1Z12A

Crystal structure of bovine low molecular weight ptpase complexed with vanadate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Crystal Structure of Bovine Low Molecular Weight Phosphotyrosyl Phosphatase Complexed with the Transition State Analog Vanadate
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 62
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z12A00
3GL9A 2FEWB 1JBEA 3T95A 4RY0A 2WY2D 4G97A 2QSJA 1YVUA 3HXMA 3IP9A 5JNWA 2J48A 1MB3A 3M6MD 3O2JA 3CKMA 3JTEA 4NCBA 5C5EA 1XWWA 4MAAA 2JCGA 5HSGA 3C3KA 3Q9SA 2FKAA 2OENG 5KWSA 1DBPA 2CD7A 5PNTA 5TQ2A 1VPWA 3LTEA 2FTKE 3KKEA 3HJFA 4KV7A 2JB9A 4EYQA 3H1FA 1MB0A 3N0RA 4W5TA 2FN8A 2E4VA 1KMIY 3N75A 4O5AA 4WT7A 5EWMB 3FFWA 4Z4GA 4KK4A 3QLUC 3C3WA 5FWXB 2MSKA 1EWKA 1A0OA 5KC8A 5B3JA 1DBWA 4ETNA 5KI6A 1DJMA 1M5TA 4KVFA 3RVRA 2W42A 1ABEA 2VUIB 4OTZA 2R48A 4OG2A 4M88A 4G0PA 2FLKA 5T7BA 2VK2A 3HUTA 1DBQA 3RVJA 3RVLA 3HDVA 2FMIA 1TJYA 2WWVD 4B09A 3GA5A 1JL3A 2PLNA 4S05A 1ISRA 1JYEA 1L5YA 3JPWA 5E3JA 4ZYLA 2PUGA 3KYIB 4RWEA 5TQJA 4KRFA 3FFTA 3O1JC 5IULC 5JNUA 4PE5B 2IYNA 3JPYA 1LJUA 5B3JC 5BR1A 1QKKA 3EQZA 3LUDA 1ZHHA 2KYRA 5GOTA 2FXIA 3OMXA 1F4VA 3QLVA 1ZGZA 2R47A 4DN6A 3DGEC 3TO5A 2HPHA 4XXHA 5T3YA 3EAFA 5DTEA 1ZH4A 1BAPA 2PL9A 1ZVVA 2YHAA 3IPAA 4RV5A 2CHEA 2FN9A 4ML3A 3DGFC 4O1IA 1BA2A 2MSLA 1J56A 4WXEA 4MYRA 1D5WA 5FBHA 4MS1B 4RK6A 3HCWA 1ISSA 2X7XA 2O20A 3SY8A 4NICA 3A10A 4LZLA 1RXIA 4CBVA 4G0YA 1KRWA 3E3MA 2QU7A 3QEMA 4MPTA 3FFXA 4MRMB 2QV0A 1D4ZA 4DQDA 3OQOA 3KYJB 5F64A 1DZ3A 1JDNA 1JHZA 1URPA 1UDRA 1Z16A 3HZHA 3G85A 5DKFA 4F11A 2GI4A 3E61A 6CHYA 2MYUA 5TE9A 1PEYA 1P6QA 3ROFA 3URMA 1Z26A 2FQYA 3SM9A 2E4XA 3M9XA 5EWLA 3EDCA 4ZMRA 2QW1A 1MIHA 3HO1A 1QPZA 1QMPA 2HJ9A 4E7PA 4Z4IA 3GV0A 1AB6A 4XARA 3K4HA 4KZKA 5JNVA 2M98A 4NV3A 2V0NA 4EYOA 4GPAA 2A9PA 1RZRA 3TMYA 3KLOA 1QP4A 2LBPA 4JA2A 4TLLB 1Z2DA 1A04A 4KQ9A 1PHRA 3NBMA 3Q7TA 1JDPA 2F8SA 1PEAA 1W25A 3JVIA 3N8IA 4FB4A 2PUFA 1DCMA 5TPWA 3SQNA 1TLFA 1NY5A 2MSWA 1QO0A 4PZ0A 2PMCA 5TQ0B 2B4AA 3OQMA 1XHEA 4QYWA 3H5IA 2RJOA 2E4YA 3BBLA 4HNRA 1DCFA 4MR7B 4YO7A 5JNRA 2FVYA 4MR9B 3H5WA 3CHYA 1LK0A 5KQLA 2GWRA 4QPJC 4WWHA 2RGYA 4XLTA 2QR3A 1GUBA 2AYXA 2PKXA 4IMJB 5IBQA 2F8TA 1CYEA 2PUEA 4E7OA 1DRJA 3O2QB 1YK0A 1IIBA 3HS3A 5BQ3A 4RZSA 4EVSA 4MLCA 1A2OA 1E6KA 3SG0A 4IMIB 4Y9TA 4LE0A 1GCAA 4N0QA 1SD5A 4YR7A 1PNRA 1PUXA 5TQ0A 1ZAYA 1QP0A 4Z4EA 3KS9A 2NT4A 2QVGA 5CNIA 3F73A 5GQSA 2P9HA 3IP5A 1U8TA 5TPZA 1YS7A 3D8UA 4PICA 1D1QA 3KJXA 2IPMA 2QVCA 2VYCA 3LUCA 3P9YA 5KQMA 4FE7A 4MQFB 4QYMA 2GKGA 1K68A 3QX9A 3CZCA 4RK1A 1JH9A 1C0EA 1EHCA 5IEJA 3CTPA 1JFSA 2DRIA 3BRSA 1BDJA 1DP4A 3KG2A 3LUJA 4P98A 4OBBA 4N0PA 2JK1A 3RVSA 3OQNA 3OM1A 2PAFA 5JS1A 2WJWA 4MS3B 2PE5A 1S8NA 4UHKA 1DG9A 1U04A 1NATA 2HSGA 4XFKA 4G0MA 1YTUA 2PUCA 3N0XA 2JVIA 3CZ5A 3DBIA 3H5TA 4JB2A 1D2AA 1P8AA 5DCLA 1Z17A 1P2FA 3GBPA 4RK5A 5EWJB 1Z18A 4G0OA 4HYEA 1NXVA 2NZVG 4EYGA 1MAVA 4ETMA 1QQBA 5EWMA 3LOPA 5FWXA 2CHFA 4EY3A 2AYZA 4D6YA 2XDYA 4F12A 1P6UA 4LX8A 3SNKA 1SRRA 1EFAA 5HKOA 3HK2A 1RXEA 3A0UA 2QXYA 4Q7EA 4RSMA 2A9QA 5JS2A 3FDFA 3OLWA 1H9CA 3R0JA 1YK1A 3S99A 2NT3A 3EQ2A 1RNLA 5KC9A 3RVKA 4ETIA 3EGCA 1RZRD 1JF8A 3RVMA 2ID7A 4FE4A 3LKVA 4MS4B 4MR8B 1AB5A 3DLBA 3OLVA 3HV2A 3CFYA 3HUUA 3H5LA 4F3TA 2A9RA 3IP6A 4TN5A 3OLYA 4OLBA 3N53A 2JRLA 3OMWA 3C3MA 3TD9A 5ED4A 3A3KA 1SXIA 4G0ZA 3B2NA 2R25B 2A9OA 1QO0D 4RXUA 4RS3A 3BILA 1QQAA 1DRKA 3T38A 2JBAB 1APBA 3LUAA 3RVPA 6ABPA 5CHYA 4TMYA 3H5OA 2BGGA 3BRQA 3VNAA 1USGA 3QLVC 3RVNA 3T8YA 1FSPA 1NXOA 1U0SY 1VLZA 3O75A 2MYNA 3H1EA 4O1HA 3MQ4A 3NNDA 3I5AA 1B00A 4N76A 1NTRA 2HQOA 3FMVA 4Z4HA 4MS1A 4XAQA 1JFTA 2P4UA 4JAVC 2I6FA 2HQRA 3ROTA 3N0WA 1FFWA 1LBIA 3ILHA 2H3HA 4H3KB 4PYRA 2WRZA 3QELB 4MRMA 4Z4FA 3LUFA 5IUKC 2B1JA 4RU1A 4RK4A 4EUKA 4EVQA 2WB4A 3OLXA 1YMUA 4F8JA 3IDOA 1OXBB 2JBAA 2ZWMA 2Q5CA 4GNRA 1Z12A 3NHZA 2GBPA 4RY9A 5TPZD 1OXKB 8ABPA 1FQWA 4YWHA 1R8JA 1W9HA 4JOQA 5IEBA 2LUOA 1ABFA 3OM0A 3TB6A 1KRXA 2NZUG 3JY6A 4G0QA 5D2CA 3UKJA 1NXTA 4Z0NA 2FLWA 1ZGGA 4IF4A 1HEYA 4KREA 4KMRA 3KCNA 4MQEB 1TM2A 4HNQA 2M1ZA 1PNTA 1GCGA 3GWGA 3QLTA 2CWDA 2FSPA 2MYPA 4H60A 5C5CA 2LP4Y 4NCAA 4MLDA 1E6LA 5FWYB 2PUBA 2PUAA 5JNTA 4D6XA 1DC8A 3GT7A 4YRZA 3O74A 1YS6A 1Z2EA 3MYYA 4LDAA 1RPJA 5JNSA 2LIVA 1U2QA 3G1WA 4N47A 4L85A 4LDZA 5TQ2B 3L6UA 3H5VA 3QX8A 4N41A 3F7NA 3O2SB 4RKQA 3RQIA 4W5QA 3DLHA 4MR7A 4F06A 4MR9A 1E6MA 2FMKA 2IOYA 4JB0A 5HM6A 3HSYA 4IGAA 3C97A 3CG4A 3SAJA 2QZJA 1Z13A 4Z9BA 1NXWA 1Z15A 3KLNA 3CLKA 3CS3A 3GRCA 4MGEA 3UUGA 5FWYA 1M5UA 5HQJA 4OLAA 4YGXB 1BDIA 3H6HA 1ZDMA 3HEBA 1FFGA 5IC5A 1LBHA 1VRVA 1ZH2A 2HQBA 4Q6BA 1XHFA 3EJWA 4YS6A 4YCSA 1JX6A 1CHNA 1NXSA 4RKRA 1M2EA 3C6QA 5BRAA 3I42A 1JYFA 5IUNC 2GX6A 4H3HB 2IPNA 3QEKA 3I09A 2WJAA 1L5ZA 5CNJA 9ABPA 2FW0A 2WMYA 3Q15C 1JWLA 1EAYA 3EULA 4ZJPA 2JVKA 1Z25A 4KFCA 2FMHA 4JASB 4MQFA 3CNBA 3D02A 4G0XA 1C4WA 1EWVA 3W9SA 1U2PA 4IRXA 2MYTA 2TMYA 2FEPA 3I45A 4YLEA 4Z9AA 4N03A 4UHJA 4P1ZA 3CRNA 1D1PA 3H75A 3OLZA 1BVHA 2PJUA 4MS3A 2ID9A 2IPLA 1I3CA 5IUJC 5BRJA 1K66A 4OATA 4L4UA 