4GDMA

Crystal structure of e.coli menh
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
253
structure length
253
Chain Sequence
b'SMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 253
sequence length 253
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gdmA00
3LP5A 4FLFA 2HL6A 3STYA 5K3BA 1EXWA 1XZDA 1GKKA 1TKRA 4KYVA 1LPSA 5AP9A 3HI4A 2WUEA 2C5GA 3STXA 4DYHA 5EGNA 4PV7A 3KD2A 3TJMA 3WIOA 3GBSA 2G63A 5LYYA 4Y2PA 3D5EA 5CT8A 1BROA 2HA2A 5YASA 1R3DA 1W6RA 5KWIA 1FFEA 5J3JA 3KDAA 4ZWNA 2YXPX 3AIKA 1E66A 1UK6A 3BF7A 1VLQA 4BVJA 3VVLA 3A6ZA 1ODTC 4J0JA 3DS8A 4C89A 4FNGA 4FBMA 3SWWA 5ALQA 2QOEA 5ALLA 3H18A 4OSEA 3HC7A 1H2YA 2YH2A 3LIIA 5DNVA 3RK4A 4DMFA 1VXRA 4UBKA 5I8PA 2JGFA 4F5ZA 3AZQA 3H2JA 4B81A 1WB4A 3V1KA 5AI9A 4BATA 1KU0A 2VJAA 1DQZA 5AKXA 2DSNA 2K2QB 1X2BA 2G4LA 3X3HA 3TEJA 4PSCA 4H7JA 1VJ5A 1XZKA 1RWQA 4B85A 5ALYA 5EI5A 4U2DA 5ALFA 1LBSA 2ZYRA 3L1HA 4I3FA 1XKTA 5C7YA 2DQZA 4BAZA 3E3AA 1XZJA 1P0PA 5HFAA 2AJCA 3STUA 4DLNA 3OC0A 1D07A 3LIPA 3WK4A 5ISMA 5F4ZA 5ALRA 2XMGA 4G8BA 4ARAA 4K2AA 1ORVA 3TGLA 3C6ZA 4L9AA 1TIBA 5FDFA 5JARA 4INZA 4UHBA 1S8OA 3STTA 3BF8A 2DQYA 1LPOA 2HA0A 5JIBA 5LLSA 3ZLTA 1LPPA 3DOIA 1WHTA 3IDAA 1GT6A 3KSRA 1B6GA 1JJFA 2HIHA 4U2GA 1C7JA 4IH1A 2WU4A 4EBBA 3BE8A 4C88A 1LNSA 4K5QA 1YB6A 2PL5A 1XZFA 3A2MA 3ZWQA 3H1BA 4Q34A 1U65A 1YS1X 4B84A 1CUSA 5EIHA 1GXSA 3FLEA 1EI9A 4RPCA 5IVHA 4U2EA 1EVQA 1O6FA 4P93A 5AO9A 4ROTA 4BE9A 2WHRA 1ODCA 2P8SA 2PM8A 4WY8A 4CCYA 1OILA 3A2NA 2WKWA 4BDTA 1JFRA 4WY5A 2EEPA 5AKGA 1QIKA 2O2HA 3F67A 3QVMA 2OXEA 3CXUA 4AZ3A 5ALPA 3I2KA 1Q0ZA 4B0PA 5JD4A 3WZMA 4PF1A 4KR0A 3ZV7A 4XVCA 3R3UA 1JT2A 5AM2A 4MYSA 3EQ7A 4Y7DA 4J0HA 4BC0A 1BCRA 3BL8A 5ALDA 3R3XA 4B7ZA 5E4JA 1ZOIA 5JAUA 4FFVA 4P9NA 1ZD5A 4QDXA 5LZ9A 2XUJA 5HCUA 3H04A 3I2GA 1AC5A 1BEEA 5ALIA 2J4FA 2WG1A 3WL6A 4EUSA 2C5FA 2QJWA 2HA7A 2GZRA 4BDSA 3W06A 2BUCA 2Z8XA 4J0IA 1XRQA 5EHNA 2R8BA 1UKBA 3QH4A 1IZ7A 4OU5A 4E46A 2V98A 5K3FA 1R9NA 1N1MA 1SOMA 2V96A 4Q3OA 2ZJ6A 1CEXA 4AO6A 3QYJA 1P0QA 1CUEA 5ALMA 3IA2A 4CG1A 4WCVA 4WDRA 1CUUA 1ZI6A 3G9XA 3G9ZA 3WQHA 4H7FA 4MWSA 1A8UA 3DYIA 4M0FA 1ACJA 1DX6A 1Q83A 4Q3KA 4X92A 1XLUA 3S8YA 1TQHA 2XT0A 4L0CA 4Y2YA 1G66A 4BCBA 5T4EA 5D3KA 1ACLA 1WB6A 2QM0A 5AKIA 1H22A 3B5EA 4HZGA 4BRSA 3G0GA 2QT9A 4B9EA 5EHZA 4U2CA 1XRPA 1EA5A 5CTAA 1MN6A 4K6KA 2WHPB 4C4ZA 3HYSA 4EY7A 1ZD4A 1IMJA 2H7YA 5K5EA 3HACA 2I78A 5A7HA 1VKHA 1G4HA 3V1LA 5KREA 2JEZA 5AKLA 3O4GA 4AN1A 3BIXA 4NS4A 3O9MA 2HHAA 4NMWA 3I2HA 3STWA 2XMQA 1YS2X 2CMFA 2V97A 2WTNA 1R9MA 1QGED 4RE5A 2C4HA 4UBJA 5AIBA 3DKKA 2EDCA 4GI1A 5C8VA 3O9VA 4W1RA 3VKFA 1ZI9A 2ZYIA 4LXGA 2FJ0A 4QDUA 2QVBA 4BZZA 1K5PA 3L1JA 5D7BA 4Y2QA 2XLCA 4Q3LA 4H18A 1MTZA 2WJ6A 4H7EA 5EIAA 5CXUA 1GKLA 5BWBA 5AI6A 1HPLA 4AX4A 5LIPA 3KOOA 2WIFA 3R3YA 2XI4A 1XZGA 2QUBA 1CUXA 3FVTA 1CVLA 3EBLA 4QDZA 4J7AA 1TCCA 1WM1A 5HK8A 1LLFA 2WU3A 5I9IA 1MAAA 1N5RA 4BRZA 4QWMA 1IVYA 5ALZA 3WK5A 3OM8A 5CH3A 3CCBA 5T4FA 2PVSA 3QZUA 1DU4A 4GLBA 4KACA 4AO8A 3ESCA 1CUJA 5IH7A 1G42A 1OXMA 1CQZA 3EQ9A 2CZQA 1GPLA 2QMQA 2QS9A 4J03A 2PSDA 3Q0TA 1N8SA 4TVKA 4G1FA 2IX9A 4MYDA 5AK3A 4KE7A 2CJPA 2B61A 4GEGA 1CUGA 4MXDA 2XMZA 5KWJA 5AI5A 5E4TA 4FLMA 1YSCA 3F98A 3D2BA 2D5LA 1ZIXA 4Y2XA 3LLCA 2WUDA 1R88A 3I1IA 5JZSA 1QLWA 5HQ3B 4BAGA 1YR2A 4LXHA 2RI6A 3WKEA 1JI3A 3D7RA 5IKXA 4B82A 1X2EA 3PFBA 4QLOA 4FLEA 3GFFA 1AZWA 4G4JA 1AURA 1W4LA 4KAJA 4KRYA 1OCEA 3CCCA 4Q1VA 1ZD2P 3QMVA 5ALOA 1CUYA 2OCLA 3H2GA 2XUIA 2VSQA 3ESBA 3UUEA 1T4MA 1PJAA 5IVIA 4JYPA 1YAHA 2ONCA 4YASA 1R1DA 3FYTA 5A62A 4OUKX 4EB0A 2PSJA 4IO0A 2YYSA 1MX1A 2V9ZA 2H7XA 4M0EA 1ZICA 3VISA 5JANA 3BIWA 5DJ5A 3QITA 2Y2VA 1CRLA 1UZAA 2XB6A 2OAGA 3R0VA 2OPHA 4AMYA 5HK9A 1EDEA 4DIUA 2VEOA 3O4JA 2HDWA 3DJYA 3E0XA 3DL7A 2XMDA 2HFJA 3AUKA 4BYMA 5DLPA 1ZJ4A 1LPNA 4PW0A 4UBIA 4TGLA 4UHFA 5ALWA 4UFNA 1P0MA 3VJLA 4Y2RA 2XQFA 1ISPA 3FYUA 4D9JA 3FWHA 3I1YA 4YPVA 2X76A 1A7UA 4CIAA 3AILA 3I2JA 2XMCA 5CT5A 3AZPA 2WG0A 3MVEA 5AKKA 5LKAA 2UZ0A 4L72A 1UK9A 2XUGA 2BCEA 1XZAA 4ETWA 4G4IA 1MPXA 3PFCA 3WWCA 3B3QA 3G0DA 5H3HA 1LPMA 3GELA 5A2GA 1VXOA 2PU7A 3DL4A 5LZ8A 4FFWA 5AKHA 3FYUC 1TAHA 3B12A 6YASA 1TRHA 1GPNA 3U1TA 5C8ZA 5LZ4A 4DTCA 1EH5A 4FTWA 1X70A 4BB0A 1UXOA 4UHCA 3UUFA 1UT6A 3ZI7A 4HS9A 3FOBA 5T4BA 1YAJA 5EIEA 1EINA 1DINA 2GBFA 4E15A 1ZIYA 4X6YA 2HA3A 4G5XA 4PO3X 1CUIA 2CBGA 2PUJA 4QA9A 3RKSA 1TCAA 3FVRA 3WK7A 2PSFA 1LPBB 2HU5A 1AKNA 2WG2A 5CW2A 5AJHA 4Y2UA 4H7IA 1EVEA 1WOMA 4ZREA 2B9VA 1CUVA 1SCQA 2O7VA 3AIOA 4WFIA 3N0TA 3AJAA 5AOAA 3DOHA 3A70A 3WWPA 3LCRA 3QMMA 1Y37A 3RLIA 3OURA 4UBMA 1C7IA 1UOQA 4DMCA 3DEAA 2O2IA 2ZVDA 4EY8A 2DHEA 4A5SA 1AX9A 1CUHA 4JUIA 1CV2A 4UBLA 1E8MA 4IH9A 3W9BA 4A23A 4JEIA 3VVMA 3K9BA 2J4CA 1O6GA 4PNZA 3D59A 1KU6A 5BOVA 2CUTA 3I2FA 4QEKA 1EDDA 1CIJA 3M81A 5ALXA 4H7HA 1CFJA 4PSUA 4KE8A 4QDOA 1QIHA 2AXEA 4G9EA 4MEAA 3GA7A 2VAXA 1QO7A 5AIAA 5JATA 2C0PA 2OCGA 1WCYA 5D3ZA 3FBWA 3M83A 1YASA 4C01A 2BFNA 2PX6A 2E3JA 2XUOA 5CXXA 2Z8ZA 1WHSA 4Y2TA 4BBZA 4CFSA 1JMYA 3UMJA 4PSDA 3C5WP 5E2IA 2XUHA 3WIBA 4OYYA 