4GDMA

Crystal structure of e.coli menh
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
253
structure length
253
Chain Sequence
SMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
publication title Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 253
sequence length 253
chains with identical sequence B, C
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gdmA00
3VJMA 2VA9A 3I28A 3QPDA 1SFRA 4LIPD 1K6EA 2WJ6A 2XQFA 3UMJA 1TK3A 4UUQA 1UK6A 3PFBA 4WJLA 3DKKA 4MEAA 5JZSA 4A5SA 3FLBA 4XIIA 3H1AA 2PPLA 5JZ9A 3IDAA 1C7IA 3W04A 4PF1A 1JT2A 1AKNA 4U2CA 3IB3A 3ESCA 3WIOA 4EY7A 1PV1A 1WB4A 4CCYA 3A2LA 3BF7A 2BUBA 4FBMA 2BCEA 4J0IA 3CN9A 4H0CA 5JALA 2G63A 1XRRA 2Y1KA 5LP1A 1X2EA 3JWEA 4L9AA 5IVIA 4BAZA 1H2YA 1ZI9A 3EF3A 3DDUA 1EK1A 1MX9A 1WB5A 1CUCA 5K3BA 3M82A 3WWOA 1L7RA 4B6GA 5EIAA 3PUHA 1WPRA 1SCQA 4FHZA 4ZI5A 3F9CA 1WCYA 2ZYHA 3H19A 5AOBA 5JYCA 3H17A 4C4XA 2WG1A 4U2BA 5HFNA 4DNQA 1G42A 4AZ3A 4FLFA 4AN0A 3EQ9A 3FLAA 4JH0A 1QIMA 1XZBA 2XUJA 3HEAA 2DCMA 1GPKA 1BCSA 4KR0A 1I6WA 2P8SA 3OG9A 4OCZA 1QFMA 1EB8A 2XUHA 1CRLA 1YSCA 5AK3A 1CUJA 4Y7DA 3G0BA 1CIJA 3WL6A 3AZOA 5IVHA 3N2ZB 1MAAA 4H7DA 4B7ZA 1P0QA 4H7HA 4J0CA 1DU4A 2HRQA 5K5EA 1JFRA 3O4JA 1OCEA 3H04A 3R3VA 2RAUA 3FYUB 3HABA 3PDCA 2HA4A 2GYVA 4B81A 1N8SA 2JEZA 4EY6A 3G9ZA 1QIHA 5HCUA 3KDAA 3DL7A 5HQ3A 2QUAA 3I6YA 1Y37A 4X6XA 4ROTA 7YASA 2UZ0A 3H0CA 1UK7A 1YS2X 4ZV9A 4N8DA 2EEPA 4FOLA 4ETWA 1BN7A 1P0MA 1TQHA 4EA6A 1XKLA 1JKMA 1RP1A 5ALOA 1F0PA 3STVA 2W22A 5AKLA 3PI6A 3OPMA 3WKCA 3FVTA 4G4JA 5AHXA 1W52X 5HF8A 2XQJA 3BF8A 3DS8A 1ZJ5A 2Z8ZA 2XT0A 2VAXA 4X7BA 5AKYA 3WWCA 5LZ5A 3V48A 4OPMA 3WA7A 1CUYA 3ESBA 1LBTA 4UHCA 5K3DA 5EI5A 5AOCA 1DWPA 1B6GA 2CUTA 2V9ZA 4AZ0A 4EY4A 1GXSA 1GQSA 1XZHA 4J0GA 3DJYA 2X76A 3O9VA 4H7KA 5FXMA 2XMRA 1E89A 4XVCA 4CCYB 1XZDA 2VT6A 2K2QB 4B0PA 1EX9A 2VEOA 2BGNA 4QWWA 1Q84A 4AMZA 3HLKA 4OYYA 2JGFA 4A16A 1R88A 2IIVA 4P9NA 2V96A 4KJXA 2PVSA 5AI4A 4Y9SA 1CQWA 3ED1A 2XMSA 5DYTA 4G9EA 4KAAA 4G8BA 2O7VA 1BEEA 3AILA 3C87A 5LZ2A 1EHYA 4KEAA 1JMYA 1TCBA 2QKYA 3DCNA 4DM7A 1XZFA 4B84A 1XZGA 1IUPA 1ZIYA 5AKGA 3DOIA 4GHWA 2WQZA 3O95A 4UBLA 3WK4A 1YAHA 5AKHA 5ALXA 2DSNA 1A8UA 4HVTA 4MWSA 5J3JA 2CZQA 3C70A 3AIOA 5D6OA 1CUGA 4LHEA 1E3QA 1YB6A 5KWJA 5AK5A 4X6YA 3OM8A 5LZ7A 4PW0A 5AI9A 4YPVA 3SK0A 1O6GA 1JJIA 5FP0A 1Q0ZA 4HXFB 1TCAA 2JF0A 4AMYA 2PSEA 4PV7A 1XRMA 4BVJA 3R40A 2RI6A 3A70A 4J7AA 3LIIA 2WJ3A 2WHPA 4Y2UA 1HLGA 2VTVA 3C5WP 3IBTA 4QZVA 1EXWA 3H2GA 4HAIA 1BE0A 5DTIA 5HQ3B 1A8SA 2WLSA 2Z8XA 2LIPA 1DWOA 3ANSA 2XUOA 2XLCA 1QLWA 1QIIA 3I6ZA 1H22A 1LGYA 4PNZA 3M83A 1F6WA 3D5EA 4IH4A 3K6KA 3G0DA 4CG2A 2JGEA 4ZREA 4H35A 1LPNA 2ROQA 3FOBA 3D2AA 2YYSA 3SC2A 3H1BA 3C43A 3BJMA 2ZYSA 3W9UA 1GPNA 1Z68A 4X95A 3WK8A 1W75A 4JYMA 5DNUA 4E46A 3LIPA 4QWMA 4QNNA 3ZPXA 2Z3ZA 3V1MA 2RGUA 2JIDA 2HU8A 1MN6A 4FBLA 4MXDA 1MAHA 5JAHA 3ILSA 4KE7A 3DQZA 4X92A 3WL5A 1CPYA 5CT4A 5FOQA 2OG1A 1GQRA 3WKEA 1VA4A 2J3QA 1AGYA 1XQYA 4FMPA 2VSQA 1GZ7A 5CMLA 4CG1A 5A7GA 5HKBA 1VE6A 1GPLA 5AICA 4J0HA 3L1IA 3WZMA 3PFCA 4AO6A 1ZD3A 3A6ZA 3KWFA 1DX4A 1AC5A 1ZICA 1ISPA 5IH7A 4YASA 2J4CA 1L7AA 5A7HA 5JAOA 1YCDA 5EHNA 3VVLA 3I2GA 1QIJA 4IHAA 1EK2A 3R3WA 1ZGBA 3VJLA 1IZ7A 4KRXA 2I03A 1X70A 3WK7A 4N8SA 2I3ZA 2PM8A 5ALNA 3E0XA 2QOEA 1XZLA 2BUCA 3C5VA 2WIDA 2RONA 3CXUA 4AO7A 1QIEA 2XMZA 4BBZA 3IUMA 4HXGA 2IITA 1WOMA 2HRRA 4Q05A 4BE4A 1CQZA 1JU4A 3IULA 3D0KA 4G5XA 3H2JA 1FFBA 4A23A 1ODTC 4QDOA 4RPCA 2OAGA 4JYPA 5ALQA 3I2FA 4IH1A 1HDEA 3BDVA 3FSGD 4W1QA 3VVMA 4X71A 4C6HA 5BOVA 5C81A 4OYLA 2GZRA 3VDXA 1B41A 2WHPB 1JMKC 4EUSA 2WG2A 1DQZA 2AJ8A 1W4LA 1CUVA 5K3EA 4RGYA 3KSRA 3SX4A 1DTEA 3QMMA 1GT6A 1SOMA 4DMFA 5AM1A 4Y2QA 2J3DA 5K3AA 2PL5A 4GEGA 1W1IA 1IVYA 1IUNA 1VJ5A 1XZCA 3AFIA 3ZI7A 1YS1X 3FNBA 5ALGA 4Y2XA 2QXUA 3I2HA 4P93A 2HA6A 3IIIA 4N5HX 2VJCA 5AH0A 1U4NA 2PSDA 3CCBA 4K6GA 3E3AA 5I7UA 4BRSA 1CUAA 2Y6VA 4Y2YA 5ESRA 1BEZA 5I9IA 2JEYA 4C4ZA 1TRHA 4M0MA 4D9JA 2VF2A 2DQYA 2GBCA 5FRDA 1FFDA 2CEKA 5FPPA 5ALUA 1O6FA 1QIDA 1MX1A 5ALVA 5JD6A 4KRYA 4LYDA 5CW2A 3MGAA 4GLBA 5CH8A 1R50A 4TPKA 4RE5A 3ANTA 3FYUC 4RE6A 2HFKA 2XQIA 4PSUA 5CRIA 5HF6A 1EH5A 4Y2SA 4B9EA 3HRHA 2BAGA 2ZYIA 2VAVA 5LZ4A 5FUMA 3I1YA 3DLTA 3R3YA 3QMVA 3OTQA 4UPDA 4LXGA 4CI9A 2HM7A 1R1DA 2VJBA 3LS2A 5AK4A 3DYIA 1MX5A 3O0DA 1AURA 1L7QA 4EY8A 1UXOA 1H2WA 1KEZA 5AKXA 1J1IA 3WL8A 4BATA 4KYVA 4BC0A 3BXPA 3M81A 4DYHA 1U8EA 5ALRA 4PSDA 5ALTA 1A8QA 1XZEA 5KBYA 4Y2TA 3RM3A 1MTZA 3OOSA 5AKJA 1G66A 2BKLA 4FNGA 4BCBA 1U2EA 3PICA 1ACLA 4XWGA 5AJHA 4CG3A 4AN1A 4C88A 4MYDA 4FNMA 1LPPA 1XZIA 2HFJA 4Q3KA 3ICVA 5HKAA 1CLEA 4Y2RA 4WDQA 5AM2A 2C0QA 1ZJ4A 4QEKA 1P0IA 3WYDA 1PJAA 1UOOA 1E8DA 2ES4A 3HI4A 3FSGA 4UBOA 3T4UA 1IMJA 1WHTA 1NX9A 2GYWA 4GWLA 4H7IA 5IKXA 1UFOA 1QO9A 2XDWA 3V9AA 3NUZA 2Y6UA 3A2MA 3DEAA 3W06A 2HIHA 5IVDA 4M0EA 1EI9A 3NOXA 2QVBA 2HADA 1HL7A 4BYMA 5YASA 2CMFA 3G0CA 2QTBA 1ORVA 5AI0A 1R9MA 4B82A 3T52A 4DNPA 3UUEA 3WLAA 2H1IA 3HACA 5ALKA 2JGKA 3WA6A 1DWQA 4ZRDA 2B9VA 3R41A 5E4YA 1UZAA 1VLQA 2OLEA 1C4XA 2XUKA 4E14A 4L72A 1GKLA 3RLIA 