4YV7A 3ILYA 2E4WA 2RJNA 1F51E 3JVDA 1JLKA 4S04A 3QEMB 4RXTA 3LUGA 2FMFA 4Z4CA 3F6CA 4EVRA 4RK7A 3OO1A 3T6KA 1Y1LA 3HDGA 4PEVA 5EWJA 1USIA 3CU5A 1FFSA 1WETA 3NHMA 1USKA 3F6PA 5I4CA 4KPYA 1CEYA 3H6GA 3TX6A 2E4ZA 4KQCA 3Q41A 3KTOA 3LMKA 3JS5A 5CNKA 1M2FA 5CNMA 5EWLB 4LE1A 5IX8A 3CG0A 1QP7A 4RXMA 4XASA 4LRQA 3RVQA 4D74A 2IKSA 3OO0A 2JVJA 1DCKA 4W5RA 2N9UA 3LFTA 1NXXA 3IP7A 4MS4A 2YHBA 1ZITA 1NXPA 1SXGA 2R4QA 4MR8A 4WZZA 2ZAYA 1QNLA 1EWTA 1ZN2A 3LUKA 4ZPJA 1E2BA 1YMVA 4KNYA 4DADA 2IPAB 2L2QA 3MA0A 1GLGA 4Z99A 1JFVA 5TPWB 4EYKA 1ZESA 3BREA 3N6VA 2FEKA 2FQWA 4QICA 3IPCA 4JP1A 2OQRA 4G86A 5DLEA 3GYBA 2PL1A 4RY8A 3M9WA 3UK0A 4LE2A 4W5OA 1GUDA 2LPMA 3HVRA 3VNBA 5KQPA 2L19A 4WXMA 1BDHA 1LJLA 3EODA 3K9CA 2IDMA 3NNSA 5ABPA 3MIZA 4EGSA 5KQGA 3MF4A 2RDMA 4HNSA 2L17A 4ZMSA 3RVOA 2L18A 4RDCA 2PUDA 1DC7A 3O21A 1KGSA 3HM9A 3RH0A 3QELA 3FGZA 4W5NA 4TLMB 1MVOA 4NQRA 4YP9A 5FBKA 3Q7RA 2E4UA 1T34A 4IILA 3DZDA 3KHTA 1TVMA 1YIOA 4WUTA 3NNNA 3A0RB 5DGCA 1ZY2A 2NUBA 2VUHB 1SXHA 3O1IC 3O1HB 3MM4A 1VKRA 3H1GA 4KK3A 3QK7A 2FQXA 3LUHA 3MMNA 3KSMA 3GBVA 4Q6WA 1TMYA 3L49A 3Q7SA 7ABPA 3QLUA 4MQEA 4RK0A 2H0AA 3LKBA
chains in the Genus database with same CATH superfamily
1TKRA 1GZVA 4ICIA 4R6WA 2H2AA 4IS3A 2I80A 2WY2D 5HKAA 3UFBA 1HE5A 2XOKD 4O4LF 2VT6A 5FFFA 1Z68A 2I8CA 4X61A 5J63A 2RGRA 1GZUA 4HEQA 2CF6A 2PSEA 2VDNB 3EZYA 1VJ5A 4J4TA 1SUIA 1ZL2A 1NUUA 4LJ7A 4M9CA 2XWBF 3OZGA 4UCWA 1Z8FA 5K6TA 4JYAB 4RD1A 4XCXA 1OGIA 2HB6A 4HATA 1SD1A 3BSSA 1RCUA 4OH1A 5L3SB 2JGDB 2HFKA 1SU4A 4KV7A 5DGXA 1ZK1A 3K0CC 2J6BA 2R1UA 4W63A 1KMIY 3GZ4A 4O5AA 4A16A 4ARVA 4KK4A 3P2OA 1M6WA 4AM8A 2QUIA 4DQVA 5CT9A 3N8HA 4KVFA 1IHDA 1SVNA 1KDTA 1MHPA 3GU3A 5CYPA 5IVIA 4S0XA 4KPFC 3IEXA 2AC2A 4JEIA 4FNMA 1MLDA 4M88A 3RFCA 3OD1A 3WO1A 2GDJA 3PI7A 4PLTA 3UG6A 4YRBA 5JDIC 4F6CA 4Q3LA 1SH7A 2DHEA 2W22A 3U3JA 3LCVB 4IIJF 2WYUA 2HSEA 2OHIA 1X0XA 1HZZC 3ANSA 1UFOA 1SZDA 4Q3CA 3VSAA 3ZBQA 1K4MA 4J91A 1PWZA 4ZYLA 5HJEA 2C3PA 1X14A 2VHEA 1V5WA 2H1SA 4KW7A 3NUGA 2XQIA 4EGQA 5BSEA 4LYJA 4IIDA 2JLSA 4E51A 1ULTA 5ILQA 3B6EA 3EQZA 4QBTA 1E69A 2KYRA 5GOTA 3TTXA 1R8SA 3KT8A 5P21A 3U7RA 2XUQA 3UWSA 4XXHA 2XDWA 1C9EA 4Y2YA 5EOVA 3SNHA 1F12A 1VMEA 4ZI3A 2LD4A 2C82A 4FOPA 3U4QB 3CRW1 3PIIA 4X95A 3TX6A 2HR1A 2WWIA 2XIJA 5A5VA 4RTQA 1MFPA 4QFCA 4JR0A 3VUEA 2QTVA 4RL4A 5H4GA 1RXIA 2OMEA 1IRIA 3VO9A 3V97A 3GNSA 1ZMTA 1A9XA 3AJAA 3DBOB 4LMAA 3M1YA 4MWSA 1DZ3A 2A0YA 4WESA 4BNDA 1WDWB 1Q11A 5CDHA 3W5JA 2OBYA 1QH1B 4EW2A 2O6HA 5AXBA 4TKUA 3ZDZB 2PEYA 5TGTA 4UNRA 2DCUA 4GT1A 4XB2A 5B3LA 1KK1A 1TXGA 1EVEA 5LXTF 4IJUA 2YMPA 4AJEA 3QU9A 5DV9A 3X1ZA 4C01A 4HZGA 2DKFA 3UWOA 2I65A 3VU8A 3ZHQA 1YE3A 4L5AA 1Q1ZA 5FUQA 1IHPA 4EJSB 3DQQA 1E1CB 5CIWA 4B2LA 3ZJVA 2ZB3A 4GRDA 1KOLA 3TAUA 1AB6A 4BKQA 4D0GA 5C8YB 5GADl 1GLVA 2BHLA 2AFRA 1CR2A 1WL8A 2HCBA 4P36A 2A9PA 4QLOA 3B20A 4GLLA 2CN1A 4PV7A 1WEHA 4AYXA 1U2EA 3QKRB 3BMCA 3LE8A 3TZ6A 4DWWA 1PSWA 3QU4A 1QR6A 4A27A 2QGZA 3C6ZA 3X1WA 1PSDA 3HKEA 4BLWA 3HYRA 2OB1A 1IH8A 2AMJA 1AMUA 2PU5A 3DBHB 4JHLA 4NULA 1Z4NA 4MNTA 2AF3C 1KDYA 4BN4A 2OTCA 2WJ4A 2VI5A 3OQMA 3TG8A 3KQKA 1XHEA 3L8HA 1CUBA 3AKYA 3OHSX 2BMWA 1Y33E 5C5IA 2E4YA 2PVPA 1P19A 1HMPA 1TI7A 4MR9B 4MVJH 2KPOA 2D1FA 2D06A 1KZ4A 2WMNB 4GMGA 4HRVA 4JGIA 4WNAA 2XB6A 3KZMA 3HWRA 1C4OA 1NN1A 2OHOA 4IJ5A 3FYUB 3PXDA 5H0IA 3T5MA 3BE8A 4DA7A 2XQFA 4J9UE 4RETA 5ALSA 5KNLA 2W2LD 5CH8A 5ETJA 3IR6A 5TF0A 1A2OA 4E5KA 3PR2B 5LQAA 4E33A 3OQIA 4HDQB 1FEZA 1TLLA 3M5DA 4L0QA 4LE0A 4GP6A 3QBDA 5CCEA 5MFPA 4BO8A 4RTJA 4QQ8A 4BP1A 2PMWB 4ZCSA 3LY5A 2ETXA 4CMEA 1NUSA 3E5NA 4O08A 1A7KA 3L04A 3A8TA 3RYIA 4BLVA 5KTMA 2ZCUA 2K2WA 3BZUA 4N6NA 3T3NA 1V39A 1XU4A 3IP5A 3O3MB 2X8BA 3LJKA 1CUEA 4J3JA 4EQ6B 2AGVA 4DLAA 1FZQA 5JXJA 2BGKA 3JZFA 4LJKA 2BT4A 1N2CB 5B1SA 1JS1X 2ZRLA 4KO8A 2AZMA 4GW3A 2ZUDA 4GR5A 1EVQA 3NUZA 2PS0A 3PPIA 1J5EB 1UAGA 2WIBA 4AN1A 2DHRA 2R6JA 4H7PA 5A6SA 3O8CA 3FTEA 3QWAA 1U1DA 2C9BA 4KNVA 3VZPA 3ST7A 1RRMA 3Q98A 5KNCA 2AI1A 1WPXA 2G76A 1Z47A 2JK1A 5LKRA 5LZ9A 4UXIA 1EUYA 5CK5A 3ZHZA 1NIPA 3C7KA 2LW7A 4BJ6A 1B6GA 2E4AA 5DNUA 1VMAA 4ZYTA 4XFKA 5LWQA 3QU5A 2ZZNA 5JAQA 3I83A 3N0XA 3B48A 1MQ9A 1YDFA 4C7OB 2GD0A 4PPQA 1Z17A 2IYTA 1QRRA 5DF1A 4CQMD 3LH5A 3NCHA 5EE9A 1HDZA 4AO7A 3QLJA 3ROZA 4EZEA 1Z37A 1Y89A 2IUSA 4WSOA 5DGHA 1Z18A 3RC1A 3U4HA 4BWYA 2H06A 1QQBA 3F5SA 1PS0A 1VA4A 1XCLA 1R6AA 4ZPXA 3RJMA 3VJKA 2BGWA 1XPRA 1M2NA 1TGYA 2CHFA 2QD4A 1E4YA 1YWGO 2NZWA 2VH1A 3C5VA 2ZTMA 4EGJA 4YV1A 1KYVA 2ZKLA 5EEHA 2PX3A 1EFAA 4HDOB 1QZ3A 2VL7A 4FYXA 4KQJA 2XAAA 2DJIA 1N5LA 4OJMX 1JTFA 1C2YA 1YR6A 5AI4A 3TTVA 3QBVA 4G9GA 4BQEA 1FYDA 2IY9A 3C7AA 4PTLA 3WFZA 4GPIB 1NYLA 3RVKA 2AEMA 4V0KA 4CMJA 1LV7A 4XTCS 1Q57A 4YUXA 4EY5A 3ZE8A 2ODQA 1EBBA 1D4FA 1OC4A 3M5CA 5LQRA 1RAFA 2DR2A 3D31A 3I12A 1R6XA 4ADSG 4RTLA 2VAMA 4NXNB 4CDMA 1PFGA 1CUAA 2OWDA 4IZ6A 3OD5A 3WLEA 3EPJA 5HMMA 4J43A 1MU0A 4U2FA 1B0UA 5JASA 1H0RA 1R6UA 3KB8A 1T1RA 3EMDA 4GOXA 5JJLA 4E1BA 3AEYA 2I6GA 1E5QA 3HI4A 4QGHA 1QS0A 3I73A 1ZVKA 4U39A 4Q1DA 5CHYA 1KWKA 3G5MA 7GPBA 2OV6A 