2QP4A

Identification and characterization of two amino acids critical for the substrate inhibition of sult2a1
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
284
structure length
279
Chain Sequence
SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNWKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKTQLSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bile salt sulfotransferase
publication title Identification and characterization of two amino acids critical for the substrate inhibition of human dehydroepiandrosterone sulfotransferase (SULT2A1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 279
sequence length 284
ec nomenclature ec 2.8.2.14: Bile-salt sulfotransferase.
pdb deposition date 2007-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qp4A00
1J2JA 3CW2A 4CW7A 2KB0A 1NVWQ 1U99A 2ZU0C 1N6LA 3CF0A 1N5KA 2WICA 1YZTA 4PO1A 4ASUA 1Q1ZA 1NJGA 3IHLA 5GJBA 2IYTA 2UZ3A 1N0UA 4I1VA 1M8PA 1ZW6A 1WBDA 2D06A 2W58A 1RC8A 4AKIA 4BPBA 1W5TA 4KFRA 1TQ4A 4M21A 3LW7A 2IYQA 4R9UC 1CXZA 3SOPA 2DB3A 2CHGA 2GILA 5BYKA 4LY6A 1P7CA 2B7CA 1XZPA 4HLCA 4MKIA 3Q72A 3EWAA 2N42A 4XTCS 4Q4JA 2XTMA 2O8FB 3OFND 4D4KA 3EZ6A 2ZRMA 4ZO4A 3I1FA 4A82A 3PUYA 2ZJOA 3BB4A 5BN5A 4L9SA 2NZJA 3MMPA 1R0WA 2BOVA 3MFYA 3SFZA 1DTSA 2EFCB 1E9RA 3FKSD 5JMTA 3VNUA 4BWYA 5J47A 4RVCA 5J4HA 5CDFA 2YWEA 4FIDA 5FBRB 4IEIA 4NYMQ 2IYUA 4IDNA 4OQXA 5M04A 3NG1A 4ITRC 3B2EA 3GLHB 2A3RA 2VA8A 1NN0A 4UKDA 1VHLA 3PIRA 5BN4A 3A37A 1AS3A 1MO3A 1R8QA 1U94A 4Q7KA 3KDSE 3QKUA 1YZKA 3BERA 2C5LA 2GZHA 3RS0A 1FP6A 2BCJQ 3O8RA 4A92A 1E94E 2XITA 5TV2A 3UWOA 2G77B 1QHHA 1QVRA 4HLUC 3QENA 5B57C 1FPMA 3I61A 2WWYA 2R62A 5HZHA 2QPTA 3MWYW 2ZJ5A 2WVJA 4DLWA 5LD2B 1GNQA 1E2PA 2O5VA 3U44A 3LXRA 1G5RA 3ND9A 1GL9B 3AKDA 4PFSA 3BFKA 1XF9A 4HLUA 4C30A 4PHFA 4A0HA 3RRYA 1EWRA 3LX5A 1FX0A 4Y0VA 5AJVB 1VCNA 4G5OA 3CF6R 4C0LA 3CZQA 4DT1A 4YC7A 4TSFD 3FFBA 4MGIR 2BKEA 5BXQC 1X1SA 1II9A 3LQRA 1UKZA 2IWHA 1M7HA 2YWHA 4NMMA 4L8GA 2NGRA 1KO5A 2R9VA 3TGPA 3AF0A 3WXMA 2QE7D 2ZEJA 1KK1A 1ZINA 1ZC3A 1GM5A 1DELA 2ZRPA 1VDZA 4YLGA 5CYOA 2ONJA 1F5NA 1XRJA 4UJ3A 1E2LA 1YRAA 2OV2A 4XH9B 2YINC 4CT4B 1SXJD 2MMCA 4ZI3A 3T12A 3LQQA 2PCJA 1MRNA 3G0HA 1W48A 4JVLA 2KBFA 2OCBA 1ETUA 2ZR9A 4NL4H 3AVXA 3AM1A 5TDHA 1C4OA 2AD1A 4JLDA 4C9BA 2H1LA 1RJ9B 2ANCA 3JZMA 1ZU4A 4Q18A 2V7QA 3V4FA 2AXPA 2GZAA 4XVUA 1ZD9A 3U3MA 4DCSA 2C03A 4JMPA 3X2SA 1OIVA 3W8NA 2IX3A 2P6UA 2ZI6A 5B30A 4R2HA 2H17A 4B48A 3A6PC 3GCGA 1R0ZA 5EUMA 4CVNA 5L3SB 1IN7A 2ZR7A 4XTRA 5HZKA 3TMKA 4RZXA 1XTQA 1JALA 4AYXA 1G7CA 3QXCA 4C0AC 1Z06A 3FPAA 3EWSA 4EJSB 2QN6A 4LPSA 5CYPA 4P4UA 4PAOA 2OLJA 2IYVA 1N0WA 4Q21A 4Y0AA 5FI1B 4G01B 3O8BA 4WXRA 1NG9A 2ZTSA 3AVPA 3KJHA 1Z63A 4IW3B 3KZ1E 3PEWA 2ASEA 4G5SA 3CX7A 4MA4A 2XTZA 4HAXA 1KJYA 3C5CA 2ZRNA 1XPOA 4AKGA 3CWZA 1SVKA 2O8FA 2IXFA 4WZAE 2QUZA 4IEEA 2PJZA 1WRBA 3K70D 2QBYA 4JLBA 1JPJA 3TE6A 4JL6A 2ZYUX 4PSKA 4PPNA 4QC2A 3LLUA 1JAHA 3GD7A 2RHDA 1T4GA 2ODWA 2R8RA 1QBKC 2WMNB 4AIIA 4HAYA 1P2TA 2EFHB 3X1DA 1LW7A 3KFXA 4OHWA 1Z0IA 1XJ0A 1ZNZA 4FCVA 5KPDA 1VPLA 3IQWA 4QHTA 2DBYA 1ZNYA 4KFSA 3FTQA 5SZHB 3TR5A 2J0QA 1GUAA 4LWZA 5LD2C 2VP5A 4IKEA 2GXQA 3PFIA 4TL8A 1Q20A 4M1WA 2J0UA 4PHGA 1OHHD 3KXIA 3KQNA 3R8CA 2QMHA 2YWGA 4RY2A 3A58B 1CJKC 1FOEB 3AUXA 1NY5A 2A5YB 1GFIA 4AC9A 3A8TA 3N70A 2FV8A 3VU9A 5AJWA 2OBNA 3CLVA 2VSFA 5JBQA 4KBFA 3RVBA 2BMEA 2E9SA 3RABA 2QENA 2Z4RA 2PEYA 4I1OA 1OIXA 1XTIA 4JVSB 2IS2A 2GJ9A 3NEYA 3UG6A 1Z0JA 2BBSA 3B9PA 3P4YA 2OAQ1 4OJKA 2WKQA 2QTFA 2FZ4A 3CX8A 3KXKA 1RRPA 4S35A 3IDQA 3EIHA 1JR3D 4GOKA 4M1YA 1OH8A 5EP1A 1ZCBA 1V5WA 1E9SA 1E1QA 1X6VA 3I8XA 5AWFC 4NP6A 3I32A 3LH5A 5KPJA 1NBME 1M7GA 4TN1A 4B71A 2B6HA 1W0KD 2A5GA 4DJTA 3U7FB 2KWIA 3GJ7A 1GIAA 3FMFA 1F2UA 5J4KA 5JI2E 1DAIA 3RNLA 3TR0A 3W90A 4OK6A 2IF0A 1H8HD 1GL7A 4V0LA 3GEIA 1VYUA 3LXXA 2WJIA 1B0UA 4LYHA 5CB6A 2DFNA 4E09A 2P6RA 3CWQA 4O2RA 3GLFA 3KJGA 3CM0A 3LAWA 1E2QA 2PMDA 2QPAA 2V4ZA 5EP2A 4TMWA 3NBYC 5DIFA 2OXCA 4M9XA 4BFXA 3OESA 4UXIA 5JJLA 3KUDA 5A5GA 2OAP1 2VSXA 2ZE5A 3S1AB 4EJSC 4YMUA 1G3IA 1XEWX 2YWFA 3OEHA 4Z1MD 2BMDA 4JLPA 4NYJR 1N2CE 1Q1EA 3SYKA 2WTUA 4ERNA 1S9HA 5FPSA 4DCVA 2B92A 2QGNA 3AKYA 4EJSA 5EP3A 3AKEA 4K8OA 1KI9A 2G1JA 2BJVA 4LJ7A 4P4SB 1UM8A 4QGAA 2CL7X 4TT3D 3PVSA 4BASA 4OBEA 4KVAA 1H65A 2DR3A 3ADDA 1K5DA 3IPYA 5BW8A 4BRWA 2HCBA 2W6JA 4LOAA 3KJEA 1E1RD 1TQ6A 1RYFA 1E79D 3OIWA 4B2IA 4P3YA 3OE7D 4C7OB 4FW9A 1GAJA 3R9IA 4Z51A 1WF3A 3PUWA 4AG5A 2O8BB 1M6NA 1EFRA 3EC2A 3U2QA 1TU3A 5G41A 1NP6A 3FGNA 3REFA 2GWHA 5JZVA 4V0NA 1K5GA 2RKOA 4A15A 4G5QA 2KBEA 1SVIA 2Z5FA 3BFVA 3MJRA 3VX4A 1L4UA 3ZVMA 3DOEA 4MQBA 2OUKA 4Z54A 4KVGA 5F9FA 4I4LA 1BYIA 2N1BA 4I99A 5K8LA 3Q5DA 1EX6A 1KAOA 5ANRB 3W9YA 3BGWA 5CLLA 4MKHA 4PZLA 3O8DA 2LWIA 3JVVA 1II8B 1HTWA 3QG5A 3U6BA 3NBFA 5LPNA 1LS6A 2G0NA 3CIOA 4Q9JA 3EPKA 4EPRA 4L16A 3OIYA 4URXR 4AI6A 4JVNA 3AP3A 4GZLA 3WYAA 3KQUA 1MO4A 1AS0A 4RD6A 3BOSA 4BFYA 1NY6A 4CEHB 1Q57A 4RZ3A 3R7WA 3C8UA 1ESMA 1OLOA 5JWHA 2ZRDA 1CP2A 1GVNB 1IN8A 5IK2D 2G83A 2EFEB 3KKPA 2ZSEA 3CUEF 2XB4A 5FL7D 3GLIE 1EESA 2FWRA 2P2LA 3L8ZA 1FMLA 