1Z12A

Crystal structure of bovine low molecular weight ptpase complexed with vanadate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Crystal Structure of Bovine Low Molecular Weight Phosphotyrosyl Phosphatase Complexed with the Transition State Analog Vanadate
pubmed doi rcsb
source organism Bos taurus
total genus 62
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2005-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z12A00
1FQWA 1R8JA 3HO1A 3GBPA 1JF8A 4EYKA 3OMXA 4WT7A 3HDGA 3O1HB 2WJAA 1NXWA 1SXHA 2E4ZA 1NXOA 2A9QA 3C6QA 3MA0A 3QLUC 4G0QA 3RVLA 4F11A 2JBAB 2L17A 2VUIB 2A9RA 3CKMA 1MAVA 2VYCA 3ILYA 3L6UA 1MB3A 3VNBA 3MQ4A 4MS1B 2E4VA 2HPHA 5TPZD 3TX6A 3TMYA 1NXPA 4JP1A 2RJNA 4QICA 2WB4A 2FQXA 3O74A 2HQBA 3F73A 5JS1A 1KMIY 3LUCA 1DCKA 1DP4A 3I42A 4MR8B 1TJYA 1QQAA 4KK3A 4UHJA 3NHMA 4RKQA 2E4WA 4HYEA 4LE1A 3OMWA 4LZLA 3NBMA 4O1IA 2GBPA 4RK4A 3TD9A 3KLOA 4F12A 4HNQA 4KFCA 4EUKA 1DBQA 2ID7A 1JWLA 2NZVG 1LJLA 3QX8A 2QXYA 4JAVC 2CHFA 2PUDA 1ZITA 3LKBA 3LUHA 3H5VA 4Z4FA 1JL3A 3GV0A 1DCMA 3LUKA 1U2QA 3HZHA 2H0AA 5HSGA 1DRJA 4XARA 4NICA 4GPAA 4RK1A 3RQIA 3OQOA 3CZ5A 1W9HA 1F4VA 3LUFA 1EWVA 3OM0A 4ETMA 4RU1A 3NNSA 1ZGGA 1MIHA 3OLZA 4YCSA 5EWLB 3P9YA 1JDPA 4TMYA 3RVNA 3QEMB 4CBVA 3SM9A 1Z13A 5TQ2B 1U2PA 5FWXA 3OLVA 4G0OA 1Z17A 5JNWA 4RS3A 1S8NA 3N75A 3CG0A 3H1EA 1RXEA 2JRLA 2ZWMA 2WWVD 4H60A 4MS3A 4YWHA 2R48A 4RXMA 5ED4A 3VNAA 1H9CA 3FFXA 3A3KA 3G1WA 1YTUA 3KLNA 3LOPA 1QO0D 2B4AA 3OLWA 3C3MA 4XXHA 1Z18A 6CHYA 3KG2A 3C3KA 1MVOA 2X7XA 3RVJA 2GWRA 1ZHHA 3L49A 3C97A 3BREA 5IUNC 3QK7A 5KC9A 1D1PA 1NY5A 3ILHA 4W5RA 3GT7A 2ID9A 3HDVA 3RVQA 4RXUA 4KZKA 4YS6A 1OXKB 3BILA 3BRQA 4IMIB 2VUHB 2H3HA 1JFTA 1B00A 1VKRA 1D4ZA 2V0NA 3QX9A 5CNKA 4YO7A 1L5YA 5HKOA 4L85A 1BAPA 5BQ3A 1IIBA 4KV7A 1JYFA 7ABPA 4DADA 5CNMA 1FFSA 2E4UA 2P9HA 1YVUA 2RDMA 2OENG 3GWGA 3LKVA 1PNRA 3EJWA 2A9PA 5TQ0A 1JH9A 2N9UA 2NZUG 2QV0A 3EODA 4Z4CA 4IGAA 1DCFA 3M9WA 1EWKA 4D6XA 2MSKA 1U8TA 4ZPJA 5KQGA 1SXIA 2PKXA 4RK7A 3KSMA 3DGFC 1DZ3A 4Z4HA 3JPYA 3O75A 1USKA 3HK2A 2JVIA 4YRZA 1T34A 4XLTA 1EAYA 1KGSA 3JPWA 4ML3A 5EWMA 4EYGA 3DGEC 4OG2A 4JOQA 4RY0A 5FBKA 2PUBA 3LTEA 3IP7A 1Z26A 4H3HB 3CZCA 4PE5B 1M2EA 2PMCA 3JVIA 3F6PA 3CLKA 4YLEA 2IPMA 3HUUA 4NCBA 2FMFA 4GNRA 1D2AA 1U0SY 2BGGA 1GUDA 3N0XA 5FWXB 2CWDA 2JVKA 4OBBA 4EVSA 5IEBA 2L19A 2PE5A 3D8UA 4PZ0A 3RVRA 3RVPA 3K9CA 3CNBA 4EYQA 1ISRA 1A2OA 1P6QA 3QELA 4PEVA 1L5ZA 1URPA 1ZH4A 4EY3A 4Z4EA 4OLBA 1ABEA 1TVMA 4OATA 1QP0A 2R47A 2E4YA 2QSJA 4FB4A 2F8SA 3LMKA 3F6CA 3UKJA 4OLAA 4WUTA 4WWHA 2F8TA 4YGXB 4LDAA 4KNYA 1QNLA 2PJUA 4KVFA 5HQJA 3RVKA 1PNTA 3T38A 3R0JA 4MQEA 1NXTA 2MYNA 4LDZA 2IKSA 3CTPA 1FSPA 4O1HA 2KYRA 1OXBB 4WXMA 2I6FA 1Z2EA 4KMRA 5CHYA 3URMA 3NNNA 4RY9A 5JNVA 4LRQA 4MGEA 1AB5A 1LJUA 3SAJA 4E7OA 4N03A 1EHCA 4Z9BA 4ZMSA 3HSYA 3KJXA 4ZMRA 1KRXA 1M2FA 2FQYA 5TPWB 3T8YA 3HCWA 4RK5A 5TQ0B 3W9SA 4MQFA 3KYJB 1JHZA 3RVOA 5GQSA 3IDOA 3KS9A 5JNSA 1ZH2A 3JS5A 5I4CA 2IYNA 1QMPA 2FXIA 1KRWA 3K4HA 1DRKA 1DC7A 4FE7A 1RZRD 3F7NA 4EYOA 4M88A 4G0YA 5FBHA 5IC5A 1GUBA 2FTKE 3HUTA 3IP9A 4G0ZA 1JFVA 2RGYA 1ZDMA 3JTEA 2IPLA 5B3JA 5C5EA 2FKAA 2J48A 4MR9B 4IMJB 3OLXA 4JA2A 1D5WA 1BA2A 3Q41A 4UHKA 3OM1A 1P2FA 1Z12A 3LUAA 2P4UA 2FVYA 4KQCA 5IUKC 1YMVA 2QU7A 3QELB 3H5IA 4RSMA 4D74A 4YP9A 1YMUA 4P1ZA 2R4QA 3DLBA 1GCGA 3RVMA 1DBPA 3GRCA 4Z4GA 2FEWB 2GX6A 3DZDA 4EVQA 4F3TA 1TM2A 3SQNA 4RY8A 3TO5A 2CD7A 5TPZA 3Q7RA 1ZESA 1AB6A 4B09A 3CU5A 1FFGA 3E61A 3DBIA 1P6UA 4QYWA 1E2BA 3IPCA 1QKKA 1XHEA 4MQEB 3EAFA 3E3MA 2AYZA 2PUCA 3RH0A 2LPMA 4PICA 4MLCA 1PEAA 3MYYA 1DC8A 1SD5A 3Q7SA 4TLLB 2LUOA 3EGCA 3LFTA 4IF4A 4MLDA 1EWTA 2NT4A 2QZJA 5EWJA 3KHTA 4RZSA 5B3JC 5BRAA 3Q7TA 1APBA 3M9XA 1LBHA 4D6YA 5BRJA 5IBQA 1LK0A 3DLHA 3N0WA 1PUXA 4QYMA 4XFKA 1VPWA 4YV7A 4IILA 1YS7A 1K68A 5DGCA 3TB6A 3EQ2A 4YR7A 4ZYLA 2FQWA 1ISSA 1Z16A 1I3CA 1SXGA 1BDHA 1VRVA 3O2JA 3MM4A 1M5TA 4Q7EA 3Q9SA 3KCNA 3HVRA 4Z0NA 3OO1A 2IOYA 1EFAA 4KPYA 3FFTA 5JNTA 3IP5A 1USGA 5T7BA 1RPJA 4P98A 4RXTA 4HNRA 3H6HA 3HJFA 1QPZA 1JBEA 5DLEA 2LIVA 3N8IA 2MYTA 3HV2A 2JB9A 4MS3B 1BVHA 5IX8A 5TE9A 3A0UA 4MPTA 2R25B 1Z25A 1XWWA 3H1FA 1A0OA 2FN8A 2JK1A 4Z4IA 2CHEA 3SY8A 1Y1LA 1SRRA 1YK0A 3JY6A 4LE2A 4MYRA 1PHRA 1UDRA 3KYIB 4S04A 5IEJA 4W5OA 3GYBA 4Q6BA 4NV3A 3LUJA 2A9OA 4N0PA 2PL9A 1HEYA 3O1IC 4RK0A 2M1ZA 5CNJA 3FMVA 4JB2A 1E6LA 3H5TA 3S99A 4W5NA 3EDCA 2NT3A 1W25A 4G0XA 1ZY2A 2E4XA 3OQNA 4PYRA 4L4UA 4WZZA 5FWYA 4MRMA 2FN9A 5JS2A 2VK2A 3O2SB 2M98A 5EWJB 5C5CA 1GCAA 2HQRA 4W5QA 3SG0A 4KREA 1ABFA 2FMHA 4MR7A 1C0EA 5DCLA 1LBIA 4Z9AA 2IPNA 2JCGA 1JX6A 1RXIA 4XAQA 2QVCA 1DBWA 3G85A 1QQBA 2B1JA 1J56A 1USIA 5KQMA 3N53A 5TQJA 4LX8A 3NHZA 1GLGA 2FW0A 3Q15C 1NXSA 3NNDA 2W42A 2FEPA 1ZVVA 2GKGA 5HM6A 2YHBA 5EWMB 2PL1A 5IULC 2DRIA 3JVDA 1YS6A 2IDMA 4RV5A 4RDCA 1BDJA 2L2QA 3KTOA 2YHAA 3IP6A 3KKEA 1K66A 3H5OA 5D2CA 4WXEA 5CNIA 5KQPA 4G0PA 3CG4A 3GBVA 1TMYA 3LUDA 1FFWA 1PEYA 3HS3A 1JFSA 4KRFA 2MYUA 3H5WA 3HM9A 4N41A 5BR1A 5KWSA 2FLWA 4RK6A 3CFYA 5E3JA 1CEYA 2OQRA 3N6VA 3OQMA 4OTZA 1E6MA 5PNTA 3SNKA 1M5UA 5KQLA 