2QP4A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
279
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNWKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Bile salt sulfotransferase
total genus 91
structure length 279
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp4A00
3Q72A 2J3EA 5D3QA 4HATA 1WB9A 2GJSA 4TZ6A 2F9LA 1CJUC 2OCAA 4G5QA 1PLLA 1KKLA 3RDPA 4XWOA 4UNQA 1H8EA 2O0JA 1OJLA 1W0KA 3QKRB 4HDOB 4CT5A 3BH6A 1N5LA 3NVAA 5LD2B 2HCBA 4CEJA 2E87A 2F1HA 3CPHA 4Q1AA 4TTQA 1UDXA 1A4RA 3WHKA 4BGDA 4Q9JA 3C41J 2G83A 3ZDQA 1S1MA 2IYTA 3B1WA 4DSNA 2DWPA 4CEHA 4PHFA 2FU5C 1T8TA 1W4CA 3H1TA 4C7OB 1SXJE 5FOSA 4MA4A 1OYYA 2BMEA 2QP3A 2W6ID 3UIEA 1QHNA 1I4DD 3KL4A 1KOFA 4A8JA 1ZM7A 4RD3A 5A4JA 4EPYA 3NTUA 4V0LA 1DO2A 1GL9B 5CK4A 3WNCA 4LY6A 1LW7A 4N0DA 4DWJA 1Q3TA 3WYAA 1SXJB 3KUDA 2Z5FA 4IVQA 5UKDA 4EAQA 3VKWA 3A36A 2VF8A 2H1LA 2Z83A 4Q01A 4Q02A 3EZ2A 2R8RA 1KDRA 2PT7A 4G5SA 1E1QA 4DUGD 3NXSA 3THOA 1JJ7A 1QBKC 3HDTA 1ZYUA 4BE7B 4BWYA 3I61A 4ESHA 2OAQ1 5AJYA 2IYYA 4Q1FA 5FI1B 1E2EA 3C5HA 1DELA 2FPLA 4KFRA 2VQSA 1B23P 3I8XA 1G3IA 2GBLA 2JJ1D 2OSBA 1D6JA 2RKOA 3BB4A 3R7WB 3VR6A 4D80A 1NBMA 2J1LA 3CNNA 1TPZA 4ACBA 1XPOA 2IYVA 1OXTA 4IEIA 4C2TA 1D2EA 4Q4HA 3Q9LA 3EIEA 2EQBA 1OW3B 4UXJA 2RGNA 1C1YA 4US2R 3RSLA 1RW4A 4BFSA 4F4JA 1T5IA 4M1OA 2QL6A 3W8NA 2Q6TA 4BFWA 2H5EA 3EIHA 2VHTA 4HLUA 1QG2A 2A5DA 3RHFA 3HWSA 4HZUA 4TYQA 4R2IA 5CYPA 2GJ8A 2V8OA 5FL3A 1XZPA 3UANA 3ZIAA 5KNCA 2Q9CA 2JDID 3IPXA 1L4YA 5EUMA 3RYTC 2ZAMA 1N6IA 1XCMA 2FSGA 3A8TA 4GZLA 4BASA 4PPFA 4R71A 4C7OA 2QRZA 2XOKA 2J41A 2AK2A 3TR0A 2YJTD 1YRBA 2VP6A 1BH2A 5HKKA 2BC9A 3ETLA 2VP2A 3K09A 4OQMA 4BFVA 4QC2A 1X6VA 1KZGB 4WBSA 3KDSE 2VPPA 1NLYA 5EXXA 1HUQA 3NWJA 2NMVA 1DG3A 4OK3A 5CDFA 3RS0A 1KGDA 2CVHA 1E69A 3KTAA 3B85A 4RCYA 4QHYA 1YE8A 3AF2A 5J4VA 2KWIA 1AK2A 4GBMA 4B2PA 3P26A 4Q1EA 1YQTA 3I5XA 4HLUC 1VTKA 2CHGA 4IHQA 3VTKA 4A4DA 3ZZ0A 1R5NA 1VMAA 5EP1A 3UXMA 3W5JA 4MQBA 2W2VA 4LJ9A 3SJZA 2F3RA 2WOJA 2AHOA 2XJ9A 4LJ7A 4DZZA 4FI3C 4MYHA 5EP4A 3CRQA 2AD5A 2ONJA 4IOMA 2ZI9A 3GPLA 2QBYB 3D6TB 3LW7A 4HAUA 1GKYA 4CYMA 1GP2A 1IN7A 1W5SA 3NBXX 2GEVA 3QXCA 3I3SR 1XRJA 1ZNZA 2WAYA 4S35A 3J81k 3PVSA 2QE7D 2IC5A 3PUZA 2BEKA 4US0R 3VR4A 4LI0A 4AC9A 1G21E 5BWMA 3KQUA 3HR7A 4TTPA 3SJBA 1FNNA 3QUSA 2R65A 4QHTA 1NMXA 3FHOA 4HB0A 4KFUA 4RKFA 1E99A 1S4QA 3CNOA 3IEVA 3T5GA 1E4YA 3K0SA 2RMKA 1CF4A 4B6FA 3EARA 1XBTA 1RE0A 3HPQA 1E2HA 5DN6D 4HAYA 2ZM5A 3QKSA 4Z1MD 1YR8A 5JEEA 3TK1A 5D3MB 2B92A 5B2ZA 4Q47A 3O8CA 1XXHE 2ZIAA 4XSGA 3C8UA 3TH5A 4Q7MB 4KV9A 4NCIA 1NKTA 5J4KA 4MH0R 4HUTA 4GNKA 1NRJB 3SFZA 4UNRA 3ADBA 3K70C 4CEHB 2JASA 1SVOA 4HEJA 4PSKA 1XMJA 3VR3A 1N6KA 3BAFA 4BFYA 4MKHA 2XB2A 3T61A 2IYSA 4H1VA 1EXMA 2OFWA 4LYAA 4G0NA 4JLJA 3F5FA 4LYJA 3CZPA 1E0SA 2ORWA 2IYQA 4C0JA 1HYQA 4A2QA 4URZR 4M9ZA 2WICA 2JDIA 4HUQA 3KUCA 3KQKA 1QHXA 4BZPA 1AS0A 1KYIA 3PJRA 3CLVA 2J45A 5DHFA 4D0GA 5AUOB 2DFLA 1FX0B 3IEUA 4KHZA 5LPNA 3VQTA 1XF9A 4Y0VA 4RD4A 3N70A 4NYIQ 1G6HA 3VR5A 1Z3IX 4MRVA 2ZRMA 4B76A 2NQ2C 2AX4A 1G19A 2FE4A 1SXJC 3BFKA 4O2LA 4MGKR 2IYWA 2QORA 5GJWC 2QENA 1X86B 1CLUA 1KSHA 2QM7A 3QF4A 4ARZA 4EPXA 2QA5A 1G20E 1JALA 1BYIA 2CL7X 2FFQA 4IOLA 3V4FA 2O8DB 3P32A 4CIDA 4WXRA 5JSZB 2AXNA 3SJAA 2FG5A 1G8PA 1KMHA 4JL6A 1U98A 2HT1A 2LWIA 4GPTA 2DWOA 4LCBA 5L3QB 3GLGA 3AVUA 2AK3A 1E2LA 2WKQA 1JXMA 1NMYA 1JEEA 1NBMD 4QBIA 1AM4D 1Z2CA 2KBFA 1ZRHA 3QXXA 1SVKA 4EFLA 1DE0A 4IDHA 1CS4C 4BRWA 4TLDA 5JCPA 2VIIA 3ZS8A 1SVSA 2ZE5A 1G18A 5L3QA 1KNXA 4B43A 121PA 2EWWA 3U3JA 2YKGA 4M1WA 2ZI3A 3EA5A 4JBYA 4DCSA 1RYHA 2ASEA 2KSQA 1XMIA 5FUWA 4U7DA 5HZKA 3W5IA 821PA 2OG2A 1N3BA 2QPTA 1G7RA 2QU8A 2IL1A 3VMFA 4D4LA 4C0HA 4DLVA 1Z0KA 1E9BA 1FMLA 721PA 3AKCA 1ZJ6A 3ZD6A 4ZPXA 1NIPA 1NSFA 2FSHA 1RYFA 4GZMA 2QRNA 2C99A 3QPVA 3GFPA 3BS4A 2OBLA 3KZ1E 2CNWD 2JIZD 2J59A 2ZRDA 2VEDA 3C4JA 5IF9A 5GJVC 2C5LA 2D2FA 2EFEB 3A1SA 3TNFA 1P62B 1YJ5A 3QY0A 3TSWA 3IIMA 2B8TA 3B1ZA 2BM1A 2CXXA 2V7QD 4NP6A 4U02A 2CJWB 2NTYC 3U7EB 5H8WA 1E2JA 2UKDA 3QXJA 4PQYA 3FKSA 3A1TA 1KAGA 1XTJA 3KJEA 3AB3A 4YXWD 1A1VA 2O8FA 4WA7A 4YC7A 2ZRGA 4R98A 5DYIA 4OHXA 1UADA 2CK3D 1E2FA 1LB1B 3MUFA 5K8LA 2QAGC 1R5OA 1W36D 1AQUA 2D06A 1QHIA 3CH4B 2C03A 1JEDA 1M1YE 2RAPA 5FTKA 1IBRA 4TTRA 2WIAA 3QI2A 4OYHA 4JIMA 5IHPA 1N0VC 2EFCB 3AGQA 1T5LA 2V55B 4GDFA 1KSJA 2CL6X 2REOA 1IN6A 1GDDA 1Q1QA 3SC3A 1SVMA 3LDAA 1RIFA 2GBLC 5EP3A 3SBDA 5FPHA 4LPSA 3FMPB 3U60B 4W5HA 4B3DA 4WAUA 3KFXA 1JJVA 1Q20A 3QQ5A 4JT2A 3CF6R 1MO6A 1OIWA 1ZVQA 4DB2A 2IYXA 4HDCA 2W2XA 2QMUA 2X2FA 3CX7A 2FOLA 1ZM4A 2NPFA 3PCRB 4YXWA 1G8GA 1ZIOA 2MMCA 3CX8A 4IXMA 5CJ2A 3QSYA 4MRPA 3RS5A 1YVDA 1S8FA 2IA5A 4BLPA 2D7DA 5JFGA 4DSOA 1RRCA 1Z28A 5L3SB 4TMZA 1QVRA 2O5VA 5J40A 1K5DA 1ZNWA 1NI3A 5CB6A 3BB3A 1WP9A 3L8YA 1Y63A 4JBWA 3A4LA 1OKKD 2CE2X 1I2MA 2R6GA 4EDHA 3U6BA 3FYHA 1UKEA 2WPDA 4OQLA 1IY0A 2W6JA 4JLOA 2OEPA 3O8BA 5TMPA 5J4YA 1GRRA 2IEZA 1XDBA 2OV2A 2XZPA 3A1VA 4DLSA 2VP4A 1WE2A 1ZUIA 3A1UA 3QNUA 3AV0B 4RFSA 3X1XA 1F6BA 4CGZA 3CWZA 1OIXA 1OFUX 3WRYC 1IXSB 5B57C 