4GDMA

Crystal structure of e.coli menh
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
253
structure length
253
Chain Sequence
SMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 253
sequence length 253
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gdmA00
4MQLA 3D59A 1CV2A 1QIMA 2D0DA 2OGTA 4BZWA 4B6GA 2C5GA 2PSFA 2QM0A 2AJLI 2CB9A 3CCBA 5JIBA 5K5EA 4K6GA 5ALUA 3VKFA 3WA6A 2CUTA 4WFIA 2PL5A 4ITVA 3QZUA 3C45A 3KWFA 1THTA 5LZ7A 3DYVA 2XI4A 2HL6A 4KACA 3N2ZB 3FLAA 3HRHA 1M33A 1WPRA 5HFNA 1JJFA 3PFBA 1UKCA 1LPNA 1ACLA 2WUGA 4EY6A 1QOZA 3OC0A 2WIJA 1CFJA 3UUFA 3G0GA 2CKMA 1FFCA 1NX9A 6YASA 2R8BA 4KE8A 1ZD2P 1Q0ZA 2AJ8A 2FJ0A 1YAHA 2QJWA 1PFQA 4WDQA 4UHFA 2RAUA 4GW3A 1E8NA 3WKCA 3AIMA 5C81A 3FBWA 3H2IA 3F9CA 2HU8A 1CUSA 4MYSA 3D7RA 4X7BA 4X93A 5HF6A 3A70A 3WJ2A 3IULA 4XVCA 1H23A 4Q34A 4E15A 2WIGA 3TRDA 4HRXA 1CUZA 2HA7A 4OYLA 2B61A 5IVKA 2WUDA 4W1QA 4AB1A 1Q0RA 3AFIA 5BWBA 4OB6A 4U2DA 5I7UA 1G42A 2XT0A 1DX6A 4DNPA 4QE3A 2LIPA 5LKRA 3UMJA 3WWPA 3ANSA 3H1AA 3IUMA 5A6VA 4GHWA 3AJAA 3WLAA 2H7XA 1XZFA 3WIBA 3WK4A 5CT5A 5CURA 5E4TA 2OQVA 3DOIA 2RGUA 3YASA 2JF0A 3BIWA 2DHCA 4U2CA 5DYTA 5HF9A 5LP1A 1WM1A 4B0OA 3BIXA 5AK3A 5AKLA 2Y1KA 3F67A 3D3NA 3K9BA 3H2GA 2GZSA 1LNSA 5CRIA 2VT6A 3R40A 4LXHA 2ZSIA 1PV1A 4UHDA 5KWIA 5JARA 4Q3KA 1Z68A 2RHTA 5KWJA 5ALLA 4PW0A 5FDFA 2O2HA 2CJPA 2HA4A 3AINA 1E66A 5AICA 1ZD3A 1BRTA 2ES4A 4Y2SA 3WL7A 1XFDA 4N8EA 4RE6A 1T4MA 2O7VA 4QDTA 3I6YA 1SOMA 4F21A 4QWMA 3WYDA 3NUZA 5T4HA 4KE9A 3MGAA 2I3DA 1K8QA 3C8HA 5JAUA 2QTBA 4FBMA 4CG1A 4DLNA 3M81A 4LYDA 1CUVA 5CXUA 4OU4A 2WJ3A 4FTWA 5T4EA 1MAAA 4KAFA 5AJHA 3W06A 3N0TA 3F98A 3IA2A 4U2GA 4X92A 2WHPB 4I3FA 4X6UA 1EVQA 2XUPA 3CN7A 3HC7A 3R3UA 3WMRA 4E11A 2PU7A 1K5PA 3IDAA 4J3JA 3NOXA 1WB4A 1S8OA 1W6RA 1UKBA 4LYEA 2BCEA 1XKLA 1QONA 5D6OA 1BCRA 2B9VA 1QLWA 1GT6A 3AUKA 1WPXA 3ZWQA 1EB8A 4GECA 5HCUA 4HRYA 3PICA 3ZI7A 2WTMA 4GWLA 5JASA 3WL5A 3S8YA 3LCRA 3TJMA 1TKRA 4YK7A 3O4GA 1FFAA 3W9BA 1XRRA 5EHZA 2Z5GA 5HK9A 4X00A 3QPDA 3F96A 3R3XA 5ALDA 2HFKA 4RGYA 1MTZA 2BUCA 5HKAA 1E8MA 2XQGA 2E3JA 3F97A 1WCYA 3DQZA 2OGSA 1FFEA 5AKJA 5DTJA 4RE5A 5CW2A 2XLCA 3WYNA 3OURA 3BJMA 3QH4A 2RHWA 3DKRA 3WI7A 2CEKA 1EDBA 4FFWA 3O9VA 4JNCA 2XUGA 2YH2A 3V1LA 1UZAA 5T4FA 5ALFA 5C7YA 1BROA 4LHEA 2IIVA 1E89A 1MX1A 1QIIA 4M0FA 5A2GA 3H19A 4MQMA 5ALHA 4C4YA 4EB0A 1ORWA 1TK3A 2JGKA 3FSGD 4YASA 1YCDA 5SYNA 1ZJ4A 2IITA 2R11A 3TEJA 1CUWA 4Y2TA 3C6ZA 3WL8A 4NS4A 5IVIA 2WKWA 5AIBA 4UFPA 3I2FA 1J06A 1AUOA 1L7AA 1QIJA 3ZLUA 4BAGA 4MXDA 2X76A 2C5FA 1ZJ5A 2YASA 1JJIA 1X70A 3FOBA 4UBNA 1BN6A 4P08A 3I2IA 4H0CA 4K2AA 1F6WA 3HI4A 3RM3A 3DKKA 2VEOA 4W63A 2JEYA 2QUAA 5AM4A 4L0CA 1ZGBA 4E46A 2DR0A 3A2NA 5KREA 2OAGA 3G0CA 4Y2VA 4AXBA 4XX1A 2WU3A 3R3YA 2BFNA 2WU4A 2VSQA 4EUSA 2WSLA 4B82A 4X97A 3PUIA 3QYJA 3D2BA 3LP5A 4C01A 1DQYA 5EHNA 2DQYA 4QDOA 3IUQA 5D3KA 2QOEA 5K3EA 5F4ZA 1X2BA 2XUFA 1CQWA 5CT6A 3SX4A 4OPMA 4W1PA 5EI5A 1B41A 1XZLA 3LLCA 3ANTA 3H17A 2ZYRA 1UFOA 4WFKA 1XZAA 1CQZA 1LPAB 3I2GA 4H7IA 4KAJA 4EY7A 3U1TA 2C0PA 1CLEA 3WWOA 4GEGA 2XMQA 1CR6A 5EGNA 1CUAA 4G9GA 1BE0A 1LPMA 1IZ7A 1CIJA 2WFLA 3KXPA 4B9AA 3W05A 1BN7A 2DFPA 3EQ8A 1AZWA 1XZCA 3R0VA 3QM1A 4UPDA 1CUBA 5LZ2A 3IURA 1R3DA 2C4HA 4KAAA 2VJAA 3BE8A 5AI9A 1AMNA 5A7FA 4K5QA 3AZQA 2W22A 4KEAA 2J3DA 3FCYA 5DWDA 3IUNA 1P0PA 4OU5A 4Q82A 1EDDA 3W04A 5A7HA 2WHPA 3O4HA 5AOCA 4I4CA 5FXMA 1U4NA 5LKAA 1GKKA 1CPYA 5ALEA 1TIBA 2VATA 3C70A 3KDAA 5HQ3A 2WUEA 3VJKA 4G4GA 4H7JA 5JD5A 1LPPA 4IO0A 1FSSA 2ZYHA 1BU8A 2Z3WA 5JAHA 2Y6VA 1GPLA 1L7RA 2EDCA 3WKDA 4DYHA 4KE7A 5JZBA 4C88A 5AKYA 4Q3LA 4TPKA 3WKBA 1W52X 1DT3A 4AZ3A 1R4ZA 4CI9A 1E3QA 4RPCA 3P2MA 4TGLA 2XUHA 5AKZA 1GQRA 5ALMA 1HPLA 2W6CX 3I6MA 3H0CA 3HACA 4AN1A 1EVEA 2XDWA 4UFNA 1QIFA 1A8SA 4ZV7A 1YAJA 4BCDA 2GYVA 4AN0A 1UOOA 3HSSA 4MEBA 4EHBA 1XRNA 1L7QA 4MYDA 2WM2A 4BRSA 2XUAA 4PF1A 1JMYA 4J0JA 1P0MA 1F0NA 4RNCA 1ZI8A 2I03A 2VJBA 2P8SA 4AO6A 3AZOA 4U2EA 3E1GA 4CG2A 3WK7A 3A2MA 4DNOA 5LLSA 3EQ7A 4HXEB 4GLBA 3OPMA 4C4ZA 4MWTA 4OB7A 2UZ0A 3HLKA 1CUJA 4YPVA 3PFCA 1A7UA 4F60A 5CT4A 5CT8A 2VJDA 5ALKA 4AO7A 4UHBA 2VAVA 5CTAA 4H7HA 2XUKA 3K2IA 1QIDA 4H7DA 4PV7A 4X85A 3DNMA 1YB6A 2H7YA 1XLUA 3STTA 4AZ0A 1UK9A 2RONA 4Q1VA 1TCAA 4IQ4A 3G7NA 1EH5A 5ALYA 3V1NA 3H04A 4BDTA 2HDWA 1D07A 2QVBA 2Q0XA 4XJVA 3Q0TA 5ALXA 4B80A 4D9JA 4DMCA 4C89A 2VJCA 3ZLVA 3GFFA 4CFSA 3EF3A 2VQ6A 4J0GA 2WIDA 3UUEA 3WJ1A 2JGJA 4Y9SA 2WHRA 2V96A 1YSCA 3E3AA 4DTCA 4OSEA 3O0DA 1CEXA 1ACJA 1UWCA 4BRZA 4EZIA 3OTQA 4UHHA 5FLKA 3GBSA 1WOMA 2C7BA 4Y2RA 5HF8A 1BCSA 1QFMA 2ROQA 3G9ZA 1LGYA 4MWSA 3WK9A 1CUDA 3D4LA 3HYSA 4KYVA 1LPOA 3G0IA 3D5EA 4ARBA 3DLTA 5FRDA 5YASA 1XKTA 4J0CA 4WY8A 1H22A 3VXKA 2BUBA 4NMWA 3PUHA 2OAEA 4FHZA 4PO3X 1W1IA 3T4UA 1N1MA 2C58A 1JI3A 1IVYA 1RYYA 2FX5A 4J0DA 4CCYB 5DYWA 4B83A 3U0VA 1N5RA 5C8VA 1A8QA 2O7RA 2WFLB 3PF8A 2CBGA 2Z8ZA 3R3ZA 4CG3A 2WIFA 2OXEA 4BE9A 1GPKA 4W1RA 5FPQA 4B9EA 3A2LA 2BKLA 5LZ5A 3G02A 3L1JA 1UKAA 2ZJ6A 5ALPA 4W1SA 2XMGA 3VDXA 1AQLA 3R3WA 1R50A 5FUMA 4NZZA 1DWOA 2B20A 2H1IA 