1BDIA 2FEKA 4E7PA 3N0RA 4G97A 1RNLA 4RWEA 4O5AA 4W5TA 2FMKA 4MS4A 1WETA 1U04A 4FE4A 1NATA 3ROFA 2GI4A 1NXVA 3D02A 4KQ9A 4ETNA 5JNRA 4Q6WA 4Y9TA 3CRNA 3O2QB 4MAAA 3MIZA 4N76A 3LUGA 3T6KA 9ABPA 4Z99A 1ZAYA 4TN5A 1VLZA 5KI6A 5KC8A 2PUAA 3IPAA 4ETIA 2TMYA 3HXMA 4QPJC 2PUGA 4IRXA 2FSPA 3H1GA 3O21A 3GL9A 1P8AA 2PAFA 5FWYB 4MRMB 2PUFA 4LE0A 1ZN2A 2QVGA 4JB0A 3A10A 1MB0A 2JBAA 2MSWA 3B2NA 3ROTA 3QLVA 4XASA 1E6KA 3H75A 4KK4A 3FDFA 1YIOA 4N0QA 4MQFB 1DG9A 1D1QA 2AYXA 2LP4Y 4MS1A 4TLMB 4EGSA 4MR7B 1TLFA 2WMYA 3I09A 1JLKA 1NXXA 2WY2D 6ABPA 2QW1A 2LBPA 4F8JA 5DKFA 1NTRA 1RZRA 4MR8A 4F06A 3EQZA 1XHFA 2NUBA 3HEBA 4JASB 2FLKA 4N47A 3QEKA 3UK0A 5ABPA 3FGZA 3BRSA 2Q5CA 4ZJPA 5JNUA 2HSGA 5TPWA 2MSLA 1ZGZA 2PLNA 2WJWA 3MMNA 1C4WA 3QLUA 3CHYA 4S05A 2HJ9A 3OLYA 1YK1A 3CS3A 3MF4A 3C3WA 3UUGA 8ABPA 3H5LA 5T3YA 3T95A 1DJMA 2QR3A 1Z2DA 2JVJA 4RKRA 3FFWA 1Z15A 2O20A 2WRZA 2FMIA 3I5AA 4NCAA 2HQOA 1QO0A 1CHNA 4HNSA 3M6MD 1JYEA 3RVSA 1QP7A 4DQDA 3QLVC 5DTEA 4EVRA 3O1JC 1A04A 5GOTA 1QP4A 1CYEA 2XDYA 3GA5A 5IUJC 2RJOA 5EWLA 3A0RB 2IPAB 4MS4B 1F51E 3EULA 3I45A 4DN6A 2MYPA 4MR9A 4NQRA 3QEMA 1JDNA 2PUEA 5TQ2A 2ZAYA 4H3KB 3H6GA 3OO0A 3QLTA 2L18A 3BBLA 5F64A 4G86A 4G0MA
chains in the Genus database with same CATH superfamily
5FD8A 3ZWQA 2VJMB 2JCSA 5IWCA 4EYKA 3OMXA 3QKTA 1JVSA 3A1DA 1PFUA 2FOXA 4L57A 4LY6A 5DX0A 3LDAA 3C6QA 3QLUC 4N82A 4P5PA 1SUBA 2VNJA 2QRVA 2R8XA 2JBAB 2J5BA 3I6YA 5CFRA 2QUIA 3AF6A 4D26A 3MUEA 4WTOA 1C3LA 2FA9A 4PQRA 3UXYA 2K7FA 1VCNA 3BEDA 2IHZA 3VHQA 3KPUA 2BHSA 1Y8ZA 3N0TA 4HRAA 1MB3A 4JOBA 3O4HA 1CZHA 4JUBA 4AP5A 1EINA 3AI3A 1R74A 2Z2XA 4G5FA 5EY5B 2B30A 4EG1A 3DJFA 3EXFA 1SQSA 1BH6A 4P4NA 3RBXA 5FTMA 5C32A 2ZB2A 4KQJA 1PK8A 3DE6X 1VLQA 3GMTA 1TJYA 4GQBA 4M9CA 4MR8B 5SYNA 3ZWNA 5LOVA 3F6BX 1GARA 1Y0BA 2B6NA 4HYEA 4PLWA 3CV3A 3R9IA 3VNQA 1Y37A 1QKJA 4R71A 1Z2PX 3KZCA 3T4PA 3TD9A 2WU0A 3A1EA 1GTMA 2B0JA 1J0AA 5JEDA 4R9RA 2HLHA 2DPGA 3MXTA 4WY5A 1QIHA 2H9AA 3DMNA 2PUDA 1ZITA 4UEOA 1M54A 3LKBA 1HFKA 3QUQA 4FC7A 4WY2A 3UMYA 5LJLA 1B3BA 1B8NA 1DAOA 2HU8A 2B5WA 2HX1A 3ZHQA 2Q6IA 1QHGA 1R64A 2ZP1A 3H3XA 3FZYA 4G67A 5F4ZA 1JE1A 4KNVA 2YWHA 3ZIAA 5BV1A 4RK1A 1IULA 4HDAA 1IZ8A 3DQPA 3T99A 5C52B 4H2DA 4C0LA 1U7DA 3K6SB 3USES 1EWVA 3R7SA 1RLTA 3O4IA 4EJFA 3MJEA 1H5UA 4L8VA 4YCSA 2KPOA 3PDUA 3PQ7A 1TYCA 1F8YA 3AYZB 2DLDA 3LYUA 1CNEA 1ENYA 1I3NA 2FSVC 2XHEA 4IWYA 4X45A 3REQA 5ALSA 1GZ5A 3VU1A 3ER9A 4JI7B 3HZOA 1DJQA 3FDIA 3HLTA 1VFPA 4JLMA 3H0CA 5L3QB 4JSTA 4KMOA 1GA6A 1WRBA 5JNWA 3O8BA 4K6CA 5ILOA 3ICPA 4X91A 4YWHA 2JA2A 4PQEA 3O9MA 1Y6QA 1UOPA 2A0FA 2JEYA 3GARA 1U28A 3JQ7B 1WF6A 3GDGA 5SY6A 4JVLA 1Z7EA 2P5TB 2EG9A 2GAJA 2X7XA 3A6PC 2GWRA 2LGJA 2WUDA 5DXAA 1MG0A 4E5SA 1YE8A 2A9JA 1YOBA 3KKQA 1CY6A 4XUEA 4R9VA 2CXSA 3CGGA 4AY5A 4CM7A 4EHJA 3OUZA 3IKLA 4RHFA 4ZCIA 2C2WA 1Z73A 3PU6A 5ESWA 3IEKA 1KQOA 5H1YA 2ZJ4A 3L84A 3F47A 1UBSB 2G7MC 3BRQA 3MRSA 3PXDA 4TLEA 5CURA 5FF9A 4JBWA 2A58A 3PNOA 1Y3DE 4FDTA 5BSKA 4HQKA 2O3JA 1EGHA 2D7DA 3EIFA 3B3QA 5L3RA 4BB5A 2YWRA 2FETA 3K5PA 3KOZA 4YJHB 5FOVA 3RFCA 5JXHA 4YHHB 1E1KA 5ALRA 2GESA 2X2FA 3TINA 2LCQA 4ZKDA 1GGKA 4C0KA 3VR3A 1FFXB 1N3BA 3W2IA 1N4AA 1KQFA 1HDIA 2GEFA 2C9MA 2N9UA 5D3MA 3FPCA 2Q27A 4DEYA 3RE1A 2O8FB 2MSKA 1OU4A 3OQBA 1E2EA 3GRVA 2H8KA 3H16A 3Q3GE 3TIXB 4BCCA 2XTJA 3EXG1 1BEEA 4K9LA 3PDWA 4QELA 2UZ0A 4KAFA 1WOYA 4ITUA 4AJOA 2AW3A 4QA9A 1F14A 2GBLC 4G1EB 2G8LA 4DKJA 1O0BA 1HT2E 1GFWA 1NWHA 3OHMA 3DGEC 4UVDA 3BDAA 2WSLA 1T8RA 3MJTA 3NATA 3WIUA 2JAPA 2PMCA 3HWRA 5DN9A 1PYGA 4PBTA 1R0BA 3PR3A 3E82A 1IAQA 4Q9DA 1O95D 1Z68A 3TLXA 1DV2A 5LQCA 4KIJA 3I5MA 4GOXA 4CCSA 4NBVA 4NH4A 5CVDA 5FWXB 2P8JA 3WB2A 3IJPA 3RYTC 2VPTA 3CRVA 1VJ1A 1DLIA 4D4IA 1T3LA 1DEAA 3CNOA 3DXYA 2Y6UA 3UQZA 2PX6A 5LD2C 4PEVA 3V55A 1G66A 1L5ZA 1ZH4A 4EJSB 2BR4A 1IWOA 4BVLA 1IUNA 1X19A 2BMDA 3K92A 4O25A 1OFTA 1KXJA 3CO0S 3I1IA 2QSJA 3ENQA 4JI0B 1EEXB 1BS2A 1R6DA 2ZUFA 4LF4B 1P2DA 1YZNA 4R8SA 3OCXA 2OZLB 1YJCA 3B2QA 3FPEA 3H2YA 2V6IA 3D0KA 2ZR8A 3PEVA 4PBSA 3A6EA 1L6IA 4HUQA 1XVTA 5HQJA 3RVKA 4DCVA 4Y18A 1RHQA 3KC2A 2FUEA 1LLQA 4MV9A 3DZCA 4AKEA 3OPMA 3S2EA 4FQ5A 1JLSA 1G59A 2QGNA 4I4TA 1IQUA 1X1QA 4DJDC 1U9IA 1M2GA 3OLCX 4HYTA 1USVA 1DAFA 2QYTA 1KKUA 3DTNA 1C9KA 2IYWA 2B1GA 2OL4A 1OC2A 2ZK7A 4V38A 3PITA 1G60A 2W71A 4B3SB 1M0TA 3VM6A 3PUHA 3DBVO 3BORA 2V58A 3SC2B 4CV2A 1OBCA 5TMBA 1T2CA 1FFDA 3ZIDA 1VKJA 2VQFB 1W0JD 2QN7A 2D2IA 2R8OA 2NPOA 4RK5A 4Q4HB 1ONOA 3A9CA 2X4GA 3RVOA 3NM5A 1OWMA 3MINB 1N6NA 2E3JA 2VP0A 3KS9A 3MWKA 4MCHA 5AM2A 4FFSA 1NG1A 2PU7A 5A9SB 3RWMB 4TKUA 4E15A 1ESZA 5KX5B 4CCYA 4NSNA 3WRYC 4DMCA 1QGED 4UBIA 1NBMD 1W9MA 4KITB 1SO8A 4J8PA 2W9XA 4S1TA 3UF0A 4DIUA 4DCOA 3ZD8A 5GV7A 3RRJA 4G0ZA 3HUTA 1W5SA 4HEA6 3C7TA 3K5HA 4EBBA 2C20A 2RIPA 1PUJA 1I5EA 1VSBA 2YN4A 1Q95A 1ZU5A 4FGUA 1GGVA 4GZLA 4JFRA 4TYMA 4ZCTA 3TL6A 4JC5A 3U5ZB 4DCNA 5J4HA 5EQFA 3N05A 3F2VA 4IMJB 1NTOA 4QDOA 3U0BA 4D3ZA 4F5ZA 1XSEA 1D5WA 4FZVA 1XX6A 3H2SA 3GMDA 3VSBA 2GAIA 4R40A 4UHKA 5BW6B 2I6UA 2GD1O 5AP9A 5K3BA 1GLNA 1Q1QA 5G02A 3VR4H 4URVR 1NF2A 4OU5A 