1ID1A

Crystal structure of the rck domain from e.coli potassium channel
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
b'HRKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPDIILSPQLFGSEILARVLNGEEINNDMLVSMLLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE POTASSIUM CHANNEL PROTEIN
molecule tags Membrane protein
source organism Escherichia coli
publication title Structure of the RCK domain from the E. coli K+ channel and demonstration of its presence in the human BK channel.
pubmed doi rcsb
total genus 51
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1id1A00
1Y1PA 3ONEA 4TZKA 1D1TA 1YXMA 4DA9A 3PYXA 1LJ8A 2VWQA 5DBIA 2VOEA 1HE5A 1Y8RA 2QYTA 1D3AA 3PFFA 4YTEA 3KLMX 1DLJA 3OHSX 4BNYA 4JJFA 1RPNA 3VDQA 3A28A 3WTCA 2PH3A 4XQCA 3GDOA 1UAYA 1BXZA 2GDZA 2VUTA 3T4EA 5IZCC 3PDUA 3FF4A 2PLAA 1DLIA 2P68A 2V6BA 2Z1MA 3DZHA 4O0LA 1JVBA 1K6XA 2BGLA 3H9EO 3O9ZA 1ZVMA 4CJXA 3ETGA 4U7WA 2HRZA 4N5MA 3STHA 5KJ6A 3FPLA 3CEAA 2ZYAA 2NV6A 2PY6A 2ZB4A 3F3SA 4NFYA 4R1UA 2YFHA 3TZ6A 3ETEA 1G1AA 1TEHA 3OJFA 3DBVO 4FFOA 2IYOA 5TJHA 4FSHA 3U4CA 4QUKA 3VZQA 4FQ8A 3U4DA 3QJ5A 3QY9A 1E6EA 3HFSA 4FGSA 1GV0A 4UVDA 4EI2A 2HAEA 2NNLD 4UREA 3TL3A 4H7PA 3FNEA 4FOOA 3ZNNA 3S8MA 2X0RA 3SLGA 5JAZA 3DTTA 3WGTA 2QW8A 2EKLA 2X7HA 2PGLA 3ZWMA 1LU9A 1VPDA 5A03A 4BO9A 4R54A 3FTPA 4BNJA 4DRYA 4N18A 1JKJA 4I5FA 3JD1A 1I3MA 1SEVA 2AA3A 3EVTA 4OKIA 4NG5A 2VUUA 4RO0A 5KOIA 4OO3A 1Z73A 3LLVA 1UXKA 4IQGA 1NPYA 3OM9A 5CPFA 3CE6A 1LUAA 4HNHA 3C1AA 5J23A 3U4HA 3GFBA 3QWBA 3JCZA 3DB2A 5TQVA 1ISMA 2Y0DA 5JAQA 2QZZA 4ZQFA 2QZ9A 2XAAA 3DOCA 1ONNA 4XIYA 5I7VA 1XIVA 2NWQA 4BNKA 5DOZA 4G65A 1TVEA 1VKOA 1Z7BA 1MG5A 4QXMA 1BMDA 4BO4A 1HSOA 1BTOA 1RM5A 2CF5A 2RCYA 