2IXFA 2QTHA 1UBEA 3PIRA 4OI4A 5KSZA 5FTLA 5FPKA 3DOFA 4HLCA 4AK9A 2ERYA 4TYPA 1GTVA 3NHBA 1SULA 3X1DA 1W4RA 1PVOA 2DFKB 2F9MA 5FR1A 2XSZA 3BJIC 2I3BA 2C9CA 3K0EA 5CM8B 1KK3A 3RRMA 2R2AA 4KLNA 2JLUA 221PA 1ZAKA 1GKUB 2NGRA 3SYLA 2Y8EA 1G8HA 2FFAA 1HA3A 2H17A 4C2UA 2WWIA 4JL5A 4LV5B 4I4LA 1II8B 521PA 1XEWX 4JZKA 2C04A 5AUNB 3EZ7A 2CCKA 1N6NA 4K81B 5FOWA 3AVTA 3C14C 3G5UA 1IAQA 4AWXA 3BWDD 4NE2A 2K5UA 4MRNA 2GHIA 3W9YA 1Q1EA 5L3RA 2DYKA 4AURA 3THXB 3ZGXA 4EPWA 3THYA 4ZCIA 1S96A 2GRJA 4TYNA 2O8EB 1E2KA 3EWAA 1AIPA 4PPNA 4Q03A 5DLQC 1J8MF 4KBFA 1BIFA 4F92B 3K0FA 2VSFA 1EFHA 1GWNA 1SXJD 2GCNA 3LO5A 3SN6A 3E70C 2C78A 3KQHA 1ZD1A 2A7QA 1VCMA 2WMOB 1GNRA 3B5JA 4NPHA 1HE8B 4MYCA 2RGNC 4M9SA 4FWIB 2DFNA 2R62A 5FOXA 3ZZUA 3QF7A 4AY2A 2PL3A 2FJUA 3O8DA 5C18A 3BIFA 3T1TA 2NO9A 2FMXA 5DH9A 4NL4H 3UG7A 4ZI3A 5K8TA 4Q1BA 3IIKA 1YR9A 2HEIA 4LGMA 4L8GA 2WV9A 3B82A 3ZVRA 2ZR0A 4B48A 2ZRKA 1US8B 5C4GB 1P9RA 4PZZA 3BFVA 3SYNA 1PLKA 4FINA 5BYKA 1FQKA 3U7FB 4PXAA 4EJSA 5JBQA 1XMSA 4MYUA 4PR0A 1RKBA 3TW8B 3MJRA 3G0HA 2G88A 4UQOA 4HI0E 5TVKA 3R8FA 3OIYA 1N5KA 4O3MA 3R9WA 4HZIA 5JMTA 1DAFA 2CK3A 4GMXA 4I81A 1RZ3A 2PBRA 4A15A 2KE5A 3NBZC 4JSTA 1YR6A 1TQ2A 4L4UA 1TMKA 4BFZA 1D2NA 3GMTA 1NP6A 2FF7A 2F1RA 4KYIB 3TAUA 3X2SA 4LZZA 4D4JA 4M9XA 4WXPA 3OHMA 3U44A 2MSCB 2DHRA 4Z8YA 2V1XA 5L3VA 3CNLA 4X8HA 1O3YA 1P7CA 1F60A 2OXCA 3U61B 4KITB 3B1VA 4TL6A 1XPRA 2JIZA 1SVIA 1CR0A 4OJQA 2J0UA 1NF3A 1T3HA 4JLDA 4DIEA 1H8HD 4GL2A 1HT2E 1F2UB 2QNRA 4TWZA 3EC1A 3B13B 1F2TA 1WQ1R 4JLKA 4JVSB 2C8VA 4Q9HA 3DL0A 3UK6A 1F3OA 2HF9A 3U7GA 2CJWA 2YYZA 3FHCB 2E9SA 2VBCA 4HDQB 1AA9A 2GCOA 4ZIRA 1F2TB 2GF0A 2C9YA 1KO5A 3B1XA 1JR3D 3Q7PA 4M1MA 3S1AB 3KTAB 1U0JA 1COWD 1GITA 2RGAA 2RGDA 2RHMA 2QMEA 3GLHE 1YZLA 5FUYA 3B78A 4POAA 4IOJA 1VYTA 4NKRA 3ND9A 4QGGA 1D2MA 2VF7A 1H8HA 3AP2A 1G5TA 5GJCA 2FPMA 4EFNA 1LS6A 3NIBA 5KSYA 1VG0B 1TL7C 3C16C 3DO6A 1VIYA 3P27A 3FMOB 3KJIA 5H68A 4A6PA 1CRPA 3KQNA 1BMFA 1FTNA 2Q3MA 2ZI5A 3U6KA 3F0TA 2D4HA 4B3BA 1KI9A 4XTRA 4OHWA 1P2TA 3BD9A 3SBEA 2VP5A 4QFMA 1FP7A 1S0UA 4KFTA 5JJIA 1ZU4A 2CE7A 3TUIC 4GMDA 4B2LA 3L0OA 1IY2A 1W2GA 4JS0A 4RD1A 3RWMB 3EC2A 1JB1A 2EFHB 1JPNA 4Q00A 1R2QA 2Q21A 2ZVQX 4AI6A 3ZLJA 4OHYA 3TQCA 1QRAA 2IHYA 4OHZA 2XTMA 4ZKEA 3EAQA 2ZRAA 3S1AA 5SZKB 1IN5A 3GJ4A 2QP4A 4Q7LA 3L43A 2QQ0A 2QROA 1QZXA 2GVZC 3BGWA 4NHOA 5JS8A 2HLDA 4OJKA 2GETA 3X1WA 4URVR 4QRHA 1MO3A 2JJ1A 2A2ZA 2W6JD 5E7MA 4YONB 5FI0B 3MWKA 3LRPA 4KVAA 4U00A 1GNQA 3EA0A 1KSGA 1LVGA 2PT5A 3CONA 1TU4A 4IKEA 3IO3A 2ZSEA 3AH8A 4NZYA 3KX2A 4I99A 1UAAA 3AKEA 3L0PA 2ZRPA 1XZQA 4AKHA 2X2EA 2RH5A 1P5ZB 2IUTA 4I1SA 4LJ5A 5GADl 4ASUA 4C0AC 1G3QA 2P3SA 5F3WB 4C9BA 3BE4A 4JT4A 4KO8A 2WWFA 1KZ7B 4JSYA 2X1VA 2YZ2A 4F38A 3PUWA 2GILA 3TQFA 4NYIR 1OT3A 1JXOA 1OKKA 1Z06A 1E2GA 2QQEA 4YMWA 3EPLA 4YDHB 3VNVA 2OESA 4E07A 2IX3A 5EQTA 1VHTA 2R9VA 3OIUA 3I72A 2ODEA 3R9XA 2GESA 2PMDA 4B74A 3L0SA 4K46A 4ITRC 1ZC4A 3U4QB 1T6NA 1GIAA 2PZFA 4R7ZA 1CBUA 1KI8A 1L2TA 3QEJA 2UZIR 1W5TA 4D2IA 4DLYA 4DT1A 1G7TA 3IQWA 4O2RA 3IO5A 2O8FB 2SHKA 3WBKA 1XEXA 4YQFA 2QMHA 4PZLA 3DKVA 5C1BA 2J0SA 2UVQA 1JAIA 3GCGA 3IHLA 3L82B 3TVDA 3AVVA 1S1CA 4Z8XA 3P20A 2GJ9A 2BBTA 4E5UA 2H92A 4D82A 2JJ2A 4RZXA 1J99A 3CRMA 1QHHB 3BFXA 2PEZA 1TUEA 2A3RA 4QG7A 2CEAA 3EIQA 4KFSA 3WMGA 2LKDA 1VPLA 2GNOA 1JQJC 3LXXA 1QHGA 3U7HB 3W90A 1OV4A 5TY0A 2XOKD 5CK5A 3OF5A 1BOFA 1MO5A 4E22A 3GLFB 1EFCA 3JVUA 3WNDA 4KBGA 3ZYCA 3NHAA 4LYFA 2FH5B 1RJ9B 2ZYWX 3UMSA 4LHZA 2CVFA 1R8QA 1G1MA 2DBYA 4MUAA 4PX9A 4DIDA 3SHWA 4OQFA 2A5JA 4D0LB 4YDSA 3EZ6A 1AZSC 2D62A 4LV6A 4UKDA 3I32A 3DM5A 4FMDB 1TU3A 2OLKA 1RC8A 5H1YA 3RANA 5DO9A 4MGYR 3U3KA 4PHTA 1HY3A 1HT1E 4B35A 3CRVA 2ANCA 1N6HA 1TEVA 4FD2A 5DNYB 3EZ9A 4ESVA 4HAWA 4PQFA 2ZJAA 4BFXA 1PUJA 2YWGA 3AF0A 3Q3JB 4UNPA 2WJGA 1JQLB 2NZ8A 3IQXA 4MKGA 2HYIC 1W2HA 2FGKA 2ZRFA 5J4LA 3C5CA 5TB5A 4C30A 2HJGA 1M8PA 4MGZR 1ZINA 3CR7A 3I1FA 1KHTA 3IHWA 1HQYE 3QENA 1T8UA 4QKQA 1RVDA 1RRFA 4IFEA 1E9FA 3D7MA 4M4SA 4PPQA 3GLIE 4V02A 1W4BA 4JYCA 3TSOA 1ZUNB 4W9MC 1R8SA 3ADKA 1SZPA 2VHQA 1UEJA 4LJ6A 2X8AA 3ZS9A 2NO0A 2G0NA 1XX6A 4GOJA 4LUCA 4Q9LA 2A30A 2ZYUX 5AWFC 1SVLA 2QSZA 3B6EA 1BMFD 1HQCA 2IXGA 1DEKA 1G64A 1WA5A 1WDTA 2EWVA 3FKSD 4ZCLA 2BMJA 3AVPA 3RRYA 2WKRA 3K1JA 1LF5A 1KI7A 2D3WA 3ZD7A 3WY9A 4IDOA 4Q9IA 2C95A 3FB4A 3CF0A 2PZGA 1U2RA 5F9FA 3EPHA 4OQNA 1KJZA 3VX3A 3ZVLA 3QPWA 3BRWD 2VRWA 4HB2A 4OBEA 2ECKA 2OE2A 2WHXA 3THWA 1G291 3KB2A 4V0MA 3RWOA 1KNQA 1KI6A 5IDVA 1A7JA 4M21A 1IJEA 1E1RD 3EASA 4URXR 3CR8A 2BBSA 1P75A 4KSBA 3THWB 1BYUA 1FNMA 3W6OA 3UMFA 5IK2A 1HTWA 1G3UA 2N42A 4G5GA 4LYHA 4QXAA 2IWRA 5JEDA 3LBHA 2BEJA 4TMVA 2WKPA 3M4YA 5CIWA 5A5GA 5E3HA 4DLUA 5GVSA 3N2EA 2IYUA 2O8BA 4Q9KA 4X8OA 3GJ3A 3QPUA 4ZKDA 2WJYA 4OKSA 2Q9BA 4LX0A 2ZTSA 2Z4SA 5FR2A 1MKYA 4Q5IA 3SFVA 3T15A 4CEIB 1H65A 1DAIA 2WZQA 3GEHA 3B9QA 1NN1A 2BDTA 1ANKA 1Z63A 5KOYA 2GK7A 2H8KA 1KSFX 1W46A 1ZUHA 3K0AA 1ZM9A 1IY1A 3RLFA 3SNHA 2FSFA 3UATA 1M34E 3AUYA 3SE0A 2CLSA 2JLZA 1VG8A 3K9GA 4DSTA 2ZETA 1JAHA 2GXSA 1FPMA 2ZE7A 5FBLB 