1Z12A

Crystal structure of bovine low molecular weight ptpase complexed with vanadate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bovine Low Molecular Weight Phosphotyrosyl Phosphatase Complexed with the Transition State Analog Vanadate
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
total genus 62
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z12A00
3HCWA 3GL9A 3SQNA 1JF8A 1NXVA 3SG0A 3HEBA 1RZRD 1BDIA 2YHBA 1TJYA 3SM9A 4MR7A 2PUDA 4F3TA 1HEYA 1E2BA 3D8UA 3F6PA 1PNTA 4DQDA 5BRAA 4EYQA 1TVMA 1UDRA 2E4VA 4ETNA 2ID7A 4QYMA 1FFWA 4OLBA 3GA5A 5T3YA 3MA0A 5CNMA 2WY2D 1C4WA 3QX9A 2JK1A 2Q5CA 4PEVA 2A9PA 5TPZD 1DRJA 3BBLA 5CNKA 4YS6A 3GT7A 4JASB 3E3MA 3HDGA 4RK4A 3GRCA 4EVRA 3GWGA 3LUFA 4MQEB 4TLLB 3MMNA 2JB9A 1BAPA 5CNJA 4LRQA 3GBVA 3A10A 1VPWA 3C6QA 5KQGA 2IDMA 1DCMA 3H5OA 3HUTA 1LBHA 5I4CA 2PUFA 1W9HA 2JVJA 2GKGA 4NCBA 3EGCA 4YLEA 1QNLA 4TLMB 1D1QA 2HSGA 2JCGA 4MS4A 4G0OA 1EHCA 1YMUA 2A9QA 3QLTA 1B00A 3MQ4A 3N8IA 4PZ0A 4YRZA 8ABPA 1AB6A 2IPLA 4MQFB 4JA2A 2X7XA 3OM0A 5KC9A 5BR1A 2IPAB 2WJAA 3IP6A 4JAVC 1JWLA 3LKVA 1TLFA 2MSLA 5DLEA 4YR7A 1WETA 1ZH2A 1BA2A 1E6MA 4Y9TA 3RVMA 1DJMA 4YGXB 1NXTA 4B09A 5HKOA 3H5LA 3Q7RA 5GOTA 4EGSA 4RXMA 2A9OA 3LKBA 4S04A 1YK0A 2CHEA 4Q7EA 1USKA 3N6VA 3NBMA 5KQPA 1QMPA 4S05A 5FBKA 3TX6A 3I5AA 1YIOA 3H5VA 5KI6A 5IULC 3FFXA 2GWRA 1PUXA 3OM1A 3Q9SA 4NQRA 3QEMB 2PUAA 2CWDA 4OATA 4XLTA 3E61A 3HSYA 5TPWA 1M5TA 4KRFA 4Q6WA 2MYNA 4KMRA 2VUHB 3QELB 1ZGGA 1EWVA 5TQ2A 1DRKA 3H6GA 4XAQA 1M2EA 2IPNA 3OMWA 5TPWB 3H1GA 2PJUA 1DCKA 4FE4A 2JVIA 1ISSA 2FSPA 5C5CA 4OBBA 4DADA 2N9UA 2FMFA 1JX6A 1PEYA 5IUJC 3CTPA 2QVGA 3KLOA 3M6MD 4MRMB 4EY3A 1KGSA 3KG2A 2FEKA 3O21A 4Z99A 1YS6A 2JRLA 4Z4CA 1EWKA 2FQWA 4TN5A 1RNLA 4G0YA 1U8TA 3O2QB 4KK4A 4Z9BA 1U2QA 1ZESA 3BRQA 4RK6A 3RVJA 1C0EA 1DZ3A 1ZITA 5BQ3A 1YS7A 2F8SA 2R25B 4D6XA 2LIVA 2PUBA 3DBIA 1S8NA 4G86A 4KK3A 4RSMA 2FTKE 3O1HB 1DC7A 5EWMA 1K68A 3OO0A 4WT7A 4ZPJA 3IP5A 6CHYA 4KFCA 4IF4A 4UHJA 1D2AA 3O1JC 3GBPA 3QLUA 2NZUG 4MR8A 4P1ZA 2FW0A 4NV3A 1GUBA 5FBHA 4IMJB 2FLWA 3CLKA 2E4ZA 3LUKA 4F11A 3HK2A 3OLXA 5F64A 4MRMA 5GQSA 3BRSA 2E4UA 2WMYA 3EULA 3ROFA 3RVOA 1Z13A 4RU1A 4Z4IA 2PMCA 2JBAA 2QZJA 3GV0A 1OXBB 3QK7A 3H5IA 4OLAA 2FMKA 5IUNC 3RVNA 1QKKA 3IPCA 2LUOA 1SXIA 4N41A 4HNRA 3IP9A 5TQ2B 5D2CA 3URMA 1QP7A 1P2FA 1GCAA 4Z4HA 2I6FA 4N47A 5HQJA 4HNQA 3H5WA 1SD5A 2FEWB 3EQ2A 4RWEA 4RY8A 4QYWA 2L17A 3CKMA 2PE5A 1P6QA 1FQWA 3JPWA 5FWYB 1GCGA 2IYNA 2HQBA 5TPZA 2L18A 5HM6A 3GYBA 2VYCA 5ED4A 5FWXB 2AYZA 1QPZA 1IIBA 3ILYA 5JNSA 3RVLA 1RPJA 1NXOA 1QO0A 3P9YA 4GNRA 4MGEA 5DGCA 4ETMA 2H3HA 3C3MA 5FWYA 2VUIB 3KS9A 1DP4A 5KQLA 3KKEA 2BGGA 1K66A 3N53A 2DRIA 1I3CA 4G0XA 3HDVA 5BRJA 5IBQA 4MAAA 4EUKA 5T7BA 1QQAA 2ZWMA 4IRXA 4MYRA 4YO7A 1QQBA 1RZRA 2KYRA 3L49A 4D6YA 3ROTA 1ZN2A 5JNUA 1JFSA 3H5TA 2FMHA 1XHEA 4HNSA 1J56A 1D5WA 5JNWA 3JPYA 3LUJA 4WXMA 3UKJA 3JTEA 2WWVD 3CFYA 1ZVVA 2MSKA 2LBPA 4LE2A 4MLDA 4MS1B 3HVRA 1XHFA 4DN6A 3JVIA 3O1IC 1GLGA 2RJOA 3K4HA 4RK1A 4UHKA 3T6KA 2QVCA 4LE0A 3EQZA 4H60A 1ZH4A 1LBIA 1ZDMA 3I45A 4N0QA 5IUKC 2YHAA 4RV5A 5B3JC 1M5UA 1USGA 1P8AA 4E7PA 1MB0A 4YV7A 3HM9A 1L5YA 3CZ5A 3EJWA 1SRRA 1MAVA 1Z16A 6ABPA 1PHRA 2WJWA 4N03A 3A0RB 3N0RA 3QLVC 4JB0A 7ABPA 2NT4A 1RXIA 4ZYLA 2IPMA 3LUCA 1Z2DA 3N0XA 3LUHA 4YWHA 2M98A 4Q6BA 4LX8A 5TQJA 3Q7SA 2CD7A 2P9HA 1MIHA 4M88A 3A0UA 4Z4FA 3FDFA 1QP0A 4FE7A 2RJNA 2HJ9A 3C3WA 3JS5A 4XARA 3T95A 2P4UA 1LK0A 3LUDA 4CBVA 1F51E 4XASA 3H6HA 2RDMA 4RXTA 1D4ZA 4IILA 3QEMA 4RY0A 1TM2A 4RY9A 1NY5A 1MB3A 3B2NA 5KC8A 1RXEA 1U2PA 2FN9A 3SY8A 4G0ZA 3IDOA 4F06A 3I09A 3DGEC 4OG2A 1JFVA 2L2QA 4RS3A 1Z15A 3VNBA 2ZAYA 3MIZA 1OXKB 3BILA 4EVSA 3ILHA 4EYGA 4G0MA 1GUDA 1Z25A 4Z4EA 3QLUC 4KV7A 3HZHA 1JDNA 4EYKA 1JH9A 1E6KA 1JYFA 3Q7TA 1JYEA 2FLKA 3Q41A 2HPHA 3L6UA 2IKSA 2M1ZA 4ZMRA 1H9CA 4IMIB 4RK7A 5TQ0A 2R47A 5C5EA 3KYIB 3HJFA 2FN8A 5DCLA 4MR7B 2WRZA 1Z12A 3OQOA 1CEYA 2OQRA 2LPMA 3QEKA 2QSJA 4KZKA 4LDAA 5E3JA 2FMIA 4KVFA 4NCAA 1USIA 2PKXA 2V0NA 4RDCA 4RZSA 5JS1A 3O2SB 3KTOA 3D02A 3QELA 4D74A 2GBPA 4Z0NA 4KQCA 4P98A 3DZDA 1A04A 1EWTA 3C3KA 3SNKA 3NNNA 4H3HB 4MQEA 2FVYA 1FFGA 4KQ9A 3RVSA 4MPTA 4OTZA 1NTRA 3UUGA 2E4XA 1DG9A 1APBA 1NXSA 1Z18A 2PAFA 1BVHA 5CNIA 4KPYA 5PNTA 4G97A 4RXUA 3DGFC 1L5ZA 3KHTA 4RKQA 3F73A 2F8TA 2PLNA 2QR3A 3RVQA 3LMKA 1YK1A 4TMYA 4W5NA 4WXEA 3EDCA 5JNTA 5KWSA 3RQIA 3G1WA 4JB2A 4Z9AA 1NXPA 1Z2EA 4LZLA 5KQMA 4MS1A 4ZMSA 1VKRA 1R8JA 4EVQA 4W5RA 4KNYA 5DKFA 1ABEA 3I42A 4F8JA 1VLZA 5IEJA 3RH0A 3CZCA 1PEAA 4JP1A 5JNRA 2MYTA 2VK2A 2HQRA 3H75A 4ZJPA 1Z17A 2OENG 4MS4B 1T34A 4MLCA 3NHMA 4O1IA 2WB4A 1NATA 3HXMA 4JOQA 3HV2A 5EWLA 3CG0A 2H0AA 3O2JA 5EWJB 2AYXA 4E7OA 2NUBA 4KREA 1EAYA 3CU5A 2MSWA 5EWLB 4NICA 1M2FA 3KLNA 4MQFA 5JNVA 1TMYA 4W5TA 5TQ0B 3QLVA 4MR9A 1SXHA 4MS3A 2GI4A 5HSGA 3FGZA 3LFTA 1URPA 1QP4A 1ZY2A 3HUUA 2ID9A 3OLVA 3DLHA 3JY6A 5B3JA 3OO1A 3EODA 4XFKA 1Z26A 4MR8B 1E6LA 4Z4GA 2FKAA 3CRNA 3N0WA 4YP9A 2A9RA 3Q15C 2CHFA 3FFTA 5IX8A 1FSPA 1FFSA 4L85A 1KMIY 1ISRA 2GX6A 1U0SY 2L19A 2R48A 4O5AA 3NHZA 3OLYA 3CS3A 