2RIRA 3FRJA 3O8QA 3OECA 1KC1A 4R51A 4RVSA 2GN4A 4CMHA 4RF2A 1T2DA 2X1HA 3S2FA 5IDQA 4A7PA 3A4VA 1T25A 5IN4A 3RROA 1ZK1A 4OMUA 3BMNB 5B4UA 1WMBA 4EYEA 3KSZO 3SX2A 1GUFA 3KO8A 2HK9A 5L4SA 1LNQA 1H6BA 4PLHA 1S6YA 3ZWBA 4DUPA 1JWAB 1VRWA 1SOWA 1U3TA 1MFPA 4F45A 1KETA 3H2SA 4ZU3A 4EGFA 1E77A 3KYBA 1HDXA 4IDBA 2NVBA 2FR8A 4RVFA 1IOLA 2HU2A 1I5RA 1Z7EA 5C7OO 3WFIA 1Y6JA 2A4KA 5K0ZA 1NVTA 4HBGA 5BNTA 1ARZA 2EW8A 3GF4A 2X58A 3ONDA 4TKMA 4KOAA 4XR9A 1YBVA 5A9SB 1DOHA 4BQRA 1IPFA 1DIAA 4JXKA 1ADBA 2IODA 5CAEA 5IAAA 1IHYA 1LA2A 2D5AA 1K0UA 5JNLA 4RF3A 1PQPA 2D4AA 3ZI0A 5AXBA 5U9CA 4D0SA 4A0SA 4D45A 4P8RA 4TMFA 1J0XO 1HF3A 1X15A 4XKJA 2POQX 4CLRB 2PA3A 2B36A 4WLVA 4MIEA 2P9GA 3G0OA 3ANNA 1OI7A 3HDJA 4LSMA 3WDSA 5IDWA 1GUYA 1H9BA 4R1TA 4BB5A 3DONA 1Y9AA 2PGJA 4UEJA 4JBHA 4E21A 4FN4A 4GH5A 2X0JA 4HKTA 2B4TO 2EERA 3BMOB 4NPCA 4JCOA 4WCDA 2O3JA 5TT1A 2O23A 1QKIA 2VT3A 4R5MA 4OOFA 1X13A 4ZD6A 4FB5A 3IJPA 2JCYA 1GU7A 4XDYA 2BGKA 3PWSA 3GNSA 4FR5A 4J0FA 1GEGA 5EL0A 1F8FA 4A2CA 4ZVVA 3OIGA 2JJYA 3L9XA 1U28A 1XU9A 4E5MA 4HV4A 3C8MA 1X7HA 1B7GO 4PIVA 4QT0A 3H65A 4W7IA 3OJLA 4Q3DA 2W8ZA 1P9LA 1B26A 5JE8A 3GVIA 5ITWA 5JYEA 1XHLA 2FPPA 4CUZA 4XD2A 3U09A 2DVMA 4KUGA 3VH3A 1E3WA 1E5LA 4BNIA 2IYPA 4XYBA 4CL3A 1AE1A 1GADO 3TZHA 4IJVA 1UUFA 2VRCA 4BO0A 5AXDA 1GCOA 3W4JA 3TFOA 5COAA 1U7HA 4MJLA 3P7MA 4ZA2A 2BGMA 3RVDA 3GRPA 3ON5A 3E03A 1EFKA 2NACA 2OP1A 1YONA 3QVXA 3ZGYA 4YDRA 1N2SA 2H1SA 3VH2A 1XSEA 2ZQYA 1FDUA 4ALLA 1NWCA 3HN7A 3ZU4A 4E5KA 3ZU3A 1U3UA 5JMWA 2E49A 3UICA 4XA8A 1UR5A 3WXBA 2DBZA 1PL8A 3WLEA 5ADHA 4WLEA 1QR6A 3H9UA 4R41A 4PLTA 4XYLA 1PJ3A 1XWFA 3OBBA 3K2EA 5TRTA 1PJQA 2I3GA 3PYMA 1LLCA 3I9LA 3Q6IA 2A35A 5HM8A 3GR6A 5FI3A 3IKVA 1T2EA 2JCVA 