1Z12A

Crystal structure of bovine low molecular weight ptpase complexed with vanadate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
157
structure length
157
Chain Sequence
b'AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Crystal Structure of Bovine Low Molecular Weight Phosphotyrosyl Phosphatase Complexed with the Transition State Analog Vanadate
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 62
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z12A00
4YP9A 3GV0A 3I42A 4RV5A 1YS6A 4NV3A 4MLDA 4QYMA 1WETA 3HZHA 3GBPA 1GCAA 1SRRA 4LRQA 1PHRA 1U2PA 2MYTA 4EYOA 1NXXA 4MQEB 3KTOA 1U2QA 4HYEA 4XASA 4JB2A 2PUAA 3KYIB 4IF4A 4ZYLA 1E6LA 1USKA 2A9PA 3M9XA 4RK7A 3O75A 3W9SA 1E6MA 3QX8A 4O5AA 1USIA 1K66A 1MB0A 1Z15A 1DCFA 1YMUA 1PNTA 2PMCA 3H5OA 1FQWA 3BILA 3IP5A 4RDCA 2W42A 2JVIA 3BRSA 3NBMA 4KZKA 4F8JA 1ZGGA 4IILA 2B4AA 3GL9A 2XDYA 3KSMA 1TM2A 4KMRA 5GQSA 1ABEA 1SXGA 4RK1A 3HM9A 2HSGA 1FFGA 2ID7A 1JDNA 1DCKA 2JB9A 2L17A 2M1ZA 3EJWA 1NXOA 3O2SB 1ZGZA 4RY8A 2FQXA 5KWSA 4W5OA 3KKEA 4RXUA 1K68A 2FMHA 2HQRA 1NXWA 2FVYA 3QLTA 4HNSA 1OXBB 4IRXA 3ROFA 4XAQA 4RU1A 3QLUA 2CHEA 5TPZA 2PE5A 3LUDA 4N0PA 4QICA 2L2QA 1EWKA 2HQOA 1Z12A 4YCSA 5CNKA 5JNWA 1A04A 4DADA 4P98A 1D1QA 2M98A 3H75A 3IP7A 3KLNA 1DZ3A 3D8UA 3T6KA 5FBKA 4YR7A 4G0XA 3HEBA 1DJMA 1JHZA 6ABPA 1QP0A 4OBBA 2LIVA 5JNUA 5KQPA 4RKQA 4F3TA 2MSWA 4TN5A 2CHFA 4MR7A 4KK3A 2E4WA 3MM4A 4LE2A 3SNKA 2PUDA 3MF4A 3CU5A 1VLZA 3KCNA 1DBQA 4EVRA 3EAFA 1XWWA 3Q15C 1FFSA 1TJYA 2JK1A 1NXPA 2WRZA 1NXTA 1ZH2A 2LP4Y 3N8IA 3QELB 4MR7B 1T34A 3CS3A 1S8NA 4CBVA 2AYXA 4YGXB 3TD9A 1ISSA 3H5WA 4EYKA 3O74A 1DBPA 2HQBA 4N41A 3HVRA 4G86A 3Q7RA 1YMVA 1L5YA 4Y9TA 3O2QB 5IUJC 2A9OA 3EGCA 1BAPA 3FFWA 2PUEA 3DLHA 5IUKC 3LUJA 4WWHA 3SQNA 3BRQA 3ILHA 5IEJA 5KC9A 3HV2A 5C5CA 1VPWA 3QLUC 3ROTA 3C3MA 4KQ9A 4Z9BA 4JP1A 4WXMA 3CZ5A 4MS4B 4EYQA 1RZRD 6CHYA 1JBEA 1YTUA 3HO1A 4Z4IA 1JFVA 2ZAYA 3CG0A 3GBVA 4IMJB 3RVNA 2R48A 4Z4EA 2IKSA 2RJOA 4W5TA 3T95A 5CNIA 3SG0A 4YWHA 3B2NA 4MRMA 1MB3A 5BRAA 3OLXA 3OM0A 3HXMA 2OQRA 4EVQA 2MSLA 2QZJA 3QEMB 3EULA 2NZVG 1F4VA 3QEKA 3IP6A 3G1WA 3LUHA 3CTPA 1ZITA 4MS1A 4PICA 5TQ0B 3S99A 3GT7A 1NY5A 5JNTA 2MYPA 1QQBA 3I5AA 2R47A 1ISRA 4JA2A 1GUDA 1VKRA 1ZN2A 4H60A 3RQIA 1ZESA 2MYUA 4KVFA 3OQMA 1BVHA 4NICA 4ZMRA 4E7OA 2PL9A 1P8AA 3SM9A 1SXHA 2LPMA 3A10A 2GX6A 2VYCA 1PEAA 4RKRA 2F8SA 4N0QA 3OMXA 8ABPA 2E4ZA 2R25B 2R4QA 2WJWA 4TMYA 3HDGA 3H5TA 5FWXA 2JVJA 3LUAA 1DG9A 4KV7A 1KRXA 4YRZA 5DKFA 3DLBA 2ZWMA 3MIZA 2E4YA 3RVQA 2RGYA 2QW1A 3M6MD 3K9CA 2GWRA 4N03A 1D5WA 4MLCA 5DLEA 3KYJB 4MS3A 1JL3A 2WWVD 2VUIB 5BQ3A 5B3JA 3OLVA 2BGGA 4D74A 5JS2A 1JLKA 4ETMA 1J56A 5JNVA 3LUFA 2HPHA 2CD7A 3C3KA 4RXTA 4H3HB 4MS3B 4OATA 3EQ2A 3CZCA 1DC8A 5CHYA 1R8JA 2KYRA 4JASB 4LZLA 3FGZA 1LBHA 3H1EA 3MYYA 4L4UA 4NCAA 3H1FA 2FTKE 3DZDA 4NCBA 3R0JA 2F8TA 4RY0A 3RVSA 5IX8A 4O1HA 1IIBA 5EWLA 1GCGA 5TPWA 3L6UA 3T38A 4F06A 4PEVA 3EQZA 3BREA 4W5RA 1ZVVA 2FKAA 1P2FA 2O20A 4LDZA 4M88A 4N76A 1RPJA 1QKKA 5HQJA 1QP7A 3MMNA 5EWLB 3H6GA 1E6KA 1EFAA 3H5LA 3LMKA 4TLMB 1YVUA 1CHNA 2FLWA 1QP4A 2A9QA 4ZPJA 1USGA 1XHFA 7ABPA 1BDJA 4IGAA 5IBQA 3O21A 4OTZA 4Z0NA 2PJUA 4UHJA 2WY2D 5TQ0A 9ABPA 3LKVA 4Q7EA 3CG4A 2PL1A 5IC5A 4MPTA 4MQFA 3LUGA 2V0NA 3LKBA 3RVJA 3OO1A 2N9UA 3O1JC 3RVMA 1AB6A 2ID9A 3DGEC 4PE5B 1LK0A 3VNBA 1I3CA 4Z4CA 5ABPA 2E4UA 1OXKB 3OLWA 1UDRA 1P6UA 1QNLA 2NT4A 2YHBA 3L49A 3A0UA 3O2JA 4H3KB 3H6HA 4IMIB 4LDAA 3HUUA 4RY9A 3VNAA 5T7BA 1DCMA 2JRLA 4ETIA 1DC7A 4GPAA 4ML3A 1A2OA 5BR1A 5FWYA 2NUBA 4W5QA 3N75A 1Z13A 2TMYA 3F6PA 5TQJA 3TX6A 3HJFA 3G85A 3DGFC 1KGSA 1Z2DA 4RSMA 3OQNA 4G0QA 3IPAA 1JWLA 3TMYA 4DQDA 4KREA 4RK4A 2JVKA 4S05A 3JTEA 1PEYA 1RXEA 3QLVA 4MAAA 1BDIA 2L18A 2PLNA 1QO0D 1PUXA 3I45A 3CKMA 2HJ9A 1RXIA 2FEKA 4LE1A 4ZJPA 1MIHA 5FBHA 2WB4A 4FE4A 1KRWA 1NXSA 3LFTA 3NHMA 2H0AA 3NHZA 4XXHA 4WZZA 1Y1LA 3JVDA 4MR9A 4XARA 4QPJC 4KPYA 3C6QA 3HCWA 1DRJA 2FLKA 3JS5A 3KS9A 5D2CA 4RK6A 4TLLB 3EODA 1TVMA 3IPCA 2PUCA 4G0MA 1RZRA 2LUOA 2IPLA 1DRKA 2P4UA 1F51E 1E2BA 1EWVA 4LE0A 4Z4GA 2YHAA 3C97A 2FN8A 2J48A 3RVOA 4MRMB 4Q6WA 5HSGA 2B1JA 4JAVC 1YS7A 5PNTA 4S04A 1YK0A 1JYEA 1QMPA 3A0RB 3O1IC 5DTEA 2FXIA 4LX8A 4N47A 5KI6A 5GOTA 1GLGA 4RXMA 3O1HB 4PYRA 3SAJA 1RNLA 1Z17A 3RH0A 3KJXA 4QYWA 2IPMA 4MS1B 2P9HA 3JVIA 4ZMSA 3Q41A 2NT3A 2QR3A 2PUFA 3RVKA 4FB4A 2QXYA 1KMIY 3FFXA 5DGCA 3TO5A 5KQGA 3UKJA 4G0ZA 4MGEA 1NXVA 1LJLA 3QLVC 3GRCA 1M5TA 3Q7SA 4JOQA 4MR8A 1U8TA 3NNDA 3GWGA 3HS3A 4B09A 5IUNC 2DRIA 1C4WA 3H5VA 2FN9A 4Z9AA 3LOPA 5TE9A 5FWXB 4KK4A 1NTRA 2WJAA 3BBLA 4MR8B 2PAFA 4Z99A 4RK0A 5KC8A 4W5NA 1LJUA 4D6XA 2RDMA 5DCLA 3RVLA 2NZUG 3QK7A 1EHCA 5EWMA 3E3MA 1HEYA 1ZY2A 3RVRA 3SY8A 3HK2A 3KHTA 3UUGA 1FSPA 3T8YA 1TMYA 4L85A 2JBAA 3QX9A 5EWMB 3IDOA 5T3YA 4EVSA 1ZH4A 4KNYA 1URPA 3ILYA 4G0YA 1ZAYA 4F12A 1MVOA 5HM6A 1D1PA 2H3HA 1Z18A 5HKOA 3DBIA 1ABFA 4YV7A 2JBAB 2MSKA 1W25A 3CFYA 3OO0A 4O1IA 5TPZD 5EWJA 2AYZA 2MYNA 3OLYA 4MYRA 2WMYA 4RK5A 3CLKA 4KRFA 2IDMA 4EY3A 4RWEA 5KQLA 3Q9SA 3UK0A 4OLAA 4RZSA 4G0OA 1DP4A 1C0EA 2IOYA 5TPWB 3RVPA 1YIOA 