4GDMA

Crystal structure of e.coli menh
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
253
structure length
253
Chain Sequence
SMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 253
sequence length 253
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gdmA00
4A5SA 4W9RA 1AMNA 1ZIYA 1K5PA 1VKHA 5HQ3B 5T4FA 2EEPA 3C5WP 4AO7A 5FV4A 2QVBA 1XZDA 4D9JA 1UK7A 3DLTA 2V97A 2V9ZA 2HU8A 5T4BA 2ECFA 3KXPA 1DQYA 5JAHA 1USWA 3KDAA 5ALDA 3QM1A 4G4IA 1TK3A 1VLQA 4PSUA 2XMGA 4QZVA 1Q0ZA 1XZHA 1F8UA 4UHDA 3IDAA 1R50A 2H1IA 2WHPA 3ZV7A 4YPVA 1VXOA 4C4YA 4FBLA 4G1FA 3H04A 1ETHA 3H2KA 4ZV7A 3PUIA 2RAUA 4YK7A 2WUGA 2DHCA 3KOOA 1W76A 1AUOA 3WL6A 3QVMA 5AI4A 2H9YA 1YAJA 1XZLA 4Y2YA 3O4GA 5CH8A 1CRLA 5AI5A 1VZ3A 3W05A 1IUOA 2WFLA 4ARAA 1ODCA 5HF6A 2BUBA 5AM5A 1LPPA 5LZ7A 1UOQA 5DLPA 4Q05A 5J3JA 7YASA 4DNQA 3JYHA 1WM1A 5EFZA 4K5QA 1XZBA 1ZICA 2C58A 2AJLI 1BRTA 2DCMA 4BCDA 5HKBA 3HXKA 3G0GA 4Y2TA 5CMLA 3T4UA 1EK2A 2AXEA 3R3YA 4M0MA 1GKLA 2WG0A 2WHQA 1QTIA 1JI3A 2WIGA 3ED1A 5AKYA 1MNAA 4P93A 1XRQA 5ALNA 4BZZA 2HM7A 5JYCA 1YCDA 2WTMA 4XWGA 1QO9A 5CXUA 1QIFA 5AO9A 3D0KA 4DNOA 2ROQA 1G66A 5LZ8A 3VVLA 3FWHA 2JGJA 2LIPA 4E14A 2WUDA 3A6ZA 1VJ5A 3KSRA 4PF1A 4FBMA 5AKIA 4X6YA 1RP1A 5ALQA 4TVKA 4PNZA 4BB0A 3UUEA 2C0PA 3EQ9A 3GROA 1YSCA 3U0VA 1N5MA 1K4YA 1Y7HA 1DINA 5AK4A 2W22A 3HACA 2NW6A 3I2HA 1C7IA 1YA8A 4HZGA 3LIPA 2XUKA 4J0HA 3RLIA 1R1DA 4WDRA 5CXXA 5AKEA 2XUAA 4CIAA 2H7YA 4B9AA 3L1JA 4C89A 5ALLA 1G4HA 4FOLA 4AO8A 1FFDA 1BN7A 1EX9A 4XX1A 4ZWNA 5C8XA 2R8BA 1CUEA 2XMRA 3QZUA 2PM8A 2WUFA 2HHAA 1HBJA 3FYUA 4UBLA 2Q0XA 2RI6A 3O9VA 4UPDA 5BWCA 1LBTA 3AINA 1QIHA 1OXMA 3LS2A 2RIPA 2RONA 5BV7A 5AOAA 5KWJA 1JMYA 4EB0A 2BGRA 3FLBA 5CW2A 3TEJA 1E8NA 1MU0A 1SC9A 2Y6VA 1YS1X 1NU6A 5H3HA 1MPXA 1S8OA 3STVA 3HC7A 5HCUA 3WK6A 2YASA 4P08A 1ODSA 4I4CA 2QXTA 1WCYA 5A2GA 3C70A 1HKHA 1LPNA 4E46A 3IUQA 4OYLA 2ZJ6A 1YB6A 3O4IA 1ORVA 3R3VA 1IZ7A 4BAGA 2ZVDA 4BE9A 2GBGA 3DS8A 2HU5A 3I6ZA 3H18A 3AIKA 1JU3A 5ALRA 3W9BA 2C7BA 2JEZA 2WU3A 1EHYA 2WIFA 1E8DA 3AIOA 5ALFA 3NWOA 1LGYA 2QKYA 5K5EA 1P0QA 1UKAA 4AX4A 4FNMA 1YS2X 5KWIA 3D3NA 4KE9A 1LNSA 1Y7IA 2DHEA 4DMKA 2CB9A 1WB5A 5EIHA 1XROA 1K6EA 1IVYA 3FLEA 3JWEA 1UXOA 5EHZA 1A7UA 1U65A 4S0XA 5C8VA 1CUCA 2WFZA 3DNMA 4ZREA 5AKKA 2VAXA 3ESAA 2XUJA 4UBKA 1FFAA 2JGEA 2OAEA 2IITA 4X00A 4FMPA 2PUJA 3I6YA 2OCLA 2JGLA 4BBZA 4I3FA 4OB7A 2G5TA 1H23A 3EBLA 2PSJA 1ZJ4A 2XQJA 4QLOA 3WK9A 4CG2A 1W75A 5D6OA 5K3BA 2Z8ZA 3FCYA 2WJ3A 1H2XA 4X95A 3K2IA 4F60A 2ZYSA 4IHAA 3VJLA 5LZ9A 3FYUC 3UUFA 5LKRA 1FFEA 2X76A 3ANTA 1MTZA 1U4NA 3KWFA 3FCXA 4J0IA 1CUZA 3R40A 1XFDA 1SOMA 3OURA 4AO6A 3H2GA 4AMYA 1NU8A 3GZJA 2HA6A 4EY4A 2DQZA 4UFPA 4WFKA 3ZI7A 4FWBA 3C5VA 1W1IA 2DQYA 3HYSA 4BVKA 2OGSA 3WWPA 5IVDA 5FP0A 4ZGBA 2BCEA 3H1BA 2OGZA 1GPNA 2Z3ZA 2XLCA 2GBCA 1QO7A 3G7NA 2WHPB 4FLMA 5JIBA 1PFQA 2VQ6A 1J2EA 4L72A 2HFJA 2CEKA 1SCQA 1QFSA 4K6KA 4PQEA 3OG9A 1AGYA 2HFKA 3ILSA 3OC0A 4LHEA 3VJKA 4H7FA 4OD0A 3STTA 2H7XA 1QTRA 4H7JA 2ZYIA 4A16A 1ZI8A 4I19A 2XUDA 4G9GA 1MO2A 1H2WA 4MQLA 2HA7A 1CUSA 3BDIA 5CT4A 2JGMA 1UKCA 4AZ0A 4C4ZA 2PSFA 3CCBA 5JD5A 1ODTC 4GI1A 1BROA 3PFCA 1KEZA 2WIDA 4K6GA 1ACJA 3AUKA 3H2IA 3C87A 3C6XA 2GYWA 5D3ZA 5ALIA 4J0KA 4BYMA 3WJ1A 2ZJ7A 1BEEA 1LBSA 5CT9A 1SCIA 1EXWA 2OCGA 1EVQA 1VE6A 3QYJA 1W4LA 4GECA 1DQZA 1EB8A 1VA5A 4X3CA 5A62A 2WILA 2ACEA 4ARBA 4CCWA 1WHSA 3QBJA 1PJAA 4E11A 1KU6A 4B9EA 2Y6UA 2HA2A 2XDWA 4BCBA 4H18A 3F8SA 5DNWA 1AQLA 4L9AA 3VKFA 5K3EA 2XUIA 2XUHA 1AC5A 1ZI6A 4FLEA 4Z49A 2Z5GA 4QLAA 3BL8A 1XZCA 1FFBA 3WA6A 1H2ZA 1IUPA 3S8YA 5AOBA 3PDCA 1LZKA 4Q34A 1UKBA 4RPCA 3T52A 3DCNA 2OQIA 1Q83A 5K3FB 4IQ4A 3SK0A 1HPLA 5D3KA 3G8YA 4WCVA 1E66A 4AB1A 3V1NA 1JMKC 4B7ZA 5CURA 4EY6A 1AURA 1IMJA 3AZPA 3ESDA 4U2EA 2WLSA 3UMJA 1DT3A 2O2IA 3LLCA 2Z8XA 5AI6A 1CUWA 1BU8A 4HS9A 4BP8A 2PSDA 3STWA 1BCRA 4KRXA 5E4YA 4BCCA 4UBJA 2HRQA 1H2YA 3O4HA 5A7FA 3GBSA 3PF9A 4F5ZA 5IVHA 5JAOA 4CIBA 1X2EA 1CV2A 3BF8A 4H0CA 5DTJA 1HLGA 1UK6A 3D4LA 2QT9A 4QWMA 1CPYA 3R41A 4PW0A 1QIIA 1JKMA 4H7IA 1UT6A 1B6GA 1CUUA 1XZFA 2QTBA 3LP5A 3EF3A 5I9IA 5SYNA 4IH9A 4W1PA 3WKAA 4AN0A 2WFMA 5LP1A 3D2AA 3DOHA 2YYSA 1JJIA 1TKRA 1XQXA 4UHEA 2I3ZA 4X91A 5ALEA 5JALA 4MYDA 5SYMA 1DT5A 1QFMA 2I78A 3WLAA 3DQZA 2WIJA 2XUGA 1QGED 5AK6A 1AKNA 5BWBA 4G5XA 5CT6A 3R3WA 4IO0A 1X70A 4GWLA 5ALVA 1BE0A 5AKZA 2VJAA 3ZLVA 1UOOA 5AJHA 4NZZA 1WOMA 3IVMA 6YASA 1MJ5A 2Z3WA 2GBFA 3HZOA 5AIBA 4ITVA 3SX4A 1F6WA 2CJPA 4U2FA 2BJHA 2WJ4A 2BKLA 5DNUA 4M0FA 1TIBA 2OXEA 5EGNA 4BATA 1ZI9A 3G0DA 5JZSA 2FX5A 1VXRA 2WG2A 1E8MA 5AK5A 4NS4A 1Q0RA 4BRZA 2WU4A 2FJPA 4ETWA 4PO3X 3Q0TA 3ESCA 5DYTA 1DWOA 3KD2A 2PX6A 2PPLA 3OPMA 2HL6A 4CCYA 4L0CA 4HVTA 3D2CA 3BXPA 2JIDA 3CXUA 3F96A 1R9MA 1SCKA 3O95A 1Q84A 4MYSA 3BE8A 3DL4A 4LYEA 3ANSA 4LXIA 4AN1A 2WUEA 4IH1A 4UUQA 1F0PA 5FKJA 3DDUA 3PFBA 1ZD5A 3ICVA 2PUHA 3V1KA 2PSEA 4GXNA 1THGA 3QPAA 3LCRA 1YAHA 1EK1A 5JZBA 1GPLA 4HRYA 1CUAA 5D7BA 3SWWA 4AXBA 1CUDA 1JFRA 3HSSA 2O7VA 2IX9A 1CEXA 5AKJA 2C5GA 4EY8A 3BIWA 3B5EA 3FSGA 1F0NA 1WB4A 3KWJA 1UWCA 