2GF9A 4LPKA 1H8ED 5HCIA 3ASZA 5JI2E 4RVCA 1DAMA 5HPYB 3OZXA 2YNMA 4TZ0A 3MWLA 3FOZA 4BUJA 2J0QA 4PC1A 5JHGB 4ZDIA 1E9EA 1AZTA 1Z6GA 2C98A 1CR1A 4Y0AA 3PR1A 4LC0A 2V6JA 4TYYA 2VHJA 5BN5A 2GEDA 4L15A 4TQ9A 2A5FA 1HURA 4PC3A 3U44B 4EPVA 1AGPA 1Q1ZA 2ZSAA 3PEWA 3GFOA 4US1R 3K9HA 4W5WA 2Q3FA 2OBNA 1ZCBA 5HE9A 5KDOA 1E0JA 1YZKA 1GSIA 1U8AA 4RJLA 4AKGA 1IOZA 3MWJA 4HLDA 5GVRA 1W0JA 1W0JD 2L0XA 1JBKA 4CW7A 1U9IA 1E9RA 2CCGA 2OFXA 2R44A 3T1VA 1Q3HA 2H57A 2XZLA 1NG9A 3A58B 2C9OA 4QHSA 2NG1A 1Q44A 2W2TA 6Q21A 1U0HC 4FCTA 3KXIA 4UXIA 1Z2AA 3CWQA 4Z1MA 4LJYA 4JBXA 3GLFA 3FHTA 3CH5A 1YKSA 1Z08A 2OM2A 5EE3A 2G9NA 3ND8A 3CF2A 2F6RA 4HAVA 1ELOA 2J9RA 2CLCX 2BVNA 3CM0A 5B64A 2WTUA 2GKSA 4OQXA 1XTRA 4MRSA 4BLOA 4V0NA 1WMSA 1HV8A 4ZO4A 2RGCA 3MMPA 5G40A 2GXQA 2ZSDA 3PUYA 4URYR 1PLJA 1E2MA 1CR2A 5FPTA 3L0IB 5JWRA 4IDQA 2FSIA 2QM8A 2YOFA 4DT1B 3EWSA 3GQBA 3OESA 2P6NA 2BMDA 4PFSA 4NYMR 2ZJYA 2G77B 1DBSA 2BKEA 4M53A 4BLQA 1S3GA 1YU9A 1YZTA 4YMVA 4TL8A 1M74A 3BH7A 4WZ6A 5CLLA 1FW6A 3C15C 1CIPA 3P4XA 3TRFA 3K70D 3ZZTA 2ZRIA 2ZE6A 3LD9A 2J87A 4GT1A 3PUVA 2QTFA 4II7A 1OPXA 1ZC3A 4D26A 3MG9A 4XIGS 2W58A 1VCOA 4EIWA 1E96A 1Z0DA 1R5BA 1JPJA 4DEXA 4B71A 4UXHA 2BJWA 4M22A 4RZ3A 4DDWA 1P9NA 1Z6AA 2HUPA 2EFGA 4EFMA 3KKQA 5CIQA 4QL3A 3HU2A 1FP6A 3CIOA 3KKOA 5HKKD 3AF3A 3PENA 3TR5A 4FMDF 3SQWA 2ZITA 2JATA 2WWHA 4NDZA 2B7BA 2ZRCA 1OH5A 1ZD8A 1E6CA 4P4UA 5JI3E 1SGWA 2ERXA 1IN4A 1NJFA 4B44A 4LHWA 5AUPB 1ZM3A 2ZJOA 1EWQA 2O0HA 3W6NA 1ZIPA 3NDPA 4IVRA 2I4IA 4GOXA 4YMTA 2YC4C 1M6NA 4NCHA 3T1QA 4PPGA 1E3MA 2ZQ5A 1Q12A 2HF8A 5KTYA 1R7RA 3W34A 1KI4A 1UF9A 4Q4HB 4LDJA 1E79D 4QGAA 3IBYA 5JWHA 2ZSFA 2JLRA 3OEED 5KHOC 2Q9AA 4KAXA 2GXUA 5JJKA 2AN9A 5JHHB 4BFTA 3DEFA 1N6OA 2HCJB 4O0MA 5JECA 3WHLA 3RSOA 1OE0A 4OI1A 4Q66C 2CHQA 1UJ2A 3LY5A 2WSMA 3ECCA 1SHZA 2C96A 1DAGA 3W6PA 4BECA 1FZQA 3AP1A 2GZDA 4XD7A 2DPXA 4IXNA 4B3FX 3VR1A 1Z6YA 2F7SA 1OFTA 1R6BX 3QBVA 1Q22A 1OFIA 1R4AA 3OFNA 4I1UA 3QEOA 1DTSA 3E2IA 5DIFA 2YV5A 4IVPA 4EKDA 4NU0A 3K8YA 1S3SA 1Z07A 1CJVC 2P2LA 4UNSA 4D81A 3WP1B 1J90A 2PEYA 1GL6A 2ZRLA 3AEZA 2AFHE 1E2QA 1GVNB 5P21A 1MH1A 1UKZA 2J7PD 2QN6A 4QM6A 1NVXQ 2BWJA 1SQ5A 4QBHA 3MD0A 4HZUB 2OBMA 1NLZA 4CRWB 1E1QD 4DUGA 4LBVA 4GP7A 3KJGA 1CULC 5J47A 3LVRE 2IS6A 3ZVMA 3VHXA 1GNPA 1Z8FA 1FFHA 4A82A 1GFIA 3KKPA 1KAOA 1CJTC 4XOIA 5F98A 1T0JB 1CJMA 3OIVA 1EESA 3VAAA 4W5JA 2ZR9A 1EGAA 4FW9A 4TN1A 4KVGA 4HUQB 4A2PA 1OXSC 4D6PA 3K9NA 5AK0A 4PAOA 4QJ4A 2JLSA 3OE7D 4GFDA 4A0GA 3NG1A 1XJCA 2FN4A 4IRUB 2B7CA 2LCFA 4Q1DA 2RCNA 1G4AE 1LY1A 1XU4A 4JVMA 1G5PA 2ZREA 2PJRA 2ZI4A 4DB4A 1Q21A 4LBWA 4QM7A 3WMFA 3HU3A 1TTTA 3VKHA 3WYGA 3SOPA 4A0HA 3FDIA 4L16A 2ZU0C 4LK2A 2VH5R 1BS1A 4A1FA 5LBIA 2FA9A 5SZJA 2OFOA 2R6CA 4TSFA 1KJYA 1OB2A 1UBFA 3DOEA 1XD9A 1KO1A 2VSXA 3ONWA 3QVVA 5TARA 2ZU6A 4MUBA 2QY9A 3QKSB 1NY5A 2QAJA 3R9IA 1ESMA 3MJHA 3TJZA 4XWKA 2XZOA 1N6PA 1XFAA 1CTQA 2BMFA 2QTVB 4GI7A 4A8JB 4HB3A 5AJVB 2N46A 4HYYA 4NMMA 3W3ZB 1OF1A 3ZH9B 1S2MA 2ZYTX 5KU1A 4B6EA 5GJBA 3K0CC 4WVFA 1RRGA 3WRXC 4I1OA 4QGHA 3B9PA 3V00A 4DSUA 3CX6A 3GLHA 3B2EA 3DKPA 4NTZA 4EJSC 4M1KA 4EPTA 5FOVA 5EXTA 1AGRA 4XH9B 4LV8B 2BOVA 3DZDA 1XMVA 1ODFA 3W3AA 1R0XA 1U9IC 4YMSA 1GOTA 4L5BA 1OB5A 1XJ0A 3IGFA 5DN6A 3PEUA 1A2BA 1XP8A 2IWHA 1OYWA 3PV0A 2HJVA 4Q19A 3JVVA 1F2UA 4QNMA 1K8RA 4KU4A 2O8EA 1D9XA 2DY1A 3IIJA 5AJXA 4DJTA 1OH8A 4BEBA 3AVXA 3DMNA 3TUZC 1XTKA 2A5YB 2QSYA 1CU1A 5HR5A 3I73A 5CDFE 4A6XA 2FWRA 2QAGA 4PO8A 2VA8A 4UNNA 2IUUA 4TYWA 3EG5A 2GAOA 3HR8A 2GZHA 3NH9A 4Q7JB 4Q4AB 4F93B 1G4UR 5IK2D 2N1BA 3QXSA 2Z0MA 2GDJA 3NBYC 1CRQA 5CITA 1PZNA 1DO0A 5D3MA 3WNBA 3ZJYA 1NVVR 3T06B 3ZQJA 1C4OA 2O8CA 3RRNA 1MO4A 2IF2A 3CBQA 2ZE8A 5F9HA 1AN0A 3I92A 5BXQC 1N0WA 3TKLA 3WMEA 4PQRA 1T4GA 3T35A 2EU8A 4JLBA 4LWZA 1Q0UA 3CPEA 5KPDA 3LX5A 4JKIA 2P67A 3LBIA 5G3YA 4D4MA 3LBNA 4G5RA 3CUEF 2XGJA 2HXSA 2IXEA 3MAAC 5EXPA 4UJ3A 5B30A 5J5CA 2WIBA 2BM0A 1AS2A 1WF3A 2OCYC 5KSOA 3A1WA 1KO8A 5FL7D 4FMCF 4WW0A 1OHHD 1KI1A 2FEMA 1G8YA 2MSEB 2QP9X 5FUVA 4JLPA 3KB1A 4CZ2A 1U81A 4HAXA 4BPBA 1JR6A 2GWHA 1P9WA 2G6BA 2P5TB 4NYJR 4AIIA 4DDUA 4ZI2A 2Q0HA 4Q7KA 1VCNA 1X1RA 2GTPA 1NL3A 4TSFD 1GILA 1NN5A 2IYLD 2ZYVX 3AUXA 2FZLA 1SKYB 2PH1A 2KJQA 3NKVA 3M1IA 4BZXA 621PA 2HLDD 4Q4JB 4P4SA 1C9KA 1TAGA 2FGJA 1V43A 1B0UA 4V0ME 2O8CB 5FOUA 3CKLA 4TQUS 3OE7A 2XX3A 1WBBA 4L9SA 3K53A 4MDFA 3A37A 2G0TA 4TMXA 4TLEA 4D4KA 3GLGB 4EQ6B 2JJ8A 2RGBA 3H0KA 4EQ6A 1P3JA 3EX7C 3PFIA 2VO1A 3QOFA 3CO5A 4C0BA 4AG5A 1TEXA 4W7SA 1NVVQ 4QNRA 3GJ5A 1TNDA 1UFQA 1VHLA 2O0KA 1VECA 2AFIE 1F5NA 4TMWA 4ARZB 1XEFA 1W44A 1U0LA 4Q48A 4Q4JA 2R6AA 4PHGA 4KLZA 4XWAA 4LBZA 4IDNA 1X1SA 4RFVA 2F55A 1FTSA 3W8RA 3RC8A 1E9DA 3K9LA 2F1IA 5DE3A 3GLIA 1GKIA 1OXUA 4NYMQ 4LJAA 5BQ5A 5KDDA 3IKJA 5BYJA 2WBLC 1FQJA 2WMNB 2IHBA 1ZBDA 1OH7A 2JJ2D 2O52A 1LNZA 4DDVA 4KCGA 1Z0JA 2FFHA 4B3GA 5FTNA 3ICEA 3TE6A 5EE1A 3VU9B 4XVUA 1R0ZA 3SQXA 4JL8A 1ZM2A 1AQYA 1KY3A 3HU1A 5CLQA 3I5YA 1AS3A 3QG1A 4TLBA 1Z83A 2JLWA 1VYVA 3B1YA 4M1TA 2CBZA 4JJZA 1TQ4A 2OXRA 4X8LA 1ZD9A 2V9PA 2NO1A 1KO7A 