3Q7TA 5EWJB 1DBWA 2QVGA 5F64A 5JNSA 1FFWA 2VK2A 3HSYA 3JY6A 3NNNA 1JH9A 1QQAA 2X7XA 2QSJA 1Z25A 1PNRA 3MA0A 3F7NA 4EGSA 3URMA 1U04A 2Q5CA 4GNRA 4HNQA 2CWDA 1SD5A 4EYGA 5B3JC 1U0SY 1CEYA 1M2EA 4HNRA 3NNSA 3OQOA 5IULC 3GYBA 2FEPA 4KQCA 5C5EA 4MQFB 4PZ0A 1AB5A 4Q6BA 4F11A 4OG2A 4ETNA 3FMVA 4YLEA 3CNBA 3N53A 4JB0A 1EWTA 4G0PA 3EDCA 2A9RA 2E4XA 1W9HA 3QELA 3MQ4A 1ZHHA 3JPWA 2FMKA 4WUTA 5ED4A 4YS6A 2GBPA 5FWYB 3KLOA 3K4HA 2IYNA 5CNMA 4KFCA 2FMIA 2QV0A 1D2AA 4EUKA 1B00A 1APBA 1Z2EA 2OENG 4XLTA 5I4CA 3OLZA 5TQ2A 1YK1A 2PKXA 3F6CA 3F73A 5BRJA 1BA2A 1JDPA 2L19A 2E4VA 4MS4A 5JNRA 2FW0A 1BDHA 1JFSA 1M5UA 1QO0A 3I09A 3P9YA 1JYFA 4G97A 5TQ2B 1SXIA 2LBPA 1MAVA 4P1ZA 3LUCA 4MR9B 5CNJA 4D6YA 1M2FA 3FDFA 1ZDMA 2FEWB 4WXEA 1QPZA 3KG2A 3LTEA 3LUKA 1TLFA 2FQYA 4NQRA 4DN6A 2QU7A 1H9CA 1LBIA 3D02A 4Z4HA 4E7PA 2GKGA 3N6VA 4UHKA 2QVCA 4XFKA 1JF8A 3OMWA 1NATA 2IPNA 3QEMA 2FMFA 3CRNA 3FFTA 2GI4A 1JFTA 1D4ZA 4Z4FA 3TB6A 1CYEA 1Z26A 3N0WA 1A0OA 3A3KA 1Z16A 3N0RA 5E3JA 2FSPA 5IEBA 2PUBA 2JCGA 3GA5A 1GUBA 3IP9A 4YO7A 1EAYA 1XHEA 3CHYA 3HDVA 3JPYA 3H5IA 3M9WA 3HUTA 2I6FA 3C3WA 1JX6A 1P6QA 4RS3A 3OM1A 4FE7A 2RJNA 2IPAB 1VRVA 1L5ZA 3H1GA 4WT7A 2VUHB 4OLBA 3E61A 2FQWA 4MQEA 2PUGA 5KQMA 5JS1A 3N0XA
chains in the Genus database with same CATH superfamily
3L4BC 1L3IA 3D0OA 4OU5A 4DCCA 1LWOA 4GO1A 4QYMA 5DN9A 2JIBA 4BX3A 3TW4A 3FOAA 3EN0A 3VAZA 1WETA 1NVFA 1SRRA 4M9XA 3LE8A 1AKVA 1U1GA 2QL5A 4DMHA 1E2IA 2GVDC 5IHXA 3RCBA 4E5UA 1UBTS 2MYTA 4OK3A 4F45A 1H8HA 4F4HA 2I54A 5G0SA 3O8QA 3QU4A 2RIPA 4ZYLA 2YJ3A 3BKXA 5L7YA 4AO8A 1LBQA 3D31A 4R1TA 3ZCQA 2X8AA 4LRYA 1USIA 4D92A 2UYCA 1IBKB 5A4KA 4WZAB 1XRMA 3FXAA 1KK3A 1A7JA 1O96A 3A11A 1I9CA 1OLUA 2F1KA 1YR8A 3T3PB 1QIFA 2HPZA 1DKUA 5D87A 4YUXA 5EJMA 3GD5A 4MRRA 4QG7A 1AGRA 4MVJF 2CE2X 4E1VA 4YV0A 3TRIA 1U81A 4TWZA 4D9NA 4EJFA 5JXJA 2AR9A 1XFDA 1WMSA 2B4QA 1GRVA 4Z1OA 4HRAA 1DAOA 2I4MA 3BIXA 3GRVA 3TECE 2X4IA 1LF5A 1LPPA 3MRSA 3I9KA 3PPYA 4OO3A 4DUZB 1MB2A 4NBUA 2H29A 2IUFA 1M1YA 2NPFA 1RLMA 3EASA 4PLPA 1IN4A 4NHOA 1FYWA 4IRXA 4M53A 5EI5A 3G0HA 4FMCB 4P5PA 2WF7A 1QAMA 3I9V6 3KDPA 5IJXA 4DWWA 5E6RB 4EAAA 1FXUA 1KYIA 4QDOA 1SQSA 1IOLA 3IQXA 3EMVA 4WGFA 2L2QA 3AK4A 5A7HA 5MN6A 1Z6TA 2GZHA 1E9EA 4U9IS 4P7BA 3NHAA 4LDPA 1IXSB 5FA8A 2ZYGA 3RS9A 3RU7A 4ASUD 4DLRA 4Z1MA 4Y9SA 5HIAA 3AINA 1QK4A 1AGYA 2J6BA 2M98A 3NT4A 2AOTA 1H8EA 4C30A 1VRWA 1E3MA 2BJWA 2XMZA 2A0XA 4P8RA 1N92A 5ENZA 3AUSA 3KL2A 5KQPA 3TM4A 3BEDA 1T10A 3PQ3A 2H1WA 1QIEA 3CVOA 4TN5A 4L72A 4TM7A 3TW8B 3QHPA 1EUCB 4DUGD 4LE2A 3GFRA 5JD5A 2F90A 721PA 4GZ6A 1B3RA 4CLRB 1CPYA 4YV1A 3U16A 3KWMA 4JN6B 2PKEA 4Z9XA 1WSDA 2X7JA 1UEIA 2R1ZA 5FB3A 1GRCA 3OKAA 3FE2A 3M1LA 1T0PA 3U4MA 1J9EA 1VJGA 3E2IA 1QK5A 2HQBA 2P41A 4DPKA 3OOSA 3QMPA 3ETEA 3NUGA 3X1ZA 1XCPA 4V3BA 2BMDA 3MILA 1A9QA 4G86A 4JVLA 3TLMA 3WFIA 5KMGB 5B1IA 1F14A 4W9NA 4C78A 4DHEA 3BPSA 3QFFA 5C2JB 1YZ3A 2VA8A 1QYWA 1O7JA 2VZLA 3ILHA 4B43A 4XD7D 5B1HA 1LDBA 3EJ6A 3O4JA 2UVPB 1M0SA 1W94A 3QHAA 4KI7A 4NDZA 3FIJA 3ROTA 4BTVA 2H08A 4I4TF 2QD4A 2ZVDA 4DCTA 3UAGA 4O2BB 4RDIA 3JAMA 3KPWA 5DSTA 4WXMA 4FNGA 2C5EA 4MS4B 2ZRFA 1ADYA 3BHIA 1U7XA 4TMKA 4CKWB 1BVYF 5FI0B 2YZNA 1TYZA 5BOVA 2NXNA 3QHQA 5H9WA 4S1OA 3CG0A 3PENA 4K40A 2W93A 4N3BA 2GHRA 1A9TA 2WWTA 4MVJA 1T2EA 3SBXA 4RL4A 5K0TA 5M2QA 3KQLA 4EKYA 2PKWA 5FUWA 3QVGA 4ALIA 1RPZA 5A5DA 5BRAA 4ODIA 2AXQA 4B5KA 4YRPA 3NC0C 3OBIA 4HFRA 2C9OA 1A1VA 1DO8A 2I22A 4DTIA 5CA1F 3DKKA 3IP6A 2GRAA 3NT5A 2YKGA 3WWZA 5E1OA 4UAVA 3TLGA 3ZE2B 2G36A 3KX2A 2R6R1 5EC8A 5K3EA 1ZITA 4C08A 4YK7A 1EX7A 3DEYX 1NY5A 5HBGA 3JWIA 1YS2X 3AI1A 2CUTA 2VQ3A 1XZJA 3FYUC 2H85A 4JLMA 4UEKA 4AY2A 3E8MA 2PXAA 3T4PA 4ZYWA 3K5PA 4J43A 1Z0ZA 4NICA 2I76A 4N5IX 5B6PA 1M1YE 2XR1A 5LQMA 1GRRA 4HGZA 5FYQA 4A8JB 3IVGA 3UOWA 8ABPA 1FOEB 2R25B 1EP2B 2AXPA 2Z5FA 1NBME 3G2IA 5EE9A 5FWXA 3FBTA 5EQDA 1SH7A 3SICE 3T0FA 2OK8A 1ISFA 1PV4A 5IZCA 1W5BA 3ZD6A 2JPDA 3IMGA 4OUDB 1DEXA 2O3SA 3WGMA 1CS0B 3QOFA 3UICA 1EDOA 2YNMD 4H4CA 1S8AA 2E82A 3AJEA 3N2GA 3IQZA 3QKSA 1OY1A 2C4MA 2GJ4A 3EG5A 3EGXA 3VH2A 4BRUA 1DJNA 3OZUA 1UK8A 4MI1A 1ZK2A 4BEVA 4MS3A 2AMVA 4FCCA 5JTTA 2J45A 5BQ3A 1MX9A 2O2ZA 2ZBQA 1W30A 2VN8A 3CZQA 3D6TB 2H31A 3OPQA 1EHIA 4HQ0A 4H4EA 1CZOA 4J9UE 2XE8A 3I04A 4PYOA 2VPXA 4G4JA 4AQ7A 1QX4A 2NV0A 4FB5A 4RC9A 3C3KA 3G6KA 5K4HA 2ZRBA 3VR2A 2AC4A 3DOFA 1WF3A 3NTOA 2CXXA 1Q84A 4V0ME 3FD8A 4AF7A 1OROA 1GTL1 1S8OA 5AK4A 1FNCA 2WSSA 3QY9A 1C0IA 3KOZA 4KMMA 1U28C 1KQPA 3DDSA 2F8TA 3A31A 1ZFNA 2BGRA 4MQLA 1TC2A 4PAWA 3RFTA 2IY9A 3IP8A 3SFTA 4ARUA 4CJXA 4DV2B 2H59A 4KRGA 5K51A 1Y7LA 1ELOA 2H2FA 3ESRA 3KJZA 4GPBA 4XR4A 4D43A 3V42A 1JPVA 3WV5A 1RBMA 4WFQA 3W3ZB 4HH1A 2WJGA 3VJRA 1ULTA 4PM4A 5JJLA 2OHHA 1GV1A 1R16A 1TADA 3E1SA 3MMNA 4PSAA 4CCYB 4H1HA 2PSJA 3LMKA 4O2AB 4RQAA 1AY0A 4FINA 2XUGA 1P72A 2Z57A 5IBQA 4MROA 4K6MA 1X0VA 1QHEA 3CXRA 4RS4A 5TQ0A 4GX2A 5HUHA 4INOA 4HLNA 5U9CA 2IEIA 3BC1A 3LQQA 1P2BA 1MT3A 2UUAB 3F9IA 3DFKA 1RJEA 1ZJJA 2B3DA 4H0FA 4QU0A 4ZQBA 1I3CA 3CJQA 4X90A 3RV4A 4AS3A 5CA1A 5DASA 2I3BA 2GJAA 1NVVR 4B6OA 