3D7RA 5ALKA 4B83A 1R4ZA 3FNBA 1MX1A 1Z68A 3P2MA 1JJBA 4UHFA 4WFIA 4OUKX 3DD5A 2AJBA 1VZ2A 1LPOA 2EDCA 1TCAA 1XRLA 1K8QA 4P92A 5AICA 3I6MA 1UK9A 4OCZA 4HRXA 3WYNA 1DX6A 3MUOA 1DWQA 4DGQA 5LZ2A 3IIIA 4GLBA 1CUYA 4X94A 5HK8A 2VJBA 1XQYA 4PV7A 3EQ7A 3K9BA 4BAZA 4UFOA 4LXHA 4FLFA 1X2BA 3O9MA 5C8ZA 2HU7A 4W1SA 2J4FA 1GQSA 2WM2A 3G0BA 4UBOA 2J3QA 3QITA 1EI9A 4BP9A 4H77A 2K2QB 5LLSA 3WWEA 1H22A 3HI4A 5AK3A 3IA2A 1NX9A 1TCBA 3H2JA 4QEKA 2XT0A 1HL7A 2QM0A 2XMBA 3WK7A 2BAGA 3TGLA 3WKEA 2WQZA 4B81A 5I8PA 2DR0A 1RWQA 2BUCA 2AJCA 5ALYA 2VF2A 4ZV9A 2OCIA 1GPKA 4Y2QA 1THTA 3RKSA 1CUFA 2R11A 3PE6A 4BC1A 4AQDA 1N5RA 3F97A 1E89A 4HTAA 3WL5A 4BDTA 4Y2UA 1TRHA 4QWWA 5JANA 3G9ZA 4C4XA 2WHRA 3STXA 5JADA 3RARA 1R3DA 2B9VA 1DU4A 5EI5A 3WIOA 1J1IA 4KAJA 4EHBA 3VXKA 4FKBA 4DYHA 2X5XA 3WWDA 2RHWA 3WYDA 4H7EA 3PF8A 4DMFA 5CTAA 5FUMA 2Y2VA 2XLBA 4G8DA 3K6KA 3AZOA 3BJRA 1PV1A 4OU5A 3I1IA 4BE4A 5CRIA 5ALPA 1CQWA 4QE3A 4DNPA 1CQZA 4EBBA 5E4JA 3QMWA 3BJMA 3M81A 4TPKA 4ZXFA 5T4EA 3YASA 2GYUA 3E1GA 3GUUA 5E4TA 1MAHA 1Y37A 4X97A 1YA4A 2G63A 2GBIA 4OPMA 5EHXA 2QMQA 3GELA 4RGYA 2XMQA 4UHCA 3V1LA 2XMSA 4EY7A 5AM3A 2ZYRA 1LLFA 2VT7A 3M3DA 3BWXA 5LIPA 2JBWA 3I2GA 3ZWQA 1QIJA 2QS9A 2Y1KA 1XZGA 3DOIA 4XJVA 1AZWA 1E5TA 1XKTA 3I2JA 2CUTA 2HRRA 2XMCA 3SC2A 4UHBA 1XZAA 5ALZA 4J0JA 1IZ8A 4CG3A 3F98A 1SFRA 2VT6A 2OCKA 4B0PA 4UBIA 1FJ2A 3V9AA 5A71A 1U2EA 2FUKA 4JUIA 3I2FA 4GDMA 4WFJA 4EUSA 3FYTA 2OPHA 1EINA 3AJAA 4BTVA 3WK4A 1UK8A 1QZ3A 4KEAA 3W9UA 2Y2UA 2WFLB 4U2CA 1R88A 4JH0A 3B3QA 3BF7A 1MX5A 3WK5A 4W1QA 4JEIA 2RHTA 2GZRA 1ZGCA 2XQKA 3A2LA 3H0CA 4AZ3A 4G8CA 4G9EA 3AIMA 4J7AA 4FHZA 2BUAA 3OOSA 3C6BA 5I7UA 3O4JA 2PU7A 4J0DA 4U2BA 3QPCA 4RE6A 1VA4A 3IULA 5IVKA 1JT2A 2YXPX 3E3AA 4TGLA 2EDAA 4MWTA 3O0DA 3W2TA 3F67A 3ESBA 3HEAA 4XIIA 4F0JA 5LKAA 5JZ9A 3HJUA 5AP9A 5AM4A 3WJ2A 2GYVA 1N8SA 3GA7A 4GEGA 5EIAA 4JYPA 4J03A 4CCYB 5AM0A 2OAGA 3F9CA 4B85A 1GGVA 2GZSA 1TAHA 2WIKA 4J3JA 5A7GA 5A6VA 4O08A 4LYDA 2V96A 4DMHA 5KBYA 2VEOA 1BEZA 1ORWA 3C45A 2UZ0A 2QOEA 4QDOA 2AJ8A 4Y2XA 2D0DA 4KAAA 3V48A 4FTWA 4E15A 1QIGA 2XQFA 2CMFA 3HABA 2IIVA 3Q8WA 3R3ZA 5ISMA 1QLWA 4GBGA 3H1AA 1UZAA 4WDQA 5ESRA 4KR0A 4MQMA 3ZLUA 1P0IA 3H19A 3WIBA 5K3DA 4B0OA 1BCSA 4QNNA 3DJYA 3D59A 1JU4A 5HK9A 4ZRDA 3I2KA 2BFNA 5FOQA 1QIEA 4HAIA 1LPBB 2PVSA 3IBTA 4DTCA 2QZPA 4BVLA 1WPXA 5DYWA 3DKKA 2D5LA 3FYUB 3W04A 4PSDA 3WK8A 5C7YA 2QJRA 2I03A 2XE4A 1QIKA 3FOBA 4IH4A 4MJ3A 1A8SA 4BTLA 5K3CA 3C43A 2PU5A 3S2ZA 5DJ5A 1IUNA 2DSNA 1QIDA 3WKDA 4EZIA 3NUZA 4N8DA 2XB6A 3L1IA 5HZGA 5AI0A 2JGIA 5AM1A 1XZJA 3AFIA 3I28A 5ALXA 3IUNA 3STUA 3A2NA 1CUHA 1G42A 5HFNA 3QPDA 4QDTA 1VE7A 4BVJA 2XQGA 2PBLA 3H2HA 2VA9A 5AOCA 3JW8A 5AKXA 1HDEA 1MX9A 3C6ZA 1QJ4A 2C0QA 4N8EA 4QDZA 5DNVA 2VAVA 3VISA 3C8HA 4UHHA 1G5FA 4ZI5A 4KYVA 1XRPA 4QA9A 1ZIXA 1XZEA 1XZMA 2O7RA 3WI7A 3A70A 3MUNA 1P0MA 4X92A 4K2AA 4B80A 1GT6A 4UFNA 2HDWA 2XUOA 5CH3A 3FVRA 1ZJ5A 2XQIA 4L3WA 5HF8A 3A2MA 2AJDA 5BOVA 1WPRA 4A23A 3TJMA 4C01A 5JD6A 4DNFA 4AMZA 2WTNA 4KE8A 5AKHA 1A8QA 1VOTA 3W06A 5EIEA 4U2DA 3WKBA 2CBGA 4OB6A 4W1RA 5ALHA 1LPMA 2RGUA 1DX4A 3G9TA 3DYVA 3G0IA 1BN6A 1EH5A 4CI9A 1T2NA 1XLVA 3OM8A 1CUVA 3CN9A 5LYYA 1RYYA 1DWPA 4DSAA 2C5FA 5FRDA 5AI8A 5CH5A 5K3FA 5DYYA 4KJXA 4KE7A 3U1TA 1E3QA 2FJ0A 3D2BA 2JGFA 1ACLA 5AI9A 4Y2JA 5HQ3A 4HXEB 3MGAA 3FBWA 1EA5A 2OQVA 2I3DA 4X6UA 1YB7A 5IH7A 3X3HA 2ZSIA 4KAFA 5ALMA 3G0CA 3N0TA 1A8UA 1QOZA 4MEAA 4V2IA 5ALTA 4KRYA 3BIXA 1CLEA 3M82A 5AH0A 1LPSA 1ZOIA 3B12A 3L1HA 4CFSA 1GXSA 2JGKA 2QUAA 4X90A 3WKCA 1A88A 2QXUA 4FNGA 4C88A 2O2HA 3IUJA 4Q3LA 1BS9A 1XRMA 2CZQA 4G4GA 4Q82A 5EHQA 3WA7A 4X6XA 1CVLA 1TCCA 2JF0A 3QH4A 3IB3A 5FDFA 4NMWA 4Y2PA 1XZKA 3CN7A 5F4ZA 2VJCA 3FLAA 2ORYA 1W52X 4BZWA 4Y9SA 2WG1A 4WY5A 4FDMA 4XVCA 1K63A 3IUMA 5HF9A 2P8SA 5HF5A 2X8BA 2DHDA 3R3XA 4DMCA 1CUIA 3AZQA 4EA6A 3FVTA 1CUJA 2ACKA 5FLKA 4DLNA 2QUBA 4G4JA 3HRHA 3NGMA 2ZSHA 4FFWA 1CFJA 2PSHA 1CIJA 4H7HA 4EY5A 4Y2RA 5JAPA 1QONA 5K3AA 4H35A 4MWSA 2ONCA 5HKAA 3DYIA 4KE6A 5CT8A 4X85A 1I6WA 2WSLA 4MEBA 4B6GA 1C7JA 2YH2A 3WWCA 3EQ8A 4INZA 3ZPXA 2XI4A 1MN6A 4OU4A 4LKOA 4RNCA 2QRUA 1L7QA 2OG1A 4X71A 2OGTA 4Q3OA 1C4XA 3BDVA 3MVEA 4BAUA 3WZLA 5HFAA 2B20A 4QDXA 2B4KA 3IURA 4GW3A 1L7RA 1ZD4A 1XRNA 1M33A 4HXFB 3CCCA 1XQWA 4DIUA 2QJWA 3C6YA 4K6HA 4YASA 5ALSA 5ALUA 5IVIA 4G8BA 2W6CX 4U2GA 5ALGA 5AM2A 4ROTA 3RK4A 3WMRA 3STYA 1T4MA 2HADA 2OLEA 4Q1VA 2VJDA 3FSGD 5LZ4A 4KACA 1KU0A 5JAUA 2E3JA 5IKXA 4UBNA 1XKLA 3E4DA 1U8EA 2V98A 5A7HA 3I2IA 1CUXA 3E0XA 1YASA 3ICWA 1OCEA 5JD4A 3DKRA 1WB6A 3I1YA 1GZ7A 3PICA 2C4HA 4N5IX 3VVMA 1QIMA 4JNCA 3GFFA 5AHXA 4LIPD 5JASA 4UBMA 1EVEA 2XMZA 2G5PA 3QMMA 3WWOA 1WHTA 5AKLA 2H7CA 1MAAA 4RE5A 4B82A 1CR6A 5FPPA 1O6FA 4DSZA 3PUHA 2VATA 4J0CA 4M0EA 4Y2SA 3AILA 3WQHA 3VJMA 1XZIA 4OSEA 5ALWA 1HQDA 2WJ6A 5DWDA 4J0GA 5JATA 4LXGA 3HLKA 1O6GA 1OILA 2XMDA 1TQHA 1W6RA 2B61A 1CUGA 1P0PA 3DEAA 2J3DA 5AKGA 4Y7DA 2PKYX 4F21A 2HA5A 5LZ5A 4C6HA 3DL7A 1GQRA 1UFOA 2WKWA 3G02A 1GKKA 1ZGBA 1LPAB 4B84A 3QMVA 2VTVA 2PL5A 3TRDA 2VSQA 3M83A 4YX9A 1EB9A 5DTIA 4Q3KA 4X7BA 5CBKA 1QE3A 3NOXA 5KREA 5FXMA 5ALJA 4H7DA 5YASA 4HXGA 3EIOA 3C8DA 1JJFA 1D07A 2ES4A 3ZLTA 5T4HA 3H17A 3PI6A 3VDXA 1XRRA 1MT3A 2HA3A 3WL8A 2G4LA 3G9XA 3N2ZB 4BC0A 3D5EA 4JYMA 1ZD3A 1FSSA 2O2GA 1LZLA 2XUPA 2ZYHA 1EDDA 4QDUA 4DM7A 1DTEA 1N1MA 5CT5A 4PSCA 3WL7A 4OB8A 2HIHA 5AIAA 3LIIA 3OTQA 1AX9A 1B41A 4P9NA 1FFCA 2HA0A 4CG1A 2XUFA 5C81A 1MNQA 4WY8A 1R9NA 1J06A 3G9UA 4OYYA 1J07A 1XQVA 2BGNA 2CKMA 5EHNA 1UOPA 4WJLA 3FAKA 4Y2VA 1EDBA 4GHWA 4NVRA 5E2IA 1XLUA 4FFVA 3WZMA 1ISPA 5JARA 3R0VA 3RM3A 3V1MA 1ZD2P 4BDSA 2JEYA 2HA4A 3R3UA 1EDEA 2J4CA 2QR5A 4BRSA 1CUBA 4N5HX 2DFPA 2XUQA 2ZJFA 1L7AA 4W63A 5ALOA 4N8SA 1XLWA 4MXDA 4X93A 4H7KA 1YR2A 5FPQA 4C87A