3WL5A 3WKCA 5CURA 4IH4A 4DMKA 1XZCA 1Q0RA 2RHTA 5AICA 5FPPA 5EFZA 3V1NA 3IURA 1HKHA 1ORWA 3W2TA 4WFKA 1TK3A 3WLAA 4X6UA 4UHDA 3D2CA 1EK2A 4F21A 3M3DA 4CIBA 1XRRA 5AOCA 4X71A 3DCNA 1QE3A 1CUCA 5ALHA 5LZ7A 3PF8A 2QTBA 3P2MA 3C87A 1DWPA 1WPXA 1VOTA 2XUAA 4FKBA 1IUNA 4MWTA 4ZXFA 3FLAA 1FFCA 3PICA 1QTIA 1QIFA 2DFPA 1QTRA 4GBGA 5FXMA 3RARA 5JAHA 4CCYB 3WK9A 1F0PA 4C4XA 3DKRA 3NWOA 4Q05A 4BTLA 2BAGA 5JYCA 4EZIA 5FLKA 3QPCA 1IZ8A 5DYYA 3GROA 1F8UA 1BCSA 4UUQA 1A88A 3WA6A 2PSEA 3WZLA 4KJXA 2AJ8A 2DHDA 4HVTA 4B0OA 5IVKA 3R3VA 3R3WA 5HFNA 4AN0A 4W1PA 3D0KA 5D6OA 4DNPA 2XMSA 3H17A 2OGTA 1EK1A 5FKJA 4GWLA 3O4HA 3EF3A 3HZOA 2IITA 1GPKA 2ZYSA 3CN9A 2VJBA 2W22A 4Y9SA 2DR0A 3HSSA 1XLVA 4W1QA 4DM7A 1VE6A 4O08A 3S2ZA 1QFSA 1J07A 1MJ5A 2Y6UA 3ANSA 4BZWA 3H1AA 1T2NA 3D2AA 3W04A 1EB9A 2AJDA 3C8HA 1DWQA 4MQMA 4AZ0A 5K3FB 2QJRA 1R4ZA 5JALA 1JJBA 2JGEA 3SX4A 2XQIA 5LP1A 5DNUA 2Y2UA 4U2FA 4X00A 4AQDA 2C0QA 4FDMA 1XZLA 1GZ7A 1EHYA 4QWWA 4X94A 1JJIA 3IVMA 3WI7A 1A8SA 5KBYA 1K8QA 1LGYA 3HABA 5CRIA 2XQJA 5ALUA 2IIVA 4H7DA 4BP8A 2HA4A 1AQLA 4LIPD 3PUHA 3EIOA 1QIJA 1YA8A 3OPMA 1CUWA 1ZGBA 2XMRA 4ITVA 2ROQA 4DNOA 4WDQA 4KEAA 4HXFB 2XE4A 2QXTA 1QJ4A 1U2EA 2AJBA 2VA9A 1RP1A 4IHAA 1MNAA 2Y6VA 4MQLA 2OGZA 3WA7A 1HLGA 4N5IX 3W9UA 3WWDA 1XZMA 5CBKA 1H2ZA 1NU8A 5HF8A 5A7GA 4U2BA 2WJ4A 5ALEA 3QPAA 1B41A 1YB7A 4H7KA 4G9GA 1E5TA 2QZPA 3QPDA 3MUNA 1ZJ5A 1XKLA 3WK6A 3ZPXA 2EDAA 5AKEA 1JU3A 1IUOA 1VE7A 1Y7IA 4ZRDA 4ARBA 2VF2A 2CEKA 5ALKA 4X95A 1AMNA 2RGUA 4BCCA 3STVA 3WK8A 5CH5A 3PUIA 3FCYA 1USWA 5ALVA 1CR6A 2B4KA 3VJMA 3DQZA 5EHQA 2JGLA 2ZSHA 1U8EA 5C8XA 4Y2SA 4QLAA 5CH8A 4AO7A 3Q8WA 2H1IA 4WFJA 3EQ8A 1MAHA 5AI0A 1M33A 4X3CA 4F60A 5AK4A 1XRMA 3L1IA 3O0DA 1FFDA 5FRDA 3WJ2A 4DSAA 1AGYA 4GECA 1DT5A 1XZBA 2HRRA 3D3NA 1QFMA 2WFLA 4BCDA 4UBOA 3KXPA 3I2IA 5DWDA 5K3AA 4E11A 4XJVA 4UHEA 2JGMA 1PV1A 3JYHA 1U4NA 1JKMA 5AOBA 5FV4A 4J0DA 3D4LA 3ANTA 4LYEA 1E8DA 2QXUA 5ALGA 3AINA 2AJLI 2RAUA 2O7RA 5ALTA 1ODSA 5K3EA 1BEZA 1DWOA 3A2LA 4Y2JA 1CPYA 2C7BA 3QBJA 2HU7A 3VDXA 3I28A 4H77A 4KE6A 5BWCA 3WKAA 5E4YA 4GDMA 5FOQA 3H2KA 5FP0A 1XROA 2VT6A 4DMHA 5AHXA 5T4HA 2JGKA 2CB9A 1ZGCA 2OAEA 3M82A 4W9RA 2HM7A 3H2IA 3R40A 2WFZA 1XLWA 3T4UA 4A16A 1W76A 4OB7A 4J0GA 2XQGA 5AI4A 2OG1A 3WMRA 4PQEA 1HL7A 1E8NA 1MX5A 2Z3ZA 4CG3A 4X93A 3TRDA 3ESDA 3FLBA 2X5XA 2JIDA 2VTVA 1CLEA 3MGAA 4N5HX 1UK8A 3DD5A 3JW8A 2WUGA 4G4GA 1J1IA 5JZ9A 4B83A 5IVDA 1W52X 1BRTA 4JYMA 1H23A 4QE3A 3NUZA 4N8SA 3HLKA 2XUKA 3T52A 5LKRA 1FFBA 1L7QA 2WLSA 4K6HA 3H2HA 3WJ1A 1F6WA 3E1GA 3HJUA 4CG2A 4RNCA 2XQKA 3ICVA 4NZZA 4BE4A 4X97A 4G8CA 4MJ3A 3WYDA 5JD5A 4DGQA 1H2XA 1TCBA 5AI8A 2BUBA 2ZSIA 2DCMA 2LIPA 3PE6A 3FYUB 1LPAB 3IBTA 3WL8A 2D0DA 1HBJA 3IUMA 5SYNA 3FNBA 1EX9A 4S0XA 2OQIA 3G02A 4BVKA 4ZV9A 3IUNA 4LKOA 5CT6A 2QKYA 1ZD3A 1XRNA 1SCKA 5LZ5A 5HF6A 2OCKA 4OCZA 4GW3A 1W1IA 3VJKA 2QUAA 1E3QA 2YASA 4KRXA 1XQVA 1UK7A 4Q82A 1J06A 1QIIA 4FHZA 2BUAA 4V2IA 2ZYHA 3FAKA 1VZ2A 4C6HA 1DTEA 1L7RA 3CN7A 1Q84A 1CUBA 5ESRA 5HF9A 5JASA 1XZEA 1GGVA 2I03A 3BWXA 4DNFA 1K4YA 1DT3A 2R11A 3I6YA 3O4IA 4BP9A 4Z49A 1N5MA 2WJ3A 5JZBA 2WILA 3C70A 4EY4A 5HF5A 5FPQA 3F8SA 3QMWA 2HRQA 1WB5A 2Z5GA 3NGMA 5DNWA 4N8DA 1ETHA 4FNMA 5K3CA 3HEAA 4OB8A 4XX1A 1NU6A 1VA5A 1FFAA 1MU0A 2PSHA 4I4CA 4FMPA 4UHHA 3F97A 3K6KA 3C5VA 2GBGA 1QO9A 1QZ3A 2BJHA 3R41A 4EHBA 3C8DA 2VQ6A 3H0CA 2BGNA 2GBIA 2ORYA 3ZLVA 4AXBA 2XUFA 1JU4A 5ALSA 3VXKA 2G5PA 3O95A 1H2WA 4F0JA 2FUKA 3WYNA 1LZLA 3G9TA 5DTIA 3R3ZA 2RONA 2DHCA 1JMKC 1EB8A 4KAAA 3BDVA 4LXIA 3V9AA 2JBWA 4XWGA 1XQXA 4YX9A 5AKZA 1IUPA 3LS2A 5AK6A 2WIDA 1UWCA 4RE6A 3NOXA 1QIMA 5DYTA 4W63A 4UPDA 2WIGA 3PDCA 2OCIA 2X8BA 1XZHA 2HADA 3KWFA 1MO2A 5JADA 3IB3A 1DX4A 1K6EA 1SC9A 2B20A 3OOSA 4QNNA 4HTAA 2VAVA 1W75A 2I3ZA 4CCWA 1MT3A 2XDWA 4YK7A 1L7AA 1QOZA 4ZI5A 5DYWA 5AKYA 2PKYX 2ECFA 4W1SA 5A71A 2VJCA 1XZIA 3OTQA 2ACKA 3G9UA 4OU4A 1VZ3A 1YA4A 3I6ZA 4Y2VA 4X91A 2JEYA 2O2GA 1QONA 3G0CA 2VJDA 4XIIA 2WHPA 3BDIA 3V48A 1VA4A 1MNQA 4KAFA 3IIIA 1UKAA 5AM3A 3AFIA 1KEZA 3BXPA 1XQWA 4UBNA 1THTA 1Z68A 4DNQA 5A6VA 2WUFA 2XLBA 1LZKA 2OLEA 3WKDA 1UKCA 4ZV7A 2NW6A 4AMZA 4B6GA 2QRUA 1BN6A 2FJPA 3V1MA 3IUJA 1G5FA 3OG9A 2HU8A 3IULA 5I7UA 5SYMA 4KE9A 3ZLUA 1QIDA 2ZJ7A 3DDUA 5BV7A 4BAUA 2BKLA 2WIJA 2HA6A 3FSGD 5K3DA 4J0CA 2XMBA 4C4YA 1QIEA 4BVLA 5HZGA 2G5TA 3H19A 4J3JA 3F96A 4JNCA 2VATA 1CUDA 4H0CA 4G8DA 2WQZA 4LHEA 4UFOA 1XFDA 4J0KA 1P0IA 3HXKA 3PI6A 5JAOA 1UOOA 4X7BA 1MX9A 2QR5A 1DQYA 2WFMA 2JF0A 4WJLA 5ALJA 5HKBA 4B80A 4RGYA 1R50A 5A7FA 1LBTA 5AM4A 4IQ4A 2FX5A 1CUZA 4AB1A 1UOPA 2WIKA 3G0BA 4NVRA 4CI9A 1CUFA 1WPRA 2ES4A 1SFRA 2PBLA 2Q0XA 5JAPA 5AKJA 3ILSA 2HFKA 2GBCA 2I3DA 2WSLA 3YASA 2JGJA 1CUAA 3ED1A 3KWJA 1XQYA 3MUOA 4FWBA 4OB6A 3E4DA 2OGSA 1XRLA 4L3WA 2J3DA 4M0MA 5AM5A 3QM1A 3W05A 3U0VA 2PU5A 3ESAA 4GHWA 5CMLA 2RHWA 4H35A 1THGA 2CKMA 5EHXA 4HXEB 1E89A 3FSGA 3DNMA 1HDEA 5HQ3A 4HAIA 4P92A 3WL7A 2H9YA 4QDTA 4X85A 1QIGA 5C81A 3DYVA 3ICWA 1AUOA 3C43A 1FJ2A 3WKBA 4JH0A 1HQDA 4OPMA 3AZOA 4MEBA 5AM0A 3HRHA 4OD0A 1UFOA 1ZI8A 3BJMA 5AM1A 2Y1KA 4I19A 1CQWA 5JD6A 2J3QA 3I6MA 4HXGA 2VT7A 3IUQA 3G8YA 3C6BA 1RYYA 4LYDA 5ALNA 1YCDA 4QZVA 4DSZA 3G7NA 3BJRA 1BS9A 3N2ZB 4FOLA 4C87A 4EY5A 1NX9A 2PUHA 3RM3A 1J2EA 1BU8A 2GYVA 3G0IA 4BC1A 2PPLA 1BN7A 2XUDA 7YASA 4X6XA 3FCXA 4HRYA 4HRXA 4E14A 3SC2A 5CT9A 4P08A 2C58A 2H7CA 4EY6A 3K2IA 4TPKA 4X90A 1FSSA 2WTMA 1PFQA 5DTJA 1EDBA 3SK0A 2JGIA 2W6CX 3C45A 1Y7HA 3GUUA 1GQSA 2WHQA 3C6YA 4K6GA 2OQVA 2GZSA 3WWEA 1K63A 4FBLA 5FUMA 2XUPA 4GXNA 3F9CA 3DLTA 2WFLB 1A8QA 2XUQA 2RIPA 1SCIA 2GYWA 2ZJFA 1F0NA 1GQRA 5AH0A 4N8EA 4UFPA 5HKAA 2HA5A 4EA6A 3C6XA 4B9AA 2ACEA 3PF9A 4ZGBA 4BTVA 3JWEA 1C4XA 5AK5A 3GZJA 1I6WA 3WWOA 2BGRA 1BE0A 5CT4A 2WM2A 4OYLA 3AIMA 2GYUA 5LZ2A 2Z3WA