5EXSA 4B32A 4NONA 3MWKA 5KHOC 1NIJA 1OXVA 3A36A 2OG2A 1XNJA 2JDIA 4KXFB 4PO8A 4Q1EA 2O8EB 1P4SA 1FZQA 2FEOA 3ZVRA 4BFVA 2YNMA 1KI6B 4C0SA 3KQKA 2NO9A 2TMKA 1RE0A 2WPDD 2ZS7A 2XOKA 5K8UA 4Q48A 2ZQ5A 4HB3A 1U9IC 2W6IA 2WJGA 2YOGA 2WOJA 4I1UA 1VMAA 2H16A 4JIMA 3ZD6A 4B3DA 1IJEA 1N5JA 5EXTA 1VG1A 4PQYA 1OT3A 2ZI3A 5AUNB 1NIPA 1U9IA 2HJVA 2R6CA 1PLJA 4HDOB 1AN0A 3B82A 1R8SA 3EIQA 4R2IA 4RZ2A 2J59A 3RRZA 1E9FA 3DMDA 4JLMA 2ANBA 1DVRA 2ZSDA 1SXJB 2C98A 4IVPA 4US2R 2B7BA 2PLFA 2WAYA 1Z08A 3LA6A 5ELXA 1FFHA 3H86A 2DWQA 5H8WA 4BFWA 1D9ZA 2CDNA 3DM9B 4HB2A 4A9AA 4B44A 2CK3D 3ZIAD 4BFSA 3LFUA 4PC6A 2MSCB 4Q66C 3R20A 1E98A 4P4SA 2ORIA 5GJVC 1ZM3A 4EUNA 2V8OA 1JNYA 3KB2A 5G40A 4CZ2A 1K6MA 3Q85A 1VECA 2IUUA 2W2VA 1U8YA 4QHSA 1Z5ZA 2G6BA 2QT0A 4ESVA 3NHBA 5DYGA 3U3JA 1T3HA 3RRMA 3TUIC 4QXAA 1KZGB 1UBFA 4U02A 1OF1A 4IXMA 4KYIB 1N6NA 1OH6A 1YR7A 5TY0A 3PUVA 1ODFA 3QKTA 2EU8A 2VP0A 2ZUDA 3VX3A 4EFMA 1RPZA 1J70A 1U8ZA 1ZU5A 4UNQA 5FTKA 4V0KA 4IXNA 1KOFA 3UANA 4HB0A 2REBA 1XXHB 3RS7A 2D2EA 3QKRB 1AK2A 1MKYA 1WXQA 1FNNA 4URWR 3BH7A 4RD2A 4CIDA 1JB1A 4ZDIA 1SQ5A 2BM1A 2EQBA 3ZVLA 1GNPA 1KYIA 2ODEA 3CRRA 1PVOA 5DISB 1N0VC 1A1VA 3LVRE 4LBWA 5A0FA 4M8NE 1IHUA 4BLQA 1KI3A 1II8A 3U5ZB 2ODBA 3OFNA 5KSZA 4MRSA 3RANA 4PQRA 3K70B 3WNBA 3WHLA 2ZUBA 1NMZA 4JJKA 1UPTA 2XNSA 5DI3B 721PA 5J4LA 5DNYB 1TQ2A 3FKSA 2QZ4A 1KI2A 1E2IA 3D8BA 2XSZD 4F4JA 1NLZA 1E0JA 4E07A 4CEHA 3ASZA 2Q21A 1QHGA 1ZP6A 3RAPR 4B3XA 4CT5A 1KSJA 5JHHB 4IJMA 3GJ6A 3C7KA 4WVFA 5E7IA 1KGDA 1X3SA 4TLCA 1HUQA 4XVRA 3T5GA 4EPTA 1SVSA 4A2PA 1ZCAA 4RFVA 3ZZUA 1E4YA 3M0EA 1U90A 3K0SA 2OFXA 1XX6A 1XD8A 2FOLA 5TXGA 4BZQA 4TL9A 1XU4A 4FCTA 4BLSA 4GDFA 4GPTA 1ZBDA 5GJWC 3T1TA 3AF2A 4PTLA 4URYR 2J41A 3CNLA 4II7A 3TH5A 3A1SA 2FH5B 1N6IA 2ZI9A 2ZPTX 2VIIA 1UKEA 3P27A 4TLBA 4XVQA 3I5XA 5K8IA 1XPUA 1PLLA 2ZRJA 2FU5C 3C14C 4JZKA 4EDHA 1KI6A 1E9DA 1U2RA 2AFHE 3SDZA 4CEIB 4M1TA 4M9ZA 5EJEA 1OFUX 1SZPA 1TPZA 3NH6A 4TSFA 4PO9A 2ZIAA 2G9NA 5LDDC 4RD1A 3NBXX 2J45A 1F6BA 3HP1A 2OFOA 1KNXA 1SVMA 1W2GA 4PHHA 4KSCA 3ZD7A 1CS4C 2QE7A 2X77A 1W4BA 3CPJB 2JJ8A 2YOFA 3ICQB 1SXJC 2C9OA 3SR0A 1P2VA 3W3AA 3VAAA 2O8CB 3SQWA 4TMZA 2GJ8A 4AK9A 2HJGA 4ZDWA 2D3WA 3IPXA 3GFOA 1QHNA 3NIBA 1TEXA 5GJCA 2F55A 2DWOA 4X8OA 4AKEA 1KTVA 2H7VA 1S96A 3AH8A 1SXJA 5FOXA 2QROA 1GRRA 2QT1A 3KTAB 4OYHA 2UZIR 3G82C 1LF5A 3CNNA 3E70C 3NVAA 3PR1A 1XMSA 1YR6A 2XXAA 2QAGB 4XIGS 2OCPA 1RIFA 4B75A 4A0FA 4DBLC 3GLGE 2GZDA 3E5HA 5C46F 3GEHA 1MABB 2OSBA 1DAHA 1TF7A 1V43A 3LLMA 1HV8A 4QJ3A 5IHPA 1NLYA 4UXHA 3OEED 3T34A 3VR4A 1T9HA 4N0EA 4TQ9A 4N1AA 2FNAA 2FDCA 2FX3A 3AQ4A 1E32A 1XFAA 5DLQC 3T1QA 4PC7A 4OK3A 1R10A 221PA 2A9KA 3NDBB 3F8TA 1B23P 4YMVA 3QF4A 1AM4D 1XTSA 3H1TA 4EPWA 2YOHA 1I4DD 1ZIOA 3FOZA 4H1VA 1OXUA 5FPYA 3CB4A 4B73A 4PSAA 2OESA 3B8HA 3ZVNA 5JEDA 5JRJA 1PLKA 4LRWA 1O87A 1RRFA 3BJIC 4FINA 4JLAA 2OE2A 4GRAA 1HT2E 3AB3A 4Q9KA 4OL0A 4Q9HA 5KUTA 3AF3A 3K0FB 1XXHA 1GKIA 2MSEB 4EFLA 1R5OA 2ZROA 2F1IA 2QP4A 3RHFA 1RZ3A 3B6EA 2A5DA 3Q7PA 3Q8XB 4B3CA 2AK3A 2Q9AA 3K1JA 4MDEA 5JJIA 2QTVB 4C4PA 3K70C 4GMDA 2FSHA 4EPVA 3QI2A 4RFSB 2B8WA 1W4AA 3MLEA 3D6TB 2WWIA 2RGEA 1G4AE 1NKSA 1GG2A 4JL5A 2RGGA 3ZH9B 4OI0A 4LYAA 1ZIPA 1I2MA 2QG6A 3HDTA 3PCRB 4OHZA 5FOTA 1TUIA 1G8HA 2E1RA 1VTKA 4NCHA 2IUTA 3KKNA 3LBIA 3TNFA 4B3GA 1HA3A 2X8AA 2F1HA 4JLJA 4M2LA 3MJHA 5DI3A 4MRRA 4NCIA 1VIAA 4Q4AB 4JLNA 2FZLA 4DWJA 4OJQA 4Q19A 3QOFA 1UDWA 3K9LA 4NCNA 4DLSA 4F91B 4YMTA 1S8FA 4Q47A 4MITA 5GVSA 4BLTA 1KK0A 5JHGB 3U3RA 1UBCA 2JGNA 5DGXA 3VHLB 2ZU6A 3TSOA 3W5IA 4DLYA 2ZANA 5D3MA 3TIFA 3VR3A 2CL6X 1XWIA 3MWJA 2QL6A 2D7DA 2WV9A 3EAQA 4UNSA 5E4FA 2NO7A 3RRNA 4ACAA 4DVGA 4TYYA 3EARA 1NVUQ 4YDHB 3IO3A 2XNDA 4CRWB 3DHWC 1OHHA 4OQFA 5F9HA 4QM7A 3QEOA 3RLFA 2P5SA 5EZ5A 2ZXUA 2XTNA 1NJFA 1D2EA 2R6FA 4KHZA 4MGZR 1T5IA 5E95A 3TJZA 4QM6A 5FFMA 3BIFA 1E2DA 4LJAA 1NSFA 4QGFA 4BLOA 1JR6A 2YYZA 3QPVA 1Y3AA 4LJ6A 3TRFA 2IUSA 4F7WA 2WHXA 3MGCA 3TW4A 1E2GA 1G9XA 4TZ6A 4RKEA 1WA5A 5LBIA 1Z0FA 3IEUA 4DLTA 4DXAA 121PA 1KDOA 4LV6A 2WJVA 1N25A 2VH5R 4KO8A 1YQTA 2PZEA 1JR3A 4MYUA 1XEWY 1EG7A 1NN5A 3LVQE 2FPKA 3THYA 2QAGC 5CIWA 1G4UR 4CEJB 2NG1A 2P67A 1D8TA 3EG5A 2AK2A 5CJPA 1JXMA 4NYMR 2R6AA 5HCIA 1W0KA 1Z6AA 4QL3A 4QG7A 3EZ2A 5EXPA 1KJZA 3NKVA 2RGNC 4X8LA 2QAGA 5E7JA 1NI3A 4DIDA 2JJ1A 1UF9A 2ZS9A 4C0HA 2FPLA 1H8HA 1DG1G 4JS0A 1NVVQ 1OH5A 1XEXB 3GJ3A 3QVVA 2RGNA 3BBPA 3REGA 4BGDA 1TUEA 3EPLA 1Z47A 4M1SA 4B2LA 4RCYA 3VQTA 3I92A 4URVR 2A2ZA 4PC3A 2WOOA 3DO6A 1X8LA 2RHMA 4TMXA 2F1RA 1EXMA 4KFUA 4Z1MA 3DL0A 1UKYA 3DKVA 2OCAA 3GLIB 4P31A 2JJ2D 5EE5B 5HTKA 3NBZC 1H8ED 1BMFD 2C8VA 3CO5A 3K0FA 2OILA 1ZUNB 1MRSA 3SQXA 2PMKA 4MUBA 3PJRA 2QP3A 2V9PA 4TT3A 2OO7A 2GXAA 3U7GA 5FI0B 3WP0A 4L9WA 1YVDA 4X8MA 5H68A 2FPMA 2ZYVX 5KSOA 4PPGA 1W7AA 4GBMA 4UNPA 4V02A 3LBNA 1E79A 4RFSA 5G53C 1XBTA 2XAUA 5KO2A 4O3MA 1NVVR 4QFMA 2OHFA 4IOKA 4XSGA 4PPFA 2ZRFA 4Q9LA 3OE7A 4KCGA 5J40A 3AVVA 1G5TA 3T1OA 3PUXA 4L4UA 2PZGA 2P3SA 2X19A 2J5XA 5CDFE 4IDQA 5FOSA 1FL9A 2REOA 4Q1CA 1U0JA 2IA5A 1ZUIA 1JXOA 1M1YE 1NN1A 2C77A 2GEUA 4JLVA 3RSOA 1DO2A 3ASYA 4LUCA 4LPKA 5F2EA 5TVKA 