chains in the Genus database with same CATH superfamily
1FS5A 3UN1A 4P2GA 1MRZA 3R5FA 3DULA 5HQ3B 1HNXB 1T13A 1GT91 1R0SA 1T1IA 2BHSA 5FA5A 3NJ4A 2EEPA 1KO7A 2WBLC 1Q15A 2P3LA 3C5WP 1O7JA 5E4FA 2LDBA 4BNHA 4E5UA 5FV4A 2D2XA 1SCAA 3MIIA 5BUCA 4II3A 4B2YA 4E2XA 5FHQA 2GHTA 2Z6UA 4ZEWA 2X1HA 3RS8A 5ARBA 1QQ7A 3RSFA 5JPDA 4CIWA 3TLJA 3TD2A 4B6SA 2ODBA 4M0PA 1ESEA 1V2HE 4EQ6A 2QTNA 3DUFB 3OPXA 1QFXA 4IEEA 4L0DA 4YVFA 3ZHXA 5IANA 5JDIC 3H7IA 4E5YA 4BGEA 5JAHA 3MB5A 3O75A 3AVPA 4KFCA 1BYIA 4MUYA 4UQPA 3JATA 2FUNB 2YYZA 3G2QA 4C2UA 1PIWA 1CZHA 1NLMA 1U6KA 2RK4A 4G4IA 5FNVA 5ADVA 3JQDA 3NWPA 5DLYA 2VRBA 3C7TA 1TK3A 1K5HA 3PR2B 2QLTA 4PSUA 3TH5A 1RXWA 3HVRA 4G5GA 3TZKA 4QZVA 4ZT7A 2FZGA 3Q1LA 2X1MA 3SXJA 2C2ZA 3IDAA 2ZI7A 4FGZA 1GKIA 4FGKA 4B45A 5FORA 2QYOA 4IIJA 3LUJA 3ZGVA 1OXXK 1XNHA 2FR8A 1G60A 3LX8A 5B30A 1DIAA 5CDYA 3SC6A 3FGZA 1YNOA 3NYRA 3OZ7A 1QH0A 4YB8A 2PS9A 3PVSA 2P5YA 4IJMA 3DZ8A 1KOJA 3THYB 5JNSA 2AKEA 4IMJB 2XTMA 4HLDA 2WJAA 5AVOA 2I2BA 2QP9X 4BGDA 4CMCA 4ESVA 5KZMB 3VKGA 1SXPA 3FFBA 4ZV7A 4EUNA 3BKXA 4P35A 3C4JA 3AEUB 4PR0A 1QUEA 2RAUA 1C50A 2MOKA 1Y6FA 2WUGA 3PFKA 3CRRA 4V2UA 1XDUA 3KOOA 1W76A 1JDNA 2YQZA 4IUDS 5C5EA 5JJLA 2PTHA 3GLQA 3O1JC 4EMBA 3DMYA 3QJYA 1EJBA 1YFLA 1E9FA 3QVMA 5JLAA 2RHHA 2JGAA 4HDMA 1GAJA 2PNFA 2R7NA 1G2PA 4QJBA 5K0NA 4J7CA 1WXEA 1G9SA 2MSEB 4TYYA 3L7JA 3P45A 5DM4A 4YBRA 3VR4A 1A3CA 1TFRA 2R4UA 3H4VA 5BSVA 4EYEA 3OF2A 5B4TA 2X9QA 1TUEA 5HF6A 1V35A 4JJ4A 1ZIDA 3T5CA 2XHZA 1Q7CA 4RZIA 3L1UA 3WYFA 3HB0A 1MOSA 3EN0A 5DLPA 4Q05A 4BJ1A 2O4UX 4R8SA 3QHPA 3ADCA 4DNQA 3JYHA 4XD7D 3AVVA 1NW5A 4G37A 5FBKA 1TRKA 3GEPA 4K5QA 1W0KD 1R6AA 4LZZA 3VR5A 1XZBA 2P3OA 1CB7A 1ZICA 1N2CE 3CY6A 3R23A 1LK7A 1GZVA 2C58A 2NOAA 5KSPA 3BH6A 1WCIA 1Z16A 2C9CA 4BCDA 1U8AA 2GXQA 3BGOS 3A2KA 3RUHA 4K1XA 4KWEA 1U0TA 3TE7A 2Q9CA 2J0SA 4FJ2A 2IYVA 4QT4A 1EK2A 1Y1KE 4UJ5A 3QOYA 4F2DA 2ZR0A 3DTYA 3HLTA 1GD1O 2HGZA 4L5YA 4H2DA 1E1DA 2JAUA 3ED1A 4JOCA 5CCDA 1TLLA 1ISSA 2QNIA 3LFHA 1UM8A 1MNAA 2I99A 1FNSA 2P6MA 4Z9YA 1BHJA 2XUZA 1XRQA 1Y1PA 3FB1A 1QHFA 3F7OA 3FTQA 2JFZA 3QP9A 3TVTA 4D4LA 4HGQA 5ALNA 3KJGA 4BZZA 6ABPA 1CHNA 3JSAA 3OJCA 3P97A 1XCPA 1YF3A 2QLNA 3MBOA 5L6LB 3KT0A 1DEAA 2BEVA 3H1GA 3FOEC 1QIFA 3EFEA 3LHDA 4OQFA 2R00A 1JG3A 2IOFK 1R6BX 1MRNA 4L75A 1TA9A 3B6EA 4Z0TA 4YLYA 4KSCA 1RJGA 2IY7A 4AU1A 5A5EA 1ORTA 1SZCA 3DAFA 3ENQA 1E61A 2ROQA 2EFGA 1AXEA 5HMMA 1G66A 2VYFA 4PGMA 2Y68A 2JRLA 2OE2A 5FTMA 3CZPA 4B44A 4BKUA 3EIXA 5CVVA 4B5KA 4DRXA 1IIRA 3BIJA 4J1QA 1YGPA 1MGPA 4GZMA 4XYLA 3AF3A 1NI3A 4EKEA 1U8CB 5K0EA 1AZSC 3A6ZA 4JA0A 1RQNA 5B3LA 1NYTA 1VJ5A 2JLQA 3KSRA 4IG4A 4MUKA 4TUYB 5ES3A 1VBKA 4OQMA 1BVUA 4PF1A 4UKDA 3REOA 5F7XA 3IYLW 4FI3F 3TR5A 2DJ5A 2WEKA 3L0IB 1P9NA 1L5HB 1PFUA 1U90A 1YVDA 4KO4S 5KMGA 1RP1A 3HP1A 2GBLA 2EKLA 2HZBA 2ZULA 3I0MA 3LC0A 4RD3A 1G5QA 4PTZA 3U7GA 2A30A 4HFJA 2WD7A 4X64B 3ZWXA 4WK6A 4LN1A 5A06A 5L6MB 3TLKA 1NI4A 3PB3A 3N2GB 2QAIA 2R5NA 4FN5A 3LUKA 2F1IA 4KR3A 1TQ4A 3O6VA 1F1JA 4URFA 3TN7A 1YSCA 2O52A 2NACA 3GRAA 2J4DA 1ID8A 1UANA 3QU9A 1MC4A 3MJRA 4OKSA 3CNNA 3LCUA 2P7HA 2Q45A 2PD6A 3UAOA 3M9WA 4ML3A 1K7EB 2WWWA 3SQLA 1E2IA 2VYQA 2CDAA 4DABA 4FR2A 4GOND 3TNDA 4D74A 1C7IA 1JWLA 3Q7QA 1PT9A 1RJ9B 3E03A 5B6JA 4DV5B 3JQRA 3VX4A 2ADOA 3BCUA 1R1DA 1EJ0A 1EM8B 2B2CA 4KMSA 5FI5A 1ICEA 2XUAA 1X7XA 4CIAA 3U3RA 3FYSA 5F12A 3L7YA 2JIOA 3CZAA 3OT1B 1W1WA 2CDCA 1BWPA 2FW7A 3E2MA 4H0FA 4RTQA 3GNLA 3DQQA 1KETA 2A94A 4KQGA 4HYTA 5BWNA 3MJHA 5CCBA 5CVUA 1AKEA 4QASA 5BR8B 4GGPA 3M1IA 1BOOA 3EAQA 3PX3A 1OR8A 3IQDB 4RD1A 1EX9A 5JAZA 4IIEA 1SBYA 1YB1A 2IC5A 3CVWA 2ATCA 3OOHA 3LPDA 2YVLA 3BZUA 4QTYA 3WRYC 1DS6A 2BFBB 1LJ8A 2NO0A 2XRYA 2XMRA 2C4KA 2FR8C 4OMCA 3U1BA 4FCVA 4JC8A 2ZTUA 3DDWA 3OUTA 2NO1A 4IEIA 4PC7A 2HHAA 3ONFA 3BOSA 2OHXA 1RC0A 3ELWA 2DUJA 1EIZA 1WS6A 1ZM2A 2EP5A 4UPDA 3S7TA 5BWCA 3DVQX 3AF6A 2WZBA 2GJ8A 1DDIA 4HPJB 1LSUA 1M0EA 1LFDB 1V4BA 1J0CA 1EZ1A 4IRMA 3UOWA 1GL7A 1JHOA 5CIQA 1YWGO 3LXXA 4OSOA 3R7DA 1X1QA 3X44A 2NO6A 3CLUC 4YLGA 4Z0HO 1QG6A 5BV7A 5H9VA 2FMIA 4EVRA 1IC6A 4HRAA 1T5DX 5T57A 3NBYC 4OBBA 5AUOB 1IULA 2NGRA 3KPYA 4G6ZA 4GP9A 3HHPA 3SC2B 2BGRA 4EB0A 5E0OA 4GM4A 5K9ZA 5DGIA 1YCHA 3IP7A 4I7EA 4PO9A 5BMVF 1C7RA 3DE0X 4O25A 1GFIA 4N9WA 1BFUA 2WMOB 3QYFA 2ODQA 4FW9A 4XGKA 2QTZA 3TX2A 5IPFA 3HUUA 4IO1A 3M3HA 4U7FA 3QEBZ 