3AKDA 3ZGNA 5DIFA 4D6PA 1XEXA 2PX2A 1H2AS 1PNOA 5E6SA 3H11B 3G5AA 4QGSA 5LQUA 2BFCA 1FBTA 3ETNA 4IXTA 5FHQA 1X87A 1B00A 1NYQA 1T29A 2B5VA 2ZI7A 1QAMA 3IAEA 1WP9A 3A1VA 1CUZA 1QSGA 3CF2A 3EG9B 5ALGA 3W7BA 3SYLA 4PYNA 1NF3A 4ZOLB 4BWFB 1ZIOA 4LCBA 1W48A 4IF6A 5BWNA 2EQAA 2J0UA 4TPKA 2ONYA 4U00A 3KQLA 5DHFA 1HT2E 3MJEA 3QELB 1NMEA 2F59A 3I4LA 4G25A 1S9HA 5WRFA 1O08A 1VCIA 1WABA 3K92A 4FFOA 4GGOA 3CISA 1C9KA 4JJIA 4TMXA 1AKUA 4ZVLA 4DY6A 1QCDA 4IUBS 1LTQA 4ZT2A 3IDOA 4E4YA 3K70C 3Q5GA 1GNVA 2OL4A 4OXNA 1XCPA 3DKRA 3S8EA 2QBYA 3SHVA 4DBLC 3FFAA 5IC4A 5IM4A 2QAGB 3KSAC 1HL7A 2GHRA 3F6BX 3NPMA 3QBEA 3V1UA 5BR8B 1SCUA 1MKYA 1QKIA 2FZVA 5D2CA 2Q0HA 1KETA 1N25A 2FLWA 3P96A 3LPMA 4KPUB 5FJIA 5KAPA 3MILA 1WR8A 3KD2A 1GQFA 5DB4A 3V8VA 2FZCA 1E7RA 2JLBA 2N42A 4UVGA 4YP7A 2IWRA 3NATA 1W87A 4FU0A 4D3SA 4N9WA 4EQZA 4WDQA 5IC6A 2ICAA 2C4HA 1ML3A 5FWYB 2HA6A 3AOEC 4JU9A 1XWIA 4YTEA 4BKPA 2P77A 4PS1A 3G9QA 4D8UA 1Y3BE 3MAGA 4HXYA 3I34X 3ZU6A 4ZI2A 2Y93A 3VZCA 5LNK1 4CKBB 4FB5A 3P4XA 4FOSA 1KS2A 3CLUC 1EVKA 2JFUA 4M22A 2ZB7A 2XPCA 3GLGB 1C3XA 2UYYA 2RKBA 1FXWA 2AFIA 2X1MA 4LZWA 4YRQA 3AXSA 4C7JA 4RKQA 4O1MA 4U0KA 1EGHA 1Q2XA 2WJYA 2YMMA 1ULUA 3FXAA 1RAEA 3C5CA 1ENOA 2GM5A 3EVBA 5EVJA 5CEJA 1XMVA 3ZZNA 1NZJA 1DAKA 4CRWB 5BWCA 2ZE6A 1P9LA 3QVWA 3VHLB 1MHTA 4Z9YA 3EUFA 3RS4A 3C3EA 5AW7A 1RBZA 2JAPA 3KWFA 4DJ5X 3TYXA 3FCEA 4QQFA 3RS3A 1XTIA 2C3MA 3GGOA 1OYYA 1UMBA 2YDYA 4BQSA 3DKIA 3TPCA 2FPGB 3AFGA 3VO1A 2GFQA 2OAEA 5BNFA 1IY0A 1KAOA 1NN5A 2IHYA 1DKRA 2PY6A 5CDFA 1YNOA 3L07A 1RLTA 1G18A 5FXMA 2DWOA 2OGZA 3ZC3A 1XJ5A 2VRCA 1EG2A 4IG4A 4M36A 4YS6A 4BO5A 2XVXA 5BW8A 3NUQA 1OFVA 4DR7B 1OAOC 3C6QA 4OQNA 4QL3A 4YT2A 3PNPA 1UXIA 2V03A 2P1ZA 3UB3A 2GX6A 4AS3A 1OBCA 2IS1A 4H3HB 4FD3A 1TAUA 3I09A 3K15A 1J1IA 1C1YA 1HYGA 4UU8A 2OKCA 1OYWA 1RPNA 3REQB 4C6SA 2G67A 3E18A 3DULA 1NQ5A 4N48A 3EPPA 3BL8A 3NX4A 1Q1GA 4L16A 4L8GA 1P6XA 3NC4A 2W4IA 4Q1VA 3T54A 3DVAB 1AKTA 2YUTA 4V38A 2MYTA 3ROKA 2GHIA 2C9OA 2H4JA 3WMRA 1BKDR 5LP6B 1MEEA 3OUZA 4N03A 2GOYA 1NE7A 1AA6A 2PYIA 1Y63A 4Y2RA 3Q3HA 2JIOA 3RGGA 2QRJA 3D6TB 2HLNA 4QYXA 4OPMA 1LW7A 3TTUA 5FOUA 1CCWA 2RGWA 2FPOA 3HNOA 1S1MA 3C4VA 1JLKA 3LCMA 1MTZA 3LUBA 3ZXYA 3ENQA 1XVUA 5SYMA 3T1YB 1YZQA 1TU4A 1PL8A 4E12A 4IAOA 2WWWA 4IICA 3LVFO 3F8WA 1J09A 5HCIA 4BRZA 3IFSA 1DEOA 1XVLA 4RIGA 3AEUB 5T6MA 3AKZA 3PUWA 2ZJ1A 3KBBA 1TPZA 1ACMA 1X1TA 3L7YA 2P9ZA 5H59A 4LDRA 1L8XA 2C4NA 5AK6A 3TIVA 3HDHA 4A36A 3GDWA 1AF7A 2VF5X 3TECE 2D4HA 1N5IA 4OJYA 1S2MA 2DFLA 4LRQA 3EVZA 3LVBA 4CLEA 4KNWA 3ZHCA 1N2CE 2D1SA 4C4AA 1KY5A 1MH9A 1NDHA 3QF7A 3EIQA 2PS1A 2NUPB 3QVMA 5AW5A 4LHVA 1JIXA 1ZJZA 4US1R 3F4KA 2G1PA 1Q0SA 2WU4A 4RHEA 2IIVA 4E32A 2H1OA 2Q3DA 3RTCA 5AOCA 2BUAA 1WPRA 1F2UA 3I6QA 5EINA 2Z98A 2DE0X 4K9MA 5DLDA 1DDIA 5DM60 4X20A 1QDLB 1VSVA 3LO8A 4JP1A 5EIFA 3A9TA 1VHWA 2Q07A 3QXJA 2WHEA 4D9FA 2OBLA 3B53X 3RYFB 2XUHA 3FPSA 2QTMA 3N87A 3L4BC 4HVAA 1I6KA 3SFZA 1CPYA 3UK0A 2OUKA 3OT4A 2O8NA 4YREA 2EERA 4ZVTA 2QG6A 5F23A 5CDTA 4DKJA 1ML4A 2IH5A 1K2WA 1Z36A 2P3SA 1UJ6A 4F5YA 3CVOA 3BF7A 4ZICA 1ATZA 1XZCA 4XCQA 4ISCA 1ZD2P 4Z0PA 3QX7A 3EGDA 7ADHA 4CETA 3RVOA 4DR3B 2JARA 3JQCA 3ID6C 4PX2A 3MBKA 2GGSA 1T36A 3QTLA 5B57C 2WNIA 2P6MA 1RR6A 4YJ2F 2B83A 2MT9A 5C35A 3FYCA 3Q12A 4AJNA 3RYHA 4YHBA 5AKXA 1R27A 2ZB8A 1T34A 1X2EA 3GB9A 4TZTA 3PVCA 5AI9A 1JJIA 1ZNXA 3C3JA 4LV8B 1DE0A 4TUYA 1DV2A 3CR7A 5DGCA 3UK1A 2ECQA 1QBKC 2OD9A 4G9EA 4JT8A 4I8XA 5FOTA 4EG1A 5ER9A 3ZLVA 1UANA 3MRXA 1H1LB 1QCZA 3KUKA 5ADHA 3T3EA 5JJCA 3U6KA 3A37A 4HPWA 5AVSA 2VQFB 1BFDA 1C0IA 1ZSYA 1G4UR 2Z8YM 2IEAA 1N5DA 4GKVA 4ZK6A 3NOOA 3IPXA 1GG5A 2O2JA 1OTXA 2IDKA 4BB6A 1EI9A 3DL4A 1HGXA 1WV1A 2ZVDA 2X41A 2PA0A 4NMXB 1AOXA 4ZRNA 5JNWA 1FFDA 3G0OA 3O2JA 4U8HA 3E7WA 3EPHA 2HOQA 4MQ6A 4HUTA 2O2IA 4MVCA 1GPMA 1RCTE 5BN5A 1SK9A 3G5UA 5AJWA 2XDQB 3VDRA 5HSGA 2WWYA 2AN4A 5GVSA 2OZLA 1GRVA 2XNDA 4OI2A 2Q1YA 1EVZA 4C0QC 1OA0A 4H6VA 4DLPA 1R7RA 4C7VA 5JH7B 3LQRA 2VDVE 1Y8CA 2VWPA 3EARA 1MC5A 2R8ZA 3LA6A 3QUBA 4AMYA 1REQB 1CZHA 4QJ3A 2ZYRA 3TVTA 1ECBA 1HTTA 3FRHA 4U8GA 3DAYA 4EG8A 5FBRB 5EWMB 1L4HA 1QGUA 4DL9A 5FWXB 3L1JA 2HFJA 2BFEA 3TLEA 4JUIA 2XWSA 4IJMA 3ONNA 4A15A 4HMQA 2YX1A 3QKSB 3U26A 1SA0A 4TTPA 2O8BA 4GD3Q 4LJYA 1H4VB 1V47A 3S44A 2XXJA 2VTKA 2B3DA 4F7DA 1ZUNA 5DLYA 1UMDA 4M1SA 5AW6A 3TW6A 1JDUA 1RACA 1RLOA 2AXNA 2Z58A 2HX1A 1YASA 1V2GA 1XQWA 3TQQA 2G4LA 3UPDA 1GA1A 1SJ9A 2AJBA 2AOUA 1H0KA 1DQSA 1Q0QA 2PD4A 3KQOA 4UBJA 4DC1A 5HYVA 4GOLD 1Z6XA 1T5DX 1NMSA 1K6XA 2IVFA 2RIRA 1I4EB 1LDYA 3ZWNA 4BTLA 3DAFA 4CMGA 5JSZA 3EEBA 3HYLA 5JI2E 1UT6A 1UP6A 3O4IA 3ZZMA 4HNUA 4O59O 3B9QA 3TZHA 2GH1A 4TM7A 5ECWA 3M6FA 1NR1A 2CVOA 3EBLA 3RBXA 5C46F 1LJUA 2FF5A 1G8FA 4QRIA 4HNVA 2HA2A 2JK0A 2F9MA 3RARA 2VTVA 4MWBA 3FWNA 3TFQA 2I66A 3RS9A 4RF2A 2V97A 5KTSA 4KSCA 2XAUA 4ZQFA 1G6HA 2YHAA 4QYSA 2PVCA 4JKIA 4QU0A 3S1AA 3UHAA 4ARZB 4V0SA 3W0LB 2E18A 1HYEA 1NVVR 1TM5E 3AVQA 1CHDA 1T8WA 4PONA 2ZU6A 4X93A 4RE6A 4JLVA 4MS1B 5CGQB 3UMVA 4HLNA 4HPXB 2WABA 2X7XA 4X3CA 4D81A 3IHTA 4R1OA 4KDCA 1RMTA 5DTQA 