4KYUA 3P26A 1AZSC 5JFGA 4QOSA 3GJXC 5FPTA 3L43A 2RH5A 3HR7A 2J7PD 4XD7A 2QEQA 3GLHA 1TAGA 4C0KA 3GJ4A 1GTVA 5J4YA 2HF8A 1YZGA 2QMEA 3B13B 2Z6VA 3WBKA 3P20A 2NZ8A 1KI8A 5J5CA 3TW8B 2FMXA 4ABYA 3VHXA 4UNRA 1AZTA 1DPFA 3CONA 1MO6A 1F2TB 1S2MA 5G3ZA 4FMDB 3PXGA 3OAAD 2Z43A 5HKKD 4GP6A 3RSLA 2ZETA 1US8B 2GJSA 3QPWA 2RGAA 4P0TA 4EIWA 4A36A 1GOTA 2HV8A 4LV8B 1NRJB 4M9QA 1FP7A 1VG9B 3T61A 4LHYA 4KBGA 4IDPA 1J7KA 1HQYE 1XB2A 4PZYA 4LK2A 1VKJA 3QKSB 4KAXA 4DLVA 3RS5A 1KY3A 2JAQA 2V1XA 1P9RA 2AL7A 2ZI7A 5IK2A 2IYXA 5HCNA 5FL7A 1RW4A 2JCSA 3L0PA 3AKCA 1KKLA 2IYZA 1J90A 3B1XA 4A1FA 2XZOA 3ZLJA 2P0EA 4KLZA 2ERYA 3LWNA 4DRZA 2GF9A 1HQCA 1QDEA 4AD8A 5KDOA 4W5HA 1N5IA 2VQSA 2R6DA 2WPDA 4HUQB 5HPYB 3ZJYA 1CTQA 3W6OA 3ECCA 2PT5A 4LX0A 4RJLA 5KNDA 1W5SA 4IRUB 2IS1A 1N6PA 1GSIA 1RJ9A 1N3BA 1KO8A 1XCMA 5CLQA 5FTLA 2P65A 2FFHA 1GNRA 2JLZA 4TYWA 3LRPA 3NHAA 1CJUC 1DS6A 2JLUA 3F3YA 2FGJA 3L0IB 3VKHA 1T0JB 3B1YA 3UK6A 1W47A 3SS8A 2F9LA 1X86B 3ZZTA 3ADKA 3PV0A 1DADA 2J46A 4A2WA 5DN6D 1NVXQ 1YE8A 5L3SA 3EPHA 621PA 1X8JA 4JLKA 1Z22A 1NMXA 4IDHA 2V1UA 4PC2A 2CK3A 2HF9A 5HE9A 4RKFA 3WHKA 4A6XA 4YXWA 1G16A 2AKAB 3LW8A 5CM9C 2IW3A 5EE3A 4D4JA 1IN4A 4V03A 1UFQA 1Z0KA 2DCUA 4KJZA 5C18A 2QAJA 1FQKA 4RD4A 1DAFA 2FFBA 3A1WA 1TU4A 3RS3A 1W0JD 1NBMD 4F93B 2XJ9A 2ZAOA 1BYUA 3BH6A 1G3QA 2ZRCA 5FUXA 4JYCA 5CK5A 1OKKD 4HZUB 2GA8A 2YHSA 1G20E 2PCLA 5DSZA 3EZ7A 1XD2B 4JKYA 4IFEA 4E22A 3LV8A 3U3KA 2C9YA 1RFLA 1DARA 5FTNA 4C0BA 1SVLA 4ARZB 1UADA 4MUAA 2GXSA 2OCYC 1E9EA 3UG7A 3D7MA 2IL1A 2ZRKA 3B9QA 2IYWA 4DC9A 3SJZA 4TQUS 2PLRA 1YZQA 3O47A 4JKIA 5FBVB 1R2QA 3CX6A 2R65A 1CRQA 1W46A 3FHCB 4GP7A 3EC1A 2PJRA 3GLGB 3VFDA 1SGWA 1OH7A 3WYFA 1ESNA 2FE4A 4G5RA 3TK1A 3SYNA 1M2OB 3SHFA 4P4TA 1SKQA 1KMHB 1JI0A 3AEZA 4YQFA 2ZE6A 5C1BA 1SVWA 4QKQA 2DHRA 1KKMA 2ZYWX 3SJCA 1XTKA 1ELOA 1W49A 3HPRA 4EQ6B 1Z0DA 1CEEA 4LJYA 1COWA 4ZPXA 1SKYE 3UWKA 1US8A 2XSZA 3GJ5A 4CYMA 2FSIA 4NTZA 2ZRBA 2ZREA 1EGAA 4CGZA 1A7JA 2YVUA 3QE0A 4LYJA 1JQLB 4RD0A 1XJCA 3QKSA 4ACBA 3AVUA 5FOWA 1Q1QA 2W83A 5L8VA 1U0LA 1Q3TA 4TMVA 2J9RA 1D5CA 4MKGA 4DCTA 3K0CC 4BEJA 3MG9A 3SHWA 2H57A 4PAMA 3EA0A 4OQMA 3B7GA 4M1OA 3IILA 5AR1A 4Q4LA 3EX7C 3VNVA 2AN9A 4N0DA 4DEYA 2W00A 4RD3A 4EKDA 2X1VA 3I62A 2VSOA 1QG2A 2ZRAA 4PZZA 2H92A 5IDVA 4C2TA 4LHWA 1M7BA 4Q00A 1G8GA 3PUZA 4B76A 3KKOA 2VTKA 4FMDF 3ADBA 4JJZA 3ZQ6A 4IFBA 1QHIA 2VO1A 5TARA 4G1UC 4HUQA 2EWVA 2VP9A 3VR2A 2GAAA 2CCGA 2GCNA 3N2IA 2BMFA 2ZYTX 3E2IA 3CH5A 4ZV4A 3ADCA 3K0AB 3GLFE 2XZPA 3A4MA 4OHVA 4RZUA 5TMPA 4US0R 3DMNA 1KSGA 1OPXA 2EWWA 2HT6A 1UBGA 3BB1A 1RVDA 3D31A 4NZYA 4AKHA 1XTRA 3DDCA 1L7VC 4MGYR 3AGQA 2BEKA 2C9CA 3HYRA 3PEYA 4FI3C 1Z8FA 2V6JA 3AVWA 4D0NA 3A1VA 3QQ5A 4PXAA 5JEEA 2EVWX 3S1AA 3QNUA 1OW3B 3NWJA 4JSYA 1FUKA 2FSGA 3BE4A 3DEFA 1WE2A 3SE0A 4JYBA 5JSZB 1OSNA 4QBFA 3C41J 2V55B 1VCOA 2D7CA 1E0AA 4HI0E 2A7QA 3LO5A 1FUUA 1Q3HA 4GFDA 2D2FA 2ZUCA 3Q9LA 1G8PA 1NG1A 2VPPA 1II0A 1KHTA 2BJWA 3C5HA 2WWFA 2WJYA 2OBLA 1LFDB 5JECA 2RGXA 3U61B 2QQ0A 4EPYA 2WWGA 1T5LA 2WWHA 1UDXA 1BIFA 1XD2A 2C2HA 3IBGA 1G7TA 5D3QA 4QGGA 3L0OA 3A4NA 3QPUA 3KKQA 3RC8A 1S3SA 3GJ8A 4D2IA 1ZJ6A 4Q03A 1TADA 4C7OA 3OF5A 2JLWA 3B5JA 4URUR 4LJ8A 2O8BA 4X8HA 1AKEA 2RGBA 3H4MA 1G7RA 4D80A 4ZIRB 1N6HA 1HURA 4GMXA 4AY2A 3GEEA 4TYPA 2WIBA 4GNKA 5JS7A 2WAXA 2O8DB 2Q9CA 2I1VB 2YZ2A 2WJJA 1FW6A 1CRPA 2JIZD 2W6JD 2ZE7A 4GZMA 2HT1A 4US1R 3ZS9A 3QY0A 5BQ5A 1KDRA 2A30A 3AVQA 4EPXA 2HLDD 1WP9A 4AG6A 2W0SA 4V0MA 2OFWA 1G291 1XMVA 2Q3MA 2BBWA 3QBTA 2AXNA 1Z29A 1BS1A 1VHTA 2NIPA 1A82A 3CF2A 4CF7A 3WRYC 1EFUA 4LSGA 4HATA 1XDBA 4LBVA 1OYYA 4LV5B 4P33A 1RYHA 1AA9A 1EFRD 1HE1C 1ZC4A 5KSYA 1UEJA 1P3JA 3NEJA 2FG5A 2VF8A 4BECA 1A5TA 3CPHA 3HU2A 2ZJYA 3KQLA 3THWB 1R4AA 4LC0A 2HYIC 2JLVA 2IC5A 4UXJA 2GEVA 2VF7A 3CRVA 1IJFA 2PL3A 1UKVY 5FL3A 2XX3A 4Q4HB 1G3UA 1R7RA 1ZNWA 3R9WA 1EWQA 2XGJA 2ERXA 4BFZA 3C15C 4DUGD 5FUWA 5HR5A 3VR5A 1HH4A 3IEVA 5CM8B 2F43B 4JT4A 2D74A 1P72A 3W34A 5FPHA 1MR3F 2IT1A 4E5UA 2O8EA 4MRVA 2VYFA 1X8KA 3BRWD 2IWRA 2C95A 2QMOA 2VHQA 3WY9A 4DSTA 1LY1A 1QG4A 4EFNA 3K0AA 3Q3JB 2QY9A 2IXEA 1ZNXA 4I1SA 2QA5A 4WZBE 1BO6A 3WMGA 5F3WB 2WBLC 1P5ZB 2CE2X 2QTHA 1DE0A 1EFHA 2ZE8A 2BC9A 3CRQA 1T8UA 1IXSB 1N6RA 4POAA 5L3QB 4O2LA 3B85A 5EXXA 1CF4A 2CHVA 1T8TA 2IXGA 3CRW1 3A1UA 3K9GA 5C2JB 3C4JA 4ZKEA 4F92B 2OEPA 3IQXA 4WA7A 1QHHB 1R5BA 5B64A 3QSYA 2CJWB 3GFTA 2FN4A 4C3ZA 3SU8A 3U3OA 1Q21A 1G41A 4DLUA 1JBKA 4TQAA 3SBEA 3U44B 4L15A 5FR2A 5JSZA 1Z3IX 5H70A 4JBXA 5EP4A 2ZRGA 1S1CA 2QRZA 1NNEA 3QXHA 1FX0B 1JAIA 2GJAA 1OFHA 2WJHA 3TKLA 3ZZ0A 1QVAA 1GRQA 4DT1B 2VEDA 4NH0A 3GP8A 4D4LA 2BDTA 1W36B 3BFXA 5IT5A 5P21A 1OXXK 2IHYA 2K5UA 1WB9A 2VHUA 2ORWA 5FOUA 5JCZA 5KDLA 3TVTA 2WIAA 4XSHA 1T3LA 1XCPA 2HUPA 4A8JB 1U98A 1NL3A 1YJ5A 3LX8A 3DVLA 1JJ7A 4FWTA 2JJ2A 1ZD1A 2VLIA 2G1KA 4D4MA 3D3QA 4HAWA 3CZPA 1BMFA 1S1MA 1XMJA 2EYUA 2ZVPX 3KL4A 4O0MA 3NH9A 3FHTA 4QHYA 3SFVA 5BWMA 3FFAA 4D25A 2LKCA 1D9XA 2BV3A 5KSPA 1TF2A 4HUTA 1CR1A 1WQ1R 4KODA 2ZAMA 4ZIRA 3QKRA 4FMBB 3UPUA 1NLFA 2BIFA 2B8TA 5A4JA 1P6XA 1O3YA 4IOJA 2XJ4A 2NMVA 2O8DA 5JWRA 2FJUA 4B33A 3U60B 2PBRA 3VR1A 