4XPZA 2IHTA 3SX2A 1DMRA 3QRWA 4DRYA 3K71B 1C30A 1U0GA 1OFGA 4TMYA 4BUJA 2OCBA 3P94A 4RHXA 5K2MA 4EW6A 5IKEA 1GKYA 4YN3A 3BAFA 3KAQA 5ARCA 1U0BB 1DL5A 4MP3A 2ZWIA 1V47A 3PUYA 2XBLA 3EUFA 4H3VA 4RC9A 4FW8A 3WLHA 1KARA 4EGAA 1XXHB 1ISJA 3IDOA 2XZDA 1AKTA 2PGOA 1DKLA 2QXTA 3BWMA 4I9NA 3TINA 2G80A 4F8YA 1IJFA 4KI7A 3HVUA 4A2QA 2CYAA 2DT5A 3IKVA 1B0ZA 1HKHA 2A0WA 1FVFA 1AA9A 1PJZA 1Z6GA 1PD1A 3DBVO 3KB1A 4DBVO 1H2EA 2FEKA 2PZFA 1T9DA 3MTBA 4JLMA 1HDYA 1NVMB 3B2QA 1LVUA 1M2NA 3TUIC 3X1YA 1QE0A 2DPLA 4J07A 1Z74A 1UC5B 1VLVA 3VR5H 1RRFA 3EBPA 1OKKA 3PNYA 2AOXA 4M0CA 1UPAA 5IH3A 1ST3A 1FA9A 2FRXA 1F7VA 1ZVJA 3WLFA 5JSZA 1ZVVA 1SKQA 2WP8J 1G21B 4C7OB 2ZZNA 4OKIA 5GP1A 2R7MA 3AIKA 1JU3A 4HB2A 1ZINA 3HBJA 3LRXA 4XR4A 2JEZA 2WU3A 4C4PA 4B3SB 4I5GA 4BNMA 3THWB 1RQXA 2EIHA 3BTSA 1EHYA 1OAOA 2JCYA 3PKJA 4ZO7A 2ZB8A 3L7LA 3HWWA 3NWOA 3OZDA 3DE3X 3ZXIA 2R00C 1JVSA 1E99A 3HNOA 1IU9A 1DQSA 3F71A 4OGLA 1YV9A 4DYVA 4M2LA 5K5EA 4GC9A 3URMA 3L49A 2RHBA 1HDXA 1M66A 1JG7A 1UKAA 2Z9BA 4DA8A 5HOEA 4AX4A 5H3CA 1N92A 3AM4A 2FU5C 3EZGA 4FHDA 5FEUA 2UUAB 4N3CA 4P4SB 2AJTA 4RIGA 2YXBA 3HMQA 5KWIA 1ARZA 2Q0HA 5ECWA 4BB5A 3USES 1Y7IA 3I6QA 3NH6A 2Z4TA 2EGGA 4MUGA 1D6SA 1F14A 3I05A 2QY6A 4DMKA 3I4LA 3M4JA 1BC5A 2CB9A 4QXPA 5EJAA 3VU1A 4PLPA 4QPPA 1WB5A 4CQMD 1YDFA 4AS1A 1SIUA 4DBLE 4HH3C 3JWEA 2XY4A 4PX9A 1UXOA 5M04A 5ULLA 2GBLC 3EZXA 1L3IA 4WE3A 2X9LA 5KQGA 3C1TA 3DCIA 2YVUA 3NHAA 2V3CC 1FL9A 3WIEA 3AEXA 5AYVA 5LYJA 3IAFA 5KQRA 5GY7A 1P2BA 1D1QA 4S0XA 2D00A 4DLAA 2R6DA 1C80A 3Q6NA 4G1BA 2FMHA 4ZDJA 4YDRA 3HDGA 4PX2A 3RRXA 5C8VA 1ABBA 1U6JA 2AZ4A 4W4TA 4F84A 3K1AA 3NHKA 3H8VA 1Y9AA 2E9SA 2I6FA 2MSLA 2WJJA 3JR7A 4LNUA 3DOUA 3ESAA 5DBGA 1K06A 4DUYB 2XUJA 2PUGA 3DBRB 4HQFA 4CTNA 1SIWA 1GV0A 1LI7A 4YRGA 2WV9A 3QLUA 1FFAA 2IF0A 1T0UA 4S2EA 2DYKA 3G2PA 2JGEA 2OAEA 3AK4A 3IIJA 3OZVA 2VNHA 4FYYA 4GPAA 4QPZA 2OV4A 4UARA 4X00A 1N2EA 3W6NA 3GNSA 3GDWA 3ZX4A 3ZG6A 3S29A 1CQJB 4IOLA 4BO7A 1E3WB 1N2OA 2XEDA 3ADDA 2P9JA 2B5OA 1Z2AA 2ZW9A 3MZ0A 1NF2A 3OHMA 2G5TA 3PL1A 4BBZA 4EKIA 4F9FA 3EBLA 3D7KA 2QLBA 3GZ4A 3DFZA 4I55A 5HTOA 4L7VA 5IXJA 5BYBA 4MWCA 1PZGA 2FN9A 1BVRA 1W75A 1Y5NA 4ZYXA 2BGUA 1KY5A 4EJ6A 1YZLA 3CRQA 3KEMA 2PLNA 1N5IA 4LJ7A 2BI4A 2ET6A 2WKSA 4KYTA 4MRVA 2O7NA 3H3FA 5IK2D 3FCYA 2C5SA 1VMIA 2VZ0A 4GUAA 4X95A 4MNTA 2BIFA 4XUCA 3G49A 4C30A 3IEVA 3UT0A 3VOBA 3GHHA 1T36A 4RVUA 3BL6A 3AP1A 3D1VA 4JB3A 4KZPA 4U9IS 2TYSB 2QRGA 3AVYA 3QW2A 2ZYSA 3C7DB 3ND8A 2YIJA 3VJLA 1IHUA 4QJIA 3L4SO 2OECA 4TKMA 4UDXX 4BGVA 3AM5A 1Y8AA 2QPTA 4RGBA 1A5TA 3F3KA 1HGXA 5LKRA 2H1VA 2WINI 2J9YB 1CJSA 1DAOA 1A7JA 1I8TA 2IUYA 2X76A 2CFSA 3VYRB 4AXXA 4EJ2A 4DA0A 1JFSA 2V7PA 3KWFA 5CG2A 1OIXA 4J0IA 3PRKE 5M5BA 3FW1A 1JBEA 2G6TA 3DOEA 4OM8A 4P7FA 2X4DA 4XVHA 4D80A 1CUZA 3R40A 1TVKA 2PLFA 1O89A 3R9XB 3ICQB 1WW3A 1JI0A 2AMJA 3L6UA 4AN4A 1DJPA 2Y71A 4UZEA 5AJUA 4AKHA 3KALA 3MQFA 3LBHA 3GZJA 2XXAA 1N32B 2HA6A 3VR4H 4F85A 4EY4A 3ABZA 2DQZA 2F1RA 2R1TA 2QN8A 2DPMA 4TSKA 4WOBA 4FWBA 4BKQA 2XVMA 2P4QA 1E1LA 1P91A 1DC6A 1KI6A 3C3WA 4RV9A 4R3NA 4DQXA 2BDUA 2DQYA 5AHRA 4PIPA 2PRJA 2W2MA 3HYSA 3PFWO 2ZR7A 3P32A 2XWSA 4E51A 1N5KA 1CNMA 2YNMA 2B30A 2F3RA 2PGAA 3CT6A 1A77A 3KL2A 2XNSA 4K9QA 4REMA 5HILA 4D79A 2E4VA 4NY1A 1TEVA 2BEUB 4FEEA 4EI9A 1SUFA 2PCLA 4LYHA 4C7KA 1WDMA 2GRJA 2R1UA 3LV8A 3NATA 5F52A 3WBFA 2Z3ZA 1B43A 2GBCA 3QXJA 3CLRC 1KDPA 4RQUA 3WYEA 5JVDA 1H2RS 1QH1B 2PT5A 4FIDA 4JMPA 3HGMA 2OXRA 2VP6A 3O8DA 2GZHA 5JIBA 1V37A 2BKUA 1C3VA 3PBKA 5KQMA 3I30X 2OBXA 5IJXA 3ZHUA 3E4CA 1NJFA 2F59A 1P6UA 2BN4A 3BD9A 4Q4HB 1SCQA 3MMXA 3WGJA 4Q3DA 1M1YA 2CHFA 1KZ7B 3QVJA 1ACMA 1M5RA 2KW5A 3TZBA 4X45A 3KV1A 2C9DA 2VBIA 5K09A 3INRA 4M6WA 1EWQA 1MJGM 1FDTA 1LJUA 1MEEA 4FT2A 1XWIA 2GCNA 4LHEA 2QQ0A 1N1GA 2XX3A 3VJKA 3AERA 4HT3B 5IZCA 4OD0A 1Y81A 4N6OA 2H7XA 3IT2A 3BEDA 3UHFA 5CEEA 4H7JA 3C4VA 6Q21A 3MMSA 2ZYIA 4E5PA 3NALA 2X8JA 3S55A 1ZI8A 2ZUUA 1ELOA 1OAOC 3KQNA 1C3OB 2GCOA 3UXMA 2XUDA 3A4MA 4LHVA 2PL3A 1H2WA 3OF3A 3T54A 4FD2A 3TMAA 3VZBA 5CIYA 3UV6A 3S0JA 1NW6A 3V7FA 3BDIA 2E5FA 3ZUPA 1UKCA 5C8YF 5KNBA 1F51E 1DKQA 2PSFA 1T35A 1JS1X 1KYQA 2X5OA 3QF4B 3WHPA 4AMUA 2QSZA 3ZLJA 2NWQA 3HYCA 4PBTA 5EYPA 3I12A 2LGJA 3VYVA 3WRWA 3PFCA 1SKYE 2ZE7A 3QE2A 2P5UA 3GT4A 1Y42X 3T7SA 4ZVVA 3ZTTA 4ER7A 5KUTA 3B78A 3E27A 1GQYA 3AUKA 1NMEA 1I2ZA 2VPYA 3PQDA 3O8RA 2UZ4A 5KB3A 3QVGB 4ZZ1A 4D9MA 2OZEA 5ALIA 5JR3A 3H0KA 1IB0A 5DSXA 3HGQA 4J0KA 2AMVA 3CG0A 3E9MA 3FMPB 3RIMA 4QO7A 3E3NA 3MJCA 1O8BA 2N9UA 4Y2GA 1PJ4A 1LBSA 1EXWA 3RF6A 1U0SY 4UDNA 5IMSA 3NIDB 4R2IA 2OCGA 1CF4A 2I29A 3QYJA 3ZK9A 1W2HA 2I3AA 5C46F 5JS1A 1P18A 4R2WA 4O4JF 4ERNA 3OAAD 1ZKDA 2SCUA 2YINC 1IOLA 2ACEA 4CM1A 4ZOQI 4ARBA 2EIXA 2Z2XA 3RIXA 1K66A 1PJAA 1U6IA 2AFVA 4D4JA 5EJ7A 5KNCH 1Y6QA 4JI7B 3ZU4A 2YRXA 1T3LA 1Y34E 1ZFNA 1ID1A 2VL7A 4IDEA 5L8VA 1S5PA 4YYEA 1G55A 3EA4A 2MSCB 3K6SA 2Y6UA 3E22A 1SOAA 1K6MA 2HA2A 4JT4A 2QPOA 2AMLA 4OP1A 1VSVA 1QH9A 3AF1A 4PPNA 1AB5A 3F8SA 5IBCA 3Q9LA 3PVCA 2Z08A 4B6FA 3GJ6A 5IM5A 2H1RA 3QLUC 2WW8A 3T3MB 3S1LA 