1E3WB 4H16A 4ALJA 4CM4A 1YGYA 2RBEA 2X4GA 4BNTA 4WLNA 5I8ZA 5CDUA 1ONPA 4FJ1A 1X14A 3PZRA 4O59O 1IB6A 3UN1A 3ZHYA 2D0IA 1O5IA 3SJUA 2X5OA 4B3JA 3IP1A 1O94A 1WW8A 3RQSA 1N92A 3CXRA 5L7YA 1KOLA 2I99A 3W4KA 4DC0A 3IKTA 4CMIB 3QHAA 1QYWA 2XXBA 3S2GA 5DULA 3JQBA 2OXIA 1MGOA 2C5AA 3PTZA 4TVBA 5COQA 2OHXA 1T24A 3VC7A 3WYBA 3VPGA 1H94A 4GX0A 1Y8QA 2JCXA 2PZJA 4MVJG 3ZV3A 1E7WA 1PS8A 2VZ8A 4ZRMA 1EUZA 3T4XA 1ZK2A 5L7WA 1U8FO 1U3VA 1W4ZA 3DBHA 2NU6A 5G2OA 4LMPA 3VVCA 1WP4A 3DBRA 4P4LA 2FPIA 3ZWYA 4OGWA 1M6HA 4P22A 1B8UA 4WK6A 3CINA 4CR7A 2C07A 4B8WA 4DPMA 3L4BA 3IUPA 3G49A 4IIVA 3ADPA 1YDWA 4ZGWA 3KM0A 3LC2O 1SEPA 4W99A 3NTOA 1HZZA 3PI7A 2ZIZA 5K6AC 3LZ6A 2AEJA 5DP2A 4MVJF 2B83A 1MXHA 1GFSA 1NAHA 3KB6A 4PRLA 3DZBA 1DC5A 1ZMTA 3NTRA 5U1PA 4Z0PA 4YPOA 1YL7A 2VWHA 1DRVA 4N7RA 5JLAA 3VOSA 2P5UA 5JO0A 4WLOA 3GA0A 3F6YA 5G4KA 4Q3CA 4RQUA 3VPXA 2C7VA 4TRMA 1PJCA 1EVZA 1NR1A 1P1HA 5T57A 4C4OA 2ZYGA 4CLEA 1JU9A 3DMTC 1LI4A 1NVMB 2PZMA 3JQ9C 4OSPA 2XOXA 4YT4A 3SVTA 4IBOA 1DJNA 3INRA 2I67A 4WCFB 2Y67A 3ZW9A 4RF5A 4LRSB 4RV9A 3GT0A 4PLVA 5KVVA 1I2ZA 2IEBA 4A26A 3NDRA 3K73O 1OFGA 4Z0TA 5AOVA 2P5YA 4OAQA 2O3SA 2DPHA 3GQVA 1L1FA 2IXBA 3JYQA 1HETA 4CMJA 5BNFA 3UHAA 2J5RA 3FBTA 4RZIA 2DTXA 2ET6A 3BHJA 2P4HX 4N5LA 3PQEA 4DPLA 4OH1A 3WR5A 3TN7A 4EEZA 2O3TA 2AQKA 3ZHXA 3NEPX 3FNHA 3AM3A 1HDOA 2JFHA 4R3WA 1DAOA 5AYVA 4NFSA 4M86A 1TXGA 5EERA 4KWIA 3V1UA 3HDYA 5KKCA 1ISGA 3CZMA 4E2ZA 1VSUA 1ZK0A 5CP8A 5A05A 3QLJA 3VPHA 5AXAA 3GN2A 1QLJA 3QA9A 1KC3A 3GEDA 1HDCA 2OP0A 3TSCA 3JYPA 4RF4A 1ENZA 3WWYA 1A5ZA 1A7AA 2CMDA 4E12A 2AXQA 2YUTA 3OEWA 3PJFA 3WFJA 2GSDA 1UH5A 1WMAA 4KTVE 4LGVA 2GERA 4IDGA 2WYVA 3PK0A 3ZH2A 1KVUA 4KQWA 4EUEA 1A71A 2UV8A 3OJOA 1DIHA 4BNUA 