3TRFA

Structure of a shikimate kinase (arok) from coxiella burnetii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
LTNIYLIGLMGAGKTSVGSQLAKLTKRILYDSDKEIEKRTGADIAWIFEMEGEAGFRRREREMIEALCKLDNIILATGGGVVLDEKNRQQISETGVVIYLTASIDTQLKRIGQKGEMRRPLFIKNNSKEKLQQLNEIRKPLYQAMADLVYPTDDLNPRQLATQILVDIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Shikimate kinase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 61
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3trfA00
3JZAA 4C0KA 2WTUA 3LBIA 1GP2A 1A5TA 4D4KA 2RHDA 2GJAA 2VRWA 1E2JA 3CO5A 1XXHE 1E94E 1NN5A 1XZQA 2J41A 2YOGA 1GL7A 3CR7A 3T61A 2FOLA 4Q9HA 1NMZA 4ON9A 2FPMA 2GXQA 2A7QA 4DWJA 1KAGA 5J4KA 2ERXA 1U8AA 4KVGA 1SVOA 4EUNA 3U7GA 4LHVA 1SHKA 2DWOA 3LD9A 1XMIA 4BEBA 1CRQA 4WZ6A 3P20A 4MRNA 3U4QA 3EC1A 3NTUA 2O8CA 1GFIA 4URVR 3AP1A 2ZS9A 4QOSA 2B8WA 3IILA 3ZQ6A 1M6NA 2O0JA 3RHFA 1E99A 2W6JD 2Z83A 3GQBA 2QNRA 2OE2A 3N70A 4I1VA 4M9XA 2BV3A 2B8TA 1QVAA 3FOZA 1AN0A 2IYZA 2Q3FA 4LHWA 3GD7A 4KO8A 3R20A 5EXSA 2WM9B 2H5EA 4W7SA 1NG9A 2RGDA 1PLLA 3IIMA 4DC9A 2FZ4A 2V6IA 4HDOB 5CYPA 3VNUA 1T8UA 2VP5A 1UKZA 3D6TB 4G3XA 1II9A 3A1WA 1N0VC 4DZZA 4JLOA 1A2KC 4O25A 4OL0A 4B3FX 1Z2CA 2BBSA 5IRCD 3EXAA 2JASA 3F0TA 2HT6A 1R4AA 2Y8EA 3TQCA 3QOFA 3MWYW 4MKFA 3A6PC 4II7A 3GLFB 2KSQA 2ZRKA 1Q21A 3SBEA 1IOZA 1COWD 1N6NA 1P7CA 1T3HA 2JJ1D 2IEYA 2VEDA 3H4MA 4PO1A 4Z1MA 3V00A 2JIZD 1V43A 1G7RA 4LWZA 1E2QA 2L0XA 4Q01A 2PJRA 1PUIA 1Z6AA 4F4JA 2FPKA 2OESA 2RGGA 1UAAA 4LY6A 1D9XA 1A4RA 2ZRIA 3B1YA 3T5GA 4LHZA 1QG2A 1D6JA 3CLVA 5EE5B 2QSYA 2BMDA 4F7WA 2FN4A 4EFLA 3MGCA 4NDZA 2V7QD 1KYIA 2ZANA 4JJKA 4N0DA 4HLUC 3AF2A 3AF0A 4MUAA 2CXXA 2GKSA 1L4YA 5GADl 1E0KA 3WNBA 1D9ZA 1JAHA 4FCTA 5JWRA 2ZI9A 3AM1A 1W47A 2WKQA 1AKEA 3L43A 5KHOC 4RD0A 2R62A 1YR6A 4URUR 1RRCA 5BQ5A 2IBMA 4JBYA 3H84A 4BZXA 4IOLA 1R0WA 1QRAA 4AIIA 5JI3E 1XFAA 4BZPA 1EXMA 2D3WA 4M1YA 2VSFA 1KDOA 1LVGA 5TVKA 1N0UA 2PCLA 3O8BA 1S1MA 3BB4A 4LYAA 1NMXA 1Q22A 5AUQA 1D8TA 3SQWA 2QAGC 4HZUA 1YKSA 2ZUDA 3SHWA 4JKYA 4TTRA 2GXAA 1CKEA 1HURA 5DISB 4B74A 1CR2A 2N46A 1WB9A 3AVWA 1NBMD 4P33A 3BD9A 4YXWA 1Z6XA 4CEIA 2CE2X 2D62A 2ODEA 3CRVA 2ZRLA 2HDNB 3RWOA 5L3QB 2O8FB 4A82A 4NPHA 4DSOA 2QQEA 3EIHA 5K8IA 2I1VB 1XMVA 1OH6A 4WBSA 4D6PA 4RD4A 4OHWA 1XPUA 2OBNA 3C7KA 3WBKA 5BWMA 1UDWA 2AFHE 4M1TA 3OE7A 3RS4A 2W83A 2YZ2A 1RRPA 4HDQB 4EFMA 1ZNXA 4UNPA 2EWVA 1FQKA 1U0JA 2ZI3A 3K09A 1KMHA 1KJWA 2JLRA 4Q02A 5HZKA 3GFPA 3K0AA 1IONA 3W8RA 2JDID 2VYFA 1G6HA 1GNRA 5EP2A 2GJ9A 4TSFD 1ZD9A 2YINC 3EZFA 1IAQA 2CDNA 1XF9A 3QKSB 4L5BA 4LDJA 1D2MA 1R0ZA 3QBVA 4AWXA 1AZSC 3U7HB 4JLBA 4EFNA 2FEOA 2ZU0C 3X2SA 3K70B 2CCJA 5JHGB 2WJJA 2VHTA 4L9WA 4OJKA 3TE6A 1WQ1R 3OEHA 4C7OA 1GWNA 2QEQA 3MRSA 3KDSE 3EZ9A 1XPOA 2GILA 4LGMA 4JT4A 5FR2A 4Q4LA 2I1QA 3DZ8A 1QHSA 1QHIA 2WPDA 3NBFA 1AM4D 3IGFA 3B7GA 3NXSA 4C30A 3Q5EA 3RRYA 2ZSFA 1N5LA 3EWSA 4AKGA 3AEZA 2ZJ2A 1E0JA 5KDDA 1VCOA 2AXNA 1JALA 1R8QA 3BRWD 4LZZA 4MYTA 1QHGA 4Q4AA 2EQBA 3QG1A 3TSOA 4A0FA 1IM2A 4JL8A 4US2R 1FQJA 1BIFA 2CBZA 5F98A 2Z6VA 3I8XA 4HLDA 4XVQA 2WWXA 2ZSAA 1MT0A 5FBLB 3KQHA 2QU8A 1OB5A 4LV5B 2V4ZA 2MMGA 1Z0JA 2IWHA 2OCAA 3QXXA 1XJQA 4BE7B 3KQNA 4Q4HA 2J7KA 1SVLA 4JVLA 2OCBA 4CYMA 2CHQA 2NO0A 2GK7A 3O47A 3EC2A 3W6OA 1DTSA 2J87A 2KBFA 2WWYA 3BERA 1TQ4A 4Y0VA 3T5DA 3GJXC 2ZRBA 3S1AA 3NDPA 3UMFA 4CEJB 1EWQA 1S4QA 2G0NA 4ZIRB 4TLBA 1U0LA 2OLKA 4KSCA 2QI9C 5GVSA 2AFIE 5LB4A 2FSGA 2JEOA 4BFYA 1LF5A 2J59A 2IHBA 4RZUA 1JR3D 1NF3A 3UG6A 4MYCA 4RD3A 3U3JA 3O8RA 2C99A 4TT3A 2AHOA 4P4UA 3OHMA 4U5XA 4D82A 4BFXA 4PSVA 1YHNA 3W9YA 1XEFA 3DL0A 2HCBA 4LJAA 4A8JA 4FD2A 4BECA 2J3EA 3EIQA 2ZJ5A 1N5JA 3PEUA 4NCIA 4XD7D 1IN4A 1IN8A 1VTKA 1F3OA 3AVXA 3RS7A 4IFEA 3HWSA 2YNMA 1MR3F 1KHTA 3TGPA 1B23P 2CE7A 4S2EA 3RRMA 4YDHB 2CMKA 1E9SA 2QRNA 1E79D 4ITRC 2ATXA 4PPQA 3K9LA 2P2LA 5D3MA 1F5NA 1AJEA 4LV6A 4XWOA 1Z6TA 1YVDA 3GJ8A 4NL4H 3PJRA 2A78A 4HAYA 4HATA 4F91B 2CJWB 4V03A 3MLEA 4ZV4A 4DB2A 2WJYA 1XMSA 2F1HA 2J7PA 3PUWA 2VSOA 2WVJA 4BLPA 1LS6A 4QGHA 3L2OB 3H1TA 3SJAA 3FDIA 3AKEA 2ZR9A 1KO8A 3CB4A 4U00A 4EPWA 4DUGA 3TSWA 1NG1A 5DN6A 4BFVA 5TARA 3K0EA 2EFHB 4YMSA 4CEJA 3AF4A 3NWJA 2DFKB 1R7RA 3NG1A 4PHGA 3VHXA 3EZ7A 4IVRA 4JS0A 4NCHA 3IPYA 3REFA 1CJMA 1PJRA 4PPFA 3A8TA 2G6BA 2GJSA 1VYVA 4IOJA 1G3RA 3NBXX 1RYHA 3P27A 4M1OA 1XEWX 4DDTA 1T3LA 2RGXA 2N1BA 4BRUA 3NHBA 1L4UA 4EDHA 4W5JA 2GRJA 5SZKB 3SC3A 1TF7A 1L7VC 2IYQA 3CIOA 1JR6A 3LW8A 3BOSA 4DCTA 1ZINA 3MJRA 1NY6A 4TTPA 4TL7A 3L0OA 3GLGA 1E96A 2H1LA 4W5HA 4QGFA 5HCNA 2PZFA 3F8TA 4GOJA 1KGDA 3LBNA 4AKIA 3ZZ0A 4TQUS 2DBYA 4Q9IA 5JWHA 4C4PA 4HSEA 3AVPA 1H8EA 4B32A 1NN0A 3BE4A 2OBMA 2Q3MA 3TNFA 5FOUA 3RABA 4D4LA 5K8TA 4EPYA 2EU8A 2W6IA 1G20E 3WNDA 1QVRA 3SHFA 5KDOA 2KI5A 5FUYA 4DLXA 5IHPA 3LVQE 2JJ2A 5E95A 1V5WA 1EGAA 3IEVA 4AYTA 4HLCA 4A0HA 1CF4A 5AR1A 4BZQA 1LNZA 2ZE8A 1K5GA 4HB0A 1E32A 2BWJA 4Q7LA 2IXEA 3BORA 4HB2A 3KJHA 1E98A 3A58B 3WHKA 3SI7A 4POAA 4GP7A 4IDOA 4P31A 2C04A 4MGKR 5FOTA 4ARZA 1WF3A 2W58A 2AWNA 4ZDIA 1DELA 3BAFA 3FYHA 2V55B 3LVRE 3MD0A 1OXSC 3WP0A 1XWIA 2EFGA 4Q1BA 3DZDA 3TK1A 