1LZLA 1XZMA 4X6UA 2WSLA 5JAUA 2DFPA 3C6BA 1DINA 5C8ZA 1CV2A 1XQVA 2QR5A 4AO8A 2WFZA 1CUHA 3GBSA 4E11A 5ALHA 1UKCA 3HXKA 4K2AA 4KAJA 1XRQA 5JASA 2BGRA 4J0DA 2ORYA 3WK9A 3DYVA 2Z3WA 1FSSA 1XLWA 3O4GA 3I2IA 1HQDA 1YA8A 2Y2UA 1XQWA 3K2IA 1MJ5A 2QMQA 1JU3A 1EVEA 4BDTA 4KE9A 3FCYA 3STWA 4W1SA 2OXEA 4H7EA 4UFNA 1RYYA 4K6HA 4F21A 2VJAA 2OGZA 1LPSA 3FLEA 3G02A 3WJ2A 2Z5GA 3M3DA 3G9XA 4J3JA 4MYSA 1ZD5A 4MEBA 3QPCA 2HHAA 2HA0A 1S8OA 3WQHA 3H2HA 4AX4A 1J06A 2JBWA 3FCXA 4OU4A 4Q34A 3WKBA 2PSJA 3ICWA 3MUNA 4FWBA 1YB7A 3I2KA 5EHXA 1A7UA 4M0FA 2WJ4A 4EBBA 2OCGA 1N1MA 4N8EA 1XZJA 1Q0RA 2GZSA 5D3KA 3R3ZA 5ALLA 2J4FA 1E66A 5AKIA 4AQDA 3BIWA 4X3CA 4BTVA 2OGTA 5ALPA 2XUGA 3L1JA 1T2NA 2QM0A 1HKHA 2HU5A 1TAHA 4ZWNA 2WIKA 3R3XA 5AKEA 4NMWA 5ALZA 2PSFA 1F0NA 4I3FA 4ARBA 1GGVA 5JADA 4L0CA 5AI6A 4X00A 4X91A 3H18A 4LYEA 4J0KA 2OQVA 4DMKA 3KWJA 2B61A 2CJPA 5K3FA 4Y2PA 4DMHA 4INZA 1THGA 4KACA 4QDZA 4HS9A 1WB6A 5A2GA 4B83A 3AIKA 4FFWA 4GECA 3TGLA 3NWOA 5AM5A 1ZI6A 3F8SA 1BRTA 2YXPX 5C8XA 3C6YA 2PUJA 1R9NA 5LLSA 5AKZA 4BTLA 5ALWA 1K4YA 4WY5A 2JGLA 5AIAA 5A6VA 3GZJA 3IUQA 4GI1A 2O2HA 3C45A 1WM1A 3STYA 1MT3A 1CEXA 2HL6A 1OILA 5A7FA 4TVKA 3BDIA 1NU6A 3G8YA 3F98A 4DIUA 1CUBA 1MNAA 4C4YA 2GYUA 2XE4A 2G5TA 1XZAA 4KAFA 2WFMA 3ESAA 3CN7A 4QLOA 1GKKA 4G9GA 5JD5A 1XRPA 4P92A 1XROA 1NU8A 4BE9A 1R4ZA 1K63A 2H7CA 1ZIXA 5HFAA 3D7RA 4PSCA 2OCLA 2OCKA 3AJAA 1FFAA 3QM1A 5EGNA 2XUAA 4QDUA 3QMWA 5EFZA 3V1LA 3H2IA 5LIPA 1Q83A 3PUIA 1XKTA 2OQIA 4BCDA 4XJVA 4OB6A 5JANA 1K8QA 3OURA 1EB9A 5SYMA 1CR6A 4E15A 2H9YA 2O7RA 2C0PA 3A2NA 5CT8A 4TGLA 4F5ZA 4EB0A 4JUIA 2DHCA 1BN6A 3WWEA 5AM4A 5T4FA 1J07A 4KE6A 4IO0A 2HA5A 4PQEA 3F67A 1BCRA 5JZBA 4O08A 4WFJA 4H7FA 3WL7A 2C5GA 1YR2A 3QITA 3WK6A 3DOHA 3EIOA 3PF8A 5C7YA 3I1IA 1CUSA 1U65A 2WU4A 3VXKA 4NZZA 3STUA 2QT9A 1VA5A 4MWTA 4ZGBA 1LNSA 5AKKA 4UBNA 1W76A 2Q0XA 1EDBA 3NGMA 5T4BA 5D7BA 3STXA 3TRDA 3EQ7A 3YASA 1UOPA 4NS4A 5LZ9A 3UUFA 4WY8A 5ALYA 2AXEA 4ZXFA 4IQ4A 5FLKA 1ACJA 4UBKA 3FYTA 2E3JA 1CFJA 4UFPA 3C8DA 4U2GA 3N0TA 2Y2VA 1WHSA 2WIGA 4BRZA 5K3FB 2OGSA 1DT3A 1VE7A 5EHZA 1DT5A 4UHDA 2QJWA 1CUZA 5FKJA 3X3HA 2RHWA 3BWXA 1VKHA 3D59A 3TEJA 1ZD2P 3U1TA 3I2JA 5BWBA 1QTRA 2WHQA 3LP5A 2XMBA 5ALFA 4W9RA 3S8YA 5AI8A 2WIFA 3QH4A 4X97A 4MQLA 5DNVA 2YH2A 1VZ3A 5H3HA 3WWPA 2XUFA 3QVMA 2D5LA 2PU7A 3O9MA 2B20A 4RNCA 1X2BA 5I8PA 3R3UA 4UBIA 2BUAA 1IZ8A 3K9BA 2ZJ7A 4B9AA 1BS9A 4W1RA 5JATA 4WFIA 1DQYA 4FFVA 3IUJA 4G1FA 5HZGA 3C6XA 2PSHA 4OUKX 3D2CA 3W2TA 1UKBA 3WJ1A 1FJ2A 1TCCA 4N5IX 4QE3A 1YASA 5BV7A 3QBJA 4UHHA 5ALDA 5KREA 3BIXA 2WUEA 3ESDA 2QUBA 5LZ8A 5LKAA 4QA9A 2VATA 4FLMA 2ACKA 4WCVA 4HZGA 4DMCA 1UOQA 2XUPA 3Q0TA 1CVLA 4DGQA 4W63A 3RK4A 1Y7HA 1ODSA 4V2IA 2VQ6A 4J03A 2ACEA 4I4CA 3VKFA 3ZLVA 2WUFA 5FDFA 2WTNA 4QLAA 2CB9A 3G7NA 3E1GA 3C6ZA 4WDRA 2PU5A 1R3DA 3WKAA 4PO3X 5T4EA 1QO7A 2YASA 4Q82A 4OU5A 1J2EA 2FX5A 2FJ0A 2RHTA 4BP9A 2WIJA 2WM2A 4QDXA 2HA7A 1UK8A 2H7YA 3B5EA 1ZGCA 3AINA 4ARAA 5DYWA 4DNFA 5D3ZA 1C7JA 2HA2A 2W6CX 2XQKA 1QONA 2V98A 3QYJA 4EY5A 1CUWA 4C87A 5BWCA 2DQZA 3G9TA 5AK6A 4NVRA 2ONCA 3QZUA 5JAPA 4IH9A 2WUDA 1YA4A 1ETHA 1LBSA 5AM3A 2XMGA 5AI5A 4OB7A 2AJLI 3HJUA 3JYHA 1SC9A 1LLFA 3F97A 1H2ZA 5CTAA 2AJBA 1CUFA 1BROA 2ZSHA 4HXEB 2NW6A 3WMRA 5KWIA 3BE8A 3KD2A 2X5XA 1EINA 5CXXA 5CT9A 3QPAA 3TJMA 3D3NA 3DNMA 3WYNA 4C01A 3HSSA 1K5PA 4S0XA 4BVLA 1EDEA 1CUXA 3WIBA 1M33A 2C5FA 2PBLA 2DR0A 2HDWA 5T4HA 4X94A 5CT5A 4GXNA 1AX9A 4HRXA 3WKDA 5EIEA 1PFQA 2O2IA 5K3CA 1MO2A 4FLEA 2FJPA 1ZD4A 5F4ZA 4U2FA 4BAGA 1VXOA 2RIPA 2XLBA 2CKMA 5ALEA 3SWWA 3S2ZA 4FTWA 5LKRA 2XUDA 3B3QA 5AP9A 3AUKA 4DSAA 3BL8A 1CUIA 5A71A 2ZJ6A 2XMQA 1QOZA 1UK9A 5CH3A 1XZKA 1QIGA 5IVKA 1MPXA 1YAJA 2PKYX 1H23A 3E4DA 1T4MA 3KXPA 4B80A 4X90A 4BC1A 1MU0A 3HYSA 3IURA 4H18A 3RARA 4BB0A 1FFEA 2ECFA 1N5MA 3JW8A 3AZQA 4YX9A 1VZ2A 2DHDA 2VT7A 2XI4A 4JEIA 5HF5A 4Q3LA 2ZJFA 1QZ3A 4WFKA 5JIBA 1ODCA 3MVEA 4OD0A 3G9UA 4CCWA 5LYYA 1VXRA 3ZWQA 1Y7IA 6YASA 2C7BA 4FKBA 5C8VA 5CXUA 3GFFA 1WPXA 1SCIA 3WWDA 5EHQA 5ALIA 4BZWA 1JI3A 5EIHA 3FVRA 2WHRA 3VJKA 1XLVA 3WI7A 2WFLA 3I6MA 4U2DA 3WZLA 3C8HA 2OCIA 3R0VA 3EBLA 2BJHA 4EHBA 4UBMA 3IVMA 3ZV7A 3H2KA 4DLNA 4BAUA 4F0JA 1FFCA 4CIAA 3PE6A 3F96A 1TKRA 3PF9A 5AOAA 4I19A 2DHEA 5JD4A 1KU6A 2R11A 5JARA 2GBIA 3U0VA 3OC0A 4QDTA 1VOTA 2EDCA 4Q1VA 4K6KA 5A62A 1G5FA 2JGJA 3D2BA 3WK5A 3VISA 1DX6A 2AJCA 2QZPA 1CUEA 1RWQA 5E4TA 4Z49A 5ALSA 3RKSA 2VJDA 3DL4A 1SCKA 3DKRA 5CURA 1E8NA 2BFNA 5DNWA 1E8MA 1KU0A 4LXHA 4J0JA 4B0OA 2GBGA 4UHEA 3DD5A 1JJBA 1N5RA 1OXMA 1AUOA 1D07A 3D4LA 3IA2A 4KE8A 3W9BA 2AJDA 2EDAA 2QS9A 2O2GA 4G8CA 4LXIA 4GBGA 3STTA 5CBKA 3BJRA 3HZOA 4EZIA 4HTAA 1LPOA 3CCCA 4F60A 1HPLA 4JNCA 1H2XA 1ORWA 1ZI8A 5ISMA 1XFDA 2R8BA 1XRLA 3G0IA 4Y2VA 1EVQA 4BVKA 2H7XA 5E2IA 3FBWA 2ZYRA 1IUOA 3GELA 2HA3A 5HK8A 4H7JA 1BU8A 1LPAB 2XMCA 1XRNA 4DTCA 4UHBA 2V97A 3AIMA 4OB8A 5FV4A 1AMNA 3KOOA 2WKWA 2XQGA 4BDSA 4BCCA 5AM0A 2IX9A 1XLUA 1UT6A 4HRYA 5DLPA 4Y2JA 3LCRA 4DSZA 1MNQA 3Q8WA 5HF9A 4MJ3A 3B12A 2OPHA 4CIBA 2PUHA 5FPQA 2QJRA 5DTJA 4MQMA 1LPBB 1AZWA 2G5PA 2HU7A 