3JQBC 2E0IA 2CLLB 4MCIA 3SF0A 1EVEA 4BS9A 2DSNA 3PQCA 2Y6VA 1T24A 1KQOA 2W4IA 3TI9A 2B92A 5CDUA 1Z13A 4RV4A 4BHTA 1OFHA 1ZD9A 2XWQA 2Q3FA 3VUFA 2D2XA 3N6RA 1BKYA 1RM4A 3L7KA 2F1OA 1HNZB 1G8PA 3H42B 3ETNA 3AL2A 1RQRA 4MGKR 2KS6A 4OSOA 1EINA 1XNHA 4PAOA 5CVUA 4B2YA 2AZDA 3AZPA 5KVSA 1DDGA 1NXQA 3DBLA 1C1YA 3M82A 2IBMA 2Q3EA 1H6CA 5CVJA 4HNUA 2WHPB 3KK0A 3O7MA 2C98A 1K27A 1W46A 1W34A 1PO7A 3G88A 3M6XA 1NRXA 3LFTA 1WSBA 4MARA 3Q3HA 3E9NA 2YJ6A 4OQDA 1M2OA 1QPBA 5FRDA 4C03A 4HLUC 4U7JA 1R6BX 5L3RA 2W0SA 1GNQA 3CX3A 4NJMB 1I6KA 4N39A 4QPJC 1TK9A 3WE7A 5CEJA 3GC6A 2H2WA 1D6JA 2MMGA 1E3QA 3JS5A 4NECA 4QO7A 5ALDA 3M6LA 4BFLA 3HVHA 4CDNA 2JLQA 1V25A 2F7SA 5JZBA 5AKHA 2IH2A 2VJMB 3G0DA 2LUOA 4QVGA 4HVLA 1OBCA 1KZGB 5CLFA 3LGAA 3D4IA 4X20A 2F3TA 3WK6A 1O94C 4H7IA 2XT9A 1ZVMA 1VKZA 4LOLA 1YS9A 4W5JA 3Q3EA 1ONOA 3THWB 1GARA 2OZEA 1ZH0A 3D6FA 3DQPA 3DZHA 3GUHA 4JROA 2H7VA 3RVBA 3RYTC 3U4QA 4TV8A 3T3HA 4D0SA 2HR1A 4F04A 4PYKA 3FJ1A 1JKMA 3O0TA 1SCUA 4FWBA 4B2IA 3BWCA 1J6UA 3NPAA 5FJIA 4BVFA 2AL7A 3RH0A 1KEWA 4E13A 1W85B 4J0IA 1Y6RA 4OYHA 1TU3A 2P1ZA 1JLLA 1PD1A 2VXOA 4BLVA 5CB4B 1M7BA 4KPUB 3QBDA 4Y98A 1MJHA 4REOA 4QUDA 4ZEXA 1CQPA 3WMEA 3WQQA 5E95A 3UKJA 4GP6A 3Q2OA 1RZVA 1SU8A 2G6TA 2Q6KA 1DQSA 1N2EA 1NONA 4N49A 4AG6A 3DG9A 3RRYA 3SD7A 3KEMA 4DLWA 5J4YA 2PXXA 3AEKA 4PO8A 4WEOA 3O4IA 3UMMA 3T41A 3QYFA 1E0DA 3MUEA 2X3UA 3ZG6A 1ZVKA 4YCAA 1E9BA 2VTVA 4BQSA 1M8PA 4YAIA 2A2ZA 3SSAA 3WKBA 1K7YA 4IJWA 3MPOA 3AESB 2GFQA 3AVQA 4HXEB 5F52A 4HH4A 2HCJB 4IKEA 4PVDA 2XF2A 4B0PA 2BW0A 1AQIA 2MR6A 3E3MA 2VP3A 3TJRA 3S2EA 2QSUA 3L7JA 3IPYA 3KFXA 4ZOLA 2FMUA 3CT4A 4I81A 2CDRA 5THKA 5IKPA 2A5LA 1SQ0A 1TZCA 2HLDD 1E3WA 1FW6A 4G25A 2PH5A 4S1TA 1EFRA 2AG1A 2VXCA 2PWAA 3A2NA 4FT2A 2Q28A 1URPA 1AQ6A 3DR3A 2AZMA 5ALVA 1C7JA 2C8KA 2PGXA 5CDYA 3GT0A 4XDYA 4U39A 2JFNA 1PK8A 1B6SA 4XWYA 3AR2A 2VYQA 2BHNA 3CO0S 5LLTA 4PX2A 3OTQA 2AUTA 2ZBVA 4KRFA 3GFFA 2Y68A 4KSCA 1IY1A 4JBNA 4L8VA 3V4FA 4OH7A 1NSYA 2Z9DA 3FFBA 2PDAA 4HB4A 3C3EA 3I6MA 1BD3A 1DBVO 4LGCA 3KB6A 2IXFA 4IKOA 1QPGA 2WWHA 1YJQA 3DT6A 2JFPA 5EERA 3UZUA 3SYTA 2Z4SA 1O54A 2ZQYA 4QTZA 3RC1A 5IJ0A 5IWCA 2FWBA 2OBBA 3K94A 1GLNA 5CFQA 2QSJA 2R8EA 3LOQA 3C43A 4HQ6A 1BCRB 3PVZA 4HZGA 1TMGE 3RUIA 2OILA 3VXKA 1JHUA 3OZVA 1O0CA 1L1QA 1VG1A 4S3MA 3TFQA 4C9BA 4ZGGA 1AKRA 1FTQA 1PR4A 3RS8A 4DSTA 5CLJA 3KOYA 1FCJA 1QOPB 1T9KA 1U0SY 1Q0HA 2ZIEA 2F55A 4GM0A 1PWHA 1P9RA 1Z0KA 4HN9A 4IKPA 4Y2HA 1N34B 4KQCA 3EHEA 3AJDA 3D7KA 4TS9A 1Z34A 5GMOA 3BK2A 4Y0VA 3KSRA 4N5HX 5CGQB 1EDDA 1U2TA 2HQSA 4A26A 4D9JA 2BMEA 2ZBUA 3CKYA 3IUMA 1KVTA 1C8LA 2Z2JA 1G21E 1RWBA 1N7HA 4PPNA 2EFGA 2ZWAA 2A6PA 3K4HA 3KLOA 3NQ41 2CGEA 1F20A 2HU2A 4KFCA 1UBHS 1YB7A 1BKDR 2QM3A 1V6CA 1QORA 2QV0A 3IDAA 1FE8A 3WLTA 4G0UA 1FNBA 3NHJA 1VLMA 3RV3A 4BYGA 4EG6A 2PWZA 4KQWA 2DY0A 2REQB 4OQFA 4LSZA 5FFNA 4YRNA 1O8BA 2ZSDA 3MAAC 4QGFA 4B82A 1YAHA 1XBTA 3D4OA 4NZMA 3UANA 3KQSA 4YI3A 4QXPA 4FSDA 4PQFA 1PHPA 1A50B 4AAYA 1HLDA 1JFSA 3FMFA 4EMTA 3KHSA 3R1IA 4M36A 4QUGA 1VJDA 1KA9H 2PZJA 1N3IA 3A6ZA 3JZAA 4JENA 3UJHA 2MWMA 4F93B 3UMVA 4PX3A 4RVSA 1M2FA 4ZXFA 4OQMA 2DCUA 2C57A 2JLXA 4NQRA 1THZA 1P1IA 3T7KA 1LBIA 4BBAA 4DJTA 2NNWB 2FP4A 4NNJA 5EKSA 4CG2A 3VISA 1PFVA 4KXMA 4Q1VA 1U3UA 3GVXA 2O2HA 1HT2E 3GIWA 4PLCA 5BN4A 1NUAA 4XW2A 3IT0A 1XELA 3EZ6A 1P1KA 2DLNA 2HL6A 1M5RA 3HCBA 2HM7A 2VF5X 3QXGA 4ME6A 2R1VB 4AL4A 5IF3A 4JYZA 4KKVA 1NRIA 2B7CA 4OSPA 4EJ0A 5T6BA 3UAVA 1IEQA 3IQGX 3N0RA 2WUVA 3CSDA 4JA0A 3HKEB 5E3JA 5AK3A 1QIIA 1M73E 3DCNA 2EP5A 4HDCA 3HJGA 4IIXA 1GUBA 3WISA 3RIGA 4E08A 3JPYA 4IJUA 3QEAZ 1Z2AA 3HUTA 4LQ4A 4N7MA 3DBHB 1HQDA 2FSGA 2PUJA 2V6FA 2IT1A 2WVHA 4XUCA 5IVDA 3OQVA 3ZXUB 4A6DA 2H4FA 2FPUA 1ISHA 1H1LA 1UXOA 4B6JA 2WJ4A 1UC8A 3SJCA 3HJFA 4LOJA 4MUNA 5B53A 4NG4A 2J9FB 1UM8A 2WVGA 1VE5A 5THXA 3L1IA 3TLXA 4C5BA 1NWCA 4K9OA 2XTMA 2W6MA 3ANYB 4MW9A 3IMKA 1E20A 2C9MA 3CE6A 2XH8A 3OT4A 3UBMA 2PUAA 3M9XA 5IANA 2PJRA 3QA3E 1YUNA 1D03A 4UBIA 5DGIA 2BFNA 3EXAA 4QOEA 4WOCA 1GQOA 5BP7A 2JJMA 2LZ0A 4LHXA 1JJBA 2GA8A 2JVIA 2WM2A 3GGSA 3K15A 3NBMA 4JLUA 4PYMA 3U40A 4DC0A 4TYNA 1GN9A 1Z56C 2IYLD 2FZVA 4PRLA 3RWMB 2J67A 1D2NA 4QTUB 2PLWA 1VLVA 1F6BA 4JSYA 4JUCA 2ECQA 1SXJC 4IIFA 1P74A 3TAHA 3PEUA 4DIOA 3HLTA 4ZT3A 4IV8A 2C0CA 2GK6A 5IARA 4HS9A 1R8QA 2ATIA 3QFCA 4CQLB 2QR5A 2M1ZA 3O2SB 2ZTSA 3WO0A 4GLJA 1A9YA 1C4XA 1ID1A 1NX6A 2DECA 3U1VA 2JCXA 1OFIA 3WG9A 4QJBA 4HKTA 2RHGB 3U3OA 1EG2A 1MKYA 3EXIA 3JAKA 1N2GA 3DSRA 3W7BA 1HMPA 2WC1A 1E9FA 4O0MA 4YT8A 3TN7A 5TB5A 2C2ZA 4EI7A 5KJFA 1A9XA 3OTHA 2C20A 2Q1YA 2MSNA 4KAJA 2QMUA 1E8NA 1BMQA 3HA7A 4K03A 1MHPA 1WW8A 5CP8A 5DLYA 1W48A 3TRDA 1CEEA 2QLTA 2ZUCA 1XMOB 4BRSA 2H00A 1WA5A 1YZNA 3K8OE 3KR1A 4Z9FA 5ERXA 1P1RA 4GG1A 4M7WA 3RIEA 1YZQA 5JMOA 4Y67A 2ASVA 2GF9A 3VU8A 4CT5A 3ORQA 3OT5A 1I33A 1XKTA 1PKEA 3GLGA 4R31A 1T36B 3CIOA 5DPMA 2Y99A 4R3UC 1EP3B 3WYFA 2ETVA 2Q45A 1CZHA 1ZNXA 5AOCA 4QPCA 5F5LA 4ZU6X 3CBQA 3KAQA 2PZEA 4ER6A 1V45E 3NCHA 3AEYA 5DTIA 4JI3B 4CV3A 1PGJA 3EXEA 3MCVA 3M5WA 1TJYA 3GJSA 4C05A 3ZDCA 3ITEA 3HEMA 5H4HA 3ZD9A 