1E9AA 1WBDA 2D7CA 4XTCS 2FEOA 1TADA 2D74A 2NZJA 3I8SA 4FXPA 4HSEA 4PO9A 4XVRA 2Z4RA 5L3SA 4DCTA 3U4QA 1I4LD 1DAKA 4ZV4A 3CRRA 1QHSA 4OHVA 1KDTA 5CB8A 3AKDA 4LHXA 1F48A 2XNSA 2ZUDA 2BIFA 2ZSBA 4KODA 4XJXA 1E9SA 3TGPA 1M7GA 3OEHD 4XVQA 1K5GA 5AR1A 1O87A 2PX3A 1ZP6A 1KMHB 2QEQA 4JYBA 1NVUQ 3OEEA 1L4UA 1UEIA 4V03A 3OAAD 4B3CA 3BH0A 4M0LA 2X19A 5FFMA 1RPZA 4B75A 1EG7A 2ODWA 3LXRA 4TLAA 3KJHA 3ADDA 3QBTA 1KDOA 2HDNB 2MMGA 3SYKA 1N0UA 4YLGA 3MCAA 2BV3A 4BLTA 1R10A 2FX3A 2YINC 3FMIA 4FIDA 2ODNA 4ZCMA 3NH6A 4CDGA 1FX0A 4J0QA 4FWTA 3CW2A 2GJAA 5J4HA 3A6PC 1GRNA 1NVWQ 3GJ6A 1E94E 4OL0A 421PA 2GEUA 4ILEA 1YZNA 3FMFA 1TX4B 3QE0A 4FMCB 2NO6A 2D2EA 4PTLA 4QBGB 3G82C 2V7QA 1YZUA 4M1YA 3RS4A 4ZDKA 2ZANA 4JLMA 1XXHA 2G3YA 3LLMA 4IEEA 4N3NA 4B32A 4BLSA 1D8TA 5FUXA 4LJ8A 3IILA 2F43A 5AUQA 1XTSA 4IDPA 3ASYA 2QT1A 3H84A 2JEOA 3JZAA 4YMUA 3LA6A 1IN8A 1G3RA 4JVNA 1GUAA 1YR7A 2DFTA 3HYRA 2IS1A 2ZJBA 3PEVA 2FFBA 5FPYA 4CEIA 2XITA 5FBQB 4MKFA 3THXA 1J8YF 4EPRA 4PSVA 3GLFE 3UWKA 2ZUCA 3D3QA 4PO1A 5EP2A 5JWOA 2NIPA 3I62A 3PUXA 1PJRA 2W83A 3BBPA 2FNAA 1KO4A 1SVWA 3RABA 3KKMA 4PC7A 2ATVA 1FUUA 3NC0C 2JLQA 5CYOA 1II8A 2TMKA 1XTIA 2CMKA 2ORIA 3WYFA 3FPAA 3UKDA 2QZ4A 2BCJQ 2YVUA 1W1WA 1R0WA 5HE8A 1IQPA 1NKSA 2P65A 3L8ZA 3TLXA 2IBMA 1EX6A 2J5XA 1KI3A 2R6DA 2Q3HA 2OUKA 2ZJZA 1OHHA 3LH5A 3UG6A 4B34A 1SKYE 2OILA 4TLCA 5ELXA 2EYQA 4O25A 3FVQA 5H70A 4Z51A 1QG4A 1W48A 3LVQE 4KJZA 1Z47A 2ZVPX 3AF4A 2QBYA 2ZR7A 4JLAA 1U8YA 2G1KA 5EE0A 3TUJC 4HB4A 2ZRNA 4ON9A 4WZAE 1LS1A 4ABYA 1P2SA 2ZPTX 5L8VA 1XJQA 5JCZA 1VG1A 5LDDC 2JA1A 3T5DA 4AKEA 2EVWX 1M7BA 1XD8A 4DEYA 1YRAA 1K6MA 2JLVA 1FL9A 5HCNA 1G5RA 1Z0IA 1KK2A 1KK1A 2RHDA 2ZRJA 3NBFA 2UZ3A 2YOHA 3OAAA 2GA8A 3H86A 3CZQA 4HLQB 3M0EA 4KXFB 1II0A 3H2YA 4K8OA 4DLXA 5KNBA 4ASUD 1BO6A 3NEYA 1OXVA 2PLRA 5BN4A 3MLEA 2V6IA 2AD1A 3FKQA 5FTMA 2YWEA 1D9ZA 1WXQA 1GZSA 1X8KA 2Z43A 3Q8XB 2A9KA 5EJEA 2XNDA 2H18A 3EPKA 4E09A 2P5SA 1KDPA 5JZVA 3ZQ6A 4LOAA 2X77A 3HJNA 2BCGY 3MSXA 1N5IA 1W36B 1HE1C 4B73A 1OFHA 4WOPA 4B3XA 2PCLA 2YWFA 4G01B 1OH6A 4P0TA 5SZHB 1P60A 2ODBA 1OXXK 1NY6A 2XAUA 4LC1A 2AL7A 3QIAA 4GRAA 5TDHA 3U3RA 4B47A 1US8A 3KQLA 1CP2A 1RJ9A 2AKAB 4RZUA 4TL7A 4BEJA 2GK6A 4G3XA 3VKGA 4A92A 3QKRA 1W49A 3SS8A 4Q21A 3GLGE 4DBLC 2XXAA 4F4CA 3PXGA 3X1ZA 4FCVA 3D8BA 4P33A 4M1SA 5CJPA 4KI0A 3K09C 4CT4B 2JCSA 4OI0A 1AKYA 3N2IA 2C2HA 1IXZA 3MWYW 3IUYA 2XB4A 3IDQA 4WIAA 2LKCA 3M6AA 2V54A 2B6HA 1EFTA 5DSZA 4TQAA 2YWHA 3FFAA 4M2LA 3H4MA 1DS6A 4RZ2A 3U3MA 1XNJA 2WOOA 2BBOA 1EK0A 3AKYA 3B8HA 5TXGA 4AD8A 5EZ6B 3MFYA 2CLDX 4C4PA 3RC3A 2JGNA 2DCUA 2QI9C 3WXMA 1GAJA 5E4FA 5KPJA 2IS4A 1T3SA 1XD2B 2R6FA 3DZ8A 2JLYA 3THYB 3U5ZB 4CVNA 1Z6XA 1COWA 3BXZA 4DRZA 1LV7A 1II9A 3SR0A 5KYKA 3QG5A 1V5WA 4LSGA 5KSPA 3AGPA 1R0YA 2EFDB 4DLZA 2ZI7A 3IPYA 3BK7A 3DHWC 2IEYA 1D5CA 3BC1A 1CJKC 5DHAA 4R2HA 3FTQA 4MKIA 4RCZA 1Y3AA 2WWXA 3PG5A 5SZIA 1ETUA 4BQSA 1DADA 1E0AA 4QJ5A 5FBRB 3AQ4A 4TT3A 4B2IA 3MRSA 1U90A 1LF0A 4G1UC 3PITA 3A4NA 1TF7A 1EFUA 2O8DA 3SDZA 5DISB 4DCVA 2J7KA 5E7IA 1KY2A 3DDCA 3T12A 4F4IA 1G6OA 2YOGA 4P4SB 3R20A 4DXAA 2OCBA 3EZFA 1KMQA 1NG1A 1Q1BA 1LFDB 4I1VA 3UWOA 2AR7A 5G41A 2FZ4A 3GP8A 3TW4A 4JLNA 2GCOB 1VCIA 2EYUA 5C4MA 1S9DA 2QUZA 1MR3F 2WJVA 3WP0A 2VYFA 1N5JA 4RFSB 3TVTA 4WZBE 1VIAA 1DPFA 1G16A 1P2VA 1QDEA 3BB1A 3AVYA 4IFBA 2OLJA 2WM9B 2ZROA 3N5CA 3HPRA 4LRWA 2ZRHA 4AYTA 5BW8A 1I2DA 2RB4A 2XEXA 1Q57A 3TIFA 1ZNYA 3NC1C 3PQCA 1QVAA 3VR2A 2PMKA 1ZNXA 3R8CA 4UJ5A 2WSSD 4G5OA 1UDWA 1VDZA 1N2CE 1Z22A 1NMZA 4M8NE 4PHHA 2IYZA 3DVLA 3WBJA 1NN3A 1L7VC 1T3LA 4IW3B 2E1RA 2W00A 3OFND 4HAZA 4QOSA 4QBFA 4IOKA 2V1UA 4KSCA 3AM1A 3O8RA 2PCJA 5EZ5A 5JJLA 2GZAA 4NYJQ 1E32A 3EXAA 1KI6B 4D25A 3AP3A 4C0SA 1VYUA 5JLJA 3X1YA 3U3OA 1L8QA 2GCPA 2QT0A 2FPKA 2VHUA 2A78A 1IONA 1EX7A 1UPTA 2F1JA 3HP1A 1UBCA 2V4ZA 1Z29A 2IW3A 4DLTA 1HEIA 3VX4A 1XEWY 5JRZA 2WJHA 2GVDC 2QAGB 1XPUA 1J2JA 4BZQA 4DCNA 3GEEA 1E2IA 3CPJB 5FPSA 5KDLA 4BRUA 1DOAA 4KYUA 1X8LA 3REFA 2H16A 2CCJA 2B8WA 3OEHA 2GAAA 2NPIA 2P6UA 4P3YA 4PSAA 5EUQB 4CEJB 1BKDR 1E2DA 1J7KA 2ORVA 1T91A 2KB0A 1X3SA 4Q18A 1T0HB 4R9UC 2IF0A 2IT1A 1P4SA 1KK0A 2BBWA 4C3ZA 3RS3A 4ZIRB 1W36C 1KKMA 1NBME 4B33A 3GJXC 1CR4A 2BKUA 5AJZA 1EFRA 3FE2A 5AJWA 3F8TA 3KXKA 5JS7A 1IJFA 3SHFA 3I4LA 1JR3A 2GXAA 3BOSA 1E4VA 2J46A 2ZAOA 2GJKA 2J0UB 3ZVNA 2AKYA 3LQRA 1MRSA 1G3MA 2JAQA 2XSZD 3B60A 4PC6A 3VFDA 2CHVA 1XWIA 3Q7QA 2W0MA 2PX0A 2ZI6A 2QGZA 3ADCA 2O8BB 3FWYA 1AJEA 1GG2A 2I1QA 2H7VA 1P6XA 5FBWB 2QGNA 2WWWA 2ZEJA 3CRW1 4P4TA 5E95A 3SJCA 1XB2A 1MABA 2B21A 2HXYA 3EW9A 3FGNA 4A0RA 4NONA 4IJMA 1KTVA 1KI2A 3LNCA 4URWR 1OIVA 5ANRB 4URUR 2CL0X 2ONKA 2WVJA 4DLWA 5LB2A 2OCPA 3AF1A 4EJSB 5FH9A 2C77A 1TF2A 1P61B 2FV8A 1ZU5A 3GJ8A 2ZS9A 1ZCAA 1JNYA 1T9HA 3SU8A 1A5TA 3GD7A 1G9XA 4Q1CA 5EXSA 3RRZA 3AVWA 4MRRA 4Z54A 4MITA 4OK6A 5LB4A 3QF4B 2MSDB 2ZJ5A 4AYXA 3ZIAD 1VG9B 2ATXA 3GEIA 3RNLA 5B58C 3O47A 4A2WA 1QHHA 3Q85A 3BERA 4OK5A 3R7WA 1UBGA 3FFBA 4QJ3A 4MGIR 1P72A 4C0KA 1S9HA 5HZHA 1YZGA 2VHCA 4TT3D 4L9WA 2G1JA 3NEJA 5FL7A 3VU9A 1GM5A 3DM9B 