2OCGA 4FMPA 3C5VA 4BVKA 4UBKA 1DWQA 2Y2UA 3O95A 3QBJA 1IMJA 1YS1X 5HQ3B 4FLMA 1XZHA 4H7EA 4W9RA 2YXPX 2XMRA 1WHSA 3DYIA 4TVKA 1J2EA 2XUDA 4XWGA 4MEAA 2HA0A 3DCNA 2ZSHA 5LYYA 2CZQA 4KE6A 3G9TA 1CUEA 3FLBA 2XUOA 4HXGA 2ECFA 1THGA 2QUBA 3ESDA 4J7AA 2PU5A 4QDXA 3H2JA 3STUA 4FOLA 4B85A 3ESCA 1XZMA 2XMCA 3RK4A 4CIBA 2PSHA 5AM1A 2PSEA 4B84A 4Y2UA 3VJLA 4OCZA 2JGLA 3B3QA 1O6GA 3NWOA 5JYCA 1AGYA 2XUJA 4J0IA 1VE6A 1QIGA 4N5IX 4UHEA 5AI4A 3MUNA 3V1KA 4BCBA 5AIAA 2NW6A 2OLEA 4GBGA 5AKHA 3I28A 4J03A 1Y7HA 2O2IA 3DOHA 2VA9A 3JWEA 5K3CA 4AMYA 2WIKA 3FVTA 3I2HA 1CUGA 2WFMA 2WJ4A 5ALSA 3BXPA 5DNVA 1XLVA 1ZIXA 4AQDA 1ZGCA 2PPLA 3DD5A 3H2HA 5EFZA 2QJRA 4ZRDA 3GA7A 3WK8A 3WIOA 2ZVDA 4AX4A 2B4KA 1KU0A 2PSDA 1SC9A 2PBLA 2OG1A 2X5XA 4BE4A 4BC1A 3PDCA 4DIUA 3FNBA 3EIOA 1CUCA 4WDRA 4FFVA 3QMMA 1B6GA 4J0HA 3AIKA 2FJPA 1G66A 1W75A 5AO9A 4YX9A 1TAHA 4BTLA 1N8SA 1EI9A 3D2CA 3WWEA 5BV7A 3AILA 3K6KA 3WZMA 1JKMA 4P92A 2XQKA 1AC5A 5AK4A 4G1FA 1TQHA 2WLSA 4X6XA 3G0BA 4C87A 4H77A 5AI0A 4ZWNA 3FSGA 5DNUA 1GZ7A 3STVA 1I6WA 4BVJA 5A71A 4BCCA 2OPHA 1MPXA 4EA6A 1DQZA 5EIHA 1ETHA 2JBWA 4X3CA 2WJ6A 2ZYSA 1VA4A 2ZJFA 1J1IA 3GROA 4X71A 4PSCA 4FNMA 1LBTA 3O4IA 3C87A 4G8BA 1IUNA 4QWWA 1CUHA 2PUHA 2WG0A 4F0JA 4FBLA 4B81A 3OG9A 3CCCA 5HKBA 2XLBA 3DJYA 2HA2A 3VISA 3G8YA 3WZLA 1H2YA 4QDZA 1ZD5A 4CCYA 1H2XA 4Q3OA 1R9NA 2JEZA 1EK2A 1K6EA 3O9MA 3WQHA 3ED1A 5KBYA 5ALJA 4U2BA 2WUFA 5FPPA 1BEEA 5AM5A 1XRMA 3D0KA 2H9YA 3HXKA 1TRHA 4QLAA 3FAKA 4HTAA 1TCCA 3BF7A 4ZV9A 1MJ5A 1VLQA 1H2ZA 4UBJA 4QLOA 5A7GA 5JALA 3BF8A 4BBZA 1VE7A 3CN9A 2QS9A 2V9ZA 1ZICA 2Y6UA 3WWCA 1MT3A 1ODTC 3M82A 5AKGA 4FWBA 4KRYA 5AM2A 5JAPA 3HEAA 4IH9A 4L9AA 3RLIA 1O6FA 4OD0A 3IUJA 5J3JA 3WK5A 4QDUA 5AH0A 1RWQA 5K3FB 1XRLA 1G5FA 1HBJA 1LZLA 2ZJ7A 5FP0A 4H35A 5SYMA 4DSAA 4H7FA 1UOQA 5JAOA 3H18A 4OYYA 4V2IA 1EK1A 1R1DA 3KSRA 1WHTA 1EA5A 1FJ2A 2AXEA 2OCIA 5AI8A 1EINA 3BWXA 5E4YA 4KR0A 2PKYX 2HU7A 3WKAA 4OB8A 1KU6A 4HVTA 1ODSA 3T52A 4QZVA 4BP8A 3FYTA 4CCWA 3LIPA 1E8DA 1DU4A 1QO9A 4M0EA 1JU4A 4CIAA 1H2WA 3FYUC 1RP1A 1JT2A 5AKKA 1R9MA 2BAGA 4LKOA 2XUIA 2RI6A 5I8PA 1MNAA 2PSJA 4A5SA 4BVLA 1UXOA 3DEAA 3WL6A 1HDEA 2VAXA 5EIAA 4G9EA 1GXSA 4A23A 1G4HA 1F0PA 2H7CA 3QMWA 3BL8A 4G8CA 3O4JA 1IUOA 5JZ9A 3ESBA 1JU3A 1T2NA 1Y37A 5AOAA 4NVRA 2Z3ZA 1Q83A 3C8DA 3Q8WA 4MJ3A 2QXTA 1IZ8A 1P0IA 1XROA 2O2GA 3GELA 4DM7A 4HZGA 1QFSA 3VVLA 1QIHA 4L3WA 5AKEA 1YA4A 2EEPA 5AI5A 1LBSA 2XQFA 2WHQA 5DLPA 5CXXA 4WY5A 2VT7A 4U2FA 3M3DA 3DL4A 1CUUA 5JANA 4E14A 2WG1A 5AKXA 1NU8A 2XQIA 4PQEA 2AJCA 3KD2A 4A16A 3D2AA 2QRUA 2HIHA 2RIPA 5ALWA 2ACEA 3ICVA 5DNWA 3BDVA 2HA6A 2PVSA 3DDUA 1OXMA 5EHXA 1XQWA 1N5MA 1JMKC 3I1IA 3EQ9A 4O08A 5DYYA 3BJRA 2HA3A 3KWJA 5E4JA 5ALRA 5HF5A 3IVMA 3OM8A 5CH5A 3MUOA 4Y2PA 4UBMA 5LZ8A 5IVHA 4UBLA 5CH8A 1BEZA 2XB6A 1USWA 2JGEA 3G0DA 4B7ZA 2QXUA 3RKSA 2QMQA 4G8DA 1UK8A 1UOPA 1XZDA 3FWHA 4B0PA 1QTIA 1LLFA 4JYPA 2WQZA 3NGMA 2Z8XA 1HLGA 1VXRA 4BB0A 2PUJA 3I2KA 1UK6A 5IH7A 5ALOA 3SC2A 1CVLA 1DTEA 4BYMA 3QPCA 2ONCA 1OILA 4QNNA 1XZKA 5AK6A 3W2TA 5D7BA 1MX5A 2OCLA 2WG2A 1QTRA 2JGFA 3WA7A 2GBIA 2HHAA 3PF9A 3H1BA 3ICWA 1VXOA 2J4CA 4KJXA 4JYMA 4UBOA 2XMBA 1FFBA 2GYWA 1UT6A 4K6KA 1HQDA 4HS9A 1XZBA 3E0XA 1J07A 2D5LA 2J3QA 4FKBA 5ALIA 4HXFB 4QEKA 4G4IA 5I9IA 5A62A 2XUQA 3WK6A 1A88A 1CUYA 4BP9A 3LIIA 4X95A 5EHQA 5ALTA 1DT5A 3TGLA 3V9AA 1QIKA 1MU0A 5ALVA 1GPNA 5DTIA 4FNGA 5ALNA 5IKXA 5K3FA 2JGIA 3FYUA 2BGRA 5EIEA 1KEZA 3ESAA 3STYA 1JJBA 3PI6A 1GKLA 4EBBA 4WJLA 1ZOIA 2HU5A 2YYSA 4X91A 3E4DA 5ALZA 3V48A 1QIEA 4DGQA 2HADA 2BUAA 2OCKA 3H2KA 2HRRA 1R88A 3CXUA 4X94A 4H7KA 4IHAA 5C8ZA 2IX9A 2QT9A 1SFRA 1WB6A 3F8SA 2VF2A 1JFRA 1VJ5A 2GBCA 1GGVA 3IB3A 4INZA 2DCMA 4ROTA 4N5HX 2I78A 1QE3A 4S0XA 1ODCA 1VKHA 3AZPA 5T4BA 3QPAA 5ALQA 4ETWA 4GI1A 2XMZA 1ZI6A 1VA5A 1MN6A 2I3ZA 2HFJA 2K2QB 4M0MA 3IBTA 1C7JA 1VZ2A 4DSZA 1GQSA 5AOBA 5AP9A 2XMSA 7YASA 3I1YA 4JH0A 3BDIA 4LXIA 1ZIYA 5AKIA 4KRXA 1DINA 1XRQA 1XZJA 4UBIA 1XLWA 3ZPXA 5HFAA 3B12A 3WWDA 2EDAA 3DL7A 5LZ9A 5K3DA 5LIPA 4ZREA 5JD4A 1FFDA 5ALGA 3G9UA 3GUUA 1SCIA 2DSNA 5HZGA 3RARA 1OCEA 4UHCA 1IUPA 4DMHA 4DNFA 5DJ5A 3MVEA 4UFOA 1MNQA 4BDSA 5H3HA 4GXNA 3WKEA 1F8UA 2OGZA 5IVDA 3KOOA 5FV4A 4L72A 5CMLA 1XQVA 4UUQA 4BAZA 4BAUA 4G5XA 3JYHA 2QZPA 1AKNA 2PX6A 5JZSA 1QGED 1DX4A 1XRPA 3X3HA 1YR2A 2VTVA 4G4JA 4IH4A 3JW8A 1HL7A 5HK8A 2FUKA 4Y2QA 5BWCA 2GBFA 1EX9A 2AJBA 1QZ3A 3FLEA 5K3AA 4BTVA 5AHXA 5ISMA 1EB9A 2V98A 2XE4A 4N8SA 1X2EA 4X6YA 1MAHA 1A8UA 3GZJA 1LPSA 5FKJA 3FVRA 4LXGA 3R3VA 3C6XA 2JGMA 3QMVA 3W9UA 1YS2X 3B5EA 4Y7DA 3C6BA 1MX9A 5CH3A 4BATA 2HRQA 4FLFA 1UK7A 4Y2JA 1U8EA 2GBGA 5JD6A 5FOQA 1WB5A 4WCVA 2AJDA 3SK0A 1EHYA 1VZ3A 2DQZA 1NU6A 1W76A 3I6ZA 3PE6A 4ZI5A 1MO2A 1XZEA 1SCKA 2ORYA 2X8BA 5D3ZA 3A6ZA 2XQJA 5AM3A 4AO8A 3VVMA 4WFJA 5AM0A 2HA5A 1XZGA 3IIIA 4X90A 1C4XA 1CUFA 3LS2A 4C6HA 1U65A 1PJAA 3AIOA 1EXWA 4GDMA 5CT9A 1CUXA 4BC0A 1BS9A 2G4LA 1QO7A 1XZIA 5K3BA 2ACKA 5JATA 1CRLA 2XMDA 2G63A 3HABA 4Z49A 3VJMA 5CBKA 4ZXFA 3DS8A 3R41A 3HJUA 4P93A 3FCXA 2OQIA 3HZOA 4Y2XA 3C6YA 1U2EA 4P9NA 5ESRA 5JADA 4LIPD 4ARAA 4IH1A 2JIDA 3S2ZA 4H18A 1VOTA 5C8XA 4PSUA 4I19A 3ZV7A 4QA9A 1TCBA 1ORVA 4DNQA 1AX9A 3C5WP 3OOSA 3L1IA 4Q05A 1ISPA 2BJHA 1YB7A 4K6HA 2J4FA 2ZYIA 4OUKX 2V97A 3EBLA 4PNZA 2WILA 1P0QA 3C43A 1ZD4A 4DMFA 1CUIA 2G5PA 5E2IA 2GYUA 4C4XA 1DWPA 4F5ZA 3G9XA 1Q84A 2C0QA 1YA8A 2QR5A 3FYUB 1ZI9A 1QJ4A 3I2JA 1SCQA 2G5TA 2GZRA 1LZKA 2DHEA 4HAIA 1AURA 4J0KA 1YASA 3ILSA 4JUIA 3QITA 4JEIA 4EY4A 3V1MA 4Y2YA 1C7IA 2BGNA 1EDEA 1XQXA 2DHDA 4PSDA 4ZGBA 1Y7IA 4FDMA 5BOVA 2PM8A 4FLEA 1K63A 4DMKA 4AMZA 3STXA 3QVMA 4EY5A 2HM7A 2WTNA 5AK5A 1W4LA 5AI6A 3M83A 3ZLTA 4N8DA 1K4YA 3STWA 1LPBB 3SWWA 2WFZA 5LZ4A 4EY8A 1HKHA 4BZZA 4XIIA 1XQYA 2QKYA 2Y2VA 1E5TA 3L1HA 2CMFA