5F78A 2IBMA 3U3ZA 4RGBA 3WGJA 1UPAA 4DILA 3WNZA 4I14A 3AFHA 2A0WA 2DF8A 4MRMB 4NU0A 2WWXA 4P5EA 1GIAA 5D85A 3W3ZB 3KQHA 3AW9A 3OQOA 5CVUA 2VHZA 2ZIEA 5CXUA 5LNK6 3EISA 4K0KB 3LX8A 3CIOA 1ANKA 4BPBA 3E61A 2QL9A 4RLFA 4UNIA 3RSZA 3UAOA 1EB9A 3SM9A 4GPZA 1G5HA 4D25A 2OE2A 2NPFA 1YZHA 1H42A 3KKLA 5D5PA 1A69A 1J0BA 2ERYA 1E92A 2XCLA 3OZ7A 3T0GA 4EAAA 5IVHA 3QXXA 1PJTA 1XELA 2GZSA 3OKAA 3PKZA 2WTUA 1KQ3A 1BXRB 3I2JA 2QD5A 3E3OA 1RC0A 2P4HX 5CLIA 3O92A 4TSKA 5AKJA 1R5NA 3I0NA 3Q7TA 4PAGA 5JATA 4PY2A 4EB3A 2CJFA 4GZ6A 5KDDA 1PVVA 2W6JD 3U7FB 1P81A 4BMDA 3QVTA 4EDFA 5JZOA 1XNQB 4I4CA 4MVYA 2FPPB 1JV2B 4Q24A 2J87A 1FVFA 3RU7A 3Q88A 2WG0A 2BM1A 1XVAA 4KR0A 1VLQA 2R96A 2H2WA 1OZFA 3CJRA 4B3XA 4H4CA 4IVNA 4L6CA 2I1VB 4CIYA 2I4IA 3UAWA 2XWQA 2VR1A 3G8CA 2W4MA 3ZZUA 2CV2A 4BNLA 4QHSA 3OJCA 4QPJC 4A5SA 4LSGA 2VDOB 2BR5A 1DPGA 1TCUA 2BV3A 2OCYC 2ONZA 4RLQA 3KL2A 1WXHA 3NDPA 4JT9A 3L5OA 2OQVA 3R9KA 4LF4B 3HS3A 3PDJA 4YT8A 1RABA 4UARA 3PUIA 1T3HA 2P6UA 2CL6X 3GJSA 1IB0A 3IRUA 1TM4E 3AUXA 4NHOA 4X91A 1D03A 4BZPA 1NVAA 1JWAB 3TG2A 1U8AA 1GAQA 1IZ9A 2CFCA 3H0EA 2RC5A 4LSWA 2ZS7A 3W6OA 3QQ5A 1NM5C 1JXQA 1M2JA 3H7IA 4RX1A 4BJ3A 3GJ4A 1UF9A 1AGYA 4Q16A 3F73A 3U56A 3BZBA 3AWDA 4B34A 5TR9A 3GGCA 3LP5A 3WIEA 1TZ2A 2VYCA 3DV0B 2XF8A 4UFNA 2CYCA 1Y5IA 2QF7A 1JI0A 3KV1A 3T7AA 3TR6A 5FWNA 1Y7IA 2ORWA 3CZCA 1CIJA 2NO4A 1OZ0A 2Q1UA 4NPAA 4C0AC 2XECA 1QTRA 1VPVA 1UL1X 4IDOA 4FI3F 1PQWA 3ODGA 4RTMA 1J25A 4RNCA 1A9QA 2IGBA 3OPVA 3F9IA 5GV8A 5GIPE 3F9CA 2ZBUA 2BFOA 4OB8A 2QROA 4NZZA 2HMWA 4L73A 4IYJA 1ZW6A 3IUQA 3H83A 1XP5A 4MA0A 5KREA 2ZUFA 1Y9DA 5AK0A 1DC5A 4MVJF 1ONBA 1QJ4A 4OHRA 1P2FA 1NVKA 2WFMA 4IG9A 1KBZA 3FCOA 3V4FA 5KAMA 4G0OA 4X8LA 3U7QB 5K0EA 1B0PA 4TL8A 4UCXA 5DHRA 3QG5A 2YFYA 3FYTA 3FPEA 3M1LA 2JG3A 4JFRA 5C1BA 1OLXB 4WXYB 6YASA 4BX9A 2UXDB 3NFRA 4HXFB 1P1KA 2R8XA 3MJRA 3ZD6A 3KKPA 4MTLA 2HD4A 3HYTA 3MSCA 5C81A 2DT5A 1ISIA 2WTAA 4GI3A 3RHZA 3RS8A 3L93A 4Y18A 3OLWA 5AKLA 1YA8A 2VWGA 3NTLA 2IYYA 1XP8A 1BQEA 1RE1A 5AK5A 5KC9A 2B8EA 2G08A 1IN8A 2JGAA 4TKZA 1GTVA 2OORC 1SBNE 2OP0A 4QUDA 2H16A 4WXPA 4ZEOA 2FSVC 1KBOA 2XYVA 3HVKA 2VDRB 5LCXA 3O1LA 4I3HA 4MH0R 3W4KA 3IP6A 2CXHA 3H8WA 1GGHA 3M4ZA 5M3BA 3QP9A 4D9NA 4HVLA 1ZHOA 5BV1A 3ND6A 3ZE6A 2J7PA 3IL2A 2PEZA 2PXHA 2XZTA 3FVRA 2XT6A 4JX8A 5CH5A 3SBDA 3C1TA 4ZA2A 4YX9A 3QFRA 3QX3A 2WWRA 2WHRA 5AKGA 3BILA 4WH0A 1DWUA 4P93A 1A9ZA 5ES4B 1AUXA 3KKOA 3TWOA 4MW7A 1JB1A 1QHHB 1C14A 3JD1A 1ILWA 2PL5A 3BHIA 5IU6A 1H3EA 4DRYA 3D6AA 3VZQA 3T8YA 1GG9A 5FTKA 4NJOA 4EZBA 2OG1A 4YMWA 3B2EA 3BWBA 3QIAA 1XOIA 3FOWA 4M98A 4HSGA 4Q66C 3OOSA 4FQ8A 2HQOA 2BBWA 2PO5A 4MW9A 2JI7A 2C77A 1GKIA 1YRAA 2YZGA 5C3UA 3UWDA 3FCUB 1U2DC 5JU6A 2VWQA 3E9RA 3W5CA 2QRPA 3A6FA 1CW2B 1XHLA 2J0VA 2Q1TA 1SQFA 4WOJA 5B3KA 1P2BA 2Z30A 4UXJA 2YMQA 1XL1A 4JCCA 5F77A 2JJ8A 5E6RB 1ONSA 2YBEA 1U0TA 4RSRA 3K1AB 2BC9A 4XLZA 2GBCA 3TXAA 4F71A 3SF8B 4EUKA 2FUEA 1L7XA 4A23A 1J07A 1KBQA 3B89A 1FCJA 3WLFA 2AJCA 3Q85A 3GR6A 3NHZA 1OIVA 1QP8A 2WAOA 1ID8A 1KP9A 1OXKB 2AFIB 4P8RA 4KZPA 5IZCC 1NVXQ 1R8JA 2NYAA 2QJWA 1BHQ1 1EEXB 1YV9A 1QV9A 2D5CA 3SMQA 1G5IA 1WY7A 3TSZA 1ZGGA 2I6SA 1HEYA 2YBDA 4OXKA 4R9VA 3UC5A 3G3EA 5ESWA 3LZ6A 2EFCB 4GQBA 4LF5B 1MOZA 2FRDC 3DUWA 5EJFA 4QUAA 1TAGA 1QGYA 4QFMA 2HC9A 1UMBB 2I1LA 2ZAGA 3IDSA 4L5BA 1T25A 2DTEA 3KPVA 4RQTA 1I6MA 5AK3A 4D9BA 2NUAA 4CIBA 1KEEB 5NULA 5CB0A 2IZOA 2VDLB 2ZRIA 3L77A 4G8CA 1RPJA 4R8KA 5JNSA 2DX7A 3HN2A 2QM7A 2MSCB 2R1TA 2VSOA 2AFHA 1HC7A 2BFDA 2QIPA 2WM2A 3KUXA 4M0UA 4N7MA 4IQ4A 4FW8A 2HF2A 5TQ2B 4ZC1A 3ZWOA 3QSYA 3WYDA 4DA8A 2F90A 4QYTA 3SX0A 1YQUA 2QYSA 3L1VA 4X00A 1JPJA 1R5JA 1TQ4A 4H17A 4MKGA 1WOYA 2YWEA 4LECA 4YDHB 5K3EA 4YJ3A 5KJ1A 4JI7B 4JL6A 1W4AA 2V4ZA 4DRZA 1NXWA 3NQ41 3S4YA 5I7WA 3IUMA 2ANBA 2ZUSA 3IA7A 3MTQA 4F1KA 1PJQA 4FGJA 4DCUA 8LDHA 4OLAA 1AH2A 3GXBA 5FTMA 4COKA 4P6VF 2IYZA 4UU1A 5MDHA 3ILSA 3Q87B 3UMMA 2ZVPX 2GT1A 4WI1A 3E9EA 2XUOA 2ZJ8A 1ZDMA 3FNBA 4DCMA 1NW5A 2PUJA 3P0EA 5C31A 4DSOA 5B2FA 5L8VA 4AJOA 4ILEA 1A3CA 2ZZKA 4M6WA 2O19A 3CVXA 4NYJQ 3K20A 2G09A 2R44A 4EHKA 1DOAA 1JKMA 1H1TA 1NG9A 5TDHA 3E0XA 4B3FX 3KXPA 4XWWA 1YR7A 2FW0A 3CEMA 3GRPA 3N3AC 3WP0A 3A05A 4P84A 4DJAA 4AG3A 4XWYA 3LQKA 4MQFA 4BVAA 3EIXA 3IMEA 5DN9A 3QVSA 4O4IB 1EWVA 1YGPA 2HJGA 5AW8A 1P0FA 2JFQA 1TVEA 3OP4A 1ZLYA 3R6DA 5KX5A 4DMRA 1P1RA 1UDCA 1X9HA 3D3WA 3PL5A 2XB2A 4RGYA 3M3HA 2C03A 1YCHA 2IIQA 3NVMB 4P08A 1PQ4A 1C3OA 1F2TA 5ECDA 2ZSIA 5LIRA 1W36D 2WHPB 4R69A 1CS0B 1RBMA 1Z7BA 3JQBA 1PWYE 3AX6A 4AF6A 1MZPA 3HBMA 4RZ3A 5GINE 1GGVA 5IK2A 3OTGA 1XJCA 3RF6A 1LDEA 3QFFA 2RJNA 3V1KA 2ZRCA 4B75A 1G0NA 1Y7PA 1H3NA 3A6HA 2IXDA 2QYHA 3KOXA 3WLKX 1SVMA 3FW1A 5LKAA 4OQYA 4CN9A 3EZ6A 3COYA 2WP8J 2C94A 4EJ0A 3KTAA 1SCKA 1NURA 1P60A 3K16A 2FZWA 1L7NA 3CT4A 4X20B 2QTZA 1IQ0A 1JXAA 2CLKB 2X19A 4EKNB 1KFKB 1ZMOA 3N2GB 1M34E 3QBTA 4HFJA 4Q3DA 5TGDA 1E2KA 1Y8RB 2B4KA 3MSXA 2RAUA 3F0TA 2NGRA 4HTFB 1V1JA 2XCUA 5K2OA 3B3FA 1EE9A 3N58A 4W9NA 5G0TA 1JSCA 4NS4A 4WV3A 3VYSB 2XNCA 2NYVA 3G79A 1N2BA 4E6EA 4QBGB 2OZPA 2BEWA 1ZITA 2I1QA 