1O0SA 5C3MA 5TC4A 3HB4X 2GGSA 3E6AA 2IZZA 1M6WA 1R66A 2C54A 1HE3A 4Q39A 2PFGA 3S2EA 2NTNA 1AXGA 3JD0A 1NFFA 1BRMA 5B1YA 2Q1UA 1WAMA 4YJFA 4AJ1A 3D7LA 4UUOA 2X6TA 2Q46A 4RGBA 2VNAA 1A4UA 5KWEA 4Q3BA 1SB9A 1HL3A 4FIZA 1E3SA 2HMWA 4J91A 2J6IA 1T2CA 1U3WA 1QSGA 3L4BC 3NYWA 2Q50A 5EINA 1AN9A 3EVNA 3UF0A 1ZBQA 3W8FA 3EMKA 3LLSA 5CEFA 1EDOA 1NQTA 3WGGA 2WM3A 4BNZA 3R0IA 3ST7A 4E3ZA 4Z0HO 4E6PA 3VTZA 3SXPA 1FF9A 3JQAD 5DNAA 2HMSA 5G4LA 1VSVA 4I9UA 3ADOA 1DRWA 1HYEA 1J4AA 4R69A 2ILTA 2CZCA 1G6KA 4G81A 2D1YA 2NQTA 1PR3A 1B0AA 1O95A 2D59A 4JBGA 5HBRA 4FJ0A 2WJPA 2WYWA 3VH1A 4AJPA 3RASA 1JLLA 1P31A 4WLUA 2J3KA 3NX4A 1DB3A 2FSVA 1DC6A 1PJ4A 2VYVD 3D5TA 1EK5A 4E33A 2DQ4A 3PPIA 4TVOA 1V35A 3WBFA 2PGDA 4LK3A 2O3UA 3NUGA 1E1KA 4R1SA 4JK3A 2QYSA 3G79A 3ENNA 4XQGA 4HFJA 1VM6A 1CF2O 2VRCD 4CQMD 3HZZA 2JD2A 3RU7A 3PQDA 2ZJ1A 1Y7TA 2UDPA 5L53A 5BSGA 1QRRA 2EP7A 1Q2XA 1XA0A 2YQ4A 3I9KA 1N9GB 1Z75A 4ZQEA 3JQBC 4MDHA 3MJVA 5F21A 5IJZA 4O6VA 1D4FA 1M67A 5JC1A 5KIAA 5JO9A 4BMVA 3DZFA 3ICCA 1DRUA 1X0XA 1VI2A 4E32A 1TT5A 1KS9A 3ZV5A 4MKRA 4J16A 4R5HA 4B7UA 1TT5B 2W90A 3TFQA 4BKUA 1N5DA 4CM7A 5JAIA 1YO6A 2O3QA 3KYDB 2D5CA 4L75A 1KY4A 3KYCB 4E5PA 2W2LA 3WGIA 4R1NA 4ROSA 3N74A 2NUAA 1LDYA 4J2HA 1C3VA 4W4TA 3OA2A 4B4OA 5JW6A 3KEQA 3H8VA 4JJIA 1LLUA 2JFFA 3M1LA 4RPHA 1H6DA 4CMEA 2X5JO 3BTUA 3JQCA 4K6FA 2Q4EA 4MINA 1VE9A 5A3VA 1V3TA 3U3XA 3VZSA 1R0KA 5F5NA 2Q1TA 2O2YA 2VCYA 3PGJA 4DC1A 4TRNA 1P0FA 4QFCA 2OGUA 8LDHA 3C7DB 4CUKA 2LDBA 3EDMA 4EJ0A 2OFPA 1DFIA 1LQTA 3RC1A 3VHRA 4BGIA 3FNFA 2GR9A 4YAJA 3FNGA 4RZHA 1U2GA 1MUUA 2X86A 5FWNA 3DMTA 2DAPA 2F1KA 4I5DA 2VT2A 4PG6A 3RCBA 1Y5MA 4NFHA 2QQ5A 3AY6A 5THKA 1IYZA 4BO6A 4FCCA 4UEOA 3C7AA 3ONFA 2R2GA 4JN6B 1FJHA 2Q1SA 