chains in the Genus database with same CATH superfamily
3VHRA 3M4YA 4UEJA 2OY0A 3K0KA 3LP5A 1XMSA 5I9BA 1F0YA 1TECE 3UAWA 4EPWA 5DM0A 2HL6A 4A73A 3HYNA 5ECGC 3GVHA 1X1DA 2VEDA 3H7IA 2AXQA 5L3QA 1DAIA 4N0QA 4F91B 2VDRB 3COSA 4P33A 3QNUA 4D8XA 3KOWA 4G1VA 4X7MA 5AVVA 1IJFA 2IHJA 1EG2A 1GKKA 2ZKIA 3CG4A 1PN3A 4RMJA 5MHTA 3HI4A 2E0IA 2XDAA 5E7IA 2BBWA 2UZAA 4UHJA 5THQA 4CLOA 4BVFA 4GLJA 1OLSA 2BP7B 3GAZA 4HNGA 4J1TA 5ESXA 1B23P 4V0SA 1FQKA 5EGNA 2Z9BA 3OQ1A 3T9FA 1DJNA 5BPHA 4PPGA 3GPIA 4KHZA 4EGFA 1I7QB 2C3PA 2G63A 4MPTA 4MQBA 4RK0A 5ARCA 3DEYX 3QTLA 4IEFB 1VL6A 5GONF 3VPSA 3UMVA 2BPOA 2ZOSA 2Q5LA 4RCYA 3D5EA 3HEMA 3GAMA 3HUDA 2IXBA 4LZLA 3OX2A 1HSZA 3F5QA 1Y8RA 3PXAA 3M3PA 4NHEA 5J63A 4ZWNA 3F6RA 1TFUA 3UMFA 4J29A 4G5OA 4B3BA 3MPUA 4AJKA 1SXHA 2FSVC 1IPFA 4WOKA 5IP5A 1P81A 3TZQA 3WOVA 5IK2D 2QRQA 1Y5MA 2PS1A 3HUFA 3NTLA 5H83A 1F0KA 3EUAA 1PL0A 3T3IA 3CUWA 3EH1A 3B9RA 2D5AA 3BF7A 3BXZA 1KI2A 1TT7A 2KB0A 2TMGA 1NUTA 3K9LA 1R0XA 4FPXA 3EVAA 3EDCA 1NRWA 3DS8A 1IWBB 3WIDA 5KU1A 3UTDA 5JU6A 1T8TA 1YJCA 4ZIRB 1ZRNA 3SWWA 1PJCA 3LY8A 3U40A 5ALQA 4TKUA 1B14A 5ALLA 3H18A 4IICA 4GOXA 1IULA 1W87A 3LC2O 4I7EA 3SP1A 1GKUB 2AOTB 4DEVA 4E2XA 2QX8A 2H08A 5BMVB 2PK3A 3HC7A 1H2YA 1QH0A 4GRAA 2JCXA 4OSOA 2YV2A 1GAJA 3GRZA 3LD9A 4OQNA 3WHIA 2OESA 4AYXA 2FPXA 4DT1A 4Q1FA 1P2SA 6REQA 1B8VA 4JJIA 4FSXA 1GDHA 5I8PA 2NUPB 5JZMA 1IVNA 5CP8A 4F5ZA 3UK1A 4R6XA 4CBVA 2QLFA 2B1RA 3NH9A 4O5OA 3TTTA 1WB4A 1DO8A 1YOVB 3UHAA 5EIWA 2PXXA 1ILWA 4ZOEA 3SX2A 3V1KA 2G80A 4CMJA 1BJTA 1QDLB 3P4XA 3UV7A 1FS4A 1SVIA 5BN5A 2DLNA 5FTKA 4DRXB 1KU0A 1Z35A 2LKCA 3KHTA 4G2NA 2PGNA 4JD5A 2M6KA 3MD9A 4KIJA 1K08A 5DM2A 1Q2XA 1X2BA 1O2DA 5LCXA 1Z8DA 5AVJA 5D1HA 1N0HA 1WVMA 3BG5A 2CNWA 4FFOA 5J1TB 3LX6A 5DVZA 3EPHA 3PHBE 3LPMA 4IX1A 5ALYA 3NNNA 3E70C 2Q5JA 2IYVA 1M8PA 1ZKMA 4JT2A 1U3VA 3A8TA 4PYLA 3NO4A 4QYIB 1LBSA 3HJCA 2R8YA 3GMTA 1DMRA 4II3A 3CEPB 3TLAA 4AXXA 1LDMA 1E79D 3HTXA 4GL4A 2P2CA 3ENWA 4LTMA 3A9SA 1KVRA 2OV2A 2Y93A 4O8CA 3I01M 5LB4A 2EGGA 4W6QA 4QPJC 4BGDA 4TLCA 3SPXA 1RQRA 3VGJA 4MUMA 2DQZA 2C04A 1YZNA 3LKDA 4BAZA 3GD7A 1I3CA 2QTZA 1NYQA 1U11A 2FE1A 4M6WA 3T9CA 4FE4A 2AJCA 2FP4B 4M88A 1EZZA 1MVOA 4NCNA 3OC0A 1R7RA 4DLNA 2W42A 4FR2A 1JDSA 3QVSA 2C9BA 2WF8A 3CY6A 1H0RA 4AQ7A 5HDQA 3VC3A 3NV9A 5F4ZA 3MXOA 4O63O 4EL5A 1UMDB 2XTJA 4MCAA 2H1RA 3GUHA 3I4FA 3BFXA 3GGJA 4HR7A 1CRZA 2J1LA 3K15A 4UC0A 2PAAA 2ECKA 4ARAA 4TVSA 3C1UA 1CBUA 2HIGA 2CLEB 2PZFA 3CNNA 5TNXA 4LJLA 1GZSA 2G9RA 3MG9A 1F7UA 3TGLA 3NIDB 2IVZA 3A1EA 2O2DA 1JXOA 3CLSC 4TVBA 1FLAA 3H1EA 5AR1A 4P4LA 4KXMA 5TQ0B 2PO7A 3C3EA 3GFSA 4UAGA 1KY2A 3D6TB 3FBTA 4EYSA 3BUSA 3UXMA 4H0NA 3VX4A 2EYUA 2Q1UA 2ATVA 2DQYA 1LPOA 2HA0A 4JEMA 5JIBA 4BO6A 3UK6A 1LPPA 2G0NA 1BH6A 3DOIA 4E03A 1WHTA 2AMYA 3UV6A 3W9YA 3F3KA 4F9GA 4MITA 2LKDA 4Q3BA 2EATA 4PFSA 5JSZB 5M04A 1W36D 5CJJA 1WA5A 1JJFA 5IAJA 3JYQA 2HIHA 3EBPA 2FR0A 4OL0A 2ZSFA 1SK8A 1C7JA 2FKAA 3KJZA 1RI2A 1LW7A 4MW1A 2PQ2A 3M6MD 1JFSA 4RWZA 4DOMA 4Z54A 5TX7A 4LZZA 1GU1A 2X4GA 4OI0A 3D1LA 4TKMA 1ICIA 4L5BA 2RHCA 2RHBA 2P6UA 2IU3A 1T0BA 3D9QX 4KLNA 5DYGA 4GPTA 1PX0A 4QTXA 1XZFA 5KEIA 3OJCA 3O2JA 4JJ4A 4RPGA 3WHKA 3A28A 2O8FB 5K3AA 3B1VA 5FQOA 2O8BB 5BSFA 1Q0HA 1ZGGA 4ZCQA 1FJXA 3SZOA 1LQUA 2KX7A 1DBWA 2QLBA 3AFNA 2ZUEA 1YS1X 1L1FA 1NY5A 5KNBA 3N86A 5IX8A 2HT1A 3DULA 1SUBA 2WU1A 3O91A 1GXSA 1B1AA 3KB6A 3LT1A 3S1LA 1Z5OA 2JHCA 2FZLA 3WNVA 2FYTA 3AVWA 4MWOA 1SCAA 1R12A 4UDNA 2LE0A 4DZRA 1HO3A 4M83A 1SULA 2HYDA 4H9GA 3I6IA 5LMUB 1O6FA 4TX1A 2HCJB 4F85A 2P75A 2P79A 3DZDA 1ONBA 3BXHA 1SHZA 1ZXBA 4OHXA 4F7DA 3D64A 4GE3A 4IIEA 2AN4A 2F8TA 3ZE2B 1XTPA 2QLJA 3VYTB 2P8SA 1F20A 1NV8A 4WY8A 1RYFA 2Z1NA 1BW9B 4PGFA 3C5HA 5HX7A 3L0PA 3FCCA 1OILA 1X1RA 3PFWO 4D9FA 3JWHA 4TKVA 2UZ4A 2AZTA 1OHHD 1JFRA 1E9VA 1N75A 1X9IA 3KQQA 2H06A 4WESA 4Z49A 2D0PB 1YE5A 2AR9A 1PQYA 1ZJYA 2CB0A 5H4GA 3ZE9A 3PA8A 9ABPA 1XD2B 1VSTA 1XT6A 1JL3A 4JYBA 1L7PA 4RVSA 4JQZA 4RCZA 1DLIA 3LFTA 2O2HA 1NBHA 4UM9D 1GPMA 1BVUA 2OHXA 3VOAA 4Q3DA 5IMBA 4FSHA 1NM5A 3RUHA 2OXEA 4Z3KA 2CCKA 3CXUA 4KOEC 1J6UA 5EZYB 4AZ3A 3LDFA 5ALPA 3I2KA 2ZJBA 3NHKA 1P9WA 1U0TA 2CLKB 1J25A 4MSUA 4Q4DA 4BRWA 2O2XA 5IJ0B 5KTMA 4DV0B 1YGYA 2JH8A 2HC9A 3L1VA 4Z9XA 9ATCA 1I2CA 1LFAA 1IOWA 3OZFA 3T9AA 3TLBA 1XCGB 5DNCA 5F2NA 3ZY3A 8ABPA 5K9ZA 5KYXB 2DPXA 4WBNA 4KR0A 1PS8A 