3LUAA 4XXHA 3SAJA 4LE1A 2E4WA 3CNBA 1Y1LA 3TMYA 4H3KB 5TE9A 2MYUA 2E4YA 3NNDA 4PE5B 2PUGA 2TMYA 1KRXA 3M9WA 1ZGZA 3KYJB 4PICA 4RK0A 3DLBA 4LDZA 3IPAA 2QV0A 3N75A 3FFWA 4W5OA 4MS3B 4MR9B 3A3KA 4F12A 1LJLA 2FEPA 3MM4A 3VNAA 4QPJC 1U04A 1A0OA 1JL3A 2PUCA 1W25A 3O75A 5EWMB 2FXIA 2B4AA 3KCNA 3OQNA 4W5QA 3OLWA 1DC8A 1JBEA 3RVRA 3HS3A 4RKRA 5IEBA 1PNRA 1MVOA 3JVDA 3KJXA 5ABPA 1KRWA 3H1EA 2W42A 4N0PA 2J48A 3FMVA 2R4QA 4FB4A 5JS2A 2RGYA 1YMVA 4IGAA 3HO1A 2B1JA 3F7NA 3T8YA 1NXXA 3TO5A 2XDYA 2PL9A 3OMXA 1DBQA 1F4VA 3QX8A 3F6CA 4HYEA 5FWXA 3O74A 3R0JA 4WZZA 4G0PA 1LJUA 4ETIA 4YCSA 4QICA 2JBAB 1ABFA 2FQYA 3CHYA 3C97A 3MYYA 2PUEA 1QO0D 3MF4A 1CYEA 9ABPA 4O1HA 3H1FA 2QXYA 3T38A 1BDJA 3KSMA 1JHZA 5IC5A 2LP4Y 1YTUA 1DBPA 1SXGA 2IOYA 1D1PA 3BREA 4L4UA 1P6UA 1JFTA 3LTEA 3LUGA 4WUTA 2NT3A 5EWJA 3TB6A 3RVKA 3EAFA 1AB5A 1XWWA 4PYRA 4GPAA 4ML3A 1NXWA 3K9CA 2QU7A 1JLKA 3OLZA 2FQXA 2QW1A 3M9XA 1ZHHA 3S99A 3TD9A 4WWHA 2MYPA 2PL1A 4G0QA 4EYOA 1CHNA 1VRVA 2NZVG 3NNSA 1BDHA 3UK0A 3OQMA 1DBWA 3RVPA 1A2OA 1EFAA 2HQOA 1DCFA 3W9SA 1ZAYA 4N76A 3G85A 5CHYA 3CG4A 1YVUA 4RK5A 1JDPA 2O20A 3IP7A 2JVKA 3LOPA 5DTEA
chains in the Genus database with same CATH superfamily
3MAJA 4EHKA 4IS3A 2VBGA 3EYWA 3H13A 3AYZB 3R3SA 4DM4A 2IF0A 3RF6A 4IDBA 1UAYA 1LCIA 2ONKA 4PX5A 3WLRA 6PFKA 1RKVA 3INRA 2CFIA 5FUVA 5LBIA 3HSKA 3O6VA 2VC2B 1AGRA 5K2OA 4IR7A 2UUOA 5L95A 1TYZA 2IP4A 4YJHA 1HNWB 4YBRA 4CKEA 4G5FA 5DM2A 3R8XA 1UOPA 1E79D 4CCSA 4YS6A 1OWMA 1JUDA 4QG3A 1RPZA 4UBJA 3HDGA 1CUZA 1JG2A 1LPPA 1OGYA 2QYOA 4GGOA 5CLLA 3VH2A 1IN4A 3TW6A 4BKPA 1CVRA 2AT1A 4JWKA 2W6ZA 4WBSA 1Z37A 3BL8A 4FYWA 3A10A 1U80A 3AERA 1ENPA 3TLMA 2DFKB 3C6QA 1YZ3A 2CV1A 3NIBA 1KPGA 4MWGA 3BIFA 3HUTA 3ZV4A 1KVTA 1OLUB 2BZGA 2Q5OA 2VP2A 2VI5A 3Q1LA 4WLOA 2ID4A 2PUFA 5ARBA 1CQZA 3Q8LA 4OKIA 4EEXA 4NCBA 2VTDA 2AEMA 1Y82A 4R1UA 5LA6A 2ZREA 3TOXA 1I6MA 1UBHS 3PQ2A 5F77A 3STUA 3ZDQA 3X1MA 1E2FA 4OFXA 2XHEA 4YUVA 4RDXA 3KLPX 1EEXB 4HLUA 1O6BA 3QU4A 3OM0A 4MUNA 4E32A 3FD8A 2Q1WA 3MWDA 4UDXX 2I71A 4BBAA 1JWLA 5K8VA 1IHXA 5JBIA 4CV0A 2J4CA 2OZKA 4M1KA 4BVFA 3V7NA 4DUPA 4DR1B 1ZH2A 4A7PA 1ZUIA 2IUFA 4HXGA 5FUMA 1P2SA 3K0CA 1W5FA 2DUUA 1Y5NA 4QHYA 4LF6B 3R3WA 1UQRA 1NVVR 2QTHA 3EBPA 5DK6A 1G3MA 4HGOA 4UPEA 5FJJA 4KACA 1C7QA 1N2OA 3EIOA 2OBBA 4AULA 2P90A 3IP8A 1R4ZA 5HBGA 3ZN2A 4REQB 4YYZA 1VCIA 1KYXA 2H54A 1I7NA 4R84A 4RH3A 4Y2VA 1PV2A 4WOJA 2ZANA 4R1MA 1LB1B 4KLZA 4CKXA 3CUEF 2JI6A 3LVQE 3WTBA 3WSTA 5ITZA 2KPOA 3Q9SA 4MW7A 1KYTA 1IBMB 4XLTA 5GOZA 3E61A 3HVJA 1U63A 3UVEA 1SRQA 1TNDA 4Q6WA 2HHLA 1H2BA 1WUTA 3A6HA 3OOSA 3DR5A 1JDTA 1K7EB 1M6NA 4DY6A 2IZ6A 3A9TA 2RAUA 4XAQA 1XU4A 1OX4A 1OW3B 2AC4A 2Z2JA 3KT6A 2XA2A 2WILA 3H4TA 1Z6PA 4CLDA 1RRCA 1EIWA 4CM5A 3KIPA 4EFLA 4KQMA 3KV1A 3I6QA 3BL5A 3DVAA 5JMPA 2W83A 4M0KA 1DQYA 3PX2A 1XF9A 2P4SA 2ZYRA 4XJVA 4BYGA 4CM9A 4BAUA 5KYXB 3WAGA 1KMQA 1XNQB 2FEKA 3PJGA 1KI1A 1CZKA 1YS6A 2JRLA 3GX1A 3QYAA 3TMAA 3I4LA 3T1TA 3U31A 1VPDA 5EPOA 1O7JA 4X85A 1JU3A 6ADHA 2GPNA 4N5IX 3TNLA 2ACKA 4WA7A 5BXYA 2EFYA 2ZXFA 1IRIA 5A62A 1SKUA 1TZ2A 1WSDA 3AF1A 4BB6A 2B25A 3DULA 5SICE 5AVRA 2F8SA 1A5AB 2LIPA 3N9IA 2QTMA 4DA7A 4O4JA 3UWSA 2F55A 3SI7A 3NIGB 4DYDA 2XLBA 3M6LA 3KWMA 4HHEA 4WT7A 3QX3A 1D6SA 1UFQA 2PZJA 4WVLA 4KFCA 1BE1A 4EA8A 3EQ8A 1BOFA 1RXYA 4HDNA 4HYYA 3T5PA 5CVJA 1E1NA 3AF0A 3ESAA 4P1ZA 2FPPB 4HNUA 4IDNA 4IUYA 2ZBFA 4IMJB 1E62A 2FX5A 5ALGA 3IJPA 3PC8A 2PZ8A 5DLQC 3GOHA 2J9GA 3TF5A 3KT8A 4DLLA 2JARA 5A4IS 1VPLA 5BYAA 3TIFA 3D0OA 1VL0A 4KH0A 3HHPA 1QTQA 3MFYA 4XRGA 2ZIXA 2VTBB 3SXUA 4BQOA 4LV6A 1GXSB 1XRSB 2B7LA 1S2IA 1U0HC 2OUIA 3EDMA 3FKQA 4K3VA 2WWRA 1SZPA 4R51A 1H85A 3L4BC 1KI4A 4HG2A 3IAEA 3W5AA 4NV1A 5KNCH 1W0KD 4OQYA 1GSIA 4Y2YA 3IHKA 3ZKWA 3AFGA 3DDCA 2XDAA 2X0IA 5AHOA 3SD7A 3GYBA 5F5NA 1QPZA 1QK4A 1NASA 2O5VA 4LCJA 1R1DA 2SECE 2V74B 3D64A 1NXOA 2NAPA 3NAZA 4YROA 3DKVA 3QU9A 3JCZA 4FUQA 4NMHA 3HCOA 5L7YA 2JHFA 2GJKA 2ZT5A 1Y4ZA 2VYVA 3LLVA 5JSKA 1JU4A 1T1EA 4KQ6A 1FSSA 4G0XA 1OBOA 4BMDA 1H1LA 3LCUA 3KT3A 5ESWA 3JQPA 2JGEA 2RGUA 3NTOA 5AOBA 4RSRA 5DSZA 5GY7A 1XK7A 3IEIA 4B6SA 3E0QA 1J0AA 3I9FA 1XXHA 2WNHA 1XAJA 5JNUA 3ENZA 2JIOA 1WMFA 1XHEA 2FMHA 3D4IA 4HRVA 3ZX4A 5FADA 2YVKA 1A8UA 4Q1AA 1L1EA 3MCUA 1CUWA 4BZQA 3NANA 1ZICA 3C3EA 2D6FA 3FCXA 2AK3A 2IY9A 1DG3A 1LZKA 4KFRA 1T29A 4ZCMA 1PR6A 4YY3B 4P3YA 2ZZMA 3IX7A 5CJ2A 2O2YA 2BFMA 2F62A 1UKCA 1RBYA 2OCPA 4GQAA 4NV0A 5K0LA 4DARA 1KQGA 3MIIA 3SOZA 2CV2A 2YJ6A 3KEFA 1NC3A 1W94A 4AFNA 4EHLA 3VYSB 4URVR 2WPNA 2QTLA 3HPRA 3R7LA 1KU0A 2PXHA 2BH2A 2JIPA 4FFDA 5HRUA 2R7AA 2XUHA 4M9CA 2GGSA 1NW6A 2HH9A 3A0RB 3O4HA 4CEIA 4JB0A 4KDCA 2ZYSA 4YP7A 3H2IA 1RXIA 2LKDA 1N6OA 2WD7A 3FJ1A 3RTGA 1JI3A 1FFDA 1B43A 1RYBA 3LF1A 3CX6A 2AUTA 4XWTA 1SCKA 3R7NA 3C48A 4AJ2A 4YUXA 2A5YB 3VHRA 4OK3A 4NYJR 3ZDCA 1GN8A 2CDBA 4QVKA 2JFZA 1Y3HA 3O3MB 4G5OA 2AYYA 3HFSA 4TWZA 1BX0A 4PLGA 1UAGA 2ZVJA 1Q2XA 2HGZA 1E9RA 4P7GA 1TDJA 4L8FA 4WLUA 2GN0A 3KYDA 1C1HA 3L8HA 4LRXA 4IJVA 3ZGOA 1AK2A 4EHNA 5CDFE 2VT6A 1F51E 1NM5A 3IMFA 1FDIA 4WDQA 3C2QA 4D4IA 4INAA 