1NHWA 1V6AA 3OEYA 3I9MA 3QQPA 1CJCA 1N1GA 3GUYA 3DTYA 5CPBA 2C5EA 4YJHB 4KP7A 1DFGA 1RWBA 4NBUA 4YAEA 5IF3A 1BGVA 3RAJA 1R0LA 4E2XA 1QYVA 3JQGA 4WJZA 3GEGA 4AVYA 3E8XA 1UDAA 1SOVA 3D5QA 3WIDA 8ADHA 3OSUA 4OYRA 4ZRNA 3BHMA 4A27A 2DBQA 2HMUA 3W6ZA 5IZ4A 1JKFA 2FSSA 3WB9A 1BXKA 4IDFA 1NQOA 4CM1A 3DBLA 1DBVO 4L76A 3W1VA 3PFWO 2P91A 1BVUA 1HDGO 1PJBA 3OMLA 4MKXA 4YQZA 1PQUA 1YVEI 3W8EA 3GVXA 4RVGA 3ZWVA 4D44A 4DQXA 4II2A 3B1JA 4B8ZA 4QSMA 5B12A 1B3BA 1GCUA 1ZXLA 3JYOA 1NFRA 1VJTA 2YW9A 3EY4A 3NTQA 4DBVO 2VYND 4GSLA 3LQFA 2GRAA 4IGFA 2QRLA 5JYDA 2J3JA 1P3DA 2I76A 3ANLA 4AJEA 5MDHA 3NKLA 4CM9D 1A7KA 2PD3A 4IDDA 1PEDA 4I1IA 4M49A 4Y6PA 1C1DA 3WGHA 3O8QB 3PWKA 2WSBA 4GMGA 4LSWA 5DBGA 4IXTA 2BI8A 2CVZA 3PEFA 4GQAA 4RVHA 3KETA 4CMBA 5DDIP 4BV8A 4L8VA 4O63O 3U49A 2PWZA 4GGPA 1W6UA 4XGIA 2R00C 3EC7A 3QRWA 4CLDA 3JQ7B 4BNHA 2PH5A 5A06A 2Q2WA 1F17A 3RBVA 3C7CB 1UJMA 4BKOA 2DUWA 4XYEA 2OBNA 4WCFC 3Q1LA 4UUMA 1IY8A 1T26A 2BKAA 3L9WA 3U0BA 1TA4A 4O1MA 1P1RA 3EZLA 1XYGA 2YJZA 4EBFA 3OQBA 4MIOA 4GBJA 4KMSA 2HLPA 1O9BA 1UP7A 3UUWA 1RM0A 5LCXA 4BKQA 2WD8A 4FOSA 1MX3A 4MP8A 2NTJA 4YBZA 4AFNA 4L73A 3GH3A 4CMEC 3QVSA 2W2LD 3R3JA 1X1EA 2X22A 2Y66A 3CUKA 3D3EA 3RUDA 4BO1A 2HCTA 3P2YA 4I9HA 3AOEA 1PS9A 5IXSA 5GY7A 2AE2A 1QYCA 3D1LA 4PG7A 5JBIA 1H5QA 4IGEA 4DIBA 4CLHA 1YQGA 4BO8A 1WWKA 3HUDA 4PVDA 4HP8A 4XQEA 3ETDA 4QQRA 2YDXA 4CLOB 4Y98A 1Y8QB 2AG5A 5EJ2A 4E2WA 4ZN6A 1ZK3A 4XEHA 4IDEA 4J1NA 5B4TA 3JD3A 1NPDA 1DC3A 3NT2A 1SZJG 5TF4A 2ZB8A 3F4LA 4KDFA 4PLZA 4XWYA 1HE2A 3WBBA 4C7KA 5B37A 4XB2A 1L7EA 5TX7A 3ITKA 3BMQA 3RI3A 5MGBA 5EQDA 1NQ5A 2YQ5A 3TDKA 1I36A 3RSHA 2NVUB 4B4WA 1SC6A 2Y1FA 4PLCA 7MDHA 1TI7A 2R6JA 3GPDG 1PGNA 1GQQA 1EVIA 3WNQA 4AJOA 3GAZA 