chains in the Genus database with same CATH superfamily
4D0RA 2O20A 3INGA 3L4SO 4NBVA 2OGTA 2D0DA 2EJVA 2IYQA 3UN1A 3PQ6A 2F1JA 4BNLA 2I22A 2P62A 2QM0A 3MTEA 3KBBA 2XOEA 5FPYA 5KVCA 1HQCA 1PEDA 3E8SA 4AMGA 4RHYA 2HD4A 4D26A 2VDWA 3KUDA 1JR3D 4X63A 3NVMB 4AMVA 5LFAA 1KERA 4WFIA 2PL5A 4OK6A 2V55B 1GNRA 3PNKA 1Y5RA 3QLUC 4KO3S 1F4LA 1XXLA 5LZ7A 1OXKB 1XDSA 2NXEA 1MABB 4NEGA 5AT1A 4CQMB 1Z45A 2XCTB 2BKEA 2HIAA 5ICSA 2XI4A 3CX8A 2QK4A 2Y1OA 4NE2A 2EQ5A 2PTGA 4REOA 5IBPA 3L1KA 2RC5A 3A6JA 1M33A 3LBIA 5AHKA 3T5GA 1WQ3A 5BNIA 2O06A 3VR6D 2ORWA 3ZDAA 1I01A 3BAZA 4ZT2A 1FUUA 4YRMA 3KFVA 2HJRA 1NR1A 2XGGA 3TGPA 1SB8A 2FRDC 3PFBA 5ETJA 1U6KA 2OM6A 5F98A 1FPMA 4OQ4A 4WVLA 3G2JA 2QQFA 3L1VA 4PYQA 4WNCA 1DO2A 1LTHR 1TYBE 1XA0A 1LPNA 2R8OA 4E2YA 5CFOA 1UBNA 3PC4A 1UQRA 4OUDB 3T3IA 1M2FA 2CXXA 3DZ8A 3KE9A 4G1EB 3HGMA 1P2TA 2XY4A 1F3OA 3O4RA 4HCJA 4L7VA 2Q7XA 3AF6A 4V0NA 3EASA 4F6LA 4D0SA 3ETHA 3U4HA 3OC0A 3Q5GA 2WIJA 1NKTA 4LVCA 4ZQFA 2BMDA 1SKYB 5BW6B 2PYZA 4WHMA 3JWPA 2CKMA 2GD2A 5K51A 5TARA 2B69A 1FFCA 1E3SA 2BEVA 2R8BA 1T2DA 5ESDA 1Q0ZA 2AJ8A 2OFOA 3CLRD 4MI3A 4ER0A 2X6RA 5DM1A 2Y0CA 5CFZA 4PCLA 2L18A 5BW4A 4ER3A 5F35A 2BZSA 2G76A 3WKCA 4EP1A 1KJYA 2NM0A 2VSYA 2QJFA 4RA9A 3HLTA 2VP9A 4LCBA 4W9NC 2NADA 3AIMA 3WMFA 2Q3LA 2GTPA 2WDZA 2NT3A 3IAM6 2W8BB 2GZ1A 1YS9A 1AT1A 1E9AA 1PDWA 1J1ZA 3H2IA 2H00A 4I1SA 1RBQA 1UDXA 3D7RA 3G59A 4QYWA 4C4AA 3K6SB 2VHEA 4ZHSA 3WHPA 4LHZA 3TIIA 3IULA 2XITA 4TWZA 1XTQA 4RY2A 3GJRA 2QTCA 1I24A 5JXHA 4XVCA 1H23A 1CZNA 2CYAA 3NVKI 2KE5A 2WIGA 3UMRA 2O0MA 4ALJA 1MEEA 2VPQA 2QWXA 1NVFA 5DMXA 4DRXA 3ODPA 5KU1A 2CXTA 3FUTA 5EQTA 2B61A 2AE1A 2XWBF 1A72A 1UKZA 3I45A 5A4MS 3T1HB 5IVKA 2EZTA 2AC4A 4EVIA 3P4UA 4QRHA 2HWUA 4ZHQB 1Q0RA 4EUFA 4RZIA 1IHDA 1N9KA 3I62A 5JAIA 3PFWO 3AFIA 3PU6A 2VNKA 4FCTA 3LP6A 1HTTA 3QA3E 4OB6A 4PQGA 3HKBB 3SYLA 1C7ZA 4ER6A 3QWFA 1SCDA 2R7MA 5I7UA 1DRUA 2JK1A 3HU3A 3IQXA 1QXSA 3PHCA 3DOEA 4GMDA 1NFQA 4R1MA 3W1WA 4YRIA 4K9DA 1T4BA 4NMHA 3L0YA 4GT1A 2XNDA 4QE3A 2GJ9A 3GLRA 2LIPA 2QTWB 1Y98A 4MVYA 3GF4A 3F1KA 3UY4A 4HYQA 3BT7A 4HFNA 3WWPA 1Z83A 2NU7A 4FUQA 3M1IA 4EHFA 3H1AA 5A6VA 2YMQA 3IR7A 1Y4AE 4IOLA 3L4EA 4IAOA 3S40A 1JIUA 4CHGA 1V7QA 4GHWA 3KX2A 1K9VF 1XX6A 3G2OA 1II8B 1ISFA 1TCUA 1I9CA 1DJLA 3VYSB 3WK4A 3QU9A 2IYNA 4DLSA 5E4TA 2X4IA 2ZSFA 4GMXA 4I3HA 3RQSA 4MWGA 1CETA 3RYCB 3DOIA 2RGUA 4QUAA 1UFQA 3BIWA 2DHCA 4L9WA 1W36B 4IIJA 1KAHA 2PQ2A 2EJUA 4NMXB 3Q4GA 2LTAA 5HE8A 2BGJA 4OQPA 5DYTA 4BVHA 1ILEA 3M5WA 3PDIB 1U81A 1XYGA 3GU3A 3G68A 4F12A 4ZJUA 1QG6A 3UF0A 2IV3A 2PNJA 4YAJA 5AKLA 3DMGA 2X0EA 3LPAA 2P3OA 4OAPA 4TMZA 1GYQA 3QPWA 2OFWA 4U63A 2BIFA 5CRIA 5T8KA 2VT6A 4WWHA 2FSHA 1A5ZA 4LXHA 2P0YA 1JBEA 1J56A 4J90A 5IEBA 3EJ6A 3U62A 2XWPA 4CUKA 5BSEA 2AQKA 1LDMA 2QUKA 1SIUA 1OZGA 1TZKA 1RPTA 2GDZA 3COSA 3DBIA 4RKFA 4BNDB 4S05A 1RJ9B 3ZDFA 2B3DA 5I9NA 3GLGB 5TNXA 3QU4A 4UD2A 4CMBA 3R9IA 2VDJA 1ZMBA 2CJPA 2ETXA 1RI1A 3HS3A 4TM8A 4Y2GA 3AINA 2LPMA 2D3TA 3G0OA 1E66A 5FNVA 3QLVC 2J3LA 1ZIOA 5JO9A 1YNSA 3D3QA 1RM3A 2ANBA 2XA9A 3HE3A 5DDIP 1KMIY 3QX9A 4Z1MA 5M34A 2ES4A 4Q9KA 4Y2SA 3WGNA 1K5GA 3MWKA 1JFFB 3WL7A 2IZ5A 3RAFC 4NESA 1NL3A 1HDYA 2C97A 2ZU0C 1XIVA 3U7GA 4PIPA 1FLVA 4Y2HA 4N8EA 1OU0A 5L9AA 5SYAA 3GZNA 3I6YA 1G8KA 3KQOA 2F1OA 2QPOA 2J7PA 3WYDA 2BGWA 1KMQA 1CR1A 3CE6A 5F1KA 5DLYA 5T4HA 5A4FS 3DZIA 5JE8A 2HSEA 4I4LA 3KAQA 2GEKA 2ZB7A 3OSUA 1V1RA 4LW8A 4DJ5X 1D2EA 1J0AA 2QTBA 4GQAA 2AF4C 2Z2JA 5ECWA 1NRXA 1OIXA 1CIVA 3KR2A 3M81A 5FTNA 3EGXA 1QQ5A 2YL2A 1SCBA 4TSFD 1G1MA 1CUVA 3F8WA 3QEKA 1FB5A 5AXCA 1FJXA 3U7QA 4NOKA 3M49A 4RXTA 1JA9A 1NF2A 2QLFA 1C80A 1M2OB 2R1TA 2WJ3A 2G1KA 3LZCA 3MSCA 4MWDA 4BX3A 3KPYA 3QKRB 4HRVA 2WTBA 4DOMA 4DG5A 2WSBA 4IV8A 3QJYA 4QLBA 3UMFA 2YV2A 4K9SA 3OZ7A 4GPTA 4TUYA 3SVLA 4ND8B 1SXQA 2O54A 4URHA 1F8GA 2JLRA 2X2OA 3F98A 3IA2A 5FOTA 3ZGNA 4U2GA 2DECA 4RHEA 3GFVA 2DKNA 3RASA 4QQ8A 3A14A 4X6UA 1EVQA 3EC2A 1YBMA 1UDWA 4U9HS 1Z56C 3QKSA 2BM0A 3KEGA 5L6MB 2PU7A 1NYQA 4K9KA 3RT9A 1RMTA 2C2GA 4ILEA 4X1IB 3FYDA 3KKLA 2PT7A 4OTZA 4BU1A 2FVXA 4TMVA 1S2DA 4E2FA 1YQQA 1RW4A 2C5SA 4IG4A 4RGVA 2AGVA 2HF8A 3BSWA 3NVDA 2P6RA 1QFYA 5EZYF 2XOKD 2WWRA 3DHYA 2BCEA 1XKQA 4H6PA 2J5BA 1XKLA 3L7JA 4IXNA 2WTAA 1H42A 5BW5A 2ZRDA 4FYVA 5DHPA 4P2BA 4AQYB 4DAOA 4YCMA 5K05A 3DZGA 4DHWA 1PSDA 2C4UA 4JKYA 3HR4A 2ZJOA 2J45A 