4A8JC 4ACAA 2I1VB 1XEXB 3P4YA 2P6RA 1TUIA 3QKTA 1IXRC 4P31A 1A2KC 4ZDWA 1E79A 2VP0A 3LWNA 3TAHA 2XXAB 3LQQA 3VNUA 2KBEA 5A0FA 3V4RA 4H9GA 2A5GA 2XTNA 4P32A 2ZXUA 3A4MA 1M2OB 3E1SA 4DKXA 2V3CC 1DAHA 1ZW6A 3KXLA 4PZYA 3JZMA 3RAPR 2HYDA 1SXJA 2QMOA 5DI9A 4NCKA 1MV5A 2DR3A 3OIWA 5FOTA 5KNDA 2ZJ2A 3B7GA 4D0NA 1NJGA 1Z0FA 1FOEB 1MT0A 5F2EA 3KFVA 1YHNA 1QF9A 2ANBA 4BFUA 4C0QC 3NDBB 1G17A 3RS7A 4RKEA 1FMJA 3SZRA 4NBSA 5CM9C 2HV8A 3LLUA 1NLFA 4FCWA 1DG1G 2WAXA 1NN0A 2WJJA 5KUTA 3IBGA 5FBVB 1W7AA 1MABB 2IS2A 2IUSA 5JRJA 2VL7A 2J7PA 4LBYA 5KO2A 1XTQA 2RGXA 1GL7A 2J0VA 3SI7A 1CKEA 1G7CA 1EWRA 3TBKA 2QE7A 5TV2A 3LV8A 2XJ4A 3BORA 1HH4A 4GP6A 4F7WA 1XD2A 3VHLB 3REGA 4BLRA 2OZEA 1M7HA 1G8FA 1N25A 1RFLA 1NSTA 5LD2C 2ZS8A 3DMDA 4A36A 3Q5EA 3Q5DA 3T1OA 4RSGA 1XCPA 4RY2A 3AVQA 2W0SA 3K0AB 1DVRA 1P2UA 4RD0A 4PC2A 4RD6A 3SEAA 5M04A 1SKQA 4JJKA 3DPUA 1W0KD 2JLXA 1ONBA 2HT6A 3MGCA 4N1AA 1Z6TA 4PAMA 4TMTA 1AKEA 1NIJA 1IHUA 2ZUBA 2XNDD 2VP9A 2OO7A 2KI5A 1DARA 1JI0A 4DVGA 3GJ0A 2PZEA 2VSOA 5E7JA 1WRBA 5K8UA 3HYTA 1U8ZA 2VLIA 4LJ4A 4MYTA 5DYGA 2EW1A 4RD2A 4U5XA 2RGEA 2PJZA 4LHYA 3UPUA 1GRQA 1Z0AA 2WWGA 3E5HA 5HTKA 3LFUA 1W4AA 4JKYA 4GOKA 4F91B 2QG6A 1OSNA 1A82A 1OLOA 1E2NA 3CB4A 2ZJ8A 4GSYA 3GJ7A 3PEYA 4QGFA 3K0CA 2QPOA 4S2EA 4JVLA 4XD7D 1KIMA 5EE5B 3F3YA 4Q4AA 1TQDA 1UKVY 2IYRA 3RS2A 1E2PA 5BN3A 4C0LA 4PANA 2F3TA 1WCV1 2YHSA 1E98A 1LTQA 1YZQA 3RVBA 2OAP1 1SHKA 4AG6A 4TL9A 3GLIB 5G53C 2F43B 1TQ6A 1N6RA 4A9AA 4AYWA 1G41A 1XXHB 5IT5A 1P73A 5C46F 4CF7A 2REBA 2YC2C 3T34A 5EE9A 3U2QA 1Z5ZA 5DI3B 4E03A 1ZMXA 4V0OA 1DAEA 5DI3A 2CDNA 2OT3B 2XTZA 4DLRA 1X8JA 4V0KA 2BHRA 4XSHA 3TSZA 2NOAA 2AWNA 1VKJA 4M9QA 3K70B 1UKYA 1JECA 1U99A 1JR3E 5FTJA 1G7SA 2ZRBA 4DHEA 2RGGA 1XCGB 3V9PA 1PUIA 1I4TD 2VTKA 4Q4LA 1J70A 1FUKA 5DGXA 1N6LA 8OHMA 4A0FA 3GLHB 3LAWA 4ERNA 4EUNA 2CNWA 2DB3A 2IK8A 3C7KA 3P1JA 3LX8A 5C2JB 2NO7A 3GFTA 1RRPA 3ICQB 4JMPA 2P0EA 2ZS7A 2WPDD 2WJIA 3LW8A 3AVOA 2FDCA 1ESNA 1UM8A 3TMKA 4LHVA 1E1RA 1CEEA 1NNEA 2WSSA 3QJYA 4MDEA 1CXZA 2AWOA 3QVUA 1U94A 2OHFA 1QHYA 3KKNA 2WWYA 1IM2A 1EFRD 4OI2A 1KJWA 1E0KA 4NH0A 4N0EA 5JSZA 5K8IA 5IRCD 1W47A 3QKUA 4ZDJA 1MOZA 1TF5A 3L2OB 4NCJA 1MRNA 2AXPA 4DCUA 1E9CA 3EPJA 2QPAA 4PAQA 2W6IA 4AKIA 4TMKA 1PV4A 3UMRA 4DDTA 4FMBB 2BJVA 2PLFA 4JLVA 2DWQA 2REXB 3QXHA 2Z6VA 4X8MA 5G3ZA 4DC9A 4NCNA 3K0FB 4FN5A 4H1UA 3D31A
chains in the Genus database with same CATH superfamily
3FW1A 2GHRA 3PA6A 3V8RA 5K0EA 3QJ5A 1KEEA 2QDKA 1TA9A 1WB9A 4TM8A 2AH5A 3BF7A 2F9LA 3S27A 1PLLA 1KKLA 3CNQS 4ZGWA 1H8EA 1OJLA 3NP7A 3BH6A 1P6UA 3GRRA 5IVPA 1K8QA 5K3AA 3AB7A 4Q1AA 2QVGA 2G63A 3MMNA 3WHKA 2W4IA 3C41J 3ZBUA 1S8AA 3PYLA 3KHSA 3RCBA 3UA3A 1S1MA 1WXFA 3KDPA 5AK6A 3CLKA 1T2CA 1JMYA 4PHFA 1QUEA 1I7PA 4N7BA 5KKCA 2HMVA 2OXIA 1LDBA 1SXJE 5AOVA 2BMEA 4DQ0A 4N39A 4QE3A 1H2XA 2G25A 1QHNA 3OUZA 3AI7A 2HA2A 4MWEA 1B00A 4RZSA 3LRXA 4AP9A 1N8SA 5AD1A 2YQZA 2BCEA 3Q6IA 1GL9B 2A9PA 4S04A 3HJFA 4JQCA 5GIOE 3S7TA 3CHYA 3FLEA 3TBHA 5CT8A 4ZK2A 3FSGA 4IBOA 3QFHA 3D54D 5F77A 1C3XA 3UVEA 1U7OA 4IVQA 4CCSA 4EAQA 4DNOA 5MF6A 1HDRA 3AEKB 3ABZA 5IAEA 1C9JA 1DGQA 1N2CB 1YS2X 1HBJA 2H1LA 4GR4A 1YWGO 4OHPA 4Q01A 2JFXA 3WLMA 4H18A 3EZ2A 4EARA 4ZYWA 1OV6A 2PT7A 1QR6A 5EPEA 3NXSA 4WBNB 1LW6E 1OZGA 2NXNA 4IDCA 3QUTA 3HDJA 3RBZA 5HOEA 1QBKC 3OJ0A 1OGIA 4BE7B 3ESCA 2ILTA 3BULA 1K3FA 2OAQ1 4ESHA 4O59O 3F5QA 4HRVA 1E2EA 5IPFA 3ERCA 1DELA 4O02B 2UU9B 4X44A 3IDOA 3I8XA 1TA0A 2E18A 2GBLA 2Y27A 4V3BA 3VO8A 5AVQA 4J0FA 2RD2A 1D6JA 1DB3A 1GU0A 4WZBA 1YULA 3RFCA 4DR1B 1R37A 4D80A 5I51A 1QCZA 1ZG3A 2E7ZA 1TPZA 2J1LA 3VTFA 3ECSA 1H9BA 4OGWA 3W05A 1OXTA 1D2EA 1UJCA 3Q9LA 4M87A 1A1SA 3EIEA 4KVFA 1OW3B 1YO6A 5DGDA 4LMRA 3RYHA 5KTSA 3RSLA 1P0CA 4JASB 4DTIA 4NS4A 3K1YA 4DR2B 2CXOA 3PHLA 1T5IA 2WTXA 3B1FA 3W8NA 2Q6TA 2Y1FA 3CEJA 2POCA 2A9QA 3EIHA 3R74A 1QIEA 1PR9A 3JZIA 3HWSA 1GG8A 1XTUA 1NV9A 2WU1A 3R0QA 4R2IA 2CLEB 2E0IA 4OLBA 2J48A 3OY2A 4HEHA 2QQFA 3UANA 1VE3A 3TOXA 1Q83A 3N2YA 3IPXA 4K6HA 3MGGA 2RC5A 5GAJA 4ANFA 5L45A 2B78A 1XCMA 2FSGA 3QPAA 4GZLA 1U8CB 4S2UA 5AI4A 3IB3A 4JR0A 1KS9A 3TCNA 2EKBA 3ETNA 1BROA 4IINA 4N6GA 2HZBA 4ND8A 3TR0A 2YJTD 1YRBA 1BH2A 4BO0A 2FMUA 3KG2A 2HGZA 2D00A 2FW8A 2VP2A 4MAMA 1PJ2A 3C5EA 2P4EA 5CVJA 2ECQA 4LY0A 1A4XA 3W2EA 1NT4A 1QGYA 2BKLA 4WBSA 1IEXA 4X7RA 2VPPA 2CKMA 3BL8A 4L50A 3X43A 2HU7A 2GBFA 2VDRB 1B43A 2IE0A 5BMOA 1NASA 4H60A 2B83A 3P0HA 3KE9A 4L51A 5TIIA 4ZYYA 4RCYA 2HPHA 3AF2A 3DNPA 3VC3A 4FFOA 3VPFA 3VSCA 4Y6LA 3QSYA 4RA9A 3BMQA 1DRVA 1PZEA 1GA1A 4Q1EA 4QBTA 4HLUC 1VTKA 4A4DA 3ZZ0A 3ZCTA 1JEAA 3W5JA 3BE8A 3LCJA 3UXMA 6ABPA 1WMBA 2VXYA 3BF8A 4LJ9A 3FCCA 3SJZA 2J09A 3IP7A 2QVBA 1SMKA 3S8EA 1GZDA 4RYLA 3IBCA 4KMSA 2AD5A 2O0MA 3MERA 4DR7B 3X2EA 3Q7RA 4UVHA 4GWGA 5K4HA 1O89A 3EMDA 2XDWA 4TRJA 2WUDA 4B8WA 1GP2A 2YVAA 1IN7A 3EVAA 1YQUA 2Q6OA 1ILEA 2GEVA 1PFYA 5JNRA 1PS8A 3N2ZB 4P5DA 3PUZA 4PBSA 2ZRQA 1V45E 1M1YB 4FONA 4WY8A 4OU4A 3LKDA 3HR7A 2IFTA 3OZWA 3QU2A 3HM9A 2XUIA 3FTEA 1QP8A 3AEKA 4HB0A 5K0ZA 4RKFA 1XVLA 2DQYA 5FTWA 1S4QA 3CNOA 3IEVA 