2QORA 1YZTA 4B40A 4WASA 1OLXA 2OO7A 4PBSA 4Y1GA 2WM8A 2IUEA 1AC5A 4R7GA 4ZAGA 2NXNA 4TTJA 4DFDA 3M5CA 1YDGA 4FNAA 3RS0A 4HPWA 2PUTA 3IQFA 4EW1A 3ELUA 3NS7A 5BN4B 1VMKA 5P21A 2C84A 2JHAA 5HM6A 4RH0A 5D00A 1H2ZA 1C9MA 3VHXA 4IGIA 1IUPA 4EY3A 1DBVO 3BS4A 3FOCA 3WBJA 2XF2A 1MV8A 1UKBA 2BPOA 4RPCA 2AW3A 3RRMA 1TVEA 2CK3D 4JI5B 3T52A 4CQLA 1F6BA 2GQ0A 4P22A 1Q83A 4F9EA 4H4DA 3TNYA 2E1RA 3BTVA 2HPAA 2JDIA 4LY3A 3KDSE 1VJRA 5TGDA 3S40A 4QECA 3FCUB 2X13A 1XJQA 2OR3A 5JWHA 5KYTA 3VV2A 5I3CA 1YR9A 4POAA 4GVPA 4MS3B 5DI3A 1S6YA 4X24A 2GPSA 2BGMA 5AHKA 5IVPA 1IMJA 5LN1A 1AHNA 1D1TA 2IZ5A 5FL7D 1H8HA 4XUEA 1UJCA 2O2IA 5JYDA 2E4YA 4OXIA 5E8RA 2IBTA 1ZUD1 3IEKA 1FNNA 1P6XA 2J9XB 2HTFA 1BU8A 1RKQA 3N7TA 4HS9A 3IOMA 2OHIA 3D4PA 1P45A 5EZ5A 3ZNNA 2DF8A 1PYGA 2H1SA 2WJGA 1VCOA 3I53A 1OX4A 1GZUA 1W96A 5G3YA 4P8RA 1MOZA 2OCDA 4K88A 3KVOA 3I6IA 2RHLA 3LT4A 2ENWA 3QXSA 4UVIA 2BY4A 3BXGA 5E4YA 2G1KA 2MR5A 2ZB4A 4GD3Q 4Z6KA 2EFJA 4HUQB 2REOA 1ZMOA 1H2YA 4Z1MD 2PX2A 5A7FA 2I2FA 2PZGA 3A7EA 4TMZA 3L7CA 3PKIA 1A2BA 4PYNA 4R9SA 1M34E 2PWPA 4LUCA 2ZTSA 3O8LA 5L3RA 1Q77A 4PQRA 3U7JA 2YNMC 2FCAA 4ND8B 3EXIA 2E89A 3BK7A 3IAHA 4G0VA 5DXFA 4I4IA 3LBAA 1UK6A 3PV0A 4OHXA 3L8HA 4ZZ0A 4V0ME 4AIIA 1UBMS 4Z99A 3D54D 2FPRA 1JKMA 2JJ2A 1KJ8A 4H7IA 3U7QB 1XNRB 4Z4QA 4RV4A 1XZFA 2Z5FA 2JFUA 1PZMA 2A9OA 2QTBA 4LGMA 2WF5A 2Y92A 2ZYAA 3COVA 3EF3A 4FZ5A 2CZGA 2BF4A 4W1PA 4YMIA 2WSYB 5B12A 3A9WA 1UAAA 3QXHA 1NVTA 3O2SB 1BDHA 3DV9A 2WFMA 3D2AA 4RVGA 4G01B 4UATA 5IZCC 2OUKA 3Q10A 4X20A 3TS1A 1K27A 1X7HA 4XAQA 3DKIA 1LFAA 4PC1A 2O3QA 2M6LA 2ATXA 4O5OA 2IIQA 4MV0A 1QFMA 2RH8A 3NNDA 2I87A 4DWJA 2EZ4A 1R3UA 2X9NA 2XUGA 2VTBB 3DD1A 3GJSA 3EVTA 4NNPA 5BQFA 4V3CA 1NVUQ 4GGOA 4XASA 5U9CA 4DR4B 1B76A 1IG3A 2ZWAA 4MR7B 4R4JA 1CSEE 2CF6A 4N39A 5L3QA 1DXYA 3IQEA 1GZDA 4PRZA 1RABA 1W5FA 3BC1A 1L5KA 2P8JA 2EKPA 1W48A 1HYQA 2I2CA 2EHJA 1V9CA 2V4UA 3ESQA 3I9FA 4Q3BA 3ZWPA 2XGJA 2Q2NA 2PKQP 1ES9A 1FY2A 1W0JA 2VJAA 3WBKA 4ZYWA 4E5NA 1YJXA 4DDKA 3BWCA 1FBTA 3TMYA 5G53C 5EIXA 3RFCA 4TV8B 5DHAA 1O08A 1ZC3A 2G36A 3Q7RA 4G67A 3VI3B 3CIFA 1MJ5A 4DA9A 3D6JA 1XPJA 3RRNA 3T7IA 5H80A 3ZZ1A 2YJZA 4G36A 5CFQA 3AQIA 4DILA 1T9CA 4WNAB 1V3UA 2BR4A 2PS1A 1Y89A 3E6AA 3DDCA 1YCGA 3OCZA 1F6WA 4N41A 1OZ0A 3SJAA 3ZH2A 2CN1A 2CJPA 3R6LA 3QUBA 4L5JA 4U2FA 3RC3A 1S2GA 2IU6A 2J9RA 2BJHA 3JU3A 3N0RA 3RIHA 4H59A 5B58C 1XMQB 1VCMA 3DOCA 4BX3A 5HA5A 5JCOA 1EFLA 3WGUA 2OO3A 2C4VA 2PK3A 3MTEA 5JH7A 3LYHA 4DA7A 4AUKA 3DE5X 2JHGA 3OBIA 1JALA 5EGNA 3QXGA 4XVUA 3C15C 2PAFA 2Q1WA 1G9XA 3OBBA 1SELA 4PS1A 4BNVA 4QTXA 3ZVNA 2E4AA 4RZ3A 1QPBA 5E7QA 5DNYB 1GIAA 1PR0A 2FX5A 4NL4H 2XR1A 4AIRA 1G5HA 2IYOA 3LVRE 3EDRA 3O38A 1GL6A 4NOJA 1P8JA 3L8FA 3GBVA 2WG2A 3KTFA 4DV3B 4HSGA 4YJ2B 3KOWA 1B8NA 1PEAA 4Y0NA 3WLSA 4NFLA 4A91A 2HRBA 3OMWA 4IHJA 4UE3S 5E7MA 5CB8A 3K0EA 2XNJA 5HE9A 4XJSA 2V7BA 4PCAA 4QX6A 1FFXA 3IALA 1Q19A 3PNQA 6GPBA 5ICSA 1H6DA 2BSQA 4TKUA 1L5OA 3ESCA 3HYLA 2ZQYA 3S2FA 4EI2A 5FB3A 3R8CA 1B6RA 3KD2A 5TMDA 2MMCA 1RIIA 4K8RB 2O50A 2IDMA 3OPMA 4Y9UA 3FLMA 2HL6A 1Y82A 2UAGA 3LYAA 4U9UA 4AD8A 5JISA 3PWSA 1IUKA 1TW3A 4JJZA 3D2CA 1EXDA 1A5SB 3CINA 3IT1A 5I9BA 1RHQA 3KKQA 3BSSA 4WXYB 1Q3KA 1JSXA 3A7DA 1XCMA 2C8KA 2O2EA 3TEMA 3EH1A 3O95A 2NIPA 4LYGA 1V11A 3ZOKA 2JAPA 3ED5A 3MXOA 5M29A 3K92A 5FBWB 1DXHA 1FQKA 3BE8A 3DL4A 4LYEA 3ZU2A 4D46A 4BL5A 6LDHA 2FPLA 5B1HA 1XCBA 2P9FA 2XDQB 3RIGA 4OQDA 4R84A 2RE8A 2SKDA 2F3TA 1Y4SA 3CZRA 3HY3A 5KOJA 1TM2A 1FDRA 5BSGA 1HMYA 3B60A 2YXEA 2I2XB 3IMCA 4L5CA 1WIWA 1Z4PX 1JEQA 4LOKA 5LA6A 1ZD5A 3ZCQA 1LY1A 3VU8A 2PUHA 1JQDA 2Q4BA 3QKTA 1VSBA 3JASA 2FQQA 3V1KA 4BNXA 3P9SA 2CFIA 2P4SA 3BRSA 4ZT6A 3QPAA 1YAHA 1T4DA 2FGJA 1VJCA 4NECA 1SVWA 2Y0DA 4MIOA 1FK8A 1XVVA 1ZN7A 2CLCX 3K1ZA 5J4YA 5KEIA 4NK4A 3TCXB 1CUAA 2VUHB 2XSZA 5FWDA 2Q4DA 2VA8A 3COWA 3RRZA 4AJ1A 3SWWA 2TMYA 4HWRA 4L15A 1U1IA 3Q5GA 1O4WA 1GYPA 1BHO1 4FMDF 3TJZA 3O92A 5JEDA 1E92A 2XZLA 2RCYA 1EFRA 2CNNA 1KZGB 2BZSA 4QTZA 2I4TA 3FG9A 1EEXB 2YY7A 3MF4A 4B34A 2DU8A 1N6IA 2AFIE 3IAS6 4JODA 1ENOA 1DTWB 1HLPA 2FEWB 1E1NA 3FSGA 4HNAB 2HRDA 3SD7A 3CC8A 4ID9A 5IHXA 4Z8XA 4DC9A 3H7AA 3FBGA 2A9KA 4CKXA 5B3KA 4IQ8A 3HY4A 4TL7A 2QT1A 2IPAB 1U5AA 1AGRA 2HUNA 4B83A 1MX1A 1Z68A 3FR8A 1JJBA 4A03A 3F78A 4MYHA 3F4BA 2CC2A 5ARDA 2H31A 1GY8A 1WHTB 1ZRNA 3A4NA 5JY6A 3FTPA 13PKA 3DD5A 1QP0A 1MD9A 1IHXA 4JT8A 1V41E 1BWQA 4Z0NA 2EBHX 1I24A 1TCAA 1IM2A 2F67A 3I6MA 3UC5A 2ZSFA 3GZNB 3AEQB 2KMLA 4DR3B 2VH5R 2D59A 3KEGA 2XA9A 4OCZA 4E5VA 4CUJA 5HX7A 5H70A 5J2TB 1S89A 5AR1A 3VNUA 5CJPA 1TUBB 3DLCA 4M9SA 5CJJA 4FUTA 2PUAA 1JHMA 2HMSA 4OHYA 3DBIA 1J42A 1JDUA 2Y93A 3OWXA 3AR2A 4NENB 3JAKA 3QXXA 5I7AA 2WF8A 4P0PB 4PFKA 4OHFA 3B6MA 3ICOA 4RKYA 2GK6A 3G5UA 3RCBA 1CUYA 3BMCA 3U3ZA 1LBEA 3KYBA 1TEXA 1QS0B 3V8QA 3AJEA 1OLUB 4O4LB 4H1WA 5GADl 1LWNA 2YFKA 2BCGY 2IXEA 3FDXA 4G1EB 4PV7A 4IGFA 5ENDA 5KTOA 1JQLB 5I51A 3C2QA 3HXOA 1GITA 2BGIA 2AOWA 2I4NA 3FM9A 4FLFA 1M54A 3N3BC 1X2BA 4JLBA 3AGQA 4GSYA 2F9LA 5FULA 1ZW1A 1T2FA 2HU7A 4W1SA 2KSQA 1H5QA 4ZCRA 4KB5A 1P62B 