1V37A 3JAKB 3MXTA 5FPSA 5LQNA 5MF6A 3CLUC 3K0AB 3F73A 3EXFA 1QQ5A 1U1FA 2XOKD 3FCEA 4UZEA 4AJ9A 5LVAA 3R3UA 3ZVRA 3OEWA 3L49A 1BA3A 3S5UA 2JCGA 3IP8A 4HJXA 3C3CA 3WQSB 1JT2A 5KPDA 2IDMA 4CLRA 2W71A 4MYSA 1TZ2A 4YGYA 2IX3A 3CZCA 4ZU3A 4AULA 1OUMA 4J0HA 1CDZA 1V11B 1BCRA 2I7DA 2ZZMA 3ZDDA 1XZQA 4B7ZA 2GRUA 1RXCA 2QU8A 4L5AA 2C54A 2I8LA 1QU3A 3PJGA 2UDPA 2AFVA 3B48A 5E7JA 1ZD5A 4D7AA 5LZ9A 5KWVA 4P4SB 2DJIA 4L8GA 4YJ2B 3I2GA 5HCUA 4DCTA 2PKEA 2RKBA 2VTEA 4Q66C 1RKVA 1H8EA 3T12A 3DEKA 5ALIA 3B6MA 6ADHA 1H6BA 5JV5A 4CCAA 3GQVA 1W49A 2BONA 3WO1A 3N3AC 3TQRA 3BKWA 1P7YA 4JQYA 4TV8A 5KYWB 4DA4A 3UA3A 3I34X 1CR2A 2JL1A 4PQYA 4TMZA 2QD4A 4CT4B 2A7XA 2XZLA 1RM5A 3RJMA 3CLVA 4IJWA 5KVCA 4GMFA 1VFPA 1X7HA 1GCAA 2DFDA 3IQIX 3H4MA 4DJ5X 3KQUA 1V8BA 2W4MA 3LVQE 1BWRA 1MO6A 4BASA 1P75A 3MD0A 3H97A 3LA8A 5EHNA 5TS2A 1AQ6A 1VMKA 2VPXA 4N1AA 4TZTA 4UNIA 4OU5A 3HKBA 4LHSA 1A7JA 1P7PA 4NPCA 1TF5A 4RFSA 4WN9B 1FPQA 3L43A 1X80A 4WZBB 5K3FA 4L3VA 5BR4A 1SOMA 5CFRA 5A4FS 3B5JA 3LGAA 1CEXA 1M0SA 1TU3A 3OWXA 5BR7A 1W36C 4U7HA 3UKDA 1XK6A 3EEFA 3GY0A 3QYJA 4RTNA 1J97A 1P0QA 5C4GB 4TTSA 3NBAA 3M5DA 3T5DA 2O07A 3IA2A 4CG1A 1I3MA 4KWTA 2IFTA 3I39X 3SYTA 3G9XA 5I51A 1O54A 2DUWA 3V8VA 2NSDA 3W5HA 2QPLA 4URXR 4ZC1A 5I7OA 3U7GA 3RF6A 3KXIA 2GXUA 4H4DA 1E7YA 1A8UA 1G20B 2NO9A 3AR4A 3I9LA 3TG2A 2NZ2A 3HZHA 3N87A 5DI9A 4JLWA 5DXAA 3LUJA 2XVYA 5TY0A 3CX3A 3IO5A 1DX6A 2F00A 3ND7A 3B60A 4GX1A 1E9RA 4R2JA 4N47A 1CHNA 4H4EA 1Q83A 4Q3KA 4Y9DA 2IUYA 2YUIA 3RYHB 1BQ3A 2OV8A 4QEZA 4I1PA 1Z29A 1P4GA 4AU1A 2C9DA 3IERA 3NUGA 4MLCA 2VOJA 4P7JA 5DTRA 2P0YA 1JIQA 1ZR4A 4Y2YA 3NTQA 3HDHA 1D4FA 3QOFA 3SYRA 1QH9A 1YC2A 3OU6A 2C1XA 2W6NA 1OBOA 3P0JA 3AWIA 1Q16A 3QLJA 3T94A 1W4AA 2QA5A 2QENA 3N0RA 3EVEA 4U4AA 3W3AD 2EFDB 2C31A 3L4SO 3OD1A 4OGLA 3T1HB 3VNRA 4TVOA 4D8YA 3Q7EA 4KQMA 4HB4A 3BH6A 2CFCA 5K8UA 3LKZA 4D1YA 2VTBA 1PR6A 2BM9A 4OM7A 1G5QA 3N0WA 4X0EA 1NRJB 2BDEA 5EKUA 3SE7A 2D06A 2W6QA 1P9RA 2V6BA 1WV1A 1Z28A 2QT9A 3WNDA 4B9EA 1VJCA 1SIOA 4NDNE 1N6KA 3TE7A 4RTRA 3KIPA 1KS9A 2OHIA 3GLHA 4G1CA 3DVRX 2WHPB 3CZRA 4K6KA 4R54A 3ROFA 2GF0A 2Q3MA 3ABSB 3NC4A 3CT4A 3HYSA 4X3OA 3HCDA 4TWBA 2Q4OA 2AR7A 4JFAA 4WWHA 5J2UB 4OJMX 4ESEA 4Y1GA 1CNFA 4GGPA 4CGZA 1FF9A 5HCNA 4LBYA 1UBOS 4QG7A 1T5HX 5KTKA 2FW7A 2I78A 4DSOA 1VKHA 1G4HA 2JEZA 2Q8QA 4RM2A 4FUQA 4GZ5A 1VJRA 3H1TA 4E5YA 3BIXA 4ZGGA 1VJ0A 5JEDA 3UFBA 2QGZA 3O9MA 5HCIA 4MW4A 1SA0B 1MR3F 1F4PA 2AOUA 4PINA 1RAAA 2ILTA 4JROA 3K5PA 3DFFA 2C1EA 3I2HA 5FPYA 4BV2A 4L95C 3AR2A 3OM9A 3V1UA 1SKYE 1E0JA 1KAMA 3QEMA 2GNOA 2WV7A 3UWPA 1U5BB 4EOGA 1SUEA 1RQGA 1VL8A 1X0XA 2V97A 2WTNA 4BWYA 5I8WA 4PLPA 1G7SA 1LVUA 3DTVB 3OE7D 4W82A 5LPNA 1GUYA 1U04A 1X39A 3KAQA 1S2OA 1VE9A 2BC9A 3L7IA 1L4MA 3BRSA 3LP8A 4P0TA 5G4KB 4AMVA 1K68A 5JJCA 5FR2A 3O9VA 1SVUA 5DN9A 1UAYA 5TQ2A 3IALA 3QGMA 2ZYIA 3HGQA 4U3JA 1BXRB 1RKBA 3F2VA 1NOKA 1QCZA 4BZZA 3LECA 1N7JA 2NYUA 3D3JA 1Z0AA 5D7BA 4D3ZA 4EW1A 1M6VA 3OIGA 4MEJA 3OSUA 2QTFA 4H18A 2IP4A 4B3RB 1JHDA 2WJ6A 1GVHA 1KZYC 1P2UA 2UVPA 3W78A 2RK6A 4KGDA 4YGXB 2X3UA 2QZSA 3V1TC 1YQQA 3SJAA 3GEIA 5CXUA 3E9QA 4O2AA 4KN6A 4ZANA 2QORA 3LO8A 1HPLA 2PLWA 5KDOA 2FSGA 1M73E 3V6LA 4G65A 4TZ6A 1RXIA 2CDRA 3F6YA 3CQ9A 5SYAA 5JS6A 4DA8A 2PZMA 4F3RA 5BUCA 1E20A 2VAMA 2QUBA 5K8IA 1FL9A 1H1DA 4H15A 4EHFA 3SIRA 4GOMD 1XGKA 3FVTA 4PBRA 2GKOA 4D3SA 5IG2A 2O8EB 1L4BA 4ND4A 4QDZA 1MAVA 4XGKA 1QH8A 2J9XB 2JLQA 2QE7D 4GRDA 1MJHA 4I5EA 1ZR2A 4CM7A 2AF4C 4UUMA 1NG1A 5FUXA 4CTNA 3NHMA 2WU3A 3JRNA 1NZDA 4XLTA 3W8FA 2O1EA 4EL0A 4QWMA 1CF2O 3GZTB 2Y0PA 5DP2A 2BLNA 2IQ5A 3X1YA 3ZK9A 2CGEA 3OM8A 1IQUA 5CH3A 4ZICA 2ZXEA 1S5PA 4G24A 5GJBA 4YRQA 2PVSA 2XUZA 2Z04A 1I10A 2J41A 1SC1A 721PA 2RB4A 1AN0A 5ED4A 2IXEA 4RZIA 3MT8A 3ETHA 4EHDA 2VO1A 4K26A 1T4GA 1OXMA 2CW5A 3AU8A 4DBLE 1BQEA 1QG0A 3SS9X 4OY3A 3L82B 2YRXA 2Y77A 1DJPA 4OJQA 3SC3A 1BOFA 3WXBA 2ZWVA 4D56A 4IDQA 2ORVA 3O1JC 1TLTA 2H65A 2PSDA 2YQZA 1QGZA 4GSYA 4NZ9A 2X9VA 1S2NA 4K40A 5JNSA 4ZOBA 3O8QA 5E4FA 2DZDA 3PLNA 1EWTA 3DJFA 3QKWA 1Y3BE 3FPLA 4P3PA 2WPDD 2CJPA 4ECEA 4H3HB 4B4WA 2B61A 2FK7A 3FD8A 5ILOA 3PQ2A 2XMZA 1FU7A 1NW6A 5AI5A 2IU0A 2FGKA 1Z17A 4JT9A 3TFWA 3W5IA 4DQ0A 3IQXA 4YRJA 1UEJA 1HDGO 4PO1A 5LXTB 3M6IA 3HP4A 3OHSX 3V7WA 4FM9A 3O8OB 1EUDA 3IMCA 4V1CB 1B0AA 2B0JA 3N2GB 3RT7A 4PN3A 2IYUA 1U0FA 3BFJA 4Q1AA 5BN3B 1DFIA 1CS4C 2Z2ZA 3DVAA 1Z4IA 1A4IA 1G5RA 1WD7A 3AETA 2A0FA 2V6FA 2P5SA 1Z36A 5FO1A 4CFZA 4CKEA 3EXIA 2F55A 3MHTA 3UH1A 4HBZA 3IR6A 3N28A 1M66A 1MORA 4RF4A 5JZSA 3A36A 1J9EA 1P8JA 1KK0A 3ORHA 4K3UA 1IEVA 1U1CA 4N76A 4QQFA 2IH2A 3IDOA 5BQXA 1ZVKA 1QKKA 4AP9A 5HQ3B 4BAGA 3OE4A 1WY7A 1YR2A 4LXHA 4REQA 2ZAMA 3ST7A 4FMDF 5LP6F 4B3MB 5K51A 1JI3A 5AVRA 4V02A 3HB5X 1LJ8A 5ULLA 2A9RA 2CL5A 3D7RA 5IKXA 1XDZA 5EJAA 1WZUA 2ZRAA 2VI5A 3HB4X 4C9BA 1UKYA 2W2XA 4JJ6A 4QLOA 3VU1A 1D1SA 3LUFA 1BHSA 3VOSA 1RWPA 3IIEA 1AHNA 3F47A 1UJ2A 1AURA 1M2FA 1VPDA 2E4AA 3M1YA 4ZDIA 4KRYA 3G2QA 1KO7A 1YI8A 3CCCA 4M87A 4ND8A 1A8IA 4NYJR 1AKTA 4KDFA 2J6BA 3C8ZA 4WT7A 4L9WA 4X20B 4MKXA 3VR5A 