2X3YA 3RBXA 5GIPE 2R8BA 1H2AS 2GDZA 5CYGA 1OI2A 3BGSA 3EARA 5KQMA 1XBTA 1RE0A 4ZFNA 3HPQA 1E2HA 4Y2YA 3U4AA 2X14A 4HAYA 4MVJI 2IELA 1F6WA 1WSDA 1TM5E 2FUCA 4MKRA 5GV7A 4Z1MD 2HO5A 3AG5A 2DKNA 3GUUA 5KYWB 2B92A 4WE3A 5B2ZA 1HEYA 2ZIAA 4P80A 1BVYF 4MCAA 4EJ2A 1HYEA 3C8UA 4NBUA 4JCOA 5A6SB 4EGSA 4S05A 2WILA 3EISA 4LCEA 4OLAA 3SFZA 3ICPA 3TLCA 2GSWA 2QMQA 4EL5A 2AMFA 1L5FA 5EHXA 4HEJA 1MIHA 1SVOA 2CDBA 2EDCA 2FW7A 3EDYA 3HVKA 4H7KA 2Y67A 4AZ0B 2XB2A 3AK4A 3T61A 5ER6A 1JB9A 2RHTA 2WDZA 1XTZA 1EXMA 3WR5A 4WCDA 5A4DA 4G0NA 4CTNA 3MA0A 3ZDAA 5CGQB 3T9BA 2OZVA 2IHTA 3VVLA 4YRSA 1JG1A 3CZPA 2VQEB 4Z4EA 1EBUA 2X0KA 4KQ1A 3ZN2A 2ORWA 2IYQA 1RLUA 1DQRA 3JAWA 2DOKA 4A2QA 4YCBA 1TVEA 1QGDA 4IIFA 3I2KA 4RCVA 5EWLA 2WICA 4G1EB 5HGJA 2ZIFA 3KUCA 3OLQA 1E58A 1QHXA 1UZMA 4XYLA 1Y7LA 4BZPA 3IEMA 1U28A 1ZGAA 1PBTA 4FYXA 1AUVA 5AUOB 3GLIB 4MDYA 1H6CA 3IEUA 4KHZA 4XWYA 5LPNA 2R79A 3QGMA 2XWSA 3P2JA 5JSQA 4KR7A 2FZ5A 1YDGA 3EBOA 1G6HA 2EZ9A 1EFVB 1YE3A 3HGQA 4B76A 2NQ2C 4TTVA 4A3SA 1G19A 3BFKA 3IC5A 4MGKR 3QX7A 3E2MA 1PNTA 3A1CA 3ODGA 5HKLA 1CLUA 3WKBA 5E6SB 3VZRA 1G20E 1JALA 1E7SA 1KAQA 2B25A 4UUNA 4N3GA 2BFWA 4UVGA 4EK9A 3N2KA 3P32A 2MINB 1DQPA 3ESZA 4WXRA 4B83A 1P0PA 5TPWB 5ENDA 2PTHA 2JFZA 2GN0A 4EB3A 1RJFA 2YZKA 2ZWOA 4TLLB 2HSDA 2LWIA 5EMMA 2HT1A 2G1PA 3I9LA 5C7LO 7GPBA 3FAZA 5KAMA 4EKIA 3KUXA 2Y4NA 5F7XA 3E9DA 3RR2A 1E2LA 4CLOA 1JXMA 4D45A 1ZRHA 1IBMB 1WXIA 1L5GB 1CS4C 1YAJA 2PSFA 3SSOA 5H3HA 2QG9A 2ZE5A 4UMEA 2VCEA 4AJJA 2PGDA 4B43A 1QBGA 2Q5FA 2DC1A 5F78A 2I7DA 1AXGA 2P9GA 3NT2A 4M1WA 3UFBA 1VI5A 1OU0A 5G02A 1L8OA 1XMIA 4UUOA 4U7DA 4QDUA 5HZKA 5GQSA 3LSTA 4AZSA 1N3BA 1TVKB 4IO0A 2QU8A 5K01A 3TJRA 4D4LA 4MMZB 4G85A 1FMLA 3MYYA 3R3SA 4GYJA 4CJXA 3AKCA 3NZEA 1T4DA 4HWGA 4U6SA 4BVFA 2FSHA 4WJLA 1J0XO 1HM5A 2C99A 1IG3A 2OBLA 3BS4A 3C3BA 4PCLA 2CNWD 4D4HA 2C2XA 2RK6A 4JGGA 1DKQA 5GJVC 1U0GA 2D2FA 1T9ZA 4WT7A 3OOYA 2ES4A 1P62B 2WYHA 2QN2A 1B1CA 1KXZA 1GFZA 3TSWA 5KYYA 2B8TA 2NPOA 3GLGE 3KT3A 2V7QD 4R1LA 4XIJA 2NTYC 4MAFA 4YJGA 3U7EB 3M6IA 3EIWA 4FOTA 1X15A 5IDYA 2V8BA 1KAGA 2QM3A 4B17A 1CSEE 3G2MA 2VDJA 4YC7A 5DYIA 2ISQA 4NEQA 2DT8A 3MT0A 1O94A 1E2FA 4UM5A 5TRTA 2FF5A 1FB5A 1RT9A 1E5QA 2D06A 3GNSA 3U81A 1VGQA 2H7XA 1JEDA 3AW8A 1ID8A 2H11A 3HJAA 5FTKA 5IZCC 5F1KA 3COYA 5IMBA 3I2HA 4B45A 2RHWA 1IVSA 3HL0A 1KF0A 1J5XA 4JIMA 5IHPA 3CCBA 1OA0A 4L75A 4INZA 1YA8A 1IN6A 1GDDA 1Q1QA 4IUDS 3SC3A 3IA2A 3LDAA 5EP3A 3M33A 4O2BA 5K3FB 2PX8A 3FMPB 4W5HA 3U60B 3B8EA 2VAVA 1ZA2A 3QQ5A 4TXMA 4WAUA 3UHJA 1FYXA 1OIWA 4L85A 2QL9A 3K0HA 4YP6A 2DZDA 1RM5A 3LBYA 4HDCA 2QMUA 3TLEA 4JEIA 2X2FA 3CX7A 4G23A 1ZM4A 3TTTA 3PCRB 3TWOA 3WC4A 2FX2A 2QRLA 5DU2A 1YVDA 4GF5A 4IY1A 5DLDA 4MTCA 4IGKA 3R1IA 4DSOA 1A3CA 4Z4HA 3OWXA 2JIMA 1J8VA 1VB5A 4LE1A 1IQUA 3A31A 4ZVOA 1J9EA 1NI3A 1MVOA 5ALYA 1IJBA 2Q3EA 3L8YA 1P1IA 3O1JC 4IJVA 5HUJA 3WFZA 1OKKD 2PA0A 4PAGA 3EEFA 1I2MA 1BQ4A 2PRSA 1L3IA 1TUBB 3WQRA 1TK3A 1R5JA 2JCXA 4LZOA 4E2ZA 1P7VA 3RVMA 5B1SA 1AKVA 5B7QA 2GN6A 3HO6A 4LWQA 1Y4AE 5KYYB 1I3NA 2WPDA 1IY0A 2OEPA 3O8BA 4BFLA 5J4YA 5AW9A 5ITWA 3HB7A 5J1SB 2VP4A 7MHTA 1M2WA 2OORA 3X1XA 5FNVF 2B37A 1QYDA 4XYGA 4FBGA 4ZOLB 3SM3A 3D7SA 3WRYC 4RH1A 2E4WA 5TE9A 4FZVA 1UBEA 3S29A 4CR8A 5FV7A 4IJWA 2CXPA 3OBBA 4GC9A 3V8NA 5FPKA 4HLCA 1CIVA 1EKXA 3NIWA 4KGZA 1GTVA 1PL6A 3EFHA 3X1DA 4W8OA 1JFVA 1BX0A 2JI8A 4BLUA 1M2VA 2IU3A 1JHPA 3EB9A 1ZO8A 2C9CA 3RRMA 5CM8B 1GZ3A 1BFDA 2YMQA 4RVOA 1I13A 2L82A 2ZWVA 2JLCA 1G8MA 1L3BA 2PWAA 4WOCA 1R6TA 4A0SA 5DBGA 3L93A 3R7DA 3K2QA 4I4LA 2VSNA 1II8B 2Y0EA 4AZ3B 3WJ7A 1AA6A 1RVV1 4RQAA 2Z1NA 4JZKA 5I7HA 5AUNB 3EXEA 1Y8AA 1YK0A 1N6NA 3EZ7A 1EYZA 3N7UA 4F86A 1P1HA 3AESA 3G5UA 4CLRA 2B1GA 2DH6A 2VCYA 4TVBA 3V7FA 2QJWA 3KSRA 1U2ZA 3BWDD 2P3LA 4E7PA 2Y1DA 3CLUD 3BWYA 1HE4A 4BBZA 4DFDA 4G0VA 2HEGA 1USKA 3WL8A 4DMUB 4NFYA 5JPDA 3T1YB 2JGKA 1T6XA 1I33A 2JLBA 2NSLA 3O4GA 2CLHB 3V4LA 3CT6A 1WUJS 2CB9A 3N8DA 4UDXX 1WQ4A 5L3RA 1BFUA 4ZCIA 4Y7DA 3JPYA 3P45A 4AWBA 3KFLA 2C42A 1FDIA 3MJVA 5AKEA 1EK2A 1E2KA 1UP6A 1O97D 4DG8A 3AM5A 4CQMB 1KYTA 2XGMA 5L6LB 4GBJA 4KBFA 4F92B 1R8YA 3R75A 3IAEA 4G56A 3UAYA 3GRZA 3LO5A 3SN6A 2HDHA 5C1OA 2X8JB 1E3TA 3FOAA 4J29A 2C9ZA 2OGWA 4FLMA 2ZR8A 5E0OA 3IHTA 4WZBB 3VBCA 2X0IA 3WLSA 1SAYA 4M9SA 4I8XA 3DGEC 3FYDA 2R62A 4FYHA 3ZZUA 2WNHA 4G8CA 3QF7A 1WD5A 1LQUA 3ANLA 3F2IA 3KQTA 4UTOA 4F6RA 2HSEA 4X66B 3NHPA 4LI3X 3OPXA 3PR2B 4J3JA 1NNI1 4P38A 4UMDA 4EZIA 4F60A 5BPHA 4DV7B 2FMXA 5CDSA 4NL4H 1I7DA 2BYTA 4OLHA 2H06A 1N2SA 3MS2A 2A5LA 4GM0A 4OLJA 2ZR0A 4U7JA 4TXHA 4HGPA 1EQUA 1US8B 1IOLA 5G1NA 1P9RA 1QM5A 4N01A 4FFVA 3R23A 3HYSA 2HY7A 2YTZA 1E6KA 5FYDA 3Q7EA 4JN6B 5BYKA 1FQKA 3U7FB 1FSFA 4GS5A 4LF4B 3VAZA 4CL2A 1BXGB 1YZFA 4IHJB 4EJSA 5JBQA 1RKBA 3U09A 4PLHA 2DFDA 4OAQA 4RMGA 3CIFA 1TU0A 4HI0E 4I4IA 3LY7A 3E1GA 3C7TA 4DDHA 1TYAE 3ZK8A 1H6DA 2CBXA 3MTQA 4YIHA 3Q3IA 4NCAA 4OQZA 1YR6A 4L4UA 5FWAA 4KYIB 4BNVA 4D4JA 2F1RA 3BILA 1UIRA 3GLFE 4U7FA 3PZRA 4MB2A 2IY7A 4ZEWA 2CNKA 2NYUA 1N9GA 5CJJA 5KU7A 4Z8YA 3GFFA 2V1XA 2HPZA 3L5KA 