1Z2OX 3CWQA 3LQQA 4FNMA 4NIMA 2VHXA 3X1DA 4PC7A 2J9GA 3P71T 5DCYA 4FWBA 1RI1A 1VMEA 4PO3X 4U39A 1DBPA 2JFNA 3JQCA 4JLUA 2IV3A 3T9AA 2C8VA 4A8PA 3AL3A 4XIJA 1XA3A 5ERYA 1OTHA 2AN3A 4RJ2A 2RCNA 5TPZA 1F20A 4H9GA 2BZ0A 3EEQA 2H4JA 2IHYA 3ESBA 3MT8A 1N57A 1QKKA 2A5FA 1VI2A 2RBKA 3BCRA 4B83A 1A9TA 2VPXA 4WKOA 3PG5A 1A50B 4LC0A 4C4PA 2Y1CA 3IQDB 4J07A 5IK2A 2DG2A 1U4OA 1ZCJA 2Y8EA 4UULA 4K6FA 2EQAA 2ACEA 3L3BA 3ZGNA 4LQCA 5COBA 1O5IA 3NEYA 2B78A 3AMVA 3A4MA 2XMZA 4QYSA 4YRFA 2E37A 1FVFA 1L5HB 4WOCA 1QVZA 2Y0EA 3OZCA 2N1MA 3Q7TA 4JX8A 1GSOA 1KZ7B 2PLFA 4K46A 1IOVA 2ZUBA 5E38A 4ZDIA 5JD4A 2OXCA 2A92A 2EZ4A 4UNSA 3OJ0A 1IU9A 4WHMA 4XTRA 1KBOA 5GGXA 2ZJ5A 3UFXB 4YR7A 4KPGA 1FDSA 5CP8A 3RU3A 3ASZA 4H17A 4H08A 2O2YA 4WK0B 2G5GX 4FLFA 2PKCA 2ASEA 3B48A 4Q18A 3UG6A 2P2CA 2D2FA 4LWZA 3NHAA 1E6CA 1ZIXA 2XVZA 2GN8A 5CXSA 4DLYA 2D4HA 2J3DA 4CT0A 5B3KA 3IHWA 2YN0A 4QQKA 2LRHA 1H2XA 1UMCB 2XXBA 3V1KA 3P2MA 2CVQA 2Y27A 3IBYA 1RVDA 2QROA 1Z56C 1FRNA 2CNKA 2I33A 3ET5A 5CDTA 4HAUA 3BQNB 2N42A 2YWBA 4ZVKA 3HJFA 1LW7A 1TJ4A 1IHPA 1PJ2A 2D5IA 2HIMA 2PH3A 4BE7B 2I87A 2Y9PB 1OH5A 2C5AA 2DFVA 4IPTA 1ABBA 4EGJA 1WCV1 3HWWA 3KPWA 2EFDB 3OZWA 4D9FA 1JA9A 1OR8A 2HFJA 2RGNC 4Q3NA 1X14A 4KBGA 3DMHA 4QBTA 4OM8A 2BFCA 2V4UA 1Y3FE 1Z0KA 2CHEA 3BK1A 3NYIA 5J4YA 1F8UA 1R0CA 2VTDA 1P73A 4V0OA 5FBWB 4TKLA 1UKEA 3RWBA 2HJVA 3QMPA 3EWIA 2V5UA 5A3VA 1Q3TA 2HGZA 5L7YA 5FYDA 3R7FA 4E94A 3WXMA 2IH2A 4FS8A 4QYIA 4U2DA 1DC4A 4CMCA 2A5GA 5CNJA 4EVIA 1G291 2WQ6A 5THQA 3EXHC 3LX8A 5IH7A 3CLRD 5DHRA 2GUWA 3HDYA 3SF0A 1U3FA 5KNDA 1EE9A 3OBIA 2OQ2A 1B23P 1QS0A 2VDWB 2WAYA 3NIWA 4RF4A 5KSPA 1M34A 1N3YA 2FN9A 5J58A 5KYYB 1Y6GA 4B2IA 2ICAA 3SHTA 3M5DA 1SU7A 3FMPB 3UJAA 2ISQA 3LIPA 4W5QA 2QPAA 1G3MA 4HB3A 5HF6A 4DMKA 2D0DA 1PWYE 2GXAA 2O19A 2C5LA 4QDXA 4N3BA 2OHGA 4RHXA 3VKUA 4FW8A 3LG2A 4CCAA 6LDHA 1YQDA 2OM6A 1D2HA 4B43A 5KYUB 4DV0B 4Y2RA 1GZ7A 3UANA 2Q41A 4EL0A 4QULA 4L6AA 2IVFA 3I6QA 4A6PA 2NV6A 4KFTA 1ZK2A 3TS1A 2FEXA 3NDBB 3RPEA 2Z8YM 1O96B 4DLAA 5IZCA 1NRIA 2GPTA 2V7VA 2FZVA 2WYHA 1SELA 1W5TA 1CS0B 3SX4A 1ACJA 4MUIA 1NJ1A 2IOHA 1USWA 2BKEA 2PVSA 1H94A 1D0VA 2QD4A 3DE3X 3PKJA 4OIMA 1KYYA 1F7UA 2JIQA 4WXEA 5C1IA 1OX4B 5COAA 3LUDA 4WOKA 1X38A 1E5DA 1RACA 3RK0A 2FCAA 5CEJA 3R7WB 4B5LA 5KUTA 1FLAA 1Q11A 1VA4A 4RZIA 5JU6A 1ETUA 1XCLA 3OTOB 1Y6RA 2A0XA 2WKSA 5H68A 1T9GR 3CJQA 1Z82A 5KQLA 3LH5A 3I5YA 4G4GA 1JTFA 4F3RA 3QOFA 2AJCA 3RYCB 1NW9B 2GBCA 2XZLA 3EG5A 4MVJA 3VO1A 4D4GA 4X71A 2GN4A 3W4JA 2BFDB 2GBGA 3FYUA 1JAZA 4I9NA 4EARA 2ADMA 4Q6WA 2FFRA 1T2DA 4F4IA 4BVBA 3WL8A 4LF9B 4BO3A 1UAYA 2JCVA 4Z99A 3DE5X 3RS2A 1VLZA 3ZI0A 4EGFA 1GTRA 4G89A 3EAGA 3W34A 4JXZA 5K7SA 3NETA 3L1IA 4N0DA 4II2A 1E79D 3F8TA 4WLEA 4YI3A 3A1UA 1YU9A 1ZYUA 4R1QA 1UDXA 1XALA 3QVGA 5AVZA 1PTJA 1TAQA 2DY1A 2ASVA 2H5JA 1A8SA 1MB0A 2AHOA 3CKYA 3PUYA 1V5FA 4U3JB 5I9BA 1JEQB 1RJGA 1FF9A 2BEJA 2OG2A 4NH0A 4MDHA 4F04A 3H75A 4TTAA 4MQFB 2WZDA 3KKZA 3PFGA 2VHVA 5ALKA 2CJPA 5A04A 5LA6A 4TMZA 4FGKA 4CU2A 3P4UA 4R81A 3PX2A 3Q88A 3QLEA 2WSIA 4KFUA 5J40A 3WLAA 3DHYA 1UEXC 2V45A 2Y0CA 3TKLA 1GG8A 1NTRA 3FSEA 2ZM6B 3KJIA 1M2NA 3EJ6A 2JW5A 3DHWC 4O4HA 2JIDA 3EQ8A 4FJ2A 1ZGHA 3EVAA 5ABPA 2VDPB 3P9KA 4U0JA 4B7XA 1EG2A 2HSGA 2J6BA 4XGKA 3BB3A 4KQFA 1OA1A 1ZGZA 2L69A 1O1YA 3C8UA 5IM5A 4ZT6A 3VU8A 4ND7A 1ZRMA 1L7NA 1AK1A 2R86A 5F2OA 5FTJA 3UUGA 4DY4A 3H8JA 3NPAA 3M4ZA 2DUNA 3FWZA 4AAYA 2I6TA 2Q0HA 3T1OA 4B5KA 2G1AA 2QSZA 4ZALA 1QRSA 1C7JA 3FFWA 1QDLB 2DPLA 1CUHA 4UHHA 5L3SB 2HQOA 4HNAA 1F6DA 3N87A 1KMNA 2EZ9A 3DEYX 3ZWBA 3CW2A 1N6KA 3BWVA 1C3OA 1EDEA 4B74A 1Q3KA 4M1QA 1E2JA 2FPUA 2TS1A 3A4TA 2Y05A 3AP1A 2HHCA 4HWSA 2O54A 3LY5A 2RJOA 5BSGA 4C7OA 2H4FA 2DCUA 3LLMA 4IIYA 4C6RA 2WJJA 4XUGB 3UN1A 1GD1O 3BE5A 3AY7A 3A37A 3ZHRA 3IBFA 3RK4A 1D6SA 4RVNA 3P0JA 2V55B 4ZQGA 4ZOQI 3SSMA 4PO9A 1NMZA 4PRZA 5BT9A 3ZC3A 3OQ6A 4P4TA 3PQ3A 4OFBA 4YT2A 5IVPA 1QIFA 4JWKA 4NQZA 3E4DA 1H2HA 4DDWA 5JROA 1XNGA 2OKGA 3H6KA 1YTLA 2O7SA 2ZJ3A 1IATA 2HPVA 3M83A 2GJ9A 3MAGA 1KSGA 1MAWA 2JCYA 3GJRA 4C7XA 3E27A 3H9EO 1YCGA 2E4VA 1QLJA 3E3OA 2PKQO 3TX6A 4L6IA 4DCCA 2WIKA 5I9NA 3AOEA 1G21A 1RRGA 1U7WA 1W47A 1CZNA 1LXCA 1AHNA 2VXYA 2AJBA 2HRDA 5IYZB 3O3NB 2D06A 3F73A 121PA 4LOAA 2YY6A 4RHTA 4A27A 3FGOA 3JSXA 1E7YA 1WPQA 3BRWD 4MGHA 4MHSA 3MJCA 4LQ4A 4CLEA 1EA5A 2DLCX 4D96A 3SBEA 5AM1A 3IHTA 4HNQA 4POAA 1EWRA 1MX3A 1SBYA 3F9IA 1XLVA 5CFQA 3EXIA 2GLUA 3OOWA 3SOPA 4RJTA 2P6NA 3KT8A 1XELA 2YV1A 1Y1RA 2DFDA 1CLEA 2QMOA 4YXWA 5BXYA 1YQEA 4BFYA 3KE8A 2Q6TA 2Q3DA 2CNWA 1WZ2A 4JNCA 4X6XA 3QA3E 2R1TB 2IA5A 1MUUA 3ANSA 3HZHA 1CDZA 4OXYA 5EFZA 2AN1A 3NBUA 3A9RA 5FV4A 4OX9Y 4N12A 4LVNA 2Q6VA 1UF9A 3FB1A 5LLTA 2XCSB 1W9HA 3D4PA 3PC7A 4OLHA 3VZBA 2IHBA 4GVLA 2VDMB 1LPOA 2HA2A 2JJQA 1R9NA 4HGQA 1KJQA 4IEIA 4M3NA 1IL0A 3VPXA 3TN7A 1RWMA 1SCQA 2ZYWX 3MWLA 4FDAA 1PR0A 5LP6B 3ORYA 3RTGA 3VNRA 2VZEA 3C3DA 3ENWA 4WOBA 5TQ2B 3SM9A 5CB4A 1D2RA 2AA3A 4J0GA 1NP7A 3H2HA 3OQJA 4HNVA 5CH5A 2XMGA 1F7VA 4RH3A 4ARUA 2WHXA 1R4ZA 1I0LA 1SXJA 2CKDA 4DMUB 3TLEA 4Q39A 5FA6A 2QJRA 4UMEA 3MW8A 3IVXA 