2B9VA 2OCYC 3EVCA 3HXTA 4XPIB 3VYRB 1JIJA 4X7MA 4HVAA 5K2MA 1Y7TA 1R15A 1EB8A 1VBMA 2G77B 2CFTA 2V6IA 4U9UA 2FWAA 3UMYA 3CFYA 3DVQX 4QPCA 4I1PA 5EJ9A 5BMOA 2PQ6A 4RV4A 4CV0A 1TRKA 3F8TA 4W7IA 2IZ7A 2QTTA 4KG7A 3SPXA 4MB6A 5H3CA 2ZRCA 4XB1A 3AVVA 3I6BA 1GL3A 1PEAA 2H54A 3PQEA 1V48A 3BL5A 2O0LA 1T8YA 3G3EA 5DGTA 2QSJA 5G02A 1JVBA 3K72B 3BZUA 3T1OA 2NUAA 3BQ9A 3EIUA 4OREX 4HLNA 5EUBA 5CB0A 1SM4A 3O4GA 3CYFA 3GP5A 4LUCA 3FKJA 2GUWA 3HM2A 1TU4A 5HGJA 2O8FA 3DE3X 3ZH2A 5JC8A 1KVQA 2Z5GA 4X41A 3HKCB 2COEA 5HK9A 1MV5A 1ZEJA 4PYLA 3PEYA 4I9NA 1S1CA 2LXNA 1GUDA 5D5HA 5C3UA 3WNBA 3G17A 3RAPR 1B8NA 2PH5A 2XQGA 4B3CA 5KSYA 5AJXA 1KS9A 4YHBA 1UFVA 5DEIA 2DUJA 3F97A 3BTOA 3V42A 3FPHA 2I6GA 3U7EB 1ZZEA 2HT6A 2WJYA 2VDKB 2W4MA 1FFEA 2DPYA 4KBYA 4ZGGA 1RXVA 4YCCA 1PJ3A 1OX5A 1CE8A 1LBEA 2R00A 1Y4ZA 3FBTA 1FDUA 3OURA 3BJMA 4NATA 5U4XA 1GNTA 3HFSA 1WDTA 3GIDA 3HFRA 4S1PA 3N9IA 3RRNA 3WI7A 4AY5A 2XECA 1KHTA 3OTGA 5EJ8A 1YU9A 3BE5A 4RF4A 1NUHA 2EWMA 4AZVA 1GLVA 2ZAMA 4P3XA 4CM4A 4ENPA 2PUBA 4A1OA 3TTTA 4A0HA 1R00A 3FNHA 4JNCA 4OKNA 5JJIA 4CF3A 2YH2A 2NUPB 2YINC 4O4IB 3HJFA 4HH3C 2ZM6B 1IXYA 4XI9A 5FF9A 1Z82A 5T4FA 2K4MA 1M75A 2HTEA 4ZYZA 3HL4A 4W8GA 1GEGA 5C7YA 5EJMA 3I5XA 1AKUA 2IIVA 4FMCB 2B4TO 4G36A 2FOXA 4N6GA 2KPOA 3O84A 4R41A 3UT5A 1T1JA 2MSNA 3W2GA 4EYOA 2EX1A 3MUEA 4UE2A 4CKBA 4BWFB 3D6AA 4RVHA 3QP9A 3WGTA 4F45A 2PMBA 4J07A 4EB0A 4ZI7A 3AP1A 1WVMA 3P96A 2F64A 1NM5C 1ORWA 2YWJA 3COWA 2JGKA 5COBA 5I7FA 1IBRA 1EFCA 5KTSA 4S3MA 4NICA 4YASA 4YTEA 3OJ0A 5SYNA 1ZJ4A 4A0FA 3R0XA 1MB4A 4OHCA 1CUWA 2PZAA 3TQFA 1SBNE 2ZYVX 4M54A 4RD6A 5H70A 3UMBA 1I1NA 1KI7A 2TMKA 4DILA 3RVDA 3VU3A 1KOLA 3OCXA 3IC5A 3QU2A 2DUMA 3C7DB 1R0KA 5UKDA 1EUQA 4FQ7A 3ENKA 1B4DA 4G5YA 4MW2A 4R6XA 2DFDA 5IVIA 1KVSA 4BO2A 4H6VA 4YAIA 1L7AA 1NZJA 1QIJA 4OIMA 1E2FA 1Z29A 1I3OA 1ZMRA 1WXHA 1PNOA 3H83A 1UT5A 3ROEA 3IEMA 2ARKA 5JY1A 1JGTA 2C5FA 2JRLA 1ZJ5A 4ZHQA 4H1VA 1BE6A 4LEIA 3VKUA 3SEZA 1RHQA 4YY3B 3AVUA 4GKJB 1L7DA 2UUCB 1ZGGA 4DNXA 3VZSA 2WJZB 2BRUA 4Z54A 3RG8A 1U8TA 3GGPA 1NT4A 1P2DA 3VMMA 1ZRHA 2WHEA 3TXAA 2GPAA 4G5OA 4RVOA 2W6IA 3GK3A 2ZBGA 4U6NA 2GN8A 4IWNA 3DEJA 2Y0BA 5B1SA 2MIIA 2FW6A 5KSZA 3LQFA 4F6RB 3AVXA 3IERA 1YC5A 2VO1A 4K2AA 1W36D 4EYKA 2IIPA 5C32A 2COUA 1RVDA 1BJRE 4KN9S 3LU1A 2QYOA 3RM3A 1OFGA 2MYPA 2NYUA 1BKSB 1UP4A 1YWGO 4W63A 3DMYA 2ZW9A 1Y63A 3ONEA 3C3EA 4XD7D 3RVRA 3V00A 4ES6A 2ILVA 1JHPA 4L0CA 3FOWA 2QY6A 3N87A 1UBFA 4BLQA 3EMDA 4JVSB 3AF3A 4DLZA 2QX4A 1KQNA 3HP1A 3VNRA 4ABTA 1ODLA 3ILXA 3NIWA 3OEHA 3MHPA 4O3FA 4WLVA 4X3OA 4E46A 3HWX1 5TY0A 3A2NA 5FOVA 6NULA 2YYAA 2Z57A 3F3KA 1V1JA 3G0CA 4UE3S 4Y2VA 4DCGA 1UF9A 1Z5PA 2P2CA 3OOHA 1PBTA 2BTQA 4OQLA 1QOPB 4QC2A 3M5CA 5KI6A 3RSOA 3EZFA 3R3YA 4MROA 4YMWA 3EEOA 1K2WA 3FPSA 1O8CA 1YULA 3GRVA 4F06A 2EJTA 2Q2VA 2VSQA 3D7KA 4XRRA 2LIVA 1K3UB 1TIKA 2F4NA 1BVHA 2WKQA 1UMCA 2ABWA 1M2GA 2J41A 4B82A 3PUIA 2P69A 5EEHA 3D2BA 2RGDA 4ILKA 4NBTA 1L5KA 4BWGA 1JQJC 2ZULA 1RC0A 4MP6A 3U81A 3VPSA 4C01A 4C29A 5EHNA 3UAXA 4YP6A 4DJTA 3DTVB 4IQ8A 3TQCA 2DBVO 3SZUA 2OXTA 4MR8B 2JLSA 1O0SA 1AQIA 1WO8A 5D3KA 2QN3A 1GADO 2X4DA 5HNKA 4CEHA 2RG7A 3AU8A 5K3EA 4A3SA 5DBOA 1A2QA 5CHYA 1X7WA 2XUFA 3AEXA 3O1LA 5A6SA 2AK2A 1T5DX 1NTRA 2JH9A 4GBJA 3DBOB 3I0MA 3CRMA 3CUKA 3IR6A 2EZ9A 1ZW1A 3U49A 3ZWPA 4BKQA 2ZRHA 4YREA 2B4YA 4V0RA 4YRAA 4IEFB 3IQGX 5L95A 2PVPA 3IXLA 4E2WA 4HGNA 3ZWVA 4WZAB 3LLCA 2ZYRA 2DUUA 1SEPA 1PR9A 3K32A 1E62A 1US8B 3I3SR 3FZYA 1CQZA 3VTAA 5F9FA 3T1QA 1GZ4A 1GCGA 1LPAB 2HQBA 3B6MA 4H7IA 3UC9A 4A10A 4ZCMA 5I9MA 5TR9A 3N0XA 4DXHA 4EY7A 5BR4A 3WHKA 4GX2A 3KG2A 3LUCA 2C0PA 4MUMA 2EIHA 2XVYA 4I36A 4IPTA 3PFHA 4LMBA 4M0CA 3WWOA 1ZHOA 4GEGA 2XMQA 1IY1A 5ADHA 4BKRA 4BQEA 1PR5A 3NETA 4WK4B 1SOWA 1V7PC 2CLIB 1L5ZA 1LLDA 2P6OA 3FLMA 3S2IA 4OH7A 5DM2A 2JCBA 1W96A 2WFLA 3MJVA 5TQ0A 1THZA 3H5IA 1VCMA 3DR3A 3QVWA 2O4UX 1L1EA 1RHKA 2GCOA 2X3FA 4R68A 4MR7B 4EMSA 2G9QA 3OVMA 1HQKA 2B2CA 4BU0A 1T3GA 1DG9A 3R6GA 2JFPA 1AZWA 2FZCA 2OBNA 2HXYA 3FMIA 4YBZA 4C4PA 3TNDA 3AVQA 4CEIB 3N3BC 3UMGA 1Z5WA 3QVJA 4YRKA 3IDZA 4UPDA 5J4HA 2OOKA 3Q2OA 1RHMA 3R7DA 3C8MA 1O5OA 4MV7A 4ROSA 3DM9B 3GJ4A 3PBKA 4LRTB 3LSYA 3O90A 3IUYA 4Q3NA 1OJ7A 5ITSA 2WAXA 5JDIC 2N46A 4M8NE 1BOFA 3CH5A 3S5UA 1J0CA 2A5LA 1ESDA 1PCXA 2D06A 3QNMA 1E3WB 3AZQA 1S4QA 1Z6TA 3TLKA 4DDKA 3NRCA 5ELMA 3ZK9A 2JFWA 3PX2A 1PQUA 4I55F 2R66A 3CIFA 1P0PA 1VCOA 5BN5B 4INOA 3N2YA 1PF7E 4DBVO 4I1UA 1GSHA 1EDDA 3FE2A 3GRAA 1V4BA 3UBTA 5AD1A 4ZT5A 2FZLA 3OCUA 2Z1DA 4AS2A 1GSOA 2ZDGA 1KJZA 3OCWA 4MDHA 1T3SA 4Q15A 5A7HA 1NVUQ 5BSMA 2R60A 4IUBS 1OFIA 1X7XA 3CF4G 1G5TA 5AJVB 4LA4A 1CY6A 1DIAA 2IZOA 4EENA 1CQIB 4I4CA 1F60A 1L5OA 3IEKA 5LKAA 1CPYA 1CXZA 5ALEA 3WXBA 4M86A 3ZWXA 4UM7A 1N0VC 5BNFA 1DPFA 2IS1A 5FWXA 4KTTE 3OU7A 1EE2A 5FWYB 1BCRB 5G4KA 1Q7GA 4D57A 2PJDA 1V6AA 4EECA 3WRYA 1GN9A 1LPPA 3CKLA 4XUCA 5LXTA 5F2OA 2Q62A 2ZYHA 4GX5A 4UOEA 4N9WA 3MJ4A 1BU8A 2Z3WA 4CFZA 5DX0A 4YR9A 1NR5A 3NT4A 4I8IA 3OP4A 5JAHA 1IB0A 1LI7A 1KBQA 4O2AF 4UXJA 4WZBA 4EYSA 3PHJA 5JQGB 2CVFA 3REGA 