1KDTA 5AUNB 2XJ4A 5JS7A 1Q12A 2ZQ5A 2VP4A 3GLHA 1P2UA 4F93B 3B82A 3KJGA 4WW0A 5FOXA 2RGNC 2QGNA 1G64A 1S9HA 1OXUA 2HLDA 2VP9A 2ZSEA 4Q4JA 3VR5A 3EASA 4IDNA 2C8VA 5CB6A 1U8ZA 3OEED 4O2RA 3DM9B 1G7CA 3VR6A 1ETUA 1SXJA 5HZHA 2GNOA 1RW4A 5HKKA 1Z07A 1KDRA 1JAIA 2B92A 2XNSA 3HJNA 4YMVA 1W36B 2IK8A 2ZE7A 4C0AC 5KO2A 3IKJA 1WMSA 3IO5A 3B9PA 4A92A 4LX0A 2C78A 2J46A 2R65A 1TL7C 3OFND 2IL1A 1E4VA 1UM8A 1S0UA 4XVRA 3AUXA 2PEYA 1EESA 3IIKA 2P6UA 3UMSA 4QHTA 3UWOA 3ZVLA 1VG1A 3K9HA 3GLHE 3PUVA 1IJFA 3U2QA 1U0HC 1O87A 1OIVA 2GF9A 1DEKA 1E1QD 1Z2AA 5DYGA 2OAQ1 2XSZD 4RFSA 4BRWA 3C4JA 4DSTA 1MO5A 3SJCA 1GL9B 1KNXA 4R9UC 1JXMA 4Z8XA 3RDPA 1SVMA 4PC6A 3KQKA 1OF1A 4DLWA 3EPHA 2ZETA 1XPRA 3GJ0A 3OIWA 4KYUA 4EAQA 2IXFA 2XJ9A 2Z4SA 3KXLA 4MA4A 4P4SA 3ICEA 3I1FA 4G5OA 3DKPA 4HAZA 3K0FB 5G3ZA 1OXXK 1LV7A 1HTWA 4EQ6A 4WAUA 2HXYA 4JLJA 2HUPA 1KI9A 5J4LA 821PA 1T5LA 1SHZA 3CF0A 1U9IA 4YQFA 3BBPA 1B0UA 4ESHA 1ZNYA 4QBGB 4MKIA 3NIBA 4XJXA 4PXAA 4FI3C 2ZVQX 4DCSA 4DB4A 1G9XA 1T5IA 521PA 2WKPA 3GCGA 1CS4C 3F5FA 4MKHA 2A5JA 4DJTA 4XOIA 1BS1A 3D31A 1CR0A 2Q0HA 3RS3A 4TQ9A 4B2LA 3DPUA 1UJ2A 5KNCA 1FTSA 2EFDB 4RZ3A 2R8RA 3DKVA 1N6OA 1T9HA 2ORWA 3CUEF 3OF5A 1G8GA 5AK0A 4L9SA 4D0NA 4KFUA 4RKFA 4BASA 2QROA 3E1SA 1ZMXA 3K09C 3R9XA 1YRAA 4OHYA 1G3UA 2QMUA 4YC7A 2Q3HA 2W2VA 4Q1CA 3ZH9B 1Z6GA 4B73A 4WZBE 2CL0X 2REOA 2OUKA 4C0SA 2XTMA 2FNAA 1AQUA 3FTQA 2NPIA 4EPRA 1DAMA 4OK3A 1P72A 2GZAA 2FGJA 4JJZA 5JEEA 2BHRA 4R7ZA 2QMEA 3AKCA 2DR3A 3BIFA 2JLVA 1XCPA 2Z43A 1Q3TA 2GCPA 1BMFD 2OHFA 3QPWA 4C2TA 1IN7A 4OI2A 4NTZA 2BCJQ 2GEVA 3I3SR 2IUSA 2D7DA 3TIFA 4UJ5A 4DXAA 1U94A 1G8FA 4UNQA 3OZXA 1FUKA 2A5DA 2OXCA 1AIPA 5FL7A 4A2QA 4IEEA 4KODA 1TNDA 4E07A 4NE2A 3IQXA 1G4AE 2AK2A 5CJPA 3TUIC 5AWFC 1NMYA 2XNDA 2F1RA 1KI6B 1W46A 4G5QA 1XTIA 5FBWB 5JJKA 1ZBDA 2R6DA 3QI2A 5A5GA 2HF9A 4NYIQ 2ZRNA 3NKVA 1E69A 1AS0A 1G4UR 2VA8A 1KI3A 4B33A 4BLTA 4TWZA 3THXA 2ZYUX 2PLFA 3DDCA 2J5XA 1LTQA 1ZD8A 2A3RA 2PT7A 4OBEA 5SZHB 3FGNA 4QBHA 5IDVA 3C16C 4NYJQ 5KOYA 2VHUA 2QE7A 4PSAA 1NN3A 4A1FA 1GITA 1MOZA 2JLQA 5FOWA 2XOKA 3K9NA 3W3ZB 3RS5A 3CRW1 1QF9A 3THWB 3SQXA 1XB2A 4M1WA 1T6NA 3ZVNA 4WOPA 3QJYA 1XMJA 4PC1A 1P2VA 1JI0A 4PC7A 3BWDD 2F1JA 4JMPA 2GWHA 2A5YB 3FE2A 1GRNA 3KKMA 4D80A 2W2XA 1DG3A 2BKEA 4A8JC 2EYUA 5KTYA 2OSBA 3WMGA 1FX0A 5P21A 1CP2A 3L8ZA 4P3YA 4NYMQ 1E0SA 1O3YA 2ZR0A 1NBME 2PMDA 1ZRHA 3I32A 1E4YA 2DCUA 1TU4A 2QRZA 4JSYA 1HUQA 3W6NA 1XEXA 4GBMA 2ZRFA 1KTVA 1U2RA 2GF0A 3GFOA 1GRRA 4RD6A 3IHLA 1US8A 4Q03A 4Q1DA 2DPXA 2W0MA 2IYLD 3OIYA 4V0LA 2ZRJA 2PJZA 5FOVA 4TLEA 1TF5A 5CLQA 2FDCA 4FXPA 4ZDJA 4LJ6A 2WZQA 4TYQA 1NJFA 3CM0A 3KUDA 4ZDKA 1T0JB 4HUQB 4EJSB 1JJ7A 1X3SA 1NJGA 1SVWA 4ZDWA 4D2IA 3W90A 1PLJA 2HYDA 1SGWA 3FKSA 1KK1A 3MFYA 3U3RA 5AJYA 5FUXA 8OHMA 3H2YA 1VCIA 1XX6A 2AXPA 4KAXA 4KBGA 4AC9A 1FP6A 4AI6A 3D8BA 2ORVA 4C0QC 5HE8A 5ELXA 1TQ6A 3BK7A 1Q1BA 5SZIA 1NSFA 1ZIOA 4Q7KA 2V54A 1S1CA 4FMBB 5EXPA 2FZLA 2GEUA 2OAP1 3Q9LA 1MRSA 2IYSA 4QGGA 4B76A 4A0GA 2BVNA 1RIFA 3IEUA 4DLUA 4QKQA 2DYKA 4X8OA 3JVVA 2F55A 4G1UC 4N3NA 5G41A 1SXJD 1W0JA 4FMDF 3TVDA 4CZ2A 1ONBA 2IYUA 2ECKA 2G1KA 3MCAA 2FEMA 2Q21A 3C5CA 4DT1B 4JBWA 1OH5A 3L82B 4NYIR 4AD8A 2QG6A 4MGYR 4I1UA 1AS2A 2PEZA 4IKEA 4TMZA 5CK4A 5FPTA 3RSLA 3U44B 2FU5C 1DAEA 3BC1A 4BFTA 3SYKA 2ZYVX 4Z8YA 2XGJA 3AVOA 2HT1A 2O8DB 1F2TB 2GDJA 2YWEA 3VR3A 2OILA 4DCVA 3EA0A 1XJCA 3IDQA 5BYKA 5AJZA 1AA9A 2WV9A 4NZYA 4JLPA 3LNCA 2PL3A 3UPUA 1IJEA 1DBSA 4JYCA 4KCGA 1F2UB 2IEZA 3HPQA 4PHHA 3WBJA 2QT1A 2WJIA 3BH7A 1TADA 2QUZA 1MABB 3FHOA 3RWMB 2G83A 2EWWA 2WAYA 1RRGA 2ZJYA 2OO7A 5IK2A 3THOA 4LBWA 3D7MA 1UPTA 1N5IA 4N1AA 1T4GA 4OQLA 2GCOB 4HEJA 5CIQA 4P4TA 3LQRA 2G77B 2Q9BA 4FW9A 2ZYWX 5LB2A 2DFTA 2WSMA 2WWFA 3B1ZA 5TMPA 2LKCA 4ZO4A 4DLRA 4U7DA 1I2MA 3GLFA 3GJ5A 2MSCB 3FPAA 3L0IB 4RZXA 5C1BA 3GLIB 1JR3E 2YOFA 4EPXA 4HZIA 1YQTA 1W0KD 2Z4RA 3AH8A 2UZ3A 4HAXA 4NYMR 3QKTA 1Q1QA 2XB2A 3BGWA 3CX7A 4ZKDA 2H18A 4RZ2A 3PENA 4US0R 1P61B 2LKDA 2X8AA 2FWRA 3MUFA 1FUUA 5KPDA 3X1ZA 4KSBA 3A37A 3AF1A 2BM0A 4FMCF 2B6HA 1IXZA 3WYFA 4JLKA 4JYBA 3EPLA 1HV8A 2WOOA 1R0XA 1U98A 4A9AA 4LJ9A 1K6MA 2NPFA 3HR7A 1OFUX 3VX3A 5DHFA 5M04A 3EPKA 4H1UA 2R6CA 3CKLA 1CXZA 3QPUA 3SEAA 1HQCA 1ZC4A 3T1VA 4A0RA 1M8PA 2X1VA 2VP0A 4CGZA 1SXJC 1Z22A 1R5OA 3FMFA 3U3MA 4QBFA 5AJVB 3GLIE 2ZRMA 4JBXA 2V3CC 2BC9A 3GLFE 3NHAA 4PC3A 4IDPA 4YONB 5L3VA 3DMNA 1P73A 4W9MC 1VYTA 1CJUC 3RAPR 2JLYA 4Z54A 4IVQA 4C3ZA 4ASUA 2QENA 2R6GA 2ZRHA 3RC8A 3ZVMA 4JT2A 3AQ4A 2BKUA 1P75A 1TQ2A 1OSNA 4LBVA 4PO9A 4JSTA 4MDFA 4JLAA 2ONJA 1Z8FA 1R5BA 2WSSD 2CCKA 3GJ6A 2J1LA 2IF2A 4IFBA 4KU4A 1XTSA 1G3IA 4M53A 2O8FA 5L3QA 3G5UA 2GBLA 4MDEA 3AGQA 1WDTA 3KFVA 4ZCMA 4PPGA 4I1OA 4URZR 3TR5A 2ZXUA 2RMKA 4Q48A 5HE9A 2NO9A 5CM8B 2QQ0A 4A4DA 3A1TA 3OAAA 1OHHD 3U6KA 2FSHA 4V0OA 1DAKA 1H65A 1TTTA 4CEHB 3U6BA 1M7BA 3QXSA 3W34A 1EK0A 1U8YA 5JSZB 4MH0R 3SYLA 3TAHA 4GPTA 1ZCBA 3PIRA 3C14C 1ZUHA 2RHMA 4C0HA 2CL7X 3VR4A 3QVUA 1XCGB 4E03A 3VFDA 3MSXA 1YR7A 1KSGA 5GVRA 3VAAA 3QKSA 5EZ5A 2X2FA 2XAUA 4Q18A 3AP3A 3BXZA 3QG5A 3TSZA 1NVWQ 2JLSA 2DY1A 