2C77A 1LU9A 1UBNA 3AUXA 1QXSA 1SVOA 4FGKA 4I9NA 5ITZB 2VKTA 4OXYA 2I76A 4J7CA 4PPFA 2DULA 2JZCA 1TZMA 2ZEJA 3REFA 5K6TA 4CEHA 1TKBA 2WWHA 3UUEA 1T4MA 2Z3VA 1Q14A 2PTHA 1FX0B 3L6CA 1B4DA 5IVIA 5EJEA 2VQSA 2L42A 3RRBA 3T95A 4QXQA 2ONCA 4Y6OA 4EB3A 3V8EA 1S7GA 3CZMA 2WA2A 3GAFA 1FTNA 3PQ4A 4TQAA 5KI6A 1RJEA 3OX3A 1DBQA 3QNWA 4FS8A 4OUKX 4ASUA 1YQXA 2R0QC 3KOMA 4G5GA 3UCFA 3VDQA 4F5EA 2YYSA 4L6CA 1DC7A 2P9HA 4N5MA 1DZ3A 1N0WA 1I13A 2OORA 1YU9A 3KJEA 5DXJA 2P2LA 3ETEA 1KGDA 4MS4B 2C59A 4R68A 2E49A 3VISA 1MV5A 2C9ZA 3EUEA 3OZAA 4XRRA 3I12A 2DKOA 3B3GA 1W2WB 2ARKA 2DFLA 1CRLA 3GNTA 4P53A 3U6BA 3R0VA 3DEJA 4FZJA 3WLFA 2XA9A 1A50B 3QBDA 5HR5A 4HDMB 5REQA 3ICOA 4OF4A 2FSVA 2QVYX 3KKNA 3PSAA 4E08A 1YF3A 5CFMA 3GMIA 5CVJA 5LSAA 3LHDA 4D9GA 1YJXA 1XHLA 1GV1A 3I9NA 5E6UB 3M6WA 4FFSA 4TYMA 4HEA6 4A15A 1RZRA 2QUHA 3GA0A 1XL1A 3FYCA 1VBNA 5DLPA 3KHUA 3PUYA 1K88A 1LPNA 2X4IA 4PW0A 3SHTA 1KVTA 3CF2A 5EHIA 5EJFA 4UHFA 4WLUA 2R4QA 2AYYA 5G40A 3KYDB 1MFZA 3FOZA 1P0MA 2BKVA 5F23A 3UJ7A 4LK2A 3K1AB 4DIEA 4ZD6A 1WU8A 3IEMA 4HADA 4NYJQ 1MJGA 2BOVA 5U4QA 2W2LA 2RGNA 3BHNA 1HE2A 4YMWA 4JKOA 4WMLA 4JS0A 1ISPA 1ZBDA 4BO1A 1ZIPA 3R9XB 5FUVA 4D46A 1DAHA 3TSAA 1UMCA 4E5NA 4M7OA 3TAXA 5KNBH 4R2HA 5FLEX 1DG3A 3ZK7A 4MDHA 1H3NA 1RNLA 3EAFA 4F4DA 5L6MB 1P2GA 2QRHA 5BV2P 4CIAA 1YDMA 5DHSA 1DAEA 4ZYTA 4UARA 1MLDA 3DFKA 1JB9A 2W2VA 2XMCA 3T99A 1YHZA 2UVQA 1JYFA 3I83A 3L02A 3R5HA 5CT5A 1M72A 3AZPA 4DCNA 4ZTZB 4LTNA 5A4MS 3TEFA 4B3DA 2CD9A 2QRMA 3IPYA 4RGBA 3OZEA 5HIMA 5BYBA 1KP3A 1NAHA 2E4WA 4IIHA 4AJ2A 4ZGWA 4QJIA 5LD2B 4AZWA 4HWGA 2MSDB 2LD4A 4YRCA 5EMJA 1H5UA 4EAQA 2L0XA 1PJBA 1WOYA 1F9AA 1J0AA 3AEYA 5AUQA 4ENRA 1IN8A 3MHPA 5TMDA 5CIQA 4BLQA 4AIRA 3D54D 1AGRA 4DWVA 1ONNA 4GI3A 5TRTA 4DLKA 2XX3A 1VXOA 3L6UA 3HA7A 5CFPA 3PV0A 3NBZC 1EX7A 4LJ8A 1WV0A 3DB1A 3FYUC 3WRYC 1E9AA 4R0MA 3AVPA 3IJ5A 2JEOA 4HX5A 3TVTA 4LMBA 2AOWA 3EXG1 5CJPA 1SCUA 1L3BA 5F77A 2PV0A 4WBSA 8OHMA 3BQMB 1SIWA 3PNVA 4NE2A 4TLMB 4YUZA 1K98A 2CYCA 1Z37A 3PL5A 1EH5A 1W5AA 1N4AA 4XCVA 4H59A 2IV3A 5FNVB 4YR7A 3GLIB 4BB0A 1HM5A 3I64A 3PHIA 2I54A 4UHCA 2EIXA 4GPEA 3UUFA 3ZI7A 4HS9A 3FOBA 3ROGA 3VA7A 1NQXA 3SZGA 2C9OA 1DOHA 1SQ0A 1NN3A 1SNYA 2QL5A 5EIEA 1EINA 2WF7A 3E2MA 3FTEA 3OJFA 2GBFA 4DCMA 3LTEA 4E15A 3GMSA 3LZCA 1FS6A 1YOBA 2HA3A 1XKQA 3T1QA 1CUIA 3PRJA 3A9UA 2YXBA 4QA9A 1N3LA 3NJ4A 3KXLA 1CWUA 1OIWA 4Z4GA 2PKCA 1TCAA 1WABA 4DVJA 2B4RO 5IVPA 1REQB 1T8SA 2PD4A 1TB4A 1QX3A 2PSFA 3CS3A 4TYQA 3ZZ1A 5LQAA 3K6JA 1AHHA 1KFBB 1KHTA 1EQ2A 2GUWA 4FDVA 1AQIA 5CW2A 5TMEA 4WN3A 4DDVA 1MD9A 3MSCA 1D5WA 2P6MA 1K6JA 4H7IA 1EVEA 4ITRC 4ZREA 2HWYA 3KTDA 1JQKA 3TIIA 5JNVA 4RGVA 2HXSA 3TJRA 5AOAA 3JR3A 3ELDA 4GM0A 1SBQA 3A70A 3RG8A 3ZDQA 2A5LA 2H1WA 4UEOA 4B7AA 4URYR 4NNJA 4MTLA 1SPXA 3JCZA 2BZSA 1EFVA 5JH7F 3QMMA 4FONA 1Y37A 3KU4A 3BM5A 2D13A 3FDFA 2AG5A 3OURA 1FTQA 5ERXA 7AT1A 5BSGA 3MGBA 1ULHA 4UUAA 1E69A 1J8FA 1PNRA 3VR3D 4L4ZA 1OJLA 2Z6AA 4YACA 4TMXA 4ZOLA 4FT2A 1DKOA 4D9BA 5L95A 5JPCA 5FPKA 3K31A 4NE7A 5KTOA 3X1XA 1I80A 3KVNA 5IEJA 4UU0A 3PT9A 4BVEA 5BUQA 2P3LA 4AWAA 3W8EA 5E6RA 1PP4A 3TZKA 3FMFA 1AX9A 3PGMA 1I4EB 2WSYB 4FFBA 3PVZA 3BMCA 3M34A 2AUTA 4J91A 4OHBA 4UBLA 3LOQA 1NX6A 5D5PA 5GV8A 5AQEA 4ESHA 2UZ1A 4EKYA 1E8MA 3A9CA 4R8MA 4ZAYA 4IH9A 2HK9A 5JQGA 3BTSA 2WRZA 3BK2A 3HB7A 3X2EA 4JLOA 2XTZA 4C20A 3JASA 3VVMA 2WICA 1OXXK 4BV3A 3OKCA 1U80A 5K3OA 4RTKA 1BX0A 2GCEA 2QP4A 1VE3A 1WUKS 1KPIA 1KYIA 2AMLA 2I9PA 3EXHB 3G5MA 3R1IA 4NOJA 3Q2IA 4BNLA 4JGIA 9LDBA 2E6KA 4PO9A 1YQTA 4MR7B 3AQIA 4H31A 1G5TA 1XI2A 5IDYA 1AMUA 3M81A 5CK4A 2VR1A 4H7HA 1U6KA 1CFJA 1ZHFA 2C3OA 1TMOA 4KE8A 4PSUA 1P2VA 1PTJC 1QIHA 3RD5A 3W6PA 4A8JC 5BQ3A 3JYPA 4R1UA 3OIVA 5KVSA 3P9RA 1VJDA 4RTJA 3GA7A 4R98A 1V5GA 2LPMA 3OLCX 2LP4Y 4YMTA 3ZCRA 5KU7A 1X19A 2C0PA 2OEPA 3D2LA 1PLKA 1WCYA 2BBSA 5TF0A 4S1TA 5IUJC 1QE5A 2J7PA 4HUQB 2YJNA 3HKCB 5DGIA 2Z30A 1XV5A 2O50A 3B38A 2WWYA 1RT9A 3FH0A 3UG6A 4OJTA 1T5OA 4FE3A 4AMGA 5HIAA 4IUYA 1XVUA 4BFLA 1E4EA 4ZT4A 1S2GA 4J76A 4PFKA 1UR5A 1Y7PA 3PC8C 1Z6ZA 2C4VA 2CKDA 4YLGA 4XM1A 1UZMA 1X7ZB 3EZ9A 3L8EA 2WD7A 1C5KA 2DMRA 2YN4A 3ORFA 2BFNA 2PX6A 3V4ZA 4B3HA 2ZT5A 5CXXA 8ATCA 4CLDA 1ZN7A 3H9BA 3RSLA 2NZJA 3O9ZA 1SCNE 1K97A 5COQA 2IH5A 1WHSA 5L51A 5EJ8A 1FDWA 3GCGA 3LNTA 2QL9A 5KKAA 3SM3A 1P19A 5EE1A 3HR7A 1DS6A 2PT7A 1JA0A 2E4ZA 3UOGA 4LF6B 4Q39A 5JAMA 5E8JA 1UDCA 2ZJAA 1H5NA 2ZUTA 4A91A 4I1IA 4NABA 1FUUA 1KMMA 1MTOA 1RD4A 1TVKB 1VLZA 1JDBC 2A57A 1JDZA 3HLYA 5K0NA 3D7MA 4ZP1A 1E9BA 1PJ3A 4OKIA 4YP0A 2Y67A 5IKPA 5ER6A 5FPPA 3UJDA 2ZAOA 3A25A 5EUQB 3B1JA 4YFVA 4RVHA 4TT3D 1ZJWA 1VP9A 3IURA 3S2GA 1F9EA 3NKFA 4IIXA 4YAGA 2DT5A 2AXPA 3ITEA 4GPAA 3WLAA 2DY1A 1C14A 4PYNA 3GX1A 4L6AA 2IEBA 1WE2A 5FFNA 2FWPA 4HFNA 2NN3C 1F48A 1Y9DA 3OJEA 3D6AA 3BAZA 1RADA 2J46A 2ZBRA 1P18A 4JMLA 1EK2A 4LHZA 3S40A 2PA0A 2Q46A 3KQKA 4KXLA 3CX4A 3GN2A 3N8NA 2WSSA 3I5UA 3L6DA 1D6NA 1KI1A 1OVMA 1GA6A 1OV4A 1C3LA 2I6UA 5B3JA 5BQOA 4CIBA 1XRRA 1JIKA 4X71A 4RLSA 3ETJA 4LX0A 5KTRA 2EARA 4F6RB 1ZCAA 2GEBA 1KEPA 4P3NA 