5ALMA 2B4KA 1QE3A 2D0DA 2XUQA 5DJ5A 4OSEA 1QTIA 2I78A 2X8BA 4UFOA 3G0GA 2WUGA 3FWHA 1THTA 2FUKA 4Q3OA 4GW3A 1LPMA 1F8UA 1TIBA 5CT6A 4C89A 4DNOA 3AZPA 4X93A 1UKAA 1CUDA 1JJFA 4ZV7A 4G8DA 3FAKA 2ZSIA 4G4IA 5CH5A 4G4GA 4BP8A 1QIFA 2WTMA 3EQ8A 2WILA 2WU3A 3GA7A 1A88A 3P2MA 2C4HA 2XB6A 2WFLB 4FDMA 1AQLA 1USWA 3IUNA 1ZOIA 1LZKA 1UWCA 4L3WA 4K5QA 4UHFA 4W1PA 1EDDA 4AB1A 5DWDA 3O4HA 3V1NA 1QIKA 2CBGA 1HBJA 1W6RA 2C58A 5HK9A 2GBFA 2QRUA 2ZVDA 4CFSA 4AXBA 2QXTA 3MUOA 1XQXA 3LLCA 3FYUA 3ZLUA 4GDMA 4B85A 4YK7A 2OAEA 3HC7A 2XUIA 4U2EA 1QGED 5DYYA 1CUUA 4X85A 3GROA 1EA5A 2I3DA 2JGIA 5AO9A 3V1KA 1QFSA 4BZZA 2WG0A 3W05A 4LKOA 3GUUA 4ITVA 5E4JA 2JGMA 1P0PA 2G4LA 5AIBA 3O4IA 1G4HA 1E5TA 3ZLTA 4XX1A 5SYNA 3L1HA 1QJ4A 2PX6A 4H77A 4P08A 5ALJA 2XMDA 4UBJA
chains in the Genus database with same CATH superfamily
4CBVA 2F62A 2X2EA 3M5DA 3OC6A 4KQFA 2VA9A 3B3FA 3I28A 2H9AA 3O8OB 1SFRA 1NV8A 2QLFA 3IT3A 3QPDA 4KQ9A 4LBZA 4YJDA 1MC5A 2N42A 2OBLA 5CFRA 4J1SA 5BYBA 1U6IA 3K4HA 4FDVA 1PKEA 2X2FA 1YMUA 1NR5A 4DLBA 5HUJA 2OPBA 5LQRA 3FWPA 1V7QA 1K8XB 1CTQA 5BT9A 1KAEA 4UUQA 4LYFA 1H6CA 1L8XA 3EZGA 4HSEA 2VNKA 4OA8A 3SZLA 4F72A 4F1KA 3HGQA 4XIFA 1RZRD 3V4RA 4YRSA 1J7JA 3SSOA 4WJLA 3TQTA 5K8LA 1H05A 4C0AC 2BFFB 1TECE 3EYAA 4IX9A 3QEKA 1CS4C 1WR8A 2J48A 3H1AA 3QBDA 4C22A 4AI6A 1AN0A 1F2DA 2AN9A 4QDJA 2CNWA 3GT0A 2W5UA 1XVVA 4ZJYA 1P18A 4GS5A 3UBTA 4F3KA 3VNUA 3KEGA 3PC8A 1C7IA 4FGJA 4PF1A 2ZOSA 1U0JA 2H8KA 1AKNA 4HNHA 3EVNA 4C2AA 3IB3A 1JQJC 2GEUA 3LPAA 5CAEA 3D8NA 1NNI1 4FQ5A 2JLXA 1UMBA 1TUIA 1J9GA 1SC3A 3PXDA 3H4IA 5IN4A 3DDZX 3AHCA 2V7XA 3DPUA 4L5CA 1KO8A 3A2LA 2F1IA 4B09A 3BF7A 1MR3F 4FBMA 2VHQA 1EWKA 2P2YA 2UUBB 3R0IA 5A02A 4XWKA 2M1XA 1V4NA 2OAP1 5JSUA 2PLAA 4QREA 4JZYA 4WH0A 1QVRA 2W2PA 1NBOA 5EJMA 2BL4A 4BRUA 2QYTA 2D3TA 1FXWA 3K8YA 3W3AD 4MTLA 4C7VA 1W36B 5CBPB 1RD4A 4B6FA 3Q1KA 2YWGA 4XB2A 4JSRA 1UPTA 1WU7A 3A14A 4XUDA 5JALA 4RO0A 1TM4E 2HGZA 2C03A 3GT7A 4R2LA 3ZHXA 5BMVF 5LP1A 1FNMA 3SAJA 1A76A 1YDWA 4HZIA 1OLXB 2C82A 3DDUA 1EK1A 1CKEA 1RTKA 1U3UA 3ZX4A 4MR8A 4RPLA 1CUCA 5GZ3A 5K3BA 5JY1A 1XZPA 2WP8J 3K0HA 1SOVA 1UMCB 4TS1A 3WWOA 1IOWA 1G4UR 3LQRA 2J0QA 4LSGA 5B12A 1DBIA 2R68A 3FPCA 3X1KA 4OK3A 3H11B 1AUQA 3EPRA 1J5PA 1OJ7A 3KOYA 1Z3CA 4ALKA 2CYAA 3IEVA 1Q21A 4NESA 3LBYA 1U8UA 3OQVA 2BEWA 4MK4A 4UDXX 5EIAA 1JIQA 4DUYB 4I1PA 1U2GA 3OX3A 1DMSA 1SBCA 3DQPA 4B3CA 1E9SA 1HYBA 2CVFA 4FHZA 1S9DA 1RWBA 4JJ8A 4YDRA 3F9CA 3UJ7A 1G8HA 2ZYHA 1XAJA 4R2KA 2WM9B 4E2WA 4CIWA 1FY2A 4EEXA 1U8CB 3KB6A 4XX0A 2YWDA 4UTVA 4JN6B 2P6RA 2E6KA 4YJ3F 3VPFA 2H1WA 4HR7A 1P3DA 1M75A 2XJ9A 3L0DA 4HWPA 4YHBA 4ZALA 3RFUA 3VU1A 2Z8YM 2XZDA 4AN0A 2GTHA 3RHZA 4DJAA 1Q3HA 3C3AA 1GUDA 4P4NA 2V9PA 1YONA 1ZITA 1TVKA 1QIMA 1Z8FA 2XCUA 1DOAA 4BQNA 1N5DA 2ZJ4A 3LCVB 1V9CA 4WLOA 2JPDA 2IXTA 1GPKA 3W4IA 4I1RA 3ZCSA 5KNCA 4Q48A 5FTJA 3K9GA 5DM0A 2P8SA 2C9OA 4JDPA 1XNRB 4OCZA 3ZWYA 3DFMA 5DBGA 2VDNB 3UJDA 2BTEA 3WQSB 1X3LA 3PZRA 4TMTA 1X42A 1H4QA 4XAQA 3RI3A 1OYYA 1EB8A 2UAGA 3RSZA 1CRLA 4RW0A 4OXKA 3IB6A 3MGCA 4IXMA 3FFTA 5AK3A 4F97A 2OCYC 3QE3A 3KIPA 3G0BA 1CIJA 3A1VA 1UINA 2CLMB 3WL6A 2GJKA 4YCDA 2X4DA 3AZOA 4EQ6B 1PR3A 1RJ9B 1GN8A 1UL1X 4N18A 5IVHA 1NRXA 2XEDA 1NWHA 4MARA 2Q3LA 3QVGA 4CLDA 3LVRE 1HRKA 4N5DA 5HJ5A 4G0UA 3RRNA 1P0QA 1QG0A 1IBKB 3FAZA 5JAPA 4X8HA 4OKIA 4YMIA 1EP9A 2UUOA 5LP6F 1KY3A 1XSEA 1G41A 1W1WA 2HRQA 3D1JA 3L84A 3E5RA 4FJ0A 3VUEA 1JFRA 3VO9A 3E03A 1OCEA 3BILA 5JEEA 4BBPA 1C9JA 1YJXA 4ONEA 3WGYA 1YFZA 3GUHA 2QV0A 3HVUA 1Q15A 2OO5C 3C85A 3KUUA 3NKLA 4WEQA 5BV8A 1L6IA 3BZBA 1TMKA 4EGQA 5B6IA 1ILEA 3E23A 5DGXA 1OXKB 2GYVA 3FTPA 3IHLA 4B81A 1N8SA 1S3GA 4UZSA 4KYUA 2Y3IA 1YS6A 2H2WA 3K09C 1DX9A 2BRUC 4RA9B 4M46A 4MINA 3DL7A 1FQOA 4FFDA 3OX2A 2MMCA 2PIDA 4I5GA 4R6XA 3DLBA 1SZJG 3B9RA 1XE3A 1Z08A 2WMOB 3L7NA 3MJVA 1N8KA 3UT5B 3WLLA 3KWMA 1G7TA 3PCTA 2LTAA 3GLFE 1JHMA 3THOA 4A8JA 1DZ3A 1UBOS 1YS2X 3P4YA 5TEVA 2WTUA 4RGVA 4DFDA 4HOYA 3TF5A 4A6DA 5ARCA 3WV4A 3QJYA 1T0JB 3VVCA 2DSTA 3DO6A 1PBTA 3TB4A 4LOLA 2F43B 1V8OA 2DCUA 3TRHA 4RHCA 5IHPA 3BXXA 1KNQA 3NYRA 5ADHA 1O8BA 1OGIA 5ALOA 1F0PA 2H31A 5BO5A 5JS6A 3ZDCA 5HDBB 4Z4EA 4WJZA 2AVNA 2QE7D 1YBHA 1Z5WA 1KKMA 3LKBA 1AHNA 3QUSA 4ODIA 4KV9A 4P86A 3EXHA 1H2EA 2GXUA 2JW5A 2QSYA 1NVAA 3BFXA 3OSZA 4TRJA 2EQ5A 3WKCA 5ARBA 1A27A 3WHLA 3I9FA 4G4JA 3PJGA 4UUPA 1W52X 4LF6B 5HF8A 2CYBA 4D98A 3F6SA 4RDIA 1D0SA 3HCCA 3BL5A 1BMDA 2JLQA 4OP1A 4A4DA 1ZR4A 3ELDA 3P32A 3UAZA 2H9IA 2PX0A 1RKVA 4HKTA 1MA3A 3JR3A 1RXVA 2YWCA 4TYWA 3JXEA 3D7LA 1W35A 4H3HB 1XYYA 1K2VN 2HZBA 2P2CA 4HLNA 4MQFB 3WLPA 1S1MA 1AA6A 2A7XA 1K06A 2Q5EA 2IHJA 4PYKA 4D7AA 1FS6A 2XNSA 1SB9A 4JBLA 4JB2A 2VZ9A 3OECA 4XM0A 4B2LA 3A4YA 2JAUA 3A6LA 3Q88A 5K4AA 1YL7A 5K3DA 2J0EA 2R8RA 1VIVA 3KZVA 3QX7A 5AOCA 1DWPA 2CUTA 4DYDA 3RYCB 2AN1A 4EG5A 5J2TB 1M2KA 4RK6A 1QZZA 4ZVOA 3U44B 1U7DA 3N2KA 2GKSA 3NT4A 3BZWA 3M0EA 4WKGA 2FB9A 3UNXA 3VMMA 5IJAA 1K6XA 2JDIA 2PD6A 1KOLA 1JQBA 3ZCPA 4F2GA 2ANBA 4Q4CA 1QQ6A 1KPIA 1THZA 3GFSA 4DN6A 3DJYA 5DBEX 3WLKX 5KZMB 4H7KA 2R79A 4URYR 1E89A 