4PYIA 4BNUA 4TQAA 1GZUA 3Q11A 1RI3A 3IE1A 1F8GA 2ZBRA 4X20B 2J9XB 1XG5A 2FP4B 4XM1A 2WSBA 5JDCC 5KX5F 2FSGA 3N2IA 4L0QA 1U7TA 2H5IA 2V7QD 4X1YA 1YWGO 2Z3ZA 1PEKE 1PFUA 4B46A 3RYCA 3G7NA 4GWGA 3VNBA 2X6TA 2YWRA 5MGBA 4K6OA 3R6LA 4TKZA 5LSAA 1M6HA 2V8BA 4E5NA 1NLYA 1QTNA 1FVOA 2BDTA 2ISCA 2WM8A 2YJ3A 2GYYA 2YWXA 3P9ZA 4TTQA 4KQ2A 5KSYA 3FOWA 3V4FA 2WWHA 2QTGA 1PSZA 1Z5PA 5IKOA 2IDKA 5E2BA 4DV6B 2B20A 2ZR7A 3D8HA 3AF4A 3I0MA 3JASA 3T1VA 4A03A 4D81A 5HXAA 1LDGA 1QYVA 1YDFA 2IKSA 3L6UA 2XWPA 5IXJA 4RK7A 5LOVB 5HUJA 4HGZA 4H18A 1P18A 5K6AA 3KYIB 3OZGA 3PFNA 1ATIA 1FY2A 2Q4EA 1H65A 3TJZA 4DKJA 4DV1B 1W7AA 1HWYA 4FZ3A 5AUQA 4DYVA 4KE7A 3WYGA 2QSJA 2ZPUA 4FT4A 2G8NA 5IDYA 1U0OC 2VDLB 4F7WA 1UK6A 1IE3A 3PGJA 1F17A 3DOHA 1CP2A 3MBKA 1A72A 4JNKA 4Z0TA 2DBRA 2BPOA 2DHRA 2J3JA 2NGRA 2VXOA 4TZTA 4UM7A 4BFCA 2AZ4A 5F35A 4BAGA 2R8RA 4BV8A 4TKVA 5J2UA 2GBPA 2BFCB 1QVZA 3K5IA 5KNBH 1YB5A 4X62B 2JJMA 4KYIB 1ISFA 4OXYA 3PDUA 2PEYA 1XDZA 3IV6A 4TRJA 4H3HB 4REOA 3MMSA 5HG0A 4XQCA 4MKRA 4EKEA 3OQ1A 4MPTA 1VLHA 3B89A 3PFHA 3RT9A 3UK6A 3N8HA 3CF2A 4B5LA 2QY6A 3FYUB 2X9LA 2ATVA 2RGRA 1ADBA 3KXIA 2IHKA 2H1VA 4KSYA 5KYVA 3SZUA 1S2MA 2PZAA 1TYCA 5K6TA 5ALNA 4I9FA 3WYAA 4W82A 3MS2A 4JELA 2FR1A 1STOA 4OHCA 3RQIA 4D4JA 3DKIA 4BNVA 3TSWA 3FTDA 4L8YA 1HL7A 3G2MA 2QW0X 3BWMA 3WLKX 4G1CA 4BL5A 5AKEA 4JS0A 1NUSA 2P0AA 1N0WA 3NETA 3AOEA 3EXHC 5E8JA 3NHJA 5JAZA 2WUEA 1XDUA 2FOIA 2B7CA 3K5WA 3NHMA 4QULA 1GM5A 1RFGE 2AI1A 2P9FA 4CUKA 3D1JA 3WBKA 2JGNA 1XGKA 4CYMA 2XVXA 4BU1A 5C1BA 4TXNA 4L50A 1NONA 3E7PA 2JZCA 3BIWA 3DFUA 2MSWA 3DWIA 3MPOA 1X7WA 4NICA 4AZTA 4Z7QB 3SQXA 2ECKA 1VJ1A 2AZMA 1ZK0A 1DG1G 1SUBA 2XITA 3AHEA 2HA4A 4J4TA 1G9XA 4MYUA 2A0FA 2ZRJA 3OIUA 1RQXA 3KVNA 4MI6A 4WASA 1E5LA 4WBNF 1V11A 2JA1A 3DF9A 1N7IA 1SVSA 1K3UB 4ENWA 1SH7A 2DBZA 4GXNA 1JEYA 2X9GA 3I9LA 3KRTA 4AJ4A 2V0GA 1B4DA 3U7IA 5K09A 2A9RA 4C3OB 5JXHA 3ZJTA 5EP4A 4GH5A 4QQKA 4CLRA 3VA7A 1L5WA 3OPYA 2CGEA 2PH3A 3URKA 1U0SY 3NHZA 3OLYA 1W5SA 4CM7A 4E2YA 1Q3HA 4ENQA 3CNBA 3KWLA 2GM5A 3WYBA 3W4IA 4H3KB 5LWHA 1PKXA 4R8VA 1UBEA 5FNVF 3V2UA 5KKNB 3CUYA 2VS1A 4BGEA 4BRSA 3M3PA 4JCCA 1CERA 3AKEA 5B3KA 4ZU1X 1ENOA 1M8JA 2SHKA 3JQGA 4MS3B 4BO9A 4KXMA 3ZY3A 2Z57A 4U1RA 1BQ3A 3VNAA 1U7WA 3THWB 1AD2A 3KR1A 1L8QA 4BEJA 5JSFA 1RADA 2VTVA 5J1SB 1GPH1 4RLHA 4GOKA 4LZPA 5FAKA 1FP2A 3NHFA 4MINA 3VU3A 2PU5A 1Q21A 1QVRA 1M2VB 1OXUA 2J3EA 3BIOA 3LX5A 3KETA 1JHQA 1XDBA 1JU9A 4QDUA 4LYJA 1X1CA 1Q19A 5DISB 4PG5A 2ZJ4A 1VL5A 3ANNA 1JEQB 4RD1A 3ZU4A 2WWGA 3KO8A 1UOQA 1S2LA 2F9LA 3PUJA 3UM9A 1UBFA 4YCLA 3LQRA 1VLVA 4TVKA 1ENYA 1JT9A 2HWXA 2I4NA 4IDOA 4F21A 1W2WB 1GTVA 3IILA 3KM0A 4NEGA 1E2NA 4K05A 2GAAA 1WZEA 2F1RA 1EVIA 4JOCA 2L69A 2VAVA 4M99A 3LPDA 4Q34A 2OCXA 3C3PA 1GTZA 3RC8A 5CURA 5IC5A 3RYFB 5JWRA 4WLVA 4M0MA 4J0QA 3ANLA 4QWMA 2HUPA 3GFTA 2DFDA 5CW2A 5IT5A 1GQYA 3D3WB 1X9GA 3OOHA 3MAAC 1M1YE 1OMOA 5ULLA 3PSHA 1YB2A 4F46A 3I1IA 4DMKA 4AI6A 3MOSA 1HT1E 1T5TA 1CK4A 3IIIA 1NNSA 1I1OA 4PYRA 1ZUD1 4I4CA 4QXPA 2VWPA 2QTZA 2VAWA 1IAQA 2YWBA 4N8SA 4B3TB 3M9XA 3S99A 3KYCA 2VBCA 5EJ5A 2PZEA 5A03A 1CTQA 5AVJA 4AKGA 4RIHA 3DBRA 3WK7A 1I13A 3BYZA 2QMHA 1G17A 4BFSA 2DWCA 4J1QA 1DCFA 3ORRA 4Z49A 4YO8A 3TOCA 3ND9A 1HFEL 1JDPA 1D9XA 2IU3A 2VXYA 3LLSA 3ETLA 2D5CA 3D7SA 2DQ4A 1NMXA 5A02A 3BD6A 2II6A 4R9RA 1UPTA 1KEWA 4TLAA 3T06B 2QPTA 3GVIA 1OIWA 2QP9X 4YQYA 1ADYA 1AQIA 4A82A 1LQ2A 3CNHA 3D1LA 2CSUA 1PNTA 4BFXA 3NTXA 3W77A 4EI2A 5AJWA 4D9KA 4EYQA 4K1XA 1YRYE 1EA5A 1Q3KA 1WHTA 5J43A 1C1XB 2C7GA 3EE6A 2VNKA 4HEA1 1B74A 1WV0A 5DHRA 5EXSA 1Q7TA 3RV4A 1KE2A 5KNLA 1JJIA 1GADO 3FNBA 1WO8A 3SZRA 3QTLA 2WVGA 1DRJA 1V26A 2HC9A 4X93A 2VH5R 1EP3B 1ECGA 2ZOSA 5JSQA 3ES9A 5CYGA 5C51B 4GZMA 4TKMA 2E89A 4TMKA 3ZDXB 4EPXA 1GEEA 2CYBA 2FQ1A 5EIEA 4J8PA 2AXQA 2HSDA 1N5MA 4GVPA 4TZ6A 4H3VA 5DBGA 2GA8A 3HGQA 3M3HA 3HXLA 1Y6ZA 2F43B 1PQYA 2CMKA 1W36B 3G9TA 4IXTA 2Y9MB 2ZE8A 1T1SA 4Z1MD 3SHOA 2RHLA 1R0ZA 3AX6A 4LOKA 4ERXA 1R6VA 4DMFA 4F4UA 1XELA 4PZ0A 1O5TA 3PF8A 4MGIR 4KR6A 2P9GA 2BVNA 3G9XA 1P44A 2P5SA 3PRYA 4LMPA 2C4NA 3NV9A 5HA5A 4IIHA 4NL4H 4R3NA 3GPLA 1FRQA 1SC3A 1R0SA 2XNDD 3O8BA 5T41A 5KVQA 4M86A 4CT0A 1EUDB 1SBZA 5EJIA 3OG9A 4LJKA 2H4ZA 1VPVA 2R6FA 3GFSA 5I7FA 1U3WA 2B21A 4UBIA 4WE3A 1DC3A 3HLTA 3JR7A 3NBQA 5IM5A 4HLNA 3V7FA 2BHNA 3R5TA 2DHCA 2NU8A 1WUKS 4EM6A 1GSHA 2GA9A 1QMPA 3FPKA 4PXAA 4ZOQI 2H1RA 2W0MA 5CBPB 1WXIA 2IA5A 3U19A 4OB6A 3O03A 1YVRA 5E2AA 1J7KA 3BA1A 4O2BA 4Q16A 2HSWA 4FSHA 1L4FA 4CF7A 3LY7A 3NXSA 2G5CA 1BROA 4QTXA 5EE9A 1QS0A 1QTRA 5EZYF 3RI3A 3SKVA 1JIXA 5KTMA 2OKCA 4HTFA 4Q0MA 3J81k 2I9KA 4HBGA 2PUAA 2BFAA 2Z9BA 4F1KA 3EXIB 1K63A 2P6NA 5SZIA 1TGYA 1V71A 2QLTA 1HNZB 2CJWA 5HCUA 4GPTA 4A8JC 1ZMOA 1G1AA 2A33A 3V8QA 2HMVA 3EMDA 1UXJA 2HREA 3HYCA 3PGA1 1BS1A 1YULA 1J8MF 4PPGA 5T3UA 2WZBA 2DWOA 1IULA 1VGVA 5IUJC 4PR0A 2X5JO 2J59A 2QVGA 4BJ1A 1WZUA 3ZYZA 4GQBA 1Y33E 1AZLA 3TE6A 1GQQA 4Z99A 3HSSA 1OGIA 5BQOA 3I1YA 2JH3A 4RHYA 3W5DA 2XQFA 4LDNA 2XB4A 3RARA 5LD2C 3R9WA 2JLRA 2E85A 3HY3A 4FR2A 3W04A 2GNPA 1C8BA 2B0CA 4EMUA 1C0EA 