3K0AB 3KYCB 4RF5A 4BCDA 4F9TA 3WHPA 1T36B 3BICA 4OO3A 1CUUA 1JR3D 1ZN2A 5ISMA 3QKUA 1LKZA 4FEEA 4H6WA 3BJZA 2EKLA 4DADA 4EFNA 3VZBA 3JR7A 4TYWA 3HMQA 5L7YA 3BRCA 2QLMA 3NBUA 4D8VA 2GAIA 2ZBVA 1NW7A 1W1UA 3D4NA 3KOWA 3BREA 2XD4A 1B3BA 1T1JA 2GJ9A 4GKAA 4MGYR 2C2ZA 4JX9A 5JMOA 3P9PA 5IKOA 1T8PA 3OEHD 1C1DB 3T15A 2PL1A 1N32B 3QKWA 5LU9A 2PN1A 4DS3A 3I4CA 1OIXA 1XN1A 2ZAOA 4I08A 3TDNA 2JIBA 2WOJA 3HGTA 1N0UA 2D2IA 1GZ4A 3A04A 1T2UA 1OXTA 1GUYA 1L8LA 1UBJS 3AINA 2WM9B 4PLVA 3MWFA 4BGVA 4F1WA 2ZULA 1EHIA 4BGDA 2ENUA 4RVFA 2GF0A 5LMZA 1O5OA 2FPSA 5TVGA 2DP4E 4G8BA 4X0EA 2DH6A 3HDJA 4R1PA 3BCSA 3V2GA 1VCHA 4P2GA 3OE7D 5B1DA 1KTVA 3Q7RA 1O0SA 1ZEMA 1JIKA 2ZFUA 3IDZA 1TVMA 2I6TA 2WJZB 1JYSA 1S8OA 1U31A 3K0FA 3LBYA 5JZVA 1U7DA 2COEA 4FZ5A 4ZIRB 5CB8A 3TGPA 1N75A 1OMOA 2COKA 4KJXA 4LIPD 1DAFA 4PAOA 3SXPA 3T0FA 2R60A 2QMEA 3MWKA 2B35A 1KERA 3PG5A 5DM2A 3PA8A 4F4FA 1ULHA 5B53A 5BSGA 3SFVA 3PVZA 3A7EA 1LEHA 2UVPB 4IV0A 3FDZA 2O4CA 4M49A 4Q3OA 2Z2ZA 3MUNA 3TLKA 5BYKA 3Q7SA 3L5KA 4JUFA 2PKQP 5K4HA 4MVXA 4EYEA 1SR8A 1QGUB 3CH6A 3OJLA 4F45A 3KELA 5HIKA 2A5GA 3GL9A 3KQTA 4OY3A 4CR7A 4MV4A 3VNQA 3ME5A 4A2WA 1IBRA 1L7MA 3CCFA 4N7JA 4B7XA 3HXMA 1CE8A 4NABA 1TA4A 3JTMA 3AFIA 3GLFA 1PKEA 5L53A 1TD1A 1JKXA 1KDOA 2H48A 3DE6X 3PUYA 4OHWA 3GP8A 3OTHA 4MAAA 2Z6AA 3VJMA 3C3KA 2FKAA 1VL0A 1ZIPA 1D4OA 1AG9A 4RVDA 2XZLA 1I1OA 4YDQA 1OX4B 1O96A 2CD7A 3C6YA 4IZOA 1N6RA 1XQ6A 4ZCPA 1YC2A 4BVHA 3E1SA 4R1UA 1BH6A 4NYMR 4BUZA 1YFJA 4ZANA 1VPWA 4YY3B 4BAGA 4ND8B 3UB2A 5B7PA 4J4HA 3KB6A 4DG9A 2B8JA 2I4LA 4UUMA 4ZDWA 3H1FA 2VNIA 3PEFA 3EW9A 5HCNA 3GQBA 1Q1QA 2NSLA 3F3SA 4RADA 5TF4A 3U44A 4QGGA 1E2NA 1CZUA 4Q15A 2HJHA 1JU3A 3JD3A 2GSDA 2QZZA 3ASUA 2GQ0A 1C7FA 5BUSA 3TL6A 2B5OA 3FRJA 2WFLA 3ZK8A 5D84A 4LJ5A 2E1RA 3KKZA 1IXZA 1KEUA 2P0AA 2CYBA 1JT2A 3L0IB 4IV5A 5AM3A 5A3SA 1IM2A 2FLKA 3IJ5A 2VK2A 2W8ZA 3OU6A 3RVJA 1RZUA 4X66B 1G3MA 2GERA 2FX3A 3QE2A 4B09A 4XKJA 3L7CA 4MHTA 2WG1A 1JYEA 1F0NA 3EK2A 4V24A 4J94A 4BO6A 3LKZA 1MDFA 2B0JA 3O1JC 4PHHA 3HRIA 2ORIA 1Y7HA 3MW8A 2UUBB 1VG8A 4HH1A 2PS9A 1GSOA 4IUCS 4BGEA 2UYHA 5A71A 3LRTA 4F04A 1FFYA 2GR9A 1RHJA 2AOXA 4G26A 1ZIYA 1YQ9A 3LL7A 3QW4B 3UJ7A 2X15A 2ZBGA 3IMCA 2WU3A 1DRUA 4J2HA 1D0VA 4B40A 1CF2O 1Z35A 3OZXA 2GM3A 4C78A 1UQRA 1BMFA 1GY8A 4RV5A 5JRJA 2FN9A 1GCUA 1QG2A 5ENDA 4ML3A 4GOJA 4O1IA 2ADOA 5FUYA 4EHAA 3UXHA 5EKUA 1DMRA 5AICA 1H8HD 2O20A 4HJRA 4NICA 3FYDA 4OL0A 4I55A 2QLBA 4NZPA 4PS0A 1DRWA 4GVPA 3VYTB 1EB8A 3JR3A 3K7EA 2IQ5A 2PGAA 2LGJA 5KKAA 4ODIA 3SVZA 4EY8A 5EJIA 1D0IA 1W0KD 2PPLA 3I04M 3PQCA 4Q03A 2FEMA 1JHZA 1Z16A 3N7TA 4CF7A 1T0UA 1KOGA 3K31A 2R11A 1QPBA 4MWDA 3HKCB 2YHIA 1VI2A 1WF6A 3PDIA 2YZ2A 3WLQA 5JJIA 5B36A 4UQPA 5C1IA 4CUKA 1EFLA 5FA6A 2O3RA 5KOYA 2FSSA 4EGFA 2XUZA 3KD3A 3R74A 3NG1A 3SLGA 3C8HA 4ZEXA 2C04A 3K4HA 4KE6A 2A8YA 1YB4A 3VPDA 1P91A 2YWJA 1OLUA 3AUTA 1T5TA 3PRHA 4GC9A 1RZRA 1JKIA 1NSTA 3HJHA 3KEQA 5DVZA 5REQB 4YRAA 5AO9A 2FDXA 5BYJA 5CFMA 3RW9A 1FRZA 1XZQA 2CNDA 3FB1A 1WB5A 4F21A 4IQ0A 2FSGA 2W2NA 4R05A 4KLAA 2R3SA 2BH2A 1WOMA 3ZGXA 1DCMA 1SM4A 2I7DA 4ABYA 3C39A 3DF9A 4Q0MA 1I36A 1E89A 4KKXB 3AKCA 4PZ0A 4UBKA 3X2SA 1AKWA 4YQEA 4RZXA 1E2EA 1R18A 3JWPA 4WNYA 4BV8A 1DXQA 3PNOA 3H5IA 3RU3A 2GM4A 1JQEA 1SUAA 2HNAA 2J31A 4HY3A 1MPXA 1RU3A 3E9NA 4YO7A 5JNRA 5F2NA 3CINA 3HDTA 1RRVA 3REOA 1Q21A 4Z3KA 2B5WA 5KQLA 1U3WA 2GWRA 1DXOA 4PPGA 2V1XA 2VJMA 2W5UA 4X1OA 121PA 4QDUA 3EH1A 4OQFA 4NZYA 2QVYX 4GF5A 4RZSA 1YZNA 1SG9A 3BA6A 3KKKA 4ND4A 4ARBA 4WXHA 2YWXA 1EVYA 4GR4A 3BOSA 1A4IA 4GP9A 2ZI5A 3ZXUB 1PJSA 1VXOA 3S2YA 1HYHA 5I7FA 2CV0A 4BC1A 2PD3A 2BGMA 3VPFA 2L0XA 2ZWOA 1U2GC 1E9RA 3DW1X 3P27A 4FZRA 1FS4A 5TRTA 4H3VA 1WWKA 2QTNA 5EMKA 4RTPA 4AF8A 3LCCA 3WGKA 1YS7A 3D59A 3U4CA 1K5DA 3B5EA 3IHLA 3C2QA 1NX9A 3N1UA 3PFHA 4YT5A 4ARAA 3DZ8A 5IASA 1OVMA 2IPMA 2RGEA 4I99A 5HVNA 2EX0A 5KQMA 3KYDA 3ZU3A 1WX1A 2D1YA 2DUUA 5DFAA 4LYFA 4BX2A 3PHGA 3PV0A 1YBHA 4J7UA 4UNSA 4C05A 5ARDA 4IHJB 1DEAA 1QKJA 5JZMA 3CTPA 3I28A 1BDJA 2FWNA 3QHQA 4AXXA 3ZGOA 3H3JA 1N1EA 2JBHA 3HBLA 4OBBA 3ZI4A 3WYEA 2CVPA 3TQSA 2Q9AA 5TT0A 4RTRA 4DGQA 3N8NA 1MEOA 2PUTA 2PE5A 4FYHA 4CM9D 1ADYA 1RPAA 4PYLA 4DCOA 1G38A 1A7AA 2DFKB 2E48A 2XUGA 4R5MA 4EF6A 4FYYA 5KNCH 2AR7A 1T8UA 3EDOA 4FSXA 4K9PA 2PFSA 3LVQE 1FU8A 1CZOA 5FF9A 3RBVA 3TKAA 4CTOA 5SYAA 1RRGA 3ZJTA 1H2EA 2I2BA 1G66A 4WY5A 1WO8A 5EIOA 5K8UA 4HGQA 5JC1A 3GEEA 1TT5A 4C4PA 4EBBA 4IOKA 1QIFA 2ZUUA 2A0FA 1WUTA 4M0EA 2OPBA 1A8QA 3A2LA 3DVRX 1ORTA 1PQYA 1RWBA 4HGOA 3UW1A 2FFRA 5C8YF 3EEOA 1R4NB 1CQPA 5G1OA 1H22A 3BFVA 4MP8A 4R31A 4BE4A 1N0WA 2CJPA 4HDSB 5FTWA 5KYXA 1EM8B 2HL6A 3M6UA 5F1OA 1NMZA 1TZMA 2Z57A 4HPJB 1P7WA 4LJ4A 1RM5A 1SVKA 1ZUD1 2OMKA 4DLUA 4HAOA 4O2LA 4OLFA 3ZS9A 4YAGA 1S5PA 3SQXA 4DLBA 5LJIA 2AJDA 4MS4B 1A9YA 1R0WA 3UN1A 3K8QA 1E7YA 3OESA 1ZINA 4F3TA 3BSFA 3BN3A 3DMYA 3HCRA 5EIAA 1XZFA 3F78A 3TNJA 4CZ2A 3DFZA 4ED9A 4DYDA 1QOQB 4KOAA 4ZJYA 1ZD3A 2A9OA 3EFBA 3CGGA 3FOZA 3P0HA 2PHZA 4WCFA 3ANXA 3SR3A 3AFNA 4HVTA 5IBRA 2EU8A 1UKCA 4IFEA 2VF8A 4IIUA 2DPHA 2C5BA 4DLNA 1AKNA 