3NC0C 4NCXA 2RAPA 1OZGA 1DQPA 2BFCB 3HCFA 1DJPA 1ZUWA 4ML3A 4PW0A 1BVHA 3OVMA 3PICA 4HATA 2F64A 2VBCA 1JEOA 2XY4A 4H7PA 4EPTA 5B3LA 2QUZA 5AVVA 5FR2A 2ZQ5A 1FNNA 3UOGA 1GDHA 2A3NA 1WOYA 1T2AA 2C83A 3HLTA 4TWZA 4XDHA 5B4TA 3H2SA 4IV0A 5EWMA 4I1YA 4F5YA 1HL3A 4BNTA 3TINA 2GRAA 5AKLA 3RRZA 5BSGA 1MR3F 1P1KA 2P40A 5F35A 2Z2KA 2Z8YA 4F5ZA 4G09A 4BQIA 5MF6A 1HC7A 3BUSA 5GJBA 2O5VA 2R62A 3D7LA 3FUUA 1VTKA 2FK8A 3AF1A 3L92A 1JNXX 1WAMA 1QIIA 3F97A 2QTBA 4EG4A 5JFTA 2ZR7A 2X8JA 3FI0A 3E6AA 2JFOA 2MR5A 5HX7A 3DZCA 2WAOA 3MTQA 1POXA 4BLPA 5JFGA 2R60A 2XT9A 2XCUA 4KRXA 2ARKA 5D51S 4AZSA 2PL3A 3RIHA 4R8VA 4ABYA 2VHYA 5HF5A 3QE9Y 4QXOA 1EWRA 2O2IA 3HJAA 1DBRA 1IRIA 2Q1UA 1F51E 3DAPA 3DTNA 4Y9DA 2OVFA 4M0CA 3AUSA 4WNAA 1G20B 5GJCA 3ZY4A 3IMEA 2IU6A 3GQVA 2QORA 3U9SA 1AUPA 3PWTA 5BNTA 5BSKA 1YFZA 3RC8A 2Q8NA 1W96A 2OCLA 4R8LA 3SK0A 3T1OA 5L4SA 1ADJA 2CMDA 1GGEA 2IJGX 3OJFA 3OHMA 3OZIA 1Q7TA 2G8NA 3ET4A 2ZE8A 3QXXA 1U90A 1LPSA 2CNKA 2CXUA 3A3NA 2W11A 1Z4LA 3B7PA 3KWJA 1SBHA 3OF3A 2J9FB 4L7QA 1B0ZA 1FFDA 3K9QO 4BB0A 2VAXA 4AO8A 1FUIA 4BZWA 1L0BA 3A36A 2DFVA 1DUVG 4D0NA 3UXEA 1YBAA 3OLZA 3KETA 2J08A 4V1CA 2W6MA 4BQNA 1G8SA 3D3NA 3C3YA 2HPVA 2AVNA 3KPVA 3L6DA 3OM9A 4TXLA 1Z4MA 2VNAA 4Y2XA 1HK7A 2VP6A 3GFOA 4R9RA 4DJJA 1V6SA 1R0RE 2O1SA 2P4SA 1HDIA 2PH5A 1ZNWA 4MR9A 4L9WA 4ZANA 2PMEA 1PBTA 1SOVA 2M9MA 3FPHA 2JIDA 4H3VA 3BFKA 1YZGA 1W0JD 4FYWA 3RS4A 5B6IA 5DLQC 3ZLVA 3S8YA 4TUYB 3P7MA 4HLUC 3UF0A 1CB7A 1QLJA 3H16A 4BP1A 5CA1A 1N1DA 4MRMA 1W19A 4MUMA 4L57A 5A6VA 1Z7YA 4U02A 1TIPA 1UK7A 1E0KA 2RK3A 2XLCA 4NDZA 4NDAA 4X45A 1GPJA 3C87A 2F3SA 1O94A 3OQVA 5HZMA 4E12A 4FE3A 3QWAA 1KMHA 2M1XA 4Q9DA 1M2VB 2Q4EA 2QK4A 4HYTA 4AQDA 4C06A 2HSZA 2Q6VA 2AJCA 2ZFUA 4OQMA 1J56A 1J09A 1Z16A 2DOKA 3GP5A 3EEBA 4Y2RA 5IXSA 1ZHHA 5LU8A 1Y8ZA 2X9QA 1JHZA 1H6BA 1JR3D 4OUKX 3SN6A 4LYHA 1QUEA 1W4RA 4EG1A 4B3FX 3QPVA 2H07A 3R3UA 2OBBA 