1YR8A 4GUAA 1JS1X 1EE9A 4UCXA 1JNXX 4ABTA 4BLVA 4C0AC 1TW3A 5CEFA 1GTJ1 2JDIA 3DYIA 2XCTB 4MDYA 4UE6A 3V3KA 2YN0A 1SUWA 3P9SA 4PZPA 1K0UA 5DIFA 1E1RA 2OQIA 3OZSA 4JLUA 3JRWA 2RB5A 3S29A 1JIQA 1N8NA 2OCLA 4F97A 1J5PA 3VU8A 1JIIA 1V3VA 2MMGA 3ETHA 4F11A 4MDEA 3ANTA 4FOPA 4DC9A 4NR0A 4CDNA 1VKHA 4WSOA 1UBUS 1KJWA 4JEHA 2J3MA 2XQVA 2GPBA 4R81A 1J25A 1Y37A 2LE0A 3DW1X 2P6MA 5CLJA 5IUNC 1FZTA 2R97A 1BMQA 4A8JB 4AF7A 4I5FA 4I50F 3KPVA 4IFTA 4PYQA 3WICA 2LUOA 4D82A 5F7OA 5K3CA 1MA0A 1I6WA 2ZJYA 3IP9A 1I1HA 3R20A 4B75A 2GJ9A 3M1AA 4Q18A 1A50B 4YR7A 4C2UA 2I6FA 4JZKA 1GL6A 2P2SA 3KWJA 3F49S 3BFVA 3FOEC 3DDNA 121PA 1JA9A 2V7EA 4RY8A 5DULA 3R0ZA 4AJHA 1TYEB 3OE4A 1QO7A 1YZVA 1IJEA 1A71A 2AG1A 2MU1A 3MT7A 4JP3A 1PJ8A 2O1XA 1E59A 4R0VA 4ZQEA 3PXGA 4OQLA 2POCA 4BZPA 1IM5A 3HUEA 1YQUA 2FW7A 1V1JA 1GSAA 2VYCA 4KRGA 4PNPA 1AS3A 3BBPA 5JNSA 3LPNA 4ZREA 1PGQA 2F48A 3FCAA 4W5WA 1DO2A 1ZCZA 3BB4A 1CRPA 2BGGA 2E6UX 5ERXA 4IHAA 3KX2A 4IX9A 1K66A 5JSUA 4FYVA 2VRBA 4U39A 1K75A 1Q7RA 1R4AA 3M4NA 4JITA 5EE0A 4YT2A 1G6KA 1M7BA 1QP8A 2O1WA 2OCKA 3BCUA 4EJSB 3DVQX 4WV3A 3CWCA 4A1FA 3S1SA 2KYRA 3KXPA 1DQRA 4K6CA 5AM0A 2OK7A 5EVCA 1U2ZA 5BN5B 3V8EA 4D6YA 3C3DA 3OTGA 1XC7A 5JEEA 3H5TA 4PLVA 4QBKA 3FAKA 4JMLA 4ESVA 1E2EA 3FRJA 4OQZA 3T4XA 3RUHA 3LE8A 3O95A 3GT4A 3WFIA 1F8YA 1KXZA 4MLDA 2EP7A 5JWOA 4WQMA 1KO7A 1BS9A 1UC4B 2BEUB 4IXDA 3MD9A 1E4EB 2O07A 5LU8A 2UUPA 4DLZA 3PR2B 3P26A 1C9MA 1UKVY 5ESDA 2PX0A 1YHZA 3QF7A 3PQEA 1L7EA 721PA 3C16C 5AJVB 3INYA 4IIJF 4FHFA 3Q7IA 1Q1GA 3MMPA 3AF6A 2CDRA 3KKPA 4FDLA 3ZLUA 4IZIA 3UHPA 1M2VA 1J0DA 1V7CA 2O7NA 4LHEA 4OD0A 5H16A 4Z2YA 4CLRB 1MT3A 2OLKA 1L1RA 1SKAA 1T2NA 3RFCA 3CLSC 3QKRB 4L76A 5JR3A 4Y67A 1G9SA 1P9RA 3QITA 4XD7A 2FE4A 2ANBA 2BR5A 3R6DA 4MKHA 6ABPA 1Y1RA 2G71A 4N03A 1EUQA 1HH4A 1WE2A 2PV7A 1G5HA 4NU0A 2DKNA 2H4FA 1E5TA 2BSAA 2G17A 4QLOA 2NU9B 5JYCA 4R40A 1Z2DA 4P4LA 4PW0A 4HZUA 5IBPA 3KOUA 4BP9A 5D87A 1DDIA 1S4QA 2PS3A 4BNIA 4NDAA 1L7MA 5BW5A 3IKTA 5THXA 3E22B 2DLCX 2CD7A 4B47A 1XEXA 1P1FA 3CH4B 4Z4FA 3UAYA 2VHWA 4X45A 3WL8A 3PUIA 5IN4A 2XZPA 3ECAA 1GHTA 3EEYA 4FGZA 5DTRA 3ZCUA 1DJPA 3K09C 4QBTA 2CYCA 4KOEC 4I9UA 3UFXB 5KOIA 1EH5A 1VA5A 3F67A 4HJRA 3I4CA 1N2JA 4W5HA 1P0MA 1Y3IA 2FUCA 2X40A 1Z0IA 1OBVA 2ODEA 3E8XA 3GWZA 3EEOA 2AQHA 4FQ5A 3UV6A 4DMCA 1KZ7B 3OEYA 4Q24A 1I3MA 3NONA 2ETXA 4IILA 5FCDA 2Z9DA 1XZHA 3DE4X 4ROSA 5DBIA 2WLSA 3SC6A 5IFKA 2I0FA 3P96A 2ZB2A 5LU9A 3K1TA 3ZWXA 2W6NA 4EG5A 1HL3A 2C4TA 5BVHA 5ETJA 4GNKA 4LVCA 1UPFA 5L6MB 1SUEA 1T4CA 2HEIA 4BIMA 3OZRA 3A6GA 3G8BA 3IDZA 5ICCA 5LQKA 2CXNA 3PCTA 2HJRA 4Y2SA 4Z4QA 2RHDA 1GD1O 3RTAA 4B35A 3PT9A 2O14A 4WAUA 3NFYA 4Z7NB 3L6BA 3HLYA 2O2DA 2CXXA 2VJKA 4Q4LA 3R5KA 5TF4A 1N3IA 1N2GA 4QFMA 3KKLA 1U3DA 2YVAA 1Z25A 3WZ2A 2EWMA 1FJXA 2IE0A 1N6KA 2B9VA 2D13A 2D1QA 4HN4B 1OT3A 4D0SA 4P33A 4NPHA 4RHUA 2Y1XA 4B2PA 5FAXA 1FS5A 3GGJA 3X44A 4GDFA 3I32A 4RV9A 2FN8A 1J0EA 2VIIA 3FNFA 3P9QA 4EHBA 4EUFA 4KODA 4I9HA 3L0SA 2XGOA 3DHYA 2FNAA 3IULA 2UYGA 4C3UA 4Q3OA 1N5LA 2ID8A 2QZSA 5HFNA 2YWFA 1L5MA 4C07A 4ESOA 2HAEA 2B8WA 1TM7E 2EEZA 4PGHA 1ZH8A 1M1UA 4RZSA 3BCRA 4UFOA 3KTOA 4OP1A 1ZO8A 3QM1A 2VJLA 4BRWA 2EW1A 1OTYA 5EP3A 1FFXB 1VHLA 2N42A 3PKJA 3SCZA 1AHIA 2VHUA 1QC5B 3U3KA 1R0LA 2GRUA 2ZI4A 3IR6A 1KY5A 4D8TA 1EFVA 5JCJD 1X1QA 3E7XA 3S5JA 1QK5A 3C7TA 2ZIWB 2EBUA 2YNMD 3WLHA 3IAXA 3MT8A 2BFFB 5AESA 2CXTA 1TCBA 3GAFA 2CNOA 3INTA 3OZEA 1A95A 4NPAA 4OP3A 1HSZA 4IWYA 1RQ2A 5KEIA 1I33A 1L5ZA 2HIGA 3G0IA 4RKQA 2XGMA 5GVSA 3CF4G 3GJXC 5KDLA 4OGKA 2HQSA 1OU4A 1UOEA 3NYWA 4WESA 3ZWNA 1V8BA 4LMRA 2L42A 2HEGA 4EVQA 4XRRA 1ABEA 5AMXA 1Z8NA 4QEZA 1F3LA 3V7YA 3T52A 2D2XA 2WMNB 3HI4A 2BR4A 2Y76A 2MYTA 3H75A 1M8FA 1ZW6A 3QQ5A 4WBXC 5JZMA 1ZCFA 4MS4B 4EW2A 1S8FA 1MBZA 1C0KA 3PC4A 5IM4F 5BXQC 1NL3A 3UHAA 3K0CC 3QMWA 4Q3AA 1JB1A 4QBGB 1KQOA 1LBTA 3A3NA 4XIFA 4C03A 1ZR4A 1JPVA 4FGLA 4UUMA 1F9AA 3STTA 4H2DA 3T0FA 1CB0A 4UMVA 1V35A 4BKOA 1ZD9A 1X80A 3M6FA 1G8FA 1IG0A 1QR2A 4GMXA 1QOPB 1R9GA 1SMKA 1SVIA 2OR3A 1KTVA 1GT91 2GTIA 4DJFC 5FI1B 4RF4A 3PPVA 4HXFB 2I7XA 4ND3A 3D59A 3F3YA 4V38A 4X20A 4DV2B 1J07A 3HR4A 2O54A 2AEJA 4FYYA 2DETA 3E1GA 5J2UF 3L6CA 4JQCA 1ES9A 3KKMA 1HV8A 2FX3A 1Y89A 3P9CA 1YKFA 4ZCIA 3K70C 3EA0A 3MGGA 4DDHA 3C3BA 2JFHA 5CX1A 4V02A 2GX6A 4E5VA 4MVJF 3ZHOA 2ERXA 3BC1A 4I19A 3KE8A 1DAHA 4RH0A 3QXJA 4JC4A 4BATA 5LQMA 2H7CA 3U6BA 1NW4A 5JJBA 3CX7A 5G4LA 4XIJA 3ZXIA 2W2XA 3ZI0A 1UBMS 3CZ4A 4L4RA 1BN7A 4LDZA 4C7XA 1XJ0A 1VGQA 4YRAA 2QWXA 3QFSA 4W5OA 1N92A 5AJTA 5ECDA 1HBJA 3L7JA 4C0WA 1KMNA 2JLQA 2PNJA 3E2PA 2IYTA 2QJWA 2FLVA 3CH5A 3O75A 1MKYA 3F4KA 2I4LA 3CV3A 5DFAA 2AFIB 1XI2A 2EGUA 3C3AA 2CE2X 2GEFA 4B34A 2W42A 4KUGA 4M8LA 4LW8A 3R3JA 4RD4A 2BWJA 3L1JA 4F84A 1RHRA 3UOGA 2IXDA 3EGXA 3BKWA 1GDHA 2C2GA 5DYWA 3IXMA 2B1JA 4NZYA 1LI7A 3OFNA 1N34B 5LD2B 3UA3A 3AR8A 3K2EA 4QFBA 3T61A 1ICIA 1BEZA 2QLLA 1K2WA 3HH8A 4WL0A 2XRMA 4Q01A 4LY6A 4B3HA 1E92A 5FLXA 2AX4A 1I7LA 4C76A 5BMVA 1YMQA 1AUPA 1YH3A 1S2GA 3QV1A 4W7IA 3C3JA 3UHFA 4I9NA 2VT7A 1WMDA 3LGSA 3OT4A 1JJVA 3H2YA 