3VR4A 2VF4X 1SU6A 3E9YA 3ZVLA 1QHHA 1NNLA 5I45A 4BLUA 4QXPA 1E7WA 4KVZA 4CMJA 1BH6A 3ESQA 1UMBA 2V4MA 2W0MA 5JZBA 2FEOA 1HG0A 4NHEA 4CL3A 2RHJA 1FZQA 3E9CA 3KZXA 1ZBDA 1I6MA 2Q50A 5AK0A 5AKYA 5ICCA 5LWQA 1E3LA 2Z08A 4TPKA 2PL1A 3U60B 5I7VA 1U5AA 2KLHA 1SXJE 2YDXA 4NFSA 3BREA 1UAAA 1E3QA 2Q3MA 4RPCA 4O8CA 5J2TA 4WJKB 4OGKA 5E6RA 2NXCA 3UB3A 1OA0A 3P2MA 4TGLA 1BKDR 3TL3A 2XUHA 5AKZA 1GAXA 4U2KA 1W0JA 3WGKA 2AQHA 4EABA 4DMRA 1B3BA 1HPLA 1KC1A 3SOPA 4BMVA 3ET5A 1PBNA 4FGJA 3TM4A 1U2QA 2LWIA 1OC2A 1X7YA 3JD3A 4LZZA 3BH6A 5CB4F 1EJ2A 3KQQA 4R2KA 4X1YA 4G1BA 4WNAA 1TTHA 4HWRA 2V4ZA 4MA0A 4Y9TA 3SKXA 3W6ZA 2I2AA 2J3HA 2P2ZA 1U9IA 1YVRA 4UTXA 1GYRA 5LP6B 3KT0A 4CJXA 2ZR9A 5A5VA 1XD2A 1QHXA 2YHIB 4ZV7A 4WKNA 1NMXA 4N01A 5L3VA 2BWJA 5HDBB 5BWLA 5D5PA 4JXZA 4DS3A 3OZTA 1NF8A 3LLVA 2HJGA 4J1QA 1ZR2A 1L9KA 4B73A 3GFRA 3PYMA 1AUQA 1BWPA 5EUMA 5JPIA 4BUCA 5ITZB 3HSSA 1A04A 3IT2A 5DXFA 3HZZA 3NT2A 4MKXA 2HLHA 4KPYA 1VG8A 4KHPB 1FRZA 2CLHB 3NX4A 4TS1A 4IZIA 2WM2A 3IVGA 1D5CA 4ND3A 2KX7A 4CDMA 3RI3A 3AJ9A 1JMYA 3UWPA 3ON5A 4BEWA 2H07A 2PO7A 3AEQA 1P0MA 3C3PA 2CNDA 3WWZA 2P77A 2RD2A 1K68A 4A6EA 2HR1A 2UKDA 4RPKA 2VZEA 2FK7A 1ZI8A 2J3JA 3E1SA 2D00A 3DUFA 4YRCA 1AY0A 4YLYA 2ZUUA 4WD3A 2I4LA 2R86A 3WTCA 5HGXA 4LMRA 5DYGA 3LXRA 2VBIA 3OQHA 3KWLA 1HNNA 3F49S 2OL4A 3EMBA 3E0QA 3U40A 4AO6A 1GG9A 4IZOA 6Q21A 3GH3A 4C2TA 4MMXB 3GJYA 4U2EA 1M9NA 3GVXA 3QVUA 1YOBA 5TSDA 2Z95A 3HCFA 4U5QA 4EO9A 3QMPA 5LMCA 3A2MA 1JQKA 4BO6A 3ROXA 5K7SA 4HXEB 1QMGA 2X5KO 2FAXA 2P9BA 2XW6A 3KUKA 3OJWA 1QGUB 4CM1A 2WYWA 3GLIE 4OB7A 4FFOA 2AOTA 3DZDA 3QG5A 4MQFB 3NC4A 3GEHA 3RS5A 4YPVA 3MHTA 1FP7A 1GPDG 1ZOLA 2KBFA 4GBED 1FSPA 2IXBA 1K6XA 2VTEA 1T36A 3ESRA 3OZRA 2IH4A 1GPBA 2VG8A 2B4RO 4II2A 3O74A 4AO7A 3ZE9A 1JG6A 3OU2A 4HFMA 2W9XA 4LJ4A 3I52A 4X1OA 5C9ZA 4TYYA 4FEGA 1YDEA 1WJGA 3MWGA 4PS0A 3L4BA 5IBRA 1ZXXA 4PV7A 2GTHA 3TLZA 3DNMA 3AEKB 2CLMB 2Z2IA 4MJXA 4NCNA 1REQA 4MYUA 2RGCA 1Q3KA 4QU5A 3SI7A 4MI9A 5EP3A 1J2UA 1EP2B 1KSFX 1JEQA 2LKDA 2ZP1A 3GRYA 4UXIA 1ONSA 4NCIA 3NRJA 2RONA 2VF7A 2ZM5A 3PP8A 4JLSA 1EXVA 3LCUA 2X13A 1XU9A 2HAEA 5HDQA 3RU9A 3PL1A 1WETA 2I65A 3CX6A 5CCXA 3AM4A 4KLRA 1O6ZA 2ONJA 4GM1A 4DA4A 1D3AA 3H04A 3KHUA 3JV7A 1G60A 1JEAA 3IOYA 4D81A 4BDTA 5ITVA 4MWBA 2BFPA 5CXSA 1DKLA 4B76A 2WF9A 1D6MA 4AFNA 5ALXA 4FKMA 4PXAA 4B80A 5JSKA 2PT5A 3OZCA 4D9JA 2J59A 3MZ0A 1PFGA 5CB4A 1AKWA 2P5SA 4Q24A 4RVSA 2X0FA 4YROA 1RZUA 2C5LA 3K31A 4M46A 4BNGA 2VJLA 5TPWB 3ZLVA 3LQKA 2VJMA 4HNQA 2JI9A 4UVHA 4XQ0A 1DKQA 1BHSA 4CFSA 3EF3A 2ID4A 3NHPA 1LS6A 1SXHA 2Y4NA 4J0GA 4LY9A 5EL0A 2FB9A 4ZVQA 3WQQA 4DJJA 4F2PA 1VIVA 4MS4B 1SWVA 2XDQA 4IEEA 4OGGA 3ZDDA 1QCDA 1VKRA 4Y9SA 2D2FA 1X94A 4NMLA 4BZQA 2B8TA 3RUAA 2VEDA 2ET6A 3LBAA 4D80A 3H7IA 3WGZA 3L0DA 1MAUA 4IS3A 4GL4A 1U7UA 2BKXA 3D8HA 3JQ9A 4WY2A 1NKVA 4QTYA 3SE0A 5FTKA 4I5EA 1Z88A 5BW8A 4NXNB 2CUNA 5J4YA 1IEQA 4BFTA 1N6PA 3DYBA 3R6LA 3K0KA 1CEXA 2Y4OA 1SKQA 1CERA 2DQSA 3TBFA 1JBKA 4EPTA 4WSOA 2C7OA 4RORA 3BC1A 1ZNWA 1QH1A 1Z4NA 2H48A 3GBSA 1XVTA 3DB1A 3K6RA 2ICAA 1H8HD 2YY7A 3AJDA 1SH7A 1TZCA 1U4SA 2H4FA 4UARA 5EKDA 3L6UA 3OX3A 3DAPA 3UCEA 1DGQA 2HRCA 3PCXA 4LYAA 3VYTB 2PBFA 3A04A 4N6NA 4F4DA 2DHQA 3X44A 3T9AA 1OV6A 1CCWA 3T7TA 3WK9A 4MGYR 3TOCA 2VQSA 1G55A 1TUBA 1UBGA 1XHLA 2CVQA 2Q21A 1KFBB 1T0IA 3H16A 3L8CA 4QPDA 1TVMA 3W5IA 2J9XB 1LPOA 1P3DA 3G0IA 2UUBB 2G0AA 1QHFA 4PWYA 4ARBA 3D4NA 3DLTA 3E53A 2VQFB 5LUBA 2E6UX 1XKTA 2GZAA 5TJHA 4YQEA 1RZRD 1YC2A 3COZA 5CYOA 3GCZA 3IDOA 4XVUA 4QX6A 4R4JA 2VHZA 5SY4A 5JSUA 1VE1A 3O5AA 1OZFA 1LA2A 2G0NA 4QVGA 3SBXA 2DH5A 1CDEA 1LRJA 3A6GA 1KY2A 1OB5A 1U8YA 1NXPA 1RYMA 3KZVA 3QUQA 3BB4A 5JWHA 5LQCA 1GG2A 3WE7A 5I7SA 2OTCA 3PQ5A 4NEHB 3IE0A 3EPHA 4CNQA 3K53A 1UMKA 4ENQA 3TQIA 4C0XA 3H6KA 1NF9A 2JLXA 4LOJA 4IIHA 1GG5A 2HMAA 2VNJA 1T2CA 4R2WA 3FKQA 2PMCA 2Q2QA 2W42A 4DIEA 4CTJA 1KY5A 1M3SA 1WL8A 2BGKA 2CMDA 2NZYA 4G0OA 4HQLA 2BN4A 4RH3A 2I2XB 1TEXA 4AJNA 4HK4A 3T5AA 4M21A 4R7TA 4AY3A 3E70C 4ZIRA 3AY3A 4U9IS 1SQFA 4FFDA 2BH9A 4IQ0A 1Q0PA 5FR2A 4J0DA 3NKFA 4D1YA 4IMJB 1R8JA 1ELOA 5DYWA 2FSFA 4B83A 2VT3A 5CPFA 4XDGA 2O52A 1NLFA 3KSUA 3EC7A 4RV9A 4OX9B 2BP7A 2IBTA 4UAUA 2HI0A 5JG7A 3UTCA 4F3TA 3T4EA 3VO1A 2CBGA 5JSYA 4ARZB 1R0BA 3GDGA 2I8CA 1PS0A 2OXEA 4PCAA 1NW7A 3E2IA 4D82A 4L08A 4TOIA 2Y92A 1ZUWA 1NBIA 3GLQA 5CA0B 8ATCA 1WVIA 4W1RA 1BQ4A 1QQ7A 4P6VF 2PRKA 4X6LA 2HBQA 3TD9A 3WNZA 4IOJA 4B9EA 5KOYA 2O23A 2O2YA 1I0LA 3OCYA 1I3KA 1R9GA 3IMCA 5BN1A 3VHRA 5LYJF 4IDHA 1T4DA 4XARA 3G02A 3L1JA 5TGDA 2W93A 1BGWA 3IV6A 2ZJ6A 1L1FA 3SHOA 4RY8A 5KYWA 3NDBB 3UKDA 2CCJA 5ALPA 2QVZX 2E4XA 1KK1A 4LMAA 2FWPA 2X2FA 3D0QA 5JYBA 3DEFA 1HM5A 2FXIA 1A71A 2W6JA 1IZYA 3F3YA 3R3WA 4PBTA 4IW3B 1OKKD 4OAOA 1QRSA 5KPDA 5F3RA 2OV6A 3QVTA 4HX2A 1Z38A 5T3UA 5FUMA 1ZP6A 5IJ9A 3U6BA 2HGZA 1FJGB 1IQPA 1CRQA 1XD8A 1FUIA 4M55A 1QV9A 3TVDA 4ZU3A 3RK0A 3DBLA 3ORFA 7GPBA 2BHLA 3EVTA 3RJ9A 2ZVPX 3BMCA 5DCUA 3B1JA 3KPUA 4UBKA 2A0UA 2J6IA 4EYQA 1L1QA 2FSPA 2P35A 3CNQS 3SAJA 3O95A 1R0XA 1V6CA 1H93A 4RTNA 3CEJA 4RQUA 5HQ3B 