2CYAA 3GY0A 2UVQA 4CG3A 4DTCA 4P31A 2YV2A 3KBBA 2HYIC 2PMCA 4PRZA 1PX2A 4MOWA 4B32A 1EX1A 4P3YA 3ETDA 4W6QA 3DVRX 2C1ZA 4M1SA 4HXFB 3O82A 3G0DA 3PHJA 3CCFA 1YQXA 3VVLA 4F85A 1H2WA 2DSTA 4IW3B 5ISMA 1V1MB 3VR3D 1W6UA 3EUFA 3QM1A 1HDEA 2X5XA 3N0WA 2BSQA 4U4AA 5CA0F 2H18A 1KI6B 1ULUA 3A14A 4Q37A 3AEUA 1QJ4A 1HKHA 3RS9A 2HMAA 2H2HA 3B2QA 2NYAA 3EEFA 3HGQA 1JDVA 1OF1A 1BKDR 1VHWA 3HEBA 1YOVA 3O4VA 4ANFA 3D4BA 1P1IA 2HUNA 3IAM1 1CJCA 1LPMA 1LQUA 4KIJA 2NM0A 1L7BA 3LGSA 2ZAYA 2NV2B 5FJIA 2FWPA 2R8RA 3NVDA 1BHSA 3G49A 2X9GA 1EDOA 1RKVA 4B47A 3KALA 1BFDA 1MDFA 4HAUA 3RARA 3S2ZA 1WUHS 1HSOA 3DV0A 5DTEA 4US2R 4U6SA 3H42B 2O6HA 1M5TA 2XD4A 4PZAA 1Y34E 1Z5ZA 3WWOA 1YCHA 3FJOA 4JLUA 4WKGA 2VH5R 4OREX 1YL6A 1ML3A 1PD0A 1XP5A 3ZGLA 4Q3BA 1HZZC 2V4UA 5LQKA 2ZAIA 2A2ZA 2GGSA 2XEDA 2GT1A 4MRAA 4Z6KA 1P3JA 1SXGA 2IYYA 3EEQA 1CS0B 2YCBA 3NCHA 3AX6A 3EIQA 1TYEB 2DPHA 3Q2OA 5FWYA 3EW9A 3QBVA 1LI7A 3JY6A 2KB0A 1E1RA 2D0OB 1EWTA 2WM2A 2CKDA 5EJFA 2HW8A 3JAKA 1JFLA 2XX3A 3E84A 3PNVA 4OATA 1TW2A 4D96A 3SE0A 4NMMA 1P8AA 4JSYA 3G6WA 1XJ5A 2NO7A 1EE1A 2EFJA 3D54D 2NSHA 3LOQA 4YASA 5DP1A 3SVZA 3EFBA 2PLNA 1WXWA 5BOVA 3BDIA 3ZGOA 5J2TB 3OHSX 3T41A 3KEOA 3LLMA 5EHNA 3SLGA 4FW9A 5E2BA 1W30A 5L51A 4QGBA 3DXXA 2WINI 3CEAA 1Y98A 5EXTA 3NBXX 2Q28A 3H9JA 3OJ0A 3SIXA 1QPBA 3VKWA 3A6KA 1E9RA 3THWB 1T5IA 4FKMA 1N2GA 4C03A 4XTCS 4RL6A 1JECA 1YF3A 2XGJA 4OXXA 5JECA 3NBKA 1WBJB 1KJ9A 1JB1A 3ZZMA 2REQB 2LW7A 2QX4A 2ZDHA 4QHSA 2VDWA 4QUIA 5IZCA 2XE4A 4M6WB 3R3VA 3A06A 3K15A 4WLNA 1ZOLA 1KZ9A 2R00A 3K6SA 1HEIA 4DSNA 1R8XA 5BWOA 3IHKA 1KEEB 3FPCA 4K28A 1T10A 2KQUA 3EAGA 4AF8A 3HADA 1VA5A 1YZNA 5SV2A 3ISJA 4NE7A 4QVGA 1ANKA 1OJ7A 4FFOA 1E2BA 4FLMA 4IDNA 1PT8A 1FVOA 4NSNA 5SZHB 4BKUA 3HN2A 5IDWA 3K53A 2JIQA 2IF0A 1YR7A 2YRFA 2C0PA 3M4NA 3K1TA 3QWIA 2WUDA 2G6BA 3ADPA 1PV1A 3EGDB 4F9TA 3LD9A 4CLRB 3IVMA 2CUTA 3A2NA 3GJQA 2BUCA 2C1XA 1Q1AA 