4DAEA 3LOPA 3VKFA 3MQFA 3OD1A 1QO0D 2AMYA 1E3LA 2B4QA 2W2NA 2XDAA 5I51A 3C3MA 1X70A 5JBNA 5DI3A 3FUCA 3KEFA 3TZCA 1K08A 2NO1A 5JCJA 5JXIA 2QX4A 1J2RA 1TM1E 3ILHA 4GM0A 5KC9A 4O4LB 4WZAA 5EI5A 3P26A 4KR0A 4DQLA 5GY7A 4D9MA 3DNPA 2J9ZB 4MICA 4YS6A 3RS7A 4CMHA 1ISFA 3I76A 4ILKA 4MP8A 5AKGA 5LYYA 1JNYA 3ZGZA 1YKFA 1KORA 3O92A 3RSZA 3IAM6 3QX9A 5EERA 5HKOA 1S3IA 4R9NA 1K92A 4KUEA 4GOND 5ARDA 4CF4A 1OI3A 2IVZA 4W63A 5DYTA 1YDMA 2OGTA 4O2AF 5CFZA 3IMFA 1VJ5A 2WMDA 3AIMA 3K30A 7ABPA 4CF7A 3E9YA 4BMOB 3K1AB 1T9KA 2N75A 3ZZUA 4KEAA 4MLPA 3JCZA 2REQB 2R8PA 4J3JA 3TSZA 2AI2A 2DYKA 4WX2B 4D8TA 1KJZA 5AUPB 4H1WA 1P9RA 2INGX 1PEDA 1XYYA 4XLZA 1N6RA 4BNUA 1QHNA 2A3NA 3HKCA 3SVLA 1P9OA 3I9V6 4MH0R 4AUEA 4C05A 3V2GA 4RTMA 2VNIA 2JK0A 3NYQA 4UE3S 3N39C 1CG6A 1WB6A 1DIHA 1WUIS 1FS6A 3IIIA 3PQ8A 3JAWA 1NUTA 2Z58A 4IGIA 4IIHA 4LJ6A 4P4GA 4ALLA 4EMSA 2FWMX 3JPWA 1N32B 1DTWB 1THMA 1YR3A 1UR5A 2IS4A 1JMKC 2WFLB 5AESA 2ESRA 1AGRA 3THYA 4ON9A 3K5WA 3D8HA 2X40A 3E9MA 1O94A 2A9FA 2C42A 3HFSA 3M6XA 4H3HB 4QBKA 5KNBH 4OP2A 4EL5A 1E5XA 3SJCA 4AQ7A 3JVIA 1WS6A 1CB0A 3FTFA 1A3CA 2QYHA 2IPMA 2VO1A 4CM8B 1YQUA 4YUZA 4ZI5A 2G1JA 3PYLA 4IRMA 1WF3A 1VB3A 2I1QA 2GS9A 1J8VA 3ANTA 3NKVA 3NPMA 1KWGA 4GOOD 4FILA 4B4VA 2RK6A 3LPMA 1MAUA 4PYMA 3MWDB 5TY0A 1KZYC 3NRJA 2IC5A 4FZ3A 3DCYA 2PGJA 2XMDA 4D9JA 4W1RA 4Z4EA 2ISCA 2ONCA 3RD5A 1YE5A 3MZ0A 2JBWA 3C3PA 4MW2A 4O0LA 4PAQA 1XOIA 4X94A 1WCXA 5ALZA 4B6EA 3IDFA 4C03A 4MUBA 2E0IA 2JLQA 2W6CX 3S70A 3UGKA 3W06A 3NO4A 5I7WA 1UJNA 2FOIA 3HB1A 3U9TA 3EVNA 3JRNA 4EYEA 5JH7A 1XXHB 1IMOA 1ZD2P 2DUMA 2Q29A 5K3SA 2VVTA 2FPGB 4DRYA 1JLLB 1YR7A 3DZJA 1YS1X 2ENWA 5LSAA 4PS0A 1T8YA 2ZS7A 3EYAA 5AHRA 3ZVRA 3GI1A 4XYGA 4YMUA 3R0IA 4GMDA 4E5KA 2C5SA 2G40A 2HSEA 2IZ6A 3KEQA 3EVZA 1N8NA 1AUOA 2XNKA 3B38A 3I39X 4I5EA 4MJ7A 1XEWY 3A3YA 4DC9A 2RK3A 3PEYA 3GJQA 1E3MA 2CJWB 4OL9A 4GBGA 1X8XA 3JYLA 3DHVA 4ZN6A 3B9QA 2EJTA 4MAFA 4EQZA 1GU0A 2C3YA 4GX0A 1XWIA 3O0TA 1B14A 2QN8A 2QM0A 1R4NA 1GEEA 2DKNA 1GAXA 3DL0A 4LQLA 1XDDA 4Q1FA 3B53X 3N7UA 1XTZA 2NXNA 3IQFA 4WFJA 3R9XB 3PNLA 1DRKA 1Q1NA 5ENVA 1SHLA 3DVRX 1ECBA 3LP8A 1GAQA 4FB5A 3JYPA 4BLSA 4NMHA 4I1RA 4OYLA 1UBTS 1SHJA 5JE8A 4B3BA 3KUUA 4J6FA 5EGSA 1E9CA 3WAGA 4Y6PA 3FDZB 2BC9A 1CW2B 2IPLA 3CIFA 1X86B 3PHHA 4IR7A 3RFVA 4V1CB 4CM9A 2AC4A 3QVUA 2ERYA 3E03A 1D04A 5AM0A 3QPVA 4JT8A 3WKEA 2HHHB 1NMXA 1KJJA 1CRQA 1M6EX 2EC5A 4KWIA 3ZG6A 4ZVMA 2QTWB 3ZCQA 4BFTA 3EEBA 3ZHUA 2BLNA 2XR1A 3CIOA 3SKXA 1A27A 4RBNA 4GM4A 2PWYA 1XQ6A 4G6ZA 2WUWE 4KXYA 4EKEA 4UCXA 4I55F 3FRHA 2OFXA 1QYRA 4P80A 4Y8VA 1GFZA 2XUIA 1A9PA 1QR2A 2H4ZA 4TT3D 5BSVA 2QE7D 2XVAA 3FUXA 3LX4A 3JD1A 1RI5A 5BQXA 4Q9LA 3UICA 2ZROA 4AX4A 1ULTA 4PCVA 1HDYA 1UEJA 4GO1A 4RL4A 1KDOA 1ZESA 4JOCA 4PX9A 2H63A 2H08A 3G6KA 1P6UA 2QUBA 4I1VA 4L8LA 4QXRA 4EUNA 3VDMA 4MQEB 4IKEA 2YCBA 3T9BA 1P0IA 2F1RA 2R6DA 1DPFA 4X8LA 4A26A 9GPBA 1QU2A 3SF8A 4MW0A 4HPXB 3QX7A 4RJKA 2MR5A 4Q34A 1EWTA 4QYXA 1NNLA 1SD2A 2JNWA 3AF0A 2WSYB 4EG7A 3W5BA 3A2MA 3BKWA 5L53A 3CVUA 3WYNA 3AJAA 1FDUA 1UKCA 1JB9A 2ARKA 2Y1EA 3T9CA 5IBQA 1PR3A 4L0CA 3TRIA 1GTVA 2DE0X 3HYSA 3HI6A 1NDUA 4IDNA 4MGYR 3TB6A 1W36D 2FDCA 1OF1A 4ZYLA 2KS6A 3CUSA 1IXZA 2M6LA 1DB3A 1IHXA 1P8JA 2UYQA 4V0NA 1EHIA 4FU0A 4FLMA 3Q8WA 3IPLA 3ECAA 1KEWA 3ZPXA 2PYZA 2A30A 2ZI9A 3GLSA 1TTPB 1KL7A 1P91A 4HJRA 4MHOA 3ZDYB 1QHXA 3OO1A 3PTZA 3UK1A 5BUZA 3DOEA 1ZUHA 1Y1TA 2DSNA 4X9XA 2NYAA 3JQBC 1RYHA 1SQFA 4Q5IA 3S1AA 2EJCA 3KB1A 2IUYA 4FOSA 4ZAXA 3SC4A 3WBKA 2OAP1 3WGZA 2XITA 4QIHA 2DZDA 3I0NA 4OUDA 4YP6A 2BI4A 4KXMA 5B3AA 3EK2A 3F7OA 4F60A 3WGJA 5GVSA 4HX5A 2C3MA 2YDXA 3OWHA 4A8JB 2PGOA 3LT5A 2W7TA 3OIVA 1VL8A 4LDNA 3BS4A 2C94A 1QQ7A 5IJ9A 1W581 4WNYA 2NXJA 1IVNA 2MMCA 4UTVA 5HR5A 3C45A 4GKVA 1UBRS 1VI6A 2NUTB 1DQYA 1TIBA 2BMFA 1VKOA 4Q7LA 1MPTA 1UT6A 4XIYA 4C06A 1PZMA 2J0UB 2NW6A 4S0XA 3JAKB 3DBRA 1ZM2A 3OT1B 2C9YA 4P0TA 4NXMB 1JU3A 1RU3A 3FJOA 2ZZKA 4W9NC 1QOZA 4DARA 1E3SA 4AY3A 3NDPA 4PIVA 3MCAA 4RK0A 4X1KB 1EZ1A 3SU8A 2A7XA 3VDRA 4W5NA 1ONNA 2IUFA 4URFA 5IT9A 2ZRHA 5JIBA 2YZ2A 5BR7A 2G88A 3GN1A 3ANLA 4E4TA 5BSUA 4DLWA 4MARA 1A4IA 4Y7CA 1RKBA 1UDCA 2WWRA 3AEZA 1ODJA 1QDUA 4NCIA 4YAEA 3BIFA 2IELA 3ESQA 3OX2A 4UFNA 4LMAA 5ESRA 1UFRA 2R85A 3TW8A 1Z0JA 4LI3X 4BKRA 4H16A 5CU7A 3L2OB 4YJGB 2R97A 3SG0A 3UK7A 3GQBA 4L3WA 3VTFA 1I2AA 1C0EA 1N2BA 1PQUA 3KPVA 5BN3A 1Q84A 3KLBA 3DMRA 3KQVA 1EI9A 2I7XA 4H6WA 4KPEC 4ZDJA 2WHPA 3EUWA 4P08A 1FBNA 1XDZA 4C7VA 5I4KA 2YDYA 1T9GS 4R0MA 3NTXA 2HF8A 4GWLA 5AUNB 5BSHA 2XD4A 4J0DA 5L3ZA 1CZKA 3JATB 1LPAB 3BMCA 2E87A 2WAXA 2OBYA 4TLDA 5CAEB 2Y99A 4C7JA 4DMLA 5IULC 4GXTA 1VHQA 4A1OA 4KH0A 3IDQA 2MINB 4MV5A 2ZWPA 4BGVA 4IDDA 2C0QA 1O95A 5AI9A 4EHKA 4RTJA 4MPRA 1NYTA 1F12A 1ZICA 2YHAA 1GCOA 3VO9A 4CODB 3QHPA 4KXNA 3R7AA 1XTUA 1CR6A 4II3A 2FPIA 5JO9A 2LZ0A 1QP8A 2IYLD 1I3LA 2X1HA 3HS3A 1SCJA 4IO1A 4DIDA 3U81A 1Y3IA 4XVUA 1EUDB 4P92A 1F2TB 3A05A 2IU4A 3HVUA 3NOQA 3PXUA 4N9WA 4E46A 1M0EA 2UZ1A 3T5BA 3W04A 1L4NA 4DT1B 1NUUA 1LD3A 2EW2A 4EGAA 3OIDA 3RBZA 4MIYA 2R7AA 2XKAA 4G97A 4JLPA 3NKFA 3FHCB 