5BV8A 1KTVA 5TS2A 4NS4A 3F3YA 2IYZA 3TS1A 5IT5A 2J4DA 3HVRA 1E99A 4QQRA 4FIDA 3AUTA 2ZIFA 1P4GA 4UASA 3EIXA 3A25A 4OL9A 2I6SA 2DE0X 3PL5A 4JSTA 3T1NA 4JI5B 5KNCD 2ZEJA 1K3TA 1WLSA 1WXXA 3BRQA 3HCCA 1E4VA 3K0FB 3OZBA 2BFFA 3T61A 4CLOB 5JZSA 3T3NA 1PEDA 2VOJA 1UJ2A 2EIXA 2FW9A 2N3ZA 1AUPA 1QVWA 3JYOA 1S1MA 4G5RA 4ZREA 3T3IA 3CY6A 3FCEA 2IWHA 1ZS9A 3I12A 5ECDA 2F4NA 4ZAYA 4HRVA 3K4QA 1OXUA 4TPKA 2ATVA 2XHZA 1G0NA 1W4AA 3W5BA 3ZKWB 4G01B 4WY5A 1V5WA 4R2MA 2ZAYA 1JR3A 3DHVA 2P7IA 5JSYA 1FFAA 4UCWA 3HNPA 2V6MA 2ZPTX 5T3UA 3FF1A 4FKBA 1FRVA 1JEQB 1NI4B 3RS2A 1OFUX 2CLKB 4P0TA 4DDKA 1N1EA 1MB3A 5ILOA 2CK3A 2QIOA 3MOSA 3RADC 2XB8A 4NYMR 3EZYA 3UJBA 5FLYA 2J9GA 2J5KA 2Q9CA 5AW9A 1EA7A 3DZFA 3H8WA 1JW9B 3UEOA 3DT8A 3V7WA 3HU1A 4EG3A 3PQ7A 1PZGA 1WHSA 4KUHA 2G63A 2OBNA 4Q1CA 1QG4A 4AMVA 3UCXA 5IN5A 4F1WA 3QEBZ 5I7OA 2GPTA 3KELA 3L06A 4ILKA 1M1UA 1VKRA 2G0AA 1GGMA 5C46F 1Z38A 3DKPA 5BNWA 2BISA 2ZJYA 3ZWPA 1YA6A 1MC5A 3DAFA 4OQXA 3RUDA 2EFEB 2RI6A 2I8LA 4HB2A 2ENUA 1UC4B 1SHTX 2RHTA 3HO6A 3MAJA 4A5OA 2A35A 3PE4A 4WHMA 5JRDS 2QQGA 3OMXA 2E5FA 1TF2A 2GD2A 2ACWA 3HH8A 3IAS1 4MUHA 3L0ZA 4TMYA 4ZVVA 4AVYA 4EYSA 1U8XX 1JT9A 3F9CA 3H5TA 3FOBA 4L9WA 4ZDJA 3VKGA 3EVFA 4BV8A 1CUAA 2IXGA 1RLJA 3ZJUA 2EJVA 1E61A 4MI3A 8OHMA 5F2NA 1BGVA 5AUPB 1TK3A 3I1YA 2JLCA 1J8VA 3ZGLA 2C54A 2FSVA 3U3DA 2FRVA 1U6KA 2RIRA 1DEAA 2X9NA 1IJFA 3VNSA 1IVNA 1Z6ZA 4MPPA 2F2TA 3TTVA 5HMLA 3ROZA 3DE3X 4WE3A 1T3HA 4ZAVA 1VLQA 3YASA 1V8ZA 2ZVPX 2DR0A 1H6BA 3UT5B 3SQLA 3KALA 1W36C 1DOZA 3QY0A 4H3HB 1WG8A 4AJ4A 5L45A 1UZLA 1VL0A 2P27A 3I05A 3QVTA 3S1SA 5HZHA 2O19A 1QHXA 2EHDA 4M49A 1NR5A 3MYYA 4J0FA 2XRFA 4J0GA 2R62A 1M2JA 2W48A 3DZDA 3AY3A 2FN3A 3RGGA 4YDQA 3FZNA 4NRDA 4RH3A 3RJ5A 1MO3A 4YA6A 3OJLA 1UWVA 1ZLXA 4EO4A 4BAGA 2DKNA 1V8OA 1XZFA 2ZXFA 3QLEA 4KWTA 4Z49A 3L8GA 4OI1A 2D1QA 1A8IA 1DL5A 1H1TA 2W6QA 1QAOA 5F33A 4OBXA 1MNQA 2O0MA 4W9RA 5B3KA 2O2CA 2WG2A 2XOEA 3L8ZA 1G1AA 4IOKA 4B6PA 1J5XA 4G84A 1I30A 3DV2A 5LP6B 1KXJA 3ZEIA 1CIVA 5BWOA 1OXTA 2PANA 4K9SA 4QT0A 1LLQA 5AW4A 1S5PA 4WK2B 3WIBA 4BO9A 1MIOB 5A7FA 1T9ZA 1MJGA 3JQPA 4HUQB 5A02A 3P97A 3CG4A 2YC2C 1QE3A 1GQ2A 3E9RA 1HDOA 2CLDX 3PB3A 5CW1A 5K03A 3A6JA 3QITA 4YRAA 1AUXA 1LK0A 1WPRA 2IIPA 2TMGA 4UNSA 1UODA 4M8LA 3ERCA 3LVQE 1TQ8A 3K6SB 2YHBA 2X6RA 4MKGA 5T7BA 4IIYA 3HTXA 2VT7A 2PCLA 3HUUA 1AURA 4JR1A 4RY9A 5EP4A 4QFCA 1VA4A 1HQCA 1QGZA 1YKGA 2I62A 3RSZA 1LV8A 4CDMA 3BL8A 2CMKA 5HRCA 2R84A 1R0WA 1T1EA 1NZJA 3LQRA 2D6FA 3D8BA 3NV9A 2QMEA 4NENA 4TRRA 4E94A 3L7MA 4BASA 1YS1X 3RC7A 1QIMA 4PLYA 5JZOA 2ZSFA 5KTTA 3OQNA 1KERA 3TL6A 5DP2A 1U80A 5KYUB 2OHVA 1FSGA 2JJ8A 1KI6A 5LP6F 2VPPA 2ZUTA 2Q2OA 4C14A 3BZUA 1QZUA 5K6AC 2FEKA 4P22A 4JI7B 2PD4A 3KP1A 3T9BA 2OTCA 2Q0SA 3G13A 3P2YA 4BWGA 3U4GA 2CNDA 1XU4A 1UJMA 4LMBA 2BRUA 4W8GA 4I6JA 4W63A 4UUOA 5FA5A 3BMOB 3CVJA 4BVKA 4X7MA 4YJ3B 3RYHB 4X95A 2RFLA 1H2YA 4NOMA 2JASA 1ONPA 2QLLA 4R2LA 3WXMA 5JHHB 2EKDA 3MCZA 1M2WA 3ORHA 5JCOC 3DV0A 1V3QE 1WW3A 1N5DA 2VS1A 3RG8A 3PIRA 3R74A 4POAA 2AJDA 2PZKA 2A88A 3ROKA 2CXRA 1F51E 4DJAA 3EARA 1IOVA 1YDGA 2BR4A 3JQAD 3CISA 4KRXA 1H69A 1QBGA 2AMLA 2WUWE 4P6VF 1Z6PA 4KBYA 2WYVA 3I23A 5AYVA 3SI7A 4EELA 5I7AA 3CR7A 5BSHA 2P78A 2QXUA 2YIVX 5HSGA 1YZHA 4JEIA 3UWKA 4BUJA 2ST1A 4Y1RB 4YPVA 3A0RB 4GH5A 2ERXA 2PIAA 4LX8A 3GNSA 1UZNA 2R11A 2WF8A 1N4DA 1GZ3A 1X19A 3MRTA 4RKFA 1C2TA 1E5LA 2X19A 3ZDQA 1MRNA 4LHWA 2PY6A 5C31A 1JAYA 2QR3A 4CEJA 2FPIB 4IIHA 1P8JA 3D7RA 1OLXB 5CA0A 4U2KA 2R8YA 4U7GA 2ECOA 5HTKA 5BVHB 1T35A 1CP3A 1FTNA 1FZQA 5EUCA 4BIIA 2H51A 1M7GA 3NW9A 3OZEA 5GOZA 5CX1A 2IHTA 2CEAA 2J5RA 5LYJA 4B7AA 1WMBA 1JGTA 1WWKA 3ZHBA 5M7EA 4Z3OA 1DBIA 1B42A 2WJAA 3NWPA 1NJ8A 3NPMA 3UCFA 2FUCA 4R5MA 1J0BA 1GP2A 1JS1X 1TJ5A 3FDZB 3D3JA 4MR8B 4F5EA 5D6NA 1LJUA 2WSBA 4DDVA 5C8YB 4R51A 4PLHA 1T2VA 3DHYA 2LKCA 3VDMA 2DBYA 1EVJA 1R6TA 2FY8A 4I99A 4LF9B 3O8RA 3AFGA 4F6RB 3AR5A 3FFAA 2JJ1A 2OE2A 3GEEA 3BGSA 2JGJA 1PBNA 2C8LA 4GYJA 4M37A 1XZMA 3NBYC 1ST3A 4OHBA 1DT5A 1L4YA 3G8YA 1V95A 3E1KA 3RS0A 1ARZA 5AM0A 1A2QA 5A0VA 1CZRA 3MMZA 4CRWB 4EVSA 1U6IA 1VPLA 1ZVJA 2D62A 2EL9A 2VH1A 2WDZA 3KSZO 3MGBA 4BE9A 1RKBA 3VC3A 1JQKA 4YV7A 2DPGA 2JBAB 4H16A 1AT1A 1WY5A 3WRYC 1ZIOA 3BHNA 3DC7A 3VTFA 1KBOA 3K9NA 3DOIA 4QAJA 2AWOA 3E70C 4XI9A 1KK1A 4E14A 1I5OA 1XXLA 4YJGB 4DNPA 1SCKA 4TL8A 4BEWA 4V02A 3A05A 4ZV7A 3K0HA 4JK3A 4X71A 2FZWA 3WVNA 2WIAA 5TGZA 4Z7OB 1RWKA 1Y6ZA 3GRZA 2D8MA 2PM8A 3TBFA 1MVLA 1HT3A 1UOPA 2D0IA 2O0JA 2MHCA 3NBXX 3BWDD 1T9AA 1MA3A 5DB4A 3KQUA 4OA5A 4FOLA 1ZCJA 1FQKA 3KXIA 1GZHB 3LPNA 3MZ0A 1KSGA 4OXKA 3RJ9A 1XVTA 4HV4A 3HB0A 1ICEA 1RWOA 3R8FA 4AMZA 4NHEA 5KSPA 4U3JB 3DOHA 4HNRA 4RD2A 1T4CB 3NIWA 2B2CA 4ND8A 1W88B 4MQFB 3N0VA 4QIHA 1XTJA 2ZIZA 3T3MB 3N7TA 3EFOB 5HWSA 2PRIA 3GJ4A 4B7XA 1BE1A 2I7XA 1EH5A 1TCUA 4S0XA 3RSOA 2B5OA 2GVNA 3G9QA 1OLOA 1UWKA 2Q3DA 1Z5VA 3HU3A 1COWD 3Q8WA 3WJ1A 1NC3A 1SIOA 1WDTA 2QSYA 3EH1A 2L0XA 2COKA 3A4MA 3ETHA 3LX6A 4GS5A 2IV7A 4X8MA 3OJEA 3RB8A 5KYXA 4IWNA 2BPOA 2YN2A 3EXHA 3G7NA 4DGSA 1ACJA 3ZGZA 4W1RA 2BKXA 1B00A 1APBA 4UFPA 3TD6A 