3IR7A 4NU8X 2B7BA 1XFAA 2X1LA 3IPXA 3VKVA 3AGPA 1CETA 3ENNA 3AKEA 1W4ZA 4R2IA 5FUYA 3VFDA 3FBTA 5TC4A 1G66A 3R7SA 3CJQA 2R6DA 2DBVO 1NOJA 2H29A 4G1VA 1LD3A 4NFSA 3STTA 3L4KA 1R9MA 3PXGA 3IOMA 1U0RA 4W9MC 2C7VA 2I22A 1ZFNA 3Q6NA 3QEJA 1ODFA 1OAAA 1ST3A 1T36B 4LZWA 2B1RA 2FSGA 2FXVA 1AZLA 2Z9DA 3X3HA 4DNXA 4DNQA 1UM8A 2IX9A 3TI9A 1QB8A 1RBMA 1CJUC 4HNGA 1OV4A 1GUBA 1YCDA 4WOCA 1JWAB 5KNDH 1HQKA 2AMLA 2RGEA 3U1BA 5C1OA 4HNAB 4GNKA 1PNTA 3AT1A 5LOVB 5KQLA 3VH4A 2UUPA 1VL0A 1TA0A 3INRA 3RK1A 5LQNA 3I32A 5AJXA 3OSZA 3BH6A 4ZAXA 4NYIQ 2WKRA 4LXTA 4X94A 3SZ3A 5D1HA 2CNBA 3TJMA 2A0WA 3DHNA 4XD7D 1W1WA 2X58A 5HPYB 3NASA 2MDTA 2J09A 1B23P 3HZRA 2ZIFA 4HVLA 3BWCA 4IYJA 3L1IA 5A7FA 1OB2A 2KX7A 4FHCA 3IPYA 4FFVA 1N6KA 4JI7B 2A14A 1M10A 5DI9A 1PJ8A 3R74A 2VQEB 1F2TB 4DQKA 5HUJA 3VUEA 5HUHA 3HE3A 3N7AA 3PFIA 3KZ1E 3MWLA 2VTKA 1JEDA 1TA4A 4A2QA 4A2WA 4FGLA 5K0SA 1S1MA 4XFJA 3BMXA 2HLHA 4GL2A 1C3OA 4DDHA 3HQ4O 4BBZA 3H1PA 4MI3A 1WTCA 3OZTA 2JCBA 1PL7A 3OT5A 2QP4A 4BKRA 3G0GA 2VHZA 5D5HA 1PJ4A 3E1SA 2QTRA 4MGEA 2NVBA 1QF7A 3E3LA 4FP9A 4IWYA 3RUAA 2I2BA 3TR0A 4EKGA 1NR7A 2BHRA 3AUYA 2Q1YA 3SYKA 4JLPA 5F7OA 1E1KA 1JQJC 1NW9B 4JBXA 3UT6A 1I6MA 4BLTA 4RD2A 2QYSA 3HBFA 4O3MA 3WLEA 2D5BA 2QJRA 5HJEA 3IV7A 5CW2A 1ARZA 1E9VA 2W43A 3L6OO 1H9BA 1QR2A 2KM1A 1XDGA 2HCTA 3A1FA 3R6TA 3T3IA 1S02A 2WABA 2YJ4A 4YCCA 2A0KA 4QJBA 2RGBA 3FYUA 4L3OA 2ZJ4A 2NU6A 4CM3A 3D6FA 3OJLA 4E33A 4RZHA 3DW1X 1JALA 5AW5A 5KYWB 4LJ7A 5TMEA 2B4QA 3HXOA 5JYBA 1MAWA 5E3HA 2GDJA 3ANYB 1VM6A 3TLZA 5JARA 3K1ZA 3A26A 4ZQHA 3UJCA 3RK0A 3K1JA 4HK4A 4YRMA 1PWYE 4A6EA 4J1TC 1MV5A 1UQTA 4D57A 1JRLA 4DSUA 4JI2B 2IU3A 3D3JA 3DR5A 3ESBA 2QSYA 5DHFA 4JXZA 1ACLA 4URWR 4EJ2A 3ORRA 1VYTA 2AWNA 2YHUA 4U2CA 3EF1A 2GCOB 4M0FA 4EW2A 2YASA 3SEAA 4L08A 5BVHB 4C4RA 3ZDRA 3NP7A 5D3QA 1PV4A 4EGJA 4GOXA 1HTWA 1N4DA 3FCXA 5TQ2A 4E0BA 3TRFA 2JHAA 3MBIA 3ERCA 1IB0A 2XDWA 