3UG7A 3U0BA 3QE0A 5ECDA 1U7ZA 1E0JA 1EFPB 4BBJA 2JAOA 2QR2A 3D8TA 4BP9A 4ZGWA 1DCFA 3V8VA 2X14A 2QGZA 1P60A 1H6BA 4O2BB 4XR9A 3ER6A 4EMTA 4QT0A 1IXRC 1EHCA 3EXEA 1M2HA 3IA2A 4EPWA 4FOPA 2HOQA 1Z5OA 1V6SA 2W6JD 5JCOC 5JLJA 5DHTA 1S8FA 5LXTB 4OXNA 1QOQB 3G68A 4M8IA 4X65B 3TW6A 4A0FA 1UF9A 3G0HA 2FSFA 2XMBA 2OBFA 2J5BA 3K9GA 5CYPA 2C03A 4EG5A 3P2JA 1G18A 4RFSB 2BTEA 4P4TA 3WLMA 2BAGA 2BBSA 2PQMA 3PXGA 1FP7A 3TGLA 3B7GA 5H82A 3AB7A 4FCTA 2OCPA 4R3WA 2DR0A 3MINA 221PA 2AJCA 4HQNA 4YIKA 3NHFA 4DUGD 1L1RA 3K9LA 4YT5A 1U3TA 4KDFA 2PANA 3H5TA 3PITA 4HUJA 3UAXA 1AMOA 3HM2A 4V1CB 2OCIA 1ODFA 4G23A 2WA2A 4PZPA 4M1EA 1R5BA 1I13A 1S2MA 2XOKD 3IERA 3DC2A 2OILA 4NMXB 4K9DA 2PYZA 4Y2QA 4FB4A 2RH9B 3G23A 4G2TA 5BVHA 3WIDA 1THTA 4G86A 1AS0A 4OREX 1QZTA 5IF3A 4TKVB 5BSWA 4INOA 3ZD6A 1J2UA 1ULHA 4C7MA 1FZTA 3U4QA 2VHCA 4OLHA 5A9RA 3HA2A 1G98A 2WLTA 3IRVA 3NT4A 3HKDA 1ZPDA 1C8LA 4LHYA 4OHBA 3F73A 4AQDA 1G64A 5J9FA 1J2JA 1EUCA 2GEBA 4QODA 5JFGA 5HXAA 2YWDA 3TAUA 3VNQA 1NG9A 4G0MA 5TF0A 1NDUA 3IP3A 3F97A 5T3UA 3U17A 4YRAA 4C0LA 4HTAA 5BSUA 3HU2A 4DV0B 3N6VA 3TQQA 1I94B 3SQDA 4KUGA 4YMLA 1Z2CA 2AEFA 1QVVA 3IE0A 4BMDA 2WHRA 4C1BA 2V8BA 2YV5A 3ORFA 4HJXA 3WMXA 5IUJC 4PC3A 5AQ1A 4O1IA 2B4AA 2H2AA 1XTSA 2OFPA 1U28A 1VJ1A 2QGNA 4BEVA 2D1TA 3FMOB 5F1YA 5AUNB 1UXKA 1XCGB 2M6RA 5HJ5A 2BISA 1RZRD 1TIKA 3K2BA 1L6RA 2PRZA 2VUSA 1R3DA 3HDHA 1DZ3A 1UMCB 3JQ8B 3KR1A 4IXNA 1DU4A 1GFSA 2Y1EA 2EJUA 1H6CA 4OHKA 1J1IA 1WDKA 3UFXB 1U94A 1GA4A 3KOXA 3TZEA 3ZD9A 1DCTA 1Z0AA 4NE9A 2Z83A 1JF8A 4B33A 2BEWA 3AFMA 3VHLB 2JFOA 5IKPA 3DO5A 3WYDA 2XNDD 3OU2A 3P2KA 4D6XA 4TRNA 1PS0A 4JX9A 3AJ9A 3B89A 2GKOA 1ISHA 1JHVA 1NF8A 4H7EA 3PF8A 1RXCA 2O5EA 1PFGA 4DMFA 4M8NE 4X7PA 5CJ2A 5CTAA 1YBVA 2VAMA 3TKAA 1WSDA 4JWTA 4PHFA 3AUJB 2CZCA 3QFSA 4G8DA 4WEQA 5B2EA 3QBVA 4N76A 1RLMA 2H54A 3CRW1 4JEUA 1IQPA 4C0SA 2JGDA 4HZIA 1ZHHA 5K8CA 3I1IA 2DKNA 3FB4A 1ZH6A 3VTKA 621PA 1YULA 1K8RA 3THXB 1CYEA 5EXSA 4L2IB 2G0AA 2ZK7A 3A8TA 4XFKA 2ZBQA 3R7NA 2NO9A 3L9XA 4ZAFA 4HAOA 1IHDA 2FPGA 2Q2QA 4HDNB 4HQKA 5DBEX 3AYZB 2YHSA 2V0NA 3EIWA 3QMWA 5E4JA 2ZUWA 4LFAB 4TPKA 3F4KA 3UFBA 3ZV3A 2PWBA 3HU5A 4TRRA 2JKYA 4ZRMA 2H4ZA 3LDUA 4KN6A 3EG5A 3YASA 2GYUA 2ZT8A 2XGOA 1FQJA 3EMVA 2HK9A 2OHJA 1YXMA 4MS4A 4KIJA 4MKZA 1MAHA 4GLJA 5E4TA 4YRPA 3QJGA 1DC4A 1HLFA 2GTIA 1USGA 1LI5A 2G63A 1A4UA 5JQGF 3SLRA 1J5EB 1XN4A 5KIAA 1TTPB 3AKDA 3G2NA 3NPMA 5CDTA 1GQ2A 2HSJA 3GELA 3CH6A 4EGCB 1M5TA 4UHCA 1L7XA 3L1VA 1T4GA 2RC5A 1RVDA 4RDIA 2RJNA 1P61B 4X1IB 2VDVE 3NRCA 3RRBA 3TDKA 1EBBA 4A1OA 4YRKA 3R7FA 3NTRA 1T10A 2Z2IA 4DSNA 3L8DA 4EQ6B 3I2GA 5LWQA 3G79A 4F6LA 2PZAA 1UDAA 2X6RA 4PNHA 3T34A 2O2SA 2QS9A 1YMQA 2PS3A 3PYLA 4LXUA 2Y1KA 1XZGA 1GZHB 4XJVA 4QIHA 1Q12A 2A5DA 4LSGA 1VSQA 3RADC 1PW5A 2YBDA 5CFLA 2ZCVA 1AZWA 4JS0A 5ENVA 5IF9A 3LZ6A 1PSDA 5C5IA 3IL2A 3I2JA 1QYIA 1P1JA 1UFQA 5J2UA 3W34A 1NIPA 3CRVA 4BQFA 3ROMA 5EAIA 1L3BA 3NTOA 4IIJB 4TTTS 4TYMA 1AE1A 1KSHA 1L4UA 2BH9A 3JV7A 4UZSA 3RIYA 1NVFA 2X6QA 4X1YB 4CCAA 5LDDC 4X6LA 5F9HA 1NVAA 3NJ8A 5K51A 2FPOA 2ZETA 5IYZA 1UT5A 1IZ8A 4ZODA 4QEDA 4OYHA 2QNRA 3DL0A 3LL7A 3T1NA 1NR1A 4OMUA 4CG3A 4MLDA 1TEZA 5KTTA 3MJSA 4NBNA 3QHAA 4ZCSA 4GNRA 1BRMA 1YR8A 1BA2A 2CNLA 3E53A 4UBIA 3SFVA 2UU9B 3PX2A 2R25B 3V9AA 2YR0A 5KOHA 2BYTA 2ONYA 1KDOA 3EEYA 1H3FA 3C3EA 4GWKA 2PZMA 4RCYA 1TM7E 1SOUA 2O1EA 2W5UA 1RI1A 2W6ID 3I2FA 1LV7A 3W2GA 1X1BA 5DT2A 2DRIA 5EKTA 5JBIA 2QRLA 1IEXA 1ZM3A 2PKCA 2WSSD 2YMQA 5IABA 4MI9A 2AG8A 3KKNA 2NT4A 2OPHA 1W581 1ZRSA 4X60A 2Q9UA 5KSWB 4W8GA 1AQJA 4TMKA 1TUGA 3M0EA 3W9UA 2O8BA 1G2OA 1G1AA 4U2CA 5EPOA 5DYNA 2Q4OA 4RY9A 1C9JA 1ZD9A 1G5RA 1MHPA 1HE5A 2O0KA 2OMEA 1POXA 3BCRA 1EFTA 3OKCA 2JBAA 2Q6KA 3VR3A 5CDGA 2YS7A 3DTNA 2V5UA 4NYMR 3RSGA 1NN1A 5CFRA 3HO1A 4MLPA 1UKYA 2C54A 4FYVA 1ZOPA 2RHTA 4CM6A 1Z75A 1RC1A 1RI5A 4G07A 1NOIA 2GPJA 1I7PA 4CR6A 2PKRA 5CFPA 3OQIB 1ZAYA 3S7ZA 4R01A 3JPWA 3E2IA 4C5BA 1HA3A 1R7RA 1EK5A 2IXFA 1M72A 1VL2A 2XQKA 1DRJA 3A2LA 3A6DA 4N6NA 4EJSB 4ZHQB 1VL6A 5AHOA 4AZ3A 2ABWA 121PA 1FVHA 2MJLA 1SU7A 2VDOB 4TV9A 5FPKA 2Y4OA 1SQGA 3HNPA 3RT7A 1U28C 3A58B 4QAQA 4AF7A 5IKMA 3UK1A 2BUAA 3OOSA 5JAIA 3WRYA 2VK8A 2BBWA 2IOFA 3O4JA 3KYDB 4LHWA 1V4VA 4LJKA 4FEAA 3TSCA 3R0XA 3CUUA 3QPCA 1IBKB 5I9MA 3TF5A 5FA8A 3CUKA 3DT6A 3MJEA 2O3SA 2EDAA 1JGTA 4QOSA 3SEZA 3U16A 4OQPA 4YHHB 2IP1A 3O8OA 3O26A 4BEBA 2NZ8A 3K7EA 5B1DA 3TBKA 2J87A 3IOCA 3I2YX 2NUTA 4E5MA 1AN0A 1J0EA 2YWGA 4HQ0A 1K5DA 5K0FA 3NBXX 5JZ9A 1X3LA 4QNRA 1G8HA 5TS2A 3TLXA 1Y48E 4CQJA 1P74A 1G4AE 1JYSA 5F7OA 5I4CA 1D5CA 3PHLA 2E55A 2W6QA 2I8CA 2J45A 4YJGA 5DX8A 1X1EA 3GA7A 2P9EA 3VFDA 1M73E 2G1JA 1VL8A 2DR3A 3QQPA 4DQVA 1VKZA 1Z62A 1IDN1 3QEKA 1L4FA 1Q0HA 1HFWA 1Z0FA 4IUYA 1AT1A 4RXMA 4DRXB 2XTJA 2YMMA 4R7ZA 5TC4A 3RUPA 1WMDA 3KD3A 1EXVA 3F90A 2Y1GA 4BBAA 4B85A 2IFTA 3O47A 4WKGA 4J3JA 5IDVA 1P81A 3L8ZA 4RKRA 5A7GA 4WKCA 1HURA 3KE8A 1YBFA 4QDJA 2WWHA 4EPXA 3H16A 1K98A 5LQRA 1JG6A 4QQFA 4RANA 2FH5B 3VR1A 1LSOA 3IAAA 4JC4A 1YKGA 4RIIA 4I4TA 4KR9A 3I1FA 4DMHA 3DZDA 4CL2A 2ECOA 