1AGXA 4XLTA 1RRKA 1BS1A 1Z7YA 2ORED 2CL6X 3GUZA 1ENPA 3BSFA 3MYRA 4TSKA 2BFMA 3T7CA 3W5HA 5JSHA 4NE9A 4FWTA 1YE8A 2H1RA 1FDTA 1NU8A 5JDIA 4AZ3B 1BDHA 1M74A 4GKVA 1ZD2P 3TSYA 3VNUA 2FDRA 5FPHA 4CTMA 4P1ZA 3OZTA 4LSGA 3LXUX 4DA7A 4Q3BA 4AJIA 3P2JA 5CB0A 3QFHA 1PL0A 3A6DA 4OQYA 4HQLA 1T5LA 5FP0A 5K8UA 5FO0A 1YZLA 1G4AE 4NBKA 4RJIA 5C1PA 5LM3A 3HRIA 4TKUB 5E4YA 5JPDA 5GJVC 3MLEA 5M34A 1YRHA 4P0QB 1ZN9A 5FLEX 4EHFA 4QOGA 1CJUC 4JI6B 2BOVA 2QS9A 2AF4C 5A2GA 5KNDA 2VBCA 2K6GA 2OYSA 3ZV7A 1RE0A 1NA5A 4WBSA 2I9PA 3SZMA 2Y67A 2CF6A 1KBZA 1RZ3A 4HB3A 4YHBA 1Y6FA 4JI4B 2IE0A 4Z54A 4BO1A 1Y3DE 2G40A 4U2CA 3DE5X 3IP9A 1KFCB 2PD3A 3I0NA 3LBIA 3M9WA 1HF3A 2AOUB 3GDGA 3NTUA 4I7EA 3DTYA 2Z1DA 4M22A 4RTRA 3CH6A 1N1GA 4XCVA 2XVMA 2H1HA 1SUDA 1FJ2A 1YA4A 2YXEA 3NH9A 4G9EA 4H7PA 2EZUA 1F1BA 1O03A 1NUUA 3LPDA 4GYWA 4TZKA 3UMSA 5GTDA 4WMLA 4DMMA 2B8NA 3N0XA 3SSNA 2XZTA 3B1ZA 7AT1A 1BQ3A 2HRCA 1NF3A 3OOEA 4FOTA 4IDDA 4KJXA 3D3KA 1M33A 1CYDA 1JVNA 3HZHA 3N7AA 3BMNB 3HA2A 1JZQA 3DAHA 2O2GA 4RF3A 4B3TB 1Y34E 3U9TA 4FTWA 1FB5A 1ISIA 2OMKA 3QUCA 1UKYA 3D1LA 4QYIA 4PNEA 1FDUA 4PCLA 4IF4A 3W9SA 4PZAA 2Z2IA 4UUBA 3T0GA 3TOXA 1NHGA 1U1CA 1XWIA 4M6WA 3P26A 1MB0A 1Z15A 5J5AA 1SCQA 2Z2ZA 4F84A 3IP5A 1FQWA 2X5NA 3ELBA 3BKWA 5JCJA 4C6TA 5IJ9A 5BWBA 2W42A 2G4CA 4KZKA 1O95C 5EZ5A 1SOUA 2AX3A 4ZQGA 5K2MA 1P4HA 5KDOA 3EVEA 2XYGA 3BGVA 3P0RA 3FN4A 4P4LA 3WLAA 2FH5B 1AQLA 2GCOA 4FDMA 1P62B 4J1TA 5SYNA 2HSZA 2GCNA 3LC7O 3VOBA 1GVNB 3PNSA 4GSLA 3QM1A 4K9NA 5KDDA 4CGZA 3GW8A 4WLVA 4CM9A 4BCCA 5B37A 5EYPB 1PJLA 4AJJA 2I5PO 2FW8A 3CZMA 4R1PA 1BHJA 4M0MA 4X45A 1MGPA 1XMQB 4QNMA 1KVQA 2HWXA 4UVIA 4DV7B 2AK2A 3VHRA 2OXEA 5DISB 3ROFA 4OJTA 1RYFA 4JITA 1H9BA 2G9QA 5D5PA 1QGDA 2XI4A 4TS3A 3QLUA 2IYAA 5BMVF 4G56A 1JR4A 3HY6A 3MGCA 2QRGA 3LUDA 3AEQA 1XD9A 2QRKA 5ITWA 1N9KA 3PC2A 2YVLA 4BRWA 4I1SA 1FTWA 4YCSA 5JNWA 1HX7A 2YL2A 4YP0A 4FGKA 3GUYA 5EFZA 1YZKA 2HA4A 4X1IB 2B20A 3PNPA 1F38A 2PKYX 1IY2A 3KHUA 3D5TA 4RD6A 3TNFA 2YUTA 1X80B 2C58A 3OECA 4MGIR 4ARZA 3U7GA 3WLNA 3B8HA 4HX9A 4YY3B 1GZ6A 3R8XA 2UKDA 4J6EA 4NULA 5IJAA 3GQVA 1EDZA 4MV1A 3KR9A 4GU5A 3C7CB 2UVQA 2B69A 5DN6A 1DXYA 4HNGA 4D8UA 1E1CB 5KOHA 4GAEA 1JI3A 3EMBA 3PWTA 2QLFA 1SZJG 1D0IA 4C06A 5KHLB 4NYJQ 3NEJA 4MR7B 4ANFA 4DZRA 1WXHA 2HNKA 3QVMA 2JK0A 4YBRA 3DMDA 1EVYA 5KJCA 2HBRA 2XOKA 4O4LA 2YY6A 1BQ4A 3NIBA 5AKIA 1E5DA 1KAGA 2P7HA 1U7ZA 3KU1A 1L5YA 3NVDA 4NFSA 4Y9TA 4ZCLA 5CCXA 5IUJC 3IXLA 3VX3A 3FFWA 1JHAA 4IUYA 1OC4A 1SULA 1W76A 2O8CA 1B2LA 3U7IA 4XRGA 1VKOA 4HNVA 3ANSA 4H7DA 4KVZA 2IYWA 3WWYA 2EU8A 1PFQA 1QV7A 2BKEA 1P2TA 2FN7A 2ZTVA 3CZ5A 4HWKA 4W1SA 1T3GA 1U1FA 4QEDA 1G9XA 1V39A 4ZCQA 4BX0A 4DNQA 1U0BB 4AX8A 1P2VA 3OOHA 4C4TA 2DAPA 3VKWA 4MHOA 4MI9A 4BFXA 4FHFA 3OEEA 3FNIA 5C5IA 3UAYA 2GLUA 2IF0A 2W6NA 2WWWA 1PL6A 2ZRNA 3TZKA 4YT4A 2B99A 2C84A 5I4BA 1G8MA 3NANA 2QZSA 2IKSA 2HEIA 2X41A 4JBWA 1GA4A 1WCV1 4C5AA 3OQJA 2J3HA 3JVUA 2B9VA 4K8OA 3WIDA 4NBNA 1IXZA 3B2NA 3D81A 3FLBA 2CFTA 4IQFA 5EZYF 3HXMA 4LNHA 4C0BA 3WADA 1OKKD 2QZJA 4HAUA 4BQQA 1Q83A 1XYYA 2P68A 4F4JA 5JMTA 1GUAA 3QVLA 4QECA 2VDRB 1R2QA 4IXMA 4X00A 4C7VA 4IHJA 4FFNA 2WMNB 2C4HA 5K0EA 5J4VA 1XLTC 2ZSKA 1VGQA 4A2QA 2I3AA 4IVNA 1WEKA 2CJWB 3GT7A 2M6KA 4YCJA 4EB8A 3H3JA 4BL5A 2Q4DA 2R44A 1C5KA 3S3TA 2B4TO 4IDGA 4EX7A 1Z4MA 4BVAA 4GI5A 2O8BB 1FNDA 1P8AA 2D59A 4MV4A 1T0BA 4ZZIA 1PEAA 2HEGA 1AN0A 3WBFA 3F5SA 2JCVA 3X3HA 3A70A 4M98A 4K81B 5CTAA 3OZGA 1MPTA 1RYBA 1DG9A 5HS6A 3UPUA 1XUOA 4DC1A 2ZSIA 3K9HA 1RVDA 3N28A 2G17A 3SQDA 4YRZA 2AFRA 4X7BA 4EEXA 5DNWA 2R8ZA 4JU9A 4IQGA 4A5SA 1T8SA 1G7CA 1VYVA 2IXEA 2OZLA 3K70D 4FWIB 1SA0B 5LWHA 4MGZR 4LF6B 4XYEA 4ZZ2A 4BX2A 2WAMA 1MO5A 3OLVA 3M8KA 3I6YA 3I73A 1BJTA 1R6AA 5JS2A 1WVMA 1ZOSA 1SUBA 2IOQA 5FHQA 3IEPA 2IYFA 4KLZA 5E8RA 1TUEA 4MV0A 2GZ1A 3Q4GA 4ZA2A 5BWLA 1JAXA 3CZCA 2WNHA 2ZTUA 1ZOIA 4NCNA 3ULKA 1DCTA 4XWOA 2OK7A 3FKSD 2WJJA 3HWRA 1WCXA 3CR3C 2VP0A 3C5VA 5BV2P 4QWMA 4RY0A 5ADUS 5A62A 1F8FA 3VO9A 2B8JA 1K4YA 2GRUA 1Z2CA 4E46A 1T8YA 5A9RA 3OPYI 4R3WA 5A03A 4MDHA 2XCIA 3LRPA 1LRLA 2NO7A 2XNSA 3BMXA 3QP9A 3G2OA 4ZOEA 4Q7KA 4A9AA 3OTWA 3PI6A 5DZSA 2BUCA 1WCIA 3H04A 2I8CA 2CBGA 2JL1A 3WB1A 2VK8A 5AVSA 1QRUA 4W1PA 1CC1S 1WNFA 2FWJA 1HT1E 4RORA 4Z86A 2FLWA 3OE7D 2AK3A 1C0LA 1RAIA 3OUTA 2XCTB 3HXQA 5DGXA 2G4LA 4DUYB 2QL9A 2OFWA 4Z0NA 2AOTB 1SUWA 2QHXA 5HK8A 4EF4A 3NBUA 1RXYA 3CX7A 1CUIA 5J4LA 1E2NA 4QDUA 3X1MA 3GMIA 3R7LA 2JIMA 4ERNA 2I71A 2A9FA 2QWXA 3IP3A 3OO1A 1Q22A 1PJSA 5ITSA 3GNQA 4ZIRB 2GESA 1H5QA 3VNBA 2VATA 4BP3A 1L7DA 3L49A 4H3KB 4M1EA 4IFTA 4OUKX 4BFWA 5KVAA 4PNZA 4MVYA 4I2VA 5MN4A 5BOSA 1E7QA 2GK7A 4MVJI 2QD5A 3R3UA 3SJZA 4ZZ0A 5BR1A 3U48A 3OEHA 1FVOA 1TPZA 2TRSB 4MITA 5HJEA 3DXFA 3GJTA 3QVKA 1HG1A 4TLCA 1XZKA 2YJ4A 5HNKA 4IOLA 3VNRA 4RAQA 1WD7A 3WQBA 2V65A 4BP9A 3HLYA 3PDJA 4FI3F 5CLHA 2HA6A 3K09C 2I2CA 3DXXA 2OHOA 3TVDA 3PFGA 2PLNA 3KEFA 4IG4A 1E6CA 2ESRA 3AY7A 4LQCA 4OQEA 1RXIA 3GLIA 2WTNA 1BCSB 2IY7A 2ZSUA 2IHVA 4FR0A 3G02A 3UMRA 1HSZA 1T5OA 1ZKMA 1NXSA 2CXSA 2PZBA 4YJHB 4XXHA 2NZYA 3RRXA 3VVMA 3IQIX 