2XNDA 1FW8A 3CLTD 4Z8XA 4ZEWA 4BNZA 1QE3A 3NBMA 4M9ZA 2SCUB 2ZYTX 3GRUA 2P91A 2X2OA 2HQ1A 3E9MA 1JIIA 1FMJA 3IPRA 2ZI4A 4V3CA 4KWIA 2EWVA 2QTBA 1XDGA 1QGDA 3OM1A 3ID6C 3C87A 2JFGA 4ZYLA 4QIHA 3RS5A 3SJ7A 5ADVA 1KDTA 1OI2A 3OQOA 2XUAA 3DE3X 4FKBA 5LQMA 1IUNA 1K8YB 1Z34A 5E1OA 5F1YA 2JVKA 3E03A 1IAVA 2E4XA 4MVJM 5FUQA 1E59A 1NR7A 3QYFA 3VVCA 3FLAA 3ZU6A 5MFPA 4PNHA 2GD0A 4IV5A 5CVEA 2O3UA 2PZBA 5EUCA 2RC6A 2ZVQX 2C2YA 2OKCA 2DFPA 2JI8A 3AL3A 2BMAA 3L07A 4NJEA 3O7MA 2RFLA 3LZDA 3RVKA 1SD2A 1L5QA 3QFCA 4RAQA 3U37A 2I6SA 2VAWA 2H85A 3H5LA 4ME6A 4YWHA 3X1ZA 4NCKA 4E51A 1E92A 1TYBE 3JQAA 2NU8B 1P1HA 3W7AA 2X2PA 2BAGA 3QFHA 4WPGA 1LDEA 1JR3A 1NSYA 2W48A 4CM9D 5DGDA 3S2SA 5JYCA 4S04A 2P9EA 3PX3A 4JAVC 4HB2A 2QUZA 1XKXA 4MUFA 2J9YB 2FPOA 1KR5A 2C88A 5I9NA 3HJFA 2AB0A 4RORA 1PJRA 3P20A 1YV9A 1AQNA 3SBOA 1HFEL 2A0YA 1ZXXA 4L22A 4CR7A 4I9GA 2V7BA 3LXXA 1A88A 1MEOA 1V8OA 3PHHA 2M1XA 3P96A 5EMLA 2WVHA 4AAYA 2VHEA 3WA6A 2YBEA 5L4LA 3ESZA 5B7PA 5K8LA 3E18A 1T3ZA 2C9YA 1C7FA 1GAQA 1WCWA 2AJ8A 2BT4A 2JIOA 2ZS8A 4LK3A 2H11A 3WYGA 1HT1E 3ZVNA 2ZP1A 1EDOA 1JWLA 1NR1A 3HM2A 2APJA 2HF7A 3AF1A 1GPWB 1II8B 4LDNA 3TRJA 1JLLA 1TYDE 2LCIA 4BLOA 4C6TA 2BELA 3OIFA 3L7YA 3R3VA 4JXZA 2GZMA 2FETA 1BG6A 1K4MA 3CH5A 3FIUA 3DAGA 3C3WA 3KVYA 4JYZA 3DWEX 2QG4A 4GLLA 2RGCA 2GF2A 3VBEA 1UINA 2JFHA 2C5BA 3TAUA 4E09A 2FN8A 4MHSA 4XQGA 4DJTA 1OZGA 3E7XA 1QHHA 3R6TA 4PIVA 2XTAA 5FKJA 3BIJA 1F38A 2WTXA 4BQRA 1PYGA 4YRGA 2FLVA 2YXEA 4KDCA 4E2YA 2ZYSA 5IDXA 2H4FA 1JKJA 3E53A 1LX7A 3F3YA 3GEMA 3QUTA 2GAIA 1MG5A 2MTBA 3EWAA 2M9MA 2VDVE 1V8ZA 1HOTA 1XPJA 3GGGA 4Z99A 4F3YA 1NMZA 2QSJA 3QIAA 4O4JB 5C53B 1ENZA 2HMTA 2W37A 4RHCA 4INAA 1LF0A 2YWEA 5EKSA 4GKAA 1RFLA 4LRWA 4DM7A 3OWOA 3NANA 5FWYA 4NCJA 3D0QA 4HDKB 3S2ZA 1I1HA 4KNWA 1EE9A 3MQ4A 4FFMA 1MKYA 4MGHA 2Y6UA 3DXFA 1O0CA 1T4CB 3SZLA 5B30A 1FQOA 4B79A 1T2NA 2BKUA 3LBIA 2EFJA 1X1EA 5F7XA 1EB9A 4DXAA 4V0KA 3C8HA 2C3MA 1EFLA 3SVLA 2RHJA 4MQMA 2DECA 2YINC 2GAAA 4U7FA 4Z4HA 2V0CA 4LI0A 3ZHXA 2QJRA 2R60A 3F71A 4MIYA 2GEFA 1W0KD 4OGKA 1JNYA 1NVEA 3SG0A 2H4JA 1H2FA 7MHTA 2SHKA 4B5KA 1K75A 4ARCA 2QP9X 2VWPA 1T3GA 1W0JA 2YVAA 2OQ2A 4LGMA 4RVGA 4MVJE 3HXPA 2OB1A 4ZDJA 4XAQA 5DNUA 4BVGA 3CVVA 2LDXA 1J39A 3DV9A 1FFSA 2C0QA 3FZYA 2FSHA 3H9GA 2AZ4A 3T38A 4OFWA 2O4CA 3LPAA 1OBFO 1YHNA 5CAEB 4QWWA 6LDHA 4H1HA 4IHKA 4QTUB 4I8IA 5DNEA 1QWOA 1E62A 2XZPA 3IVMA 4FC6A 3QA3E 3WI7A 3ZHVA 2PZEA 3HSYA 2AKAB 1RYNA 1E3JA 1LDNA 3CLTC 2O23A 1LGYA 3PJDA 4NP6A 5KBYA 2XQJA 4KKXB 3TPZA 3AUUA 3ZHZA 1A9XA 2E48A 1Q21A 3IV6A 3KG2A 1AQLA 2Q0QA 4WJKB 3RIXA 1Q1BA 3KLOA 3HYTA 1WO8A 4ZU1X 4LIPD 5TXGA 4G41A 4XUDA 3SIWA 1U3CA 4H3VA 1YA8A 2EAUA 3C3AA 3OPMA 1W2GA 2HEIA 3X44A 2EERA 4RTOA 2XMRA 1OYWA 2LW7A 4HFJA 4ITVA 5B64A 2ROQA 3I9V6 2Y4NA 1MEJA 5CGQB 4D4IA 2QT0A 4K8OA 2WF6A 1OPRA 3AP1A 2PLFA 3Q9SA 4IF4A 1RHMA 1V6CA 1QJ4A 2CLOB 1WTCA 1YO6A 4AROA 3FA2A 3MZ0A 4LC0A 4EMUA 1XPOA 2QHXA 1T2UA 3KUCA 1OA1A 2OZLB 4A2PA 3V5NA 3EF0A 3Q2KA 2CZCA 2DPMA 2O14A 1SVKA 3A4IA 3CRW1 3IUBA 4EGQA 2ZU0C 3TI7A 1HDIA 4MIKA 1K1EA 5AW2A 2Y6VA 4MQLA 4BP1A 1Z13A 1U3FA 4XJTA 1ZAKA 3M2TA 2OGZA 1PGNA 2QRJA 3E81A 3EIHA 5H02A 3M1LA 4TV9F 3EFEA 2O8CB 1DQNA 4MRMB 3CRMA 4RVOA 1YL6A 4B6FA 3WWDA 1QX4A 2SKDA 4GQIA 3AUFA 4LSMA 5C5CA 2WNIA 3AVQA 1DC8A 1G1AA 1GGEA 3HDYA 4DR6B 1LNZA 2C7QA 4JBGA 5GZ3A 1QQTA 2YHIB 2Y1GA 2IYXA 2NVBA 1U99A 4I2VA 1SG6A 5CG1A 4YAFA 2VUSA 2WZDA 4KQ1A 2E18A 5A7GA 4U2BA 1MXHA 1XEWX 3OF5A 3A2KA 4YMVA 4XB1A 1E63A 1BMQA 3FFBA 1ZOPA 3VR5D 1V9LA 3NHYA 1E0KA 4G0QA 1EM8B 1EXDA 2J3IA 1QRRA 2R6JA 4MKIA 4CMBA 2ZBGA 3THSA 3FPCA 3VFDA 4D43A 2QZPA 5TIIA 3E4CA 2WZBA 1KI3A 4IXTA 5HILA 1C50A 1O97D 1PR4A 4UAVA 3RVBA 3HUEA 2J0QA 2H6EA 3D8UA 4KYTA 1XKLA 2EDAA 4HGOA 3QOXA 4URWR 1P4SA 3PDIB 1JLSA 3K0CC 1XTZA 2K6GA 3FG9A 4G23A 3SYNA 1K9VF 3TGWA 1U94A 4KN8A 4LSZA 5EZQA 1U4SA 5BOSA 1ZNQO 3V7UA 3THXB 1D2GA 2H5EA 1XA0A 2PRZA 5LMCA 2NU9B 2OC9A 1Y33E 3P5BA 4G1EB 2QDXA 5I8ZA 4EP1A 1JF8A 1YXMA 3GCDA 3WQBA 2P9GA 1LCIA 1ZLXA 5JBNA 4HDSB 3R7WB 2A14A 3FB4A 3PZRA 5AFSA 2CEKA 2CWDA 2WJAA 4G0PA 1L4UA 2EHJA 1TCVA 2GEDA 5H70A 1RQ2A 4NQRA 3L8MA 1AMNA 1ZJ6A 1WDKA 2PS0A 1SQGA 3PD0A 4J90A 5J40A 4ON9A 3MB8A 4CIXA 3UJNA 1SPBS 3STVA 3ZXYA 4OHFA 4P8RA 4PLVA 5ALVA 1JRLA 4LF9B 1YRBA 3PKZA 2C83A 4HDRA 1YUMA 2GX6A 2COKA 2B4KA 2XIJA 3UCEA 2EP7A 3D5QA 3BJIC 3DL0A 4RX1A 1MVNA 1OIVA 3KX2A 5DX1A 4UTVA 4R2LA 2ZI6A 5EHQA 1U9IA 2FA9A 5HGJA 4NHOA 4WLFA 3N1UA 1R0LA 4IL5A 4Y2SA 3QVLA 4D8UA 4DQLA 1VTKA 4H1VA 2R1UA 3KEGA 3DBLA 4FHGA 1GZDA 3FWYA 2H1IA 4HL6A 2PKQO 3JVIA 3MLAA 1UDRA 3F5FA 1MAHA 1O58A 1M33A 3HDTA 3I72A 4LDQA 1Z2OX 4OATA 3ZWOA 1U2SA 4XJXA 2XF8A 4D8WA 1XRMA 2IYTA 3G1TA 4WECA 3IV7A 1G63A 1AUPA 3LSTA 4O0MA 1ZOOA 1EWKA 3OM0A 5EXSA 3ZXXA 1KY3A 4E6PA 1KSJA 3EZNA 4YPFA 3SY8A 3GLFB 5KDDA 4A26A 3OA2A 1DT5A 1O9HA 2I2AA 2V65A 3MFQA 1XZBA 3N59A 4MV6A 4TM7A 3SZMA 1S3FA 4YREA 1J56A 3I53A 3AJRA 2ISCA 1QFMA 2WFLA 2X15A 4JJZA 4ALKA 2IXFA 1DBSA 1T6ZA 4UATA 4C05A 1CY6A 4KN5A 1JEQB 4KW7A 3H6KA 5FWXB 1SXQA 3AQ4A 1HFKA 2D1QA 2IT1A 1EJ6A 