5LB2A 1KDTA 3QXSA 1S4QA 2AWOA 1ZD8A 1DAKA 3LBHA 3AP2A 4ZCIA 1BOFA 3KXLA 1I4LD 3GFPA 1ZM9A 2BHRA 1IAQA 1P75A 3ZQJA 1E4VA 3HR8A 4DDVA 5BN3A 1S3GA 3OIVA 2FFAA 2AKYA 4BFUA 4M22A 3RDPA 2OM2A 1CR4A 1KO7A 4OI4A 1XTJA 5FUVA 2WMOB 3QUSA 4H1UA 2BBTA 1X1RA 1QF9A 3THWA 3FMPB 2J7PA 2BVNA 4Q1AA 1RKBA 4DLRA 5DHAA 4AYWA 1A2KC 1TX4B 3KB1A 2ZRHA 1CJVC 1T3SA 2ZJZA 2VL7A 5JI3E 1Q44A 2C99A 5JWOA 4HSEA 4M1MA 2CNWD 3ZGXA 4U00A 4Q4HA 2ZRLA 1YZNA 3VKWA 1VYVA 2WKPA 1AQYA 4HAUA 2HCJB 2A5FA 2ZRIA 3OAAA 4TMTA 5HKKA 4B3BA 1M34E 2ODNA 2YV5A 4D6PA 4XWKA 1DAEA 1LTQA 4KITB 2QBYB 3WMFA 2F43A 4LHZA 3HWSA 4TWZA 1P2UA 4AWXA 2HDNB 2R44A 5IRCD 1LS1A 2B21A 2JASA 3EXAA 3UMSA 2PH1A 3I8SA 1CIPA 4KFTA 3FWYA 2F9MA 1F60A 2HEIA 3FB4A 4PAQA 4Q9IA 1DG3A 1S9DA 4BFTA 1E2HA 5SZJA 4CEIA 3OHMA 4A4DA 2A5JA 3FVQA 1G1MA 4JT2A 4Q1FA 3RYTC 4JVMA 4GL2A 5L3QA 2CLCX 2VP2A 1SXJE 3K0EA 1E9CA 821PA 3SJBA 1Z2AA 5GVRA 4TYQA 2O8CA 4Q5IA 3DKPA 3QVUA 5B58C 1QHSA 5L3RA 5FR1A 4UQOA 2J0UB 4HDCA 3CR7A 2CJWA 4B2PA 1JPNA 4ZKDA 4URZR 3WNCA 1A2BA 3EA5A 1TL7C 1KI1A 3U7HB 2E87A 1J99A 3KTAA 2XEXA 1W36C 4TTRA 3VU9B 1YZUA 3QXXA 1XCGB 2JA1A 1SKYB 5EE9A 2C78A 2CE7A 3FMIA 1SHKA 4XJXA 1KO4A 3CH4B 1Q22A 2ECKA 1RRGA 2A78A 1F48A 2IYYA 4Q01A 4A8JC 4TTQA 2CXXA 1MABA 3G5UA 2O0JA 2DY1A 2QPOA 4LBYA 4B3FX 2GDJA 2IF2A 3IUYA 3K8YA 5EUQB 2D62A 1E2EA 1YKSA 4TLEA 4XWAA 3KQHA 4TTPA 3TVDA 4I81A 3GPLA 4M1KA 5BYJA 4A8JA 5IF9A 5JRZA 2GKSA 3U7EB 1A4RA 2CEAA 1GITA 2GXUA 3UMFA 4F4CA 1Z6YA 5DN6A 5FUYA 2NOAA 2ZI5A 2CLDX 4FN5A 4KU4A 2IS4A 4Q1BA 1XXHE 3QG1A 3DOFA 2IHBA 1G18A 3B1ZA 2PEZA 4DDUA 1KY2A 1XP8A 1F2UB 1KDPA 3VR6A 2WSSD 2GNOA 4FXPA 4WZ6A 5SZIA 1MH1A 3SN6A 1G3RA 1IXZA 5FBQB 1W0JA 3AGPA 1Z07A 1NBMA 4BZPA 3W3ZB 3RC3A 1TQDA 2HXSA 3HU1A 2GESA 3DZDA 3GLFB 2NO6A 3CPEA 5CIQA 4GOJA 1OKKA 2ZSBA 3ONWA 1Q1BA 8OHMA 5E3HA 1E1RA 3WBJA 1YRBA 2IEZA 1J8YF 1TMKA 1YR8A 3C16C 1G5PA 1Z6TA 2REXB 4TL7A 1XMIA 1CBUA 2BBOA 1FTSA 4JL8A 2RGCA 1E99A 1CJTC 1CKEA 2BCGY 1E9AA 3P4XA 5JLJA 4WW0A 2EFDB 4TMKA 4YONB 1XD9A 5CITA 4LDJA 2JLXA 2X2FA 4MYTA 4W5JA 5EE0A 5AUPB 1YU9A 4FMCB 2GRJA 4HAZA 4Q4AA 4RSGA 1ZRHA 2JLRA 2ZVQX 2QQEA 1JQJC 4ASUD 2V6IA 3B1VA 3IO5A 4OQNA 5H1YA 1E0KA 4DCNA 2FF7A 2O52A 1E2KA 1JJVA 4JBYA 3SEAA 3FYHA 1OIWA 1DBSA 1U8AA 2ZJBA 2ZI4A 4HB4A 3ICEA 1CLUA 2AR7A 4R98A 4BEBA 4DLXA 1OE0A 1E2FA 1R6BX 2EW1A 3K9NA 2DFKB 3V00A 4RCZA 1U0HC 1W4CA 4HYYA 3I73A 3GJ0A 3U4QB 3CBQA 3MAAC 3BD9A 2UKDA 3SBDA 5CK4A 4ZI2A 3NXSA 4OKSA 1YR9A 5C4GB 2BMJA 4BZXA 3GQBA 5J4VA 2R6GA 1EFCA 3HYTA 1D2MA 5FTJA 1YZLA 2LCFA 2Q3FA 3KKMA 2GVZC 1AQUA 1QHXA 2ZR0A 4Q1DA 4XWOA 4HAVA 1JR3E 3PG5A 3NDPA 3PENA 1G7SA 2KI5A 4PX9A 2JLSA 1DO0A 3RWOA 1P9NA 2Q6TA 1PZNA 3JVUA 1RRCA 4YDSA 1NF3A 4TL6A 3SJAA 1ZUHA 4TLDA 2EYQA 1G21E 1SULA 3ETLA 2VHTA 4WXPA 2ATXA 4OK5A 5KNBA 4O25A 1W44A 4JBWA 3P1JA 3AV0B 3TSWA 3AVOA 4C0QC 2XNDD 4WOPA 1GRNA 2CVFA 4FCWA 1SVOA 4LJ4A 4OQLA 4CEJA 1Z6XA 2Q3HA 3IIKA 3WP1B 421PA 3EPJA 4U5XA 1IOZA 3X1ZA 2FSFA 3QBVA 4Z8YA 2BM0A 4NPHA 4OHXA 4B74A 3T15A 2DFLA 4LJ9A 2JEOA 2W2XA 3HU3A 3R7WB 1G8YA 2GJKA 4ILEA 1FTNA 5AJZA 1CR0A 3WRXC 2KE5A 2RCNA 3ZYCA 3TUZC 3NC1C 1AKYA 1XEXA 2RGDA 3R9XA 2FGKA 2GETA 2RAPA 4NYJQ 3EZFA 3M6AA 1G8FA 1E9BA 5C4MA 3THXB 2VHCA 521PA 4TYNA 4IDOA 3WYGA 4B43A 1W36D 1MT0A 4QNRA 2BEJA 3V9PA 1UJ2A 3BC1A 3IHWA 1PUIA 3GMTA 1FMJA 2GCOB 2VHJA 2Y8EA 2LKDA 5KOYA 2ZS8A 3EIEA 4A6PA 1G64A 2J87A 4FWIB 3GLIA 3QEJA 2NO0A 1GDDA 3T35A 3UMRA 2GK6A 4D0GA 5AUQA 1L4YA 3TAHA 4FD2A 1PV4A 2F3TA 3OZXA 3ZIAA 2JJ1D 4G3XA 3IBYA 4QBHA 3KUCA 1D6JA 2IYSA 2WSMA 4Q7JB 2ATVA 4Z8XA 1NN3A 3WNDA 2AD5A 4NE2A 2CVHA 4V0OA 3SC3A 2PX0A 2W0MA 2AFIE 4NYIQ 2V7QD 4M4SA 4M9SA 4PPQA 1IY1A 2XB2A 5FBWB 2ZJ8A 4C0JA 2O0KA 4WIAA 4R71A 1GZSA 3MCAA 4ESHA 3QIAA 2GCPA 3MRSA 2CCJA 2ZSAA 4AYTA 2V3CC 4N3NA 4D81A 1EX7A 2GAOA 1E2JA 3W5JA 3HPQA 1XEFA 2DPXA 3I3SR 4HZIA 3QXJA 3R8FA 2J3EA 1BKDR 4HLDA 5SZKB 3TQFA 1OXSC 5FOVA 1PUJA 2J0SA 4LZZA 2O0HA 1N6OA 1T0HB 3WMEA 2ZM5A 1MOZA 3MD0A 3B78A 1E69A 3SNHA 1GP2A 1G6OA 3GLHE 2V54A 5AUOB 3X1WA 2PZFA 3CR8A 3FDIA 3L2OB 4LC1A 2JIZA 5DE3A 1G6HA 1LV7A 4XOIA 5EQTA 1DAMA 2HLDA 2R2AA 2EFGA 2F7SA 1JECA 5E7MA 3O8CA 2ZJAA 4PSVA 3QJYA 3U4QA 1YHNA 1L8QA 2G88A 3KJIA 3N5CA 4QJ5A 2Z4SA 1KI4A 4NYIR 2UVQA 4YMSA 4BQSA 3IIMA 1F2TA 3JZAA 4MYHA 5TB5A 4LBZA 4DB2A 2CMKA 4FMCF 5FH9A 1ZM7A 2QRNA 4MRNA 4NHOA 1P62B 1OXTA 4G5GA 4PR0A 4BRUA 1IN5A 1SHZA 5LB4A 3K9HA 3TSZA 1ZYUA 5KDDA 1E6CA 1JEEA 1KO1A 3CNOA 2MMGA 1T91A 4BUJA 2VRWA 2D4HA 3FKQA 3QF7A 4XD7D 1BH2A 4E03A 1W4RA 1Z83A 1NMYA 4KSBA 5JS8A 3Q5EA 1N6KA 1C1YA 2KJQA 4DUGA 4UNNA 3DPUA 2ONKA 1IBRA 2QMUA 2GK7A 2ZSFA 4P32A 4U7DA 1KIMA 2CLSA 3K0CA 2GTPA 4OI1A 4PHTA 2H8KA 4NKRA 1OB5A 2AX4A 3MUFA 1ZVQA 5GADl 2CBZA 3RS2A 2QU8A 3MWLA 4JLOA 4DDWA 3BH0A 1P60A 4B47A 1W1WA 1Z6GA 2QP9X 1HY3A 4L5BA 3I5YA 1MO5A 4NCJA 4F4IA 3DM5A 3FHOA 3PITA 3F0TA 4MKFA 1LVGA 4LJ5A 2WWWA 4Q02A 4AURA 3PEVA 2P6NA 2NQ2C 3FE2A 3SI7A 1E96A 3TAUA 4QJ4A 3K09C 2OT3B 3THXA 4B6FA 5KNCA 3V4RA 4TZ0A 1AGPA 1AJEA 1P61B 5FBLB 1KAGA 3M4YA 3ND8A 1GKYA 1L2TA 5K8TA 3LDAA 2GCOA 4DZZA 1IM2A 5B2ZA 2OLKA 3K09A 4W7SA 4GI7A 2J1LA 4D82A 3P32A 4HDQB 4LI0A 4H9GA 