1GZHB 1JLRA 3CU5A 2ZS9A 3GA5A 3L7KA 3DL2A 1Q1QA 2DWQA 4NP6A 3E2PA 1PI3A 4P3NA 2XF8A 1Y33E 2BSQA 5IT0A 2Y1XA 2I76A 5AXBA 2VT6A 2K2QB 3EEBA 1P8JA 3C3YA 3SYRA 4EB3A 1TK2A 2FN4A 2NNWB 4MUMA 1CK4A 2AC7A 1BXGA 1P17A 1E7QA 3EG9A 5LJIA 3CWQA 3WIEA 4OP2A 2VEOA 4IXWA 3L0ZA 3RKUA 4B3IA 1R0YA 2Y67A 3Q0EA 4L2IA 2OZKA 3FGNA 2HR1A 1ONNA 1USIA 3B70A 1A5AB 1RJGA 2BE9A 3BFVA 1RYHA 2M2IA 3BHJA 3VR6H 2F48A 2P2ZA 2FW6A 3PXCX 4C3VA 5IJ0A 3ER6A 1R88A 2EJCA 3U3RA 4ALLA 1AM4D 2H2AA 2O8EB 2FWAA 2IZ0A 2JBAA 4JOSA 3CJTA 2HUNA 3EXEB 2GPAA 5K20A 2QL5A 3D6AA 1ULBA 4C0WA 5AESA 4UMVA 4TZ6A 1SKQA 4GX2A 1K88A 2FWIA 5DNDA 1TGYA 1YKSA 3MYRA 4G9EA 3TFQA 5EOVA 1FNSA 2FMUA 4G86A 4M9SA 4IIDA 2O7VA 4QBHA 1BEEA 1KF0A 2VAMA 2JIQA 2AL7A 3AILA 3FUWA 3T5TA 3LT1A 3OFNA 1CDEA 3PFHA 1EHYA 1XD8A 1QK3A 1U1IA 2A5DA 3QF7A 4B6OA 1PL8A 1JMYA 1P73A 1ABEA 2PKCA 4RVOA 3CZ9A 4XPIB 3A10A 4DM7A 5HP4A 2JFOA 5EHIA 2HMTA 4RZSA 1XTKA 1V5IA 1CZRA 1PL6A 3DOIA 3AERB 1WXFA 2EKLA 2W2VA 2WAXA 2XA2A 3L4EA 3LDAA 4Q24A 4QBKA 1PJCA 2BMEA 3A6GA 3AY3A 4EPRA 2VSFA 2BLLA 5IJXA 1FCJA 1H2RS 4O25A 5L8VA 3ADDA 2Q4EA 3DSRA 1WD5A 1JA1A 3O83A 2N3ZA 4ND6A 9MHTA 4G0PA 1W0KA 5ALXA 2E87A 5DM2A 3ZIAA 4GMKA 2CCJA 4KW7A 4PXAA 3KT0A 2G76A 2IYXA 3OIGA 3WDKA 1NI4B 4KO2S 2XYVA 3ZD6A 2MSKA 1ENZA 1UBHS 3ZJTA 4ND1A 5EESA 1P1RA 4CKBA 1BCSB 5FULA 5J3JA 4C0XA 4B3TB 1D4AA 2JD2A 3EDRA 5HE9A 1L8LA 2C20A 4MRPA 5D84A 2R84A 1YKGA 3BD6A 1AHPA 4CIYA 3AF1A 4BVEA 1E3QA 1OIWA 2XUZA 4FMDF 3EW9A 3P9SA 4CL0A 3LP8A 2ZU6A 4NS1A 2DFTA 4PW0A 1NBAA 4A92A 3ACCA 4TVOA 1MIOA 1P62B 3OCXA 4WZBB 5J1TB 1Y1SA 1A9YA 1E1NA 1OFUX 1T9GR 1YBAA 1NBMD 1Y3FE 3EUFA 4MCHA 4W6QA 4J1QA 5D8DA 5FP0A 5IDVA 1X7GA 1Q0ZA 5LMNB 1HGXA 2GT1A 3U81A 4IGIA 3JWIA 1YUMA 2DLNA 1L7PA 2YMLA 2CLSA 1IDN1 1N4DA 2GJ9A 2C78A 4RKQA 3KHKA 4KKXB 1E62A 4PV7A 4LF8B 4BVJA 4JKYA 4J7CA 3W90A 1VCIA 3V4SA 2PVCA 2J3IA 1AS2A 1H6DA 4S05A 3P9CA 1E5DA 1P0FA 2ZZMA 2WJYA 1UFRA 4LNAA 2ASEA 2WJ3A 4HAXA 4PX9A 4JVSB 1HLGA 4MHTA 2C5EA 3F73A 2V8BA 7MHTA 1RWXA 5K0LA 3KYIB 4LQCA 5FQNA 3IBTA 1PWHA 1KETA 1KKLA 1E6KA 4RD4A 1KQGA 2YWXA 1LVHA 4HAIA 3TZHA 1J7KA 2L18A 4E03A 4E1BA 5I9NA 2AV6A 3H4VA 2WYWA 3HDYA 3SMVA 2AFIE 2Z8XA 3HNRA 4Q3NA 3GCXA 1K7XB 3HXQA 4EYKA 1BJRE 3ZEAA 5B3AA 3QEMB 3BSYA 4D8YA 2XUOA 5ICMA 2H57A 2AMJA 2XLCA 3LYAA 1QLWA 3I6ZA 5B1HA 1QC5A 4LF9B 4GR9A 4HCJA 4J0QA 1JEOA 1H22A 1LGYA 3C3DA 4KDRA 4MLCA 4OHBA 4UE3S 3HH8A 3I3SR 3A2KA 5KX5B 1KYXA 3BCHA 1ECBA 2V5VA 3IE2A 1AE1A 3CXRA 2WZCA 1SXJA 4FDAA 1Y4SA 4HEJA 4IH4A 4NECA 4C7KA 3G0DA 3M6AA 2NZUG 3EQZA 3REOA 4CG2A 1XEAA 3L92A 1R5OA 3UJHA 4XYLA 3W5DA 1OZHA 3LHSA 2A0XA 4IIJB 3E9RA 5F3RA 1KA9H 4CKWA 1R0CA 1U7HA 1PR0A 2ROQA 3VYUB 2UUAB 2CNWD 3D4IA 1E9DA 3D2AA 4DC9A 2YYSA 3JYNA 4OI1A 3UF0A 4FE4A 3O90A 1D0VA 1FW8A 4MHOA 1PZHA 2CLDX 2EJBA 2HBQA 4GSYA 2X41A 4EG8A 1BEUB 3H1BA 1P1CA 3C43A 2C3YA 5JZVA 4LE2A 3DF9A 3M6FA 2P0EA 3F7MA 1EJ0A 5DEIA 1RPZA 1WABA 2ZJZA 5DTMA 2AGVA 3DBHB 2VHVA 3TBKA 4WFQA 5EWJB 2HSZA 1OFVA 1J90A 2R1ZA 3KTFA 4ZVRA 1T10A 2G71A 4BLTA 2YX1A 5JW6A 4AKHA 4OMUA 3EYWA 3TUIC 2O19A 2WYIA 4P3PA 3KYDA 1E1CB 4L8LA 1EUDA 5DNUA 1WKBA 4O2AB 3NWJA 3FKQA 2CLOB 1GILA 1FTNA 2C2OA 3NBKA 1ECGA 4Y6OA 4ZT5A 3B38A 4QWMA 1U3FA 2ZJAA 3ZPXA 1R5JA 3PKJA 1TEVA 5AXCA 4C4RA 1E79A 3IKTA 4JIGA 2QQEA 1IE3A 3AJEA 4IUCS 2RBEA 4YJKA 4EB6A 4KXLA 2ISQA 3MJEA 3PCXA 4OFZA 2BFEB 1QANA 2BY4A 4R4JA 5JCPA 3QXSA 4NYIR 1H2BA 3LLSA 1Z25A 3K2BA 4PFQA 1IQRA 3O3NB 2IZ6A 4I4LA 4QGBA 1MAHA 1XXLA 2H2DA 1WSDA 5JAHA 4PO9A 2JLYA 1HFJA 3KUXA 2BMJA 3I04A 1DBRA 1COWA 2A9JA 5DH9A 5JU6A 2FPMA 3UFBA 2I7VA 5CX1A 2JGAA 2MMGA 3HB9A 1AV7A 3WL5A 3GLIA 8MHTA 2QD1A 5E1BA 3CF6R 3VTKA 4ARUA 3BGIA 1VIAA 2OG1A 2MSEB 2ZJ8A 2FY8A 5K51A 2JLZA 1Z62A 4S0ZA 1GQRA 3I32A 3WKEA 3K1YA 2COUA 2WV7A 1SY7A 3A4NA 1FP6A 1XD2A 3CJQA 3KKLA 3R8XA 4AU1A 1I7NA 2NZ2A 1A2KC 1GZ7A 1E4EB 1XZ8A 2IY9A 2PT6A 4HYTA 2C7VA 2I7XA 4G07A 1KHHA 2I4IA 2ZDGA 1VE6A 1VI5A 1FFHA 5GJBA 4PZPA 3GLGB 2QBYB 4OK5A 2R44A 1O3YA 1SUEA 1Z0JA 4L02A 3T5MA 1TYAE 1MB3A 4YQYA 2XTZA 1N6IA 1DKMA 1E3EA 5BRNA 5BUSA 1FJXA 4Q1CA 4AO6A 1MJGM 3VSEA 2FNAA 5DW0A 4YCJA 2JJ2A 2I9PA 3ZK9A 2VP5A 3B3AA 1AC5A 3IIJA 1RIFA 4NHEA 1ATZA 3JYLA 4GKKB 3M9LA 3T1TA 4R8LA 2N9UA 5KNCD 4MV7A 4RHTA 2H5JA 1ISJA 1F38A 2J1LA 3HN2A 5AWFC 3UKDA 4LMPA 1E3WB 6CHYA 4PO1A 1CF2O 1A95A 3I2GA 3GI1A 1CDOA 2O2JA 3ZE6A 2H5LA 1OYVA 1ZGBA 3R3WA 4N01A 5LUBA 4DWJA 5D00A 3KRTA 5LU9A 1SQSA 5CDYA 2HHJA 3A1FA 3OIUA 2HK7A 3NEPX 4G0WA 3DTTA 3OSUA 5A5DA 1X70A 3GR6A 2P9YA 4BHTA 1XCMA 2QZSA 4RSRA 1C1HA 4GX1A 2YDYA 2Q6KA 4IUBS 3SJUA 3GA0A 3GJYA 2I3ZA 2PMEA 3U3DA 3W7AA 2RSLA 2AF3C 3L8GA 4GPAA 1JBKA 3FIUA 2CT8A 3Q10A 1KBZA 3E6AA 4EBFA 1N7GA 5ICGA 1T8TA 1L7MA 2E4UA 2QOEA 3DGFC 3UG7A 1SM4A 2FUCA 1IWPB 4MGKR 4RHUA 3L4KA 1Z0UA 1W46A 3PRJA 2RONA 3HZZA 1NUQA 4W9NA 1V5EA 4XH9B 3RC1A 4AO7A 1SRQA 2A4MA 3VH1A 4AMUA 4YCMA 3V7YA 3SBEA 1QCZA 1WP9A 4WESA 3EEOA 3FSRA 3IUMA 1P29A 4HUQB 5CNMA 1GL6A 1PS9A 1QDLB 3MWYW 4WBSA 4ZN6A 3FDZA 3OZRA 2QV7A 2OD7A 4KXMA 2HRRA 1ZN8A 4KV7A 1EK0A 1CFZA 2J07A 3VKUA 3VR6D 1HETA 2I6TA 2OKCA 5LUAA 