3RD5A 2W22A 4PQRA 1JE0A 3NAQA 4A9AA 1NW5A 3OZRA 3CF4G 2E2WA 2D2VA 4S0ZA 6GPBA 4WZAB 2UKDA 1I6WA 3H99A 3V1YA 4R5HA 2VC2B 4N5HX 2RJOA 1S2GA 3HJUA 1C7FA 4AI6A 2R4TA 2F9LA 2JKZA 2Y4OA 5H5JA 1MP0A 1S5PA 1YVEI 4ZO7A 4QC2A 5HF6A 4Q3LA 2R85A 1L5RA 3NIDB 4OK6A 2C77A 2X1VA 3FJYA 5NULA 2A1IA 2ORVA 2EZ8A 1A3CA 2X8LA 4EB0A 1QFZA 2F3RA 4FGWA 2J32A 5BRNA 1NVGA 3KHKA 2FZGA 1JFFA 2P62A 3LDGA 4RYDA 4DANA 4ZYYA 5BMVB 3O9MA 4MMXB 1PK7A 3D3EA 3HHPA 4MVWA 4R8SA 3O8RA 2WRZA 4EBBA 1JR2A 1Q1EA 1ZMRA 2M2IA 2QE6A 6PFKA 2B92A 1ZVKA 5A6SB 4DGQA 3N75A 2ETVA 3AFNA 4ZDKA 4Q1BA 4HLQB 1IOWA 4JJ8A 2A0FA 1BH6A 4KFTA 3FNFA 1WDMA 3OCZA 3U7FB 2ODPA 2QW8A 3QKTA 5TARA 2PFSA 2J3IA 3UK0A 1KAEA 3KL4A 5JLJA 2LKDA 2OG2A 1XNJA 3KU4A 5LNK6 1IU9A 3TQHA 2XUGA 3WJ7A 2TSYB 2XW6A 3KOMA 4JJZA 2DFNA 1TVKB 4UCQA 4WAUA 4EAAA 1Y37A 1RAFA 3CWZA 3WWPA 3HSKA 2A9QA 2D54A 4XYEA 1TZMA 4D9CA 2WFLA 4DIFA 5JJBA 3B89A 4Y6QA 1NBMD 1PSWA 4KBGA 1W4BA 1XTQA 3HU2A 4WHMA 2E6UX 2QMYA 5AKYA 2OK8A 1SULA 4RK0A 1YB7A 3KB2A 1UK9A 4ZEVA 4KN8A 1JSRA 1RWXA 3B5IA 2A7QA 3LUAA 4OAPA 3S68A 1LUAA 1UZAA 1V71A 3ITEA 8GPBA 5EWLA 4W63A 2GTPA 4FX2A 4AJNA 4L50A 2FAXA 4ZCTA 2VHVA 5AKKA 4C21A 2FE1A 3WV5A 1J8FA 1L5HB 1D2NA 1XRSB 3GUHA 3GD5A 3HVUA 5CGQB 1GVHA 3ZHZA 1GNTA 4DCTA 5IUJC 2DY1A 3EF0A 5AUQA 4OLAA 1C7JA 4NFYA 3TL6A 1XPJA 4JJ7A 4CGYA 1N6LA 2JLAA 4OLHA 2GN4A 4KXWA 3VTFA 1JPUA 3GLHA 3O7WA 3D1VA 1E5QA 3ELUA 3IDOA 4NAUA 4HPXB 3M9LA 2GZSA 1HE3A 2WF6A 2ZPAA 5LZ8A 3A1EA 2QUKA 2H0QA 4GGPA 4J0HA 5CB6A 3QMWA 4BZPA 4TVBA 3T1YB 3NDRA 1XVAA 1R4NB 1ZD4A 3OPXA 5C4IA 2ECKA 2P9EA 4OL0A 5TVKA 3IVGA 3RYCA 3WI7A 2JFGA 3OX1A 5I7HA 5CYPA 5LBUA 3WTBA 2AEMA 1IBLB 1NJ6A 2PLRA 5AK5A 3N0RA 1IPEA 4N3NA 1H0HA 2GDZA 1CDZA 3ENKA 5BSTA 3LGXA 2IUEA 4B4UA 4ZGWA 2NVOA 5IULC 1I1OA 1K8ZB 4BRWA 4QARA 4DA4A 4U3JB 1CHNA 2I9PA 1RLMA 4FTWA 1ONSA 1ECBA 3CNLA 2W42A 1OW3B 2EW1A 4KXYA 3ENVA 1M66A 1EJ0A 1EVIA 1RQLA 