2RB4A 4QRHA 2OZEA 3H0KA 2ZITA 1PJRA 1FQJA 2CHQA 1IY0A 1UAAA 3ZS8A 1CR2A 1KK2A 1E1QD 1NKTA 2CCKA 2H18A 4D0LB 1Y63A 1R5NA 3HJNA 4OI2A 2C04A 3BS4A 4A0GA 4B35A 5KYKA 1XPRA 5DHFA 1ZAKA 2IK8A 4Q7MB 3IGFA 1OJLA 2QI9C 3CRMA 4OHYA 2SHKA 1IONA 1VCIA 1JEDA 1DOAA 3EZ9A 2JLQA 3PEUA 1G19A 4NDZA 1F3OA 5DO9A 5L3VA 4MDFA 1U81A 1C9KA 3UIEA 3H84A 1CJMA 2NO1A 3E1SA 2P5TB 3OEEA 1ZM4A 3CKLA 1P2SA 2DFTA 2X2EA 3NTUA 3T5DA 4Q7LA 5KTYA 2JLYA 3DZ8A 4PQFA 5F98A 4R7ZA 5G3YA 5DH9A 2IYLD 1KMQA 2YC4C 1HT1E 1UEIA 1XJQA 1GWNA 4HZUA 4A0RA 1G3MA 1LB1B 4A2QA 5DYIA 4EAQA 4UJ5A 1KZ7B 1VG0B 4ARZA 1KK3A 2XXAB 2I3BA 1UBEA 3OEHD 1WMSA 1N5LA 5KU1A 3AVYA 3W6NA 4DSNA 1AIPA 1GILA 2PT7A 5HE8A 2J0VA 4ON9A 2QM8A 4MRPA 4YXWD 3PQCA 1QHYA 1CULC 3UKDA 4CDGA 1EK0A 4HEJA 1ONBA 2H5EA 4JSTA 1W2HA 2Q0HA 4G0NA 1T6NA 2NPIA 1Q0UA 3GLGA 4W5WA 2PX3A 4C2UA 4NCKA 3TBKA 3W8RA 2IBMA 3QF4B 1OFIA 2NPFA 3BXZA 4MYCA 3B1WA 4WAUA 1FNMA 1KMHA 4DDTA 4DB4A 1OB2A 2GF0A 2Z0MA 1TEVA 4QBGB 4D26A 1NSTA 2F3RA 1TF5A 3OIUA 3W6PA 1TNDA 4LYFA 2OXRA 1E3MA 2Z83A 6Q21A 4EQ6A 3IKJA 3T06B 3AP1A 4K81B 3TUJC 2W2TA 2IS6A 1LF0A 4PANA 5EZ6B 1Z2CA 3L0SA 1AGRA 2MSDB 4IOMA 3LNCA 1E0SA 1ZMXA 5CB8A 2VP4A 5AK0A 2NTYC 2VP6A 3VKGA 3FMOB 3B60A 2CNWA 3L82B 3I72A 3J81k 3H2YA 1QRAA 4NBSA 3BORA 2GHIA 4DSUA 4IHQA 4YMWA 4W9MC 4HLQB 5FTMA 2Q9BA 1IY2A 1KJWA 4Q4JB 4LCBA 5EE1A 2I1QA 3EASA 2ORVA 4GSYA 1KSFX 4GT1A 3A1TA 1HE8B 2I4IA 1COWD 4KLNA 5CJ2A 3BB3A 3SYLA 1Q12A 2F1JA 4M0LA 1P73A 2J7KA 4QGHA 4ZCLA 3LY5A 2F6RA 1S0UA 2WKRA 2CL0X 2C96A 5D3MB 3KX2A 1G17A 2YC2C 3X1XA 4DCUA 4LHXA 2DWPA 3ZDQA 3TQCA 1VIYA 2QNRA 2AHOA 3UATA 4IOLA 4LGMA 2HXYA 1QZXA 4KI0A 2KSQA 1GL6A 2GEDA 2GBLC 5UKDA 5AJYA 3AF4A 4B6EA 3UXMA 2IYRA 1I4TD 1J8MF 3EW9A 1D2NA 2YJTD 1WDTA 2FFQA 2DYKA 3N2EA 2IEYA 1OV4A 4IVQA 4S2EA 1OFTA 4TLAA 1KSHA 3TLXA 3VTKA 2BKUA 2GBLA 4BE7B 2YKGA 2WM9B 4GOXA 3SZRA 1KI7A 2JDID 1XZQA 3F5FA 1M74A 2QGZA 3AF1A 5AJXA 1VG8A 4KV9A 3KFVA 3NC0C 4K46A 1HEIA 4WBSA 3THOA 4DIEA 1VCMA 1TTTA 4M53A 2FA9A 2HYDA 2XOKD 4B34A 1GKUB 5JJKA 3RWMB 1OYWA 2W6ID 4LHVA 2ZJ2A 3U6KA 4DHEA 2QSYA 4J0QA 1IN6A 3K53A 1IXRC 2OBMA 2GVDC 4ZDJA 3X1YA 3AVTA 1MV5A 1R0YA 1ANKA 3BWDD 5FPKA 1KNQA 3THYB 1R0XA 4ZCMA 1CU1A 1P9WA 2QSZA 2RMKA 2VBCA 2L0XA 2WZQA 3AUYA 1I2DA 3LD9A 3Q7QA 4MH0R 2QORA 2JATA 4DKXA 3IIJA 1DEKA 4QNMA 3BK7A 1E2NA 4MGKR 1DAGA 1H8EA 2WSSA 2G0TA 2FEMA 1HYQA 2BWJA 5DI9A 3T1VA 1VYTA 4IVRA 2XZLA 1Z28A 5JCPA 3MSXA 4DLZA 3M1IA 4PC1A 4DEXA 3L8YA 1WBBA 3I4LA 3VMFA 1IQPA 1E2MA 4V0ME 4BLPA 2G3YA 4BLRA 1EFTA 4ZDKA 3RS4A 3BAFA 2AWNA 1LNZA 1Z0AA 4DSOA 1ZM2A 4F38A 1AS2A 4QBIA 2QM7A 3A4LA 4NU0A 2N46A 2WWXA 1WCV1 1K8RA
chains in the Genus database with same CATH superfamily
2HGSA 3ZCSA 1YAHA 4CW7A 3QNWA 2D0OB 3WJ7A 3PC6A 4Z3OA 2KPOA 1N5KA 4ASUA 4IVNA 2IXDA 1NXVA 3I6QA 4BX9A 4XXHA 2HZBA 4A8TA 1P4JA 3HKDA 4BBPA 2P9FA 3DFIA 4DFDA 4EWLA 4YAKA 4LWQA 4UNIA 3VZDA 1WBDA 3M4JA 4P3NA 2DSTA 1PQ4A 4L5IA 3JD2A 2ZWIA 1S02A 1BCSB 3O3MB 4AKIA 3RVOA 2D1RA 2CDAA 2VDJA 3PE6A 1NF8A 1N7GA 2XB8A 1TQ4A 3LW7A 4WECA 2A9JA 2O2SA 1Q0TA 1L1RA 2DB3A 2NN3C 4E7OA 5LMNB 1LX7A 1RWQA 2GILA 5BYKA 3HLTA 4KXXA 2H29A 5J2TA 1P7CA 2AFIB 3IUBA 1TXGA 4MJ7A 3PVZA 1N5OX 4MKIA 1BE0A 3ROFA 4WESA 3WWCA 3DYVA 2FI1A 2WU8A 2V7TA 3FUVA 4KQHA 4Q4JA 3PL5A 4YAJA 3W2FA 4C01A 1Z4IA 1UBLS 3OFND 4D4KA 1U7HA 3EZ6A 3V97A 1OBCA 4QOHA 1Y1TA 3IOCA 1G20B 4ZO4A 3QBJA 1NLUA 4XDHA 4C3UA 3BB4A 5BN5A 3FSGA 5F3DA 2NZJA 3IP8A 5ALMA 5HKBA 2JFQA 2H1VA 3SFZA 1DTSA 2RBKA 1ONPA 3FKSD 3JW8A 5JH7A 5JMTA 2F9FA 4BWYA 2CHUA 3L1UA 3WWOA 5CDFA 1S7GA 4FIDA 3KPVA 1VRCA 1XKLA 5M04A 1M1YA 1QGYA 2XUQA 2OCKA 1WHSB 4ITRC 4KQEA 2J9FB 1NN0A 1ADYA 4EVRA 2XTJA 4CM1A 1ZLYA 3ETDA 4ER3A 1LPOA 4PCUA 5AM1A 5CURA 1EEXB 1FP2A 3KDSE 1UPUA 3G5TA 3GOHA 2O5RA 3LRXA 4DMUB 3JWEA 3O8RA 4A92A 1NM5A 2GNPA 3D54D 3GT4A 3I12A 4G1BA 1U0TA 4F97A 1GGJA 3QOYA 3I61A 4L7QA 3FCAA 1MORA 3JD1A 4MW7A 3ZHZA 2B1JA 3DMTA 2B4TO 1E2PA 1PWHA 2O5VA 1XWWA 2PHZA 3EQ9A 1ADBA 2OWDA 3K2BA 3LYAA 4K6MA 5FRDA 2YFKA 3ND9A 5BUSA 1XF9A 2OBBA 4C30A 4G81A 3V80A 1EWRA 1FX0A 4KHPB 4Y0VA 2B5WA 2VA9A 3NJ8A 2WYHA 2QLFA 4B4VA 2F4NA 3DLHA 1W9MA 3CZQA 3GDGA 2Q4BA 3UNXA 4AS2A 4CR7A 3FFBA 2G4CA 5TJHA 1NTRA 9ATCA 5FF9A 3QLJA 2FUKA 2BKEA 3RS9A 5FJJA 3IIEA 3CB2A 2XLCA 1R9MA 3I2IA 3TFOA 4FMPA 3ZGVA 3OO1A 4EYGA 2PX8A 3G2IA 1ZC3A 3DD1A 1DKRA 3IKTA 3W3AD 1IXYA 5HFAA 2HWWA 1VDZA 2FXIA 2G9VA 2O23A 4GUAA 4MA0A 4YLGA 5HBGA 1FUYB 1F5NA 2ONJA 3ANSA 3DAYA 2X5KO 3M7IA 1H9BA 4K03A 1SCKA 3HGTA 3T12A 1NU8A 5KI6A 3G0HA 3KT0A 2KBFA 4NL4H 3LYHA 2YYAA 5KJEA 4A0SA 1KKUA 3EAFA 4CKEB 1QO9A 4JC8A 5TDHA 3NR2A 1M2NA 4M36A 1OTXA 1XCJA 1GAQA 2NSYA 3VJMA 3VPHA 1FP4B 4MV8A 1RJ9B 4P98A 2EW8A 3HADA 4MUJA 4GX1A 1BJRE 3GRVA 3U3MA 5T6MA 2EX1A 5FOQA 4JMPA 1D5WA 2I22A 2ZJ1A 3Q8WA 2VOJA 4TVBA 3ZGYA 5FKJA 1B6RA 4IIYA 1OIVA 2QL7A 3MSCA 4GR9A 4L27A 5KYYA 5MHTA 3WLMA 1THZA 4DCPA 3DQQA 3ZTTA 1DEXA 4ZCPA 3OM0A 2C3MA 3ILSA 2L18A 4N8DA 4PG8A 2JKYA 4XTRA 3T9DA 1K66A 4NOJA 3WSVA 2WV7A 4BNNA 2WJZB 4YT2A 4RZXA 5BNZA 5HZKA 2XCRB 1GCGA 2NNLD 4B83A 4D1YA 3WIUA 2BLNA 13PKA 3COWA 4QXOA 1KQOA 3ITNA 1MJHA 4C0AC 1Z06A 3N3AC 3EWSA 4ZVKA 