2FEXA 1VFNA 4H2DA 3JVDA 2H9AA 3MD9A 2LE0A 1HE1C 4KDCA 4U5QA 1ZGBA 1JHXA 2CVQA 4BKUA 5JAHA 3U19A 1VTKA 3HCWA 3G82C 1DX9A 3WLHA 1OH8A 3EC2A 3QMVA 1FJGB 1RYMA 1XA4A 2GK3A 1KR2A 2C5HA 2P90A 1A7UA 3BMCB 2HMTA 3GEGA 3IAS6 4GT1A 2JGFA 4HAXA 4TTQA 5IC4A 1RRFA 1GTZA 2BL4A 3BTVA 3FKJA 5B12A 2AQ8A 3AFOA 4W9MC 1WABA 4LE0A 1TU0A 4BB0A 3BB4A 2YHAA 1PZXA 1LQTA 2GFIA 1FFXA 1C7EA 1QSGA 3TDKA 3AT1A 4S04A 4UMDA 2IRWA 4YV2A 3MWKA 1EA5A 1UBNA 3O1IC 4GOOD 4HDRA 3DL4A 5E9AA 4J07A 1I13A 1QLJA 1CDOA 1HQYE 4KO8A 3TLGB 3VDNB 4JHXA 3E4DA 3PPVA 3UW3A 4HN2A 3EDYA 3E8XA 2I6XA 2VJPA 1EYZA 2BONA 4LJ4A 1E1KA 4XQCA 1WCWA 1KMIY 4XDZA 5DXAA 2Y1OA 3PXUA 1KSHA 2I7TA 1F6DA 1KP9A 2IU0A 1R0XA 1GL6A 4N7RA 1H8HD 2ZT7A 2WJIA 4DA6A 4DF3A 1UFVA 3IT2A 3THXB 4BQRA 1GGKA 3JWGA 4XOUA 4XJXA 2GDZA 3B60A 4WLNA 5FWXB 1WZIA 1DDIA 1FF9A 3D54D 4LMPA 4EJSA 3A7DA 4Z99A 2VEOA 1VM6A 4MUFA 3IOCA 2AVNA 1JA1A 1O6ZA 3JR7A 1BRMA 3EGXB 3N2GB 3QENA 1OZAA 1VQ1A 3QKSB 5GWXA 3JX9A 2O3RA 5EWMA 3UFXB 4BFYA 1HEYA 1JQAA 2GN6A 4WKBA 4WZBE 5K7SA 3RVRA 4TQ9A 4MW1A 1EBUA 3I76A 5K3DA 3WTCA 2A4MA 1Z2OX 3IKMB 3UK6A 3I1JA 2PPVA 1TUIA 2VPZA 4HTFA 5B36A 3SQWA 4KNYA 1WXGA 3PQ5A 5EIOA 5GADl 2GPNA 3MUFA 4GR9A 1TQ4A 3STWA 2ZJ0A 3ZCPA 1EQ2A 1UKVY 3CVVA 4B79A 5BW8A 2P8SA 3UXYA 4YH1A 3OO0A 3V1TC 4XM2A 1T1RA 1R66A 4AJ1A 3KQVA 2LVBA 3NASA 1EJ2A 2JFUA 4RJTA 4RWEA 3G7UA 1BWQA 1ZK3A 5CEEA 5K0JA 2IGTA 2EIHA 4IDCA 5JQWA 4RHXA 4RO0A 4QLBA 3EBPA 3QE3A 1NBIA 2YJGA 5DX0A 4CMCA 5EWJB 2UZAA 1LDYA 1TKCA 4EATA 2GAAA 1WQ3A 2PMFA 3J81A 1SURA 3B9RA 4QUAA 5LMNB 4YP1A 1GV0A 5A5VA 3GLIE 3EAGA 2GBGA 3Q7PA 3WQRA 3T7JA 3IP1A 3MMSA 4PPFA 2BDUA 1M8FA 3D1VA 5EKDA 1QE0A 5FI3A 4URUR 3Q40A 3FOZA 2JRCA 2Z6VA 3QEJA 1HYHA 4R54A 2J3MA 1E2EA 3LU1A 4M1MA 1JEYA 1IHPA 1FS4A 1P5ZB 3O0DA 5AM2A 1V26A 4N3AA 4H31A 1EXWA 2XF8A 3KPYA 4ES6A 3BX1A 3G2NA 1ZMRA 1F4PA 2WMOB 2VYVA 1V2HE 1B2RA 2FG6C 2HIMA 3NHRA 1UDWA 4NH0A 4XSHA 2R00A 3EEBA 3QEOA 5B5SA 5CBPA 4EY7A 1FLVA 3WK5A 3PICA 1CV2A 5ALHA 3TFOA 1J8QA 4Q3CA 5I9LA 4F7DA 3FI9A 1NN3A 1OTHA 3AW8A 1JIXA 1EDBA 2HRDA 2NACA 4FX2A 1AMNA 1NNEA 2NO0A 4LF4B 4P84A 5KYNA 2QN9A 2X0NA 2B8EA 3HVJA 4LHEA 4CF6A 5LKAA 1K8YB 4IO1A 1FX0A 5CLIA 1JSLA 2H9YA 3D8NA 1LSSA 1YRBA 1Z22A 5DYYA 4QO8A 4AYWA 4F2DA 2QAIA 2B98A 4QGAA 1ULZA 3BN3A 1M75A 1B0AA 2O3TA 3F6YA 1A95A 3B13B 3IBCA 3WL6A 4EHLA 1G4UR 3O73A 4MVJD 4YCDA 1SU7A 3VO8A 5DHSA 1PFUA 2X58A 1UFKA 4U0KA 2R1UA 2SKCA 1E4EA 3I34X 4NMHA 5AH0A 2X8JB 1TIKA 4P3PA 4N5NA 2LDBA 4YONB 4CHTA 1I7QB 2QU7A 1WL8A 2O14A 2G8NA 4EHIA 3C4JA 4JOBA 3EW9A 3IEXA 4XFKA 1Z0FA 4LMRA 5H8WA 1ITZA 3KPUA 2AKAB 4C7KA 4QM7A 1EEHA 4E15A 1JFTA 1D4ZA 4M4SA 1YBMA 1TD9A 1W35A 3TB6A 2FKNA 1KDPA 2WWRA 3N0WA 3WNDA 5BSGA 5CDTA 1ZA2A 4MVWA 3U81A 1SO8A 4FYYA 4QDKA 2FSPA 3SR4A 3TJZA 3Q0TA 1AUOA 4TV8B 1VI2A 4LDJA 2X9QA 2D3TA 4G37A 2REBA 1QQ6A 3DDWA 3RC9A 4Z4EA 3T7EA 1Y6GA 3SCZA 3L9XA 1DVRA 3C3WA 3PU6A 1JX6A 5T6MA 3E35A 1Y6QA 1IBCA 2R87A 3EDOA 3G0IA 3G0CA 3HU2A 4MKZA 3RHTA 3S6JA 3AB7A 3ZQKA 4BZZA 5C81A 2B9EA 2B4RO 1PD0A 3TW0A 2WIGA 1YQWA 3RVDA 5BYAA 2GCIA 1GKKA 3K6KA 2CMDA 3PCTA 4YP9A 4NV3A 2RGDA 4D3DA 1CE8A 1UUFA 2W58A 3BTSA 3S2GA 3FHLA 4Z53A 1UJCA 3G2LA 4KLAA 4CNQA 1KEZA 3RS7A 2NZWA 3GFSA 3C24A 4XASA 5FNVF 5K8IA 3VNVA 5BNTA 1E6LA 1NM5C 1KY3A 4Y2RA 2XE6A 2ZXEA 3KZKA 2VYFA 2R6GA 1SVNA 2BMJA 4HNAB 1V3VA 2EQAA 2JD0A 4IUDS 1E89A 1PR6A 2ZJAA 3GU3A 3WGGA 4BVEA 1VG0B 3AR4A 3VR2D 1X7ZB 3T99A 1NMSA 1FJXA 2J85A 3CZ9A 1PUJA 2X2OA 3GRRA 2ZJ5A 3K96A 4ZO8A 4ZOLB 4CV1A 4KQ1A 5HILA 9MHTA 1I4LD 2NYVA 1PQYA 4ZC1A 2WSSD 5HDQA 1P1CA 2WHYA 3V8VA 1QU2A 4IINA 3UWPA 2I0FA 4MWCA 2X22A 5MHTA 2ID7A 2ZYHA 4GPEA 4QREA 1JVBA 1ODTC 2L17A 3ZNOA 2RMKA 4WX2B 2WPDA 4DIBA 1B23P 4CU2A 3S8EA 3PZRA 1Y0BA 3FPKA 5B2FA 4XGNA 5CTJA 4MDFA 1C8KA 1TF7A 2FMHA 3RARA 5DLQC 2ZUSA 3P9SA 4B44A 2GYUA 3V2GA 2B5VA 4L3WA 1EWYA 2XD9A 4PZCA 3DYBA 2GAJA 1QYVA 4D0LB 1JWAB 5DIZA 1G7SA 1NUQA 1YQTA 4RU1A 2QRJA 5GVSA 4RJJA 2GS9A 4I9GA 3HYLA 2I4OA 4ZCPA 1CTQA 4B75A 2ZI7A 5DWVA 5KJ6A 2QYTA 4KXLA 4KNWA 2JEZA 1SKYB 2QTWB 3B9PA 3RASA 1SY7A 2XUKA 1BFKA 1JSXA 1ZM7A 3I39X 4LBWA 2X5JO 3EVGA 3H75A 5COQA 5DEOA 1T9BA 5G1OA 3EGDA 4ZJYA 2PUHA 5FBKA 3TWOA 1ZK1A 2UVDA 2J4FA 2W98A 2X4LA 4G0XA 4RKYA 2D7DA 3DB2A 1ZH6A 1JA9A 2JAHA 2HH9A 5BQXA 3SWWA 5GZ3A 1LI7A 3I8SA 1JXMA 3TZBA 2V6IA 3PUZA 4RKQA 3Q98A 2FQQA 3NS7A 4UZEA 1Z3CA 4I1RA 2DY1A 4F3TA 2HCTA 1QZZA 4MCHA 1ODJA 1YI1A 5EPEA 3QFRA 5J9FA 1W2WB 1XVIA 5EY5B 3SNKA 1VLZA 4AJ2A 3LC0A 1LCIA 3JYLA 5IM5A 5AKXA 4AJKA 3VJMA 4FFPA 1TL7C 1T9CA 1TZ2A 4A16A 1Z4IA 3D3QA 1EGHA 1ZK0A 2PSEA 2XQKA 3EXFA 4OIMA 5EMNA 4DM7A 1ISSA 1M3SA 4ED9A 2N1MA 2WP0A 3DMNA 3PKJA 4ZAXA 1LSUA 4GW3A 3LCCA 2J32A 4JT8A 2ZAIA 4YBZA 2WKWA 3SHQA 5B7QA 3NOQA 1MC4A 3GLSA 1N33B 4BLUA 2HUNA 1SCJA 3E0XA 2CVOA 4LF7B 1JEEA 3CNLA 5HZKA 3WYDA 1KGDA 2FR8A 2IHZA 5EE0A 1LFAA 2Z9CA 4WKCA 5EJ4A 4O4IF 4CQJA 2ZJ3A 4RHEA 3QGMA 3MTAA 5EMJA 1P0IA 4JDUA 2NUPA 4NARA 2BR3A 3LYUA 2H1FA 5TV2A 2VO1A 4FONA 4X8HA 5B1EA 5ELXA 1C1DA 3NJ8A 1IYZA 4BNDA 3QU2A 4RTMA 3GH1A 1JFVA 1N7JA 1QC5A 2H8KA 2VHWA 3FDXA 4BNZA 2WYIA 3WLLA 1NVBA 1ZGJA 