3JQAD 3PKIA 1N3LA 1OBCA 3JYNA 4R1PA 1ZIXA 3GG2A 3ISVA 3A9VA 1V1MA 1TA0A 3ZE1B 3ZV3A 1L9XA 5BOSB 5I9MA 1K86A 4RTMA 2ZIUB 3L82B 4PSDA 1XZQA 3NBXX 4HVAA 3DTVA 4QPZA 1KDRA 2NT3A 5EOVA 3U3XA 6GPBA 1BU8A 1VDZA 2HFJA 1NQVA 1GU1A 3EAFA 3M4YA 3RRJA 3TB6A 2E6KA 4D3ZA 5FLEX 1EUZA 4ML3A 2WI8A 3DV0A 3GUYA 5BVGA 1OWNA 3GDFA 3OLZA 1JLKA 1PDWA 4FZJA 4TYQA 5JISA 4BAZA 2MYPA 2GBCA 4GXTA 2CK3D 1Y5MA 2ICAA 4D4GA 2VPZA 4YCMA 1F6DA 1Y3BE 2RHRA 3ELDA 1KO4A 2C83A 1JQAA 2X7HA 2DKOA 1GKIA 1SU8A 3IEUA 4HDKA 1TTTA 4TTTS 4PZZA 3DOEA 3A1NA 4CL3A 1OLUA 3NIWA 4YAOA 1X8JA 3VH1A 1MV5A 2R60A 3DVAB 4HEJA 3VHXA 2BTQA 3B1YA 3WJ7A 1HEYA 3TYXA 1Y9EA 1V25A 4DPMA 4QNRA 1RC8A 1CR6A 4R9NA 1UDRA 4BYMA 2QTCA 3DTNA 4JH0A 3H5AA 4Q9LA 1T9HA 5ARCA 1LSSA 3ZJ5A 4YRMA 3V1NA 5DYNA 5ADHA 4CDGA 3J7AC 5JE8A 1WDMA 4EUSA 2A1IA 4UMDA 2ONZA 4OY3A 5JBQA 4JI0B 2E0IA 4B45A 2A9KA 5BVGB 2VF4X 4EBFA 3NHWA 1C80A 1W88A 2EERA 3O3CA 4L07A 2FZWA 1I32A 5F5LA 1BAPA 3VC2A 5CVCA 3ZGNA 4EKDA 1VZ3A 4H9GA 5CCBA 3VYTB 2ANCA 2QTRA 5IH7A 4OMUA 5JXGA 4W9MC 3AUUA 1ZJ5A 3MUFA 3H5OA 1G5QA 4ZK6A 4QJ4A 5DNVA 2HMAA 3MWGA 3R7BA 4ESHA 4CCYB 4HR7A 1RPNA 3TECE 3Q87B 5CDHA 4UE3S 1JHDA 4YLEA 2X0JA 4O63O 5FFMA 5KNDA 2JCGA 1KZ1A 1PN3A 2G80A 3ZDZB 3N8IA 3D2LA 4O4IA 4OLHA 4FEEA 5E6UB 2D4HA 2NV0A 2R9VA 3Q85A 4MQFB 4P81A 4GICA 4ZAFA 5HDQA 5I3ZA 1JDSA 5LXTA 4L08A 1CT9A 1WDKA 2W48A 3EQ9A 2CCKA 1F2DA 1GJRA 1LA2A 4NXNB 5BUCA 4OL0A 1R8XA 2FP3A 4Y7CA 2IXGA 3VZPA 1GRQA 3OX2A 1ATZA 4TYWA 2OHJA 2Q3EA 4RL6A 4A6EA 2O7RA 2QNRA 2J30A 4EGSA 3T3OA 5LKRA 2XMSA 3AEZA 3DAPA 3WL4A 1NI3A 4EG3A 5JDIC 3OH8A 5AM2A 3V80A 4H0NA 3W5JA 1CZHA 1NVWQ 4DABA 3D4LA 4PPYA 5EXPA 3BHNA 2YQ5A 1Y9DA 3GNTA 1CDEA 1LPNA 3B1JA 5I47A 4G1FA 2ZR9A 3M9LA 1RP1A 5LIPA 1GPNA 3ZCSA 4XDHA 4KU4A 5KMGB 4CMEC 4ER3A 5REQB 1YDWA 4LSGA 3GQBA 1Y81A 3QUTA 2OFXA 1YC2A 1VYUA 2OG2A 3FE2A 1DXYA 4PPFA 4RZQA 2H1HA 2IV3A 1M2EA 2HB6A 2H1FA 3NJRA 1LY1A 4C7VA 1K27A 5KMGA 4YCDA 2ZM5A 3F2VA 2DWQA 1F06A 4WVFA 5C5CA 3JQBA 2C7PA 4FDUA 4R05A 5AKIA 5BV8A 1H9BA 1JX6A 2DCUA 4HVCA 1X13A 4XSGA 1SCNE 1PBNA 3JAKA 3ZDFA 1G291 4EY3A 2M6RA 2C3OA 3CPJB 2AC7A 3ITDA 5EYPA 2FQWA 1OHHD 1TECE 3I04M 3M2TA 1FFXA 4QL3A 4EPRA 1CLEA 2ORYA 3H4IA 4E5DA 3QGMA 4JFAA 1IOZA 4KVGA 1PVDA 4HF7A 3UMBA 1KTIA 1DNPA 1XZAA 3NBZC 3U4IA 2PVCA 3OMLA 3E3AA 3QFHA 4LVUA 4NU5A 1MMFB 2OGUA 2VYFA 4WACA 1XQ1A 2H63A 2QKYA 3R3YA 3BUSA 4NG5A 3ER6A 4B3FX 1OR8A 4W9NA 1NDQA 1XTTA 3ZDEA 5A04A 3L8CA 4ZO9A 2J0UA 2WHYA 3W8NA 3IP5A 2NQ2C 3I9V6 4CF5A 1T4CB 4HYTA 4C9BA 1CVLA 2ZQ5A 3I3OA 4BVAA 1IM2A 2CL5A 4COKA 3BXFA 5IDXA 4YMUA 1UEJA 2BMEA 3DAHA 5TEVA 4BN4A 4M36A 5FBHA 1JN0A 4U6SA 5U4QA 3SS9X 4TV9A 5JZSA 5BSHA 5H9WA 3QXGA 5BYJA 3B9BA 1HI9A 4RU1A 5FBRB 4L8VA 4MB0A 4ZVTA 3VR3D 2JIRA 2XE4A 3DMHA 3QK7A 4S1TA 3VU1A 2EYUA 4JBXA 3ENNA 1ESEA 1AV7A 4KIFA 4HDMA 4Y6LA 2OQVA 1U02A 3CVWA 1FNDA 2BFBA 2QOEA 2C8LA 4P08A 1ZUNA 1FTGA 4KYTA 5EKTA 4MXDA 1SXIA 4E12A 2Q2VA 3UJAA 3MCVA 1DC6A 4Q1BA 3UAWA 2B4KA 3P71T 4DGQA 1VA4A 5DI3B 4L9RA 4CN9A 4XWOA 1MO6A 3RK4A 3DEIA 3T1QA 5HQJA 2HV9A 5JJIA 3FF1A 4BFVA 3RUIA 1UJ4A 2QLJA 5LKAA 3H9UA 3H5NA 3B1WA 3TQHA 4PS1A 1WD7A 2QRMA 2W4IA 2O8CB 2YMQA 1R0BA 3PWKA 5E9WA 1N78A 2IYNA 4AO6A 3OD5A 4V24A 4LFCB 3WK8A 2ST1A 1W5BA 3ILYA 3IMCA 2XXAA 1A5TA 1QHSA 1CU1A 3HCNA 1GL9B 4RUKA 3UC9A 4AZ3A 1PGPA 4CIVA 2Y0DA 5ALTA 5KQLA 1TUEA 3HCEA 3FR7A 4AP6A 5B7QA 1A1VA 3TR5A 2IYYA 5BRJA 1U9CA 1YUBA 4EUKA 1W46A 3VPBA 2WIDA 1QQBA 3B6KA 3QVTA 5J2TA 3P5SA 2G83A 4YJGB 1J97A 2H51A 3LS2A 4GKKB 4KWEA 3U2QA 4H7PA 1NBEA 2PKCA 3UMVA 1Q1QA 3NDIA 4O6VA 4OJNA 4Z5XA 4YUAA 5T8KA 1YZYA 3O9ZA 4Q4JB 1VL8A 4WXMA 4B81A 3K73O 4ZKEA 4B71A 3W9BA 3GHYA 5B4VA 5D01A 5KYUA 4AZVA 2MSKA 2W98A 2DERA 3ET4A 1EFKA 4RFSA 3K2BA 3K1AB 1V7PC 2CNWA 3AL2A 5HS6A 1GLGA 1NJ6A 3AV0B 4JL8A 2HWKA 2O2IA 5A7HA 1KYVA 4FZ5A 5D3MA 1CF9A 2C2BA 1GL7A 4PNZA 3T1NA 4D9HA 4KPFC 1LBIA 1KYWA 3LHKA 3I5YA 4IKOA 1MD9A 5IUKC 2IOFA 1K8XB 2R8YA 1TKBA 4YIHA 3KSAC 3U7GA 4HFRA 4DWOA 2OV8A 4INZA 1XLUA 2O7SA 1F0PA 1RMQA 2JIQA 5DWVA 3SQMA 2QM3A 3N8GA 2G0AA 4YP5A 3W5IA 2CXOA 2J0VA 4LKRA 1HG1A 3EJWA 3A6EA 1ZUWA 4GLBA 1KEZA 1ZOIA 2OQ2A 1IRXA 3K9BA 5SY6A 1YDHA 1II0A 4BPRA 4FMBB 2PPVA 4QPCA 4QODA 2PGIA 1NI4A 2IIBA 1C9KA 2V65A 1FF9A 3EVFA 3PXXA 4YWHA 4XX0B 3ZWQA 4BMPB 1CJCA 4AQDA 3LBNA 4HX9A 4D0NA 2IUTA 1KL7A 1RC1A 2NVUB 2GLUA 1GGMA 2QJRA 2GEUA 3A2LA 3NP9A 4DW8A 2AFIA 3UUWA 2JLYA 3DM5A 3GELA 2ATXA 4FE7A 2YV2A 2RHMA 4Y0NA 1RPTA 2HJ9A 4P34A 5KSOA 2WYUA 3F8SA 3GDHA 4J7CA 4E3WA 1UPAA 2RDMA 1LWOA 4JJAA 1FLAA 2I6GA 3C0KA 4G37A 3O4IA 3K9LA 3P4YA 2CLIB 3V4ZA 3MUNA 4ENUA 4LY9A 4L28A 3IUJA 1QIKA 3T7CA 1XQYA 2XMRA 4EMTA 1NZFA 1QDEA 1QOZA 1Y3AA 2V6BA 4KAJA 7AT1A 2ISQA 2FN9A 4G0ZA 3UMJA 3WSWA 3DOIA 2JFFA 2VF8A 3COPA 3WKCA 1X19A 4HEA6 1OXKB 2R85A 1V0JA 4YMHA 1I3KA 1FYWA 2BFCA 3MVEA 4ZYUA 1FBNA 1FX0A 2QLNA 3H7AA 1NMYA 5DGXA 3K71B 2DPYA 3ERCA 4H0CA 3BRWA 3WGVA 1KEEB 4RFLA 5LB4A 1B6GA 1OFHA 1E4EA 4K03A 3AVPA 3P2YA 2IV2X 5PGMA 4MRAA 5EJ4A 2AR9A 1WNFA 3E05A 3GOQA 2B1IA 1HDYA 4ZARA 3QYFA 1PFKA 1MCZA 1HRDA 1R4MB 5C5EA 5AVZA 1KEKA 5IRCD 3WGHA 