2WA1A 3MS7A 1QHYA 1KQPA 1V0JA 1PDVA 5HKKD 3NUQA 2H17A 1U04A 4FBGA 4IDPA 5ICMA 5F2KA 2ZETA 3AB7A 4CMIA 4PN7A 4N76A 1DRUA 1D2CA 1WA5A 1V39A 2CUNA 3D3WA 2A4KA 4D9EA 5FKJA 4HDCA 1GL9B 1WMAA 3FWYA 1FRFS 4JWTA 4M49A 1PR4A 2BDUA 4UXJA 2NM0A 3UAYA 3LZCA 2VJOA 4G1CA 1PGPA 2YVQA 3TQRA 4BQIA 1GG9A 3JASA 3UAVA 1W0JA 3O1LA 4RIFA 3JR3A 4RA6A 3BCSA 2J09A 3VI3B 4YRCA 3OFNA 2O0LA 3DE4X 2RC5A 1MXHA 2HCRA 3PDIB 1JILA 5I4CA 2AZXA 2P5UA 1LTKA 2X15A 4N0QA 1D1QA 5BSTA 2H2WA 1SVIA 5IDVA 4DMRA 4YRAA 3R8FA 1ESNA 2FU5C 2QPOA 3GGGA 3WGNA 3N2NA 3NHWA 1IHDA 1M0WA 1P1KA 3M7IA 3VNUA 4MUYA 2BJWA 1JGTA 1NBMA 4YMHA 1WDMA 3WL5A 4KR9A 1E58A 1RPTA 4OXKA 2NTVA 2OFOA 4JI1B 1GP2A 3GZ4A 4XFJA 1YMQA 2H51A 3NWEA 5BWMA 2RKBA 1AGYA 4ZK6A 2BH2A 4JDUA 1M1NB 4OFWA 4TX1A 1D6JA 3BRSA 2OWEA 5AM4A 3TJMA 3LGSA 3SBOA 4I2VA 3SYKA 5JJBA 3WGIA 3CUYA 2V03A 2IGTA 2WJWA 2BGJA 3MMNA 1OXTA 4AECA 1NW7A 1GV1A 1P1IA 3KVRA 4GMHA 4ALNA 4OGWA 4XUCA 5K0CA 4MI9A 4XX0A 3LWZA 1UPCA 3AYXB 4G5GA 1X7YA 5AJXA 4B3JA 1TQHA 5L9AA 5BO5A 1W4AA 4WSOA 2VFAA 1YVEI 2O1EA 3S8MA 4UHDA 1BRTA 4PLTA 1JYEA 2YS6A 4PU0A 5BWNA 5FUMA 5JSHA 5E3IA 2MSEB 3DUFA 5HKBA 3BK7A 3QV1A 4KN9S 3ND7A 2GSDA 2RKWA 2YFHA 4R8VA 3TLYA 3F4BA 3ZX4A 4G01B 4MR9A 2BFMA 3K09A 1WXXA 3P5SA 3HG7A 3GY0A 1VIDA 3MSCA 4BJ5A 1OAOA 5HIMA 3QLTA 1GNVA 2B99A 1LV8A 1SBCA 2BEUA 2GKOA 2LDBA 4G86A 1EUCA 4RSRA 4D56A 2AZTA 2Q4RA 4HV4A 4ZC1A 3PQCA 3AHCA 5KX5F 3S8YA 3GLRA 2ZKIA 1NONA 3CH7A 1XNJA 2DR2A 1BD4A 5HCUA 1P4GA 2QP3A 2NSHA 3BXZA 3EEYA 1VJRA 2L17A 4KR3A 1MAVA 4MKRA 1M6VB 4K7JA 3FVTA 5D5HA 4GPZA 4NCHA 4C4YA 2X8AA 2D1SA 1M3SA 3X2FA 5E7QA 1SIWA 2YXDA 3MUNA 3AFOA 2H2GA 4D6PA 3NHRA 4WXPA 4MGKR 4B73A 3V9PA 3C16C 1W88A 1RJ9B 2HRQA 3ZI7A 3FD8A 1PBTA 5ALPA 5A3JA 2PS0A 4XQGA 5LLSA 4FSHA 4DQ0A 1E2IA 5K8UA 1TF7A 1Y34E 3SE0A 2UDPA 4ZU3A 4LNHA 2Q0SA 5AHXA 2FSSA 3EFOB 1Y98A 5KTPA 3JZDA 5A6SB 3PI7A 1HL3A 2HY7A 5AKLA 1Z8FA 2IWHA 3GRZA 2UZAA 2ZSKA 1MN6A 1ARZA 4KG7A 4ZYZA 2JDIA 3E8SA 1RRKA 5E4TA 3D4LA 4M37A 2J87A 3DAPA 4JFAA 3TLJA 1MO3A 3O2NA 5K3CA 1GGHA 4CETA 3DEJA 3QE4A 2AKEA 2OVFA 4PFKA 3DTVD 3OQOA 3IH5A 2QRGA 2ZCVA 5LDGA 4LNAA 4C7BA 1M6NA 2HBRA 3JQRA 3V8VA 3ZWWA 5JAQA 4LXGA 1BU5A 1QCYA 1E2GA 1Q15A 1X2BA 3BE4A 2R8YA 3GEPA 2AT1A 3N86A 2I03A 1Z08A 3GLHE 5G3ZA 5FT9A 4TSRA 1E1CB 3BL8A 3KYDB 4C6TA 3CX6A 1E3WB 1V8ZA 1T3GA 5AICA 4KSYA 3EZ7A 4OXXA 1KJNA 3EVFA 3VZSA 2CKMA 3THXA 4JLNA 3NGXA 1IBSA 4IUBS 1CF2O 2ZQYA 3N75A 5LMZA 1P9LA 1W75A 2ZWMA 3LQRA 4MUNA 5A9RA 2JJ1D 1MO2A 3V97A 1ZL0A 1JAYA 2Z4RA 1R0LA 3SEQA 2NO7A 3E2IA 4CIBA 2GFQA 3ITKA 4F2HA 4C7KA 4YK7A 1KDPA 2GFIA 2YOFA 1CT9A 3G0BA 3P2YA 1KMHB 1T2EA 3N7TA 1D1PA 1SXJE 1IAVA 4A0SA 2QAGC 5C31A 1CUBA 1NVMB 1Q2UA 4HVTA 5JUWA 3EPPA 4V3BA 4WZBA 1PLJA 1V1RA 4HP8A 4UATA 3GJXC 1FUUA 4OHVA 1NN0A 4X92A 1H65A 1B00A 3SLRA 1UBJS 2J3HA 2AG0A 2OP1A 3DWIA 2QX6A 1BCSA 2IHTA 5BQ3A 4P4SB 5KCMA 2JPDA 3S2IA 3LCJA 4F38A 3F6EX 3G8CA 5U1PA 5IJWA 5K0ZA 1OLXB 1HRDA 3FG9A 2OEPA 4LCJA 5CHEA 2ZI3A 3JWGA 1PJZA 3N2ZB 1EVKA 2OO7A 1B41A 2XZTA 4RGYA 4U5QA 2GO1A 2OTCA 4FGSA 4UCFA 4YQZA 1ZX1A 4OP1A 3RGWS 1GU7A 3WLIA 2W2OA 4FGLA 2CLOB 4TL9A 4FOOA 3T5MA 2Z5FA 1EFTA 5EP4A 4D41A 5JDIA 5K6TA 5HMLA 5KYWA 4FMPA 1KAHA 1XTIA 2IW1A 3K0BA 2QQEA 2AFIA 2R8RA 1EJ2A 3HEAA 4W5HA 5T64A 4EZEA 3I3OA 3MUOA 1YHZA 4Q4DA 2IZOA 1ORWA 3WGUA 3M3HA 3OTIA 3GGSA 5A4IS 2X2PA 1E2MA 1C9DB 4E5YA 1W1WA 2LD4A 2GPWA 3P5BA 1W76A 3ICOA 3OP4A 5I8WA 4QGBA 4R2HA 4ZGBA 3HN6A 1VFNA 1K0UA 3FTCA 2VEDA 3J7TA 2GCOB 4RZ2A 5DBHX 4AICA 1SUWA 2PQMA 1ZK3A 1OI4A 3PZRA 4PSCA 2MDTA 4EI2A 4ZHQF 4PCUA 2AG8A 4QUGA 1RMYA 4ZRDA 2VA8A 1BWSA 2VK4A 2PMKA 1YAHA 2FV8A 4LNUA 1HQKA 3V8BA 3NTUA 1EGVB 1QNFA 3QKIA 4BFUA 2BGGA 2B94A 4MSUA 1E8DA 2EAUA 1WCIB 1ZJJA 2OZPA 1QZ3A 1O8CA 2QN9A 4MAMA 1JSZA 2RB4A 1PJ4A 1E79A 5KWIA 5J1SB 4ZV7A 2I9KA 1J1UA 4QM6A 4KQIA 2JATA 1YB1A 1HV8A 5CM2Z 4BV3A 1CR0A 1P5RA 2CL0X 4WXYB 2HMWA 3TNJA 1R8XA 2CXHA 4JYZA 1YHYA 3DEAA 1JJBA 4ZT4A 3UXMA 4FB4A 3LMKA 4FEYA 2NUPA 2BH9A 5KOHA 2VJAA 4FZRA 1FP2A 1M73E 1U8XX 3HE3A 1Z5VA 5I5GA 4XX1A 1WD5A 2Q4DA 3R0JA 3SQDA 2FK8A 1FFYA 2D3WA 1PK7A 2P7HA 4IBOA 1ZR4A 1XO1A 3BQMB 2EJUA 1CQZA 1VP3A 3AEKB 4YRLA 3ZXIA 1OI7A 3I32A 3NJ8A 4B75A 3LXMA 4C3VA 5A5EA 4TPKA 5IKEA 1Y89A 3AJEA 4MXDA 4TTSA 4DDMA 5I7UA 1GPNA 2PPVA 3V8RA 2ZU6A 4MVJI 2XCLA 1UFVA 1K8RA 4G56A 4EX6A 4Q16A 4LV6A 5DFAA 2PZFA 5TPWB 3UOWA 4LZWA 5JVDA 2CZGA 3UAGA 5EP1A 1PFVA 1TB4A 4K3UA 5GQSA 3CEHA 2ZTUA 2L0XA 2HRRA 2X9NA 4JEHA 4HZGA 3AGQA 4HLDA 2JC3A 1G55A 3NC1C 3N2KB 5FTLA 1QBKC 5DJ5A 4EITA 3GRRA 3N6XA 1QHFA 3NV9A 3WDSA 3F7NA 1R7RA 1ZJZA 4Q3BA 5KQSA 5E8JA 3PDHA 4CXMA 2WAAA 1N6PA 1OFUX 2HEIA 3LTNC 2JAQA 2ZFUA 5H59A 3WGKA 5JYEA 5CMLA 1TECE 2WJGA 3QPDA 1ZUD1 1TK2A 4L4YA 3TZ6A 4ZHQB 1QG4A 3I52A 3QF7A 3QSYA 5A4AA 2O8DA 3BTUA 5B3JA 4GKJB 5L7WA 4HDRA 3ICQB 4NZ9A 4OJTA 5JRJA 4JA2A 1QG2A 1PD1A 1NW8A 4EUEA 1D03A 1BKSB 2PUWA 3KR0A 4KRGA 4TYPA 4PG7A 1FFCA 4WI1A 2YBDA 5J2UB 5ICGA 3GVPA 1BS1A 2NADA 3DXXA 4Y2TA 1B4DA 3HABA 3H5IA 3CEJA 2Q4OA 3ITEA 2R5WA 5EP3A 4MEJA 4EUFA 1WTAA 3NHYA 2GK6A 3HA3A 3EPKA 1EX7A 1OH7A 5EL0A 1N2EA 6PFKA 