3DEFA 1ZW6A 1Z0DA 2QGZA 3HU2A 3PCRB 3MMPA 3CNLA 1DAIA 3QXHA 4MRPA 2WWIA 4TL9A 221PA 1XP8A 2IW3A 4BFUA 3DM5A 4GI7A 2V8OA 1E9AA 1E2DA 4OQFA 3QKRB 1ESNA 1I2DA 2CNWA 4URWR 5JECA 5DGXA 1DS6A 3KKOA 3SJBA 3O8CA 2C96A 2NTYC 4TL8A 1LB1B 4WXPA 3WMFA 5AUOB 5EE9A 3U7FB 3PUZA 4M9SA 4XIGS 3SNHA 4AYXA 2J0UB 2N42A 2YC2C 5ANRB 4L16A 4L4UA 1RKBA 1SQ5A 4UJ3A 4BQSA 2HF8A 1IY2A 3VR1A 1OYWA 1ZU5A 1GL6A 1ZM2A 4GOXA 3VMFA 3UANA 2GJKA 4BFSA 2VHJA 2XTNA 1OYYA 1FW6A 2I4IA 3ZS9A 1AQYA 2G1JA 2W00A 3WP1B 3CPJB 1GRQA 3ZJYA 2GCNA 1ZCAA 1E1RA 3QUSA 4RFVA 2F9LA 4JL5A 3VX4A 4PAQA 5FPSA 3Q85A 2OEPA 1FMLA 1VPLA 3LRPA 1YZQA 3N2EA 4PQFA 4V0MA 1AS3A 1MO3A 4E09A 1OB2A 3GMTA 2ZRGA 3WNCA 3KTAB 4GZLA 4ZIRA 2CK3D 3NEYA 1WBDA 1KKLA 2H92A 5FTNA 4F92B 5G40A 5TY0A 2IS4A 4DDUA 4QFMA 2NO1A 1R0YA 1KJYA 1KSJA 3K0CA 5CK5A 1XNJA 1KSFX 1OT3A 1J90A 1NVVQ 3HP1A 3P32A 4H9GA 3PVSA 1BOFA 3Q72A 4MUBA 3K0SA 4C9BA 3OIVA 3QKUA 3RVBA 2F43A 3G82C 3ZIAA 4XSGA 1I4LD 1QDEA 2YC4C 3JVUA 2A30A 2F43B 3LQQA 4R2HA 3TUJC 1GKYA 1GSIA 1WA5A 2GK6A 3LDAA 5JRJA 1CULC 3CZPA 1VIYA 1H8HA 2CHVA 1J7KA 2P67A 4HYYA 1Q3HA 4V0ME 2FE4A 1MKYA 1XU4A 4BLOA 2CJWA 2JGNA 3UG7A 1HQYE 2QMOA 1HH4A 1R8SA 1RJ9B 1P9NA 3RSOA 2OM2A 1CJTC 4TLAA 1GDDA 5EP4A 2ZPTX 2J0VA 2ZTSA 2BIFA 3Q3JB 4K8OA 3UWKA 4XWKA 1P2TA 1W4AA 1G5PA 5KDLA 3WRXC 4B3CA 4Q7JB 3NEJA 1TEXA 1ZUNB 2R2AA 3CPEA 4TMXA 3TMKA 4PZLA 3MJHA 1P9WA 5IT5A 4LK2A 3QEJA 4NONA 1VMAA 4BLSA 3WXMA 5B64A 1S9DA 2FA9A 3C41J 1E2LA 4DEYA 1NLYA 1KI2A 5JHHB 4TQAA 5A0FA 1KSHA 1W49A 4C0BA 1KY3A 1Y63A 1FL9A 1KMQA 2AKAB 1GNPA 1E2HA 1HEIA 2RGEA 3ND9A 4KV9A 4QXAA 4CDGA 4QM6A 1LW7A 2A5FA 2Q9AA 2ZRCA 4C0LA 2RGAA 4JVSB 5FI1B 2ZE6A 4ZPXA 4NCKA 1DVRA 1NN1A 1KO5A 2XXAB 4Z1MD 1SULA 1R6BX 1T8TA 3KL4A 1SVSA 4TZ6A 2WWWA 2OV2A 3W5IA 2ORIA 1KNQA 2ZAMA 3E2IA 3L0SA 4P0TA 3FFAA 1KIMA 4H1VA 5HPYB 4Q1FA 1W1WA 5B2ZA 4PHFA 3LXXA 4BUJA 4KLNA 1DARA 1OFIA 1KDPA 3K1JA 4PC2A 4HAUA 4UQOA 3I72A 3UIEA 3WYGA 2F9MA 5DH9A 1FMJA 3EW9A 3CRRA 3E5HA 4Q5IA 1E2FA 3HPRA 5GJBA 1ZNZA 4DLYA 1X8KA 2ZJAA 5LD2C 1NNEA 1SKYB 2WMNB 4PAMA 1KKMA 2BEKA 4MQBA 1C4OA 3CPHA 4NCJA 1P3JA 1KK0A 2CLSA 2YOHA 4QHYA 5EE3A 4BFZA 1E9FA 3SU8A 3AF3A 2GAAA 2ZJZA 4BWYA 4XH9B 5FUWA 5BXQC 2EYQA 2CLDX 2IX3A 1SZPA 5B30A 1QZXA 1ZM9A 5FTMA 4G5SA 1CBUA 3LH5A 3MWLA 1LF0A 3SN6A 4EPTA 2V1XA 2JLWA 1OKKA 3X1YA 5HR5A 3QVVA 4DSNA 1KK2A 4IOKA 1P6XA 2NO6A 5C18A 2H16A 1Q1ZA 1QHHA 4KLZA 4QG7A 4NCNA 1QHHB 4YXWD 1W4CA 5F2EA 5J5CA 1R5NA 1KOFA 1X1RA 3HU3A 1VG8A 4TYWA 4HB3A 3V4RA 4YMUA 3ND8A 2BJWA 1WBBA 1GTVA 4OI1A 2O8EB 5E4FA 5BW8A 5TV2A 1R2QA 2Q9CA 5B57C 2HYIC 4PQYA 1OJLA 2WHXA 3OE7D 4PZYA 3CRQA 2OFWA 2E87A 3ZZTA 3C15C 5EUQB 5J40A 4IOMA 3B1WA 1J70A 3AUYA 5FFMA 1RPZA 1P2SA 2XZOA 3HR8A 5FH9A 4XWAA 3V4FA 1I4TD 1JPNA 1K5DA 3ADKA 5KSOA 5JJIA 1KY2A 1ZC3A 3LLUA 3KB2A 3DOEA 3NC1C 3P4XA 2YHSA 2OZEA 4CIDA 4PPNA 4NH0A 4TN1A 3THYB 2LWIA 2ZITA 3VNVA 2GZDA 5IF9A 1DOAA 2VF7A 1XZPA 3M6AA 1E0AA 4QJ4A 2B7BA 1ANKA 4HLUA 3R8CA 1OXVA 3OEHD 4RJLA 1TF2A 2FSIA 4QL3A 4GMDA 4BPBA 3KJEA 1ELOA 3TVTA 3MAAC 4D0LB 2WPDD 1OW3B 2QPTA 3RC3A 1P5ZB 2GXSA 1EX6A 1E2NA 1W4RA 1K8RA 4A15A 3FVQA 4PX9A 1JB1A 2DWQA 2AD5A 1NLFA 5EP1A 121PA 1E9DA 5DO9A 4D0GA 3QNUA 5JCPA 2W6JA 3K0FA 2QM7A 1BYUA 1YRBA 1U81A 1E2MA 2ODNA 2JA1A 2PLRA 4GOKA 1XD2B 2CVFA 2QAGB 3CBQA 2J0SA 2NGRA 5G53C 1E9CA 3P1JA 3LV8A 3R7WB 1SKQA 5JS8A 1Z0KA 5FBQB 1Z47A 2C2HA 2VPPA 2CEAA 1RVDA 1TEVA 3D3QA 4QNRA 5DE3A 2NZ8A 1AGRA 3ONWA 2P5SA 4IW3B 3V9PA 3WHLA 4AY2A 3I5YA 1Z29A 2NG1A 2WWHA 3I62A 1IBRA 4Z51A 2QT0A 2CHGA 1JNYA 5GJWC 5E7MA 3PUYA 5EZ6B 4QJ5A 4KBFA 5K8UA 3L8YA 4WXRA 4TYPA 2V9PA 3DO6A 1DPFA 3TKLA 1N6RA 4NKRA 4PAOA 5FL3A 1I4DD 3CNNA 2JJ1A 2OCYC 3AKYA 4OHZA 1Z0AA 4TT3D 2JIZA 3I5XA 3T1OA 5DI3B 4O3MA 1AGPA 1PZNA 4M9ZA 5TDHA 4QGAA 1NY5A 4OQMA 1Q0UA 1MRNA 4UXHA 4QC2A 3ZD6A 4Q19A 3NDBB 3ZS8A 2XX3A 4JLVA 4OHXA 1XD9A 2P6RA 5C4MA 1OLOA 1XTKA 1EWRA 2ZE5A 3X1WA 3AVUA 3CWZA 2HV8A 2V7QA 1PLKA 4UXJA 4G5GA 5FOSA 1VIAA 3CONA 4YLGA 5L3RA 3AVVA 4KHZA 1ZNWA 4RKEA 4B2PA 3BS4A 4NHOA 5FUVA 5DLQC 1WE2A 1ZU4A 4B6FA 1GIAA 4AKHA 4C0JA 1Z6YA 5JCZA 2NQ2C 1TAGA 3LA6A 2J7PD 4GRAA 4D4MA 3UK6A 1UBGA 1IY1A 1CLUA 2AK3A 4DKXA 3IO3A 4GMXA 4M4SA 3I61A 3GEHA 4GT1A 1YZTA 5CLLA 5F9HA 721PA 2P0EA 3VU9B 1MH1A 2OCPA 2ZI5A 4DUGD 5AUPB 4QM7A 4PHTA 2PCJA 1IN5A 2BOVA 4FN5A 1KI6A 5DN6D 3T34A 3CH4B 5JJLA 4LC1A 2D74A 4GNKA 4LJ7A 5KUTA 1Q57A 421PA 1EX7A 2NOAA 1KO4A 3TUZC 4WZAE 4TMVA 2PZGA 1OIWA 2GTPA 1NBMA 2IT1A 1GNQA 4WA7A 2IS2A 5JI2E 3B5JA 3B1XA 1G1MA 3AKDA 4LYFA 5UKDA 2ZRDA 4YDSA 2O8BB 1DAFA 2G9NA 4LRWA 1Z28A 2ATVA 3IHWA 2D4HA 1IXRC 2QBYA 4UNNA 5FBRB 3NVAA 1PV4A 4RY2A 3THWA 2QBYB 2AR7A 1RZ3A 3UMRA 2B21A 5K8LA 1FNMA 3ECCA 2QY9A 2QAJA 4M1KA 1UADA 2C5LA 4MYHA 5TB5A 1KJZA 4FIDA 1EFCA 3CW2A 2IYYA 1TUIA 3RRZA 1OIXA 1BYIA 2JDIA 3H0KA 3B8HA 1G7TA 1LS1A 4TSFA 1H8ED 2XTZA 3GJ7A 3B1VA 3NC0C 4IDHA 4ZCIA 5HCIA 4BEJA 4LSGA 2AKYA 2G88A 2RGBA 3IIJA 3QXCA 2A9KA 2W6ID 5JLJA 4BLRA 2WICA 5E3HA 2WIAA 3I4LA 3GFTA 1A2BA 2X77A 2JJ2D 5FPKA 1N2CE 4M8NE 2FGKA 2J45A 2V1UA 3PUXA 4M1SA 2QMHA 2DWPA 4XTRA 2R6FA 4MITA 1EFRA 4HUQA 