1UEIA 3FVQA 2TMDA 4OQLA 1SN7A 3EXG2 4TL7A 1WG8A 4J0GA 2YN2A 1DKPA 5ILGA 4D2IA 3AR6A 4LRWA 3KQPA 3TL3A 4BQRA 4F72A 1KEKA 4M37A 4LOKA 5CDUA 2IWHA 5H59A 4DWWA 4W5NA 4ZVOA 4D8TA 1F0PA 4WASA 4X63A 2DC1A 5BMOA 1TKBA 2GZ3A 4Y1GA 10MHA 3PL1A 4GC9A 3WL7A 2JI6A 2OGTA 3LCJA 4DABA 1U5AA 4U7DA 4O4HB 4IMJB 3VZBA 4XWTA 1JYSA 1QH1B 3KVYA 3DAOA 4ED9A 1QO9A 1MU0A 4CG1A 4GYYA 5IYZF 4MJLA 1KXJA 3I4CA 2FEXA 1QONA 4EX7A 5EMLA 2GA9A 5IYZA 2KWIA 1H8HA 1P2GA 3C7TA 4BGUA 2GNPA 3MXTA 1ODCA 2O19A 4N49A 4O02B 1WL8A 2QTFA 1NT2A 1WCV1 1HWYA 3N8KA 4MW4A 4XAQA 5LDGA 3CH6A 3SZLA 2JS7A 4H1WA 1JJIA 1PJLA 2QLBA 2SCUB 2WWHA 4MRVA 4Q4HB 3VO1A 1DARA 2DF8A 2ZSKA 4JA0A 3U7QB 4KIUA 3KHTA 4OFZA 3CYFA 4JBHA 2EJVA 3QVJA 1JR6A 1Q5PA 2DQSA 3AIIA 4CQMB 3ESXA 3ANMA 2XUKA 5EE0A 1FNMA 4ND8B 3PYMA 3PZBA 3AB7A 3F67A 1Q0QA 1GPNA 1TCAA 4R1LA 2H0AA 2PZKA 4KQMA 4DMKA 4JP1A 2Q4BA 3LZDA 3I1FA 2EJUA 4LFBB 3JVDA 4RPLA 5F7ZA 3CNNA 3CGGA 4R1NA 3VU3A 4FFBA 4A10A 4B73A 3ZV4A 5BUQA 1I2AA 3K72B 2CDRA 1CUVA 1XRJA 2UZ1B 2ON6A 4ZOBA 3DBVO 3L1HA 1OSNA 1JLMA 4MS3A 3QZUA 1F12A 4DQXA 4JYAB 4J2HA 1ABFA 4HQLA 5L7WA 1TK9A 1PG2A 2IY7A 1MMFB 1U8FO 3I6IA 3K6KA 4GOJA 1E18A 3WIOA 3DNFA 3NNDA 3H65A 1VGVA 5J4LA 1ZI6A 1YC2A 4GWKA 4IDFA 4IX1A 5AJHA 3DT6A 2GS9A 3KSAC 1WSDA 2AKEA 1P5HA 4RLFA 5HMLA 5CHYA 4AS3A 3A9CA 4OU5A 5GP1A 5JATA 4WN9B 3WYBA 2HR1A 2NNWB 3DMDA 3LX8A 2NXNA 3KVNA 2Q45A 1G7SA 1YRQA 2P3SA 3FSEA 4KLRA 4RX1A 4CFSA 2IXAA 4G5FA 3N07A 2NTVA 4MVJF 4PCAA 3PIRA 1LBSA 4DJFC 4E11A 4GXTA 4WNYA 1QIFA 3I5MA 2Y0CA 4MVJA 4X93A 4XJVA 5K6AC 3ILVA 3CN9A 2G8LA 4C43A 4UMEA 1EEHA 3NHSA 1U1IA 4RXUA 2VDLB 3AG6A 3IEPA 3OEHD 3C3DA 1RMYA 1YNOA 3PXAA 2ZGVA 4FJ0A 1R12A 3QPCA 3T4XA 3IFSA 3KYBA 2QIOA 4YHHB 1YI0A 4PLTA 3ZHBA 2QMOA 3O8DA 2DP4E 3KTDA 4D9FA 4AM8A 4YIHA 1BCSB 1R6VA 1XJQA 1AY0A 2J33A 3AG5A 4BMDA 4RVFA 3VU9A 2X8WA 4Q24A 1KE2A 1NQOA 4LDNA 3P9QA 4YQYA 4ECEA 4P3NA 4DF3A 4KREA 3HDTA 