2VDWA 2Q3HA 4HDSA 4INAA 3NHBA 4KAFA 1N3LA 3M6FA 4H4DA 1A98A 2GEDA 2VTKA 1C3XA 1S0UA 2PT6A 3H17A 1P0CA 4A15A 5BN4B 1Q91A 5LB2A 3ZWKA 5ICSA 1NQUA 4QBKA 5EKUA 2QRVA 4FZVA 3EULA 1GGVA 5EEHA 3IBFA 4M9UA 3SBOA 3IHLA 5FLXA 5BVGA 5LFAA 1JNYA 4BMXA 3H83A 1Y82A 2C2GA 1B1CA 3P32A 4NBRA 4XIFA 1UIRA 3AG6A 4JNCA 4PSUA 2PKCA 3SDZA 3BB3A 2GAIA 1YU9A 1WU7A 2C5BA 2NVOA 1T4BA 3IT3A 5ALKA 5EIWA 5H68A 3RQIA 1HZZA 3LFHA 3K9GA 5LZ8A 3D5EA 4NU0A 2FPMA 3R4CA 3Q1KA 4CXMA 2LPMA 3DS8A 1YHZA 3E8SA 1IHYA 3IT1A 1HO3A 4HJRA 1XRPA 4KBGA 4I1YA 2P11A 4YJFA 1CZNA 3IVXA 3PGLA 4HEHA 2C4NA 3QX7A 2HHHB 4XKJA 3H4VA 3ISJA 3ND8A 2XTAA 4ZCSA 4AZVA 1CT9A 1RAHA 1J8YF 3A4YA 3EDMA 4DM3A 1TA9A 1NOKA 4FDAA 4W8HA 2P5YA 4M0LA 4TT3A 1EB8A 1ECJA 3V00A 5IYZB 3M6MD 1LVHA 3OPVA 4IFEA 5EL0A 3T3DA 2MSEB 1XCOA 1Q0TA 1M1NB 4WTOA 3GRUA 3HCPA 4TZTA 4EKDA 4ZICA 5LUAA 2WT4A 5DLDA 2WWIA 3A1NA 3FSGA 4RTQA 3WLFA 1EFRD 5CG2A 3L8FA 3KIPA 1N0HA 4WKOA 1PZEA 4URFA 1P1JA 1JLKA 3IAFA 5KJEA 4QJ5A 4BXOB 5AJWA 4PRZA 1FDVA 4CM6A 2HPHA 2J8ZA 4GUAA 5TY0A 4Y30A 5CDHA 2ZI9A 5M5BA 4RHYA 4DBLC 3G17A 3G2MA 4FIZA 2P2LA 3IL2A 2ZUBA 5F9HA 1GFZA 5I9BA 2MMCA 3NH6A 1J1IA 4IDPA 3T5CA 2WJHA 4C7BA 1F7UA 4ZRNA 3UGKA 4LZLA 5ETJA 3HKCA 4R4JA 1UDCA 1I94B 4ENTA 4R2KA 1II8B 4WBXC 4ZHQA 2VDUE 4ZJUA 4OFBA 2YUIA 3VYVA 3KJHA 2QEQA 1IU9A 3KHKA 1GCGA 1XZNA 3ABRB 2SHKA 3QNMA 5H02A 5F7XA 1UK7A 1IXYA 1OXXK 4NAUA 1OW3B 3H13A 3JAKB 5PGMA 4QGSA 1PDOA 4HZUA 1GXSA 5F3RA 3P8ZA 2BY4A 1YKSA 4KQFA 4NMMA 1RC8A 2CF5A 1MDBA 1P7ZA 1AQUA 2FB9A 4GPTA 1PT6A 1T9HA 1E6KA 1VBMA 5JYCA 5IMSA 3OM9A 5ARDA 2OT3B 2CHQA 1ZSYA 4E5NA 1NVXQ 1H2XA 4OAQA 3AVUA 2A92A 1QGAA 5EXTA 3DKIA 1MB9A 3IMFA 4A6PA 2XW6A 5A6VA 4Q7EA 1Z8NA 4R8SA 3H7AA 5IC5A 3WP1B 3GLGB 4EF6A 2HSEA 5BSEA 1KJJA 1JDZA 4QPPA 3OQPA 4ZAZA 3ZI0A 4DXHA 4XX0A 4B8ZA 2Y77A 2WA1A 2L42A 1DMRA 4G8JA 3O2JA 1Z4QA 2XZPA 4IDAA 2DBRA 3A58B 1V9SA 2YZ2A 1ACMA 2FHSA 1C7QA 2JLRA 3H6HA 1PJCA 5FBZA 2BGKA 5EE3A 4ETIA 3K8YA 1M6WA 2OCYC 3I4CA 5EN4A 3M1YA 3IGFA 1OWNA 5KPDA 3BFXA 3LZDA 2XCOA 2XODA 5J2TF 1GSHA 1J22A 2CDAA 1DQPA 4REMA 1JNXX 1JDTA 4N82A 5AKEA 1YBFA 4CKXA 2HN9A 2NTEA 4MUYA 4KG7A 3TUJC 3TZEA 1L4NA 1RACA 2JVKA 4RTJA 1T0JB 1PG0A 1XK6A 4U7HA 4JEUA 2AMJA 2HHAA 2KB0A 3EG9B 5LP6C 1PS9A 4UVHA 5IAJA 4AWAA 3KLPX 3HM2A 3PUVA 4MK4A 4XLZA 1CY0A 3WJAA 2B1RA 3WRVA 4PO3X 3S1LA 4NCHA 4M9CA 2NU7A 2AA3A 3UGTA 2AN9A 1NP3A 4IQ0A 3LZCA 2POQX 2VHVA 3DKVA 3I6QA 3OKCA 4QPZA 5A5EA 3OZDA 4RPJA 1ZH8A 2FLKA 1BHSA 3F6SA 1L7NA 5EAIA 3BFVA 5BUQA 5HK9A 2DERA 4G63A 4Q82A 1BXGB 4BV3A 1TM5E 1BQEA 1P77A 3PGVA 2NXWA 1R9JA 1E5QA 1L3CA 5TGTA 4UVDA 3DNFA 1CJTC 3EDRA 2QN1A 2A78A 2OAQ1 3C97A 4M1YA 5FPQA 4ILEA 5D7NA 5HQ3A 2IZZA 1JTEA 1ZUNB 2OECA 4FYKA 5HVNA 2XB9A 1KL7A 1E1RA 1PQWA 1YK0A 1TKBA 2A57A 1SEPA 2I1QA 5JANA 2O8FA 4D80A 1GAXA 2QLNA 3I1IA 1ZCZA 4B4KA 1XO1A 2NU6B 3GJ6A 4Q9HA 1HLPA 3DUWA 1XJ0A 3H2KA 4B3DA 4L4ZA 3X1DA 3ZHVA 1Z17A 3WK9A 1WHSB 1MEJA 1OBVA 2H48A 3AOEC 1TJPB 3CUTA 3NCTA 4D81A 3JCZA 1D1TA 3LJKA 1TJ3A 3L4EA 2JF0A 2P3QA 1V2GA 5EIBC 1SKYE 1RXWA 4CM3A 1M5TA 1G3QA 1KJIA 1QS0B 2OUIA 3AC0A 4NE7A 4D9MA 4E12A 2GN1A 3GR6A 2QPOA 5JPIA 5BURA 3FNGA 2EEPA 4GI7A 2BMWA 3IUEA 1T4DA 1U6JA 4ESVA 1GTVA 1SOWA 2GBCA 1DZIA 1A5ZA 2BFAA 2FN9A 4Z9AA 4AWXA 5E38A 4ZANA 4IRUB 1MW8X 1VB5A 1GG5A 1KVRA 1QUFA 3O2NA 5IC6A 1TAHA 4D4HA 3A06A 3EEQA 5CFRA 3AF5A 2IC5A 2OCGA 4D6XA 4ABYA 1P0QA 1CD5A 1GPDG 2HPAA 2QNBA 4KO4S 2CZGA 3EOBI 5KTYA 3LIPA 1FUYB 2G5GX 1RS0A 2R5FA 3BXHA 4MQUA 3WIUA 5CU7A 2YHIB 3LF2A 4RJ2A 4S2EA 2BN4A 3OC6A 4R3NA 1VKHA 4ZT2A 1JMVA 4KQIA 4RANA 3RHSA 2O3JA 3CRMA 2YMLA 3DCJA 1J00A 3PXGA 1TCAA 2QNIA 2E9SA 4MWEA 3OFKA 3DFFA 4M9ZA 1KQ3A 4LXHA 5G40A 3VR4H 4V3CA 1CUFA 4BOYA 1IZ9A 1C4OA 1K5HA 3GCZA 2W43A 1D1PA 1RRPA 1MAAA 4YUWA 4Z51A 1PL7A 1BMTA 1RLTA 3DJYA 3MD0A 4M0EA 2PGNA 5GZ1A 4KWEA 3DZGA 4EA8A 2CKDA 1AKWA 3DFUA 3CFYA 4R1NA 3OEWA 4WKNA 2ZZMA 2PKRA 4TL6A 4F56A 2QW0X 4WI1A 1PJQA 2PR7A 2O23A 2Q3BA 1OJ7A 1J90A 1H2RS 1ULHA 2QX4A 4HH0A 1G20A 4TRNA 4TS1A 1IBRA 4LJAA 3T15A 1F5SA 5D3MB 1DE0A 1I32A 1Q0ZA 4HLQB 4RZSA 4IIEA 3WNZA 3WLSA 3FNBA 4G0OA 5ERYA 4ESOA 2P9CA 1G8KA 3OQ1A 4MW2A 5CFOA 2HTEA 4HQFA 2CFCA 1RP1A 1X9HA 4QU8A 4RZ3A 1PSZA 1YCDA 1POWA 3QW2A 4L2IA 3ROMA 3BTUA 5J5CA 1Y5RA 2HWKA 2P9ZA 1OX4A 2QX9A 5K4AA 4UOZA 1VHDA 5DW0A 1E2FA 1A77A 4IR7A 1XEWX 4JLVA 3ZGNA 2FWMX 2VJBA 4EGSA 4FYXA 2AG5A 3L46A 4XGKA 1Z73A 2XZLA 3RJTA 4EYGA 2JHCA 1CEYA 1P1BA 1EM8A 1MABA 4MTCA 2FUG1 3JYHA 4UMFA 2O9JA 1NMYA 2HRQA 2X8BA 4WK4B 1OWOA 5TRTA 1NW9B 2BHRA 3ESCA 1WY7A 3ZY5A 5C5EA 1I7DA 1PNOA 1XXHA 1FXWF 3FMVA 4YLEA 1DDOA 4AQYB 3MSXA 5C53B 1ONNA 1E59A 2A30A 3LCVB 3TMKA 4DLBA 1D07A 2E4XA 2HX1A 3EA5A 4K9DA 3DNMA 1E18A 3MQ4A 3KXPA 1GOTA 1Q7TA 2D5IA 3FYHA 4IM7A 4MMXB 4NU6A 4QXOA 1OUMA 4IO0A 3TIFA 3R7AA 4BNVA 1GNPA 4HQKA 1H1DA 1CJBA 3KKNA 3WL8A 4N0DA 3V97A 5KX5A 3LYLA 1XCBA 4NENB 4Q4LA 1T2UA 2JW5A 5KTPA 3CF4A 4H15A 2FPPA 5CVTA 2I7CA 5BW4A 4H6WA 1FYEA 3E58A 3ROQA 4C4AA 4UNRA 2C5FA 4DR7B 4MDEA 5LQUA 4F2WA 3UW1A 1KI6B 3EQ7A 1YK1A 4I3FA 1N25A 4RULA 2FJ0A 3F73A 4Q47A 4WCFB 2VP5A 1EGAA 1JDPA 2F3RA 2F3SA 