4EJSA 4DCUA 4DLVA 3QQ5A 4R71A 4C2UA 3CRMA 1S96A 1EG7A 4WIAA 3DOFA 1XXHB 2KB0A 3QEOA 3QF4B 1G5RA 1KI7A 1T3SA 3KFXA 2MSEB 3BFVA 3LBHA 1J2JA 3EIEA 3ASZA 5CM9C 2IYTA 1UF9A 1YJ5A 2AD1A 4IXNA 4LHYA 3TBKA 2VBCA 3HDTA 4NU0A 1ZIPA 1PVOA 3FMPB 4OI4A 4MGZR 1U99A 5TXGA 1XJ0A 2FFHA 2REBA 4B48A 4MYUA 3B85A 3M4YA 1FPMA 1Z06A 4B3BA 4GP6A 2HLDD 2YKGA 3SDZA 4RD2A 4GL2A 2ODBA 2ZUBA 5L3SA 1II8B 3ETLA 1E9RA 4FCWA 1DADA 4DT1A 2BDTA 5HKKD 5H70A 5L3SB 1RFLA 1W36D 5KU1A 2F3TA 4URYR 4YMWA 3U44A 2IUTA 1JR3A 2VSXA 2YV5A 2CCGA 3A1UA 1N6KA 2O8DA 4W5WA 1F2TA 1J8MF 1GZSA 1GKUB 1KI1A 3GEEA 2GESA 4DIEA 1IN6A 4DRZA 1L2TA 3T35A 4AG5A 1CJKC 5EXXA 3HYTA 1M7HA 4L15A 5H8WA 1KI4A 1J99A 4NYJR 4JLDA 2ZU6A 4XD7A 1ZP6A 2WWGA 1F2UA 5LD2B 3SE0A 3TLXA 4FINA 4LV8B 2ZAOA 1UFQA 1M2OB 2QTHA 1JPJA 1MABA 5GJCA 5B58C 3MWJA 5DI9A 1JXOA 2RH5A 2BBTA 1XBTA 2UZIR 1XTJA 2IYRA 1E79A 5KYKA 4FWIB 2GCOA 4N0EA 3U4QB 4D81A 2O8CB 2A2ZA 3KKNA 1FOEB 1RYFA 5FTLA 2ANBA 2FX3A 3U61B 2ODWA 5FTJA 3BB1A 2O0KA 3GLIA 5LPNA 4LUCA 2J9RA 3A4MA 1BKDR 2UKDA 1ODFA 2ZSBA 2FPLA 2VL7A 4PZZA 2GVZC 3LFUA 4LJYA 5CB8A 4OI0A 4RVCA 4JLNA 5EE0A 3CF6R 1E6CA 2V6JA 4M0LA 4Q1EA 1VG9B 1MO6A 3R9IA 1M7GA 2WJHA 3R8FA 2QPOA 3IPXA 2ZS8A 1MO4A 1F6BA 2AN9A 4CVNA 4JVMA 5HTKA 2RGNA 3MG9A 1D2EA 1UKYA 2XZPA 1NLZA 3RYTC 4DBLC 1CR1A 2ZS7A 2IS1A 3PXGA 3BJIC 1JECA 2R44A 3C8UA 1NIJA 2QP9X 4M9QA 2ZRPA 3FMIA 1X86B 2XB4A 4ACBA 1AZTA 2X2EA 5DHAA 2JLUA 2IS6A 2ONKA 1VCNA 1W36C 2GA8A 1CEEA 2KE5A 1AKYA 1WRBA 1VYUA 4B3GA 3HYRA 5FTKA 2ERYA 2YWGA 4A2WA 4PFSA 4CF7A 1CU1A 2OG2A 3ADCA 1ZJ6A 2IYXA 3P4YA 4HAVA 4XTCS 4CT4B 3B60A 2ZJBA 3WMEA 2QP4A 3PEYA 5JZVA 3RANA 2WOJA 2FFQA 2QTVB 4S35A 3Q8XB 5JBQA 1T91A 2VO1A 1E2IA 1UBCA 3VHLB 4ZCLA 1YR8A 2ZYTX 2ZJ8A 5FL7D 2PH1A 4HDCA 4NBSA 4TMWA 3SJZA 2JJ8A 3OESA 1JQJC 1VECA 2ZEJA 4ABYA 2XNDD 4Q00A 4CEHA 1E3MA 2IC5A 2H57A 5JSZA 3LY5A 1W5TA 3A1VA 3ZQJA 1HE1C 3KQLA 1QG4A 2QN6A 4TL6A 2VP6A 1N25A 4HZUB 4IXMA 4KFTA 3AP2A 3TRFA 2DHRA 3QIAA 1IXSB 4EKDA 2E1RA 4CEIB 1U9IC 2MMCA 3FHCB 4R2IA 4LPSA 2QE7D 1NL3A 2HXSA 3I73A 3QBTA 3EWAA 2LCFA 1W2GA 2YWFA 3GPLA 2XOKD 2IF0A 2Z5FA 2YWHA 1EFTA 4DLZA 1G291 2IWRA 3SYNA 5EXTA 4LYHA 5EJEA 4WVFA 4GFDA 4TTQA 3BFXA 2D06A 3QKRA 1CIPA 2QM8A 3VQTA 2O0HA 3OEEA 1D5CA 4I1SA 5H1YA 3PG5A 2G0TA 1G7SA 1N3BA 2W0SA 3X1DA 1IQPA 1KMHB 4KITB 4P32A 4PTLA 1GG2A 2QORA 4B6EA 2ZM5A 1CRPA 3K0AB 2J0UA 2RCNA 4I99A 5AJWA 2KBEA 4AK9A 4OK5A 3AVTA 1YZKA 4J0QA 2MSDB 4EIWA 3BH6A 4MRRA 4UKDA 1X8JA 3ZGXA 4B44A 5BYJA 1Z3IX 5LBIA 3OFNA 4ZKEA 4E22A 1A82A 3BB3A 4C7OB 2DFNA 4M21A 5KNBA 2C98A 3KXKA 5JRZA 4O2LA 5H68A 4X8MA 3VKHA 1E1QA 5DIFA 2WMOB 2XSZA 4AG6A 3LX5A 1RC8A 1EFRD 3X1XA 2JAQA 3KTAA 3AGPA 2W2TA 3CX6A 2C9CA 2Z0MA 2GZHA 4X8LA 4QJ3A 4LJ5A 4Q4AB 1TQDA 1UKVY 1G19A 2JATA 2H7VA 3DVLA 3CNOA 3FKSD 2YVUA 4Q9JA 4M22A 1A7JA 1JEEA 2BBOA 1Z08A 1QHYA 3ZVRA 4LJ8A 3ADBA 1E2GA 4Q4HB 4NP6A 3N5CA 3B6EA 5E7IA 2ANCA 2ZREA 3W5JA 1CR4A 1HT2E 1NKTA 1SVIA 1OFTA 2C77A 1W5SA 2EVWX 1OH7A 1XTRA 3IBGA 1E2KA 2P3SA 3CZQA 3IQWA 1GOTA 3K8YA 3S1AB 3QF7A 1NVUQ 1N5KA 3FWYA 1W0JD 4JKIA 1EFHA 1NKSA 5J47A 4JL6A 2GETA 2EFEB 3FMOB 1FZQA 2VF8A 1S2MA 1UEIA 3QXJA 3ZDQA 5JEDA 1W2HA 4DDWA 1KK3A 4Q47A 1MV5A 4CW7A 1KO1A 4QHSA 1RJ9A 4ILEA 2P5TB 4OJQA 4PO8A 2PT5A 2BMFA 1VHLA 3Q5DA 3TQFA 1KO7A 1YZNA 1ZM7A 2GVDC 2IXGA 1GM5A 1JBKA 1GUAA 2FF7A 4A8JB 4GSYA 4URXR 3SOPA 3RLFA 4JZKA 5EQTA 1AK2A 2OFXA 1GAJA 1M34E 1A1VA 1TU3A 4A36A 1TX4B 2BCGY 4TYYA 3KUCA 1OH8A 4V0NA 2WKRA 2ZI6A 3W6PA 1E2PA 3W8NA 2AWOA 4AURA 2FV8A 4DLSA 5IK2D 3CR8A 4X8HA 5FI0B 3T1TA 2BBWA 1Q20A 1BMFA 3A1SA 5D3MB 1BH2A 3E70C 4LHXA 1GKIA 3U7EB 2OFOA 2PX3A 3ZZUA 4KFRA 3K53A 1F48A 4US1R 4OQNA 3NBYC 4B34A 4EJSC 2A5GA 2F7SA 3KKQA 1U90A 2FMXA 3WRYC 1EFUA 1G17A 1ZUIA 2XXAA 3C5HA 2NZJA 1FNNA 3AVYA 2F1IA 4E5UA 1ZAKA 2C9YA 3CF2A 4IEIA 1CTQA 4ZI2A 1N6LA 3LAWA 2NMVA 1RRFA 1D2NA 4UXIA 2PX0A 3PR1A 4XVUA 2XZLA 3SFVA 3WY9A 4A6XA 3P26A 2PBRA 4F4CA 2C95A 3Q7PA 2ZUCA 3U5ZB 1XEWY 4K81B 3QENA 4RCYA 1S8FA 3ZD7A 4ZI3A 4TZ0A 3PEWA 1E9EA 1TMKA 3F3YA 3IUYA 3EARA 4DHEA 3N2IA 3RS0A 3M1IA 2ZI7A 3AB3A 1Z83A 4HI0E 3TR0A 3PQCA 1UKEA 3LX8A 5CITA 2RAPA 5G3YA 2VTKA 4HUTA 1T0HB 2HCJB 4NMMA 1N6HA 3LXRA 3OIUA 1NVVR 3NH6A 3SFZA 4FMDB 3A4LA 3B78A 5KNDA 1HE8B 4Q9LA 4ASUD 2E9SA 4G5RA 3GLGB 3IBYA 5GJVC 4LCBA 2IYWA 2I3BA 5C4GB 1P9RA 1LFDB 2HEIA 2QZ4A 3CX8A 1JJVA 5L8VA 2BMEA 2CL6X 1W44A 1OV4A 2IYVA 4XSHA 4GDFA 2WJVA 2WBLC 3GP8A 2BM1A 5BN5A 5CDFA 4OYHA 2ZR7A 4HAWA 2O8EA 5JWOA 1KZGB 1HT1E 1SKYE 1L8QA 4B47A 4LOAA 3OAAD 3BH0A 5KPJA 1OE0A 1N6PA 3EA5A 2VP2A 3KQUA 5JMTA 2NIPA 1RE0A 2C03A 4TLDA 2VH5R 1P4SA 2GHIA 3A4NA 4EPVA 3FB4A 3H86A 3Q7QA 4ARZB 1IHUA 3GLGE 3M0EA 4DDVA 5C46F 2JLZA 5E7JA 3EZ6A 4RSGA 4UNRA 3EAQA 5C2JB 2DFLA 2JCSA 2UVQA 4UNSA 1ZVQA 3KZ1E 4JIMA 4I81A 1VHTA 2H17A 2GEDA 3THYA 4L8GA 1QHNA 3EG5A 3UATA 2R6AA 3L0PA 3HU1A 3GLHB 3K70D 2OLJA 3ADDA 3CWQA 4HB4A 3LO5A 4FMCB 5DSZA 5CDFE 4TYNA 3W3AA 4LC0A 2O52A 2FG5A 4B3DA 1M1YE 3PFIA 3PITA 1G3QA 4Q4JB 3BFKA 2WJGA 2CNWD 1NIPA 2NO7A 1OXTA 1G18A 2BJVA 2BMJA 1SXJB 2FJUA 3K9GA 4MGIR 4OKSA 3U3OA 4DCNA 1J8YF 1X8LA 3RRNA 