1ORWA 5F3WB 3OM9A 3OIVA 1SVSA 3HXLA 2DPGA 4NFSA 2P11A 1K7FB 3BE4A 5ICGA 3VZPA 4XVQA 5D7NA 2ZSJA 3ZDQA 4NCXA 1EX6A 4BVBA 1SCUA 1XQ6A 1A8IA 2AJ8A 2NP7A 3D3KA 2JFYA 2C4TA 2B7LA 3IUBA 3LF2A 5IMBA 5A03A 1XLTA 3SQXA 4E22A 3V48A 1Z35A 1QQBA 4BX8A 1RDFA 1NVVR 2EG9A 2F3UA 3QVVA 4Q4AA 4RLSA 1KO1A 4UM7A 1UBLS 2BFEB 2CMFA 3ZEAA 1EIWA 3HABA 4R2LA 2IIVA 3N59A 3GGCA 4LHXA 3QGMA 1O58A 1Z12A 4MS1B 5LP6A 4XEUA 2QVCA 3LZCA 2R6R1 3HZHA 3CRZA 2A1UB 3SYMA 3QUAA 4MQMA 1AS2A 3DWIA 2J3LA 1P0IA 4Q5IA 5F1PA 4A0RA 5ICEA 4IXTA 1EWYA 1FOEB 4TTVA 3TRFA 3EGOA 4FX5A 5E7IA 4KVGA 5K3DA 4EECA 3NDPA 3NHBA 4G9BA 4QNNA 5IT9A 5GTDA 1T0JB 1EFHA 4OA8A 4MW1A 4GG1A 1RWOA 1TMOA 3DMGA 5H68A 4FPXA 4RWZA 1KOLA 4ZRDA 1YJ8A 3T4XA 2I1WA 1N2BA 4H27A 4QUHA 2R96A 4OJKA 3SR4A 2OLKA 3I04M 4FYJA 2Q1YA 5C1OA 1U3UA 1T3ZA 1C9DB 3IBTA 1EEHA 1QV6A 3GJ4A 3K73O 4LEIA 2JI4A 4MWOA 5DYWA 1HX7A 1Q17A 1R8QA 5LJLA 3P9ZA 1MVLA 3WDSA 4OK5A 4D8VA 4Q7JB 3F46A 2N1BA 2FMFA 3B3FA 3F6YA 4M9CA 2D1SA 2OFOA 1KC1A 4Z8YA 4LOLA 4MJ3A 4BTLA 3L07A 2FETA 3Q2IA 3X2FA 1TEHA 3TCNA 3IPLA 5K3CA 4A4DA 3LY7A 2XBMA 1AF4A 1MB3A 3CSDA 4TUYF 1YO6A 3JQ9A 3S2ZA 1DAGA 2AHOA 1IUNA 3ELYA 3UKJA 3K0SA 1H42A 4KLNA 4QBFA 3N53A 2X8LA 1QIDA 3BH0A 3WKDA 4EZIA 4H1HA 1RI2A 3WMFA 2P2CA 4MH0R 2C4NA 1I7QB 4N8DA 2W2TA 2BF7A 5FA6A 4DJJA 3KVYA 2FZEA 4P4GA 5HZGA 4HAWA 2EKDA 5E3HA 4UXHA 1QQ5A 4K3UA 4BKPA 2RG7A 4LYAA 2F48A 5AI0A 5AM1A 2DY1A 1KI9A 3CLVA 5KJCA 1OHHA 4IPTA 4UTZA 3SX0A 4AZVA 3DFMA 3STUA 2VRCA 3AVUA 3OIWA 2A1IA 4B32A 2VI5A 3V5NA 3PEWA 1CUHA 2QSJA 2NZYA 2P9CA 3NU1A 2W6OA 3QBDA 1FXWF 3ETGA 4WBSA 2XQGA 2PBLA 4C08A 4GSKA 5A3VA 4D99A 2HK7A 5AOCA 2R8OA 3ZI0A 4GE0A 2GN1A 3KXIA 5KJFA 5AKXA 1I01A 4IY1A 3K8QA 2QDXA 4FOOA 3GO4A 5A3SA 3C6ZA 1X1SA 3BAZA 5DSZA 3DAPA 3EFOB 2WK1A 3DDNA 1KQNA 4NNJA 3ZXSA 2XRZA 5HDBB 4UULA 4BLUA 2J31A 2C7QA 4OFWA 1WD7A 2NV0A 3HA7A 1P72A 2JLCA 4QDZA 3WI7A 2TSYB 2VAVA 3T95A 3DM9B 3K9HA 3LUCA 4QAJA 4JYAB 1GLGA 2BMAA 4L07A 3ZGOA 1OFIA 3MWKA 4WK4B 2WR8A 1G5FA 1TYZA 4U1RA 4RDHA 4WBXC 1N5OX 3JARB 4MV3A 4ER3A 4N48A 4OGWA 4DREA 1KSFX 3HFRA 1K89A 1GRCA 3L0CA 4PAWA 3E7PA 2OVBA 4KO3S 1KFBB 3H3JA 1LS6A 1SUAA 1XZMA 5SY4A 1RE0A 2XAUA 3N5KA 3O8CA 2G8LA 2IYAA 3DZBA 2IHYA 3A70A 2X3FA 3H5AA 2MSWA 3QFHA 3T15A 4EPVA 3OJFA 3W3AA 2IQIA 3QSGA 4V0LA 4HAYA 4NPAA 3EIUA 5EWLA 5BSKA 4JCCA 3AWDA 4JQZA 4UFNA 2XUOA 2VYND 1WULS 4MPDA 4IILA 3ANYB 1VJDA 2OGUA 5HW0A 2DUUA 1LLUA 4I1VA 5FO0A 4BPRA 5BOVA 1VKJA 2GA9A 3OSZA 1S9DA 2BFMA 2OV8A 1DZIA 2QI9F 3FWKA 2ZBFA 4M87A 4C01A 5ADHA 5JD6A 5JW6A 4KQMA 2VPWA 3D6UA 4B8ZA 4JU9A 2ZAIA 3RK0A 2VCYA 3KX2A 1JHXA 4KE8A 5FOUA 3KQHA 2C8VA 1R8SA 3QE3A 3UUGA 3IJRA 1U9ZA 3W06A 4U2DA 1L5GB 2GM4A 4Q4LA 2ZJ8A 3WKBA 2G17A 2G3YA 3EEOA 2YHUA 1Q5PA 2GILA 3CS3A 2LTAA 1PX2A 2QX8A 4OJYA 2Q0QA 2V45A 4N5LA 4W1RA 2XCQA 4KPUA 1NUHA 3U56A 4QPNA 2H59A 2RGUA 2O8EB 1DX4A 1RPJA 4CDRA 2HWXA 2JRCA 1U9YA 2PGDA 3KB6A 1BN6A 1OBOA 1YVPA 4CI9A 3I4FA 5FEMA 2WJPA 3LOUA 3Q3JB 2XWQA 1Y4ZA 4B6QA 5EC8A 4B3GA 1C8KA 1NW3A 3FPFA 5GV8A 4MSUA 1YHNA 1C1XA 1XOIA 2FVXA 1XLTC 3OPVA 4XJTA 3TMKA 4OVKA 1EP3B 4AJJA 1EG2A 1OBFO 1DX9A 1W59A 1KI4A 4BNDA 4XVRA 3ABSB 4WXMA 5JT1A 1ZSNA 1DWPA 2QG4A 1ZGHA 5J5CA 2RMKA 2A5YB 2O6LA 4HVAA 3GN1A 3QVWA 5JDCA 5LP6C 3H65A 3U26A 4KRFA 5FRDA 1EDZA 1XD9A 2JGNA 3JZAA 3AL2A 2YQ5A 5KVVA 2YTZA 4RPJA 2K87A 1CS0B 1PWZA 1B2LA 4L4YA 5FBRB 3BK2A 4KJXA 4UQLA 3IOEA 3O1IC 1QRTA 5K01A 4XRRA 1H0RA 3G7SA 5PNTA 4F3CA 4DV1B 4M1WA 4ZI2A 1G5TA 1TM4E 1E3QA 4JBLA 3ZCTA 3H1TA 3D2BA 1XMVA 4PTLA 3GFOA 4I55B 1NFRA 1V3VA 1LLQA 3OLYA 5SZJA 4U6NA 1AN9A 3SOPA 5BN3A 5AI9A 4FYPA 2A0UA 4Q3NA 3BMNB 3MGAA 5A6SA 2OV1A 1J8FA 3T5BA 1KKMA 3AUTA 3E9YA 3O83A 1YB7A 1AGXA 2EGHA 1JEJA 4CMJA 3X3HA 2ZSIA 4HCJA 4IJWA 4NFYA 3SIPA 5EP2A 1T36B 4F86A 4OA5A 2HLDD 1A8UA 3LDGA 4MEAA 3B1VA 1Q95A 3HU1A 3IHWA 4NR0A 2B1RA 1B0AA 1Y9DA 3OPYA 4GR5A 4BB6A 3X0DA 2V5AA 4U8HA 1R8YA 4BO5A 1L8XA 2FWNA 4IWYA 4R69A 2O5CA 3GP3A 2VP3A 4GMXA 4JJFA 2B92A 1TA0A 2KS6A 2I6QA 4AJNA 1ZOIA 3E5MA 3CZ5A 2B1GA 3ABIA 2I1QA 4GI5A 2I4MA 2Y9PB 3IQXA 1UDXA 3UA4A 3IKMB 5FF9A 2RCNA 2F17A 3NEPX 3WKCA 3NVKI 2QXUA 4C88A 1IXYA 3BT7A 3UA3A 1TVKB 2RHGB 1QPZA 1A4XA 1SHUX 3JQ9C 3SXUA 5HEKA 4QVIA 1D2EA 4GLOA 4MVJM 4MUIA 3SDSA 2PZBA 3RHFA 1PG5A 1EGMB 4G4GA 5K8TA 1WF3A 3WA7A 4X6XA 3H9UA 4RTKA 2WJYA 2QDKA 2TS1A 1BA3A 4R2HA 3PXXA 4JA2A 5C5CA 1W88A 1PS8A 2PBRA 4ESHA 4MDFA 2SBTA 3SDBA 1X9IA 3LM8A 3VR4D 3IB3A 4I2NA 4YFVA 2XRMA 4IJ6A 3NOVA 1KI6B 1R5JA 1Z06A 2DG2A 1CCWA 1GN9A 1YRWA 3S2EA 4B7CA 5I9LA 3EVAA 5IRCD 2C29D 2I1VB 1XX6A 4N0QA 2J6BA 2XB4A 3C98A 3U3KA 2I65A 2GXUA 2JLBA 2PV0A 3AH8A 3UANA 1CVIA 1OAAA 2HDNB 4BFVA 1LXCA 4B7AA 2QN9A 4G97A 1XR3A 2FVYA 1U81A 3KTAA 3UMBA 5LPNA 2O2CA 4AWBA 4YGYA 4ZIRA 1HL3A 2F8MA 1SVKA 1FYEA 1J8YF 1TTQB 4RZUA 4WFQA 4QJ5A 4MRMA 2OB2A 4TTRA 5ECYA 2IHNA 1TXGA 4JN6B 3RE1A 3CX7A 3U80A 1UINA 5AW7A 3KZMA 2ZBRA 3IP5A 2B8JA 3H9GA 3THOA 3ECCA 1ENZA 3LX6A 1GGMA 2CLMB 1D2RA 3TOVA 3C1AA 3R3XA 1Q0QA 4F11A 3KSUA 4JQSA 4R2MA 4PYLA 2H2HA 2FRDA 1YQGA 2OZVA 2VCHA 1W5AA 4RKQA 2DKFA 2IS2A 1I3CA 