1TUEA 4FZ3A 4EMSA 1HG1A 2D1RA 1SB9A 3MGKA 1IQPA 5E6UA 4B83A 1EEXB 1R6UA 1DOHA 2AA3A 4FT4A 1W4CA 4PQEA 2A5LA 3T1HB 2G4LA 2ZSAA 3D7SA 1I7DA 4BLSA 1WZNA 1OXSC 4QYXA 1S8FA 4CMCA 5L6MB 3IIEA 1EFRD 2HNKA 4KQ1A 1L9XA 2C3UA 1JPJA 2D62A 3HABA 2BR3A 4MROA 3NHRA 3GRCA 1OH8A 1H94A 4GI5A 4LK3A 1U2EA 1PT9A 2QRUA 4LHSA 4QUGA 3NDJA 1XMXA 2D1FA 2P9FA 2VH2A 3JPWA 8ADHA 1FMFA 5TGTA 5FD8A 1RC1A 5KPDA 1O6CA 1QYWA 2BFAA 1GAEO 2AYXA 3ZWCA 2KSQA 4AT1A 4DL9A 3T5PA 2IFTA 5HOQA 1MPXA 1T8TA 5H7XA 2IY9A 1VPTA 5HIJA 1N9KA 4CL0A 4OKSA 3EDMA 4MIKA 4KLCA 4XB1A 1E98A 3RTDA 3Q6MA 4C4XA 4YCMA 1SAYA 5HILA 3L07A 3HNPA 4BMSA 5FUXA 3BJZA 2GYVA 1GTL1 4QFCA 3IJPA 2R11A 1D4AA 2WKPA 1H2RS 1PDVA 1T5LA 1PR6A 3KVVA 2A0UA 3IS3A 1EK2A 4ZAFA 5SZKB 4HEJA 2ES4A 4MQFA 1UWVA 4RPGA 3A3KA 3NIWA 1QR6A 4GP9A 3JZFA 3ANNA 2ODBA 4Q15A 2M6LA 3MJHA 4EL5A 4J49A 4DMLA 1TU4A 3H2YA 4F6RB 3M81A 4X62B 1M33A 3ONDA 4MPRA 3UMJA 3BFJA 1P1RA 1YDGA 2XQIA 1C2TA 2VNHA 3REQA 1XZAA 3NDIA 1EFDN 1GU1A 4X44A 4AG3A 1K97A 1QFJA 2CMGA 3LIPA 5FJJA 3N0TA 1W0CA 3ZY3A 3BX1A 4YRCA 1IG0A 1Q1QA 2EFYA 3WKDA 4BEJA 3QSYA 1PVOA 3THYA 3PSHA 1HORA 4L5BA 5G0VA 4YK7A 3ZQJA 4AX4A 1P4RA 3NOQA 2HPZA 2W71A 2CJWB 3A70A 4RKQA 1RWNA 4JELA 4ZT5A 2WFZA 3SQDA 3WLNA 4WJLA 4DR4B 4BP3A 1Z25A 3NONA 4P84A 1MPTA 2FJ0A 1LDBA 3TI7A 1RRVA 1OGYA 2G1KA 3KYCA 5D00A 3FLMA 4FZ5A 3TMYA 1J39A 1Y3AA 5BNWA 4C6TA 1K75A 2Z3VA 3DE5X 3PF9A 5B53A 1XX6A 2AFIA 2XE8A 4FDUA 4ASUD 4EYGA 4L5YA 4N76A 3QLUA 1O1YA 3R3JA 5BR4A 3TKYA 4KQXA 5FOTA 1LKZA 1D2RA 1NN1A 1A8PA 1QRAA 2H1VA 1G21A 1XQ1A 2J9YB 2JFVA 2JGLA 3WA7A 1CERA 1Z5OA 2X8BA 1BXRA 4UQPA 4YJ2F 1OASA 1U0EA 4GBGA 2ZIXB 3D5TA 3VYUB 3W06A 1MG5A 2FRDC 4GQBA 1VBMA 4CTMA 5FUQA 1YS7A 3RRMA 3VTAA 1ZK1A 2IHZA 4QUDA 1GG9A 4YO7A 3K0FB 1FVXA 1VG0B 2BFOA 2HCFA 4RJTA 2P78A 2VJCA 2ZLBA 3AVWA 2VDQB 4Z86A 4BIMA 1SKUA 3I2HA 5T3UA 2P27A 3R8FA 4GL4A 4CMJA 5IXYA 2QRHA 4GR4A 2ZUWA 2L69A 3GUYA 