4CRWB 1GILA 2WIBA 3U60B 2TMKA 1FP7A 2F3RA 2ZSDA 4JLMA 2VQSA 3KB1A 3TW4A 4IHQA 1G6OA 4G0NA 3VKGA 5KSYA 1XD2A 1S3SA 1DE0A 3NH9A 2QAGA 5EE1A 4M1MA 2ZIAA 2KJQA 1YR9A 4IJMA 4M2LA 3R7WA 2QSZA 4ACAA 1ZD1A 3TH5A 5JFGA 1E1RD 1G16A 3B13B 4PR0A 1G41A 1YE8A 2XITA 3J81k 2FSFA 4KXFB 2ZI4A 4RFSB 3CH5A 5A4JA 2GBLC 2GXUA 2YYZA 1F60A 5KSPA 1G8YA 3KKPA 5FR1A 4D26A 3GJ3A 1DG1G 2P6NA 1W48A 5EUMA 3FHTA 1SXJE 1R10A 1TPZA 2FFBA 2GJ8A 2ZROA 5F9FA 1DO2A 3WYAA 1OPXA 4B75A 3U3KA 1M74A 1W4BA 2ZVPX 4P4SB 2XEXA 2C9OA 3I8SA 1W0KA 4OK6A 1P62B 1Z5ZA 4EQ6B 1COWA 4F38A 5DI3A 1VG0B 1E2EA 4Q1AA 4DIDA 1ZM4A 4MRVA 4DVGA 3B9QA 1FFHA 4D25A 3ZIAD 5FPYA 3KX2A 4Q66C 1KI8A 2D7CA 5DYIA 2DB3A 1YZGA 3T15A 1P60A 2IHYA 1G5TA 1II0A 3REGA 5LDDC 3TW8B 4A2PA 3LWNA 4AYWA 2QA5A 4QBIA 4IDQA 1H8HD 1XDBA 3K70C 3VTKA 4FCVA 2QPAA 1IY0A 1E9BA 2YJTD 3A36A 4LI0A 5D3QA 3G0HA 3QSYA 4ESVA 4QRHA 2EFCB 1G8HA 3VKWA 2P65A 1PUJA 3EZ2A 1C1YA 2Q6TA 4LYJA 2IA5A 2G3YA 2VIIA 3MWKA 2RB4A 4BFWA 1YZLA 3AV0B 3NBZC 3VU9A 4YMTA 1LY1A 3FFBA 2CVHA 3QE0A 4OHVA 3RNLA 3ICQB 2K5UA 4DLTA 4LJ4A 4PANA 4A6PA 2REXB 1X6VA 1XCMA 1Z0IA 2B7CA 5EP3A 3ZYCA 2X19A 2O5VA 2F6RA 1ZYUA 2R9VA 3B2EA 2OT3B 3KJIA 2CLCX 2D2FA 4B35A 1WP9A 5FPHA 3LW7A 2FH5B 4Q21A 4AKEA 4RCZA 2WSSA 1QHXA 3PEVA 3TAUA 1JQLB 1UDXA 2WAXA 2FFAA 4B3XA 1QBKC 1YZUA 5CYOA 4LPKA 5BN3A 2O8BA 1KZ7B 1FTNA 4HLQB 2RGCA 621PA 1G3MA 5BN4A 2PZEA 2J0QA 4LBYA 2AX4A 4F4IA 1CJVC 3DMDA 1S3GA 4JVNA 4U02A 5CJ2A 4LBZA 4G01B 1OHHA 4K46A 5CIWA 3T06B 4B71A 4PSKA 2GAOA 4V02A 1Z63A 2ASEA 3DHWC 1UBFA 2HJVA 4RD1A 3K0CC 4KJZA 4PQRA 2ZRAA 3SZRA 1W7AA 2OXRA 1NVXQ 3GEIA 3THXB 3JZMA 1Y3AA 2IUUA 4DSUA 3RS2A 1UEJA 1Z0FA 3T12A 4CT5A 2PMKA 1N0WA 3I92A 3SBDA 1DAGA 1N6IA 4D4JA 4MRSA 3FKQA 2H8KA 4IVPA 1HYQA 4TMTA 3T1QA 1TUEA 1GVNB 2JLXA 1ESMA 1BO6A 4R98A 1G8PA 4I4LA 4ERNA 2QL6A 2SHKA 3ZLJA 1NP6A 2VHQA 3QPVA 2ZJOA 5J4VA 3TJZA 4B43A 4KFSA 3ASYA 1KAOA 5F3WB 3UKDA 2VLIA 1ZM3A 4QNMA 5FBVB 2KWIA 4Q7MB 2OBLA 3QY0A 1XRJA 1OKKD 5SZJA 1X1SA 4V0KA 2QP3A 3AVQA 1YU9A 3EPJA 1XXHA 1UBEA 3SR0A 3QF4A 3UXMA 4TMKA 5J4HA 1WCV1 1FX0B 1WXQA 4TLCA 5AJXA 3SS8A 4DEXA 1HY3A 1G21E 2QTFA 5J4YA 3O8DA 2BEJA 4Y0AA 4KVAA 4KYIB 1XEXB 5KSZA 1NSTA 1XTQA 1HA3A 1US8B 3R9WA 2HJGA 1DAHA 1XD8A 4MKGA 1DO0A 1JEDA 3VR2A 4B2IA 1NI3A 2EW1A 4BLQA 3EX7C 4Q9KA 1SVKA 1VCMA 5DNYB 1VDZA 1VKJA 3KXIA 3LLMA 4O0MA 1II8A 2CK3A 4KI0A 4OQXA 2D2EA 2AL7A 4FWTA 1OFHA 1Q1EA 1C9KA 3GJ4A 1Q44A 3PV0A 1NRJB 6Q21A 4IRUB 4GZMA 2RKOA 2VHCA 4BGDA
chains in the Genus database with same CATH superfamily
3JZAA 3QTLA 4I6JA 4C0KA 4AZ3A 1GP2A 3CH6A 4F2PA 2XKKA 2P75A 2GJAA 4B31A 4TWIA 4OHRA 1DT5A 2J41A 2YOGA 3HUEA 3SIXA 4TUYA 5IVDA 3PICA 3ESYA 5DCWA 3T61A 2GVNA 1FMTA 2FOLA 1Y5RA 1EB8A 1EFVB 2YHIB 4Q9HA 3V7WA 2ZVDA 1NMZA 5I7VA 3IP9A 1FFXA 2FPMA 5J4KA 4WXHA 1GFSA 1IE3A 3W2FA 4JASB 4NESA 1I8TA 2RH9B 4QA9A 3V42A 3W05A 2K7FA 1QKIA 5BSVA 1SVOA 3AOGA 4EUNA 1E6UA 4LHVA 5ALOA 1ZSNA 3Q9SA 4BBAA 1RFGE 5BVHA 4RMJA 4J0FA 4TTJA 4IIVA 1N2XA 2QUIA 4B3IA 2P1ZA 3V8PA 4KSYA 3I0ZA 3R3XA 4X63A 1OX6A 2XNJA 2ZS9A 1PHRA 2L18A 1JJAA 1ZEJA 4O2AB 2HUNA 3INYA 4NJEB 5HA5A 2YV3A 3VI4B 1DKLA 1EBFA 4AJKA 3IBCA 5AESA 4XRRA 3DA8A 4BMPB 1XWWA 5TQ2B 4BDSA 4I1VA 3DEZA 2BL4A 2OOKA 3O2JA 4BNWA 1AN0A 1K2VN 3QLUA 4C14A 4DPLA 2QQFA 1KYQA 1DEOA 2GM3A 1JGTA 4QX6A 3UA4A 4ZEVA 2RGDA 1NG9A 3HLTA 1ID8A 4DC9A 5K6AA 1VPWA 4D3DA 4DLNA 2I87A 1UOEA 2V6IA 2WZBA 3UV3A 2UUBB 1N8KA 3VNUA 3RVJA 1KA9H 5M34A 1K8QA 1M10A 4PW0A 1N0VC 3VGJA 4DZZA 4DIKA 3LT0A 5KBYA 1T2DA 3AZOA 1FX1A 1Z2CA 1NVDA 4KAAA 5IRCD 1P9LA 2HQ1A 3GVCA 1RYMA 2REQB 5FAKA 1MF7A 1E6WA 4M7PA 3F0TA 3VPSA 2UZAA 1R4AA 2Y8EA 3P0EA 1AKNA 2VT7A 3KEQA 4MKFA 4OD0A 5E3IA 2Y2VA 3TQCA 4TKVA 5K2OA 4IF4A 2FVYA 2KSQA 1Y3IA 1C80A 2ZRKA 4LF6B 4RA9A 2OWEA 2GLXA 3DCIA 2JIZD 1V43A 1WCIB 1G7RA 1SOVA 1UCFA 2CJFA 2CFCA 4Q01A 1SCAA 2PJRA 1PUIA 4KWTA 1CUWA 4N3CA 4PBSA 3ADOA 1QGAA 2E5FA 4PZ0A 2OESA 1U3DA 1D9XA 2OP1A 3RWBA 1A4RA 1H1TA 4BZWA 3H1GA 4RZIA 5ECWA 1ZH6A 4NFYA 4N9WA 2D1FA 2BMDA 4N0MA 2CXSA 3MGCA 2JI8A 4CF4A 2QIPA 1L9XA 1ACJA 3DOCA 3ODGA 1WVIA 2Z2IA 4M49A 1H6CA 4NNOA 2BYTA 3VYTB 1BC5A 2QR2A 3I4FA 4PLTA 1JPVA 1JT2A 3C8HA 3K6RA 4MUAA 3NX4A 3EYAA 4G8DA 3UJDA 3WVNA 4TYMA 4HXGA 2GKSA 2ZSUA 5JNRA 1GNTA 2O2DA 3E61A 2FMTA 1B41A 1E0KA 2YXBA 4UEKA 1D9ZA 2I6FA 3WNBA 2J85A 3AM1A 3IJ5A 3JWGA 2WKQA 1AKEA 5CVVA 4NWIA 4RHCA 1YR6A 1RRCA 4JBYA 1V4VA 3PPIA 7GPBA 5I47A 1KYXA 5JI3E 4AAYA 4BZPA 5U4XA 3C6MA 1MV8A 4O8CA 5HEKA 4JCOA 4M1YA 2Q2OA 2QRVB 2VSFA 4R68A 1KFJB 2IIVA 1N0UA 3C3AA 2BF4A 2FHSA 4PS1A 3VYVA 3AQIA 3HFJA 1NMXA 4YV7A 2V6MA 4HDAA 5K3BA 4ALNA 3SQWA 1RC1A 3OCZA 5CA1B 5I3CA 4JKYA 3CBGA 5GQSA 1CR2A 1EK5A 4EI7A 1WB9A 4G37A 3SWWA 3MJVA 3TLMA 2PO7A 3M33A 4H59A 2ODEA 4ZAGA 2ZRLA 2HDNB 3N75A 3FOCA 3Q7IA 3H13A 2Z6QA 3OU7A 4GZ6A 3ITEA 2NSYA 4KR2A 1GRVA 5ECGC 4DMMA 1ZGGA 3HMQA 4GEGA 4F85A 2QLNA 2G07A 1MX3A 1TA0A 3ZE1B 2HU5A 4KNVA 1OH6A 1O58A 1JLSA 4H18A 3RUCA 1CCWA 3DOUA 5DWDA 5F1PA 4E4TA 1RQLA 2AFHE 4M1TA 3EGDA 5BSHA 5IZCA 3RS4A 2VQFB 5ALDA 4NHEA 4NJMA 3ZCXA 1BE8A 5LYJA 3LWDA 3B5IA 3LDUA 1YBHA 2UYYA 