4DV4B 5EJ2A 1F60A 2O5RA 3U61B 2X5NA 1KVUA 5G0SA 2VHYA 3S8YA 2JIZA 1SVIA 2JA2A 3FFTA 2CW5A 1NF3A 1SZCA 3Q1LA 2ZYIA 2XAAA 3H9UA 4JFAA 1MPXA 1F2UB 1WOMA 1EUYA 1U02A 3AL3A 3B13B 4GH5A 4AUEA 5BOSA 2IBSA 1XZBA 2C8VA 5AKHA 1RWMA 1VZ2A 4GMFA 5TC4A 3I9V6 2CJWA 3U7GA 5H3CA 3ICWA 4DBVO 3CGGA 1RP7A 2FEPA 3BMQB 4L5JA 2FUNB 2ZIGA 3OO1A 1M83A 2GCOA 3AEUA 4MV8A 2ONCA 2EC5A 2W6QA 4RV5A 2GF0A 3H8JA 3G8AA 3PDCA 3Q7PA 4HFMA 1GNLA 1WHTB 2BSXA 2G80A 2HLHA 2H2IA 3HRKA 1COWD 4UUMA 2J9FB 4LGVA 2RGDA 2RHMA 2VDWB 1NJ1A 2LRHA 3GAMA 4LNUA 1JYFA 1ULTA 1Z4JA 2FW0A 3CH7A 4PNPA 2V7PA 5FUYA 3V5NA 2A4MA 4NKRA 2RG7A 3ZG6A 2EGUA 3PYMA 1QH1A 1HT3A 3OT1B 5DVZA 1G5TA 1H4VB 4B79A 2FPMA 3OICA 2MSWA 3HCBA 3L8EA 4EFNA 4UOZA 3OKCA 3WL7A 3C2QA 4HGNA 4O33A 3RTEA 4OREX 4BNXA 4DWWA 1JH9A 4CM4A 1DRWA 4ZV7A 4ZOQI 5H68A 2AI1A 2GEKA 4XWTA 5KNBH 3U6KA 1L4KA 2JGLA 3B36A 1WMFA 3AHCA 4G8JA 5JCOA 1JFSA 2IDZA 3RVQA 4DCOA 1XZDA 4E30A 1B8VA 4ECAA 3LUFA 5AVWA 1KI9A 3NRCA 1QQ6A 4QQNA 4OHWA 4UFOA 2P27A 4PNHA 1FP7A 4RPLA 3TW8A 5JJIA 1NVDA 3FUTA 3GC6A 3R41A 4RK0A 4QUDA 2LCQA 2C4HA 4GVXA 4GMDA 4ZZ3A 2F3UA 1FP4B 3L0OA 1IY2A 3SIXA 1I5EA 2QX7A 5DXJA 1M1NA 4INOA 1KVTA 3RWMB 4QXRA 1JB1A 2EFHB 4BV2A 4C0XA 4OB6A 4N82A 4K9QA 1ISSA 4XWGA 3MRTA 3MOIA 2FUKA 1ZSVA 4LZLA 4P08A 4PZEA 2K7FA 2ZVQX 4UNIA 5C35A 1FS6A 2ADFA 4HRYA 4OFBA 3SF0A 3DE4X 5ECYA 1BE1A 1K6XA 1X7XA 2YS7A 4DUZB 3NFRA 2CDAA 3EAQA 1UXGA 2LZ0A 3QTBA 3OTOB 2ZRAA 2HRRA 3S1AA 3SC2A 5SZKB 4WCFA 4EVQA 3L43A 1X14A 3UH1A 3ESDA 4NHOA 4LFCB 3NBQA 2O9JA 1Y48E 2I4MA 2WF5A 3O2SB 4OJKA 4TT8A 1PJQA 2PS0A 2Q6LA 3B12A 4TWBA 4URVR 1HTTA 2HNAA 2WIJA 2W6JD 3LIPA 1V8BA 4FHCA 2AOVA 3NHMA 5E7MA 4D57A 3PLNA 3S6JA 3MWKA 3ZHTA 3UY4A 2Q1SA 3HKBA 3CONA 4BJ1A 1A9XB 2FX5A 4IKEA 5JDIA 4DYHA 4WKOA 1LI5A 3E03A 2Q7XA 4EHIA 4Y9UA 3HXPA 2A9FA 2Q49A 4Y8VA 2ZBRA 1LDGA 1KE2A 1P5ZB 2GFQA 3K31A 4IGAA 4CIXA 4G07A 1VKNA 2YHBA 3A1DA 3T3GA 4C0AC 3NORA 5JXJA 3KL2A 3MPOA 3OZ7A 3IJRA 1J0AA 1F9EA 2BUBA 1BKSB 3BE4A 3F8SA 1K9VF 2QQ5A 5IVIA 2YVLA 1M5RA 5K5EA 3OPVA 3V1NA 3AHJA 4RLQA 3TQFA 2O3TA 1CZRA 1WUHS 4IZOA 3WIEA 1OKKA 1Z06A 1OWLA 1E2GA 2KS6A 3MQ2A 1JG7A 1A76A 3VJMA 4DIFA 5C32A 3EPLA 2APJA 1PJ3A 2QZZA 3I8OA 3OQJA 5A1TA 4U9UA 5B3LA 4CLEA 1QYWA 1TZMA 5EQTA 2IX3A 4W5QA 2X9NA 3I72A 3OIUA 4WPGA 5BSUA 4HQFA 1KDVA 2EZUA 5I7RA 3DP7A 1AE1A 1NX9A 1QZUA 1N5OX 3BXGA 4K46A 3HB9A 3O8OB 2RHCA 2QN3A 13PKA 1X7WA 3HK2A 5FUBA 1GIAA 5JY1A 2WYVA 2ICAA 5ALNA 2OO3A 3DWGA 1RLIA 3DAYA 4ALLA 1L2TA 4J1TC 2XUOA 2UZIR 2WU3A 1WD7A 1W5TA 2AVDA 3P2IA 5DT9A 2IV2X 1V3QE 1E92A 3CVJA 4DLYA 1QNFA 1S6YA 2OCXA 1WKCA 2RCYA 4G41A 5A3RA 1XEXA 2DE0X 4P7BA 4O2AA 4HDAA 1SIWA 2ZP1A 1C0IA 3D6FA 3DQZA 5C1BA 3IHLA 3L82B 4OOFA 5REQB 4TKMA 3AVVA 2O2DA 1PT9A 3M49A 3JD2A 4FQ8A 5AM4A 2X9GA 3ABRB 3KSUA 4TZKA 3DOHA 4YRBA 4JDUA 5IULC 1BXKA 1OGJA 1VL1A 1XZJA 4OXRA 1RD4A 2CZGA 2DTEA 2A3RA 4BQPA 1CLEA 1G42A 2PH7A 4DIBA 4PXSA 1U3WA 4RJKA 1A9TA 5REQA 3U7HB 1JQJC 4L5YA 3G5LA 3DNFA 3PC4A 1OV4A 4K8RB 4YJHB 5IJWA 5CK5A 3U44A 3CTMA 3GLKA 3A6EA 1AKRA 1BOFA 1ZZEA 3WLPA 4TYMA 5IKMA 4WK4B 4HMQA 3GLFB 1RI1A 1QFYA 1EFCA 2XQKA 5HJ7A 1H5NA 4NK4A 3NHAA 2FTKE 3D2AA 1LSOA 1YS1X 4I6EA 1GQYA 1G1MA 3JQBA 4DIDA 1YDHA 4REQB 1PJ8A 1CUGA 3GPCA 4OQFA 3E7FA 4C03A 3SSMA 1WZ2A 1SC4A 4C22A 3EZ6A 3ROTA 3ZNPA 3F67A 2IOQA 1EJBA 2D62A 3ILSA 4GOLD 2CXNA 4LV6A 4GKAA 4J7AA 4G0PA 2OLKA 3FA2A 4MVJE 2XDYA 4YPFA 5H1YA 2AYYA 1RC8A 2X6QA 4NOMA 2CMHA 2QSUA 4IQ4A 4MS4A 3FSEA 1VMKA 1GAXA 1HT1E 3G2PA 2ZBFA 4EA9A 5KX5B 5JTTA 5FWYB 1HFEL 1TEVA 3KWLA 3WBFA 3LS2A 5DNYB 4MHTA 1ZS9A 3W7VA 3IL2A 1PFUA 2Y9PB 3PI7A 4BFXA 3JQPA 4XYMA 1VM6A 4J2TA 3CVWA 1WPQA 2YWGA 5LBUA 3UC9A 4FX2A 2EDAA 4UNPA 2CVOA 3MJEA 2OQVA 4BRZA 3O4FA 1UBLS 2MHCA 3DVRX 3G85A 3W79A 4RQUA 1W2HA 3AQIA 3BHMA 4RJTA 3FCAA 3C5CA 1RAHA 1EP2B 1M8PA 4MGZR 2PMWB 1NI4B 1N0HA 1BS2A 1HQYE 3IHWA 3LC1O 4J0CA 4WKCA 5KOJA 4ZQHA 1TIKA 2PU7A 2ZBUA 5M34A 1E9FA 1SUBA 3D7MA 4M4SA 5EIBD 3WADA 3DOOA 3S0JA 5B4VA 1XFDA 5CX1B 3L8CA 5LP6B 2B8JA 1ZUNB 3LYUA 3M6UA 3TSOA 4W9MC 1SZPA 3EEOA 1Q1GA 4FYKA 5KQRA 2VHQA 3ORYA 2I3ZA 2W2PA 3BHNA 3ZS9A 2NO0A 4QPNA 2CFOA 4Q9LA 1CFJA 5DSTA 2AG8A 2WJZB 3KQVA 3L7KA 1PR4A 3AI3A 1V5IA 1HQCA 2IXGA 2ZTUA 4DLLA 4EP1A 2CEKA 3FKSD 2UZ1A 3HA2A 1JHXA 5HYVA 4QTYA 3IXQA 3K1JA 1KI7A 2A14A 1ZONA 4IDOA 3K9CA 1XQ6A 4DM7A 4WGGA 3FB4A 5IVKA 4TRRA 1X7YA 1UFOA 3CF0A 2A59A 5IVDA 4NE7A 4RTQA 4M55A 1P81A 2IZZA 4RF4A 5F9FA 1Q11A 1Q0LA 1T9GR 4OQNA 5HMMA 3ZVLA 2FHPA 4AO7A 3WOHA 3BRWD 1KFJB 2WJPA 2Y1OA 4HB2A 3GDOA 1RYYA 3N53A 1GVHA 2RFLA 2OE2A 3MWDB 3FLAA 3NIFB 3ENQA 4YNBA 2CDCA 2PUVA 1FYFA 4RKQA 3KB2A 4X7PA 5C7OO 1PTKA 3QVOA 2AEMA 1KI6A 2Q1YA 2Y1GA 4Y6OA 3GPBA 1ZCZA 1MAHA 3C3CA 4NG4A 3ZHSA 1WHSA 3EASA 4KQ6A 3T3IA 4I9UA 1HQKA 3CR8A 1P75A 2PANA 4LZNA 3THWB 1PR6A 3NANA 3UMFA 3OWHA 4D97A 1HTWA 1TO2E 4KQGA 4MUNA 3G9UA 1X9GA 4PHCA 4AP5A 1AV7A 1EMDA 3W5AA 3AFOA 5JEDA 2YFKA 5IBPA 1LGYA 1BHJA 1MB0A 3D6NB 4TMVA 1B15A 3JWHA 1JDBB 1DFGA 5A5GA 4NARA 2XMPA 4DLUA 5GVSA 2HK8A 3ENVA 3LPLA 3SHTA 1RWOA 4TV9B 1PVDA 1XMXA 3WK9A 2C7PA 4GMHA 3DBLB 