3BRCA 3DEFA 3PBKA 2AUTA 3PIIA 1PL0A 4BZXA 1JG2A 1MXHA 5B3KA 3I8XA 3B52X 3V97A 1LDGA 2NT4A 7MDHA 2IS1A 2IPNA 3OSUA 3W7AA 3OPQA 5TB5A 1L7OA 2Z9BA 4WCDA 1YQWA 4FUQA 1YK1A 2J3JA 4KQIA 4R0MA 1Q6YA 1QBGA 1O3YA 2GEBA 2C7PA 3DTVB 1E6CA 3SXPA 4B35A 1W5EA 3VUFA 2YOGA 5JCPA 2MCFA 1EGAA 1J2JA 5BO5A 3UJ7A 3AHFA 3WYNA 2JBAA 2R25B 4B45A 3KU1A 2J3LA 3WLMA 5KYKA 3IALA 3E5RA 1X1DA 4QULA 3B9RA 4RCYA 4UBJA 4EHIA 3K4QA 4AW9A 2HWWA 3IJEB 1F6DA 2BEUA 5FLYA 4DSOA 3CSSA 4IEEA 3QLVA 4GP6A 821PA 5I8WA 1CJMA 1K4KA 3TAHA 1K7SN 4PF1A 3TJRA 5HCUA 2BH2A 1CEEA 1HDOA 1YIOA 3MRVA 3AHGA 1HT1E 1OV6A 3TS1A 5I9SA 3T9FA 1GL6A 2C42A 4KXUA 2DWUA 5IBCA 4PHFA 5AVUA 1PYOA 2ORED 3TZCA 1BQ4A 1C7IA 5EE3A 1LC3A 4D79A 1KDTA 3CZ5A 3KAJA 3UHFA 2O0JA 1AKYA 2AG5A 2R65A 5F2OA 4D6YA 5JJCA 1KR2A 1Q7GA 1XA3A 3OZ7A 5IW8A 2QVCA 3AUXA 3RIYA 5AUOB 2JNWA 1PWXA 4P1ZA 1IAQA 2ZSJA 3CJTA 2JAQA 1NMQA 4G8DA 1PX0A 5CFRA 4JI3B 1DIGA 1CY1A 2MSCB 3TCXB 3H04A 1ZRHA 3OFND 1RZ3A 3HYTA 2IYAA 3QVTA 3NP9A 1TYAE 4G1EB 1QWSA 2XF8A 3L7CA 4K1LA 1GY8A 3ZS9A 2KMLA 1M83A 3N8NA 2WD7B 1SO8A 1GGHA 1V9LA 4D0GA 5H68A 4AMGA 5I4IA 5FLXA 3EWSA 1HTBA 4HO1X 3NYQA 3I09A 4UXHA 4BVAA 1GA1A 2WU0A 4RF5A 1EZ1A 2G9ZA 4HEQA 4IIJB 3M82A 4JWKA 4P32A 1N9GB 1XQYA 5DTIA 2PZEA 2WHPB 2D1QA 5HTOA 3L9XA 1O57A 1NDUA 2RGUA 2YXEA 4J0CA 4RVOA 3UKDA 4EZBA 3S8EA 4YUVA 4E32A 1G20E 1E7RA 3CEMA 1MUUA 2OGWA 5HR5A 1DC4A 2ZW9A 3UG7A 5LP6C 4QBKA 4RIFA 1YVDA 2CXNA 4D26A 3UB3A 4NJMA 5E3IA 1ST2A 1XNHA 1H1LA 1IYZA 2IUTA 4RIGA 3RTEA 1XDUA 3VR6D 5LUAA 1W9MA 3P0FA 3SC3A 4EHJA 1PTKA 1NMEA 1KH2A 3ESQA 4M9UA 1EUCA 3RSOA 1E9BA 2IY8A 4JBNA 3VDQA 3HMQA 1G2OA 1YO6A 1TRHA 2W8BB 4KHZA 1JA9A 4L27A 3JR3A 3PHHA 5IM5A 4HH4A 1LTHR 4O4LF 1W29A 5IT5A 4O4LA 4NCJA 1QK3A 3JZDA 1LBQA 4NF2A 2P91A 2IZ6A 2RAFA 4MYHA 4J16C 3RASA 2PKCA 4IO0A 2XBUA 2FF7A 3FSGD 4E1AA 4YV2A 1Z18A 3EXIA 4YVFA 2HMUA 3II6X 1US8A 4B81A 1XNRB 3QQ5A 2WUWE 4ZREA 3LC1O 