4S04A 3ZXUB 1ZNXA 4MA5A 1VKZA 1Z4PX 1Q95A 4C4AA 2ZKLA 4ZFNA 1FSSA 5HK8A 2IDZA 1AZLA 1KMHA 2BGIA 4Q02A 3DEJA 1L7PA 2JEZA 3O9ZA 3K0AA 1IONA 4QSMA 3RSCA 2I76A 1DKUA 1HC7A 2WT4A 2ON6A 2VYFA 4Z7NB 1GNRA 2Q2VA 4BLVA 4C43A 2NV0A 1D2CA 1KFKB 4XPIB 3ZLBA 1D2MA 1PV2A 3O4HA 5ARDA 2H11A 3U7HB 2XLBA 1Y48E 2G63A 2P6OA 3JWHA 1TZKA 4YJ3A 4B5KA 1BDJA 2IZOA 3Q1LA 3FPJA 1JZTA 4BU1A 2CCJA 4EF4A 3T3OA 4L9WA 4OJKA 4XB2A 3TE6A 2ZBQA 3EZ9A 1XPOA 4QASA 4ES6A 2YXPX 2ZJ7A 4YEDA 2P0YA 3B6IA 3BXPA 4LFBB 2ISSD 1M0TA 4M9CA 3WICA 4PIVA 5AYVA 4ISCA 2MU1A 2DUJA 2VHXA 3MT0A 3Q5EA 4C30A 2ZSFA 1N5LA 4AKGA 1RQ2A 3RYCB 2ZJ2A 4F3TA 2PL5A 5KDDA 1OWLA 3CVXA 4IDDA 4RKYA 5F2KA 1R8QA 4MYTA 5CFLA 3TSOA 5JDIC 2OENG 4IUCS 2Z1NA 3AHFA 3QG1A 3BD6A 4A0FA 1M1NB 3MNFA 2NXEA 4XIIA 2OGZA 1FQJA 5JAZA 4B80A 4X84A 2DQZA 1Y8QA 4EHFA 5I5EA 3JRNA 5M29A 3ND6A 1MT0A 5JVDF 1ONOA 2QU8A 1OB5A 4LV5B 3TLKA 2V4ZA 5CX1A 3W9SA 2AG1A 2VT3A 3P2KA 1XJQA 4OB8A 3NWPA 5KKAA 3KQNA 1BAPA 5DM2A 2J7KA 1MXHA 1FNDA 2WWVD 4NATA 2GK7A 2PA0A 4I14A 1YWGO 1UBRS 3I6BA 4Y0VA 1H2HA 1H69A 2H4ZA 1PZMA 4I46A 3IERA 5CBKA 1NVGA 4BP8A 1UWVA 4IV5A 2DT5A 1H2YA 3G89A 3UMFA 4Y1RB 1S4QA 4CEJB 1FFDA 1OR8A 2CV0A 1EWQA 3NU1A 1XDGA 4CM4B 4FFOA 1NNLA 1IJKA 4TLBA 3ELYA 4MB6A 1QB8A 4DMHA 1ZHOA 3K4QA 3EK2A 4OGLA 2XV1A 2IH4A 4MQEA 5JH7B 2RHHA 3DBLB 4AXXA 4BJ1A 3PI6A 1T24A 4EUFA 2DPGA 4ZZIA 3WLQA 5AK5A 2E21A 1YUNA 3RRJA 2RGUA 3KOUA 1FC0A 4RK5A 5AI8A 4MYCA 4RD3A 3FYUA 2BFMA 1M2JA 1VJRA 4DJEC 1RWKA 1NRWA 3DE5X 4BFXA 4PSVA 1OLUA 3W9YA 4LJAA 5IAEA 1CQPA 4HAIA 2J3EA 1E6MA 1JDSA 3C70A 1CZKA 1Q84A 1R4MB 3I45A 3UTDA 4RYDA 5EKXA 5CEEA 3D0OA 4L0DA 2Q5FA 1VBFA 3UOWA 4P7GA 5DBEX 3RJ5A 4NDNE 3QPBA 5KYYA 2YXDA 4WY2A 1X14A 4O59O 4H1HA 2ZIWB 1BA3A 4S2EA 4TV8F 3K94A 3ZGLA 4ZVSA 1SBYA 4EGSA 1GY8A 1E79D 3A1EA 4PPQA 1A98A 3L8FA 1AJEA 4LV6A 4XWOA 1T2EA 1ML3A 1DIBA 4HAYA 3KU1A 4IFIA 4F91B 2FKAA 1H2BA 2CJWB 4ZV4A 4DB2A 1IRIA 1GUFA 1XAIA 2F1HA 1JV2B 3GZ4A 3SSAA 3WNVA 1DINA 2VSOA 1G66A 1VI2A 1LS6A 2HIAA 1DQNA 2NU6A 3MGBA 3H1TA 3EFHA 4GBJA 3U7IA 3AKEA 2DSNA 4KXMA 4UHBA 1P7VA 4F3RA 2ZR9A 3BXFA 3CB4A 2OR3A 3AXSA 3IFSA 5CAEB 4MNTA 5FRDA 2B30A 1H2FA 3KDPA 3BRQA 4J0CA 1NG1A 4ZHSA 2BRUC 1QPGA 5A2QA 3IAFA 3LCCA 2EFHB 4TWBA 3DWIA 3IP8A 4OY3A 4UHKA 2CDCA 2XWPA 1KZYC 4FK8A 4IDCA 1FU7A 1KJ9A 3SLKA 4BKPA 1ZGBA 3QP9A 5D01A 3ZHZA 4IIYA 4RW0A 1HTTA 2DH6A 2RK4A 3IDAA 3N7TA 4JS0A 5ER6A 4CKCB 4NCHA 1PT9A 3IPYA 4Z3KA 5JCOC 2Z2XA 1HOTA 1CJMA 4KO4S 4YJHA 5GONB 3F3SA 3A8TA 3K6SA 2GJSA 1G2QA 3WL8A 2X3UA 4R6XA 3S4YA 2Q4EA 3V8EA 1KAEA 4M1OA 5LQCA 1I7QB 1XDSA 1FYEA 1XEWX 5T4HA 3W5BA 2B35A 1D1PA 1U1DA 3M8KA 2YWXA 1DXOA 4BRUA 3SSNA 1VL2A 2E48A 3NHBA 4OLFA 2FW1A 2JIQA 4CLHA 3GJTA 4I5EA 3QWFA 1I80A 1OQAA 2I4NA 5DULA 3RFFA 2XBUA 3N0TA 5B6IA 4X97A 4GKKB 2IQ5A 1LZLA 4TUYF 1F06A 4ZTUB 1JHRA 1RBYA 1TF7A 4OQYA 1RXCA 4OREX 2POCA 3CIOA 3F49S 5G4KA 1GCGA 3BOSA 4KQHA 5TJHA 2HX1A 1NY6A 1VB3A 1TMYA 5CW2A 1E96A 2H1LA 2QR3A 4W5HA 3U1TA 1ZZEA 2N9UA 2PZFA 2I6GA 2VRNA 3EF0A 3LBNA 1G8JA 3KCNA 2YWCA 3C87A 2ZWOA 3JASA 4OIFA 4B32A 3BE4A 1TCUA 1W76A 2W98A 4YX9A 1NXPA 5H81A 8LDHA 5H83A 3RABA 4G8CA 5K8VA 3FSJX 2GZMA 2F3UA 2DOKA 4FR2A 3SHFA 2IU0A 3JWEA 3DP9A 3EVZA 4QE3A 5L7TA 4DLXA 5FUYA 4MYSA 5IHPA 4RLSA 3LVQE 2JJ2A 5E95A 1HNXB 1S2DA 3N2GA 2CYBA 4K8RB 3SVZA 4EABA 5IF3A 1QRTA 3IEVA 4A0HA 1ES9A 1CF4A 2Y1CA 1J20A 5THQA 2VNHA 3P9ZA 5TPZA 1E32A 1LBQA 1TVCA 2H29A 2HMAA 2Y4OA 4FHDA 4Q7LA 1A5AB 2HN9A 4P3XA 1CVLA 3C7DB 4OM7A 3F4KA 2P3QA 3DE0X 4FR0A 5HFNA 4BQFA 1TIPA 2A14A 4JJGA 3VYWA 4HXYA 1GTRA 2C04A 2AEEA 4MGKR 1WF3A 5CXQA 4NOKA 1IBSA 1K7YA 2W58A 4TLLB 1DELA 2HU2A 2BISA 3FYHA 2V55B 3Q4GA 1OXSC 1QG0A 4J0KA 1XWIA 4QULA 4F97A 2EFGA 3ISJA 2PYZA 4Q1BA 5L51A 3ENKA 1N3IA 4TSKA 2R79A 3QFCA 3R6LA 2XJ4A 4DA0A 2ZQ5A 3CJRA 2AGVA 1D4ZA 2IV7A 1ULAA 1QO0D 1PI3A 3B12A 2LV8A 2OBFA 3G9ZA 3GGDA 3IVAA 5DGHA 4UNIA 5K3AA 3RIGA 4Z4HA 3PTAA 3KJGA 4QYIB 5LQUA 2WV7A 2RGNC 1BS9A 4EYQA 4L7VA 2QGNA 1M67A 1Q3KA 1S9HA 1O6BA 1OXUA 2HLDA 2Z6UA 3DH0A 4Z86A 3EUFA 1IK6A 4KE7A 5B4VA 2C8VA 1OUMA 4UMVA 3RHTA 3OEED 3WJ7A 5CB6A 4KLAA 4ALLA 3KZXA 2JH9A 2GPSA 4WCFB 1SXJA 4FD3A 4B1FA 1N77A 3F78A 1YL6A 4HQ0A 1NMEA 1RBMA 3TECE 3EHEA 1OC2A 2C7QA 1JG4A 4DR2B 1I4OA 3CHYA 3W5DA 1RLTA 3BZWA 3IKJA 4UUQA 1JQDA 2WT8A 3ITNA 1Z26A 2HL6A 4IJ5A 5SY9A 2TMYA 3GLTA 3HA7A 1QH9A 2I80A 1GGKA 3VTFA 4MW7A 2C78A 3UT6A 1TL7C 2E49A 2N47A 1UM8A 2A5LA 3BQNB 3BWBA 2P1DA 1M9NA 2X4DA 3WSVA 3UMSA 2P6UA 3HJUA 3NT5A 4YMIA 4EO9A 4MCIA 4ENPA 5LMNB 1U0HC 2GF9A 5BURA 3I5MA 1DEKA 1Z2AA 3PLNA 5ALNA 4FZJA 2OAQ1 2XSZD 3GT0A 1QKKA 3C4JA 1EDZA 2LCIA 2ZRQA 3RTAA 5EVCA 1MO5A 2KMLA 3PJGA 3SJCA 2ZKIA 1P31A 2QRPA 3L6EA 1F8UA 2ZXFA 4YIKA 4GW3A 4R9UC 4YAEA 2CL5A 3DE1X 2D7JA 4DN6A 1S7CA 4PC6A 3HCBA 4B4VA 2NADA 4QU8A 1CUJA 4DLWA 3MTQA 8AT1A 3N0XA 3GJ0A 1YJAA 3OIWA 2E6UX 4EAQA 1B3BA 4P4SA 2GYWA 2G1UA 4XA8A 1DX9A 2XZDA 4FC6A 4G5OA 4UM9D 3DE6X 1DV1A 3OIFA 1LV7A 1RQNA 4LMRA 3KP1A 1T4DA 3CJTA 3ZJ4A 3RAFC 2QVYX 3QPAA 1YDGA 3KE9A 1T5LA 3CF0A 3OG9A 4KX5A 1U9IA 1RIIA 4HNAA 1A8IA 2W2MA 1T8RA 1PGPA 4KJXA 4EF6A 3TSYA 