2IYOA 3UATA 3R7WB 3F90A 1GQOA 4A5OA 1BCRA 2V3CC 1VMIA 3R0QA 1KQ3A 2QVZX 1G19A 2HA2A 4GEKA 1Z83A 3RUPA 1WKBA 5BN5A 5KDOA 3TGPA 3OZBA 3BMNA 3QW4B 4D0GA 2PQMA 3FSEA 1T24A 2V03A 3O7WA 5CVEA 2NUTA 2XCSB 1G4AE 2G25A 1XU7A 4GVXA 4CE6A 4Y9SA 1LW7A 5AHKA 3ZWPA 4WH0A 4RTPA 5EXTA 3HMQA 3DZGA 4TWBA 4Q9KA 4K6FA 2XTJA 3GJ5A 1FNSA 2GD1O 3PB3A 4MPJA 2YS7A 1C7FA 3U9LA 4E11A 1NTRA 2LZ0A 4MV3A 2C0CA 1G18A 2E4XA 2WF9A 1KJJA 5HX7A 4BB5A 3K2QA 4P38A 4YLYA 2IDJA 3HB7A 3DG9A 3EZ6A 5E6SA 4QOHA 5LZ9A 3WRYA 4IVRA 3MJRA 1IPFA 4MJ3A 4IWNA 5DV9A 5KPDA 1YO6A 1X0VA 2Q2QA 4KL8S 4P80A 1USVA 2R8BA 4JLVA 3ACDA 2GD2A 1AQYA 1WVMA 2GNOA 1XZBA 3ZCVA 5EJ8A 4ZT5A 2QRVB 2WE8A 1DX4A 2P1RA 1CETA 4MRNA 1NVTA 1J33A 1O08A 3QLEA 3RAJA 1VKRA 1OVGA 2XW6A 5KOYA 4W5RA 2EF1A 2PGOA 4RVOA 1PUJA 1UDBA 4MWOA 4TYNA 5CJJA 4WHMA 4H7KA 4HFMA 5KYTA 4BNZA 1JBKA 1TJNA 3WDSA 4CN8A 1Z5VA 3IV7A 1MNQA 2EHDA 4KNWA 2YW9A 3JARA 1JA0A 3C7CB 4HTAA 2IU6A 1Q5PA 4JCOA 3FZNA 5T57A 1WUIS 3Q6IA 5EYPB 2B69A 5A3VA 3N0VA 3W8RA 3HV2A 4IOMA 4P0TA 4LNHA 1T8YA 2Z6VA 3GZNA 4Z0HO 2EDAA 4IKEA 5EWJB 4NNJA 4C06A 1IFXA 4JQZA 2X4GA 2EJUA 1JAYA 3T5MA 3SF0A 3WLNA 1EBFA 3IQIX 5GADl 5K3FB 1ZJWA 1MH1A 4W8OA 5JNVA 2IKQA 4OHWA 4TGLA 3TKAA 3EFEA 4RVCA 5IASA 3FGPA 1KI7A 3USCS 1TQDA 2KBFA 1TRKA 3VYVA 1O94D 1Y7PA 4NFLA 3EZXA 2W43A 5CFPA 3OLVA 1E0SA 8LDHA 3RRBA 3E9QA 3PDIA 3QOYA 3KJHA 1E3EA 1MHPA 1N0IA 3QFFA 4M0EA 4U7HA 1QZTA 3RREA 1Z26A 2OG1A 4CIAA 4KQKA 1TGVA 2WJZB 3QVXA 4I5DA 3EDOA 1PDVA 3C43A 3KLBA 4G67A 2E82A 2JJ1A 3UY4A 3K09A 1PJRA 3PDHA 1RMTA 2CHFA 3Q15C 4K3UA 5BSKA 4FTWA 1U0NA 1U7PA 3D3WA 5LMUB 2ZTSA 2PMDA 3GDWA 3IS3A 1R8QA 4UU8A 2CNBA 4LYHA 1AUVA 4FHDA 3U0BA 1YU6A 3K70B 1RXUA 1S02A 2O8DA 1GO2A 5BNZA 5DM4A 3BAFA 4S0XA 4WRRA 4XGNA 1O6CA 1P61B 4DZRA 1E2KA 4RVHA 4Y2HA 2ES4A 5AW4A 3AF5A 2NVOA 4U2FA 3COVA 1P45A 1S9HA 4EWLA 2I3ZA 4DSTA 3VR4H 2NO4A 1AKTA 3L4EA 4TWAA 1GG2A 2IZOA 1CR1A 3MM4A 4JB8A 3MRTA 1II8A 2Z2XA 2GCEA 4P4NA 3U7RA 5B12A 2WZCA 1HZZC 1Y8ZA 5EWMB 1C7RA 2FXIA 2QVXX 2M6KA 5IZCC 2O19A 4W5QA 4R7TA 1KBZA 3PIRA 3R5XA 4RKRA 2A0WA 3B52X 5DHAA 4URYR 2BTEA 4A2WA 3NHPA 1FDOA 5H82A 5C8YF 3PEVA 5H83A 4IMPA 4B3IA 5GONB 2D8AA 4JBHA 2OXCA 2RH5A 5JS2A 5JAIA 1ST2A 2O3RA 1Q0RA 3AW8A 3IA7A 2B4TO 3G5MA 3KUUA 2JIZD 5ECGC 2BKAA 1DBQA 1F4VA 1NNLA 2NU9A 2QQGA 4AICA 3ZI4A 4RPLA 5KVVA 5F9HA 4UAVA 3F2IA 3NYRA 5HCIA 5IMSA 1R5BA 1VIDA 2OO5A 1ZEJA 3OCWA 3FHOA 2ZVPX 4P7KA 1DT5A 1P77A 1DT3A 1ID8A 1UMDB 1SPXA 2FSSA 2PSHA 2EFDB 2H8KA 1SQ6A 2ZYGA 2AOTA 1RJ9B 3QVMA 4FWIB 5KX5B 1XNHA 3RAGA 4PSKA 2A0UA 1YXMA 1T2DA 3UANA 1QO9A 3JZAA 4URXR 1K8RA 7REQA 1KDTA 2BBWA 4F2GA 3B6EA 4EUHA 1BZYA 2Y1CA 2G5TA 4UAUA 4BMNA 5LQRA 2JFXA 1XXHE 4TYMA 5I8ZA 2YBEA 4MA0A 1QF6A 3N74A 3HN6A 3P19A 4LJ7A 4X1IB 3RVKA 3W90A 4DA8A 3GRPA 2OC9A 4MV9A 2BGJA 2Z8XA 3H1AA 3LYLA 2R96A 1H2YA 4FGUA 4YYEA 1EGMB 1G6Q1 2AWOA 1M0TA 4OF4A 1WPXA 2I99A 1LTHR 4Y1GA 1FYFA 1WB6A 3ZNQA 1T2AA 1YZTA 7ADHA 3PV0A 3NHAA 4EGJA 3LU1A 4IUBS 1G64A 1U0RA 1GGVA 3MGCA 1EVQA 5KTYA 2O20A 4EJMA 2GEDA 3CC8A 1JLRA 3LOPA 4RF3A 4URWR 4JYMA 1Z6AA 1C4KA 1NWHA 2IVZA 4K9LA 3T4EA 1O4WA 3N7AA 3HEBA 2AWNA 3LT5A 4AZ3B 5SZKB 3D7KA 4PZYA 2OE2A 2FPSA 2IEZA 1YR6A 4L3WA 4WESB 2PUDA 3UJ8A 2W2MA 3D3EA 5EXDA 4K6KA 1K6MA 1ULBA 5LNK6 1JAXA 5JW6A 1ZHOA 1RAFA 2VTKA 3ZOZA 2E4VA 2R7KA 2OBXA 5DNEA 5IDQA 5J4YA 1XZKA 3L8MA 5CP8A 3EFOA 2P4EA 1G8AA 3U16A 4J4BA 1UXHA 4KX3A 1WIWA 3K0KA 3K4PA 5JI3E 5DF1A 4L9AA 3VR5A 3I76A 3GJSA 2UU9B 1DXHA 3PSAA 4FFWA 4RJKA 2EF0A 3BBLA 5TJ9A 1E1KA 4MVJA 4D4KA 3GT7A 2DPHA 3QXXA 3GWGA 1ZD2P 2ZWOA 3IBFA 4GI5A 1JH8A 3OIYA 1FL9A 2PBFA 1V16B 3FSJX 2IYUA 3AGQA 1GRNA 5P21A 3PCXA 4K9NA 1ZMRA 2A88A 2QAIA 1X1SA 2WTAA 4UM8B 1H4SA 3ONWA 1FA9A 4DBLC 1LKZA 1WY7A 2PUTA 3O31A 1OILA 4FD2A 2AKYA 1W9HA 1YQDA 1T4DA 2APJA 4MLZA 1MC8A 1ITZA 1JB9A 1VL6A 4MTCA 1DUVG 6Q21A 3TZQA 4D9CA 5AW7A 3EGCA 2A6PA 2GUWA 2R2AA 4FILA 1X86B 3VFDA 4YWJA 2CYAA 3IDAA 4ALMA 5HOQA 4EQ6B 4V2IA 2AG0A 4WKGA 2GRJA 1KH3A 4PGFA 1KFCB 2WTMA 4HQNA 4V0OA 4YRZA 5I5EA 4KQHA 1V47A 1P0QA 1PSWA 2C99A 5IU6A 3KOMA 1CP3A 2J7PD 3H9QA 3PXDA 5FTWA 3U7HB 4IVQA 3S8YA 2C5LA 2PL5A 1QZUA 3SNHA 5JOQA 4LNUB 2QM0A 3WMWA 4AM8A 2LKCA 3U49A 3CQ9A 4GE3A 4YGXB 3D7MA 3ZK7A 2J87A 4LJYA 1CUXA 2A9OA 2RBKA 3ZJVA 1HE1C 3O47A 1V2HE 1S3SA 2CUTA 2OHGA 3JSXA 2XWBF 5AKGA 3RU9A 3TDKA 1EX1A 1IZ8A 1YS9A 3OPQA 4L1KA 3N6VA 2WUFA 4GYWA 4LBYA 3RFVA 1U3VA 1FUYB 3FJOA 4QATA 4ZPXA 4MX8A 4NK5A 1I5RA 2I6UA 1CIVA 3AI3A 1IQUA 4LHVA 4ND4A 3BULA 4HAWA 1HMPA 1X94A 2JBWA 5KI6A 5FQNA 4MYDA 3FSGD 2HRCA 4E5KA 5ALLA 5HQ3A 3LVRE 4KLRA 2C7VA 4WUVA 4NS1A 2NUPA 3HG7A 3PXUA 1SO8A 3NWBA 1DPGA 1PT7A 1A27A 2OSVA 3BE4A 4K6GA 3H3FA 3W5BA 5YASA 1FDVA 2HBYA 3D8TA 4Y6SA 3ANXA 3QENA 4DLSA 1QJCA 2DEUA 5I8PA 1KIAA 3U48A 4D3DA 1I6LA 1E1YA 4ENSA 2UUBB 5E8RA 3ZD6A 3KYBA 5KZMB 4WTOA 5I7HA 3MB8A 2OHVA 5JSZA 3NVKI 1PEYA 4RA6A 5CB0A 4K8RB 4F60A 2B4YA 2OV3A 3AIIA 1NN1A 1UKYA 1JQ3A 1KGSA 3UUFA 1JR6A 1RHJA 4E2WA 3FBTA 2WHQA 5BN4A 3N2GB 3O8CA 3CF6R 4NCKA 4KXYA 1PP4A 4HQKA 3B6JA 4QDTA 3Q3CA 5CFQA 3O2QB 2PIAA 1YVPA 3ESBA 4KUHA 1T10A 4R9UC 