4RVCA 3P45A 4UPEA 5EIWA 3WXBA 1DXYA 1R0SA 3Q7RA 1B15A 2IIVA 3NHUA 3WZMA 5HPYB 2F4VB 1SH7A 3UT5A 3K0AA 3KBOA 4D45A 2AFHA 2XUDA 1YVDA 2WJYA 2GK4A 4YP5A 3ZXXA 4Y2SA 1S3FA 3JWJA 3VKVA 1MH9A 3BRWA 5JEEA 5JZBA 3GJTA 4NLLA 5K6AA 4RD3A 1LQ2A 1YZGA 3FSGD 2NT4A 1JR6A 1BXGA 3EXEB 1XLTC 1QR6A 3WSVA 4NU5A 3NHSA 5BRAA 3RIMA 4CKBB 4BECA 1FUEA 4EA8A 5F23A 4FUTA 2ZBUA 2FJ0A 1CUJA 3FFBA 2W6ID 4NNJA 3FJYA 1Z74A 2VPYA 1JQ3A 3ZGXA 3NP9A 1KFCB 2FX2A 3BWYA 2YTZA 4UVIA 3RC7A 3V7WA 3M1YA 1X92A 3D6NB 3KOOA 2AG1A 4ZKEA 3ZE2B 2C4MA 5HRAA 2V7BA 5EQJB 3T06B 1PFQA 1T2FA 2D8AA 4UBMA 4M21A 4WNAB 3G2PA 1JJIA 3DW1X 4F7WA 5A0VA 1JA0A 3JARB 1TFRA 3VH3A 3SS9X 1IK4A 1RYBA 3Q40A 1SN7A 5LBTA 3NI2A 4KSBA 2ZT6A 4CM5A 4IY1A 4PVCA 1TM7E 3KXLA 1L4EA 3PA8A 1T15A 2HBZA 2WUGA 4XVHA 1IOLA 4LZPA 1OJLA 4BQQA 1N8TA 4P98A 5C3MA 2LVBA 2C4VA 1M72A 3AF1A 3BGDA 3PPXA 4RXTA 5LQAA 1QIKA 1FJGB 1PT5A 4MUAA 1LWNA 4AG5A 1LF5A 4JBGA 1QPBA 4RGBA 3N8IA 2VRCD 3G2KA 2EFGA 3OZIA 2GEKA 4CQMB 2PX5A 5EAIA 4PX3A 5IYZF 3WL6A 3A0UA 1ZA1A 4KQXA 1II8B 3FR8A 3IPXA 4NE7A 2P9CA 3GZJA 3W5VA 1AA6A 3VKHA 4G5SA 4JZKA 3BMXA 3IOMA 1GLVA 4F6LA 2VAMA 5HIIA 3VHXB 3VOSA 3V42A 1GAJA 1OWNA 4FFDA 3O8OB 1LBTA 3THOA 1JZTA 3W8NA 1EK0A 3U60B 1TK9A 3GC6A 4Q6BA 3PC4A 2RI6A 2YZGA 4A03A 5JXWA 3TD2A 2ZAOA 4R5MA 3DMTA 4F85A 3DXFA 4UUQA 1KQ3A 3ADCA 1NOJA 1J33A 3BMQB 3S2YA 4WZZA 1VOTA 3FOZA 1NVTA 3KLPX 1K1EA 4MA4A 3TQTA 1HYQA 1UBEA 2V0CA 4C14A 4XFDA 1Z0FA 4BMZA 2YW2A 3AIIA 3DS8A 3GMSA 3Q1KA 4QGSA 1T0IA 4H6VA 1HF3A 2GEDA 3X43A 2FP4A 4AO8A 5IAOA 2KM1A 1MJNA 2Q5IA 4Z7JA 2FDRA 4H7DA 3ZVMA 3YASA 3LUPA 1RBQA 1W1IA 4R1UA 5ECDA 1NPDA 5JS7A 1KEEB 4EHBA 1F06A 1KY4A 1U7TA 3AQ4A 3NHZA 2FW0A 4J0HA 4CLRB 3CH4B 5AKHA 3KQKA 4W8OA 1YVRA 4LS3A 4CWAA 3BXFA 2IYEA 3LL7A 1DBVO 3UCXA 1H2BA 1YZQA 4U2GA 4BFWA 3PLNA 3TKAA 3WBBA 4BFSA 3KV1A 3C8ZA 1K7CA 4O4LF 4PSDA 3AB3A 3RU2A 4GRDA 3TNLA 2A6PA 2POCA 4ARZB 2BRUC 1DJPA 1VIAA 4GOMD 1QUFA 3R1IA 3WTCA 3NORA 1BEZA 2G28A 4HLNA 1I36A 1MFZA 3CVWA 2X77A 2XGJA 2A5JA 2GM5A 2ZTHA 1VG8A 3QXHA 4B32A 2PZAA 4Q1EA 4JP8A 1Z8NA 3ITNA 3UJ7A 2IXFA 4X41A 4MS4A 3C6KA 4FR5A 4MVJG 3ZYCA 5FUVA 4DSOA 1NATA 2YOGA 3AHHA 4BO1A 2D1RA 3IUQA 4I5FA 2O2XA 5H83A 4C4ZA 2I71A 1TAUA 1QFZA 3MIZA 3NTRA 4GVXA 1VHDA 3M9LA 2JANA 1AU9A 3KFXA 3DXZA 2PZ8A 2ECOA 1X8KA 1CY7A 3OUTA 2VOEA 3QUSA 5HG0A 4KTVE 1L6RA 1N1EA 3WGHA 4RC9A 1M74A 4KZPA 5T41A 4RA9B 5DCWA 1Z5NA 4Y7DA 5FWYB 2HWKA 5BPHA 1D09A 4B6RA 1JQAA 4KQGA 4TUYB 2NNWB 2P2ZA 4NOLA 4RZ3A 5BT8A 1Q57A 2GNAA 2IF0A 7ADHA 1UDWA 2H85A 3CRZA 2AYXA 3ABQB 1WBBA 3NM4A 3WYEA 5EHIA 2ZSHA 2NP7A 3QNMA 3DE7X 3R5JA 4ACBA 4BNKA 1ZCZA 4AJNA 1FMJA 2C57A 1DQZA 3QPBA 5DKFA 2YQ5A 1K6IA 2DU8A 4JBNA 1YZ3A 1UWCA 2M1XA 1KC1A 3TAUA 3OHPA 2CUTA 2BR5A 4AQDA 4C08A 3PJFA 2J3JA 2J67A 5IG2A 2QR2A 3BWDD 3TRHA 5A0FA 2WJ4A 5EKUA 4AKGA 2C98A 1QHHA 2AOTA 3P0IA 4RYDA 3RRFA 5LDDC 1KTIA 1FJ2A 4KE8A 4XA8A 3N59A 1NBME 2KW5A 2VHZA 4NFSA 3W7VA 1TM4E 5DHPA 1A95A 4NAVA 3SMVA 1G38A 2WMOB 2DKFA 3H5LA 4QPDA 2WVHA 1T24A 1KZ4A 4F97A 1JEJA 3IEUA 4LK2A 1UK8A 1G8JA 3WGMA 3EUEA 4B84A 2BF4A 4EFDA 1TPYA 1WSBA 3ZEAA 1EESA 1GNPA 4LFCB 4HNSA 3KQQA 4IDOA 3ELDA 3OZTA 4P7KA 4TT3A 2QE7A 2VXOA 5DTEA 4YCDA 1NF8A 3VR4D 1ST2A 2DTDA 1GDHA 2FWIA 2B4YA 3CCBA 5GOTA 5FNVA 3UB2A 1NAIA 3TR0A 3B5JA 4LEIA 4BGIA 2UVPA 3D54D 3HPQA 4KGZA 4BV9A 4O3MA 1F51E 3I45A 3Q9LA 4PAMA 2P3SA 4J7AA 4M8NE 2XNHA 1Q0ZA 3GD7A 2O7QA 2OQIA 2PUEA 5IP5A 2PUTA 1RYEA 2PXCA 2W2KA 4JC4A 3BIOA 1KSHA 2X9GA 3EZNA 4FI3C 5CT5A 2DEUA 2ZJ8A 1AKNA 3RRXA 2IXAA 3L0DA 4C2AA 4MWOA 3VSDA 1R8JA 2GDJA 1V4VA 3PWZA 2W8BA 2XMBA 4KDFA 4MYDA 3JV7A 4WQMA 3G5AA 4DILA 3FY4A 1T6XA 1NXOA 1ZPDA 1GYPA 1WPGA 2FZGA 2SKDA 4GPEA 4ZOEA 4A6EA 4MK4A 2J85A 1I4EB 1UJMA 3DLAA 1J7JA 1QONA 2HHAA 3FYSA 2V59A 1NUQA 3MQ2A 4G5YA 4MINA 2CGEA 2MHCA 4WECA 1X13A 2CJFA 4HN4B 2AE2A 4MS1B 4WJZA 4QUAA 2VBIA 1XZAA 1PR9A 3UHPA 5JLAA 3PUIA 3WLMA 5EJFA 2V7XA 4YAFA 5JS1A 5DBIA 4P7JA 2ILVA 1XRMA 1U6KA 1XVIA 5REQB 3TJRA 5IHXA 1UJCA 1A7UA 1LSSA 2Z5VA 2DM6A 1X7XA 1DEOA 3Q5GA 5EHNA 7AT1A 3PCTA 5JC1A 1SQ5A 2ZIEA 5DP1A 4G36A 1ORVA 1EX6A 1MRZA 2QBYA 4PYKA 4EECA 2I6GA 3GLIE 1I14A 3QX8A 2YHIB 1ZBQA 1IG0A 1D9XA 2NO5A 1W2HA 2NGRA 3H4MA 4FWIB 4JJ7A 4N3GA 4Q4AB 5EVCA 2RHRA 1BGXT 4BMSA 5U4QA 2DT5A 2O5EA 4IFBA 1U2DC 1JBQA 5FAXA 3CF2A 4C1NA 5B1DA 3QVMA 4OHUA 1X1EA 2IYXA 1E2UA 4DVJA 1O08A 1DMRA 5KOJB 2IX3A 1NJSA 2AEMA 3PPVA 1KO7A 3OT4A 4WINA 3OH8A 4ZYXA 5GZ3A 1R00A 1A69A 1VJDA 2FJUA 4QZVA 1JWAB 2FZWA 5ITZB 3IELA 3TPFA 2H4HA 2ZRDA 1SZJG 2PMBA 2C59A 2DR3A 1VJTA 3EQ9A 3K9NA 3KOMA 4H1VA 4M0LA 4MZXA 3ZTYA 3KO8A 3OE1A 5C80A 2Q5OA 5BQPA 2D13A 3KV3O 2QRNA 4LV8B 5FRDA 2YWDA 1KAGA 3PIDA 2WG1A 4MS3A 3ZDRA 5K99A 1AM4D 5EQDA 1RXYA 2J0EA 5IKOA 3OLWA 4IX9A 1TYAE 3LQ4A 4PFQA 3EN0A 1G19A 1DKRA 1NIPA 4JJZA 2QWXA 3DMFA 2OZEA 2VS1A 4FS3A 1NULA 4ZRNA 5BW5A 5I48A 3VZDA 4DBVO 5FL7A 1TZKA 3A6DA 3G9UA 2CL5A 3UC9A 4PIPA 3KX2A 4YALA 1UKAA 4GQIA 3IUEA 1XP8A 5AXDA 2GYVA 4MUGA 4ENTA 3Q1LA 4JMPA 2AMVA 1TVKA 1EFLA 2PFKA 2XWJI 4AMBA 4CDMA 3OF2A 1E4EB 2V96A 1ND6A 2WEKA 3W5AA 4G1BA 4RIIA 2X42A 4MIOA 2ZS8A 