1C3OA 4ESHA 3T7RA 1DG9A 4W4TA 4F06A 2PUEA 2C1EA 1LTKA 1ZIXA 1LRLA 3AC0A 1H93A 1HKUA 3O0DA 4FI3C 4JNKA 4MDYA 4O4JB 2WKPA 521PA 3TGWA 2GMWA 4R6WA 1E8DA 5K05A 5AHWA 1MFZA 2B61A 2IU3A 2MT9A 3HUDA 4MV8A 4JXKA 4NE9A 5LYJF 1CR0A 1QVZA 3A9CA 4QYMA 1CUYA 1PNTA 3RS3A 1C29B 1NGSA 3CA8A 1DB3A 3DPUA 3BDIA 3ELDA 3NV9A 2BUAA 1FTSA 1L5KA 3ZU2A 1TE2A 3AX6A 4Y1EA 1YDEA 1V3TA 3CUEF 2NUAA 4EB8A 3GUVA 1RCTE 2FPIB 4RDCA 5C8YF 3MT8A 3AG6A 1XKXA 1A96A 2J5KA 3G8DA 3OFKA 3ZDZB 5I7SA 4AB1A 4DR6B 3I30X 4CR6A 3BMCA 2QMUA 4IJQA 4ZQEA 3RKRA 1C4WA 1DKPA 2W2VA 3AK4A 1YRWA 3R23A 5EIXA 1P44A 2REOA 1SUIA 4Q1VA 1Z6PA 2OUKA 3NAZA 1Y9EA 3TFQA 2FNAA 3AU8A 4O1HA 1C9YA 1XPJA 1WB5A 3RQIA 4BMCA 1U2QA 4EPRA 3SKVA 5IT4A 3PKIA 3FXAA 1H66A 3VO2A 2GZAA 3PXUA 3R3WA 2F59A 1X87A 2PZJA 3BIFA 1HDCA 2DR3A 1YB6A 2Z43A 1BMFD 4LJKA 3K5PA 3BZUA 1PQWA 2GEVA 1NVFA 3TIFA 2CUZA 4JNCA 1O0SA 3RQSA 1UKCA 1CUEA 3RG8A 4LS3A 2IYOA 5FL7A 3JQ7B 5IAKA 3FSGD 4GPAA 4IEEA 4UPVA 3HDVA 4A2QA 4ZHQF 4E07A 4S2UA 4NE2A 5CJPA 3TUIC 2JGDA 1PZGA 1W29A 4PWZA 5LN1A 3A1DA 3WLKX 1KI6B 1W46A 2B4QA 2EJTA 2ZJ6A 4HNRA 5EQFA 5KJCA 5TGDA 2HF9A 4CTNA 2ZRNA 1DMSA 2ZYHA 1K92A 2R7NA 4S05A 4PICA 2YASA 1G4UR 2H4JA 1OWOA 4FCCA 4BLTA 4EEZA 1R37A 5JVDB 2LRHA 1G21A 2BHTA 4OFBA 3C39A 4L2IA 3WS7A 4EUSA 3THXA 4DQVA 2J5XA 2W4MA 1O03A 4MYRA 4GI3A 3AFMA 3FGNA 4QBHA 1GUDA 2XT0A 1GG9A 5IDVA 3C16C 5MN6A 1H4QA 1YULA 3CUYA 1B14A 1ZD2P 2EZ8A 2QE7A 1K4YA 4KTVE 3HCAA 4ER7A 3KOWA 4MPJA 1GITA 4X3PA 3IAXA 5FOWA 3ESQA 2ZIEA 3RBVA 4A73A 2XOKA 5JYCA 3JSXA 2OD7A 5EUCA 1ZJWA 3L8CA 3Q2IA 3SQXA 4KREA 2XYRA 4M1WA 4YTEA 5KREA 1XMJA 4FE7A 4NABA 1LV8A 1P2VA 4BXOB 1N5MA 1F0KA 2BSAA 4QQKA 2EFYA 3N2LA 1XMQB 3OLYA 4M36A 4D80A 5KYKA 3HCEA 2UUCB 1YR2A 5BQPA 3G49A 1FX0A 2IP4A 4FDMA 1LFAA 4GBED 5DBFA 4NYMQ 4DQ0A 5C4IA 5I7RA 4KB5A 4JI7B 1UQRA 1F3LA 2PMDA 2ZR0A 2ID7A 3FFTA 3BQ9A 3I83A 1X2BA 3IA2A 2O3TA 4JJFA 3WIEA 3W6NA 2Z2YA 3AL3A 4CWAA 2QHXA 2ZRFA 1KTVA 1U2RA 1GT91 2HSZA 3RK0A 4EFDA 5B6JA 1USIA 5CB4A 5B3AA 3O4IA 4Q03A 3ZTYA 4D42A 2W0MA 1RKUA 1XK7A 2X7XA 1NURA 3KOXA 4AJ1A 3HLYA 4V0LA 4DM7A 4ECEA 1DFIA 2FFJA 4JELA 1ICEA 4R16A 3DD1A 3LUDA 1W5FA 4AJJA 1GTL1 5IAOA 1V0JA 3N2KA 4FXPA 4M0DA 5JZMA 3BQMB 3I58A 2B6NA 3WRYA 5A9SB 4HUQB 1JJ7A 2AMJA 1QV9A 4K6FA 2HJHA 4O2BA 4QWWA 4DC0A 4BNUA 4XFJA 3TRKA 4D2IA 3H0EA 5HG0A 1PLJA 1JEOA 4LOIA 2HYDA 1KK1A 3EN0A 3MFYA 3PE4A 8OHMA 1LGYA 3H2YA 4KAXA 4KBGA 4KLRA 1KVSA 3WYEA 4HVCA 1X9GA 3Q1KA 4J0EA 4AP5A 3NNSA 4BBZA 1FP6A 3MS2A 4AI6A 1WL8A 3TD6A 1EDBA 4FHFA 1ILWA 1WD7A 4C0QC 3BK7A 2WABA 1MJFA 2FZVA 5SZIA 4FSXA 4EELA 1XSEA 5LIPA 4JZYA 4XJSA 2FZLA 2QJOA 3PXEA 2IX9A 2W6NA 1V9LA 4LXHA 4TWRA 3AEQB 4RS3A 4Z9XA 2L17A 4FUQA 3DYIA 2IYSA 1SH7A 2CLLB 3EBLA 4QRIA 4A0GA 2I3GA 3CZ9A 1Y4SA 2FZGA 1LK7A 3STXA 5KOHA 2BGTA 2DYKA 2GLTA 3PGKA 1W0JA 5G41A 2VC2B 2QMQA 1EIZA 2IYUA 3T7KA 4C3VA 5C7OO 3MCAA 4E15A 2FEMA 5DSXA 2P9FA 1DMRA 1CJCA 3GCZA 4DT1B 4JBWA 4BO2A 3INTA 3F6YA 1YBMA 1Y42X 4NYIR 1YKGA 3KHTA 5ALMA 3VNQA 4TMZA 3TL6A 4L95C 5CK4A 2FU5C 1O96B 4OIMA 3SF8A 4BFTA 2E0IA 2H0AA 1PZEA 1FS5A 3BMNB 3VYUB 1XCOA 2CUTA 4QU5A 4FGUA 3DHYA 4R8RA 4BFLA 3RVQA 5AW5A 1PS9A 4DCVA 1EXWA 4Z9AA 2J07A 3L06A 5CB0A 3ONNA 1XJCA 2CXUA 4UHDA 4AG3A 1N33B 5AJZA 5D6NA 4CLOB 1JDPA 2WV9A 4JEMA 1JQ3A 2YXLA 4JLPA 5BPHA 2PL3A 1IJEA 3P4UA 4PHHA 2GF2A 2HRQA 4MI1A 1TADA 1L8LA 1EUYA 1YD7A 2GYYA 4OB6A 3RWMB 3WGTA 3QEBZ 1NI4B 2EWWA 1SVNA 2G83A 4HWOA 2ZJYA 1DQYA 1VA5A 3ORQA 4TT8A 3QM1A 1UPTA 4FPXA 3U7RA 3V1NA 4E2ZA 2NVUB 1G55A 2J6IA 1UJ5A 4CQMA 3JY6A 2RH4A 3MTGA 1P33A 2ZYWX 4RY9A 2P9TA 3NBUA 5HRAA 1M73E 2PSHA 3WV4A 4DLRA 2FTKE 1I2MA 4PTYA 2ONCA 2Q8QA 3B6MA 1BZYA 3DW1X 4U7DA 4RZXA 2PU7A 3PC7A 4F12A 1KYTA 2VK2A 4HZIA 5AVRA 4UBIA 2Z57A 2UZ3A 4HAXA 4TV9A 3IBTA 4KXXA 1XC7A 4HFRA 1M5TA 3CX7A 5HF5A 5ERGB 3SHTA 3A28A 3K31A 4Y98A 4EG5A 4MARA 2FLVA 3PENA 3HJAA 4N8DA 5JSFA 3TOVA 5LQNA 3A37A 3AF1A 3GG9A 1PWEA 2B6HA 2OZPA 2X5JO 3L7LA 2XDWA 1RRMA 2G76A 1Y1LA 1Y7LA 2WOOA 1U98A 4WLNA 4UZSA 4A9AA 2XUOA 4JK3A 3L4EA 1K6MA 4YUWA 1KZ9A 3E0QA 4LGCA 4NU6A 3AUAA 2NPFA 1R4ZA 2O5RA 3GQVA 2BE9A 5DKFA 3VX3A 4EUKA 5M04A 5JCJD 4FJ0A 1SUPA 3A06A 4NENB 3PFGA 4WMLA 4H1UA 4MXDA 2R6CA 1EZ4A 2I33A 3CKLA 3W2HA 5KMGB 1QFJA 5M2QA 2JVIA 2BGKA 1ZC4A 4WNIA 4KLCA 5EEHA 3T1VA 3GLUA 5LP6F 4HQ6A 1PWYE 4CMJA 4ZREA 1P0PA 1XYVA 2Y6VA 1GPYA 2W6QA 3GLIE 4QOFA 4JBXA 1UP4A 5JIBA 5CLJA 5JNTA 3WO0A 1ZXXA 3KHSA 4IDPA 5L3VA 3DMNA 2A94A 1ZOLA 1GG5A 3IIEA 3PLRA 3ZW7A 2KQUA 1UIMA 2YZ7A 3N6XA 4Z54A 2YBDA 2GAFA 2PKQO 4UARA 4F0JA 1WSBA 3LECA 4O63O 2WFLA 3PA8A 3PSHA 4LXYA 4JT2A 3AQ4A 4K9DA 2GZRA 4D6YA 4P5DA 4DQUA 1OSNA 4PO9A 2PRIA 1JHYA 4IKPA 4EX7A 1UZLA 3H19A 2C4HA 2HH9A 4D4HA 2WSSD 1R5BA 1R64A 3ZBTA 2R11A 4IFBA 1WG8A 4DMRA 2JGJA 4KU4A 2OM6A 1G3IA 2DC1A 4NECA 4UM7A 1Z75A 3DTYA 2O8FA 5L3QA 1QNLA 1VL0A 3ENZA 3TFWA 1WDTA 1C4XA 3KFVA 4KXWA 2VPYA 5K99A 3C45A 1KQFA 2Q5OA 4URZR 4YJKA 2ZXUA 4ZOQI 4BGUA 1Z6ZA 2C2WA 2NO9A 2PSSA 3WLOA 4PYIA 3GF4A 3KQWA 4GPIB 2DFVA 2AVNA 3JQAD 3NGXA 5B2FA 5C8DA 4BGVA 5EHZA 2ZDHA 1G5QA 1BXZA 2FSHA 1DAKA 3HYSA 4V0OA 5IKXA 3N87A 