4EW2A 1YTUA 4JYAB 2QRGA 3IULA 4XD2A 2Q5OA 4F92B 3QBEA 1H9AA 1PEKE 1FDVA 2QRVA 3SX2A 1ODTC 1GPH1 2WVAA 3ENQA 3K96A 1VCOA 1NUPA 2W43A 3QFSA 5ALQA 1RHUA 3BDVA 4MR9A 1NMSA 2X0RA 2EG9A 3DH0A 3Q4GA 2JHFA 2JJYA 2Y27A 3VVMA 1Y82A 3JQ8B 1YRHA 5BOVA 1EGAA 3OKAA 4OYLA 5C18A 1HLPA 2GETA 2HPVA 4JGGA 1DWUA 2IBMA 1B41A 3HU5A 2NO9A 3R5KA 5HS6A 3RJ5A 3VDXA 5I7FA 1S9HA 3VPCA 3LQQA 4CIDA 4DBLC 4PLHA 1HK7A 1Z3IX 4A0QA 1XU7A 1Q3KA 4X3PA 3TIVA 1O96A 3QBTA 2VHCA 2F7SA 2ZIAA 1WQ1R 1OGYA 2A0UA 5C31A 1GRVA 2C99A 1YDMA 1QQBA 1DQZA 3VSAA 1ACMA 3R75A 3AKCA 1KO5A 4J1TA 1G5HA 2Q6IA 4QOJA 2OFPA 4WZAA 3WGVA 4IYJA 1DTEA 2E0IA 1SQFA 5AVKA 5A3SA 1NN3A 5C34B 3RVDA 3NNNA 4DMFA 3KZMA 1ONSA 4KIGA 1YB1A 5DWVA 5K3AA 1Y1KE 2PL5A 5L3ZA 4LDRA 4XIJA 4MPJA 1W1IA 1OC2A 1UWVA 2PZGA 3CX8A 2GM3A 1NZJA 4O8ZA 3ZZMA 4G09A 4FD2A 1PF7E 1I24A 3A1TA 4IEEA 1RAHA 2QLBA 3FB4A 4RVSA 4EARA 3ONFA 4OI4A 2WT8A 1TA9A 1M34E 3LUBA 4ZO8A 3AVYA 1GUYA 5CG2A 1EFRA 521PA 4GP6A 5ALGA 4MQEB 3M5CA 2YKGA 3DKPA 1PJSA 4NPCA 3BUSA 4RJJA 1ZVKA 2Q5FA 2QTFA 2V59A 2OLKA 3IBFA 3SF8A 2VJYA 3AHEA 2JNWA 1NVKA 2EGHA 2CDBA 2JDID 5L4NA 1QFYA 3ZS8A 5IZCA 1IEWA 1ZUNB 4BQSA 2J5XA 3DYBA 3BQNB 1QYXA 4DIMA 3RSHA 4OQPA 4UTZA 1MVNA 2K7ZA 1KSFX 2KM1A 2WYUA 3IVAA 5DHPA 5DSZA 3CCBA 4CLOA 4G67A 5GJWC 2W4IA 3E3AA 1K5HA 4HH0A 3KETA 3B9PA 3RLFA 1W4ZA 1YMQA 1FZQA 2NX2A 1G20B 4ALJA 4BP1A 2PHZA 1QP0A 4F3TA 1XMSA 4YMTA 3AEQA 3QPVA 3VR5A 4C4ZA 5F3WB 2QRZA 3ZJ4A 2WSYB 3LC2O 2JHCA 1YU6A 1DAPA 4TYQA 5DX0A 5TEWA 5JH7B 3UA3A 4G6ZA 4M8NE 2CEKA 1J42A 1NVUQ 3CPEA 3QKUA 5LXTF 3R09A 4H16A 3WYEA 3NYQA 3OD5A 3SQMA 1N2IA 1G6KA 1IPFA 1CQIA 5ALUA 3I4FA 4EFMA 5ICSA 2OV8A 2PAFA 3FRJA 3GRRA 1M1ZA 4DDKA 4K9DA 3ZQ4A 4QVIA 4HMPA 2IGTA 4EAQA 1DAGA 4F5YA 4XDYA 1E2PA 5JD6A 1C29B 4KRYA 1E1RA 4JEHA 4LYDA 3J81A 2QX7A 4TZ0A 3WTCA 4YB8A 1LSJA 1L0BA 3TL2A 2ZRGA 3U3OA 1HE3A 1LUAA 2VJPA 3OPNA 3OZDA 3SXPA 2EHDA 1R50A 3OFND 3EGXA 1NJ8A 5H7XA 2BI4A 4IIHA 2I33A 1ECLA 4WA7A 4TPKA 4CLEA 4H7PA 3U4MA 3K6JA 1YK1A 4B7UA 2E6UX 2GPWA 1I2MA 1SGWA 2HX1A 2LCFA 2QNIA 3FYUC 3K5IA 4N9QA 5DSTA 5EWMB 3VTZA 2HFKA 5CYGA 1NKVA 1UPFA 4Y18A 3RYTC 3LHIA 3P8ZA 2V5AA 3CUUA 3MMNA 4Y2SA 2ZCJA 2I2CA 4DIEA 3UGKA 3X1DA 4DJEC 1RSZA 2W71A 3DE5X 2Z6UA 3T7KA 4S35A 3CUSA 2AHOA 2REQB 1X74A 2AK3A 2DVMA 4O59O 3O2QB 3QMVA 3FOEC 1XXHE 4PRKA 1KZ7B 4G5FA 1NJSA 1BO6A 3ZZ1A 1W0KD 3ZIAD 3ZDDA 1SHZA 1KSJA 2FZ5A 2EGGA 2ZPAA 3MELA 4JVNA 3DDHA 5D51S 4Y0NA 4OQLA 2VJBA 5LLTA 1L4YA 1DDOA 3LS2A 4V0LA 5J9FA 2H00A 3O0DA 3JQ7B 4D8VA 1PD0A 2BSAA 5A9SB 2B5WA 1U99A 2FSGA 1KORA 3H9QA 1U8TA 2BEVB 1U3GA 1Y7TA 4N03A 5FI0B 1L7QA 4JVMA 2P6PA 5TNXA 3R8CA 4BBAA 4EY8A 1DL5A 5C5DA 1UXOA 2UVQA 4I6GA 1K1EA 2H4YA 2QRMA 4AP6A 1I6LA 2FK8A 3T7JA 3GBVA 5FO1A 5AKXA 5JMTA 3ND8A 1J1IA 4Y9RA 5CEJA 1QGAA 3WDLA 3WL8A 4BC0A 3BXPA 2X9GA 4DYHA 1IRIA 2EQAA 4IFIA 4B44A 1U8EA 3DUFB 5IBQA 6NULA 3TNYA 4C20A 4C6TB 4EMBA 5B64A 3ZK8A 1ESDA 3GYBA 1RKBA 3B6MA 4GZMA 4LMAA 5EIBC 4BO0A 3E9CA 1NBME 5JAQA 3ADOA 3QEAZ 1SBQA 3TRFA 1KZ1A 5K05A 1P4HA 3SHFA 4I9GA 1M1YA 3OOSA 1UJ6A 4WE3A 4M0CA 1FVFA 3HB7A 5EQJB 1EFVB 3VU9A 2VDQB 2W70A 1FDTA 4CEHB 2AOTB 1JHYA 4RD1A 4HY3A 4OQQA 4C5CA 1QAOA 2O3SA 2ZUBA 5IC6A 1U2EA 3GHHA 2ZI3A 4MUHA 4TV8F 3OZSA 5FAXA 2XYHA 3ACDA 3C7KA 4MV4A 4QD3A 4QPPA 4GBMA 2O3UA 4N0MA 4OKNA 2HMAA 1F14A 4XWGA 1SHLA 3FI9A 4NF2A 4ZO9A 1EEXB 1TYBE 4AN1A 4OJQA 4Y9UA 4MYDA 4KC0A 3WAKA 1AO3A 1E6MA 3OQMA 2L82A 2QTVA 1BX3A 3CF4A 3FXAA 1O6CA 2ZYUX 3G5UA 4PPFA 4AW9A 5K09A 3QX3A 2CVHA 1YBFA 4Q3KA 4ARZA 3ICVA 2XBLA 2CSUA 1K6IA 3UWDA 4B31A 3AVXA 3KKOA 4PYIA 3UAXA 4C3OB 3THWA 1ZM9A 2VUTA 3OA2A 1GA6A 2Q5LA 2CV0A 2O0KA 3SNHA 3IPRA 1PYDA 2IXAA 1ZJ4A 1PT6A 4U6SA 4D44A 4YNBA 1VE9A 1P2BA 3K0CA 2CXSA 3R6LA 2XGJA 3DFKA 3AKZA 3JAWB 5L9AA 1M6YA 2QYHA 2NUAA 1C1XA 1FMJA 2OO3A 3CW9A 2J0UA 3ZTWA 3WYDA 1WLSA 2ID8A 4BLQA 3E9YA 1ADGA 1UOOA 1TTTA 4FC7A 3FPJA 3OIDA 1N0UA 4CF6A 4Z4CA 2B1RA 4JWTA 4O63O 1SIBE 5L3RA 3HLTA 1WEHA 4IIJF 3FSGA 1PX2A 3RU3A 5BVGA 4CE6A 1IMJA 4OBEA 3PFWO 4RZ2A 1NX9A 2AFHA 1JIKA 2GI4A 4GWLA 4H7IA 5B1EA 4KMRA 4MUJA 3AM5A 3V3KA 4AJKA 3R76A 1NJ6A 1UFOA 2XDWA 1BMFA 3JARB 4WUVA 3CB2A 3HSYA 4BMDA 4DPLA 5BRAA 1ZK0A 1QRRA 4D26A 1KFKB 1P5ZB 2GWRA 3P97A 3VPGA 4DS3A 2G1KA 2MU1A 4BJ5A 1KI8A 2QN8A 2Q6LA 5DYNA 2FCRA 1PZXA 3KT6A 2XDQB 3N86A 4OQYA 4CMJA 4F3NA 5BSVA 2L19A 3EE6A 2HNAA 3P4XA 3AESB 4NI5A 1L5KA 2Z04A 1MAUA 4I4IA 4MLPA 1T3GA 3AYXB 4G5SA 2EFJA 4ZDWA 4CFYA 4PANA 4CMGA 3Q9SA 4YAUA 5YASA 1JL3A 3FUUA 3AEUB 3OKCA 4O2AF 4XB6B 3K70C 4EKEA 4RAQA 3OJEA 1X8JA 4IPTA 2ZIUB 2J6IA 4RX1A 4TN5A 3EVEA 4MAAA 3I01M 3KB1A 4QPNA 2FHSA 2Z1MA 1FLNA 3N0XA 1NVTA 3Q3JB 2BFWA 4WLUA 2DZDA 4C7BA 5IASA 1VDZA 3PTZA 5EKXA 3G1TA 3UUEA 3QEBZ 4BUJA 1KZ4A 4WCFC 4BUZA 5EXPA 3SEFA 3O4RA 1AF7A 2V7BA 3HACA 4G0MA 2LNDA 3B2QA 1Q17A 1COWD 1J24A 3CVVA 3L8EA 1SD2A 1XPJA 2IEGA 2OB1A 3WA6A 4LJRA 3L6RA 1CWUA 3TE6A 2OORC 2BZGA 3M33A 3EAGA 5LOVB 4UAGA 4M21A 3PT9A 3LGAA 1IK6A 1XEWY 2PQ2A 1C4XA 2OBBA 4FHCA 4NK5A 4WTOA 5K1ZA 4X65B 2ZRFA 4L72A 4C7MA 1NE7A 3H5VA 1OLSA 2ODEA 1XGKA 4KFSA 5KPDA 4OXIA 1LZLA 1XZMA 3WGNA 