3M6IA 1Z82A 3OJ0A 4WASA 4FDAA 4AL4A 1BWSA 4LVUA 4DTIA 4K26A 4L9RA 3OF2A 4Y8VA 2X0NA 1HTBA 3I23A 3OP4A 3BMCA 1YE3A 4MVJH 3U62A 3N7UA 2CY0A 1EBFA 3RUAA 4YJDA 2EWMA 3R1IA 1EE9A 4IMRA 4DMMA 5C37A 1KEUA 1HXHA 4B4UA 1NQAO 5DF1A 3WG9A 4J6FA 4RORA 3DAPA 4YJGA 2VQ3A 4B7CA 3WYCA 1EQUA 3RUIA 3G1UA 5T8KA 2HJSA 4XGNA 1M2WA 4JBIA 3OH8A 3GN1A 5C7LO 1T4BA 5F3RA 1HE4A 1JAXA 2EKPA 3KYCA 4BL5A 2E48A 5GMOA 1R6DA 4KWHA 3WSWA 5G0VA 2SCUA 2XF8A 3COSA 2RHRA 3E18A 4II3A 5ER9A 2YV2A 5H83A 3RJ5A 5A9TA 3DWFA 4AJIA 4YJFB 3I9JA 1DXYA 1ZMOA 3ROMA 4JLWA 4HADA 3IJRA 4RQTA 1DPGA 1B16A 1Q1NA 1CETA 3WSVA 3UCXA 2GCGA 4J7XA 1EUCA 4PLGA 3WICA 4AJLA 1ONOA 4XCVA 1PGPA 2B4QA 5DCUA 2VHWA 5FYDA 1HKUA 1UP4A 2BF7A 4PZEA 1PSDA 2A94A 5AQ1A 5B4VA 5L4LA 1Y81A 2GNAA 2JAPA 5CEEA 2LDXA 4J90A 5IXYA 3X2FA 4QECA 2D3TA 5KTKA 3N58A 2YDYA 2CVOA 5JDIA 3F4BA 3E82A 5I9NA 3TOZA 1V0JA 1GYQA 2EXXA 4YVFA 3C3XA 1B14A 4LRTB 2GZ3A 5L7TA 4UUNA 1BW9A 2HMVA 3WTBA 5TT0A 4BNMA 2A9FA 3HWRA 1LX6A 3JQFC 2C59A 5IZCA 3DXFA 4G2NA 3DO5A 4JNKA 3AFNA 2UAGA 5IG2A 1HWYA 4JROA 3WYEA 4JJGA 1ZJZA 5CG1A 1CQJA 4NBRA 4INAA 4DIFA 4NDNE 1VJ0A 1R12A 2PNFA 5TS3A 3ZWWA 2HKIA 5ES3A 3T7EA 1T4DA 3H4VA 1MFZA 1NM5A 3H5NA 5EPOA 5TLSA 2BFOA 4F3YA 3VVBA 1E3JA 5EQFA 4IPTA 1RM3A 9LDBA 3NJ8A 3MOGA 2Y1OA 2CDCA 1I3NA 4GKVA 2GO1A 4DLBA 1NXQA 4WPGA 2HO5A 2AEMA 3WS7A 4W6ZA 3DZIA 2VTEA 2AE1A 3AI1A 1XQ6A 2WTBA 1ENOA 4PRKA 2R00A 3CMCO 3LT1A 2WMDA 5KVQA 3FPCA 2GD1O 1ZXBA 3GLQA 4YAGA 4C7JA 1MV8A 1M66A 1QMGA 2B69A 3GGPA 4JGBA 1XQ1A 3I6QA 4ALIA 4GGOA 5I7FA 5JXWA 5EMHA 5KJ1A 1AGNA 1GPJA 1O89A 3DBHB 3LK7A 5A5EA 1ZSVA 4P38A 5T64A 4LVCA 5LDGA 3PHHA 2I9PA 4M54A 3PIDA 4Y67A 3FN4A 4DPKA 5K9ZA 2OL4A 2Z95A 3E5RA 1D8AA 1PJSA 2J3HA 1P1KA 1RKXA 1MLDA 