3OM8A 1G8SA 2WDPA 3O9VA 1OCEA 4LX0A 5IDVA 1I9GA 1YC5A 4QUEA 4JIGA 2NG1A 3E2MA 3OSUA 4PHFA 2OQ2A 2RGAA 1GXSA 4Y9DA 2ZBPA 1P31A 3GEGA 4Z4HA 1O77A 1VG1A 3GVHA 4A6EA 1AS0A 3G7NA 5D51S 2I6FA 1WY5A 4LK2A 3WLRA 5GONA 4QDTA 5DTIA 2QKYA 3EC1A 3A3NA 2VZ8A 4W8OA 4XGNA 5DHUA 4ZYYA 4EZIA 1IN7A 4U2EA 2CCJA 1KP3A 1GDTA 1XD8A 3DOJA 3V7YA 1XZNA 3CUKA 3OPNA 4Q4LA 4B6FA 5CFPA 2ODAA 4GNRA 1ENPA 2XSZD 5LA6B 4EO9A 4ZCMA 4YCNA 5BSKA 2G40A 5CB4A 4F3RA 2IP1A 3FSGD 2GTHA 3EVAA 1GL9B 2PYDA 3PQ5A 3D1JA 2GWHA 3DTYA 3CWQA 3B60A 1ISFA 4MV6A 5I9SA 3WXBA 4R81A 2NZUG 2XYRA 2AX4A 1UWCA 4JBIA 5J43A 3C3CA 4GSYA 1UK7A 4J16A 2JFNA 3V2UA 5BOSA 2CLLB 2UV8A 2AQHA 4C30A 3W5SA 2OZKA 2WT9A 1TM2A 5AXDA 3HP1A 4AKTA 4NYIR 3ZI0A 3HJRA 5LLDA 3F3YA 4JLJA 3OIDA 3AH8A 4CKEB 4J2TA 1Z8HA 3LQ4A 4PIPA 1O87A 5BW4A 3AJ9A 5FBLB 3NWJA 2YOGA 1J39A 4YHHB 2AQIA 4KTVE 3ZE0B 4PNEA 3DNPA 3Q5EA 4ZOCA 1WXQA 1XAIA 3LP6A 4HB0A 3T3GA 4Z2YA 4YRZA 2LIVA 2JDIA 4M6WB 3THOA 4L85A 3F7TA 5H02A 2W6IA 1HE8B 2OFPA 3F67A 3F7NA 4LW8A 4TV8B 1H6AA 1O54A 2F3PA 1UBKS 2VXOA 3N8GA 2F55A 3GJQA 2ZAMA 4XA8A 4BN5A 3DCIA 1E0SA 1O9BA 3GARA 3R6LA 1CB7A 2BN4A 4JB0A 5K0TA 5C0OE 1JQBA 4JBNA 4WOCA 5A4DA 4GSLA 3GH3A 1L7AA 1DC4A 1THTA 3W9UA 1QO9A 1VLMA 3CLKA 4QJ4A 2Q21A 3WMGA 4F93B 2B4QA 2R66A 4KI7A 2PRZA 4BU0A 2G9NA 3ABSB 3FH0A 1IM5A 2H1HA 2PO7A 5I4BA 1Q0PA 3MRSA 3V4ZA 2H07A 1IUNA 3L4SO 3BFJA 3KSBC 1QE5A 3VBCA 2PV7A 3ORYA 4Z86A 1PU2A 5I7HA 3OU2A 2X2FA 1E1YA 3SYRA 1FTWA 2GB4A 2W2PA 2WHXA 3UMSA 2MSDB 5H83A 4M9ZA 1PJ3A 2CL5A 1ZGBA 1I33A 1U7UA 2EJVA 5HE9A 3FD8A 1KJ9A 2KQUA 4I46A 2ES4A 3D43A 4L9AA 4I6JA 3CURA 5HJ5A 1ISJA 3QEKA 1U7TA 5ELMA 1L5ZA 3IAS1 1N0VC 1IMOA 3EULA 3ROXA 5CFOA 1OWMA 1X8LA 2HPVA 2HJRA 3PC4A 3PICA 4B5KA 5C1OA 4U02A 3VR6H 1CNEA 1II8B 3VU3A 3BL5A 1U8UA 1YQTA 2ZIZA 2ZPAA 4MRPA 4ZKDA 2ANCA 3EGWA 1B74A 1T9GS 3BULA 4KQGA 1SHJA 4EX7A 4ZOLF 3Q8KA 2C1XA 1J23A 3Q3EA 1NQOA 4PC7A 2EQBA 5AR1A 3Q6IA 2H4HA 2PX4A 3TLXA 2VHTA 3SCZA 2VTBB 2FP4A 4BWGA 3SFTA 3GJZA 1H2ZA 2QVBA 1Y9AA 5F1PA 5TSDA 5DI3B 1B8UA 3DTVA 3IUJA 1OA1A 5LZ2A 1KHTA 4EKIA 2BI8A 3WNCA 5CG1A 1LDNA 3ENWA 3DD5A 4WW0A 3LUGA 3ZHRA 4Z4CA 5AM1A 4RK7A 3OO1A 4A8JC 4IOJA 2XXAA 2P5SA 4TQAA 5AI0A 5E1MA 3SQMA 1VKOA 4KO1S 3PC7A 2J5RA 1S8FA 5CLHA 4AXBA 1N7IA 3QVOA 3PGXA 3T3IA 3WGVA 4UVDA 521PA 2B0CA 3FVWA 3JU3A 2HTFA 4KQCA 1JEYA 1FMCA 3QA9A 3R5SA 5INTA 2CD9A 3V6MA 3GK3A 3PCTA 1BCRB 2EJWA 4NOMA 1BN7A 2TMKA 2PMDA 4UMDA 2IXGA 4LE1A 5BMVA 4GL2A 3DKPA 1EJ0A 2IKSA 2J9YB 4MWGA 3U81A 5J1TB 1MB9A 3RKSA 3ASYA 2D7DA 3ZLUA 1RBQA 1KQNA 2EYUA 4JB8A 1T1IA 3OOEA 4TXLA 2IYAA 1H4SA 3OUUA 1U90A 1MR3F 3BORA 2O2XA 3EIHA 1OFIA 2E37A 3EXHA 4Y2XA 2BTQA 2GCPA 4KFSA 1K6MA 4ZPJA 2IU0A 4DMKA 3IOMA 3DV9A 4P4TA 5CG2A 1I13A 2OVBA 1P2TA 2X6TA 3LXXA 1C7EA 2HWKA 1BMDA 5DSTA 3TM4A 4KGZA 3DEJA 1R8QA 1TMOA 1F4PA 1EINA 4UTPA 1BIFA 4ZQCB 5JEEA 1AQ6A 1QG6A 4LY0A 3BXGA 1Z6PA 4RY2A 2PRSA 3HB9A 4BOYA 3W5VA 3UG7A 3AM5A 1BOFA 5DO9A 4A2CA 4BFZA 1SIUA 2XUFA 4LE2A 3SDBA 1QU2A 3DZKA 5M2QA 2H65A 1SY7A 2QR5A 3Q2KA 5KQPA 4HZIA 4I7EA 3W2GA 4B1FA 1Q17A 1VJDA 1Z4JA 2OHFA 3PFCA 5ABPA 3FZEA 3MF4A 4G1FA 3L8EA 3F4LA 4LOAA 3EQ7A 4C3VA 1LLFA 4RDCA 4H35A 2MIIA 3WLOA 4EWLA 2PMKA 3ZY6A 4F4JA 5LQNA 3PHBE 1KKMA 2YXBA 3A58B 3C7CB 2IHVA 4BFLA 1UXGA 3R7BA 2EP8A 5IXSA 2VG8A 1E9BA 4Q7KA 1AGXA 4TLMB 1SZJG 2VRCD 2PT7A 4N1AA 3EFEA 3E1GA 5JC8A 5BVHA 2CZQA 2VF4X 4NZMA 1OB2A 3GG2A 4A6PA 3B1JA 2VJAA 1S89A 3ONWA 1KMHB 4DTCA 3EPLA 1SXHA 4URHA 3FA2A 3Q9UA 4CMIB 2BIFA 2OG2A 1BC5A 4X90A 1E1MA 1G6OA 3PCXA 4E2WA 2WJJA 1V6AA 2BMJA 3U9LA 1Z22A 3ORSA 3EAGA 4JLOA 1I3NA 1QVVA 2VAPA 1RKQA 3HU1A 4A8PA 4MQEA 1SU8A 2Q41A 2AG5A 2JZOA 4XVRA 4AQ7A 2OXIA 2EAUA 3MUFA 2NSJA 1KARA 5CT8A 5TNXA 2Q9BA 1F8XA 3NRJA 3F5MA 2QM8A 2AQKA 2NO7A 2ZIAA 5FOXA 5IHPA 2QN3A 4Q9AA 1UPCA 5IXJA 4EUFA 2JCGA 1L4LA 5B6IA 1NA5A 1YOVA 4B3BA 5KEIA 4HV4A 2GBGA 1PEKE 3OOHA 4BNUA 1VL8A 1IEXA 1QBGA 2IUTA 4G1MB 5PNTA 2BKEA 1QIMA 4BMXA 2BI4A 3L4KA 2YFQA 3TQOA 1E64A 2GK7A 2XB4A 4NBRA 2IS4A 4KR9A 1HLFA 3GEHA 1M34A 1B8NA 1ZM3A 1A71A 4DLLA 3QPAA 1ADFA 1H6DA 2M2IA 4PHGA 4RA6B 2W2KB 4NJEA 4CLOB 5JYEA 3R1IA 2PKEA 4JOSA 4O2AA 1OYVA 3NOXA 5BUCA 1NW3A 5DISB 4NCIA 1KVTA 1QH0A 2ZBDA 1QFXA 2Y3IA 3HEAA 3K09C 3QU2A 4N0DA 3UA4A 4C6HA 4PLZA 1CG6A 2HK9A 2IS2A 3G0DA 3EY4A 2R48A 3RRYA 3ER9A 1QK3A 4DF3A 5F7ZA 3E3NA 1GA4A 4ZVUA 1KDVA 1YQQA 3DLTA 4OU4A 1DBQA 1XCOA 3E82A 4Y2PA 3RAPR 3KUDA 4FYWA 1QJCA 2POCA 1VHJA 4BDTA 3FSEA 3WWOA 4V3BA 5BXYA 2A1UA 4C22A 2QRVA 3AZQA 1IBMB 4JGBA 3Q6NA 3L40A 1MO2A 4UW9A 1TTHA 4POAA 4UCFA 1QQ6A 1WLSA 2P9JA 5CJ2A 2RHBA 1ZHHA 4C14A 1VDMA 2PRJA 3DHYA 3P9IA 1P2SA 2GK3A 3QLVA 3AP2A 3KHSA 4FJ2A 2HPHA 2RJ3A 3D6NB 5JVDA 1OWOA 1WHSB 3D3KA 2FPRA 1R9NA 2OC9A 2W0SA 2ZTVA 3A6EA 2Q9UA 1P4HA 4B6EA 4K6CA 4LHWA 1NIJA 2B4YA 3IPAA 4C7MA 4UM7A 3RT7A 2CHEA 1R8XA 2K5UA 2XKAA 3RRXA 3AUKA 4WFQA 2MSLA 2Y0EA 1BGVA 1VLLA 2EEZA 4IDPA 2YV2A 2UAGA 4IQGA 4AI6A 4Q7QA 5ALDA 3W8FA 3ZVMA 1DTEA 3A3PA 1Q1EA 3N2KA 2Q7OE 4POOA 3DMRA 1S2NA 2D6FA 3IEKA 2V65A 4ZO6A 1O9GA 3ZKWA 1X7XA 1OU4A 2PR7A 3W2IA 4MVJG 4HAYA 8OHMA 3ETEA 