4IO1A 2NYVA 2RGRA 2IH5A 1RYFA 1AK9A 1QDLB 1KPIA 4M1WA 5EI5A 3U40A 2X9VA 1X7ZA 2GB4A 1E9SA 3KOOA 4MAAA 2DMRA 4LZOA 5T4BA 2PJRA 5JCOC 3HJGA 5C1PA 4QELA 4MH0R 2DKOA 1PR9A 3UENA 5DM2A 1J21A 2JLRA 1N2BA 2PAAA 2XT6A 1R9NA 4TLBA 1U81A 1YTLA 4E88A 4UTOA 4GM4A 2C3PA 3Q3GE 3TRJA 3RJZA 2Q5QA 3ZHRA 4E6PA 1C1DB 3IKLA 4DC1A 1SK9A 3GLIA 3JAWB 5TSDA 3DMHA 5LC1A 4S04A 4PTLA 2IDJA 1Q7EA 5IX8A 4N0MA 4FKZA 3CC8A 4CDGA 4MYRA 3FCYA 1LBHA 3QFTA 4IEIA 4OMUA 3HCBA 3KEQA 4QJ3A 3S2YA 2QP3A 2WJVA 3QYAA 4RLHA 4PLHA 3PLNA 3NOOA 1D7OA 1CE8B 2AOTA 2P5YA 3BA1A 4P2GA 1YS4A 1NIPA 1UBNA 3DXYA 4TGLA 2UZ4A 3RWOA 1YULA 2GHTA 1RZRD 1II9A 3V5NA 2J4CA 3OD1A 1RWWA 4ZT2A 3HJCA 1QS0B 2FE4A 3FRHA 1KMQA 1TYBE 1XLTC 3OZEA 2R7KA 4C08A 2FY8A 4QRDA 1L5ZA 3RU3A 1SPXA 5KTMA 2QVBA 3JRNA 3LT2A 4WZBB 3WDKA 3WYGA 2AQ8A 2PGXA 1O2DA 2GLTA 4BGVA 1U2TA 3KAQA 1IZ8A 4ENQA 1XMJA 4D45A 1CUWA 5DZSA 3VHLB 1P17A 1YXMA 4IRMA 4RGQA 2QHXA 1I13A 2BGTA 1ESDA 3T7AA 1BRMA 3EARA 3Q41A 4YGXB 4C0XA 3LV8A 2GETA 4NONA 4M49A 2X86A 3CEPB 3TOXA 4E70A 1M8GA 1BWPA 1NVXQ 4WKOA 4UTVA 2XNKA 5GY7A 5CVVA 3FTDA 4X7RA 2CCGA 3HACA 3L40A 4K6HA 4LV8B 1IZ0A 3I52A 2Z4RA 4BKMA 4Q9HA 2YYAA 3D7KA 3E9MA 4GBED 4BTVA 3ZJ5A 3W5AA 1V95A 3TE7A 5GAJA 1TCCA 5CM9C 3AGQA 3O26A 1JN0A 3LBNA 2VI5A 2D7CA 1YBFA 4O2RA 4LKRA 1M6NA 3TJZA 4V0RA 1CF4A 3IUMA 2J6BA 4FSXA 1IBKB 1N78A 2EIHA 1U3DA 3DC2A 2QL5A 1KBQA 3ADKA 4IDEA 2O8CA 2DBRA 2QDKA 3PDJA 4FHFA 5CT6A 5CTAA 5DM70 2XZDA 2W4QA 4H15A 1LCIA 4YO8A 2W6ID 3GJ0A 4YP9A 1GQOA 3E8MA 3DHEA 3UN1A 4EKEA 1EQUA 1GJRA 3PC6A 1X7DA 4G07A 1FIUA 1N32B 4B79A 3T1QA 4PXAA 2F4VB 3VPFA 2VUUA 2WP8J 1BWSA 3WGMA 1KVQA 1QQTA 3ZWVA 2VHXA 3IKMB 1FFSA 3U7EB 2OXRA 1J8VA 3GUZA 1CZUA 3VNAA 1LI4A 3N74A 5THXA 1XVLA 4PNZA 5L3SA 4IGFA 4FGUA 4BO5A 2DB3A 4AZTA 1IM8A 1RLTA 3A1VA 3BK2A 2VRNA 1REQA 2II6A 4JI5B 1NW8A 4UHBA 4EFDA 5EJ6A 3AUKA 1PNRA 1C1XB 1TM1E 4L51A 1D07A 1TU0A 3H8VA 3HNRA 4MMYB