4E1VA 4X8OA 3QPUA 1PL7A 4ZKDA 1LU9A 2PMEA 4WN9A 4RTPA 3Q7SA 4Q5IA 2P8JA 3SFVA 2JFFA 1H65A 4S0XA 2GFHA 3GFSA 4I55B 4AKTA 1D6NA 4Y6GB 1NW3A 1ANKA 2W2KA 3W3AH 4GRDA 3K9FC 2GK7A 2H8KA 4FT2A 4RTSA 3ZKAA 2UZAA 1N2EA 1J22A 3UATA 5JS6A 2CLSA 2FJ0A 4Y2GA 5DMHA 3UCEA 1VG8A 2ID8A 3K9GA 4YV7A 3O2NA 5IYZA 2EX1A 1XRRA 3LC2O 4M99A 1FPMA 3GFGA 1LSUA 1TM1E 1GN8A 2X8BA 4XGQA 5HK9A 5IH3A 1MA3A 3T9DA 5JI2E 1PS0A 2ZDQA 1DAMA 1Q7RA 2HTEA 3Q4GA 4UBJA 1RHRA 2YNMA 4MUXA 1Y33E 3MWLA 4BUJA 1M0EA 2J0QA 1AT1A 1EZ4A 4PC1A 3G49A 4ZDIA 1E9EA 3UW3A 1QKJA 3B6ZA 2OCKA 1M8KA 3KVOA 3PPXA 4L2IB 5AKKA 4N03A 5GMOA 4Y0AA 2VRCA 5BN5A 4IS3A 3FZQA 4BVLA 2ZUSA 4L8VA 2PX2A 5FWYA 3DLTA 4I7EA 3PEWA 3FWNA 1HF3A 3GFOA 5DW0A 3J81A 2QPLA 4US1R 2V58A 4U2EA 1G5IA 2JFNA 3CY6A 5HS6A 5CDYA 1KAEA 2QNBA 4GXRA 4OFZA 1NR1A 3EF0A 5C9ZA 1YZKA 3FDJA 4X93A 1GNVA 1GSIA 2VZEA 4AZVA 3R9KA 2XCRB 2JGDB 4BL5A 1IYZA 4YCAA 2GN1A 1A77A 4CM9A 2PWZA 4RHFA 4F97A 1XPJA 1PT5A 1E9RA 2VEOA 2OFXA 3GVXA 3VDNB 2R44A 2I2CA 4C01A 3MB8A 2XZLA 3VU8A 2JI4A 1BXGA 4F06A 1DKMA 1IFXA 3DL4A 4AG3A 4BUZA 5D2CA 1P5FA 5IH7A 6Q21A 4LSZA 1REQA 1Z2AA 1DX9A 3CWQA 1LTHR 1SBYA 4JBXA 3GLFA 3ZCUA 1ZGJA 3T7KA 3FHTA 1WW8A 2I1LA 1Z08A 2OM2A 1R6XA 1A97A 1QIMA 3CH5A 2C61A 3I5MA 2F6RA 5EE3A 4KIFA 5EWJB 4EGAA 1N34B 3Q3EA 4F6LA 2GF2A 3TCKA 5DTIA 1JFTA 2YCLA 4ADSG 1JJAA 4JXXA 1SHLA 3CM0A 5LP6F 2FE1A 1X87A 3PE6A 4FZRA 3VOSA 3Q10A 1XQXA 4M8LA 3I6YA 4V0NA 1Y89A 3LBAA 1MD9A 4B9AA 1HV8A 3PQ3A 2I66A 2VJOA 3RB8A 2HH9A 2GAJA 3MMPA 1F8FA 1DTWA 1VSUA 2GXQA 2N9UA 2SECE 3H11B 1PLJA 3OQ6A 3OU2A 1WU8A 3PUYA 4QDTA 4IMPA 4IYRA 3IDFA 2Q2QA 4ENVA 2I7XA 3E84A 1SUCA 1USGA 4F9EA 4RH0A 2FUEA 3VI3B 2FSIA 3RYFB 4PPYA 5I7UA 1G9SA 1A7KA 3GQBA 4L07A 2YXPX 3I6BA 1J25A 1P3Y1 4W1SA 3HDQA 2BMDA 2R1TB 4NYMR 2Y6UA 2A1UA 2JFVA 2EF1A 3OPYB 3RWBA 4CHTA 5MFZA 1DBSA 1G20B 2BKEA 2JLAA 3JD4A 1Z5WA 2VDPB 4YMVA 4QD3A 3OZAA 1QB8A 3HFSA 1JFLA 2QD2A 2ZRIA 4TWAA 2ZE6A 3LD9A 2J87A 3MFQA 4ZCPA 4GT1A 4Y7CA 2MOKA 4BBAA 4DLNA 1HXHA 2DUUA 3KPYA 4ZZ0A 3TI9A 3KOXA 4WLNA 2C4TA 2IPAB 3IDAA 1MJNA 3MLAA 2UYOA 3DLIA 4TM7A 3N5KA 4QSHA 1VQ1A 1DIHA 4AM8A 1DBRA 1JPJA 2OK7A 2EL9A 3E9NA 4JBLA 1YONA 4MQEB 4UXHA 1U9ZA 3RSZA 5HHTA 5GINE 1L7QA 3D2BA 5TVGA 4DF3A 1NULA 2P2NA 3SR3A 1SM4A 3E22A 5TLSA 3EXEB 5KOHA 3HU2A 2XKJE 4KKVA 1O95A 4BAZA 4YT4A 4BX9A 5KAPA 3PENA 2I99A 2VZ9A 3GJQA 1VL6A 4UW9A 3S68A 3TR5A 2JATA 1ORTA 1NPYA 2I6XA 4N7JA 4NDZA 2ZRCA 5D5HA 1ZD8A 2NUAB 1EJ6A 5F7ZA 3THSA 1GV0A 1RJWA 4EBBA 1IN4A 4OEHA 2BAGA 4PF1A 2NU8A 1NWHA 3MYRA 1HG0A 4WCFC 2PA3A 3RBAA 3W6NA 1ZIPA 1O6BA 3ELYA 4UUBA 2C3YA 2ZIXA 3N8GA 2FEXA 5JQGB 2PO7A 2YC4C 4NCHA 1ADBA 2G8LA 4J1NA 3HCRA 5KTYA 1R7RA 5FO1A 4B6SA 2C4UA 1CUDA 3VR0A 1EDOA 4Q4HB 1KQGA 4QGAA 3GLSA 3IBYA 3QYJA 2ZSFA 3GJRA 3OEED 4G89A 2GPWA 4LN1A 5DFAA 3KBBA 3PGLA 4KAXA 5DM60 2Y76A 2AN9A 3BDAA 4OVKA 5JHHB 1U65A 2XVYA 3NAQA 3TKAA 4KP7A 1P7ZA 1ZJ5A 1Q91A 3WL6A 3RSOA 1V9LA 1I1OA 2FPUA 3LDUA 4OD0A 4PVCA 2CHQA 1UJ2A 2GBIA 4C2AA 4KQXA 4DLBA 5LQNA 3ZKWA 1EWYA 2HU5A 1H2BA 2CVPA 3W6PA 2UXDB 5AI5A 3H19A 1MBZA 1W5AA 3T7SA 1R0RE 2DPXA 3PKIA 3QEAZ 3CX3A 4EY6A 1TT7A 3NKFA 4II2A 1FIUA 1CUZA 3HCFA 1C1XA 1I5RA 4WK2B 3LUGA 1VPVA 1X7GA 3T8YA 1BMDA 1Z45A 1S8NA 3C3XA 3E35A 3EHDA 4I1UA 2XPCA 4EVRA 2I8AA 5AKJA 3E2IA 3FGPA 1IBSA 5ES3A 3RTAA 2YV5A 4IXWA 1EK5A 1NBIA 3UBMA 1EP1B 3E9EA 3ENKA 4KWIA 4YCCA 2P2LA 1ZKMA 3WGNA 4D81A 2BTEA 1OWPA 1T29A 3NCHA 1FVXA 5LZ7A 2PEYA 5EHQA 2ZRLA 2DHDA 2AFHE 4B6GA 4JJGA 2J7PD 3ZE8A 4JBIA 1NVXQ 2HIAA 1SQ5A 3L06A 4I9HA 1GEEA 3VPAA 4JI1B 1MC1A 3HG7A 4B6RA 1EIZA 2OBMA 1Y4UA 3T7TA 3R3YA 3OC0A 3PTLA 2XUKA 3IIIA 3LVRE 5EEHA 3WVNA 4E5KA 4JVOA 2IS6A 5BWLA 5C7YA 1FFHA 3GGJA 3ZDCA 4LWPA 2NLOA 3VZDA 1GFIA 3PXDA 1MUUA 4A03A 1JR2A 1L5YA 5MFPA 2XRMA 3A6LA 4S12A 1OCEA 2TMYA 1D4ZA 5T64A 3D1LA 4MEBA 3VAAA 4EHFA 4FW9A 5FD8A 4BNLA 4F72A 1KA9H 1KJIA 1H85A 4KVGA 3DE6X 2Q45A 4HUQB 4JLWA 2WUFA 3ECAA 1NHWA 1CDDA 1OXSC 1IBKB 2WF6A 3HB5X 3K1AA 5AK0A 3NTQA 2QVZX 3AJ8A 3VDMA 1Q7EA 3OCYA 3EODA 2N1MA 4A0GA 2FN4A 5DCUA 2X41A 3ZNOA 1C80A 4DMCA 2EJVA 4D8UA 1VDMA 5TGDA 3ROEA 3PDWA 4BRSA 5AW4A 3QFFA 4P3OA 4DA9A 5IT0A 3DB1A 1DKUA 3NHSA 1OLXA 1UPCA 1G4HA 2GK3A 4DB4A 3FROA 2YWCA 3ZVKA 3RJ9A 3H9BA 1LRJA 3ZGZA 3VKHA 4ZALA 2PZ8A 4AAYA 2XUFA 5CXUA 2RB5A 3UAWA 1T8WA 3DEYX 2QUHA 2VH5R 4GWLA 4OGKA 3SIPA 4CG0A 3MNFA 4QAJA 4GGPA 1FFGA 1J2RA 1UJMA 2WTMA 3A4IA 3MF4A 5EKXA 3RQIA 2HMAA 3ONVA 2X15A 2AZTA 3OURA 3JTEA 2R6CA 4P0QB 1OB2A 3L41A 3DOEA 1XD9A 1O6FA 2C83A 2VSXA 1F17A 1A7UA 1U0EA 1GZ5A 1A2QA 1EM8A 1Z2NX 4M8SA 2B1RA 2QY9A 3AESB 3NBAA 4GU5A 1KJJA 3EYAA 2DR2A 4JJ4A 2Q6KA 4XWKA 1N6PA 1RQLA 1RXUA 1ZWKA 3DWIA 1WJGA 4X61A 3V1YA 2QTVB 4B87A 4PXYA 4Z86A 4DUPA 1B8PA 1UJ6A 1ZZGA 4LRXA 4KYVA 1H3NA 4H31A 4NMMA 3W3ZB 4Z1OA 1OF1A 2Y1LA 3HCDA 2AFIA 1W1IA 2JGEA 4TWIA 2Q2OA 2FPPB 1YJAA 4OXIA 1IB0A 1M2VB 1NWCA 3DV9A 2ONZA 3K0CC 2Q9UA 3N0VA 3EZNA 1UBKS 3RO7A 1FTWA 3V00A 2D0IA 3O1IC 1ZJWA 2NO5A 3GLHA 1ZA1A 1T8PA 1Y1PA 1ISGA 4F6RB 4NTZA 1RTTA 5D51S 4QVKA 5IJZA 1JDNA 5DF1A 4M1KA 4EPTA 1DV2A 3PHHA 5FOVA 2GUGA