4U9HS 4EJ2A 1Z8NA 2QQ0A 3PNYA 2H2DA 4DMUB 3LDUA 2G8LA 3SSAA 2ORYA 4FYMA 2RGNA 3MEQA 1QB8A 1B1CA 4NWIA 4MYSA 2B7CA 3L46A 3AI2A 1VRCA 4MULA 1GN8A 3Q7QA 4LZJA 4ZMRA 4UOEA 1MIHA 3IO3A 4TROA 1U4SA 4DGSA 3Q7EA 4WY8A 3T7RA 3ZH9B 1DI0A 1MG5A 1PDVA 2HXGA 1IVSA 4XARA 4AUMA 4F46A 4KR6A 1U4OA 3DS8A 3VPBA 3ROPA 4UBIA 2CMDA 2O8FA 3QPVA 3B9BA 3RUAA 1QP4A 2P27A 3P45A 4D9GA 1VKHA 3K5WA 1A82A 1HQKA 3JQ7A 2H3EA 3T7IA 3JVIA 3CRMA 5JG7A 5B7GA 5FL7A 2VC2B 5FUBA 2XNDD 5U9CA 3RSLA 4MHOA 4Z53A 1KHHA 3DZFA 4JBXA 1PZHA 2O14A 2NX2A 2NOAA 3KSUA 5GV7A 4DR4B 4CG3A 4B76A 1C7QA 3WDSA 4DYHA 1W5EA 3CLTD 4PSAA 3WGLA 1YU6A 4FHGA 4RVUA 3BBLA 1UJCA 4L6IA 4NU8X 4OAQA 5E7IA 4F9GA 5J1SB 1PGOA 1AKMA 3HXPA 3IAS6 4BCBA 4F84A 2OO5A 5C18A 2WJGA 2PQMA 1U9CA 2B37A 3GWZA 3O0TA 5AHKA 5H82A 5LUBA 2RGYA 3OIFA 1R66A 3VHRA 2HK6A 4DQ0A 1E79D 4LKRA 1PD0A 3NCTA 3KYDB 5EZYA 4MV7A 2GA9A 4JY7A 4RHTA 2QN9A 2R6FA 2H4ZA 2QG9A 2WKWA 1JKFA 1K6EA 4KIGA 5F12A 2Q46A 1Q95A 1V5GA 1X15A 1X7GA 1P5HA 1QF7A 4CFYA 1FPQA 1X94A 2C4TA 4BB5A 4PZUA 2VSFA 3CSDA 4HC4A 3V48A 5GMOA 1WV0A 4N0QA 1PS9A 4YR7A 4O4HB 1HDEA 3H19A 10MHA 1VJTA 1H2HA 1V9CA 5ILGA 3IE1A 2IXFA 2VNKA 3GFVA 3GYGA 3EW7A 3O8BA 4PO8A 1KAHA 2HPAA 2B1QA 1J49A 3W05A 4YQFA 3PD7A 4GXRA 1XBTA 1EJ2A 1KJNA 4ZO9A 2J4FA 4I5IA 1JFFA 3AEQA 5I7AA 5K3AA 1PJRA 2PJZA 2ODNA 5L4SA 3M70A 5G41A 4B3DA 3GCGA 1ZLXA 1N4AA 1G3RA 2XBLA 3CM0A 1C9DB 2CLOB 1KIMA 1NLFA 4D3XA 4EPWA 1Z4PX 1ZL0A 3QFCA 1SG6A 3QKTA 3QMWA 1TCVA 2YZ7A 1C0EA 4BFCA 4EEZA 1TCCA 4MJ3A 1JFSA 4J76A 4ZDJA 2VTEA 1JHVA 4P98A 1L8OA 3R5KA 1DIBA 4KGXA 1FQOA 2BGUA 4ES6A 3JAMA 2A0XA 2PH1A 2PMBA 4BFVA 4E2ZA 4CF4A 1M2OB 3MOIA 1RJWA 2OSBA 2R7NA 4HF7A 5DWQA 3GOHA 3M83A 4F96A 3ZHXA 1HLDA 2ZI4A 4CMEC 5HQTA 5J59A 4OGLA 5JPDA 4YXFA 2W98A 1TFRA 3K94A 2G71A 3ZY5A 4X1YA 1V45E 1OZAA 5FOWA 4HADA 4DRXB 2CMKA 2LIPA 2Q5EA 4UHCA 1DIRA 1P73A 5FO1A 2IHTA 2WR8A 3O8LA 3JQEA 1MAVA 1GUFA 1FQJA 2G8NA 3B52X 3HB5X 3LOPA 1E2FA 2QR2A 4S24A 3G8AA 2QLJA 2ZYHA 4RD4A 2GN4A 1VIMA 1J0AA 3W7AA 1BMTA 3CUWA 3BMNB 3JARA 4ZKEA 3B2QA 4CYMA 1IPEA 3B1VA 2PANA 3NR2A 4ON9A 2BDEA 1Q6ZA 3IDQA 4G8JA 2XODA 5BSHA 3IHWA 2CUKA 3CZRA 1G21B 4N9QA 4AWBA 3PGKA 2Q99A 1GXSB 2CDNA 3ORHA 1MBZA 3LKVA 1MJGA 2EX4A 2MMGA 1TIBA 3GUUA 4PFSA 4BFWA 3E1KA 2X8JA 4UZEA 1QX4A 1HDCA 1R10A 3CFYA 3IE2A 4KUGA 2Z2KA 5CA1A 3W5BA 1JT9A 5HZGA 1DNPA 1CY0A 2XUJA 4IH1A 5GGYA 5AIBA 3I9FA 1P4RA 4H31A 1IXKA 4LTNA 5CYFA 1DU4A 3VJRA 4YI3A 3HCNA 1I3OA 1KI1A 3LDHA 4TS3A 1ZJWA 3HJNA 3GPLA 3HA3A 4M46A 2Q5IA 4F3NA 3QMVA 2CXPA 1KQPA 4X63A 3KB1A 1APBA 4DB2A 6ABPA 3E48A 1J2JA 1KAMA 2X86A 3WRYA 5T4FA 4CL8A 2H51A 1KKUA 3CRRA 4BP9A 1U3TA 2IEGA 3GJYA 3I3OA 3O75A 1AUOA 4GRAA 4N5NA 3RS7A 5EPOA 2Z2XA 4MW0A 3MQ4A 1W34A 3IT1A 4CNBA 4N76A 4ZRDA 2ZE8A 4D4LA 1CUDA 4OM8A 1T10A 3VC7A 2GUGA 1UFVA 1X74A 4JAVC 2FN7A 1HEUA 1ZJ6A 3B9PA 5DCUA 3IBFA 1UT8A 4HEJA 4MUIA 4MYHA 1W8DA 3ZH2A 3WWZA 3OFJA 1G6KA 5L3VA 1MRNA 2JGEA 2QRZA 1N6IA 1XF1A 4U9IS 5EXSA 2IUUA 2VJQA 4CV0A 4PVDA 1Q20A 5HWSA 1U8FO 3GLIB 1T0PA 1NLMA 5ALLA 1B6TA 1U11A 2VZLA 3WIOA 2RBEA 2ZWMA 1W0JD 2P3OA 2I99A 2Q5CA 3TSAA 6AT1A 1L5HA 4KHZA 3U62A 3ZIAD 2H4WA 1KO1A 4FP9A 2ZB2A 1PVDA 2EQ5A 4CODB 2DLNA 5EVCA 2EV9A 2J9FA 2PQ2A 3W3AH 1CUJA 3C8UA 2LUOA 1VIAA 2VDQB 4EY7A 3GCDA 2PNJA 1HKUA 3IODA 3MLBA 4OA8A 4PO3X 3BD7A 3KUUA 2W00A 4Z7QB 1ZR4A 1QE3A 1KOFA 1YDWA 3GUHA 1NQVA 1M73E 3HSKA 3KCNA 4FBGA 2IU3A 4RH1A 5EAIA 3TW0A 2UUCB 3SZ3A 4CIXA 4D9CA 4M4SA 4EVIA 5EJ8A 1N3BA 1GPJA 4JXXA 3WJ2A 2KBEA 3UTDA 4WOBA 5C5CA 4OGFA 1AO0A 4XJTA 2V58A 1GITA 4TMKA 2OBXA 5D8DA 3E03A 4NU6A 3P20A 5F7OA 1M67A 4DIKA 5C2JB 1E3WB 4D4GA 2CGEA 5E4TA 1LPNA 2CEAA 1TYBE 3PNQA 3VTZA 4C1NA 3VKGA 4L0MA 3GPIA 2HDNB 3HB1A 4UAGA 5E7QA 4C2TA 2GILA 3H7AA 4C89A 3K0CA 1WP4A 3NKFA 1XKLA 1TZJA 4D0NA 3SIWA 2JEYA 2PLRA 3KJNA 1SRQA 4D8YA 1N36B 4JJEA 3DT8A 4RVGA 1E6WA 4QNNA 5AUOB 1DJPA 3K2IA 2QPAA 2YY5A 3USCS 5JANA 3BXXA 3TE6A 1EBUA 2CLFB 4FR5A 4UUOA 4BEWA 3H6HA 5A7HA 5JBQA 2IBSA 3S1LA 3BCRA 2R7LA 1P1JA 2HT6A 3EIWA 3OJWA 4PRLA 2G06A 2J6IA 6NULA 3GD7A 4KQFA 1A5AB 5BVGA 1LPMA 1DG1G 2J4DA 3CTMA 1N5JA 2XKKA 1XHFA 5KTTA 1TEZA 1TC2A 2AK3A 4JLAA 4ZAGA 2D3WA 4CTKA 1UDWA 4P53A 2XCSB 1S2GA 4YRNA 1HZZA 2HH9A 4KIUA 1MB4A 2C96A 4NZOA 5J2TB 3ZXSA 3AVPA 3H2BA 1HY3A 3I6BA 4ZWNA 2ACEA 2BZ0A 3TFWA 1RFGE 1THZA 1ESDA 3PL1A 1OPXA 3D1LA 3D8NA 4JQZA 4LRUA 4PSVA 1CEEA 4NHEA 3ZDXB 3CW9A 4EF5A 1EFHA 3UK7A 2F1IA 4UTVA 1R00A 1B23P 3L84A 4CCAA 4RMNA 4CNQA 3A27A 4YJKA 4EJMA 2ZJAA 2AZXA 4FMDB 1ZD8A 3ZI7A 5KS2A 5ALJA 4JYPA 4UEJA 4YAOA 2HM7A 3JYHA 4FMBB 1PDOA 1XJQA 2AUNA 3I8SA 4M9XA 3ZBPA 5BMVB 3GCWA 2G83A 4NONA 3IOYA 1GGKA 2D0OB 3LIPA 5BRJA 1K66A 2QLNA 3SQLA 4F6LA 1WJGA 3ZVKA 5KDLA 3TMAA 2NADA 2ZANA 3LM8A 4KIJA 4S04A 1G19A 3QEMB 1PYOA 1SOWA 5LM3A 2VLBA 4LYYA 3TFOA 1E9VA 2WKQA 3BD6A 5J2UB 4CPDA 2FHSA 3O73A 1Z06A 5ITZA 2JGFA 4D2IA 4D0SA 1USKA 1L4NA 3AETB 1T2NA 3HVHA 4A1OA 2FW6A 4A0QA 1JHOA 3GH1A 3I72A 1K4KA 2J85A 1XVVA 1VHQA 4G85A 3HCPA 4O0MA 3KJQA 5ITSA 1NX6A 1U3GA 1IB6A 4N5HX 1H9AA 3OO0A 5L3ZA 1M6YA 1CQWA 3UV6A 1DXHA 3E22B 4TVKA 1E4EA 5E2IA 