1AKVA 2WSLA 3DCJA 4BP3A 4FHGA 3PD1A 5EIWA 5FD8A 1BOOA 2QQ5A 4GGMX 4HZUA 5E9AA 1NYLA 1OXXK 2KWIA 2BR4A 2A84A 2BEJA 2Z2XA 3GGOA 4ZYLA 5HOEA 2WABA 3OJWA 4H6XA 4P4UA 3F5SA 4WKBA 5H68A 5K9ZA 1L4BA 1QRDA 1TMGE 1WZNA 1XQVA 2JJ2D 2NYVA 1NUAA 1KMHA 1U8XX 2UVPA 3D8SA 3GBSA 5A6SB 1VG0B 4DLXA 4FFRA 2O8CB 1F0YA 2IYNA 3FUTA 3SDBA 1L7OA 3VGPA 1CVRA 4L5BA 1I0ZA 1ZLXA 4EIWA 3GLHB 5T8KA 2HBZA 3NBUA 5CB0A 4KPGA 1SH7A 4QEDA 2PLWA 4TKMA 4EL0A 3H6GA 5JASA 1X1SA 4KNYA 1P45A 2DY0A 3KBOA 4GOND 2NACA 3PX3A 1IATA 4QFMA 2VDWA 3L1UA 3HY4A 2Z3WA 2JLRA 3C2QA 4UEQA 1RMTA 1PW5A 4PZCA 1FSSA 4RTJA 3I92A 4F3RA 4F45A 1U7TA 1QB8A 2OLJA 1OFIA 3K31A 4FFLA 5HTKA 2AXNA 4LZZA 3LH5A 5AOVA 3S81A 3HCBA 1C8BA 1E0SA 1YA8A 1T6NA 3PNBA 3CPHA 3SSAA 2JG3A 4BNDA 3K2IA 5TPWA 2OFOA 3CURA 1M5RA 2GDJA 3N39C 3PUJA 1TJYA 2XCIA 3AUUA 5AJXA 1AIPA 1T5SA 5IPFA 3BKWA 4UVEA 3FCSB 1KEEA 1XV5A 4KE9A 1P5RA 4X9XA 1TAQA 1CY8A 2OXEA 1NW4A 4ZIRB 4QUKA 3AFOA 4FGKA 2NU8B 2ZJ2A 1L5SA 1W9MA 1Y89A 1YL6A 2G17A 3ED5A 4K6HA 4WCFB 3KVNA 3U3ZA 5THQA 1EM6A 1DEHA 5F73A 5G2OA 1Z74A 2OGZA 1LPSA 1AKRA 3X2EA 3E81A 1GCOA 4YC7A 1NQWA 3G9XA 4ZEWA 1I2DA 3ZGLA 1OBOA 2L42A 1DRJA 3MLAA 5I7AA 4NY1A 4E5YA 1M8KA 4MEBA 3QPCA 4XGKA 3U39A 3WY9A 2EJVA 2YWFA 1IDOA 1S8OA 1B43A 2P5TB 2FSUA 2Z4SA 3SYNA 2HPZA 1FNCA 4AKEA 4AX4A 3AEXA 4QPCA 3A3KA 5KCMA 4KOEC 4OU4A 4TM7A 1X9HA 3LY7A 1VE3A 1O8CA 1F1JA 5KHOC 3TJRA 4LX8A 1FLDA 4G9BA 4M6WB 1NX6A 3EDCA 1UMDB 1BDJA 3ANXA 7AT1A 2PSJA 5JJIA 5F51A 1YCGA 4FWBA 3TTYA 1IQPA 4DCCA 3VAAA 3VAZA 5G02A 3WSTA 1E9BA 3KOZA 5TB5A 4CT5A 5LU8A 3DV0B 2EYQA 3JQGB 1CVIA 4CKEB 2AQHA 2NUTB 1GZDA 1GCGA 2JGDA 2HO4A 1IZ9A 2Z2YA 1B6TA 4GLFA 2CJXA 1RWOA 3QUBA 5HIJA 3UYLA 5BNWA 3K15A 4US2R 1HNNA 2YFQA 3CEHA 3KC2A 4EF5A 3BTSA 5DP2A 4DOMA 2EGUA 4BJ3A 3E27A 3SHWA 2J4FA 3C1OA 1O03A 2VSOA 4II3A 1E66A 4OV6B 4IWYA 3DVAA 5AKIA 4CEIB 4DR6B 2P2SA 3R6WA 1YULA 4QJ3A 1FPQA 4M0PA 1BXKA 3KOMA 3RIMA 2J6BA 2L69A 3EBOA 5D85A 1JFTA 3O31A 4JT2A 5CPFA 1N3YA 5D5QA 4PZ9A 1WY5A 2QRHA 4ZCQA 3O7WA 5IFKA 1Q0PA 5JSQA 2HJRA 2Y71A 2HU5A 2V0GA 1TAHA 3UFXA 5BWMA 2OOSA 2WOJA 2ZCUA 5AKEA 3KXLA 2W6MA 3RUDA 1APBA 2VXOA 3AM4A 4GT1A 5KYUB 1VC2A 4RFSB 4CKZA 2CV1A 3FTFA 3EEYA 3I39X 4FB4A 1W8DA 1W85A 2GOYA 3CBQA 1TIKA 3UGJA 1EFRD 5A4IS 1Z37A 3OJCA 4JL6A 1ND6A 3B8EA 4JLSA 3ND7A 4U8GA 1Z07A 3WXMA 5JADA 3ZVMA 2D8AA 4IMJB 1NJ5A 1P6QA 4BZQA 3RWBA 2XECA 4X91A 1I0IA 2NSJA 3O8DA 2XZLA 3OE5A 3EN0A 1DJMA 1SUAA 3EZ7A 2OQVA 3HYRA 3JPYA 3KWJA 4GPEA 4XOIA 4WBNF 2ZM5A 3DMNA 4YRFA 1Z5UA 3HO8A 3OHMA 4OJNA 4Y2PA 4INOA 4QOHA 4X20A 4INZA 2V8OA 3Q3VA 2Q3MA 2DMRA 4ZRNA 5DM70 2X7HA 4RVHA 3OTOB 3OCWA 1MH1A 3FHCB 1EMDA 1XDDA 4OLJA 4PGAA 2FZVA 2GF9A 2VSXA 1D03A 5KPJA 1JH9A 3D0RA 2DBRA 3TGLA 4LRQA 1R6AA 2P2DA 3CLSC 3NP7A 3A3YA 3TI7A 3VR5D 2EWWA 5AM5A 4J0EA 1V8PA 3RVMA 1N2CB 4NENB 1REQB 5TX7A 3BD9A 1GQ2A 3LD9A 1MHPA 5H70A 5TS3A 2H1OA 2ORVA 3KB8A 1K6JA 4GL2A 3B20A 2QU7A 1HQKA 5J63A 2G9RA 3SD7A 3U7RA 4WXEA 3D4PA 4NFYA 3CE6A 4P53A 5TE9A 4D0SA 2AOUB 3ZXXA 2AYXA 3ENZA 2QUKA 3K1AA 1T9AA 1FUIA 1GFZA 3GZJA 4GKJB 3EFOB 4Z53A 2AHRA 3OUUA 3STHA 4Z2YA 2AG0A 1H3NA 4EO7A 1E1RD 5A04A 3X43A 1QSGA 5HSGA 2PXCA 1C7ZA 1TVCA 2GK3A 5LDHA 1YZYA 2HL6A 4LCJA 2QJFA 2ZK7A 1UKEA 1O0SA 4ZODA 4F6RB 3GH3A 4OXRA 5FFMA 4GM4A 1FS4A 3I0ZA 4LGCA 4D92A 4B6JA 4POAA 1U8AA 3HFRA 4D8TA 1NU6A 1XTBA 3I9V6 3A25A 3K8OE 3ZWMA 2CXOA 5FYDA 2AXPA 4ZGGA 5KNDA 4OLBA 2BTOA 3OY2A 2HW8A 3H5RA 4M0KA 1ZXLA 2XAUA 4BNHA 5FFNA 1SJ9A 2GYUA 4XWYA 2XE4A 1KVTA 1RQ7A 1PYGA 3TSCA 2G3YA 5A1JA 2ZQZA 3WLNA 3D31A 3PCRB 2AZDA 4HFJA 5HG0A 4GPTA 1X7DA 5K0TA 4NG4A 4LBVA 4RCVA 1WULS 1GKKA 4G9GA 3CVYA 3HUEA 3A6EA 3SR0A 1E5QA 1K8YB 1KP2A 2WWXA 4MB0A 3TZCA 4LF7B 3HHPA 3EPJA 4BE9A 4PE5B 1S02A 4RM2A 1PVOA 3DWEX 1KI4A 1RQLA 3PHBE 1U0SY 3VDQA 1NE2A 1K63A 4EGJA 1ZIXA 4TZTA 4BQQA 1KPHA 3HR8A 2EZ9A 3AI2A 5HFAA 1A8HA 4ZPJA 2I7CA 3KXIA 3HKDB 5BR7A 4AJEA 1PQ4A 1ZGGA 3AJAA 5CHYA 1W5EA 2J5QA 4TX1A 2R65A 3UK7A 5K6AC 2IDKA 3MQ4A 5EGNA 2ZE7A 3M49A 3CEJA 2FFJA 2XUAA 4JT8A 3B1KA 4QDUA 2AWOA 1JVSA 3DR3A 2XIQA 3FTEA 5E7QA 3PA8A 3JD3A 3OZFA 2I2WA 3AOEC 3GP3A 3V55A 3D3WB 3ELUA 2BFCA 5LIPA 5JO0A 1V43A 5JS1A 3GARA 1J33A 4N3AA 3GFVA 3NEJA 5LA6B 1ZJYA 2OQIA 1TZMA 4XJVA 5FTLA 2B3DA 4R05A 4TWAA 3TDKA 4CGZA 2PKXA 1M83A 4TM8A 2GCEA 4MVJM 1JYSA 2AQKA 1G9XA 4FHDA 5JZ9A 2IYPA 4DWWA 4J75A 3WGGA 4PYQA 2JATA 2QG6A 5CLQA 1M7BA 2W6IA 3A2NA 1KJNA 2Q49A 4RMIA 2CVZA 3ZHUA 4TGLA 1M0TA 2I2FA 5EMNA 4LZNA 4BNFA 1G21B 2D54A 5J4KA 1HXHA 4M38A 5AVSA 1IWBB 4B35A 2FSSA 3NORA 2W6QA 4CQMB 5ENDA 5BOSB 3L46A 2P5SA 2DHCA 2YQ4A 1BN6A 3WWEA 5JNVA 1AD2A 4MVJF 5AM4A 2PX2A 3SVZA 4US0R 5T4FA 3FETA 3HU1A 3LF2A 3OFKA 3P0IA 4HH4A 4KE6A 3E7PA 3VHRA 1DOZA 3PVSA 1RRPA 4LOAA 1QS0A 2O2YA 1JALA 2HA5A 1KQOA 3O94A 1WSBA 1X87A 5L40A 4U7DA 2M98A 3WMFA 2AZXA 1JIUA 1Z12A 2V7TA 3MINB 1JG7A 2IVZA 3T7AA 1ZEJA 2JIRA 4PPGA 1Q95A 2PFKA 3NR2A 4IF4A 1A9XB 4GDFA 2WKRA 2HJVA 1D4ZA 2DEUA 4KRGA 4TUYA 3G3EA 3GRPA 3R8FA 4O4IF 4KDFA 3FDJA 2EW2A 2H2GA 3WK6A 3ICPA 4E4RA 4OU5A 3MHTA 4ZC1A 5FBQB 1NFRA 3QI7A 5C7YA 5KDDA 1RQ2A 3VXKA 