1U98A 4LRYA 4BBAA 3NDPA 1V1JA 1UKEA 2RB5A 1HG0A 1I6KA 3DKIA 4LQDA 4O02B 3VX3A 2BFDB 4D26A 3C3KA 5KJ6A 5EERA 3X1KA 1FB5A 1T3SA 4C0LA 3OT1B 4XJVA 4W9NC 4MQEA 1IB0A 2GN6A 5AXAA 3J80A 3JYHA 1CETA 3GF4A 4ID3A 4JB8A 4ZKDA 4MWZA 2IA5A 4ACBA 1YVDA 3GDOA 3Q5GA 2VYNA 3OQVA 5KOYA 3HJNA 3IOYA 4UNRA 5ALGA 2H2DA 3OSZA 1W1UA 1S96A 2E4VA 3KSZO 3AKYA 3U7QB 3EFOA 1J5XA 1LK5A 3ZI4A 2DQ4A 2O7RA 5FQNA 5KHAA 4LXUA 1JAYA 1R8JA 2FE4A 3HNOA 5ALTA 2ECOA 5KAMA 2QR2A 3LOPA 4CQMB 2G6BA 1E5VA 1BEZA 2C4WA 2GILA 2ZTVA 5IUKC 1GTSA 3TNYA 2DETA 4WLEA 4EG4A 1VG1A 3OCYA 4KNYA 1JJVA 3PGJA 5IWCA 4O2BF 1KOJA 1VYUA 2VBIA 2F3QA 1KIAA 3A2LA 4GX2A 4XM0A 1EIWA 3PPYA 1LWOA 1HKUA 2BP7A 3OFKA 4H77A 4Z0TA 3TR6A 2EWMA 1RQPA 1GR0A 5BWCA 2VDMB 5AW3A 1EUCA 4DV6B 4PY2A 4QNRA 4EUKA 1UBUS 4H6VA 1W88B 2PCLA 4LJYA 3TB6A 2VKQA 3SNHA 4ZYYA 2IZZA 4LFBB 3DE6X 3QELB 4MA0A 4EW2A 1VE1A 1XXLA 3ND6A 3GR6A 5FOTA 1NXWA 1XROA 2ZTUA 2ZCVA 3HFGA 3DM5A 2VT6A 2A9VA 3OFNA 3GP8A 1TJYA 4DMHA 5T4HA 3VTAA 2XSZD 4D42A 3SHWA 1G2OA 3DDOA 2A84A 2EFHB 3M82A 5E3JA 3VZRA 5B5SA 2HM7A 3B1KA 4MI1A 1CIPA 5LA6F 2OWDA 3H2IA 2UYGA 3B9BA 3GJ8A 1T5TA 2O5VA 4E5SA 3OZWA 4ZI3A 4KLRA 1O97C 3EGWA 2RGYA 4DBVO 1XELA 2G40A 2IYQA 1RLOA 1NE2A 4MCIA 2QW8A 4ENQA 3GNQA 4BFUA 5AI4A 1YMQA 4X3PA 2QRZA 4ZIRA 1MX5A 2ERCA 1WSDA 4S05A 1C3XA 1Q22A 4BQIA 3C4JA 1AB5A 3LUAA 5EYPB 621PA 2BBTA 2Q1XA 4QDKA 1T43A 4TSRA 1ODKA 2AOTA 4JUFA 1T3HA 1T2EA 4AJ4A 5BMVA 3OZVA 1CK4A 3NOOA 1JX6A 1L4GA 4FFLA 4W8HA 3WRYA 5I3CA 2ISSD 4DV5B 3F74A 3VSAA 4Z3DA 3F0TA 3FFAA 2NUPA 4MUGA 1JJ7A 2BM8A 5CJ2A 2JHGA 2OOKA 3DEZA 4JUDX 1S8AA 4F6LA 3EPLA 3FJYA 3QVJA 5FTNA 4IFTA 1YOVA 4N12A 4QHTA 3QFFA 2EKBA 2JJ2A 1SZDA 5HM6A 5LQRA 3HDVA 3S2YA 4AVYA 4DRXA 1PGJA 3BJEA 3B70A 2WJHA 2BF7A 1DB3A 1KDOA 5TPZA 4I46A 1MW8X 3CUKA 2QMZA 2VTKA 5HZKA 3OEHA 3K92A 5L4NA 3EBOA 1LI5A 3D4NA 4QE3A 3OCWA 3NUZA 1WXQA 1KJNA 3JR7A 4N8SA 2F3PA 2XUKA 2UUPA 1EKXA 1FFBA 1OFGA 1L7QA 4A5OA 5SY9A 4UJ5A 4QXRA 4QYIA 1IXRC 1MT0A 1OE0A 2PBZA 1FVOA 4C5CA 4WXMA 5IEBA 4AUNA 1EM6A 3FW1A 3L9XA 1F6WA 1U8TA 3E1GA 1JZQA 2GO7A 3HJUA 1WEHA 4TMFA 2BEVA 4RNCA 1XDUA 2XQKA 4DA9A 3AL2A 3ICVA 1TVCA 4MKGA 2VXYA 4BE4A 4CM6A 4DBLC 2WY2D 1FUEA 2CSUA 1ECBA 1PEYA 4KG7A 4DLVA 5HBRA 1A69A 3ETLA 4XQCA 5CB8A 2FP4A 4NV0A 4B3CA 2Q5HA 4G1MB 4K9SA 3S81A 3KR1A 4NZMA 3WYDA 2CE2X 5E2AA 3FHTA 3VDMA 1T9HA 3T7RA 4DGQA 1WNTA 2P6NA 1HUQA 1L8AA 2HJSA 2Q07A 2GVZC 4QXAA 5AI8A 4YAUA 3WLLA 2PUVA 1JBKA 5EAIA 2HBZA 1GSAA 2GWHA 3B13B 1RRFA 3KWLA 4I99A 2BZ0A 5E3IA 3REQA 1Q0TA 2X9LA 3M7IA 3FNBA 3WBBA 2IYLD 1EX9A 4ZYUA 2QTVB 4S0XA 4OI1A 4OOEA 3G02A 3LUDA 3EGXB 1OYVA 3HVJA 5DKFA 5M3BA 3S8MA 3NHAA 4LKOA 5F2OA 3BAFA 1BGXT 4EKDA 5TQ0A 3FLMA 3PPIA 3EEBA 4N0MA 3AKZA 4TRNA 4B1FA 1OWMA 2OSBA 5F1KA 4HUJA 5LB2A 4BKRA 3IAUA 3IB6A 2OFWA 1HDZA 4EABA 2H00A 4PZZA 2BEKA 2DUJA 3VV3A 1A9SA 2NSJA 2QUAA 1T9KA 5TJHA 3JAMA 4UZSA 2DWPA 4RXTA 5JSZA 2QGFA 3BSSA 2HHJA 1M2EA 2HPVA 4YO7A 5LNK1 3V4FA 2Q8NA 3WLHA 1Y81A 4QYWA 4GM4A 5JCZA 3KZNA 1QK3A 3BZWA 4G6ZA 4PZEA 1GL3A 3PNPA 4ALIA 5BV1A 2Z6UA 5J5CA 3VYUB 1PR1A 3L3BA 3CT6A 1SUIA 3P9XA 1J90A 4X1IB 5FTWA 1K3TA 1WQ3A 2RK3A 1ZC3A 3S5JA 1B15A 4C6HA 4C78A 1T10A 3JQPA 3PWZA 4L5JA 5LU8A 2JDIA 1QG6A 1U3WA 4G56A 2O8FA 2C03A 4ES6A 3CN7A 4XZ3A 4EFLA 5KKCA 1W4CA 2ODPA 2VUUA 2O8BA 2BSXA 3ESYA 4URZR 5EWJB 3ZYZA 3RVRA 2BL4A 4LCEA 1T29A 1CDDA 3W1VA 3SEAA 4M60A 2CN1A 2J67A 2A9KA 4P34A 3VNQA 1WTAA 2A3NA 2AFIB 1ESCA 1TPYA 2R7MA 2VSXA 4MPRA 3UMCA 3ZD6A 1CDOA 1VHLA 2R11A 3SC4A 5JRZA 2D1TA 4M53A 1OB5A 1YRLA 1WEKA 1LK0A 3R75A 2G7ZA 3K35A 3Q7QA 4GR9A 3NYRA 4JC4A 1DAGA 2DBVO 2F43B 2AW3A 4RHXA 2TSYB 5CU7A 3UHPA 2WILA 3AJDA 4ENUA 4O4LF 1JQ5A 3BEOA 5C51B 1EBUA 1ECFA 3NHUA 5FPQA 2Q3LA 1E0AA 5EPUA 4J2TA 1BW9A 2NTVA 2W58A 1MJFA 4DANA 4EWLA 1I01A 1FC0A 3LW8A 4LBWA 1EZ1A 4ZMBA 5BW5A 1TW3A 2IY7A 1Y4DE 1YHYA 2R7LA 4K86A 4LEIA 2Z5GA 1ESMA 2GEJA 3W2FA 2BFEB 5L3SB 1PK7A 1RFGE 2IS2A 3HVUA 4GYYA 2ORED 4B6EA 3RS8A 4E21A 1ITZA 3BL5A 5GZ1A 1CQIB 1W8DA 4FNMA 4HHEA 3VKWA 3CNOA 2QYOA 3HEAA 3OFVA 1XD2A 1SO8A 2AG1A 2R8XA 1CJKC 2Z0MA 1A76A 1BMDA 3Q7SA 3RRXA 3JWJA 1NYLA 3ZHQA 1ZHOA 4RAOA 2PSHA 4KXYA 1A82A 5EWLB 3ICEA 3OUZA 4ZRNA 1DO0A 4YBZA 3ZIAD 1QTQA 1X7XB 4C7OB 5EZYA 2IYYA 2V7QD 1GQOA 2AW5A 2F2TA 1IY9A 4YCMA 4J07A 1NMXA 2WKPA 5IJ0A 3VH2A 4DCGA 4HLDA 4L51A 2QT1A 3S68A 1GY8A 3SFTA 1QO9A 4DHWA 3EODA 3S1SA 2ZRBA 2XWSA 1JB1A 2UYHA 1X87A 2BJHA 3ME5A 3OLQA 5KYXA 1T0JB 4EHBA 3C8DA 2VQ6A 3JAKA 2QIOA 1M5UA 3C5EA 3K0AA 2BGNA 2ZTLA 3R5FA 2ORYA 2RARA 2ZYDA 7REQB 1NPYA 4TYPA 3AF4A 4Q0MA 3N74A 3OMXA 5JG7A 1Z73A 1E2UA 1IQPA 3O74A 4C3ZA 5C32A 4L27A 1RHQA 2XUFA 4JHXA 2JC3A 3QU5A 4KL8S 1CZLA 1YJBA 2WAMA 5ALSA 5FEUA 1PJ8A 1V11A 2NV0A 2P27A 1P6QA 3WYBA 3FMIA 3I5AA 1H2WA 4MHOA 4QTZA 5DHTA 5H3CA 2HMAA 4XIJA 3JZAA 2FUKA 3IGFA 4X7PA 3N6XA 4P4SA 5MGNA 3G9TA 4ROSA 1DIBA 5E2BA 1A04A 2IYEA 5B7QA 4YJ2A 4JQSA 1WZNA 2YV4A 1O95D 1ISMA 4PANA 4WLOA 1NNEA 1A8PA 4KAAA 4QBTA 3UAGA 5CGZA 4LXIA 4XDZA 4TTRA 3NHBA 2JBWA 4BV8A 3IPAA 1CULC 3VPGA 5KYWA 2ETXA 4DG8A 3SHQA 3MYRA 3SKXA 4I08A 1MIHA 