1ODLA 5DRTA 3T06B 3GZTB 4WBSA 4MR8A 4XJVA 3N0TA 1DS6A 3PE4A 2GZ3A 3KYBA 4Q82A 4CKWA 5IT5A 2PGDA 4I6GA 4DC9A 4G63A 3U16A 4UMEA 1C9YA 4URVR 5J3JA 1YMVA 4R83A 4RGVA 4OQQA 3T3HA 4CMAA 4I2VA 1OTHA 1Q92A 4M0KA 3LK7A 2WKPA 4Q9NA 4UDXX 3GEPA 3I9LA 4EW1A 5KWEA 3L6CA 2RCYA 3PZRA 3AMVA 2IU4A 2YC2C 2CLHB 3T9FA 1W59A 2Y1WA 1FZTA 3GIWA 1S02A 2QB5A 4AN0A 3TLYA 3HZOA 2X77A 4HDNB 1ZRSA 3T34A 3KZKA 5LD2B 2F62A 4WZBA 1O5TA 4G5QA 5AVVA 1GKKA 1Z34A 1QHEA 3ENVA 1JLLB 1S3GA 1EQAA 4HEA1 1R0RE 3E9CA 2ZW9A 5BURA 1QHXA 1YTLA 3K30A 3PDWA 4TM8A 1GG2A 4TL9A 5EIWA 5TMEA 1OXSC 3RRMA 3QFSA 3TJRA 2YJ4A 4NIMA 3PJEA 4NX2A 3RADC 3A11A 3DB2A 4S1PA 1OPRA 4HAWA 1QHIA 4YP9A 2E4UA 1V0JA 2YASA 3KHTA 5CAEB 5JMTA 1XLVA 2ZREA 1VL5A 2DU8A 2HJSA 2PDAA 1N33B 3M6IA 3O1IC 2IXAA 3KAQA 3D6JA 4P54A 2IW1A 5CH3A 3QK7A 3OCUA 3HTXA 4X85A 4HNHA 2JLXA 2FH5B 1ACJA 2WQZA 5IYZB 4G81A 1DB3A 3IT2A 3MWYW 3GBVA 5FV7A 4KAFA 1MH1A 2HIAA 1YHZA 2OLKA 2UYGA 3SR0A 2IOHA 3STUA 2NXJA 3THRA 1VGRA 2YWFA 1BVUA 3VC3A 3WLAA 2HO5A 3GLHB 4G4IA 2BEUA 4OHKA 4A0SA 2FEXA 4XB6B 1NBME 5CD9A 3INRA 4IDFA 3RI3A 3K6SA 2NSDA 1T2DA 3H6KA 3OFVA 3PXBA 4ISBA 3WRVA 5BR4A 5B6PA 3DNMA 1UFKA 2IX9A 5BYAA 3LZCA 4JJ4A 1ONPA 1K7YA 2JFXA 5CURA 1QANA 5K4AA 4BUCA 4AU1A 5IK2D 3D9QX 1WBJB 4Y0VA 1VL6A 1C3VA 2M32A 1ISGA 1P4AA 1E32A 1WE2A 1YZTA 2CW5A 2E85A 4S1NA 2BMEA 3ZWMA 4L3VA 4OHZA 4H7EA 1V8DA 1QK4A 4ITVA 4YJFB 2ZIUB 1EXDA 4MVJM 5HZKA 3GLIE 2VO1A 5KKNB 3MTJA 4DDUA 3Q0EA 4KQ2A 5I7UA 1RJDA 1PFQA 4U2BA 1YU9A 2J5BA 1RHMA 3GEDA 4OFWA 4RC9A 1IOZA 3IMGA 3O3OB 4L2IA 5FFMA 4EEKA 2HLDA 1ABEA 1OHHA 4C4OA 2PSSA 2ZSEA 2YNMA 4L8YA 5CX4A 3TLMA 1CUXA 3EA4A 4ER7A 2B92A 5FKJA 3SJBA 3AL2A 3D3NA 1LQ2A 4CF5A 2D5AA 2V0CA 3STVA 4WOKA 2PZMA 3BMOA 3PNLA 2FMIA 4AIIA 5I47A 3WO0A 5K8LA 3W8RA 2X3FA 3GA5A 3U4MA 2WV7A 5AM0A 1KZHA 2LKDA 2D0PB 4H0FA 4TUYF 2R6ZA 4P7BA 4MPJA 3CLTC 3C4JA 1XIVA 2R1ZA 1LFDB 3JQ9C 4FWIB 2AD1A 5ERXA 2QAJA 4MCAA 3CCCA 1U8EA 2XCRB 3AF6A 4EPYA 2R8YA 4ZRMA 3NBFA 5BR1A 4X1KA 5FI3A 1GSHA 4CWAA 5EJ7A 5JCJD 2H4FA 2OPHA 5DBOA 4UUQA 3L1HA 1KOJA 4V0ME 5FPHA 3VU0A 2WKSA 1PT9A 1VE1A 2F4NA 4B45A 1ZYUA 4RPKA 4FQ7A 1BAPA 4EOGA 4MJLA 4PYMA 2HZ7A 3WK8A 1SQ5A 1ZH0A 2WMDA 5CT6A 1QIEA 2VZEA 1XXHA 1ZRNA 4Q4HB 2Q27A 3LPNA 5KUTA 2AIRA 4ENRA 2FMTA 4OXIA 4LXUA 1W7AA 1W5BA 2VBCA 5IWAB 2Y92A 1BWSA 2VRBA 1SHTX 1A4XA 3BE5A 3GMDA 3PXUA 4IXMA 4L5YA 2OK7A 4C08A 4FN5A 5IAGA 5MN5A 2JCXA 3VDMA 4Y2GA 5KYGA 3ACBA 1J1UA 5KSPA 3OBBA 1WIWA 2DWQA 4BMNA 1WB9A 4N65A 5DKFA 1Z6ZA 2C59A 4F11A 1O4VA 1ZGJA 2ZYSA 2YTZA 1IJKA 5G0VA 4ARCA 1UJNA 1ZS9A 1MOQA 3FIJA 4E46A 4X1IA 1NU6A 1DVRA 3URMA 1Z26A 1M2WA 2FQYA 3WB0A 4N01A 2HO4A 2QYTA 1CULC 2YWBA 3U17A 4CV1A 1KEVA 2HJ9A 4FR0A 1FSFA 4E7PA 1I51A 1XK7A 1EX9A 2OVFA 4KAJA 4KZKA 5H81A 2V0NA 2X5JO 3PEUA 1XK6A 3KFXA 1S7CA 4OA5A 1QCYA 3IOCA 5EZYB 1ZONA 1XVTA 1VMIA 4ZT5A 4AWAA 2BLNA 1SCQA 1YR2A 1GDDA 2KM1A 1MMFB 1G63A 1V3TA 4KQ9A 4ZI7A 1HG0A 4MRAA 4RHFA 3T9CA 1X8XA 1RMQA 3OWOA 1SXQA 2AE1A 4HQLA 4ONEA 2QENA 5KWJA 4NNOA 2HIGA 3I8XA 3ITNA 3RYCA 2DUMA 2VA8A 3J81k 3MINB 4INPA 3UAVA 3A6PC 2QYOA 3C3PA 4QDJA 4TTIA 5ELXA 1GRQA 2X42A 1RWWA 3JQ8A 2ZYUX 4JBYA 4S12A 1UBEA 5SV2A 3UK6A 4QT4A 4HNRA 1SVWA 2EZTA 1ESNA 1PWXA 2GFHA 3AEQB 1JHRA 3DBRB 2ZUBA 4HP8A 4LXXA 1Y8QA 2FWBA 3MS2A 1F8GA 1G8KA 3QHAA 1J2EA 1SVIA 2QPTA 3HVJA 3OPYI 4XUGB 1DAEA 1PBNA 5DHPA 4AWXA 1N8KA 2VNJA 4XIJA 2Q29A 4XR4A 4Y9SA 5AJVB 4BAUA 2P2CA 4BXOB 5IARA 2V74B 3IP3A 3DDSA 4EVSA 1FX1A 1HDOA 4HFMA 5CLLA 2O57A 1M6NA 3AEKB 5KOHB 4P3XA 1SKMA 2FETA 4FX2A 2FPXA 3W04A 3M49A 1KFBB 4TZ0A 2BCEA 2QUJA 3AFMA 4G3XA 5B58T 3R8FA 5KPJA 5P8WA 1OAOA 4B17A 3ELWA 3KS9A 4B4DA 2HA4A 3L7OA 1IUPA 2YVLA 5SY9A 1TTPB 5CLFA 3INTA 2LVBA 3N2ZB 2CXXA 3H99A 1Q7EA 3QUTA 1NI4B 3AUUA 4INOA 3D8UA 4PICA 5A2GA 1W49A 5IVDA 2YIJA 1WKBA 2P78A 2C84A 1CUWA 4Q19A 1I94B 2LNDA 4GVLA 3LLMA 4QYMA 4K9KA 3ENZA 1PK8A 3LC1O 3SQDA 1UBNA 3SOPA 4JOCA 4D9HA 4J0DA 3GP3A 2H29A 3B5JA 3UYKA 3BWYA 3WGNA 5KMGA 4F3CA 2Z4RA 3H4TA 4TV9A 3QPBA 1Q91A 3ROGA 1NDUA 1R0ZA 3AR3A 3I5MA 4JN6B 4UEKA 3RVSA 5IFLA 3ZVNA 3TNDA 4AECA 1PJ8A 2I2AA 5KJEA 1WNTA 1MQ8B 1HRKA 3CUEF 4TKVB 2IZ7A 3CV3A 4IP0A 4YJGB 3ZOZA 1W85A 3ZQUA 2CLSA 2ZJYA 2XE6A 3N59A 1IOVA 2JVIA 3EXG2 4E5MA 3DBIA 2DUJA 5DCLA 4BC0A 2X0NA 2JIZA 3BG5A 1GADO 2NPIA 4K6FA 2HDOA 1M33A 2XUAA 1JJFA 5IJ9A 3BIWA 3IYLW 4OKSA 4ETMA 3DR5A 1KZ9A 3K35A 4X92A 1EX6A 2NAPA 2JIDA 2IYWA 6PFKA 3NH6A 1CWUA 2AYZA 1V7ZA 3W5IA 3LA8A 4ZI5A 1PS8A 1ZJJA 5E3HA 1YS9A 4AS1A 3K9WA 3WA6A 3TDMA 1NVVQ 5ESDA 3T7TA 3ESYA 3LU1A 2XOKA 4BVGA 1YONA 3QNMA 1G7SA 2AB0A 2Y9MB 5YASA 2A9QA 4DLSA 3L8MA 3P5BA 2F3TA 3DDHA 3DVLA 1KZYC 3ZGLA 5L45A 1BS2A 1N1DA 5EQJB 1PV4A 3VZDA 3EGCA 3QTTA 2J67A 1RZRD 4HEA6 4E4TA 4FE4A 4KLNA 3W4JA 1NBOA 4MUEA 1HYBA 3VU9A 4EF4A 3COVA 2YY7A 4PGAA 5A5FA 2IHNA 1SUFA 2Q6VA 2B8TA 3AUAA 4JBHA 1Z2OX 2DBZA 3GPBA 1V8PA 5EKSA 4D0RA 1YVRA 2ALJA 4ACAA 5KNDA 3DA8A 3QVUA 1K9VF 1NFQA 2DFVA 3WVNA 1RYBA 1D8AA 4PYOA 1K4YA 7MDHA 3CWZA 4NK4A 4RS3A 4M1QA 5LYYA 1SOAA 5M04A 2CZGA 5H8WA 1JDJA 4MWEA 3SJ7A 1N6NA 1COWD 1F5SA 5CVCA 2G5CA 1XA3A 5KO2A