2R7LA 3CB2A 1M7BA 3W34A 1KEKA 1EK0A 1DRVA 3PVZA 4H0FA 1W6UA 2Z1DA 3S81A 3ABSB 4MH0R 1VIMA 3SYLA 5DK6A 3HUTA 3WL3A 3BWMA 1ZCBA 2FPUA 5HM8A 2CFSA 1KEEA 4F04A 4ZEMA 3DE7X 2I55A 4KNYA 4HOYA 3G2IA 1KSGA 3EZXA 3LUJA 1B8VA 3LPNA 1U3GA 4Q18A 2RGWA 4Q6BA 1CETA 4MV7A 3WDLA 1TFRA 3ZKWB 2BT4A 2W6PA 1NT4A 2A4KA 3TSZA 3MIZA 3WWYA 2HB6A 2JLSA 2YQZA 4B8ZA 3JQ9A 1JFFB 3FIUA 4G41A 2A35A 4L9AA 3HU2A 1Z88A 3CNLA 4TL9A 3QXHA 4RVSA 5DYNA 221PA 1UMBB 3R3HA 1EA7A 1O4VA 5AXAA 3LHSA 4BFUA 4DMLA 4R31A 5DEIA 4AN4A 5BW4A 1UZUA 4K1LA 2OZLA 3KYDA 2CVPA 4XQ9A 3VU0A 1P1JA 1ESNA 1I2DA 4YCCA 1T2VA 5DGXA 3SJBA 4PGGA 5C1OA 2GZSA 4YQZA 4C6RA 2O20A 5AUOB 2YRWA 4B6PA 1RYEA 4MI9A 4XIGS 3PDCA 2CF5A 3NW9A 3TDNA 5C8YB 1PU2A 4LHSA 4MZDA 2YC2C 2D3TA 3G9XA 1UBJS 1QIJA 1YZHA 4FTWA 4L16A 4L4UA 4BQRA 2EEZA 1QIFA 2J9FB 1SQ5A 3RGGA 4ZRNA 3HJCA 2VZ8A 3VR1A 1V25A 1XNQB 1GL6A 2I66A 1ZM2A 3FOAA 3TCXB 2NYAA 1OTXA 1V41E 4MWDA 4XQGA 3T5BA 4BFSA 4YUZA 3WQRA 4MV6A 1NR5A 2FPXA 4GICA 1CZLA 2G4VA 3ZS9A 2X42A 3JVEA 3K1ZA 3ONVA 2Z2JA 1KYWA 4S0ZA 3L84A 1I9GA 4LKRA 4L85A 3WWCA 4ARVA 1X7WB 2CGEA 1R3DA 2KYRA 4JB8A 3ZE8A 4TXLA 1AS3A 4LGYA 3MHTA 3BCUA 5E0KB 1D1SA 3H11B 3QW2A 5DLPA 3V4OA 4ZIRA 3KZVA 2OECA 1HRDA 2C3PA 2J48A 3NEYA 3PSAA 4QARA 4CKEB 4DBVO 3WO1A 5G40A 5F4ZA 2IS4A 2HA5A 1TK9A 2ISCA 3YASA 1K8XB 4ZHQB 2NO1A 3NKFA 4QGBA 1KSJA 1EXNA 1JHVA 1KP3A 1P8JA 1Q50A 2HADA 3D9QX 1B6TA 3K0CA 4G07A 4OXRA 4MCJA 5CK5A 3WLEA 2Z04A 3QLJA 2JGAA 3HP1A 1I7PA 3EXHA 3WX0A 3ZYZA 1TCAA 4K2HA 1IHPA 3R3JA 3K0SA 3IP5A 4OPMA 1JHMA 2ZUSA 5IXSA 2H85A 4HGPA 1KQ3A 1R6TA 1YCHA 2F43A 3G82C 4KQ9A 2W6MA 4EENA 3JQDA 2WQZA 1WPQA 2NZ2A 1JHDA 2NZXA 2XKAA 3TUJC 3RGWS 1PFUA 5EJGA 1GKYA 1RZRD 3EGCA 2IE8A 4OSEA 3OOYA 1UFKA 3G0IA 3VVCA 3CZPA 1SUCA 1VIYA 2OBYA 3KQYA 1H8HA 1Z25A 3OCVA 4WPGA 3RB8A 1FYDA 3MVEA 4W1QA 2XDQA 2VWGA 1TEHA 1LPSA 1MKYA 4NMHA 1FZTA 1RPNA 1QH1A 3TZQA 1LSSA 4GI1A 5I9TA 2B2CA 3NV7A 2B36A 2QXYA 2PANA 3ZW8A 1OFUA 2OQRA 2QMOA 1HH4A 1IHOA 1EBUA 2FUCA 3O8NA 4NDAA 1CYDA 4MRAA 2ZR8A 4TVKA 4AUEA 2OM2A 4LXGA 1GDDA 3ORYA 3EVGA 5EP4A 5HF8A 3TLGA 5L4NA 5AKIA 2ZTSA 1KEPA 5CIYA 3GFQA 1K6XA 4YT4A 4UTXA 5H80A 4K8OA 3KALA 3OM0A 4FFWA 3P0IA 4EF5A 3ME5A 1N2JA 1W4AA 3WRXC 1W4ZA 4AJLA 4B3CA 4J0JA 1TEXA 1ZUNB 3EVTA 4HTFB 2PUJA 2FRDC 2R2AA 3CPEA 3TMKA 1IBLB 2ZSJA 1A4UA 3MJHA 3FJ1A 3HS3A 4MCHA 5DOVA 1CB0A 1ZOIA 1R3UA 1ZS9A 3OJCA 3USES 5IXYA 4JYAB 5IT5A 3QEJA 3ZV5A 4MQ5A 1SG6A 2NSJA 4ZI7F 2OORA 1VB5A 2ZW9A 4XR4A 4X6LA 5I8ZA 3JZDA 5TQJA 1RCUA 3WXMA 5ICCA 3Q8KA 1YQWA 5AKEA 1NLYA 4EECA 2FXVA 3LRTA 1E6KA 2V58A 5JHHB 1KY3A 3TQQA 1TUGA 2GN1A 1BXRA 2AI2A 1E2HA 4J1TC 1XZ8A 4YBRA 1JHAA 4QM6A 4CDGA 3D02A 2R751 2ZRCA 3KLOA 3I6IA 1ABEA 4C0LA 1Y3HA 3QOXA 1T5SA 4BO4A 3IV9A 1DVRA 5ALWA 2XXAB 2Q1SA 1T8TA 1R88A 1R6BX 2QLFA 5F2OA 2JFZA 4DYHA 1Q7TA 1UQUA 4IIXA 4A91A 4TZ6A 2OV2A 3QYJA 2VCYA 3ZWQA 3E2IA 3R24A 3TQRA 3FFAA 4ND1A 4IP0A 4ZYYA 5K03A 4JIGA 4Q1FA 1DXYA 3M9WA 4CKZA 5FT9A 2DLNA 3VTAA 1VL8A 1I3NA 3RTCA 4PHFA 1B1CA 5D1HA 3M70A 4BUJA 4KLNA 5KQPA 2RHTA 1KDPA 1HZZA 1R6AA 2GPNA 3I2YX 3K1JA 4OHKA 2PK3A 2F9MA 3RAGA 2Y1GA 5B2EA 3U80A 3T1HB 2BEVB 3OLXA 1HRKA 3I4CA 3HPRA 3P0FA 2FDRA 5EG5A 4DLYA 1GU1A 3NRCA 4PAMA 3L1VA 1SOWA 4C22A 2Q50A 2ZB2A 3F6PA 1GU0A 1GN8A 5DNCA 2HPHA 1CUCA 1J09A 2C9MA 3B6ZA 3SU8A 4DAOA 5KS2A 3BL8A 1LC0A 3N59A 3G5TA 3WYBA 1NW9B 2EYQA 4LCJA 1E5LA 1CPYA 3FETA 2IX3A 3LIPA 5B30A 3GCWA 3U19A 2YVLA 1ZM9A 2DWUA 5FTMA 2ASVA 1I6MA 3E7XA 4G5SA 1VHJA 4LQLA 3TJRA 2V1XA 3QWAA 2Q8PA 5CG1A 4YFYA 1YQQA 1S2NA 3PQ2A 3QVVA 1WUIS 2Z9BA 4HGQA 2BMWA 4MUGA 1AO0A 5C18A 5K0FA 3LNTA 5FI3A 4IKOA 3LPLA 5H9WA 4KLZA 4RJ2A 4QG7A 2BEUA 3IAM6 4NCNA 4J4HA 2WIDA 1YFKA 1U3FA 1WOMA 1R5NA 2DCMA 5K6AC 2D5AA 3UK0A 4BEWA 3TDKA 1GTZA 2OCXA 2CFRA 5BN5B 1JLMA 1TJYA 3GFGA 5SICE 4X00A 3TMYA 4EAAA 4GSKA 5IDXA 4DMCA 2BJWA 1GTVA 2FZEA 3Q2OA 1E59A 4OI1A 2O8EB 4WLFA 1TGYA 4ZT4A 5TV2A 1HQDA 1R2QA 5LQMA 3R5FA 2VK1A 5KTRA 4TV9F 1X39A 3D3WA 4D9FA 4GVXA 2HYIC 1OJLA 3OE7D 1EDEA 1EEHA 4PZYA 4ZJPA 2COUA 2AKEA 4NBLA 3TQIA 2YN0A 2E87A 3PKJA 5EUQB 3BPSA 3B1WA 1RHMA 4EWLA 2G04A 2C9ZA 2FWMX 1XAJA 1J49A 1IM8A 1UOQA 1RPZA 2BI7A 1U5AA 3HR8A 1WHTB 4JROA 4DDHA 1I4TD 3NI2A 1DZIA 5DM60 2QPLA 1WXIA 4UHJA 3ZDEA 1Z56C 1ZEMA 4ZANA 3R3VA 5JJIA 2JF0A 1KY2A 4QTUB 5CVJA 3WNQA 3OY2A 4YUXA 4ZYZA 1JBQA 3WBBA 1RJWA 2YHSA 2DY0A 2OZEA 4BEVA 4CIDA 2Y0CA 4IMJB 3THYB 1JILA 3UPDA 3OLCX 1GZUA 1P5HA 4L6IA 3IRVA 1Z0UA 4BY9E 1TM2A 3M6AA 1D0VA 4M83A 4R0MA 2VKQA 1LDMA 1Z39A 2H9IA 2VKTA 1ANKA 4HLUA 2XUHA 3R8CA 5HIKA 3LZCA 2ARKA 2ZOSA 3QX8A 1X0VA 4QXMA 4QL3A 4GMDA 1MX1A 2HWKA 3QQPA 1ELOA 2DSTA 4PGFA 3TVTA 3CLSD 1OW3B 3HZHA 4REOA 1Y3FE 3RU3A 3RC3A 1NXOA 1WCWA 4CFZA 2GXSA 3DLPX 3C3EA 3CVVA 2VPQA 3ZI7A 1SHUX 3R41A 3D6FA 1QYDA 2JL1A 1K5PA 3HBMA 3KDAA 4JBHA 5LP6B 4A15A 4N0QA 1L8OA 2O1XA 1O6FA 2DWQA 2GT1A 3VNBA 3I2GA 121PA 5DO9A 4D0GA 3PQEA 1C1HA 5JZ9A 3OQIB 1YRBA 4QUAA 3PC6A 5DLYA 2ODNA 2PLRA 4GOKA 5DPMA 4ZVMA 5F64A 1EWKA 2Q0QA 2PBFA 2J0SA 1V1MB 3N53A 4MR8A 3P1JA 3DAYA 5CRIA 1PNOA 4GM1A 5AKJA 3VOBA 1SKQA 1GPKA 3FHLA 1Z5PA 3T6KA 4F84A 3AR2A