4WZBE 2RDMA 1ZVVA 4F9TA 3TOVA 4QGFA 2Q5FA 2PR7A 3OTHA 4B7CA 4BMVA 3EARA 3TVDA 1W85A 2NV2B 5A03A 1TVEA 4GS5A 4HZUB 1KI2A 4M0EA 3KQUA 1CJUC 4IGAA 4A8JC 4HBGA 1R9GA 1GM5A 4K9KA 4BKUA 5KQGA 2QVYX 4AMZA 5JT1A 4R1TA 2JL1A 4OI2A 3SD7A 2PY6A 1ULUA 4LZAA 1JA1A 4EG5A 1L3BA 4EQ6B 4PRLA 3P9IA 3K73O 1DX9A 1OU0A 3ESAA 3NWPA 4U7WA 4HSEA 1FSSA 3JQ9C 1Q19A 5F21A 3MCWA 4U00A 1QUEA 4OJNA 1NUAA 2HH9A 2JIBA 1T26A 5HKKA 2AFIE 1C8LA 4YJKA 3STUA 2Q46A 2Q7XA 3LTEA 2QMYA 2IPOA 4LJLA 4UDNA 5I9SA 4AL4A 1W59A 1ODIA 2NU9B 1O4WA 1X1CA 4BNJA 1ZNXA 5HE8A 2Z8YA 4KWTA 3ZDFA 1GZDA 5FPSA 5AVJA 2C31A 3G68A 4M76B 2VDJA 4O2BB 5DK4A 3HUEA 4IHQA 5K0SA 5GIPE 3F1KA 3RFFA 3JALA 3S0JA 2MR6A 2PE5A 1N2CA 2PUJA 2Q4TA 4MWCA 3SXUB 3AFMA 3LXXA 1P6QA 4PQFA 2QT9A 3CRMA 4LISA 3CRQA 5AKZA 3RKUA 1CNFA 3WGQA 2AKAB 3WKDA 4GX1A 1K6EA 2WE7A 2Y93A 2BHRA 1ZD4A 4F3KA 3VSAA 4J94A 4B3DA 2WOJA 3K7EA 1QK3A 4OGFA 2PJUA 1V1MB 2H48A 3PFCA 3UJNA 3MN1A 4DR6B 4MCJA 5JZMA 3RIEA 1IONA 3IP1A 4GGPA 2OBLA 3AERB 4O6VA 2VTVA 5HE9A 1L8XA 3UOAB 3ZUPA 2AK2A 3LL4A 2QG6A 4H0FA 2H7YA 1JE0A 5KPJA 1P1BA 1Q1BA 1JW9B 4H7JA 1ZMOA 4QUBA 4RY9A 4DIEA 2I99A 4QTXA 1PKXA 3NS7A 1AB5A 1LJUA 3K16A 4WJKB 2ODAA 2JAHA 4HX9A 3RHTA 5E6SB 3BHIA 5ALXA 3UWPA 3T8YA 4GKAA 3UTCA 1N9GB 3QVOA 1VMAA 5KJ1A 4GT1A 3W9SA 3PRHA 5DBFA 5C5IA 4J1QA 4KN5A 3NMUF 1P80A 4TKVB 1QF9A 1D8TA 2EW1A 1EFHA 1OQAA 2I2CA 2ZRLA 3WV5A 1UQUA 1EWYA 1X7WA 4Z9XA 1KYWA 4CKCA 5EIBC 5C7IO 4ZEXA 4B6QA 3DYBA 1FZQA 5KNDH 5IK2D 4YFYA 1ZC4A 2HWUA 4DCSA 3U44B 4MW5A 1FOEB 5AI5A 1NVVR 3O4FA 3PNPA 3OIGA 3R0QA 2VSXA 2W6OA 1E63A 3IMCA 2RHHA 3KOUA 1F8GA 1KFKB 1L7AA 1D6NA 1XRJA 4MW1A 3TZQA 4ACAA 5D84A 1JQ5A 3F3MA 1O2DA 1HLGA 1V11A 3M6UA 1O58A 4RZXA 4E5VA 1G42A 4LJAA 2D6FA 2LV8A 2IZ5A 3KU4A 4JIMA 2DX7A 3F71A 5COQA 3TIIA 4B7ZA 2YR0A 3EGIA 5BV7A 1Y3HA 3MEQA 1SU6A 2HIHA 1XTPA 2YQ4A 3VDXA 1A1VA 1OGIA 4QQFA 4S24A 2YZ7A 5FL3A 1EXMA 4I66A 1T91A 3VYSB 4YYZA 1YMVA 4RKYA 1W30A 2J5RA 1LS1A 4S1PA 4ZI2A 2C58A 5LQNA 1V41E 5JAPA 3ZZ1A 5EKTA 3DLBA 3ZV5A 3UY4A 1WW3A 2ZUCA 4YIKA 1WNTA 2VSFA 3GRCA 4GBJA 4UNRA 4D8WA 1D6MA 1PGOA 2ZBGA 3L04A 1PX0A 1X7DA 4I14A 3T3DA 3CEPB 3V46A 4HDSA 1QRRA 4YT8A 5AJWA 5IASA 2P90A 1UJ6A 4NYIQ 3CU5A 3WHPA 4LF8B 1KEVA 2ZPTX 4TXNA 2R6CA 1OLSB 3BTVA 4I4LA 5K5EA 2IZ7A 3PICA 5K0JA 4UCWA 5LQSA 3CF6R 3D1VA 2OXTA 3X1WA 1QC5A 1J0XO 4R3NA 2PSDA 1EE1A 1H2AS 1LB1B 5EN4A 4AMGA 1XNHA 4MVJH 1E7MA 5IDYA 3KHTA 5G3YA 3AILA 1ILEA 3TQHA 1ISIA 4U7HA 2I66A 3PE4A 1OXSC 4DWOA 2RGGA 2WIFA 1F60A 1P3Y1 4LDRA 2OFPA 1MX5A 3VX4A 3OU2A 5L3VA 4XJXA 3RSGA 4OSOA 1LTHR 2ZQZA 4YNBA 2EZ8A 1MXFA 2ZRBA 3TLBA 4C22A 1IOWA 4F8YA 2P27A 1JG1A 2YNMA 2R6ZA 3C41J 3FI0A 2QXUA 3O31A 4MV4A 4QQRA 3DTVA 1G9XA 3EHDA 3ZU2A 1QZTA 2B83A 5C18A 3BGWA 1BTOA 2JAXA 1GZSA 5CLQA 5JC8A 5L40A 1HNXB 1H1LA 1DXOA 2ECQA 3AW8A 3ND8A 3QYPA 1X80A 4V0KA 1WUTA 3HJHA 3NAQA 3PIIA 4JLBA 2HK8A 4DW8A 1UIMA 3U1VA 1WMFA 2CL6X 5I7HA 1NVDA 2NAFA 2Q5QA 1NLUA 2HBQA 4UXHA 5E4FA 2OSVA 3W5JA 5JNTA 1TEXA 1CR4A 2O3RA 1UAGA 3G0CA 4K9NA 5TR9A 3WIDA 1JFLA 3OKFA 2OY0A 5EEHA 4BVJA 3LA6A 3HKEB 1BO6A 4N7JA 2R6R1 1L4KA 3UUEA 5HOQA 1HURA 3H6HA 2IY9A 2B98A 4FE3A 3WL7A 4TQGA 4OSEA 5DM0A 4G26A 3HV2A 3ETCA 2W4MA 4B6JA 1ESDA 2IUTA 4N7RA 2OMKA 2W90A 4JNKA 4YN3A 3EPHA 4C01A 3HLKA 2WTUA 4F8EA 5JS6A 2JK1A 5IF3A 1RBYA 4GI5A 4IM7A 3H87A 5LZ5A 1U80A 2KB0A 3QM1A 5FJJA 1T13A 3IBGA 1A77A 4D79A 2R1UA 1CR1A 1Z3IX 3LECA 1PHRA 2EG5A 1QYVA 2IFTA 2X1VA 2RGDA 2YMMA 3KYIB 4OREX 3RANA 5CA1B 1GWNA 1ZN8A 2J3LA 1A7JA 3L9WA 3JD0A 3LUJA 3TG8A 5JSZA 1AQ6A 1WB4A 3X1KA 1XMPA 5K4HA 3AKYA 1CQIB 2XBLA 3O1IC 3T1QA 5THXA 2GVZC 4IIEA 4DBLE 2CVHA 5EMHA 3S99A 2GXUA 1S8AA 1W25A 3GPLA 2FWRA 4RGVA 1CZRA 1NT4A 1ZY2A 3QEAZ 1WEHA 1ZJYA 2QY9A 3TEJA 1HWYA 1WW8A 3DEZA 1SU4A 3PXBA 2VPIA 1CUEA 5IZ4A 4R1SA 4NS1A 3U4DA 1IZ9A 1QH8B 2IZ1A 4DV6B 4JUAA 1YBAA 2HA0A 2PCLA 1SUIA 3RC1A 3PSHA 1KY5A 4Q1DA 2HMSA 5DRYA 1SU8A 2ATIA 4R51A 3IT0A 4IDEA 5H7XA 2IPNA 3VTAA 1T5HX 4WNIA 2A0UA 3K4PA 3TEFA 4DTIA 2CK3D 1WV1A 4DQXA 1E7SA 2DFTA 3IRUA 3EOAI 4IDGA 5FOXA 2EYQA 3N53A 1TT5A 3T61A 3EEFA 3D5QA 4G4SO 2R751 4AJ2A 4XI9A 3EGVA 3W6ZA 4KUGA 2RH9B 1MEEA 3EY9A 3I4CA 5IJ0B 2VYFA 5L8VA 1PR1A 2ZJ0A 2VF4X 1AN0A 3TFOA 5DM60 3FCAA 2OV3A 2Y1GA 1YZLA 2IH5A 1LTQA 1YT5A 3TGLA 1S3SA 1X2EA 4BPBA 1AJEA 5F3DA 3L7DA 1VKNA 3WKBA 5B37A 1G1MA 1FQOA 1VSUA 5JMTA 4HQNA 1XHLA 5BVGA 1AQIA 5CNIA 3GT4A 5KNBD 5LYJF 2JKVA 1XE3A 2CXPA 1PG2A 2JA1A 4H3SA 3UCFA 4QJ3A 4AF6A 3R6GA 1XB2A 1UJ4A 3O3OB 1NQWA 3PJRA 1LVHA 4Y2HA 3OQMA 1JVBA 2DP4E 5CX4A 4RPKA 2O5RA 4BO8A 3AF2A 1AKEA 1OGYA 1X9GA 2CNLA 2E89A 2NVUB 1F1BA 2QGFA 3MTIA 3VC3A 1U5AA 3D6FA 4R9UC 3QWFA 4WVLA 2FMKA 4ZVLA 4E12A 3ZU3A 4F9EA 5HIAA 3HKDA 5FLEX 2BF7A 3S29A 2BBTA 5CCDA 4BASA 1G18A 2F9MA 4UD2A 3L5OA 1L8AA 4J2OA 2XYQA 4RAQA 4K03A 5FBZA 1M0SA 4QDKA 2Z43A 3VC2A 2X0JA 4ZXFA 3VYVA 3IXQA 3JQAD 4F56A 3GFFA 4CDGA 5E0OA 1SMKA 3TZLA 3GLTA 3EIEA 1A71A 2ZVJA 3ISVA 2VBFA 3LYAA 2PAFA 3IAUA 1M6YA 3AK4A 5EUMA 2BMVA 2MJLA 1YB4A 1TCCA 1YUMA 2C5EA 4FFRA 4CEHA 5FULA 2XE4A 2DGDA 4HR7A 4L4SA 1W0CA 3PNYA 3D9QX 3NJ4A 5G1OA 5JWOA 2UUPA 