1VRWA 5CG1A 1ZAKA 3IEUA 3HYCA 1Z18A 1PQWA 2VFAA 4NZZA 4GMXA 2G5CA 2AJTA 5JWHA 3TLBA 3U7EB 3M6WA 4DA8A 5SZKB 2RI1A 3BRCA 2OUIA 5EP3A 1ZM2A 3LM8A 2WNIA 3TRKA 4MQ4A 4PCVA 3EVGA 4UBNA 4F4DA 2Q0XA 5JVDF 1BMFD 3VPHA 5BSKA 4WHMA 4IVNA 3NGMA 3HWSA 2BEKA 2FEOA 3IQXA 5KYKA 1V8DA 3LNCA 4LHXA 1V4BA 4IBOA 1MKYA 1VG1A 4NS4A 1RM5A 4WGGA 1F48A 3UW3A 3YASA 2P78A 3KQHA 5TVGA 1AT1A 5TXGA 3VC3A 3ZIDA 1VJTA 4XDZA 3TBFA 4L76A 4A03A 2FW0A 5CA0B 2P0AA 2CLCX 1MQAA 2QSZA 1ORHA 2SKDA 5LDDC 2BR3A 1MB9A 3FYHA 2QD5A 3Q5GA 3P0HA 1TJNA 4RXUA 3AW9A 4B17A 1STOA 2ATIA 2JHAA 4IQ4A 1NFFA 3SICE 3A58B 1Y4DE 3TLZA 5JLAA 3USZA 3W1WA 4IL5A 1H4SA 1VB5A 1CFJA 1JE0A 3AVPA 1TT7A 1Z4OA 3DL0A 3KQYA 4IDDA 2CF5A 4U2GA 2IWHA 2F1HA 3AJRA 3TRIA 4D82A 1NQAO 1PLKA 2EBUA 5AD1A 3EHDA 1NUTA 4ZEOA 3TW8A 3GZ4A 1HDRA 1N5KA 1K7YA 1S8AA 1ZEMA 2HQ1A 2YXNA 4AJ1A 5BORA 2RC5A 1VE7A 3MLEA 4QARA 1PEYA 3QPBA 5SV2A 2V3WA 5CR9A 1K3FA 3L4BA 4YIHA 1D5WA 3O3CA 4MYRA 3C3PA 1CUZA 1KZYC 1LBIA 1Z29A 5C52B 1FJHA 1QG4A 1JKIA 2VJMB 1ZN2A 3FVVA 1Z38A 2QPTA 3PJEA 4H0FA 3FGZA 4UNPA 2PEYA 5MGNA 3D59A 2VA8A 5FL7D 1D0IA 1JLHA 4MPRA 4M89A 1Z0KA 2EG5A 3Q9LA 3IVCA 3M6XA 3ZCUA 1NVXQ 2G80A 2Q7XA 3ESXA 4IDPA 5EE3A 5KIAA 1G6Q1 1LS6A 2IS6A 3PR3A 3LP5A 2W2OA 4LC1A 4QRDA 2IP2A 5ALFA 1L5ZA 2AKAB 2QAGA 1G8FA 4LKRA 4CUJA 1XZQA 1DS6A 3S8YA 3UXMA 3A1SA 4LV6A 3K1TA 1Y4ZA 5DMXA 2O0MA 1HE1C 1N5OX 5LM3A 3ESQA 1RJWA 4HDNA 1ZNXA 2Z56A 2GPTA 1VLLA 3ILHA 3PPXA 1CQPA 5REQB 2ZSJA 3CGGA 4H0NA 4PVCA 5H3HA 2CXPA 1J49A 5TT1A 1GL7A 1N8TA 3N0WA 3QVMA 4G3XA 2D5LA 2PU7A 4MQ6A 4GXQA 3QYPA 2ISSD 4XR9A 4QSHA 5DCUA 1D04A 3RRXA 2VBIA 3TRJA 4PLPA 3O9MA 3UHFA 2GZAA 4ED9A 2FWNA 4EFKA 2ZTLA 3OU2A 4JODA 1G1AA 4HWRA 2BTQB 4OATA 1GU0A 3R3UA 621PA 2IXBA 2J9FA 1AS0A 1SA0A 2MYPA 4CCSA 2YIJA 4UCFA 4ZOLB 1ZGJA 3PUXA 3TOZA 5L6MB 4JBGA 1Z36A 2VIIA 5DRTA 3K0FB 1UJ4A 3N58A 3GP5A 3CZCA 4OMFG 1DQPA 1ZJZA 4WLVA 5BWOA 5I9LA 1HF3A 2EJUA 3B7PA 3CNBA 5F2EA 4AECA 2A35A 4B9AA 1K89A 3VDNB 1BS9A 1G7SA 1NY6A 2LCQA 3TW4A 4PC3A 2O8FA 5FLXA 4PEVA 3I5MA 3TLGA 1E4VA 2IDMA 1KDTA 4FFVA 5FEUA 1C9EA 3WGHA 3C6XA 4JLAA 2PSHA 2FW9A 4OUKX 3VKVA 1L5HA 3W2TA 1F2TB 1E3DA 1BHO1 4QOEA 4QE3A 4X61A 1JHAA 2HCRA 2X4IA 2NT3A 3X1XA 5BNTA 1ZHHA 4Y8VA 1E1QA 1R0XA 1JXQA 1DQRA 2C8LA 5UKDA 3QSGA 3P9NA 5ALDA 4P5PA 1ZNYA 4MW2A 4HAWA 3ESDA 4QGGA 1MZVA 5IABA 5KQLA 3ZGOA 3LXXA 1LJLA 2LKCA 1LJUA 4KGXA 5LZ8A 2FMKA 3H2BA 1QHHA 4X44A 1YJBA 3O92A 3TMAA 5JAMA 4QA9A 2VATA 4O2BB 4ZAZA 3GJRA 4ABTA 2HYIC 3OE4A 4WCVA 5IXYA 4KR9A 4OBWA 2B69A 4BIMA 1X80B 3UXHA 4UXIA 2G9VA 4DMCA 1XN1A 3RAFC 2XUPA 2R8OA 4K0KB 1RBZA 4DVGA 3O8LA 3N8IA 4DLYA 3RK4A 3NYIA 2VYVA 2C2WA 3IT1A 4E21A 3RV4A 4BGIA 5KTTA 2VQ6A 3V4OA 4GKVA 3SZGA 3Q3IA 2OBNA 4MMXB 2DFDA 3TVTA 4EO4A 4R0VA 4TXHA 3DAGA 1ZJJA 5DCYA 1F9EA 2LXNA 2Q27A 2VTEA 1XMOB 1YVUA 1JV2B 3TKYA 1WXWA 4EMUA 5FTMA 3E1GA 3H16A 3F6RA 3LYHA 4WDRA 4A2CA 2PU5A 5HGXA 1ZK2A 1FYEA 2P4SA 1KAQA 4YTEA 4Y6PA 2NTNA 4HVCA 1JDBB 3SDZA 1P7YA 3WKAA 5MN4A 4HNAA 4PSVA 1JDSA 2YASA 3HN6A 4BGDA 3E9NA 5HWSA 3GEPA 1ZUIA 2E89A 4X62B 5BNZA 1VI2A 3W8NA 4L08A 2YZ7A 1Y9JA 5KJFA 4UDNA 5JCOA 1UPXA 2FX5A 3LC0A 3DKVA 5C5CA 4WADA 3GPDG 4JUAA 2WIJA 2C9ZA 4AAYA 2R6GA 4S1VA 3HKCA 1MHTA 4DREA 3GJ4A 2HA7A 4R2MA 1C7EA 5IG2A 1O6ZA 3FJYA 4TMZA 3VKWA 2JEOA 3LPLA 3PRKE 5DLQC 4JBYA 2RGDA 4HDCA 1ZAYA 2CXTA 4V0MA 1KYYA 3LA6A 5BNFA 2JL1A 1TB4A 4MO9A 4GGPA 5K45A 4XJXA 4RVGA 4RTLA 1RMQA 2V1UA 1ZGHA 1NMZA 4EL5A 3LTEA 3KO8A 3KQQA 4JV5B 2XKJE 1HYEA 2V7GA 1QONA 4EY5A 1CUWA 1Q92A 3TFOA 1V3VA 3DP7A 3W4JA 1Y6QA 1DBWA 3QKIA 1VIYA 1OH6A 5BN1A 1KO7A 2WVGA 1E2UA 1O4WA 3NYWA 3QFHA 4WNAA 3ABZA 3B1FA 5AK6A 2BGUA 4NYIQ 2ONCA 3QZUA 2A92A 2GMWA 4V1CA 1QFXA 3JQ9A 4FZJA 2FPKA 4ENUA 5AW1A 2QP9X 2O50A 4TOIA 2C9YA 1VPLA 2F3TA 2IP4A 2PMDA 3NXKA 5JZMA 3UT6A 3ZD7A 1TUGA 1LBSA 2RJNA 3FUXA 2ZBGA 2QRLA 1VKJA 3IILA 2AR7A 1NJGA 3L8MA 1F2VA 3JYHA 4GWGA 1SUBA 2GZDA 2C5AA 4JYBA 4NSNA 4B73A 1YZGA 3KKZA 2PANA 4BO1A 3F97A 4B2PA 3O1JC 1Z9BA 2FW1A 1RWNA 4DMRA 1V6CA 3AUTA 4JY7A 1BQ3A 4FGSA 4QOFA 4EYGA 1ZU5A 5JI2E 3PE4A 5AW0A 2GUWA 1XUOA 4RMHA 2BFBB 3AF2A 2XRYA 3PNQA 4R51A 2XD4A 5EZ6B 2IUYA 3U7HB 3DHYA 1E0DA 1QQ7A 2NZYA 4FMBB 3UXYA 1ZO8A 2I4OA 3K94A 4ACAA 3RTCA 3NBYC 1UC4B 4D5EA 4GMDA 2PQ0A 1U5BA 3G2KA 4D8WA 4Q3EA 2QENA 4TL8A 1J5EB 2ODNA 3LL4A 2YWJA 4IQGA 3S7TA 4YV1A 5KWIA 1I3OA 1JAYA 3KD2A 1R27A 1KAHA 3GGCA 4GUAA 3H2SA 3OJOA 4HAYA 4MRAA 2VNAA 1EINA 3ZV4A 4FZ5A 4ER3A 2QG4A 3QVJA 3WB2A 4JI8B 2JCYA 2ZYVX 5KNDD 3ASZA 2B2XA 3TQRA 3U40A 5E6UA 4D0NA 4NZNA 4S0XA 5DGTA 4BVLA 3DLHA 4PSKA 4J9UE 1CUXA 3PX2A 2EFEB 1HZZC 2R85A 2P79A 3WIBA 2DR0A 3WGIA 1CP2A 5T4HA 1OY1A 4W5OA 1GGFA 4GXNA 4J1NA 4INPA 3WKDA 5EIEA 2EW1A 3GY0A 3MJSA 4KI7A 4E6EA 2ID9A 1ID1A 3DVQX 3GN1A 3NM5A 4RZHA 4UE2A 1MO2A 1UBNA 4ARCA 1YZKA 3K6RA 2MCFA 4CKXA 3QELA 2M1ZA 2IODA 1RXCA 1UODA 2P91A 1IXKA 2RGEA 1VMDA 4FIZA 4UHJA 4YJHA 1JWLA 2AIRA 2YVQA 5FA8A 1V7CA 4HRVA 2XLBA 5EUMA 3W4KA 2IDJA 3RQSA 4EYEA 1TUBA 1SOUA 4P81A 4XKJA 2QL9A 3P52A 3G13A 1HEIA 4M1TA 2P9GA 4Y6LA 2WB2A 3MJCA 1A5ZA 4XR4A 2JH9A 4RCYA 4Z9BA 3DOOA 