3O47A 2ZR7A 1R5NA 3H9JA 3W79A 4YCSA 4QU5A 1Q1NA 4EPRA 3ZE0B 3T7KA 1IUKA 1UH5A 2PLRA 4BP3A 1Y63A 2FH5B 3INNA 2FG7C 5KSZA 1JIVA 5J2TF 4LE0A 2ATIA 4JLUA 1TD9A 3RV3A 4EO4A 1Q2UA 4ZQEA 4G3XA 5IBCA 3Q40A 3HUUA 3JQ7B 4U0JA 1OV6A 3AEUB 5IT5A 2R84A 4WN9A 2Y0DA 4WZBA 3NVDA 4OQZA 2IDKA 3A9TA 5TR9A 1XNGA 5HM8A 4RDIA 4OQPA 2B1GA 5CM8B 3THRA 4YCDA 1Y1KE 2HADA 3DEHA 3DHEA 4YRFA 4ZVSA 2AI1A 1MO2A 3AJ9A 4N3AA 3TLJA 2ZSBA 3CUVA 2E1PA 4E3WA 2BSQA 3IB3A 4DKXA 1WR8A 2ILVA 5I9IA 3T6KA 2IL1A 3M4JA 1H0KA 1VL5A 3BCUA 3IUPA 4EHAA 3N2NA 1QFXA 2BSAA 3KDSE 1G20A 5TGZA 1NVTA 5HRAA 2BI4A 3VVBA 3E1KA 3KAPA 1YH3A 2Q99A 4XPZA 3TR5A 3ZX4A 3DSRA 1LWNA 4HPJB 4MPPA 1W75A 4LXTA 3D1VA 1KR2A 1RI3A 3L7DA 1RQXA 1WSBA 2DOKA 2XDWA 2A1TR 3V7YA 1QCYA 1R9JA 3HA5A 1G41A 2QDKA 4ZALA 3FDJA 2X1LA 5H5JA 4E2WA 4ZOLF 1Y1LA 2D7CA 2JGAA 4ZI5A 4D9EA 5DYWA 1ZH4A 1LRJA 1N2CB 2VXOA 1PAUA 4YRLA 5AKYA 2IF0A 4GDFA 1GCUA 3DOOA 2FUCA 5ABPA 1BKSB 4WA8A 4W1SA 3OQMA 2WOOA 2VJCA 1JG3A 1HOXA 4INOA 2JGDB 2A9PA 3BZUA 2ACKA 4F6CA 2M32A 5JQGF 2OXCA 4M98A 4ESOA 3D3QA 3HK2A 5AT1A 2HU2A 4O0LA 1YTLA 5KNCA 4JVOA 4LJ7A 4Q9AA 5KVAA 2O20A 4BUZA 2LNDA 3QKRB 2JKVA 1SKBA 4CM3A 2D6FA 3PXGA 2HLDA 3G0CA 5EG5A 1W96A 3RHTA 2WHPA 3BDIA 3M9XA 4AF8A 4LFCB 4RZQA 2VSOA 1L5LA 2P5YA 2GUGA 5FPTA 3UT5B 3P2JA 1XXHE 2ZE8A 2ERXA 2BJVA 3PB3A 4KAFA 4YT2A 5KC8A 5J2UA 3IIIA 5BW8A 2VS1A 1G16A 3GEEA 4EJSB 5AM3A 3ZQJA 3PDHA 1KEZA 3HN7A 3FOWA 2ATEA 1RC1A 4MWCA 4QJ4A 3EVBA 2UZIR 3AHCA 4AIIA 4BJ6A 5AJUA 3IFSA 1DG9A 3GPLA 1SRQA 1BGWA 3CZ5A 4YI3A 3U4GA 5JS2A 3QXGA 5AW4A 1TO1E 4JI2B 1NN0A 2HW8A 2VT2A 4NLLA 4BKQA 1QZTA 4KCGA 1TUGA 4KPGA 4P6VF 4WKOA 1JDTA 2XZOA 3PCTA 4GOOD 1J7KA 3AHEA 4M8NE 2WUFA 2XLBA 3H9UA 2Z1MA 2X14A 1P6XA 2OLEA 2X23A 2VJKA 1OAOC 1Y80A 2FMFA 3R4CA 2O19A 4OFXA 1QKJA 2NT3A 4OQFA 1H4VB 1U5BA 2RGGA 1IHUA 1EX1A 1ONPA 2GPNA 4PC6A 1E5DA 1BVHA 2Q3HA 2ACWA 2QRUA 3DTVA 1GAWA 1SUDA 3IUJA 3JQFC 1TGVA 3R5JA 4KBGA 3ZY2A 2II6A 3AYXB 3IQWA 5G4KA 2O6LA 4IGAA 3PWKA 2EL7A 4RV4A 4UDXX 1Z18A 1LD3A 3B3FA 3L06A 2WJPA 1IG3A 3MIIA 4FGSA 3SKYA 1M3SA 4M1QA 3I01A 5I7UA 1BXRA 4MMYB 4Q3NA 4N7BA 2WZQA 3NBKA 5LUBA 2QX7A 4N3GA 3Q3CA 3PENA 1OIXA 4DWWA 2L2QA 3A31A 5BRAA 2Q6LA 5JSUA 1A9QA 1UMBB 3EDYA 2XHZA 1JVBA 4TMWA 4DA7A 2O8DB 1TIPA 4BFWA 4NCXA 1O95C 2GJ4A 4OXXA 2IU6A 3QLUC 3VNVA 2UV8A 5JLJA 1PT6A 5CXSA 3BRCA 2C7RA 1TFRA 3ZUGA 3CNEA 4B7XA 2H52A 3GLGE 4C4YA 4FWTA 5A06A 1QHEA 2FPPB 3PFFA 4ISCA 5ILQA 2P7IA 1S0UA 1XTSA 2AEEA 2F9MA 3D6HA 1KTVA 1N2OA 5FFMA 5DW3A 1CUDA 1MCZA 3SNKA 4G8DA 2WQZA 3EIQA 4RD6A 2O8EA 3ZWDA 1LC0A 1XFDA 2XD4A 4C3UA 2RBKA 3L1KA 5CDFE 5DI3B 2QZJA 1FMCA 3PI6A 1O8BA 4RADA 1N6LA 2HF9A 4IIBA 2YWHA 3GMDA 5HUJA 2OVBA 1MX9A 3J81k 1ZVVA 4YCCA 1I30A 2QR5A 2PMFA 4KXNA 2KLHA 5G41A 1E2FA 2JF0A 4C3OB 1DAOA 1USKA 1RHUA 4L5IA 3TIVA 3IO3A 3QKTA 5ALJA 3TQSA 2XNHA 5DRYA 1NJ6A 3TINA 5TS3A 4FHFA 2IZ7A 5HKBA 3DHWC 1GLVA 3CTMA 4XASA 1JEDA 3AMVA 1XMIA 4M7WA 5A7FA 2ZIZA 3GD5A 3OE1A 1ZSNA 3BDAA 3T5TA 2GRJA 4IIUA 1TAQA 4Q18A 5CCEA 4R2MA 1L3IA 1LTHR 1IZ9A 3DMTC 3C3MA 5A0VA 2HOQA 2G06A 1I36A 4NVRA 3ASZA 1CNMA 2F1KA 4Z1MA 4C1NA 1NUPA 4YDSA 1WPRA 1R0CA 2C2XA 3EPRA 3U3MA 3GHYA 1ZCBA 1IN5A 5A5FA 3O3NB 3RFFA 4GPD1 2BMDA 5AKJA 1RU3A 3MQFA 3TCXB 1PFKA 5HVNA 1V25A 3F6EX 3IEIA 1A2QA 2FWMX 1KYTA 1CYEA 2IGTA 4QASA 3ZZUA 1J23A 221PA 1KPGA 2P35A 4O59O 3UMGA 5MN4A 4FMDB 2JGJA 5LP6B 1CUAA 2GESA 3KWJA 3PLRA 4FWBA 4JGGA 4NG5A 4QBFA 2AKEA 4WH0A 2ZQ5A 4A82A 3CSDA 4MRRA 3L4BC 2OGSA 3O8OA 3S6JA 1XRLA 3ZS8A 4L3WA 3GDGA 3FNQA 3N2GA 4R41A 4V1CA 4M0MA 2YV3A 5BN3A 4ECAA 3HN6A 1DEOA 3QM1A 3NVKI 4MQ5A 3W05A 1RWVA 3L40A 2QTHA 2YFHA 1UM8A 1IONA 2F1JA 1P2BA 4YJHB 3N53A 3SHOA 5EJMA 3TZEA 1VPTA 2JD0A 5A9RA 2RH4A 3Q85A 1F8FA 3Q12A 2NNLD 1MP0A 3SIXA 4E88A 4HXEB 2C1ZA 4IWXA 4EQZA 1I5EA 3GEHA 1HDOA 1L4HA 3MB5A 1POXA 3C6QA 4WVFA 5HQ3A 2QU7A 4P92A 1A5BB 4Z4FA 3P97A 2GN2A 3UV3A 5JJ5A 3DP9A 1K0UA 4GC9A 3ZU4A 3PX7A 3EFBA 1J70A 1TEZA 1C0PA 1EFDN 1QIGA 5C81A 1RVDA 4OYHA 3INGA 4BU0A 3WV4A 1GU7A 1GN9A 1G21E 3T0IA 1AUOA 1GNRA 3P32A 1FJ2A 4B09A 3SR4A 3HWSA 4R1PA 4IVPA 3KOUA 1C1XB 3SCZA 2AL7A 3LQYA 4KH0A 3TM5A 2G25A 1YB4A 2PD3A 5E38A 3WMXA 1QQAA 2EP5A 4CT0A 2M1ZA 1HEUA 4QGAA 5KNDD 4X20A 4WV3A 3AVYA 2IZ5A 4Q4HB 3PKIA 4IZIA 3PNYA 4GP7A 4YN3A 5HXAA 4UQLA 2JAWA 2QPAA 5ITZA 5TARA 3C3DA 4DMGA 3FZGA 1VIMA 1T24A 2JIRA 3DCJA 3Q9LA 1ZI8A 3BJMA 2Z4RA 5CDSA 3DXYA 3RS4A 4HQ6A 4I19A 1SKAA 1V8FA 4RVDA 3GVCA 2Y92A 1FX0A 1MOQA 4HXGA 5GM1A 5F7ZA 4JI4B 2VT7A 4HAUA 2VZ9A 2CJFA 2DBQA 3LU1A 3ZD8A 4M0PA 1V26A 3Q0IA 2ZYVX 4RIHA 1F8GA 4HOYA 1LRKA 2W83A 1IN1A 1RZVA 1Z3IX 2JJ2D 2YWRA 3RRYA 3CRVA 4QZVA 2H2IA 1DGQA 3EA4A 5JAUA 1JIXA 4TTVA 4ZKEA 5HQTA 4DSZA 3C7CB 4PNEA 3T7AA 4DHEA 4BHTA 4MS4A 3FOCA 2BFOA 3TZ6A 1ECLA 1NLYA 4C87A 2ODQA 2FRDC 3IAM1 4UE2A 1NBOA 1NX9A 2ZW9A 4PZDA 2PUHA 4H2DA 5GV7A 4DMUB 3R24A 1J8DA 4WHMA 1BU8A 2X5KO 1GA4A 5JYEA 3BWVA 4FT4A 4HDMA 3TF5A 1KRXA 4RK5A 3UEOA 1II0A 2KI5A 2XDYA 4E14A 3VKGA 3CNLA 4B75A 1XCJA 3N8DA 1N4DA 5CT9A 4P08A 2C58A 5E6UA 521PA 4EKGA 2P2GA 2D5CA 1VHJA 3U7EB 3PEVA 4OJKA