5LJIA 1N7GA 1FP6A 4LRSB 1ZKDA 1ST3A 1Z34A 5DOZA 3ZQJA 3RAEC 4K9PA 3WHLA 4NARA 4MZDA 1PJCA 4XSGA 3VUEA 5HKKA 4G5QA 1JAZA 1DMRA 2BFEA 5CFMA 2DBYA 1C4OA 1HFJA 2GJ8A 1NY5A 3L02A 1WHSA 3Q15C 4B4WA 3DDCA 1MVNA 4CTNA 1IXRC 3DYIA 4S24A 3SVTA 3FDZA 1F2TA 4TKMA 3ECCA 4J0QA 1EDOA 3DCNA 4MEAA 4OGLA 5F33A 4B3FX 3OP1A 3OPXA 3VDNB 4U7JA 3LJKA 1QQBA 4NCAA 2JFFA 5TJ9A 2RGNC 3A3NA 1Z2NX 3OF2A 5DGIA 5J5AA 2R9VA 1CUEA 3C3CA 3FLBA 3L0IB 2ECFA 4BQPA 4CLDA 3UWSA 4DB2A 4KVGA 2ISCA 4EJSA 2H1WA 2VZ8A 3S1LA 1WD7A 2APJA 3FHJA 2JFNA 2QUBA 3ESDA 1EWKA 4ZO4A 2EP8A 3QE3A 2JCYA 1GAEO 3H2JA 4FOLA 5E2AA 3STUA 4HB3A 3QU7A 4B85A 1A9TA 3ESCA 1KAEA 1V8PA 4H4EA 3SCZA 3EXEA 1SK9A 2IA5A 1ZUNA 2GCEA 2NV6A 3H4MA 4PTZA 4BMDA 1W4RA 1O89A 1DTWA 4UW9A 3SC3A 5JECA 3GLKA 3QWAA 2HHLA 3H2BA 1RWKA 5EPEA 3ZE2B 1TL7C 1DIRA 3HVJA 3IH5A 2QM8A 4P5EA 1J2RA 2X8JB 2Q5EA 4ZOLF 2CCKA 4JEHA 4WASA 2DERA 1EWVA 1O6GA 2HBZA 3FZGA 1Z2EA 1B74A 1Y42X 2P6NA 4HJRA 3RR2A 2Q1XA 5AJUA 2OD9A 4W5HA 2IOHA 3K9QO 1L6RA 4J0IA 1JLKA 2E89A 1QIGA 4KV7A 3NAQA 3VC2A 4ZICA 5KNDH 4Q4JA 3ROGA 4GC9A 3ZHXA 4ZVKA 2C00A 5ECYA 1TC1A 1PJ8A 2V0NA 3I9FA 5FWAA 4OLJA 1QE5A 621PA 2JFXA 5B64A 3ITDA 2QZSA 4G23A 4BCBA 2QL9A 1C9NA 2F43B 3AXTA 3FVQA 4Z3OA 2NW6A 2OVFA 3GUHA 1W73A 4ZAGA 1Q1ZA 2H51A 3K8YA 2JBAA 2GZ3A 3UOGA 4B8ZA 2P0AA 1U9ZA 4NU6A 4POAA 4DEYA 2VP2A 1JYSA 4RWZA 4RCZA 3R7WB 3DDWA 2H18A 3CNNA 3RODA 1XCBA 4XCVA 4B4UA 2VK4A 3OBBA 1R0RE 3V6LA 5BSTA 3SQLA 5E6SA 4IHJA 2WIKA 3FVTA 4OYRA 1CUGA 1HWYA 1U1DA 3DMFA 3NCHA 3ZE8A 2VDPB 4KI7A 3BXPA 1XLVA 1P75A 4CEJB 3DD5A 1LDEA 5EFZA 4CKCB 1IJBA 5BVHB 1AN9A 4ZRDA 1QUEA 3EXIB 4FSDA 2YWXA 3M2TA 4PC3A 3WIOA 1B16A 3KQTA 4AX4A 2B4KA 2C3UA 3PV0A 4MW6A 3R76A 1QV7A 5HRAA 4FZVA 1TO1E 4L5AA 4D6PA 3ZXSA 1TJ3A 2XAUA 4X65B 2I1QA 4JP1A 4BMOB 4GX0A 1JE0A 1XPJA 2O07A 1KGSA 1OZHA 2OG1A 2YUIA 4QTXA 4LZWA 1KDOA 2AUNA 5IAKA 4MR9A 2ODTX 5JCPA 1SBYA 3OEWA 2QNBA 3OUTA 4V0ME 3QE9Y 4K86A 1CUCA 3IMEA 4Q12A 3F74A 2EV9A 3AVWA 2UUAB 3BTVA 1Z6PA 3MGGA 1J7KA 2H31A 4TXNA 4WESA 4CYMA 4EQZA 4N18A 1TU0A 3M6IA 3DZBA 1X1CA 5BRAA 3IQWA 4Q9NA 1DXOA 1CDOA 3BRWA 3CX7A 4QJIA 1SQ5A 4I50B 4ZTUB 1O95A 3ACBA 3BL6A 3W7VA 2JZNA 3WO0A 3R8XA 1MG5A 3TRJA 5B5SA 2C5HA 2D0PB 5AO9A 1ZU5A 1Z0AA 4HTFA 2FUG1 2XT9A 4NDNE 1WZUA 4B74A 4YX9A 2QJOA 2OP0A 3VVCA 2GKGA 3GHHA 2XKJE 3O93A 1XXHA 2LR0A 3URMA 4B4VA 3UYKA 1MTOA 3LD9A 4KW7A 1G3IA 3F5DA 1U2DA 1M0WA 4HDRB 4IGKA 5EIWA 4YMGA 3KELA 5L3QA 2JI8A 2PMWB 4IFEA 4OGFA 1N8SA 3B13B 1EI9A 2C2MA 2ZBEA 3D2CA 4RY9A 5BV7A 2BHNA 4FZ3A 3PFGA 5B6PA 1VFPA 1G3RA 3CC8A 1RQ2A 1JKMA 2C4TA 3SKYA 2P2SA 4FD2A 4RKRA 5AXDA 4CVNA 1JHMA 2VUUA 5DH9A 2JJ2D 1Q15A 3CXRA 3U48A 4AS3A 2GA8A 4P3OA 1TQHA 5FBHA 4Y98A 1AIPA 3OT1A 3QFCA 4S04A 3IODA 2A58A 2PUVA 3C1OA 4HKTA 3G0BA 1LFDB 3MOSA 4KIFA 5DI9A 1UMDA 3ZDBA 4C87A 3QU5A 3HKDB 1I2AA 2CVHA 3P9SA 4OEHA 3KCNA 1AS0A 2AWOA 4LTMA 5AI0A 1FUEA 2R47A 3WR5A 3KJIA 5BV0A 1JG3A 5HYVA 1O6BA 2V74B 2WUVA 3MSXA 1GTSA 3LUBA 1H8ED 3P7MA 1NG1A 3M4NA 3FSGA 5LM3A 4EVSA 4MUAA 3IJRA 5E3JA 5A71A 3V1UA 4TMKA 1M2JA 2GBLA 3PQFA 4PZ0A 4F8JA 3ZXIA 4B3MB 5K0FA 2OPHA 1SG6A 5A3SA 3TNJA 3IAEA 4CU5A 3I92A 2MINB 3JD4A 1BCSB 3PIRA 1USUA 3LDFA 1VP9A 2GILA 5TS2A 3VR1A 4GQBA 3OTOB 1EX6A 2RH9B 5E1MA 2B4QA 2FEKA 2YJGA 4PG5A 4DCJA 4ICIA 4G86A 3VZDA 2WUWE 1YR6A 3K5IA 5EIHA 3SJCA 4OQZA 4ME6A 1RPJA 1OYVA 4L27A 1RC1A 3GEMA 3OJXA 3QHPA 4TWAA 1LUAA 1GFIA 2CE7A 4MEJA 2C2ZA 2X6QA 2FN7A 3TZHA 5AFSA 1Q57A 2D59A 4KXQA 4LGVA 1ITZA 1KAGA 4FSHA 4X3CA 5EUQB 2GHIA 2WJ6A 3SLKA 2ZYSA 1XV5A 2EVWX 3GUYA 2B83A 3MJRA 1KETA 4YWJA 3UHAA 5JXJA 4AG6A 2I1WA 4J1SA 1A77A 3ACDA 5E7IA 4PSCA 1N6NA 5C1BA 3AHFA 3KSAC 3RK1A 2DU8A 2V0CA 4BRWA 4M0PA 4QICA 4AG5A 4FE3A 2BVNA 2QQGA 1E5XA 4BMSA 2ZJ4A 4QWWA 1RYFA 2PUHA 2C8KA 2C88A 2XDAA 4D4GA 4BEJA 1SUPA 2VUTA 3CCCA 1WMSA 2FMFA 2P9EA 4C5BA 2XLBA 3N2GA 4MRSA 3MG9A 3G9QA 2MYUA 2CJFA 2OORC 3LO8A 3F7OA 3WZLA 3MMPA 4GPIB 1HT1E 2QA5A 4GR5A 1U0GA 1KJQA 4WNYA 4QDZA 1ZD5A 2EU8A 2PX5A 3KZ1E 3WIEA 1ESEA 2JAUA 5K8IA 4IINA 3UO8B 1YCHA 2Z98A 3G13A 2C20A 2IPMA 1M1XB 2PT6A 2JEZA 1HGXA 1JQEA 4DV6B 3GGGA 4EITA 1EK2A 2AFIA 3AHJA 3D8NA 3O9MA 1OOEA 4FHEA 3FRIA 3GN1A 1AK9A 1TZBA 2CUZA 2QTVB 3ESXA 4P0QB 5FB3A 1A9ZA 2WSSD 5CU7A 5ALJA 4B3RB 4F4CA 5DK6A 4P4GA 1M2WA 5AM5A 1TTQB 1TF7A 1XRMA 1XUOA 1KMHA 1XJCA 4A73A 4WVFA 1SBZA 1WY5A 1YJAA 2C42A 2IP4A 4L57A 4QLAA 3IL2A 3HNOA 4HTAA 1TCCA 2WAOA 3KR1A 1RQXA 2DULA 1MJ5A 4KLAA 4LZOA 4WCDA 5LIRA 2RBEA 2WWWA 1L5HB 1GTZA 2W8ZA 2M1XA 3UMMA 1GR1A 1KKMA 2R6JA 4CQJA 1ZUD1 4W82A 3TYXA 1JDBB 3GXBA 5AQ1A 2Q99A 1R8XA 2X58A 2E1PA 1PLKA 2F3TA 4LQDA 3Q6MA 4BWYA 4PQYA 3RROA 2ZUBA 3OEEA 3P4XA 3JPWA 1OAKA 2EKDA 2DEUA 3CZAA 2GJKA 3T34A 1BWSA 3VNSA 4CMIB 1I4TD 3C41J 4EMTA 5AKGA 2LNDA 5K0NA 1X39A 4JT2A 3P45A 1NNEA 5JAPA 3HEAA 4HEHA 1LI5A 4L9AA 4R2MA 4US1R 5C34B 4C7VA 2FWNA 3ROPA 4AZTA 5JVDF 5H82A 4B3BA 1G20A 5DBHX 4YQZA 4RACA 3SDBA 4OQFA 3AUYA 3GFSA 4QDUA 3THOA 3TTYA 5AW5A 2P27A 3C7KA 2H2GA 3PCRB 2GPJA 4FYWA 3UAGA 3I8OA 4MGHA 4JN6B 4BUJA 2YUTA 4HH1A 1J49A 2WE7A 3QF4A 4POOA 4Z4CA 3GYGA 