2XMPA 5A71A 3SKXA 5JCJD 2XMQA 1E7YA 3C7TA 4ER5A 4ZV4A 5CIQA 3UH1A 2D5CA 4E12A 1FDOA 1H23A 4R8RA 2IV2X 5C8YA 2ZIFA 2IUTA 4RIFA 5IBCA 3HCNA 2YHIB 2QM7A 5ARDA 3U4QA 4HGZA 3KXPA 4BMZA 1IHUA 1MU0A 1M2OB 4YRJA 3HYSA 4W8OA 2WVJA 3RVJA 3U9SA 4BGUA 3L6BA 2R7KA 4RKRA 4WKOA 2ZRCA 4KXUA 4Y6GB 1HOXA 4WN9B 3V1YA 3N3BC 4X8OA 3ZNNA 5FO0A 3PUYA 4BB0A 1PEDA 2W6ID 4NAVA 1XEXA 1T9CA 1SZCA 1N5MA 3DE0X 4I9FA 2Q3DA 2WOOA 3AUAA 3NWEA 5L3QB 1J8FA 1VZ2A 3NDJA 3E5MA 3GJTA 3UO8B 5IUNC 3PC2A 1AHIA 4QUBA 1E96A 2Q5HA 2XI4A 1JDZA 1Y5MA 3U7FB 1L3BA 4Q3LA 1MO6A 2I2AA 3BGDA 3NUQA 4DBVO 1V3UA 2G4VA 2JJQA 5K2OA 1J6UA 2PD4A 2FR8C 4MVJI 1HG1A 3LE8A 2FPSA 5DX1A 1NXWA 3IQHX 4CDRA 3G9UA 3EH2A 1XEWX 1SBZA 3ET5A 3IBCA 1G17A 4X24A 3LW8A 3MGBA 3ORRA 4Y2HA 4W5QA 2E21A 4LVUA 4NU5A 1HSOA 1A9SA 3ON5A 2WINI 3VR0A 2VWPA 5CUQA 4BX0A 5AUOB 1IY0A 3RYHB 2CJWB 6YASA 1B26A 2E7ZA 1H9BA 3MT8A 4LRXA 3LLMA 1UEJA 2OHXA 2Q21A 1XP8A 1PZEA 4XGQA 4K88A 4I4TB 5FIUA 3QF4B 4FOSA 5HNKA 4TL9A 2EATA 4ZZ1A 1JSCA 1KY4A 1XJ5A 1FX0A 2Q0QA 5EHQA 4L7VA 3DMYA 1NTRA 1NPYA 4DRZA 1O54A 2FOXA 2BDEA 2I55A 4RORA 2Q7DA 4I9HA 5CCEA 5JNUA 3RW9A 4KX5A 4O1IA 3T4XA 1OB2A 2G77B 5BURA 3O7MA 3FVRA 2FOLA 2W2MA 4PGHA 2WHRA 3MSXA 2QN3A 3N3AC 5TV2A 3SX0A 2BFMA 1KAOA 3JAMA 3CMMA 1OJLA 2WJZB 1WBDA 1G7CA 3DBRA 1JQ3A 5TF4A 2JRCA 4U2DA 2WZBA 4ZEXA 1DO2A 3H8SA 4AKGA 2PJZA 1RE1A 5LMCA 1JHRA 2RG7A 3H05A 3L7BA 4GL4A 1C1DA 3W3ZB 2I54A 2GA8A 1W96A 1XKXA 2V0NA 3R0VA 1Z35A 4NPHA 4AY3A 2D7DA 2XITA 4MGZR 1SIUA 3Q7PA 1MX3A 1QU3A 2BJHA 1YE8A 4KIWA 2XODA 2D2FA 2I2XB 4EHBA 4MWCA 3U9LA 5FLEX 3SOZA 2A78A 3U1VA 5LJLA 5KEIA 1CR0A 4P98A 4QU8A 1DP4A 4DUGA 1FYFA 3EXG2 4F0JA 5F9HA 2M6SA 2H0AA 2ZT5A 4NJMA 4RJLA 1EQAA 4C2TA 2F3RA 2BM0A 3ZG6A 2FEPA 2DHEA 1EE1A 3ENVA 4JP1A 4CM6A 5JARA 4AYXA 4B4DA 3PPYA 3EAQA 2LCIA 3I4LA 4XCXA 3RADC 5TARA 1ZX1A 4IDCA 3OC0A 4QDTA 5JJCA 2UZIR 5LQMA 4WK6A 1IEVA 4CEJB 4MS1A 4CIAA 4XVRA 1W2WB 1V1RA 4NFHA 5JNTA 5A62A 2IYZA 2FPIB 3TMYA 5DHTA 3VISA 2QRNA 3QOWA 4KXQA 1OX4B 3R5FA 1N1GA 4A26A 1UBJS 1JLKA 1ZSYA 1TJ3A 4AJ2A 4TVBA 4UW9A 5IT4A 3GFTA 4YQEA 5B58T 1OXUA 4Z49A 5ALSA 1P19A 3BMQB 3IA7A 3LUPA 3VPSA 2NMVA 4GD3Q 2W58A 3M7IA 3N2GB 1SCKA 1S2NA 1P9OA 1E8NA 4NZ9A 2VQDA 3EOZA 2YIMA 4PIMA 4MNTA 3AI7A 4YFYA 1E8MA 1GA1A 4LXHA 2BOVA 4KTTE 2ZWPA 4DANA 4B0OA 2GBGA 4UHEA 1UKVY 3LX4A 1AKMA 4KWHA 2FMTA 1D7OA 1JJBA 2V58A 5J2UB 5K01A 1D07A 2JFWA 4KXYA 3OEHA 2DBQA 1R8YA 4B8ZA 2AJDA 1ZKMA 4BO9A 2OTCA 1ISSA 2HBYA 2O2GA 1SBTA 3GDGA 5I7SA 3FNIA 4PXYA 4R3NA 4YP9A 1D9XA 2MHCA 3N8GA 3STTA 3IPYA 2NSLA 5CBKA 5A9RA 2I6XA 3NRJA 3OOEA 1TKCA 3KQLA 4HTAA 2GZ3A 3AFNA 4R1MA 2F1OA 3GVIA 2ZRPA 1XDGA 1M74A 3IOEA 3PLAE 3ZI0A 3RVPA 5J4VA 1UBRS 3QU9A 4A0SA 1ORWA 3MMPA 4WV3A 5G1PA 2IOHA 3RC8A 3V46A 1I1HA 1RLUA 2MOKA 3COZA 1UJNA 2R8BA 4ZJUA 1AXEA 4FYJA 2Y1WA 1X0XA 5TSDA 4FILA 2V74B 1OA0A 2FZ4A 3A6JA 1EVQA 1FMTA 4IGFA 1MC8A 5E7JA 1FTYA 3EW7A 1L8OA 4Q9NA 1E6EA 2AFIB 2D2EA 3E22A 5DBOA 3UMFA 2QM8A 1OWPA 1Z15A 5IAAA 5E2IA 2VN8A 3IAS1 3QUCA 4ZI7B 1OIXA 4C0HA 3EVCA 2A9VA 1KFEB 1E1QD 4RQTA 1QP4A 4JP5A 4RV5A 2YYYA 4BBJA 2OBFA 5HRCA 2AG5A 3MTJA 4JKIA 2ZSUA 1FSPA 2XMCA 4UNQA 1VPVA 5FLYA 4UHBA 4TV9A 5SY6A 3H65A 1OBFO 1Q7EA 4ZHQB 4KH0A 4ENSA 5C0OE 2P40A 1TZCA 2IHVA 4ZQGA 4QJBA 4I55B 4BDSA 3ZTYA 1G18A 5AM0A 1HO3A 5LB4A 2VHUA 3VDMA 3L5OA 2F3QA 3TK1A 2BHLA 4EO9A 1PQPA 5DLPA 1YFLA 1LDGA 1Z6QA 2QGZA 2O8BA 3JVVA 1CNFA 2ZATA 4ZTBA 1VB3A 2C7QA 1QAMA 3N74A 1PTJC 4E5DA 2VYVD 1MGPA 1KS9A 1DFGA 1KK1A 1O7JA 4TLCA 4WVFA 2PGOA 5K8IA 1WL8A 1PZNA 1P3JA 2CUNA 1EWTA 1WMFA 2O4CA 1C14A 2WNSA 3B12A 2D5BA 3GQBB 4Y1RA 1JQAA 5DNEA 2A5YB 3C48A 4Q9AA 1AY0A 1OWLA 5EAIA 5FPQA 1KMQA 4J3NA 2A0FA 1GM5A 4WOCA 2XRZA 5ADWA 3EQ6A 3U26A 4BMVA 1IH8A 2PV7A 5KSZA 3H6HA 2O7SA 4F56A 4LCBA 3D43A 2XKAA 3GJ3A 3GZNA 3K4QA 2VQSA 3DWFA 5LNK1 1UXGA 3OLYA 1CJCA 3ABIA 4OSEA 3LFTA 4LQDA 1Y6ZA 2I78A 3BEOA 1E94E 1U9IA 2QORA 4UFOA 3G0GA 5CB4B 3CS3A 1Y34E 1RRMA 1LW6E 3THSA 1SXPA 1L5NA 5IDQA 4CN8A 3DD1A 4QTTB 4UCQA 1THTA 2R6HA 3ESZA 1LI7A 2WSBA 1JQLB 1OAOC 2YINC 3FOWA 3FNRA 3GJXC 4GW3A 3TI9A 3L04A 4OGKA 2IWRA 3A6FA 1KFJB 1KO1A 4YMWA 5KNBA 4C7JA 1FVXA 4KQIA 3B9QA 3BXHA 2H63A 1MCZA 2ZSIA 3CUWA 3LDFA 4HXYA 3QXGA 1N1DA 4G4GA 4FSHA 2LGJA 4HQRA 3RVOA 5KDOA 4RTPA 1YQEA 3EZFA 5D3MA 2CHEA 3OZBA 1P1BA 2I2DA 3N53A 3F5MA 4RVNA 4NG5A 4L78A 4PBSA 3O8NA 3VH3A 2GZHA 4CV0A 4TS9A 4D42A 5IT5A 3NJ4A 2P2NA 2ODTX 2J9GA 5LMUB 3P2MA 2WF8A 3RSOA 5HZHA 3M6IA 4BFCA 3R5SA 2WF9A 4M9QA 2XXBA 3A1DA 4YMGA 5F98A 1IM5A 2AYYA 4UAVA 1QYDA 3H9UA 3VX3A 2QX6A 2W83A 2WU1A 4D9BA 4DAEA 1Y8RB 4OY3A 5G4LA 5B3LA 2GZMA 1G98A 3O8CA 1G9TA 1I3LA 3ZJ5A 3QX9A 1DJNA 2J3MA 1YOVA 1NVGA 1SXIA 5LBIA 2NTJA 3CX6A 4IMRA 4L3WA 3B85A 2KX7A 1EDDA 4MUFA 2XXAA 5DWDA 3ZY6A 1T8UA 2XTMA 3D6JA 3KLOA 3V1NA 4AY6A 1QIKA 2CBGA 3TUJC 1AMUA 4YQFA 4XWOA 2A1UA 2IYOA 1W6RA 3DULA 4JC4A 1M2JA 3PFIA 5IJZA 2ZTUA 5HK9A 5B55A 2QRUA 3IJPA 4NEQA 2H65A 5BY2A 4Z4GA 2WFAA 3KM0A 2G0AA 1DRKA 3ROZA 1FF9A 2RHDA 4KDEA 1SKYE 4DT1A 2P9BA 4RVUA 3UQZA 5K0SA 1XMXA 3RSQA 4LYHA 2P6OA 2O3RA 3FYUA 3RC7A 5CITA 3UENA 4KNWA