1Q7TA 2QP4A 4JB2A 1HE3A 3PPIA 1PJLA 1M1NA 3AZQA 1PEYA 4BNTA 1E9CA 2I5PO 2IE8A 2J3IA 2X8JB 3FVTA 2OA0A 2XCIA 3LP8A 5JAMA 5A4AA 1XMXA 1I9CA 1VCHA 2VJKA 1SUBA 1T3GA 3TZ6A 4D6YA 1BHSA 1Z0UA 4WPGA 2PSHA 1DEHA 1VCNA 1EJ2A 4NONA 2LR0A 3CVOA 1WO8A 4HL6A 4WZ6A 4LYFA 4NYMQ 1SC4A 3I72A 5K3AA 1TM5E 4DLSA 3LI2A 4MMZB 2A5LA 1RTTA 3KFLA 4LHZA 4ZO6A 2YV1A 2BBOA 4R0MA 4OUDB 1BEUB 3ZGNA 4X85A 2QZ9A 2Q3JA 1NONA 5HUJA 3D8UA 1XBTA 4R2XA 2G71A 5LMUB 3GLVA 1PJ8A 1WKVA 2W2NA 4MEBA 1QX3A 4GFDA 1UPFA 4U02A 2BMWA 4B6GA 2QAGB 1UXIA 2P62A 4N5NA 5FHRA 4P3OA 3EQ8A 4PYRA 5GZ1A 1AKRA 4INZA 2XI4A 4UTOA 3IMGA 1G21E 4JUCA 1MN6A 2HY7A 4MWZA 4PCUA 1IBMB 3RK1A 1K6IA 3ZK8A 5INTA 5K4AA 1J4AA 2EATA 3MS2A 3KIPA 4MYRA 4Q9NA 4X71A 4M0KA 2OGTA 1B3RA 3ORHA 3EGXB 4HB4A 4Q3OA 4XOUA 4BO2A 4JSYA 3SBEA 1XMJA 3CZMA 5D1NA 2SCUB 4UQOA 5EPUA 4E3ZA 1CIVA 3MVEA 1WXGA 5F5NA 1BDBA 1VI2A 4DAOA 1DLIA 3SSAA 3KAKA 1XQ1A 3ORSA 3R0ZA 4JITA 4GW3A 5BOSB 5MN6A 4DDVA 4XGIA 3CCCA 5TB5A 3DVAA 1EM6A 4LJYA 3E22B 5DLQC 3C6MA 4DIUA 3B2NA 1RBQA 4HPXB 3AEKA 1VGVA 3C6YA 5JZVA 5JDCC 4GP6A 5ALSA 1JJAA 3RC8A 4UTNA 4BLTA 3VDMA 3U6BA 3FF1A 1H9BA 2X15A 4G8BA 3KFVA 3ZC3A 2QUIA 2W6CX 4MVXA 1BZYA 4HFNA 1QOPB 1Z8DA 3QX9A 4I66A 4RBNA 2D1FA 3B9BA 4LFCB 4GMDA 4RKEA 2Q8PA 3GRVA 4U7HA 4Q9HA 3RK4A 3W8FA 1TJ5A 4RZ2A 1DAPA 3GFBA 3I5AA 5BV1A 2VT3A 1F38A 2PMWB 2OLEA 4U3JB 1ZQ9A 5U4QA 4WH0A 3CBQA 2X2PA 3OJLA 5CU7A 3BTUA 1I5EA 4RF5A 3GLGE 1CQIA 1U3DA 1D2CA 1KTVA 1RAHA 3C85A 3QFRA 5DXAA 2ZTVA 4KXXA 4ZI7A 3ZYCA 4B74A 3VKWA 1Y8CA 4RK4A 1MHTA 2HT1A 2E3JA 2GOYA 4H9GA 4ASUD 4CQLB 2PBZA 4EF5A 4H6WA 4H6VA 3QVUA 2ISCA 3FNQA 3E4DA 4OXXA 1NXXA 2OORA 1U8EA 2W6NA 5A7HA 5CVCA 3UXEA 1AQYA 2FE4A 1G8YA 3GLIA 4RF4A 4D97A 1F2TB 4KQ1A 5G02A 5EZQA 3IFSA 4EABA 1F20A 3DZKA 2WV7A 2EOAA 4E1VA 1C9EA 2R3SA 4F4CA 2O0JA 2GPWA 4FT4A 4CMBA 3T0IA 4WRRA 1SVUA 1NVVQ 5IBQA 1WB6A 1E5VA 1YOVA 1EX7A 1YRAA 2WAYA 3OTWA 1Q0SA 4NG5A 3ZHVA 5E0KB 1W29A 5EPEA 3RU7A 2KYRA 4YLEA 2FAXA 5BURA 2C4HA 8ATCA 4FFPA 1BQ3A 4N5IX 5AW3A 1CR4A 1J1ZA 5F7ZA 3VBCA 3QX3A 1U7XA 2VJMA 3CZCA 3GFFA 3HJNA 3K0KA 4EQZA 3S70A 3CVXA 4G5RA 1QRSA 3DZHA 1LDYA 1T43A 3SBDA 3K0FA 4AP5A 2JW5A 2I66A 1NE2A 1YMUA 3D7NA 2NUBA 1ILWA 4QGHA 1UJ5A 3Q7PA 1RVV1 2D0PB 3FCAA 3SZRA 5G4KA 1SOWA 2XMZA 4TRMA 3QMMA 3UJCA 3CNEA 1GSIA 4ROSA 3EY9A 4ND5A 4X7RA 1NW8A 1XZ8A 2GRUA 1YI1A 1C0EA 1I1HA 1SXHA 1SXJB 4FVTA 4DBZA 1E2DA 1UEJA 2DKOA 1JIVA 4UNSA 1JECA 2IDKA 2IHJA 4IMIB 1GTZA 1YJ5A 3EZ2A 1X80B 2IHUA 3RAPR 3T1TA 3CJQA 2JHFA 4Y2SA 3SC3A 5JJ5A 1T1RA 3CTMA 3M6AA 4G0XA 3N8HA 2KB0A 4UUNA 5KYUA 1VPDA 6PFKA 3CNLA 4TXMA 1BDMA 1QE5A 4WA7A 1N0IA 2J6HA 2UXBB 1A9TA 1XCLA 2K2WA 3DW3X 1KA9H 3RBVA 1GU0A 2REXB 3AHIA 3FNIA 3CLRD 4DLZA 2GEVA 1IATA 2C88A 2A67A 2C2KA 2O2YA 4LWQA 4R51A 3LYLA 4WLUA 5FYDA 3WLTA 2WJ6A 1AKWA 2VRNA 3D31A 5TQ2B 1OC4A 3PHHA 1Z2OX 3L7BA 3UYKA 3TDMA 1OILA 4ZT5A 4HKTA 3ZUGA 3A32A 3T3DA 1V1JA 3ZIAD 721PA 1K86A 3NTLA 3FCOA 3IC5A 3ZCUA 4PLFA 1GQFA 2B61A 2FRDC 2P90A 3B13B 4P84A 2EKZA 1KPGA 2J48A 3BGDA 3KAJA 4TSFD 1ZYUA 1NBMD 3L82B 3S44A 4BWFB 2IF2A 3AUSA 5AKGA 1Y1LA 2O3JA 1T2AA 1WW2A 2XNHA 4EGQA 1ULAA 2Q8QA 3VPAA 3ZGZA 4QYWA 2FW1A 3TCKA 2EJCA 1IZZA 4GYYA 4AP6A 3OFNA 2IYEA 3PQ2A 3WNDA 2FW6A 4H6XA 4Y6QA 3NKFA 2GMWA 3W9SA 3DL7A 3MM4A 3ANNA 1YL6A 3CONA 3GYBA 1GCAA 4MB0A 4F7DA 4TL6A 5EIBC 3HWX1 1UFOA 2CMKA 1XPOA 4YCCA 3U5TA 3AESA 3G1UA 2OBLA 3HCOA 5E1MA 2NTYC 4B84A 2VTVA 1U0JA 4KLCA 4K28A 2FY8A 4O3FA 1R0ZA 1FDUA 1R4MB 2VSQA 3O91A 3OPNA 2IV3A 3TL6A 2GA8A 3DOFA 4I99A 3JVVA 5A05A 2H2FA 5EERA 1T6ZA 1Z5GA 1O96A 3IR6A 3PC4A 1EB9A 4NULA 1E7WA 1NW4A 3B1ZA 4CEHA 2XTNA 3LT2A 3PQCA 5CX1A 5FBVB 4NP6A 3LQ1A 5KWEA 3QW4B 1N7GA 1NBOA 2E0IA 1L5RA 2QGFA 4O2AB 1QDEA 2DSTA 3WMEA 2B2XA 2JFBA 3ANXA 1CF9A 2M32A 3KEFA 4GBJA 2O59A 3UHJA 1D07A 1XVIA 4PPGA 1EFCA 3EW7A 4ER5A 2ES4A 1J23A 1GWNA 1W94A 1MB0A 3WYCA 1U5BB 1OFHA 4F06A 3SIRA 1W4ZA 1QKIA 1KK2A 3PI6A 1YT5A 3NHRA 2OHVA 3QA3E 3QKSA 3LBNA 3KZOA 4RVOA 5NULA 2HA3A 4H1VA 1DEXA 1M8GA 4GPTA 2H65A 4M98A 4EM6A 3MJ4A 4UEWA 4MWBA 5DW3A 4DIOA 3Q8KA 5DU2A 2WE7A 3G9XA 3HSKA 3EVDA 5FYQA 2PX4A 3D5EA 1ORIA 3R09A 2EHDA 2H5JA 3ZV4A 3SSMA 1FSSA 4OOEA 3AOGA 2A6PA 4DXHA 3HUEA 3UJ3X 4FNOA 2OFFA 2DBYA 3ROXA 4B3JA 1G3MA 2I91A 2ZYHA 1JQ5A 2ZJ0A 4HHEA 1U7OA 2XYHA 3WGLA 5KCMA 2CDNA 3B2EA 5DXJA 1UFRA 4DM7A 5A1JA 4WMLA 1EP1B 5G1PA 2Q7DA 1TMKA 3P26A 3Q9NA 1P2UA 2XTAA 2Z09A 4JOQA 4OB8A 4JI6B 5IC5A 2JIRA 4GL4A 5D3MA 3OTQA 4KGZA 2V7EA 3SJ7A 1JPUA 4DANA 5BW6B 4M4SA 4OK3A 5FPSA 2P6UA 4DHWA 1AHPA 2H4HA 4F71A 1FRQA 1KIAA 5KKNB 1BMFD 1SHKA 4AJKA 5C81A 5JHHB 3TRIA 3FKQA 16PKA 2FXIA 2VDJA 3H5IA 4CEIA 3GCDA 1V11B 3B36A 1YBHA 1LNZA 4CKZA 4OYYA 2CKMA 2HWWA 3OE7D 2H6EA 5HJEA 1EE2A 1UOPA 1UKZA 2QF7A 3EC7A 3TTYA 4GHWA 3MTIA 4HDKB 4NVRA 5JS7A 1Z39A 1GPBA 1VPTA 3GQBA 3AR3A 5AXAA 4OO3A 1OPRA 2I80A 1X0XA 4DLRA 3PR3A 5CK4A 3FHOA 1VCIA 2G76A 1OX6A 4RF3A 1QR6A 4NH0A 3UMGA 4TV8F 1HMPA 1PJ2A 1U3WA 3X1XA 3SDZA 5LA6B 1O95D 1JVNA 4MRAA 1CZNA 1GPH1 4IKOA 1HYEA 3WYGA 4WUTA 1IQUA 1EA7A 4RZQA 4W7IA 3WIVA 2PD3A 1QNFA 2J4CA 2QR5A