3EZYA 4ZA2A 2IYWA 1I7DA 1C41A 2AJTA 3VNBA 2C4VA 1IWPB 2QN9A 2IH5A 4NDZA 1H3NA 4JJZA 1XRLA 1G5FA 1HBJA 3BFJA 3A4YA 2ZXEA 3N2KB 3F7TA 4BNXA 4QXOA 3PNQA 3Q40A 5FPSA 3NC0C 4H35A 1A9SA 2XZDA 2C7VA 3L4JA 1T34A 1SZDA 1HDOA 2YN2A 4FDAA 1WRBA 3ZY2A 1YRQA 1BRMA 5K6AC 3RVBA 3L04A 4DBZA 2O7NA 4JJFA 4OYYA 3NP9A 3QY9A 4EKYA 1UH5A 3X1YA 5JSZB 3SJUA 1K4KA 3FGOA 4UUPA 4FINA 3PQ3A 4HQNA 1AG9A 5F2NA 2GA9A 2OO5A 1FJ2A 1L8OA 4NBLA 2H4HA 1E2JA 3QTBA 1ZCJA 5AI8A 4D8WA 1EINA 2X8WA 3MJTA 1NVVQ 3BWXA 5E4YA 1H9BA 1XSEA 3RRYA 1SUCA 3V55A 4ADSG 3PNPA 5B4UA 4MUYA 4C6TA 3O7MA 1OX6A 1ILWA 1H2RS 4L5JA 2HRZA 2F48A 4OB8A 1EP1B 4N4AA 1Z06A 1MJHA 3JU3A 3NBUA 5FOWA 4QZVA 3LW7A 1YQUA 2CN1A 5MGBA 3CF0A 1C3OB 5AXAA 2NZXA 1SG0A 3BGDA 3FBGA 1GPAA 2BFBB 3HJRA 3NS7A 4JL8A 1L5MA 3MELA 3LIPA 4CCWA 1E2IA 2R751 5EIFA 4IDDA 4HNRA 5KZMB 2EGHA 3QJGA 2ADMA 3HYCA 4GU5A 4KNWA 4M0KA 4RDHA 4C1NA 1ZJWA 2NZUG 4X1KB 4F4UA 3GHYA 3UIEA 2D2XA 3FUCA 1Z4QA 3KNZA 4PLZA 3ZD9A 4EI8A 3RVPA 1X0VA 1IQ0A 1SC3A 4CIAA 2ZB8A 2ZRKA 3U7IA 2IHYA 1Z8HA 5BYJA 2FPMA 2LD4A 1RQGA 2JGDA 4D9KA 3CRQA 3FTQA 1QFJA 1XQ6A 2W2XA 1QM5A 1N2CA 3KB8A 3BS4A 3IAHA 3NBXX 1T5HX 2ZI3A 3GLFE 1VLHA 4YALA 3R7AA 4R8SA 5M5BA 3NEJA 3CLTD 4GWGA 1NW6A 4BXOB 3GFGA 1MNAA 3CBGA 3DHWC 3W2FA 1CJSA 1UXOA 4XDZA 4BKMA 2L19A 2A0FA 2G5GX 5AHRA 1JB1A 4HGRA 2FFQA 3NOQA 3F71A 4A15A 1SJ9A 2CNBA 1N2IA 1UBKS 4WE3A 3R24A 1A9XB 5JCOA 1GVHA 4KPGA 4NABA 1N2ZA 1OT3A 4HAOA 3SF8A 2KHZA 3QMWA 3L49A 2AR0A 4G8CA 1JN0A 3ZGZA 4EIWA 2YZGA 5HX7A 3DR5A 1GOTA 1TPZA 1P9NA 1JU3A 4JENA 3CLUC 2OZKA 3UPDA 1YL5A 3E3OA 5B7QA 1XDGA 1JG4A 1FDWA 3DOJA 4KMOA 5AOAA 4BNMA 5JUWA 2ZE5A 1LLCA 1YZLA 1M1YA 5EERA 4A8JB 2IXDA 1EUYA 1CZRA 4GE0A 4NK4A 2X7JA 4F04A 2LKCA 2QXTA 1Y6QA 1P0IA 4V24A 2AEMA 3HZRA 4QYMA 5KHOC 4I66A 2JBHA 1XROA 3GN2A 2BFDB 2O2GA 3LOPA 4XYGA 2YWFA 3IP7A 5EWLB 2EKQA 5ENVA 4HZGA 1COWA 3KKNA 3FNEA 1T8TA 1Y1PA 3VPHA 1KZ9A 2WOJA 3AVOA 1FQKA 1SC6A 5EZSA 2EEPA 2FEWB 3ILYA 3ZHVA 1BVUA 2RB5A 2C9CA 1DG3A 1LBSA 1DCKA 4NE9A 1OT5A 1FRVA 3RAJA 3ZBUA 1OTXA 1M2VA 4RX1A 4QSHA 5B36A 2WHQA 1CR0A 4YBRA 5E9WA 3E9QA 4C04A 3LZDA 5JLJA 3HB1A 3RGGA 1PZXA 4YDQA 4MKZA 1C1XB 1G2IA 3ZIAD 4NBNA 3R3JA 4TTTS 5EJ4A 3AYZB 1UQTA 1X3LA 4KXYA 1EK5A 2WG1A 1NJSA 4OOFA 3L0CA 1Y3FE 3ZU6A 1NU8A 4EGAA 4Z1OA 2CJWA 4ZRMA 4M87A 3JS5A 1YCFA 3FW1A 5H59A 5HIKA 4DSUA 1Z0DA 1K86A 1P4GA 2HF2A 3K0HA 4MRVA 5FFNA 3ZX5A 1PJZA 4KO4S 1CHNA 2O8CA 1P1HA 4RK5A 2WKPA 1MCZA 4LYJA 3CLSC 3ZHSA 5DNWA 1WBDA 1E1DA 3RWBA 1S96A 3CCFA 2CLDX 4H15A 1L5GB 1R5BA 3CM0A 3TRIA 3TZKA 3V7UA 5HTOA 1ZQ1A 1N6OA 5JDCC 4AL4A 5LMZA 1CULC 3LW8A 4HUQB 3RS4A 3T0FA 2X5JO 4I6GA 2PVSA 2W2QA 1E7RA 1Q1AA 1DBVO 1WZEA 3K9WA 3PRKE 4Q6BA 4ACBA 1BHQ1 2DGDA 2NU9B 3OC6A 4DN6A 5EHXA 3OFVA 2I6SA 1XPUA 3BMOB 1XQWA 3WFZA 1N5MA 2IU3A 2YYYA 5GGXA 1QKJA 1JMKC 4FK8A 4B48A 1ND5A 1PJQA 1IXKA 4YJDA 3EQ9A 4JDUA 2G67A 4BNJA 3BJRA 3L77A 5CGZA 1WXXA 1OBOA 1P5FA 3GLSA 1TJNA 3SBDA 3ZCUA 2JS7A 1N2XA 1VMDA 3TFOA 1NP3A 4TRNA 5CH5A 5SV2A 3RIXA 2A8YA 1YH3A 1AO0A 1LK7A 1GT91 4AS1A 1EFKA 3DDHA 3NEPX 3M5PA 4GE3A 3V8BA 1WUHS 4N3CA 1XQ9A 2V6FA 4PE5B 4Q4HB 1P0CA 2HEIA 3G5MA 3ND7A 4WZBE 4HYYA 4UBMA 5LZ8A 4LRWA 4BE7B 1FDVA 4UBLA 1YBFA 2QRVA 1JDZA 9GPBA 3VJRA 4DDHA 5A5EA 2ZAGA 5IG2A 4UVEA 4HLCA 4Y18A 4YT2A 2YJNA 1NDHA 4HI0E 3S81A 1OLSB 1SG9A 3ZKWB 7AT1A 4DCNA 2H52A 1Y4SA 4URYR 1APBA 1UK8A 2QI9F 2PGOA 3DLBA 1P3JA 1WZNA 1XZDA 2XAAA 3IP3A 3OLXA 4KQMA 4HATA 4PZZA 4RIFA 3S7ZA 2ERCA 3SR4A 4TN1A 4B0PA 4ND7A 4Z4GA 1V43A 1QTIA 1LJUA 4OJTA 1LLFA 1DRWA 3ZTTA 3L1UA 4HADA 2WQZA 1OU4A 2PZFA 3E4CA 1KMMA 5CK4A 4PU0A 2EFJA 3DUWA 4DR7B 4IIXA 4MV4A 4BB0A 1NTOA 3DM5A 2XHZA 4QYXA 3AT1A 3K9CA 2QLBA 3RJ5A 5FORA 5BV2P 6REQB 3I2KA 1P0FA 3CLKA 5IH7A 3VSAA 2VHTA 3DPUA 2A4KA 2NO7A 4D9FA 4F5WA 1YE3A 5H9WA 4WXMA 1M54A 5AW7A 2LRHA 1O97D 2GCIA 2NLOA 2PD6A 3Q5DA 3QPCA 4FJ2A 5LL6P 2V7XA 4CFYA 4LXYA 4RD2A 3RHFA 1GZ6A 1JHDA 3HA3A 5A3VA 2GQ0A 2IHBA 1DEOA 1RSZA 4RK1A 5I4KA 1VI5A 2I3AA 5KIAA 2FE1A 1MX5A 1AZSC 3CZ5A 4TN5A 5DIFA 1GZDA 3R7LA 3EDMA 4O3MA 1VHLA 4P2GA 2WG2A 2Q1WA 3PIDA 4UUOA 5EZ6B 2JGFA 2GNPA 1V16B 3PF9A 4Z9YA 2PD3A 2ADFA 2BEUA 3H1BA 4H7PA 3MRXA 5LQJA 2JIZA 4XLLA 3TI7A 1T2FA 1JFLA 2QTNA 3HCCA 4WZZA 3SSOA 2J4CA 4A0QA 1PDOA 3KYDB 1W0KD 3TVYA 1CZOA 4YJ3B 3TL2A 1A5TA 2RGGA 4RHXA 2WP8J 3FXAA 5CBPA 2F8SA 4AY2A 2Z1NA 2CXPA 2GYWA 1ZBQA 3C5EA 4R9SA 1OBFO 4XWAA 1FSZA 2JD0A 5FR1A 3SIRA 3F6CA 2W7TA 4KVAA 1EXMA 2ODAA 4TMTA 3GCXA 4JZKA 4K9RA 3SSAA 4BB9A 1XZBA 2HDHA 3E0XA 1VPWA 4D44A 4M1TA 3NHWA 3IAXA 2BV3A 1I3CA 2OHOA 2V7TA 1X9IA 2CF5A 4FKBA 3FFBA 4HXFB 2FPGA 2AX4A 2X7XA 4IDOA 4WLUA 2HV9A 2J08A 4Y3UA 3VC3A 2DP4E 4J7XA 1NXQA 1U6IA 4LRXA 4BHTA 5A2QA 3FYSA 2Q7DA 2WIBA 2AEJA 1TYAE 2HRBA 4C78A 2B1GA 1CUYA 2VPWA 4QL3A 3EOBI 2YICA 3C14C 3LIIA 2CW5A 1WX1A 1DT5A 3ICCA 4N7BA 1YZFA 3MF4A 4KPEC 1K75A 1QIKA 4YJGB 3NDPA 1NOJA 3RVQA 5DTIA 1LSUA 3FTFA 4HFJA 4YCNA 2ZROA 2EW1A 2QL7A 1OXTA 2OZEA 2CZGA 2JGIA 1E99A 1NNSA 3FYUA 3RRZA 3S27A 4YJ2A 3ADOA 2AB0A 1PJ4A 2EYUA 2XVMA 3T7KA 1BDIA 1KEZA 4YO7A 4YMLA 1PD0A 2XB4A 4RBNA 