2H7YA 5BN4B 3RVJA 5LQJA 4YP6A 4UUAA 2Q3CA 3ONEA 1E9CA 2HCJB 3SHQA 1SCIA 4II3A 1NUPA 2YMLA 5DHTA 1XQ6A 2IYPA 2HMUA 4NHEA 1NKTA 3VX4A 5LXTF 1TUGA 3HRHA 3QZUA 4FFLA 2QD2A 4G1VA 1KC1A 3G2IA 4FCVA 3GCWA 3GRYA 5H7XA 4IF4A 4UHJA 3T0IA 1O89A 2CEAA 2GCOB 1XX6A 5KYYA 1DKNA 1XJWA 4ITRC 4MR8A 2OBYA 1U9IC 2O0JA 4LDRA 2DLDA 1F48A 4IJMA 4NV3A 4YDSA 4OXKA 4AJ1A 5B6JA 5HKKD 2IE8A 4YJ3F 2ZRPA 5ISMA 2E4UA 3I2JA 3HGTA 4IIYA 1S7GA 4MJXA 3OZDA 4QQRA 4BO4A 3WC4A 1ELOA 1VKOA 1YCGA 1CDZA 2YXEA 1WXFA 1N6PA 4PNHA 1WBDA 1D07A 1P7CA 2VDKB 3IOMA 4G2NA 4BGUA 1UIMA 2GASA 1NUHA 2OOKA 3CLUC 3ECCA 1SR8A 1FP1D 3Q12A 4EHJA 4J07A 1U7XA 3GJ3A 4ME6A 5TQ2B 3V1KA 4IPTA 5KYGA 1XRMA 4K9PA 4RTSA 2XXBA 4MKIA 5B58C 4H6XA 3ZD9A 1H4QA 4IFIA 1UJNA 2Q0HA 3R41A 5E7MA 5IBRA 4DNXA 4ZP1A 4K2HA 5INTA 1PG0A 4PHFA 1OX5A 4CGYA 4ZALA 1AUXA 3MAGA 5I7OA 2ZM6B 3L92A 4AT1A 1OLXB 3U39A 3LYAA 4JUIA 4D4LA 2BBSA 4J3NA 5AVXA 1RPJA 3FVVA 3ZHQA 5JQWA 3HL0A 1B3RA 3A4LA 3C3MA 3CVVA 3MWEB 4PHTA 3ESXA 4NJOA 2XI4A 1P80A 1D8TA 1HOTA 3OT5A 4X84A 1Q14A 1C14A 3BQ9A 4B76A 5IBQA 4KPUB 4CTJA 3VAAA 3WHLA 4X94A 5KYKA 2EWWA 1EXDA 3UJ7A 4C29A 4HO1X 1BHO1 2IPOA 5F78A 2C2YA 2BHRA 1L3BA 3R23A 2ZXEA 4QSHA 1BMFD 1UKAA 4G6ZA 5DXJA 3RG2A 4D97A 2F4VB 1D5WA 1W0JD 4P3OA 1IBKB 2Y0CA 3ZE2B 4P82A 5E6UA 1CYDA 1G7TA 3COZA 3GYGA 2LBPA 3KAJA 4DV5B 4RKFA 2YNMC 4B8WA 3DLTA 3ZBTA 2WG1A 1LVUA 3KVRA 3ZWDA 2IBSA 3H0CA 1IBSA 5IHXA 4EL0A 5BOSA 3RPEA 1CRWG 1XROA 2J08A 3HXKA 1QYRA 1ZDMA 2QJTA 2YHAA 4OIMA 3KVVA 1WB5A 3ZLVA 4BBJA 2ZRBA 4EG8A 4YRNA 3DMRA 3V9PA 3MCWA 1Z6XA 2W6QA 1IBCA 3OPNA 1QCCA 3ANSA 4IWXA 3D2BA 2A94A 2E5WA 4AS2A 1GZ4A 2PMKA 3I0NA 4IDPA 1A3CA 3HZOA 3KKKA 2O2XA 4QYIA 3C3XA 5COBA 3SGLA 1LFAA 2C92A 5KYWA 2PZBA 2PJZA 4KXLA 2K5UA 3L0IB 4RKEA 2RKWA 4TTVA 2EKQA 3WE7A 3FTPA 4DLVA 2JFPA 3LUHA 3BXPA 5A0TA 2Z2ZA 4NOJA 4QHSA 4X3OA 3EF1A 2EGGA 1HORA 3TGWA 3KDSE 4KRXA 3BAZA 3O8DA 3E9CA 4IHJF 4L75A 5E4JA 2MWMA 4MYTA 1PI3A 1RI1A 5GV7A 4XLLA 2DMRA 1IN8A 2CVZA 1PHPA 4DSOA 1LXCA 2YFKA 3HBFA 3H1BA 2DU8A 4A0GA 1L7VC 2ECFA 5AI4A 1VFNA 5TSDA 1KBOA 4KLCA 3ZH9B 3WQHA 2RGDA 3DKPA 2C1ZA 1DSSG 1GNSA 1UP7A 1VCHA 2JFNA 4WJKB 4XASA 5EE3A 2PWYA 3L79A 3KWFA 5FR2A 3I04A 4Y7DA 2C2OA 2JGAA 2QGZA 3MK31 1R6DA 2H2IA 4CV2A 2RI0A 3D7RA 3AR6A 3Q9LA 1LQUA 4FFOA 5G40A 1UZNA 5K2MA 3B2NA 4Y9DA 5EHXA 4KB5A 3B1ZA 1W96A 2UVPB 4F06A 2C7QA 2JCBA 4IQ0A 2QD4A 3AZQA 5GV8A 2L2QA 2O0HA 2GVDC 4X8HA 1IL0A 1NJ5A 1J5XA 2ZS8A 1JZTA 3THSA 3VC1A 2Y1EA 2TRSB 3IBYA 5J4LA 1PGNA 3A36A 5EKUA 3COYA 2OXIA 3O1LA 2B2CA 3BILA 3QPCA 4TT3A 5KBYA 2G4CA 4XWWA 1R4NB 4LGYA 5EIAA 1MVLA 4BCCA 3SZOA 3VO9A 3AESB 1BSVA 3CVOA 1G63A 5A5EA 1GAEO 2WP0A 1CF2O 5FUWA 3CM0A 4ZMRA 2OP1A 3GAAA 3QVKA 1L7OA 4M9SA 1O58A 2G0TA 3EXG2 4JR2A 5BT9A 2W00A 2P35A 4BNJA 5L53A 3HJFA 3IT3A 1T0UA 1ECFA 5BWNA 5KS2A 4KN6A 4WZBE 4DR4B 2YC2C 1YV9A 4ON9A 3W79A 1T91A 1PBTA 2BGTA 2IK8A 3CO0S 3L8EA 3Q1KA 3VDNB 5J58A 1EPUA 4CFSA 3NG1A 4QXAA 5FUXA 5EJ9A 3G0DA 1KEPA 5K0SA 3VTZA 2DWUA 2O8EA 2GD0A 3BTOA 1E1MA 2BELA 3KJZA 4JENA 3QVUA 3TN7A 4M6WB 2IYFA 3GFFA 2W5UA 2Q3LA 4U7FA 1PX0A 3WYEA 2QDXA 3DZHA 4IGIA 1O2DA 1Y8QA 1RCUA 1WCXA 4W8GA 3U4QA 2XB8A 3V00A 3DDUA 4HB3A 5F52A 3RJZA 4I8DA 1VI6A 3QPWA 2V7WA 4B9AA 4G5XA 2B8NA 4YDRA 2WZQA 3SIXA 2CLEB 3QPAA 1NYRA 1IPHA 2HD4A 3KJGA 3ZG6A 1M83A 1YQ9A 3LIPA 4KP7A 4MRSA 4OTZA 5JCJA 4EI8A 2OAGA 3MYRA 1PNQA 3JQFC 4IS2A 1NPDA 4N7JA 1YBAA 2ZIEA 4HMQA 4ZVQA 5BORA 3U1BA 4Q7MB 3RV3A 4RXUA 1UR5A 2GO7A 3KHTA 3AHIA 4GOND 2VSNA 4DIFA 1CEXA 1I4LD 1M1YB 1PS0A 2WF7A 4BVGA 4X24A 2YIJA 5K3BA 1NMQA 1XTUA 3PJEA 1ODKA 1IQPA 4QUIA 1NYQA 2F3TA 2Y67A 4LZLA 2R6HA 1OC4A 1AGXA 1USWA 5B2EA 5K0FA 5IVHA 3DPSA 3PWZA 4LOLA 1RCFA 5JCPA 3MWDB 1NJ1A 5DKFA 1DS6A 1LTKA 2XMZA 4URFA 4E1VA 3RH0A 3CZCA 1A96A 1OAKA 2VK2A 1F14A 2AV6A 2WUVA 5DGHA 1YONA 1G4HA 1Z34A 2P79A 2GCOA 2QAGB 1EFHA 3I64A 4M0FA 5HIJA 5I9IA 1E69A 4QQNA 4EFDA 5IM4A 3GLGB 1JAHA 5BO5A 1RT9A 5BRNA 3RS9A 1OFUX 3MGAA 1K4MA 4MGHA 3G9QA 4F0JA 3LT1A 4IXNA 1ZVMA 3C6BA 1IXYA 1CBUA 3MTBA 1L9KA 5LZ7A 1D2MA 3TIGA 3F9RA 4GR5A 1E2PA 5A5FA 4ZVKA 4KREA 1FUKA 4BNFA 1F4PA 2JG3A 4JQOA 4C01A 1TUBB 5GZ1A 5IT9A 1DC5A 4L2IB 1A88A 3PFIA 3QI2A 4KHZA 4WZAE 5JDCA 3QF4A 3KP1A 5EHNA 3TD6A 1TW2A 3JVUA 5IXSA 2G6BA 1TEVA 1PJLA 1MOZA 5A0FA 1HE3A 1E9AA 4QOJA 3UW3A 2WJHA 3C4VA 4DMMA 3JQFA 3PFFA 1ZJJA 2DECA 4RTOA 4XEUA 2KI5A 3CRNA 1NQTA 1P9LA 4OYYA 2MHCA 4FMDF 1SK8A 2E49A 4HADA 4NMWA 4D80A 3VOAA 3K6SB 2JL1A 1C1DA 3VAYA 1FFSA 4BFUA 3GLIB 4L85A 1QMGA 2ECOA 2QR5A 1DIGA 1XZIA 2RGNA 2CVOA 1CXZA 1XEAA 2XMGA 3H5IA 1W4CA 3H86A 4IJWA 4WNIA 5FL7D 5DGIA 3PJRA 2X4DA 1ZD3A 3KTFA 1T8TA 3RS5A 3RSCA 4EB8A 1H0RA 4B6JA 3TNFA 4PE5B 4RPCA 4ZO6A 1I0LA 3OM9A 4XPIA 4Q39A 5M7EA 1YS4A 3OFSA 3OPYI 3P9RA 4OA8A 2XBLA 4XVRA 3KZOA 2OD7A 1NVXQ 2QLFA 3JQ9C 4ZO4A 3RIHA 2DFNA 4R71A 4DV0B 2OHOA 1WB9A 3IYLW 1XDWA 1U3UA 4FHGA 4G1EB 4AJIA 4A8HA 3OQNA 1IQRA 1QNFA 1TZMA 1TJ3A 3LRXA 1V41E 2Y68A 3H1EA 4O4JF 4HY3A 3GJ7A 1KEEA 2QMEA 5DU2A 1KI8A 4ZZ1A 4OQNA 3H2BA 1THMA 1W48A 3LDFA 1GITA 2XB6A 4LNUA 2ZJZA 4RIFA 3R1IA 4Z8YA 4YPOA 4TXMA 5HEKA 