4J6EA 2FUCA 2PPVA 3G2LA 3OKFA 1DJPA 2FZGA 2FSVA 2REQB 3UJ8A 1N0WA 3FFXA 4H59A 2J3QA 1JLRA 3IJ5A 1U9ZA 1WOYA 4WXRA 4FEEA 1RWXA 4W1RA 5JPDA 3OCXA 3V2UA 3VJRA 3H5LA 3KJHA 3MNFA 4EHJA 4NSNA 3ZHBA 1CYEA 3CX7A 1QNFA 5IKMA 2GAJA 5C8YB 5LR6A 1A27A 4IQ4A 1NGSA 1QTRA 3C5CA 4MIOA 3VI3B 4QLBA 2XMPA 2O8FA 2IXFA 2YQZA 1ZZEA 1THGA 3HYNA 3LT1A 3PCXA 4IF6A 4WZAE 3VH2A 3WL5A 1WRBA 4D9JA 3K70D 4BBJA 5IBCA 4D9GA 3UHPA 4PPNA 5CVJA 4EGJA 5F2KA 3LLUA 2Y1EA 2OZLA 1JAHA 2BGUA 4OUDB 3D8UA 4XM0A 1H66A 1E59A 3IV7A 3THXA 3GD7A 3BTOA 3E22A 1QBKC 1T1IA 5CCXA 4GO1A 1P3Y1 5KQMA 5AW3A 1PWZA 4FILA 5A5FA 5BR4A 1O9GA 2BP7A 1XJ0A 3ESDA 4D97A 1CUDA 5KPDA 3Q9UA 2VTBB 5A03A 4UARA 5AKGA 2C0CA 2Q5OA 1MIOB 4QHTA 3BXGA 3OJWA 1H5UA 1UMBA 1I13A 3QHPA 5FTWA 2AOWA 2CMHA 2HBZA 5FLEX 2AI2A 3SF8A 4QO7A 1M1ZA 4LWZA 1QUEA 3DMPA 1YA8A 3BFPA 2MSKA 1YE5A 1JLKA 4WGGA 1CQWA 2XYGA 1F0NA 2MDTA 3GRUA 3W1WA 5A4AA 4M1WA 2D0PB 4HF7A 3HRIA 1EJ6A 2PH7A 2XUOA 3PHIA 4RY2A 3A58B 1FOEB 3UTDA 5GINE 4MR7A 2FV8A 1PTKA 1ZQ1A 2NYUA 3OLZA 5AJTA 3VU9A 4E6PA 1R9GA 3AR6A 5JBQA 4KBFA 4C76A 3RVBA 3AJ9A 3N7TA 3QELB 1PV2A 1G5IA 1J20A 2N1MA 2Q5EA 4JVSB 1YGYA 4ZHQB 2IS2A 4IUYA 3QVGB 3VHRA 4S04A 3PDWA 3UG6A 4DRYA 3R1IA 3P4YA 2OSVA 2IYAA 3H7IA 3MC1A 3HKCB 1ODTC 4ZJPA 2WKQA 1T25A 2VK2A 2Z09A 3KXKA 5LIRA 2AFVA 2WSIA 4LCJA 4S35A 3EIHA 5ES4B 1ODJA 1A9XA 2GPNA 2VPQA 1GJRA 1FMCA 2NVUA 2P4HX 1H0KA 1JVNA 2FSPA 1OH8A 5K0TA 2AIRA 3FR7A 1WZNA 3UAWA 5D8DA 1X6VA 3IQZA 2ZVDA 1D4ZA 5HMMA 5KQLA 1M7GA 1W59A 1ZNQO 5B58T 2AJCA 3VJKA 1G0OA 3SKXA 4D3FA 5B4UA 3FMFA 5J4KA 2W11A 1ZS9A 1DAIA 2XBUA 1CZUA 3TCXB 4OK6A 3PRHA 2HQBA 5AT1A 3WLQA 5D1HA 5AOVA 4FD3A 2H1HA 4LJRA 1HZZC 1VYUA 2XGOA 1P6UA 4O5OA 2BPOA 4NLLA 2FPRA 4C05A 4ND5A 3GLFA 2Y0BA 1LC0A 3HVUA 3MEQA 2EKBA 1IH8A 2XMQA 3MCWA 4HN9A 5ICFA 1G60A 2Q0QA 3T7JA 3WLSA 3WWDA 2VRCD 3JR7A 4TMWA 5DIFA 1J6UA 3LT4A 1RMQA 3OQBA 3TCKA 4BFXA 4UEJA 5IYZF 2QQGA 3DT8A 3U7JA 4DCMA 1WXHA 1CUEA 2FXVA 4CUZA 4DJEC 4FBGA 4Z7QB 2Q0SA 5A5GA 4NFHA 2ZE5A 1NW4A 2QMQA 3HEBA 4FFOA 1L8LA 4JOQA 3FNBA 2C9MA 4OPMA 4Z1MD 3HUFA 5ALQA 3KWLA 3DWGA 4NYJR 1VGVA 3R7BA 2WTUA 3HDJA 1CB0A 1E3DA 2JI6A 4C4YA 1DDIA 1EYZA 2QGNA 1GAWA 5CX1B 3OD1A 2BTQA 4ZVLA 2IEIA 4EJSA 1RXVA 5H4HA 3HBLA 1MQ9A 4J76A 2HN9A 1KI9A 3C6BA 5ALJA 2G1JA 4P7JA 2K4MA 3BA1A 5EQJB 1DQZA 1YR1A 3T4PA 1UM8A 2WIGA 4NOMA 3AHGA 1SUDA 4GHWA 2DR3A 4NAVA 2FW1A 1NKVA 1K5DA 1ONSA 1FBTA 1QOZA 4J0KA 3QTTA 1EWKA 1MGPA 3FWHA 4JUBA 5AXBA 2IQ5A 2W6JA 3D1JA 4I4IA 4M0DA 1JTEA 3OCCA 5TR9A 2BI8A 1TQ6A 4E03A 5IXSA 4NMXB 3A14A 1RYFA 1T8PA 2HIGA 2JGFA 3K9BA 4XWYA 1NX6A 1PFKA 2Q4DA 4D9IA 5MN4A 1YQEA 4ZK6A 2C59A 2J3IA 5KNLA 1A9SA 1Y4AE 5H16A 3RYIA 2A0YA 5FEMA 2QTNA 1LKZA 2PGIA 3AXTA 4Z51A 2BH2A 1LRLA 4AJPA 4IIHA 1M8GA 3PWZA 2O8BB 1XQ1A 1RLJA 1PJQA 1TZMA 1TU3A 4NATA 5T4HA 5DNDA 5G41A 4KV7A 4C7JA 4EBBA 2G80A 4GYWA 5JZVA 1OJ7A 3WK5A 1J8VA 2OGUA 4JUDX 4PTZA 3BFVA 3I0ZA 1PJLA 4RQTA 4WASA 2Q41A 3ZCTA 1L4UA 3EIXA 1M6VA 3FPFA 2ABWA 3EDQA 3WYDA 4KVGA 5LQMA 3V9AA 4BEVA 2OAEA 4IHKA 2AXEA 2N1BA 1J5EB 3GDFA 1NOKA 1KEVA 1NP3A 1ULSA 1KAOA 4G0YA 1FMTA 3BGWA 4YRSA 3O8DA 2YWXA 1HTWA 2OR3A 5LMCA 4AS3A 4MW1A 3O1JC 1DO8A 1W581 2RK3A 4BHTA 5LPNA 1FNCA 2OZKA 4MI3A 3BTSA 2AV6A 4DZTA 2D6FA 2QJWA 4MYSA 1B8OA 4AI6A 1SXHA 5DBEX 3L05A 4JVNA 4JYPA 4YCLA 3GEBA 3AP3A 3GU3A 4GZLA 2Q6OA 3G7SA 3KBBA 1G5HA 1ZMTA 3G8AA 5JMPA 3UW3A 3WYAA 4BFYA 4II2A 1NY6A 1ECBA 2YBEA 3R7WA 5JCXA 2BUAA 1U3FA 1OLOA 1XZHA 2HJ9A 4JJFA 5JWHA 1ISRA 1XAIA 3CMCO 3UJNA 3CO0S 4K9OA 3T6KA 1GVNB 1LPNA 1IN8A 1JMVA 5L4LA 3USZA 1SHLA 1SG0A 1XVAA 1BHO1 2DGDA 4FKZA 5FNVA 3VYTB 4F2PA 1ZESA 4HFRA 5FP0A 5FL7D 4AKTA 3GLIE 3O9MA 4C21A 1NQXA 2V4UA 4FB5A 3L8ZA 3ZCPA 2W6ZA 3FPEA 5EXSA 3QA9A 2DQ4A 1KEEA 1QYRA 3HK2A 3A36A 3ESRA 4RULA 4P08A 5E1OA 5HS4A 3ETHA 4ZYTA 4TRRA 4S0XA 4H60A 2QB5A 1HDOA 2FEOA 3N0RA 3QU9A 3W9BA 4UDXX 1FS5A 4RZQA 4BFVA 3PWKA 4AO7A 2ZS7A 1PJBA 2XOKA 3S2UA 2PKQO 1EAMA 4RVNA 2M1XA 2J9XB 2WB4A 3BTUA 3D1LA 1SD1A 3O8LA 4FFRA 1ODCA 2FDRA 2YOGA 2OBFA 2WOJA 1VMAA 4I1UA 4JIMA 4N5HX 4ZAYA 5LBUA 1Z0SA 1T24A 1VA5A 5D7BA 4HNRA 2WVGA 5FAXA 4CDMA 1JHPA 1N5JA 2CC2A 3KYDB 2OHXA 3NHUA 4PQYA 1YS9A 3CE9A 4WZBA 4YREA 4DUYB 2DKNA 3RQIA 5TF0A 4F3CA 4UUAA 1JSXA 3TS1A 3I6ZA 5J2UA 4UEQA 1N9KA 3B82A 4L5YA 3GFBA 3T7DA 4G67A 4PRKA 2VPIA 1ZKMA 3WGIA 1L3IA 1NVTA 2NYVA 4Y2GA 4FS8A 4RMGA 4D5EA 1W29A 1KU0A 4E5DA 2B7BA 3RF7A 2I3AA 2PLFA 3LA6A 4UEKA 4UMDA 4B4UA 3H86A 5ADHA 4CQMA 1QOQB 5K4HA 1KOGA 3GYBA 4BFWA 4I3GA 4HB2A 4HWSA 4AXXA 3OT1B 4B6QA 2H07A 1ZONA 4KX3A 4OFZA 4Z0NA 2QM3A 3ZIAD 4BFSA 4PC6A 2PA0A 3R20A 3OKCA 4P4SA 5A02A 1IIRA 5GJVC 3U81A 3HUTA 5KWVA 3L49A 2DX7A 4X90A 4D8XA 3K3PA 5EPEA 3ZJVA 2DHCA 2V8OA 3KB2A 5G40A 2YVAA 2P8JA 5I7HA 3GVPA 1GGKA 4GVXA 4QHSA 2OO5A 4WI1A 1NURA 1NZFA 2JH9A 2ZSHA 3IVMA 2RGWA 3JASA 1JT9A 4HFJA 4NJOA 4WT7A 3U3JA 4CV2A 1GFWA 1QRDA 2HF7A 3X2EA 1N2GA 1K89A 2XUHA 1PZEA 2BHSA 3QU5A 3ZW9A 4HVLA 2YW2A 2J4CA 3GC6A 3PUVA 3FPSA 3WLOA 4ZO6A 4L2IA 3KYCB 3VNRA 1HLGA 2B5VA 2PWZA 2QD3A 1OZ0A 2RKBA 5DV9A 3DLCA 1JG1A 4K86A 4V0KA 1V5FA 4BOYA 4EHKA 4CKZA 1K63A 1B1CA 5DWVA 1B6GA 1KOFA 1T3GA 1KWGA 4GM4A 