4JI6B 5DI3A 1GRRA 2YVUA 5TX7A 2VXOA 4EHIA 4Q4DA 4JL6A 4X91A 2XYVA 4TWBA 1ONOA 3CPEA 1NT2A 3CNLA 1MLDA 3E4DA 3KT8A 1XLTA 2HADA 2ZJ5A 1CVRA 2G88A 4OLFA 3WFIA 1FTYA 4P84A 1JYEA 3T99A 5BWNA 3CUYA 3D4PA 3RS9A 3EFBA 3WLKX 2I7CA 3T9FA 4A7PA 3K6JA 3L18A 4DCCA 4KCGA 1H6AA 5JNWA 2ZJ3A 3MOGA 5C5DA 3HUFA 1SFRA 1WB6A 4RMIA 4TSFA 3SHQA 4FGWA 4LV5B 1FL9A 3N2NA 4IXTA 2GBCA 2I2FA 4GIBA 3UKJA 4QREA 5GZ1A 3M34A 4N5HX 4ZKEA 2D5BA 1A2BA 5EPOA 4UVGA 4ZVOA 1P6QA 3P20A 2Q8QA 4B7XA 1OI7A 2FHPA 2HBYA 5EG5A 4EUHA 3THWB 3AZPA 4BVBA 5ADWA 5ALQA 3B3GA 3HXOA 1SBTA 3AG6A 3AL3A 1MIOB 2FX3A 4EG5A 3I4CA 2XD4A 4M36A 1IIBA 1MN6A 2C78A 1FVFA 1ZH2A 3LPMA 3PJDA 1ADCA 2HPAA 2KQUA 2HFJA 3CNHA 1GA1A 2K2QB 1NQ5A 2Q3CA 2XB8A 1AVTA 3HXPA 3LCJA 4OI1A 2AOUB 1K8RA 1ATZA 1IY2A 3P27A 1K0FA 4BLVA 3OLVA 3QKIA 2R6FA 3B1KA 4EG7A 1C14A 1RQNA 5DF1A 3T12A 4E0BA 1GQSA 1Z7EA 2BEWB 3IOBA 4QJ4A 1X92A 4U8HA 5AP9A 1MZVA 3C16C 5CEFA 3F73A 3Q8LA 2IYOA 1SCUB 2XOKA 2R6CA 4P4NA 3WGGA 2VBGA 4CG0A 2A5JA 3ELWA 1CNEA 1X1DA 4WI1A 5J2UB 2FPIB 1CZHA 1M34B 2JIPA 4KRXA 1IEVA 2FNAA 1XRQA 1XZJA 5D1HA 4ZHQF 2H4ZA 4ZVUA 3ZPXA 1CS4C 3IXQA 1B6RA 3QFFA 4M0LA 5HFAA 4EG3A 4JLKA 4FT4A 1MDFA 3F90A 5T6MA 3UZUA 4A0GA 1XTVA 1XYVA 5CDGA 3IPAA 4CMEA 1JT9A 3IT0A 1KEEB 5CGQB 3H1TA 3TD6A 1ETUA 3P9ZA 3RIHA 5LIPA 4GUAA 4NYMR 3PJFA 4ZREA 4RLQA 4UM5A 4IOKA 1F20A 3P9YA 1MABA 4CQMA 1XJWA 3OUUA 4KR3A 1U6JA 3OM0A 2Z0MA 5LBTA 1Y8RB 1U0HC 2H0QA 2PA0A 3NJRA 2GCGA 3PLAE 2Q0QA 3GUUA 2OPBA 4YGXB 2BMEA 1BC5A 5HZGA 4L8VA 2OHVA 5C1OA 4ZT7A 4UHCA 2H4JA 3QWIA 1KEKA 1G3MA 1IUPA 4PS1A 1Y48E 1N3LA 2IXTA 1C3LA 1GGEA 4EVRA 3HB7A 3SE7A 5EE5B 1RI2A 5DN6D 1KI1A 3Q2KA 1NSFA 3UAOA 2VWQA 3TR5A 5DJ5A 3ABQB 1UC4B 2Q3DA 3MVEA 4K03A 4DW8A 1J2JA 2II6A 4X8OA 4WNIA 3ZZ1A 1XMIA 2C54A 3FCEA 1DO0A 4OUDA 3NO4A 3DWEX 4BKOA 3T7EA 4L72A 2WJVA 5DM4A 4AJHA 3KKEA 3WLQA 1S2MA 3TIVA 1W34A 1XQVA 2CLKB 4RLSA 1DRVA 2YWDA 2CHVA 2WVGA 1KQPA 3KKPA 4G5XA 5KCZA 4M0UA 3ORRA 3W2IA 1Y9ZA 1BHJA 3CRZA 2BKAA 1TM3E 3J81A 1UBEA 3TMYA 1ZO8A 1JAYA 1QGED 1G21E 1SD1A 2AKAB 1XMXA 1Q2XA 5HVNA 2ODWA 1P7VA 3GPDG 5AR1A 5DZSA 4C7JA 1T13A 2WJWA 2P11A 3HXMA 3HL0A 4INPA 3R0ZA 2I6TA 3QXHA 3IAM1 3OE7D 1HL7A 2W6MA 3W0LB 4WGGA 2FZ5A 2VP3A 3EXAA 1XAIA 3B7WA 1DI0A 2FUKA 2J3MA 3MS7A 3ZZMA 4AN4A 2ZUWA 4YAKA 3Q7QA 5BWCA 1JB9A 3B48A 2WWYA 2O5VA 1QZ3A 1JLMA 1I7LA 2H5LA 2WICA 3AM3A 3J81k 2YFYA 3K6SA 3Q6NA 4BTVA 1IJEA 2YQZA 1B1CA 1FTWA 4OQDA 2OFPA 5ISMA 3GT4A 3AVYA 1KARA 4RKQA 3H5VA 4P80A 3O3NB 2F67A 1SZPA 4FU0A 2BTOA 2QD3A 2DC1A 2NVUB 1Q6YA 1Y34E 2IYAA 3T3GA 4O63O 3VO8A 1X2EA 4EB3A 4X6YA 1EVZA 1WMAA 4GP9A 1DIBA 2IS2A 2W90A 4J43A 1A8UA 3MAAC 4BP3A 4L8FA 5AHOA 3MTAA 4XZ3A 1LPSA 1XF1A 5FKJA 1E4VA 2VRBA 2DPXA 2I7VA 4ZQBA 2OHHA 3R3VA 3GEIA 4QTTB 5FL7D 1YI1A 4ESOA 3HKBA 4ZZ0A 1YFKA 3THRA 3B5EA 2WYUA 1NDUA 5J59A 1IY8A 4MKGA 5BT9A 4BX9A 5IVPA 4BBJA 2LE0A 4IG9A 1N2EA 4DQDA 1AE1A 4CLHA 4BATA 1U0RA 3RBZA 3JRXA 2M6LA 1KQ3A 1RJWA 3K2EA 3DXXA 2JFUA 3NWBA 1Z08A 1TAGA 3D31A 2EP7A 2HBRA 3Q9LA 1SOUA 1Z12A 3FG9A 3M4XA 4B35A 5HJ5A 4Y2JA 1H6BA 1U8EA 3LH5A 4Q00A 3GEEA 2GBGA 3Q9UA 2JJ1D 2V6MA 4MJ7A 3D8TA 3VTZA 1ZR4A 1P7PA 2V3CC 2X0JA 1BU5A 1U7TA 4LOAA 5FOQA 1WB5A 4IFTA 2QU8A 2W2OA 1IE3A 1U3TA 3CBQA 4CIXA 4H0NA 5I48A 2XYHA 3T1YB 1BEUB 2LCQA 1ENOA 7MHTA 1VPEA 1MIHA 2AJDA 1NATA 2IKQA 3X0DA 1MHPA 1VZ3A 4P1ZA 3LTEA 3RYCA 4Z8XA 3IXMA 3AB8A 5EYPB 3O31A 3IAAA 2J46A 2WT8A 3RYIB 1MO2A 3WRVA 4BV3A 1J20A 3QEMA 4YJFB 4JYZA 1T2AA 4NTZA 2ORYA 2X8BA 5I5EA 4EMUA 3GAFA 1KP2A 1B7GO 1H1LB 2IYEA 3PDIA 2BFAA 4XD7A 5DNYB 3C1AA 1E1CB 4NX2A 3SQNA 1E6CA 3CINA 3UV7A 4DDTA 4C07A 4HAZA 3IIIA 4E2ZA 3B70A 4YV7A 2Q4BA 3SC2B 1DKUA 1KFJB 4GOKA 4MRAA 4DIBA 1LW7A 4TVSA 4C6HA 2ZIUB 4M3NA 3T95A 1BDMA 1PJAA 1MQ8B 1WEHA 3JTEA 3WTBA 4XIJA 4TZ0A 4O4HA 3ORYA 2O8BB 1GUAA 4IRXA 1E7YA 2ZRMA 3F4KA 5CT9A 3WS7A 1BS9A 2G4LA 4BC0A 1E2NA 2P67A 3I9NA 2CLFB 3AR4A 1L4FA 1SVIA 1ZJYA 3F6PA 1QYDA 1QO7A 3G2NA 4S12A 2WPNA 3GLHB 4PCUA 1IOZA 4BNDA 1CY4A 1RJ9A 4KK4A 1KDVA 2CEAA 2BI7A 1R6XA 2XADA 4PGHA 5KHLB 4ZDIA 4ZO6A 3WRXA 3GLGA 1NXVA 2RDMA 4W5JA 4Z3KA 2Q3JA 3N86A 5MF6A 3BK2A 1R18A 4GSLA 1S89A 4RKWA 2PZGA 2QN6A 2A59A 4FYMA 4P93A 3HZOA 3ZHOA 1U28A 2JW5A 5B3JA 1OWNA 4BUZA 2WYVA 4MUKA 4RCVA 2VSNA 3MMNA 5ESRA 1VSTA 2QX9A 4O4JF 3ZI0A 1V11B 2P65A 4OK3A 4RK4A 2QLTA 2EGGA 4EGCB 3GZNB 2FW0A 3F5SA 1XP8A 3EVBA 4Z4EA 4BYGA 4J0FA 2ILTA 4CU2A 4DLPA 2IP1A 4L4YA 3OM9A 1GNVA 1L4GA 1EBBA 1V3VA 2NPIA 4P32A 3DCJA 1OW3B 2VQEB 1C81A 1TCBA 1ORVA 1GPYA 1XNJA 2PMFA 4ECAA 1V1RB 1GPUA 3TLAA 1HDXA 4MKHA 5IARA 1TMOA 5FV7A 1RAAA 2BJHA 2M2IA 4MARA 3E2PA 2AXQA 4BNUA 4BFSA 2J4FA 1KK0A 2FWJA 5KYUB 4RD3A 5LN1A 4G5GA 3OKCA 3HY3A 4OUKX 5JTUA 4WBNB 1WNTA 2G9UA 3PZBA 1B3RA 4MTLA 4H4DA 2V7EA 1L5YA 2IU4A 2I34A 1DCTA 5DW3A 5T8KC 1FX1A 1M2OA 1EE1A 2HO5A 1FVXA 4MW4A 4TUYB 1ZD4A 3QKRA 1CUIA 2C31A 3LQ4A 4TMXA 1NZFA 2PXXA 3GCWA 1YB1A 1FU4A 2DFLA 3BQNB 2I87A 2Y1DA 1UJMA 3JSXA 2PGIA 4MUNA 4E6EA 2L17A 4F5ZA 4ND8A 1Q84A 3OZVA 1RLJA 2C0QA 3ZZUA 1G8GA 4I46A 2Q5JA 1Y1QA 4O4IF 3D7SA 3I2JA 4YRGA 2PJZA 3HYLA 4P38A