2V5AA 3OA0A 1ECCA 1DFHA 2D1FA 2FR8C 1XZEA 2COUA 4QXQA 2P0YA 5KJFA 4WAUA 4PSVA 3T5AA 3ZDCA 2XD9A 4U2EA 1NNUA 4MYTA 1E66A 4CCYB 3EQZA 4D1YA 1ND5A 1PCXA 2EKBA 2QAJA 2D3TA 4GGOA 3QF4B 1YFLA 1FVHA 4CM6A 1Q2XA 2DPYA 4EEKA 3L0SA 4L0QA 4Y30A 4D0NA 1FTQA 4KXVA 4EW6A 3KB8A 3A70A 1A8UA 3JQFA 3ML1A 4HAZA 1XN4A 3IQIX 1B1AA 1PYDA 2IYTA 2JAUA 5FTWA 1F4LA 1ZL2A 2QTGA 4M53A 5FB3A 1WZNA 4ZDKA 3ER6A 3QY0A 3S40A 4CMGA 5U4XA 3O3CA 1U0NA 3OPQA 4BX2A 2WJ6A 5EJ9A 1Z2DA 1VIVA 1D0SA 3IO3A 3GGPA 3ESXA 3WTBA 2XUJA 3KTAB 3RSCA 1ZONA 3GLGA 1J25A 4BCDA 3CISA 5EJAA 1VSTA 5FBRB 1A04A 1EZ4A 4NV0A 3PC8C 3SICE 3GA5A 2FW6A 1MAHA 1LDNA 3IKMB 3OCUA 1N5JA 1NOIA 1Z62A 2DTEA 2NX2A 2QPLA 3MXOA 4PHHA 2I22A 1C9NA 1X8LA 2BBWA 1G8AA 2WBLC 4IUYA 1DQRA 4BMCA 2Z1MA 1K0FA 1M1YA 4D82A 3Q3VA 4KE6A 1PFGA 3P97A 2WPDD 2CXUA 1NZDA 3CC8A 2E4AA 1ZSNA 3L6CA 2FOLA 4M1KA 3ETJA 3I8SA 3OJWA 3FSGA 1MNAA 1A2BA 3VTKA 4BNWA 2I65A 1YQTA 1J00A 2JIZA 1UOEA 2AH5A 1MC4A 3O1HB 1KJIA 1G6HA 5AYVA 4Z53A 1NXWA 2B9VA 1YE3A 5DYNA 1EYZA 4F11A 3RVLA 1A8IA 2OWDA 4XR9A 3H11B 2W6IA 5EJEA 2JGLA 3DP7A 2H54A 3HDQA 4MX8A 4ZO9A 3QKRA 1BKYA 3ZCUA 4ESVA 1RD4A 5GJWC 2WUFA 1Y8CA 1H93A 2C2YA 1Y8QA 2YIMA 3FPKA 4IVNA 3TI7A 4BNFA 1QXSA 4F46A 5CR9A 4ZYYA 1OKKD 2P62A 1I30A 4NC9A 5ALYA 2FN3A 2W6ZA 3I37X 2I67A 4AJHA 3K9QO 5AW0A 5G4KA 1P7PA 2A9KA 3GJ6A 4XTCS 3DJYA 3T5DA 3V4OA 5K0EA 5KTRA 1CUUA 3E6AA 2PVPA 4QU8A 4I3GA 4J91A 5J2UF 4IJWA 3HBNA 3W2EA 1K98A 4RKQA 1T1IA 3ANMA 1MCZA 2V3CC 4GLBA 1DGQA 5A5FA 1ZXLA 4R2KA 1X1SA 1FNBA 1JDJA 2YJTD 1Y63A 3NBMA 4GIBA 4PPQA 1DV1A 5DM2A 2ZIUB 3ASYA 3VQTA 4B7UA 2O0JA 2XMPA 2QAIA 2YH2A 2JIMA 4I50A 4PXYA 5ER6A 1T4MA 4BP1A 1NI5A 1DEHA 1J0EA 5C8YA 3SDBA 1JWLA 1ULSA 4L8GA 5YASA 3W9UA 3JYHA 4NEHB 5ALQA 2ATCA 1TPZA 3C1OA 1U98A 2AJTA 2CHFA 4P3PA 4RV9A 4BFZA 4L75A 4ZGWA 3GZTB 4N8EA 3A1TA 3U16A 2VRCA 3IIJA 2QSYA 4D97A 4PG8A 1EVQA 1X3SA 3K1JA 4QHTA 3M33A 5IXSA 2Z6AA 4D81A 3H7AA 5FXMA 1I1QB 4M22A 3JQEA 3FSJX 5A4JA 4FINA 4YAJA 1CLUA 1BJTA 2BFCB 3ZNNA 3S6JA 2Z08A 3UMBA 4H18A 2O05A 3MCVA 5IABA 2BHTA 1CRLA 2FPPB 2IYSA 2REBA 5ARBA 2NZJA 4Z7OB 2Z0MA 3ZEIA 3K0CA 4G0OA 5GONA 3D0QA 2FEOA 2YXEA 3T9FA 1V71A 2BISA 2X5XA 4KKVA 2VBCA 3FYTA 2B35A 3IUSA 1UCFA 2EHDA 3FFXA 4IJKA 4YONB 1JIUA 2VQ6A 3FCEA 4REQB 3VHRA 1QS0B 2OK8A 4EELA 1RP7A 5ESXA 3JQ8A 3O83A 6CHYA 4Z49A 3AY6A 2RHOA 4R8MA 4UAUA 3AKCA 3CF4A 3BE6A 4BATA 2HYDA 3W5DA 3PFBA 3PNQA 4NE9A 4ID3A 4UU8A 5DV9A 4NYJQ 2XVYA 3TNFA 2CLLB 4D4HA 2QJFA 5JI2E 2F6RA 2IBMA 2Q6OA 4E22A 3DVAA 3VMFA 5EKSA 2QDXA 3C6BA 1JDBB 1C1XA 1NJ2A 1SC6A 2EERA 1KK2A 3EA0A 4IIJB 4M0DA 5C34B 3RU9A 1CCWA 2OHFA 4QXMA 1TCAA 5CYFA 2RARA 1IVYA 3UHOA 2MU1A 4XCVA 4KXQA 1TW3A 3BMNB 2BP7A 4E1AA 2O4CA 4UUMA 2W2MA 4E0BA 1C9YA 1YVUA 2RGAA 2OENG 2VKQA 3IAHA 3COPA 4QGGA 1KOLA 5MN4A 1S89A 1KI1A 3VUFA 2R7MA 4AP9A 3C0KA 1OUMA 1E3QA 3LAWA 3QOWA 2DHCA 4EP1A 1U94A 3M5PA 4IGFA 3TOXA 3FLMA 4HZIA 2A84A 4D6XA 1ZJ4A 2Y2UA 1RBMA 3IOBA 3LF1A 4K6KA 2RHWA 5GM2A 2O2EA 1HKHA 5CT6A 4HGYA 3O7MA 1CZUA 4KYVA 1CYDA 1G0NA 5FWDA 1V3VA 1QBGA 4N01A 3HO6A 3JPYA 4PWZA 4S12A 1I9CA 1GL6A 2JVIA 1UQRA 1GNSA 1CNMA 4ITVA 5K05A 5KKNB 1IPFA 2W2QA 4GG1A 3ZU4A 2JIRA 3JZMA 2Q6KA 4OG2A 4D3XA 3AR4A 1NX9A 1JEYA 5FBKA 2C9CA 2XYRA 1Z2AA 2EATA 3ZTTA 3EG9B 1JPUA 3RAEC 2QY6A 1OLUA 4YT4A 3VNVA 1WQ3A 3DBLB 4QRHA 5ELXA 4XGQA 3JQPA 4HGRA 2FMFA 2JJ2D 4ZU6X 1D2AA 1WDTA 3S28A 3MSXA 3DVLA 2QIOA 4IAOA 5F2NA 2JVKA 4JDPA 1EDZA 2D7JA 5AI4A 3FWPA 3STTA 3QBDA 4DG9A 3BA1A 2C2KA 3R24A 1VE3A 1U0OC 4COOA 4EYQA 2E21A 3ESZA 3I12A 1SC3A 3QBTA 5K3DA 4C4TA 2FG7C 2XODA 4OLBA 2QDKA 2G80A 5BN4B 4TWJA 1GGMA 3NEAA 3CLTD 5AJYA 1YXMA 3PNBA 1UZAA 3A6KA 3BICA 1R12A 3KD3A 5AVUA 2CFCA 4MMXB 1I7QB 4DLZA 3W5CA 1W4CA 4B46A 4AN1A 3PX7A 3Q6IA 2XYGA 2WWXA 2HJHA 3G13A 4GLOA 4PG5A 3F97A 5DSZA 2GRAA 1JU4A 4QT0A 1FFBA 5LA6B 2MYNA 4BYGA 1KYZA 3WKCA 1EVEA 2KYRA 1YCHA 3CMMA 3ZWAA 2RBGA 4RJIA 5AHKA 3IUBA 4R3UC 5CHYA 2RMKA 3SXJA 2F43A 3WRXC 5AW4A 3KNZA 5IT5A 5DULA 3HUDA 2FWAA 1JKIA 2CDBA 2G6TA 3D0RA 3NH6A 4CM4B 2G9NA 3K9GA 2PS9A 1WG8A 3M82A 4NYJR 1SFRA 1EFUA 1RYMA 2P4QA 1NR7A 1KEUA 1NBAA 1RI4A 3BSFA 2FZLA 7YASA 3SLGA 3L05A 3PNMA 2WNSA 1FDTA 4RF2A 3HJNA 3H5AA 3CVJA 1ZRSA 2CMFA 2NVWA 1KI7A 1YGPA 3QEJA 1NBWB 1LU9A 3JS5A 2VT6A 1I33A 3FWNA 1S96A 4OMUA 3F3SA 4HH3C 3PTAA 1WL8A 2B2CA 1G8SA 2A4MA 3ET4A 5C5DA 1MGPA 1WZEA 4HNAB 1RZRD 4RNDB 3A26A 3FPLA 5A62A 1PKEA 3AHDA 1QGOA 2QUZA 2X0RA 1PWZA 4L3VA 4R1MA 1NI4B 2PGLA 1G98A 3IERA 3L7IA 1QYCA 2FF5A 4DXAA 1FJHA 4LSMA 1HG0A 1BFDA 4HATA 1B0PA 1UINA 3VYWA 2ZBDA 3EZLA 4TUYF 3QXSA 2QU8A 1T1JA 3R40A 4P38A 4O1MA 3ZWDA 2V54A 3L93A 1TE2A 2E5WA 2WIAA 4OUKX 1ZJ6A 1PT8A 1WULS 4Y6LA 2XVMA 4A92A 5HJ5A 2BKAA 5E2AA 3BBPA 1FYEA 4XSGA 1N7JA 4R68A 4OYRA 3BXGA 2NU8A 1A7AA 2PX0A 3QELB 3IUJA 1JHUA 1F2DA 3VH4A 1M33A 1YUBA 1L5GB 1QSGA 1CULC 1AT1A 1HE8B 2GX6A 3MTAA 3DHEA 2R00C 4M1SA 5E1BA 3V7FA 3EGWA 2ZIGA 5HTKA 1MOQA 3I5UA 1SQGA 1ZS9A 4I99A 4M9QA 1B0AA 4Y2JA 3LYHA 5FORA 2WHEA 3ZH9B 3ZR4B 1UODA 4EPVA 2N3ZA 3EZ2A 3KJNA 3PF9A 3EVDA 4IHJB 3WDMA 2PWAA 3QITA 2WKWA 1IM5A 1JKXA 1GL3A 1NMQA 2QN2A