3K2QA 4DSZA 4I5IA 2WDPA 3N59A 1KDZA 5KTPA 3Q7EA 2BDUA 1MKYA 1FFGA 2PWPA 3ICVA 4M87A 3UJ9A 4CKXA 4XQ9A 5JCJA 5IH3A 2AMJA 3CRRA 3M5DA 5T67A 4HVCA 3LXMA 1A1VA 2HC9A 1UR5A 3OTWA 1GPH1 2VDVE 2QVCA 1GGMA 4DC1A 1VSBA 2PZKA 1KI3A 1XLTC 3O3CA 1II8A 1C30A 2NZVG 4C03A 4UM9B 5CEJA 2VZ0A 2X23A 2P2CA 1PG2A 4LYEA 5B5SA 4PQRA 3A9TA 4L76A 3WNBA 5HVNA 5F7ZA 2GR9A 4KUEA 2ZUBA 4IJUA 5JDCA 1J0AA 2VPWA 1HI9A 1RQXA 1SQ0A 3BD8A 5DI3B 721PA 1W1IA 1RYDA 2QZSA 3C74A 1PKEA 4I4CA 2AOUA 1KI2A 4W1QA 2X6TA 5K4GA 1E2IA 4R0NA 1GDTA 3CR3C 3I2FA 2BI7A 2PBLA 4Z1OA 5T8KA 1NLZA 3LX4A 5HEKA 1AXGA 3A4IA 5AD1A 2PZLA 2Q21A 1HNNA 2VNIA 3WYBA 5TPWB 2PS1A 3C7KA 16PKA 2ZUSA 5TX7A 2WWVD 1RWMA 1X3SA 3ABRB 1WZIA 3R09A 1IU9A 4MUGA 2WMYA 4XVRA 4KQJA 3ZD9A 4EPTA 1I0ZA 1D07A 1KIAA 1PZMA 1YS7A 2VN8A 3DZGA 1E4YA 3QI7A 4GLLA 4X7BA 3UK1A 3O7MA 3UEOA 1CQJA 2IFTA 3EPPA 1U90A 3ER9A 3K0SA 1XX6A 4Y7CA 2ZUEA 2AQ8A 1IXKA 1OLSA 2VLBA 4FCTA 1RHKA 1B16A 4XB1A 3DLBA 5GJWC 3IQDB 4PTLA 3BJZA 3RBZA 4RE5A 2FY8A 2IX9A 4II7A 4EO9A 1BN6A 3NHRA 1SKAA 1U65A 3MTEA 4CN8A 3ZBPA 2GTIA 3QLVC 3UY4A 2ZPTX 4XVQA 1U5BA 3KV3O 5F21A 3I5XA 1PLLA 1QYCA 2FU5C 2R7KA 1FUIA 4JZKA 3VYSB 4EDHA 3SDZA 1P91A 2H31A 3K2IA 1X2EA 2ZBDA 3MFQA 1N2ZA 4ND8A 1Y8ZA 3NBXX 4WXMA 2J45A 5B7NA 3FYDA 5IP5A 1JWBB 3ZE6A 2BCEA 3GT7A 5KAPA 1CS4C 2B9VA 1QE0A 3GUHA 3QIVA 4RADA 3EXEB 1W4BA 5DCUA 4DMLA 4E5SA 2YOFA 3ICQB 1SXJC 2C9OA 5CX4A 3SR0A 3H5TA 2JBWA 2O8CB 2ZIZA 1EBBA 2HJGA 2D3WA 4KR3A 5CDTA 2G17A 2MYNA 1CQIB 4Z5XA 4X8OA 4WCFA 3A9VA 5K0EA 4JUCA 4YCBA 2WYWA 4YJGA 1G21B 3WK8A 3KTAB 2ECPA 1DKMA 3H1BA 4UQLA 5KTOA 3E70C 3DAOA 4P86A 2QYTA 2NU9B 2FOXA 3SZGA 4Q16A 1RIFA 3EDOA 1R0BA 4AJHA 5L3ZA 3COPA 4A0FA 4DBLC 3D59A 3GLGE 5IXYA 1BU5A 4JEIA 3GEHA 5JYCA 2C88A 2OSBA 2ZTLA 3LLMA 1HV8A 3CUWA 4H6XA 4QJ3A 5IHPA 3UUEA 3SHQA 2JIDA 5GOZA 3T34A 3VR4A 3FZEA 1KXZA 1M6WA 1XCOA 2FDCA 3AQ4A 3FGPA 3KVYA 5D86A 4CM7A 3ZJUA 3DEYX 3O2NA 2A9KA 4GWKA 3F8TA 3N0TA 3QF4A 1D1TA 1XTSA 1C0KA 2YOHA 1I4DD 4WVLA 1ZIOA 5TF4A 1WV1A 3KKLA 1E6WA 3D43A 2AOXA 1JPUA 3URMA 4MQEA 2OESA 3B8HA 1G6KA 1PLKA 1XZNA 5T57A 1BDIA 5JD4A 4GRAA 5KTKA 3JD0A 5IFLA 1QHFA 1XJ5A 4QQFA 2Q3JA 6PFKA 1UPXA 3K0FB 1XXHA 3LLSA 4IJQA 3CVUA 3FUUA 2ZWVA 3S44A 2QTBA 2MSEB 1CWUA 4TYMA 3H3XA 2WYUA 3WIOA 1UJMA 2QQ5A 2WUVA 1UZAA 1S2DA 3B6EA 2JZNA 4H17A 2GPSA 1ZW1A 4U2EA 1WXGA 2JAOA 3MD9A 3I0MA 2AK3A 3SICE 5ENZA 1OLUB 4ZOQI 1Z5NA 4HVTA 4Y9SA 3P9QA 4EPVA 1PL7A 1ORDA 3BIOA 3KZOA 3M2PA 4ZU3A 2B8WA 1E64A 3NM6B 3SLGA 1Z35A 3WFIA 1P1BA 4JDUA 3WB2A 2RGEA 1G4AE 1XZDA 1GG2A 4KRXA 2QVZX 2RGGA 2FPWA 2G63A 3GGDA 3MN1A 5EIOA 1GQQA 3I64A 5JJ5A 2W9XA 5KWJA 2QLBA 5FUQA 4BP9A 4IFIA 5AKZA 4H2DA 3HC7A 3PR2B 2IUTA 3LBIA 4NCHA 4PZCA 4OQ4A 2X8AA 4CM8B 4JLJA 4ZMSA 1VMEA 2HKIA 2P4EA 4AUMA 2ZGVA 4PCVA 3I2KA 1SCDA 3GA5A 4MRRA 1NVEA 1T2UA 1L5OA 3QWBA 4Q4AB 2QMYA 1AXEA 1MENA 4JBNA 4OJQA 1EDZA 3NTOA 4Q19A 4BZWA 2ETXA 5B6JA 1NPDA 3PJFA 4Q47A 2PA3A 4PSCA 5K3DA 3IMKA 2C2WA 2B3TA 3PQ8A 2O0LA 3PGXA 4GKKB 4ZO8A 5IDQA 5DU2A 4XQEA 2FMKA 2E89A 4TUYA 3SIPA 5K7SA 2EAUA 3I05A 3VR3A 4NMHA 2H3HA 1WW8A 2QL6A 2V59A 2D7DA 3UQZA 1QE5A 5AICA 2XI4A 3PT9A 5E4FA 4C0QC 4YYZA 1PG5A 4TYYA 3A7EA 3FUWA 1V16B 2F1KA 4FHGA 4LZLA 4FOTA 4N7BA 3RU3A 4BMNA 3BEOA 4P92A 2XT9A 3IO3A 3UFXA 1OHHA 4I14A 4OQFA 4QM7A 3F3KA 3HM9A 1PX2A 1ATZA 1WW3A 4X94A 5EZ5A 4ALLA 2XTNA 1NJFA 5I7RA 2ZXUA 4WBNF 3KO8A 4O4IF 1OWPA 3ZX5A 1DWOA 4KEAA 2EHDA 4C7XA 1NQUA 3TD6A 1JU3A 4LJAA 4PVCA 1SXQA 1KQ3A 4RF5A 4QGFA 1Y1SA 2FLWA 1SIBE 4LW8A 4RTOA 3LVFO 1JR6A 1ECLA 2GN8A 2B2CA 3WISA 2DRIA 1M67A 3NDIA 5CDSA 2WHXA 3QPCA 1THMA 5DEIA 1XRSB 1ZL0A 1E2GA 1G9XA 2FCRA 2WW8A 4L02A 5DDIP 4ZMBA 3HXQA 2EV9A 1WA5A 5LBIA 3TLGA 4EY6A 3G9XA 5LNK6 1KDOA 3IERA 4M0MA 1FRNA 3MTJA 4GI1A 2VH5R 1T3TA 1CHDA 2PZEA 4EZEA 1P74A 1WS6A 3OE1A 2CN1A 1XEWY 2MR5A 3L4BA 3V32A 1GLVA 2FPKA 3NHYA 3RBVA 4CEJB 3H87A 4MVJH 4BNJA 2W6OA 2XWBF 5CJPA 1G9SA 4RUKA 4E2ZA 1JXMA 1GU0A 1Z6AA 2DZDA 2XNCA 1ACLA 2Y71A 2RGNC 4X8LA 1UMCB 3AI3A 4C78A 1O57A 3BQMB 2DTDA 1B0AA 2DKOA 4WNAB 2ZS9A 1TAHA 4Z9YA 2E0IA 4G4SP 1TE2A 3CGGA 2HIHA 4FCCA 4LFCB 3BBPA 1NDQA 3PDIB 3PNSA 4BP8A 2A3NA 1V6AA 3TTSA 1DMRA 1J42A 3LSYA 3AF6A 4O2AB 2MIIA 1NATA 4CM3A 1RI2A 3I92A 1QQAA 3L8EA 4TWIA 2XPCA 4CV1A 4D5GA 2AC7A 3BXOA 4XLZA 1M73E 3KJZA 1QV6A 1RQRA 1X8LA 1JSLA 2AOTA 2JNWA 3KJXA 4PLFA 2F1RA 1EXMA 2H63A 3EIOA 1FCJA 4FSDA 3EHEA 2EHJA 3D2LA 4PO3X 4C4SA 6CHYA 1KRXA 3GLIB 2OCAA 4MLCA 3S2IA 1IPHA 2VP3A 1QFYA 3M6IA 1QF6A 4LXYA 5EE5B 1YNOA 3VVCA 1SMKA 3KSBC 1BMFD 4PNZA 2O59A 1MQAA 3CO5A 3MB8A 3COJA 2OILA 1RM4A 2H1CA 3PQFA 4BS9A 3MMSA 4EZIA 3SQXA 2IU0A 3PJRA 4ZICA 2ODTX 2QP3A 2OO7A 2V5VA 5FI0B 1X7WB 5IVHA 2VJQA 1GT91 1RYEA 4L9WA 3N0WA 5H68A 2UXCB 5FIUA 5GONB 3V8VA 3MGBA 1K6EA 2D5CA 3AB7A 1P1RA 3M6MD 3P0IA 3EEOA 4B3RB 2HQOA 4GBMA 4FM9A 2X8JA 4PSDA 3MYYA 3DOOA 1Z45A 1E79A 3D0RA 1CUCA 4RFSA 3FTCA 1GV0A 4A91A 1EVIA 1EP3B 3C3MA 4O3MA 1Q15A 3M2TA 3LDFA 4PPFA 4G65A 4ZAXA 4P22A 4B3IA 3OE7A 3S99A 2Z6UA 5IN5A 5J40A 2NUPA 4U2FA 1ZGHA 2M32A 2WTXA 4LXTA 4Z4HA 2GEFA 3KSUA 4GWLA 1I7SB 1IHYA 4W9NC 6ADHA 1I5RA 2PXAA 2RI1A 5CDFE 4IDQA 1FL9A 4Q1CA 3MQ2A 