3UAZA 3C5CA 2X1MA 3HDYA 1G8GA 3SZ3A 3ZZUA 4KMOA 3KZNA 3PC2A 1ZOOA 3RG8A 4G0PA 2B8EA 2CBGA 5JEDA 2ZSBA 1AMUA 4G9EA 4F72A 3DUWA 3LI2A 3EPHA 3AOEC 4JBNA 1FRZA 1N9GB 4JYBA 4LCBA 5AW0A 4OI1A 3K8OE 2G1JA 2XNJA 3AKDA 2H52A 3BJRA 3SBEA 3UJCA 4ER5A 1BDJA 1FRFS 1OROA 4ZDWA 1Q12A 3RD5A 3V3TA 3C1UA 1XPUA 1HO3A 3BK1A 1DBPA 2O2CA 4MQBA 2G6TA 3DXXA 2VSXA 4XQ9A 1DFGA 1N57A 3EK2A 3KD2A 1XJCA 3AILA 2QD1A 3I4FA 1O0CA 1Z8HA 3QUSA 1YVDA 3LXMA 1FMLA 3DVSX 4KFTA 2C4HA 3V9AA 5AUPB 5KSZA 3OFJA 1JPNA 4FPXA 3F0TA 5I4BA 5C18A 1N5KA 4XB6B 4AWAA 1L8XA 1S8OA 2QU7A 4Q4CA 3TVDA 4YPVA 5JZOA 3CW9A 5B1EA 3I83A 4ZHQF 1ZL2A 3DEFA 4H6VA 4EYOA 1CHNA 2O2SA 3LUPA 4UBNA 3NH6A 4YQEA 4I4TB 1GDTA 1KYYA 2X8AA 2AF3C 1ZAYA 3BWEA 4JSYA 2NYVA 3HA2A 3SIPA 2PRKA 1RI2A 5LLTA 2J31A 3ZWOA 2WAAA 5HWSA 2P9CA 3CXRA 5C53B 1PK9A 3RU3A 2Q6VA 3OE7D 1GOTA 3NI2A 4EHDA 3GL9A 5IYZA 3BXHA 2X5OA 5CH3A 2ZFUA 2QXUA 4DDTA 5L3VA 4MJ7A 1FCJA 3CZMA 3IPXA 1S3GA 2W6MA 2PYDA 1G16A 1BCSA 1H2ZA 4RTKA 3QU5A 1XXLA 1M2NA 2PGXA 1WBBA 2PRIA 3LC7O 1ACLA 4N54A 2GFHA 1VL1A 3DBLA 4QASA 1US8B 3QX9A 3VOTA 2VF7A 4DLNA 3OJEA 1C7ZA 1ZM3A 4H7IA 1I4TD 3KXDA 2FFRA 4IRUB 3WRVA 2UZ4A 2WD8A 3BTVA 3C98A 1ZBQA 1L7XA 4RWZA 4WOPA 3SXUB 2G5PA 4ABYA 1XKXA 3WV5A 4DJTA 1WY5A 3U40A 5K3FA 4RF2A 4JXKA 5TMBA 3SWWA 1O8BA 1XOIA 3DVLA 5EJ2A 1QHIA 1KFEB 1ZKMA 3Q9UA 4QU0A 4CLHA 3BM5A 4TV8B 3AR5A 3GGPA 5L4LA 1LPBB 4C6HA 4J43A 3U4DA 2ODPA 4PLYA 3PDIB 5J5VA 4N7MA 2JCYA 5F2NA 2GN2A 5COAA 3OJOA 2YYYA 1YD7A 2JFOA 5BY2A 2M2IA 3IQXA 1WMSA 4Q9DA 1CUEA 4EP1A 1N1DA 1VJDA 2OCAA 3AO0B 2XQIA 3RT1A 2B8JA 3PHJA 5DDIP 1KHHA 2BBTA 2QENA 1QH9A 1H6AA 2HM7A 2WSMA 4NYMR 4YMWA 4I81A 1PJBA 1RI4A 2BSXA 2H4WA 4L4YA 1T5DX 1BA2A 4MV1A 3MTEA 4RD0A 5TS3A 5B5SA 4DA9A 2OXRA 5CDTA 1QQTA 2CLHB 4FLMA 1EGQA 4HDRB 4NJEA 5JNLA 2A9VA 1LPMA 1O77A 2WV9A 1YJAA 5FORA 4PC2A 4Y3UA 3JZMA 4PNEA 1I2AA 1TRHA 2FSHA 2V5VA 3L04A 4JWTA 3BL6A 4J0EA 3VPHA 1YA6A 4BFTA 1V7QA 2IZ0A 2XXAB 2GBLA 4JFRA 3I5AA 4L51A 1MPXA 1PDOA 2ADFA 5ALDA 3TAHA 4UMFA 2QYTA 4JYPA 3USZA 1WU7A 2BLLA 3ZZTA 1MQAA 2WSSA 3RAPR 1SCDA 4YRIA 3EA5A 4MI1A 3ZLBA 4KZPA 1QYDA 4I36A 2X2FA 4RD2A 3AY7A 3CVXA 4BZXA 4WK0B 1MJGA 1W59A 2F1OA 3DFMA 2ZTLA 3M5WA 3W7VA 4O3MA 1MC1A 3HJRA 2OO5C 1X8XA 2YJ4A 1D4AA 3DFFA 2VF5X 3VR6D 5J4KA 4OBEA 2YY7A 3T3DA 4IXWA 4LXTA 4JJKA 4QELA 4HTFB 1GU0A 2MSCB 1P74A 5K3DA 4XSHA 1FP4B 1HKHA 2QUIA 3FOCA 4NNOA 2DT5A 1ISHA 2FSPA 5DI9A 3N05A 3FGNA 3FCYA 1SOWA 4DKXA 2F3UA 2PXXA 3KG2A 3LAWA 1AGPA 2X41A 1N6IA 4G25A 1BE0A 3TW4A 1EKXA 1L8AA 4M1ZA 3D6JA 4RPGA 3R75A 1GRVA 1H8HA 1P7ZA 2DX7A 4XYMA 4MUKA 4PX3A 2BKUA 4TMXA 2ORVA 2QN8A 4L5JA 3W2TA 3B1XA 4JU9A 4RSHA 1P29A 1I3NA 1Y6RA 3EC7A 3GLHB 2R25B 4KI0A 1CJVC 3IKJA 4O1MA 3LHIA 1P1BA 2Y6VA 3OOWA 1E3SA 1YBHA 4N49A 3PU6A 4XIYA 3CPHA 1R4MA 3M3DA 4H1VA 4KDEA 2Z56A 1UUFA 3B9PA 3R5SA 4H3SA 4PC1A 4FP9A 1K7CA 4QVIA 1AT1A 2G28A 3CNQS 3FN4A 1EP2B 2F3SA 2R4UA 4KUEA 4UUQA 2EJTA 1VHJA 3KZCA 4KW7A 5FEUA 5JO0A 4C0BA 3GFRA 2A4KA 3FUTA 4QGHA 1UMCB 1J9ZA 4LQCA 2QZJA 1OXBB 3RQSA 3QVVA 4FJ2A 2VPPA 1ZD1A 2EJCA 3OESA 5JSYA 2DFTA 4DXHA 2HPVA 3G2LA 4JB3A 3KU4A 3DLAA 5J2UB 5DTMA 4J7XA 2PRJA 4ARSA 2R68A 4K26A 4RVGA 5JROA 1A9XB 5EMJA 2R62A 4K9DA 1MENA 2VLIA 4QGSA 2HTEA 2I4MA 2JJ2D 2HX1A 3H8SA 1RWMA 3P32A 4QYWA 4BO0A 2QRHA 3ROGA 4ZDIA 5CA1A 3U3ZA 2Q45A 3WHKA 4JJFA 3ZQ6A 3A05A 2ZP1A 1N25A 4YRCA 5G0VA 4LQLA 4S35A 2BMJA 4KE6A 3ORSA 4LJ4A 2ZJAA 1Y8CA 4LXUA 4ETMA 4YK7A 5FWYA 2C2ZA 1CY6A 4FBLA 3BZBA 3PQ7A 5ALHA 2CKDA 3K6JA 1U65A 4GLFA 4QO7A 4PYOA 4UNSA 2RGAA 2UXDB 1GUZA 4PLHA 4BMCA 5DRTA 5B6PA 2VSQA 5F12A 1ZWKA 4O2BF 4PCUA 3DAYA 5CDGA 2H5EA 3PUWA 1JFSA 3N3AC 1LFDB 3LV8A 2WQZA 3P0RA 4RZXA 4CJXA 5IWAB 3HJGA 3KSRA 1GFSA 3HNOA 3JQ6A 4WXRA 4ZAZA 1YJQA 2OGSA 3GIDA 3BG5A 1KFJB 4KPEC 3Q3HA 4RVUA 1JXQA 3QMVA 1MOSA 1WHSA 2GN9A 3JVIA 1G2QA 3BGDA 3R6GA 4OMDA 1FRVA 1YR9A 3LT4A 4Q4JA 5CJPA 5JC8A 3ET5A 3ASYA 1YI8A 3I2FA 3T6KA 3AM3A 3B3GA 2R5WA 2AJTA 3BF8A 5K1ZA 4E88A 2BJVA 4U9UA 1O9GA 2IYQA 1ULUA 3IAUA 3Q3VA 3GCDA 2UUCB 2E5FA 2QL9A 3W8EA 4XEHA 1DBSA 4HRYA 3ZI7A 4Q4HA 1TE2A 3IP1A 2PGAA 3E5MA 4UUBA 1A9PA 3IKVA 4E31A 4TSRA 5I7WA 4RZUA 4U6NA 1KWGA 3HM9A 2FK7A 3CZ5A 4IICA 4YUYA 3NDJA 4JEUA 2XTNA 4LRTB 5LC1A 5TQVA 1QPGA 1LS6A 4HNVA 4JGBA 1J8QA 5KVSA 1T2VA 4QQFA 3A25A 1UK9A 4KIGA 5FPQA 2VL7A 3TL3A 5EZ6B 3ZZ1A 1EFLA 3RCBA 3W9YA 1A7AA 2P6UA 1Z6QA 4LXHA 4NZOA 1G38A 2Z5FA 5EZ5A 1ZW1A 3VPGA 5LB2A 1XLVA 4QDJA 4R9SA 1RSZA 4XCQA 2OP0A 2FPIB 4DAEA 1XCBA 1KHTA 1U7OA 4XA8A 3IXLA 5CG2A 1YFLA 3A0UA 4LF9B 3FDXA 3N58A 4OH1A 2RGNC 3WWDA 4R0NA 2KQUA 3OLCX 2YZNA 3OEHA 1G4UR 5A0VA 4TQ9A 2RJNA 5K8TA 1IAVA 1Q3TA 5FUQA 3PTAA 2AJ8A 3C3WA 2XNSA 4XARA 3UIEA 1PR1A 3PD1A 2PCJA 3S1AA 1NP6A 2BM9A 5DHFA 3GFVA 3SYLA 5JYEA 2NSJA 5K03A 1Z62A 2HIAA 3OKPA 1SNYA 3EH1A 4G0VA 1GAQA 3Q7PA 4GM0A 5A2GA 3WBJA 2QNIA 3EVGA 3QEMA 2HJGA 4QBIA 2GNAA 4DUYB 3AK4A 3IJRA 4NEQA 3E81A 3RUAA 1B8OA 1DAMA 3SY8A 3R8FA 1EHYA 2WOJA 5A9SB 1UJ2A 4PFSA 1QAOA 2OHFA 4RS3A 2Q4BA 3SBXA 4XOUA 1E8NA 4AU1A 2O3SA 4BOYA 3L3BA 2C5SA 1FYXA 3E84A 3NUZA 3SC2A 3ZV7A 3GIWA 4XDZA 3ZU2A 1UT5A