2L19A 4WN3A 3W79A 4B85A 4C0AC 5KYYA 1MQSA 2ZYSA 2N1BA 1E32A 1JYFA 1Y3BE 2FWAA 1QLWA 1JR3D 2PZMA 2WABA 3M34A 4FYJA 3FPFA 2QT0A 3AVVA 5AW6A 3LUCA 5CNJA 1ZHOA 1CEQA 1PR2A 1XRNA 4HRYA 1L7RA 4UC0A 4X24A 3B6KA 4ID9A 2QZZA 2AOVA 4LWQA 4WXEA 3ED1A 4QGHA 1PGNA 4ZU1X 1J5PA 3UVEA 1H22A 2CK3D 4LXGA 1L9KA 3BD7A 5LQRA 1X87A 3DV0B 2EAUA 3O8OA 3ADCA 1IN5A 1NJ1A 3WKCA 4AXBA 4E7PA 4PO9A 4R1LA 1KP2A 2QVCA 4IDOA 2YCBA 2HREA 1G9TA 1X9GA 1Y33E 3MCUA 4M0DA 3R76A 3GXOA 4I4LA 1SUFA 4CQMB 3D8HA 1ESNA 1UZMA 3C3PA 2GI4A 1X39A 3WMWA 2A0UA 3UB3A 4HGYA 5J3JA 3Q3IA 2FUNB 1JIKA 1ZOLA 3NMUF 5HCNA 4PGAA 5L4NA 1K97A 2WSMA 5JZVA 2Y66A 1ZI8A 1RQPA 2DH6A 1PQ4A 3EYAA 4R9RA 4ZT7A 5LIRA 3CV3A 4TMZA 3HDVA 4YP5A 5JSZA 2WSYB 2D1RA 4LX0A 5ALXA 4PPQA 1L5ZA 4M7OA 4CEJB 2VUHB 3NGXA 4RPIA 4DIUA 4G07A 1QVRA 1RLUA 1JT2A 1TT5A 5CA0B 3IO5A 1TQDA 4DDMA 2DPYA 2IJGX 2RKBA 1XN4A 3C5WP 4IEIA 4MLDA 5E7MA 1L5SA 4MRVA 3ZIUA 3DTVA 3LQ2A 2HTFA 3T9AA 3EZ2A 1XNQB 4TYWA 4PGHA 5ENVA 3ZTYA 1G2IA 2DHRA 4N8DA 5CX1B 3WNVA 4HWSA 5LYJB 4IIJF 1USUA 3LNTA 1UPAA 3L82B 4WCDA 4CT0A 4ZARA 3OQBA 2WYHA 1YDFA 2CWWA 4JIMA 5HCUA 3DVSX 2O1EA 2WKPA 2B6HA 3GN1A 5DCWA 3VPFA 1IULA 2QTGA 2WU8A 1JLMA 3FSRA 1DC6A 5E6SA 1U3VA 3DEZA 4Q3LA 5G4KA 3UKOA 4HMPA 4RIFA 3ASUA 4LHZA 2B4KA 1DG3A 5TDHA 1NW6A 2CC2A 3RKSA 2HMUA 2PFKA 4S0ZA 1E96A 1TW3A 3CLUC 3P5SA 3UC5A 4LF5B 3BXGA 1L5OA 4QM6A 8AT1A 2YV1A 3MERA 4WOPA 4YB8A 3E5MA 4D3SA 5IDVA 4DQXA 3FOFC 2OORC 3QI2A 1DI0A 1XXHE 2I2AA 3C7TA 4FXOA 2G71A 3LECA 4BNKA 1N2HA 1PYDA 1E60A 4X92A 1N8SA 1OX6A 1JIQA 2O7NA 3B85A 3IKJA 3QLTA 1GFSA 1VL6A 2QTFA 2YXLA 3HFJA 1WPGA 2GEFA 1H9AA 2C0QA 2XX3A 4HNSA 3G8AA 2NU8A 3UJDA 1GPKA 1DAEA 4RA6B 3GVPA 4DL9A 2VF2A 3LLSA 2CHEA 2V9CA 2WU0A 1J7JA 3FTPA 2XNDA 3VI3B 3QJYA 3DH0A 5ICMA 1YJ8A 3X1YA 1TUBB 3QBEA 3R6TA 1A8PA 3V4PB 3ZLTA 3ADPA 2RGNC 1W44A 2GRJA 3EIUA 1MRZA 2Q4TA 1BA3A 1JDUA 1UIMA 3LBNA 5E9WA 4D4JA 4TSFA 1F7VA 1I7LA 1HT0A 2ZE5A 3R3JA 4LUCA 1FNNA 1W49A 1VPEA 2GZSA 2VBGA 3K71B 2ZBEA 3Q8XB 4WZ6A 2K5UA 2J3QA 3FTQA 3UAXA 3BB1A 10MHA 1FMTA 2E48A 3E0QA 2DXIA 1EFLA 4C7OA 3OF3A 2NGRA 1FP4A 2FZ5A 3C87A 1VGVA 4IIVA 3CU5A 1M2VA 1D6SA 3GDWA 3PGMA 1XPJA 5LB4A 4FMBB 1OIXA 5DHFA 3R0ZA 3GFGA 3TSAA 1HQKA 4X64B 1EFUA 3BVPA 4CLXA 4EL5A 4YCMA 1RXVA 1Q2XA 2QRQA 2I03A 1J99A 3EY9A 3I28A 3LVRE 4RJLA 5H59A 1FVXA 5I9SA 3SLKA 4DLYA 4GMKA 3CEAA 5JR3A 4G1MB 1STOA 1XQXA 1YMVA 4P7GA 5JROA 2HSJA 1T0HB 1B93A 1XVLA 1XOIA 3DLHA 5EIXA 4WWHA 3L93A 2ZWOA 2Z04A 1VL1A 2Q7DA 2JHGA 4UPEA 4P0PB 2G9VA 4KOEC 1H42A 4RBNA 3MRVA 1R18A 4JP1A 4B3BA 5IK2A 4BFCA 3ZZUA 1MA0A 4JP2A 1KAOA 2J6CA 1FYXA 5ICEA 1Z63A 3Q6NA 2PMDA 3MW8A 5E1BA 1NVVQ 1H5UA 2FFAA 2B21A 5HTOA 3BHJA 1FBTA 5K99A 4HEA6 1OC2A 3BOSA 5JO9A 1UP6A 2RHRA 1P7WA 1PG2A 3U13A 2WJ3A 4X1YB 5DFAA 4Z4IA 3X43A 2HDOA 2X9LA 1KJZA 2RJ3A 1SHLA 1X7WA 3HZOA 3QYAA 5JWOA 2LNDA 4UREA 2VWQA 1VC2A 3ICCA 1J0DA 3LHSA 5FI1B 2QK4A 3F97A 3B3QA 1G8JA 1KH1A 1MR3F 1QYCA 1VJCA 4G1EB 4N8EA 3TW6A 4MRMA 1BN7A 4OH1A 4PX5A 2YQ5A 3LNCA 1OJLA 4LZZA 1XZGA 4BVJA 1QTIA 3HN6A 4AO7A 4EVQA 3PUKA 1J39A 4XYGA 3QX3A 5KOIA 2DVMA 2RGBA 3QE9Y 5JDCA 3GQBA 4OJKA 2XGOA 1PF7E 4N54A 4NTZA 1K8XB 4GBGA 3UENA 4FOOA 2ZU0C 1RQGA 5LLSA 5JAUA 1QQBA 1CUDA 1XDGA 2BUAA 3MSCA 3DHNA 4JA2A 3TKYA 5BUSA 4HDKA 5AI9A 4YREA 4X7PA 1ZG3A 2D4HA 3R5SA 1ZESA 1YQQA 3FDIA 5JXWA 5CBKA 2VJCA 3DFIA 5L3SB 1E9VA 3BE8A 5FAKA 5JC1A 4DCOA 1Z06A 2AEEA 4AZ0B 4NXNB 4YQEA 4E70A 4TTSA 1SXHA 4UM9D 5CYFA 1JTVA 1T4MA 3Q3CA 1OILA 4IXTA 4UAJA 4WNAA 2AHOA 4IYRA 2WJWA 4QTXA 3CX4A 1NFFA 1PLLA 1UINA 3D4NA 3HDGA 3NKFA 3OZ7A 4N4AA 3KB2A 1VPDA 2QL7A 5DNVA 4NYIR 4JXXA 2JAWA 5FUQA 3K4PA 5CGZA 2C99A 2D1SA 1CQJA 1EFKA 2AQHA 3MIZA 3PA8A 1C80A 4LJYA 2JJ1D 5DVZA 1V9CA 3K9CA 3AVXA 2GWRA 2H54A 2BBSA 4NV0A 3T0IA 2LXNA 3DZKA 1L5VA 1Q11A 3EVBA 3TAUA 1HFJA 1MAUA 3L0BA 1SD1A 1GO2A 1ZGAA 2PQMA 3AR6A 3VHXB 2VSNA 3QUQA 1M83A 1VHJA 4OOFA 3C5EA 1ADFA 2YNMA 5BXYA 5F2KA 2PSHA 5H3LA 3RFXA 4PG5A 4G3XA 4C6HA 5EVJA 5F5NA 2J1LA 1TM3E 4YAEA 4BB6A 2W00A 1P81A 1QJCA 1TX4B 2V0CA 4I8IA 4IQ8A 3BSSA 2KYRA 1RT9A 4PRYA 1QHNA 4JASB 4F8EA 5BUZA 1J5EB 3GELA 1UKCA 2ZIVB 1JSZA 3OJ0A 4QHSA 2BF7A 4IDEA 1EX1A 4Q93A 3R0JA 3S2IA 4BGVA 2J87A 3E5RA 3FPEA 1ZRNA 5BR8B 1YVPA 4JGIA 2H9IA 5C8VA 4TUYF 3ZJYA 3H11A 2ZXUA 1DQZA 4AJHA 3QUTA 1E0KA 2IU6A 3DBVO 4J9VA 4DFDA 4BN4A 3L6UA 4R98A 1GLVA 1TAGA 1Y8QA 3EQZA 4Y6LA 4W5RA 4C0LA 3D6MA 4PNHA 4AKIA 3E2PA 4H0NA 4HR7A 2CXHA 5FBRB 3ENZA 1WJGA 4C7MA 4WFIA 3OCXA 5AW5A 3AEQB 3PX2A 1QU3A 5JRZA 3QXXA 1WTCA 3MWGA 1T5DX 2AN1A 1YL7A 2FG5A 3E5NA 4M1OA 3AUJB 2ES4A 1CHNA 3AI7A 3QMMA 1BDJA 2FR0A 3G7SA 1OAAA 3KPJA 4ALJA 3O03A 2PBLA 3SLRA 4J2OA 1UMCA 4IGKA 1PLJA 2V0NA 2Z2XA 4FGZA 4GOXA 4K6CA 1CUGA 2VXBA 2QAGB 1AZLA 5ALOA 1SGWA 2IEYA 2R2AA 2XB6A 2EZ4A 3DE7X 3HACA 3IXQA 3MVEA 1UDRA 4BLRA 1AA6A 3CQ9A 5BSTA 4X6LA 4FKMA 5IW8A 4DWVA 4LZNA 4GKBA 2PJZA 5L40A 1DKQA 3RR2A 4CKZA 1PV1A 1ZRSA 1L1RA 1IQ0A 2R4UA 4F72A 1E3IA 2P3OA 4DMCA 1A2OA 2JJ2A 4QGBA 1MH9A 5J1SB 3DT9A 3DYVA 4FDLA 1V9LA 3LGXA 1P7CA 3BSWA 3KQOA 3B1WA 1FRFS 1ZM4A 4L22A 1AKUA 2C61A 3TG2A 5JI3E 1XPUA 2W8BB 4P36A