4GQBA 4RH1A 1KQNA 1Y3CE 3M4ZA 1K0FA 1U0JA 5LOVA 1J24A 1JXOA 1M1YE 1N5DA 4BNWA 4B73A 1QGED 5ESWA 4IBOA 5F2EA 1W85A 2G36A 2IGBA 4GQAA 3QBEA 2OM6A 2X9LA 5TVKA 3VH3A 3P26A 1IWBB 2QT9A 1YZYA 2HU5A 3UMMA 3AONB 1FFDA 2SECE 4RPKA 3HZOA 3GJXC 3L43A 4CKWA 2BHNA 2GN4A 4M98A 1LTHR 3OJXA 4XD7A 1VB3A 1TAGA 4JFRA 3ZK7A 1UOOA 5J4YA 2ORYA 2HF8A 2FHPA 3G2QA 2I5PO 1CUWA 2Z6VA 3A10A 1HX7A 1E20A 1SXGA 4HNGA 4M9UA 2FMXA 4YRLA 3VHXA 4GD3Q 3ZHQA 2ZDGA 2DT8A 1F2TB 2HREA 1Q14A 5G3ZA 3PXGA 3OAAD 3RJMA 3UT6A 1DRJA 1MB2A 1YUMA 3H04A 5L45A 4DCGA 3L9WA 2Z1DA 3ZWDA 2NU6B 1WXFA 1NRJB 3OX2A 4UD2A 3SEFA 1FMFA 4XE5A 2FEXA 3N2YA 3OM1A 3OT5A 3RJZA 5IH7A 1HQYE 3AILA 4RABA 1ADGA 1WSWA 4LK2A 3QKSB 1EA7A 3RS5A 1A9YA 2O50A 2JAQA 3IR6A 1R74A 4LHEA 2DG2A 3VSDA 1ZISA 3TTVA 4HEHA 1B3BA 4Z2YA 3DWEX 3UPDA 1RW4A 5B1IA 3HN7A 5G1OA 5MGBA 1MJGM 4HNQA 1ZK3A 2IYZA 2R97A 3B1XA 2XZOA 1QO0A 1T0BA 2XBMA 5DK4A 3A0UA 3EVFA 4LF8B 1Z68A 1LLUA 2GF9A 1V37A 4OEHA 4JJIA 2VKTA 3W9SA 2RHGB 2XMDA 3KDPA 3HTXA 5D01A 2VQSA 5EIBD 1VKZA 4MJ3A 3TPCA 1BE8A 3NWPA 4NJEA 2OKGA 2WPDA 2ZQZA 1P5HA 3MAGA 4K3UA 3ZJYA 4B80A 4C22A 1U7UA 1UBKS 1ZMBA 3X1MA 3W6OA 1VGRA 5FI5A 1KJQA 5HGXA 5C81A 4J2HA 4XJVA 5B3JA 3ZCXA 4PV7A 2IIVA 1SG9A 1SUPA 3CINA 3ND7A 1PZXA 1ZG3A 5K51A 2JKZA 3DNFA 1E3IA 3G88A 5BQOA 3R6WA 4RK6A 1V6SA 1N3BA 1UWLA 1XCMA 5CLQA 3C7AA 3VZPA 4V1CA 2FFHA 4X97A 1SRQA 2YDYA 3NHAA 3P9RA 1H4TA 1T0JB 5L6LB 5AM5A 3UK6A 1W47A 1ZJ4A 2PUVA 2F9LA 2V98A 4LG1A 4UMFA 3SS8A 4E4RA 5LYJF 1YFZA 2RSLA 3ADKA 3LUFA 1GTRA 4PZDA 2J46A 3E9EA 5DN6D 5L3SA 1M3SA 5DXFA 5HUJA 4DL9A 2FZCA 3Q3VA 4HHEA 1LPAB 4JLKA 4LY3A 5IBRA 4EB6B 2V1UA 5JNSA 4FE3A 3ACCA 1TJ4A 3BGIA 1X19A 2AKEA 2VS1A 2IPAB 4NU8X 3WHKA 1RCUA 4YXWA 3LW8A 1JQ3A 3KOYA 3HLKA 2IW3A 4D4JA 1NYLA 4KJZA 1NBAA 4TTSA 1FQKA 1H2FA 2ID9A 2Q28A 2ZIWB 1JWAB 3KD2A 2H5JA 3NGXA 2MWMA 4A8HA 4YBZA 1BH6A 4Y2UA 5ICSA 1G38A 4DQVA 1UZNA 1SB8A 5FUXA 1ML4A 3S8MA 4OLHA 1J2EA 4JYCA 5CK5A 5E0KB 1V41E 1ARZA 2PCLA 3NLLA 4UCQA 3EZ7A 4V0RA 5DSZA 3T99A 1XD2B 2FPGA 1DARA 3JQRA 2BEVB 1AUPA 1SVLA 1RHQA 1RI5A 2PU5A 3DE4X 4X20B 3RU9A 3B9QA 3SSMA 2HLNA 2EJWA 3EXHC 4HRAA 4JEHA 2L2QA 3T0FA 4TQUS 4YGXB 1R0CA 2GHQA 2PLRA 2EBFX 3O47A 2CNNA 2VK4A 2BFCB 3ABSB 4JKIA 3IRUA 4QVGA 5DYTA 4ZHQA 2UYQA 1R2QA 3FRIA 5EE3A 3KQYA 3UYLA 3NQ41 1GRVA 4MP3A 3TECE 1CPYA 3HCNA 1PZGA 1VKOA 1W46A 2CYBA 4ND1A 3D0KA 3RV4A 3O2JA 4GP7A 1LLFA 1QIKA 2QIOA 3GLGB 3VFDA 4ZYUA 2DFDA 3ABQB 2RG7A 5JFOA 1P4GA 5FD8A 4G5RA 1WLYA 3I4FA 2E37A 5BVHB 1X7YA 1JEYB 2UYYA 1OASA 1NC3A 1YK0A 1KMHB 4OH1A 4P4TA 2Y99A 4O4HF 3V1YA 4QKQA 3F6CA 2C4HA 3GJQA 2ZYWX 4NXNB 3SJCA 5F1OA 2SKEA 3BIJA 1Z0DA 1OX4B 4G1EB 4MI6A 5ALWA 1US8A 1EPUA 3GJ5A 3O74A 4CYMA 4WUTA 3HJRA 3OCZA 2XWSA 2JK1A 2WG1A 3V34A 3PNBA 5A1JA 2IIQA 4YJ3F 4WK2B 1DMSA 4CGZA 2YVUA 4C08A 4WXEA 3WLKX 1SIWA 1XJCA 2P9YA 2WT9A 3O93A 2CXSA 4JXJA 1I3CA 1ZN2A 4EX6A 1IFXA 3R76A 2J9RA 3L3BA 4NICA 4C5CA 4DCTA 3T41A 3W6ZA 4ENPA 3MG9A 1FJGB 1UDAA 3CNEA 5B7QA 3EA0A 3HV2A 1Z39A 3B7GA 3D2BA 4M1OA 3JYHA 4TKUB 5F73A 5IUKC 3E7XA 4ZEWA 1T10A 3K31A 4K3VA 5KAMA 4NZOA 3T7EA 2Z5LA 2VUSA 3MBOA 3NDRA 2FG7C 4RD3A 3NAMA 2DLDA 4K0RA 3WYCA 4J0IA 3RPEA 3RW9A 4QG3A 4HGYA 3SC6A 5CIYA 2O54A 1XHFA 2FW6A 4G86A 1N8SA 1FRQA 2H92A 4N9WA 4LHWA 1EIZA 4XB2A 3TNDA 3T5BA 2RD2A 4C2TA 1CUXA 1IULA 1Z0UA 2QUKA 4FMDF 4BZZA 4G1MB 2K2QB 1T8WA 4BLVA 4BKPA 1PR2A 4MXDA 3VZBA 3FPLA 1I2ZA 3VOTA 4G0MA 2GAAA 1Y0BA 3NORA 2Q6LA 2BMFA 5HIIA 4A2PA 3ADCA 1RLIA 4G5FA 3GLFE 1A96A 2OA0A 3A4MA 3MA0A 4HSGA 4OHVA 4RAOA 4UU0A 3T7IA 5TMPA 4US0R 3ZY5A 1J49A 3JATB 4J0DA 1OPXA 4I8IA 4MCAA 4Y98A 2HT6A 2IXBA 3CLTD 2JARA 4HN2A 1HNZB 1RVDA 1BNCA 1Q11A 3GIDA 3NTRA 3QYFA 4N03A 2JGLA 1QK5A 3DDCA 3FFTA 3D8NA 4H3HB 2BT4A 3L7CA 4P82A 2VQEB 2BEKA 1P29A 2C9CA 2ACVA 2HMVA 5AW5A 4HAIA 2IUYA 3MJEA 1Z8FA 2V6JA 1ORIA 1CQZA 3DC7A 3AVWA 1AMNA 3QQ5A 5JEEA 3DOCA 3FYCA 4HNSA 3AHFA 3INRA 3NMUF 2DUWA 1RADA 4N39A 3TAXA 3WIVA 3DEFA 4RL6A 3SDSA 4JYBA 3ZH2A 4QBFA 4I4TB 1JQDA 4L0CA 1I6KA 2V55B 3GUVA 4NE9A 5E6SB 1Q19A 3GT3A 1NF9A 3CT4A 3GHHA 3P0EA 5A7FA 4HI0E 2A7QA 2VNKA 5JATA 2AG0A 4V3CA 1FUUA 2HDWA 1Q3HA 3KSZO 1RCFA 1EGQA 2J9YB 3DJYA 3IAXA 3PS9A 4MPPA 5F52A 4AAYA 2PY6A 1CUBA 2ZFUA 4OBBA 3CG4A 2XB9A 3WWEA 1RHMA 4CMIB 4YV1A 1HMPA 1OAOC 2BSAA 3C5HA 4S0ZA 2WWFA 2WJYA 2LE0A 3AF5A 3NNDA 4G89A 3M5CA 1LFDB 4BNGA 2RGXA 4JGBA 1H69A 3A1NA 3ZWCA 2VAMA 4HDRB 5DP1A 1UDXA 4FZ3A 1TVKA 1D2RA 4GIBA 3SE7A 3TIGA 1HM5A 3K5PA 1K0UA 3R44A 3KKQA 3RC8A 4TTTS 2C57A 4D8TA 1P7ZA 1YS1X 2PMWB 4FFBA 2J3JA 2PMEA 4KDCA 5ER9A 3LO8A 4E2XA 4EJ0A 1DBRA 1PFGA 1NUAA 2VRBA 4M1ZA 1AY0A 4MUKA 3KZVA 4YIHA 3OF5A 3EVZA 3O1LA 4EX7A 3B53X 3R6LA 4DMCA 5A3QA 5IN4A 2IOYA 1IVSA 1IUKA 2HCRA 4HDNB 1AKEA 2P6MA 2CFOA 2OKCA 2ZBGA 3N8IA 5E4TA 1HURA 3I1JA 4J2OA 3HWWA 3M9LA 4GMXA 4YDQA 3RK0A 1Y4DE 5JS7A 2O8DB 5CCEA 1C9NA 2IDMA 2QLNA 2WJJA 2XA9A 2YZ2A 3ETCA 4TVKA 5CA1F 2HW8A 1FDIA 4XARA 3ZS9A 4IR7A 4OMFG 3R6TA 3ZJ4A 3FETA 5BQ5A 1WKBA 3AVQA 3R3SA 4RKWA 4Y6SA 2YMPA 4YAEA 1AOXA 1CCWA 5F9MA 5FJIA 3WZLA 4V0MA 1QIJA 2OFWA 4AJLA 2G8LA 4DJ5X 1XMVA 4HUJA 1P4AA 3ONDA 2BBWA 3C3XA 4LY9A 5K2OA 4P7GA 1O0BA 3ZUGA