1HYGA 2GYYA 3DZJA 1NNUA 4TKLA 2EGHA 3DHEA 3DZKA 3AI3A 5KVSA 3GMDA 1GEEA 4BMSA 1BXGB 2Q99A 4Z3KA 3ICPA 3IS3A 3SC4A 3V2UA 4CM9A 4E5YA 1H6CA 3DEYX 5ENDA 2O4CA 4RPKA 2PKQO 1ULUA 1KVQA 4BNNA 4XQ9A 4Z3DA 4OXNA 3PIIA 1MG0A 4CV3A 3EYWA 1FDVA 3QVWA 3LC1O 1YOVB 1R4NB 3PRJA 4IS2A 3CKYA 3CH6A 3NGXA 1MC5A 1PJ2A 3WQRA 3JTMA 2VN8A 4PZCA 4CR8A 2BFPA 4R01A 4AJKA 1ISIA 3EGOA 2WWRA 5KKAA 3TWOA 3KLPX 5BR7A 5BNIA 1O6ZA 1YKFA 4BNGA 1WZEA 2GF2A 1YS4A 1KEPA 4BGVA 2PR2A 2EHDA 4D3DA 4E2YA 3OQ1A 2EEZA 3H3FA 3WGYA 5JDIC 4HWKA 1P1IA 3LF1A 3U5TA 2C29D 1YWGO 3TRIA 1PJTA 2HK8A 1GY8A 3NAQA 3ROQA 3IIEA 3UAGA 3CPSA 4YRAA 3TL2A 1XCBA 3JD4A 2ZB7A 2C7GA 4ND1A 1J49A 2EIHA 1BSVA 3D64A 1WVGA 1YJQA 3OICA 3BMCB 4IZHA 1KVSA 1RJWA 2Y0EA 3PJDA 4J7CA 4ZHSA 1HT0A 1ZW1A 1AHHA 4L4SA 2NSDA 3GVCA 3AY3A 3GRKA 4ND5A 4E0BA 2CF6A 5CDYA 4NJMB 2I66A 4AJHA 4YYZA 1H93A 1OC4A 2CNBA 1BDMA 1PWXA 3AW9A 3DZGA 3MTJA 3IDSA 3RBZA 3TOXA 4TROA 4IJUA 3I9NA 1T2AA 1QP8A 3INTA 1PTJA 1XEAA 4U0KA 5LC1A 5CDSA 3WGZA 4EJ6A 1E3EA 2EGGA 2TMDA 3Q11A 1QORA 2P9CA 3H9JA 1LDBA 4K6CA 5ICMA 2Y99A 3PDJA 2G1UA 1XDWA 3BIOA 3PJGA 4HUJA 4NI5A 3X2EA 2DUUA 3A9WA 3FWZA 3GDFA 1F06A 1IHXA 3I9OA 1NYTA 3JQ8A 3DFUA 4NK4A 5DT9A 2I5PO 5CHEA 2C20A 4NNJA 4DBZA 3QIVA 3KV3O 1R15A 2CFCA 3D0OA 4TRRA 4Y9DA 2VHVA 3DC2A 2FR0A 2X9GA 2WE7A 3ULKA 3Q2KA 4J49A 4ALMA 5KCZA 2NVUA 2X9NA 4RPLA 4L4XA 1E7MA 3PQFA 3CIFA 5F1KA 1FMCA 3BMQB 5JC8A 3DFZA 2O2SA 5JS6A 5L3ZA 2P2SA 3KVOA 4QX6A 4GPD1 1YQXA 3BZUA 4J7UA 3GG9A 5H81A 2ZCVA 2G0TA 5T5QA 4LCJA 1IUKA 4AJ4A 1WDKA 2BI7A 4AJ2A 3BMOA 1PGJA 4FFRA 1SO8A 3LDHA 1DC4A 1QYXA 2AG8A 5FFFA 3KTDA 1Y9EA 3QP9A 1HDRA 1HZJA 1GR0A 3BXXA 1WPQA 4NJOA 1R4NA 3GPIA 4YXFA 3H5RA 1EFLA 2DLDA 2PKRA 3UOGA 1MC4A 2GZ1A 3MJ4A 5L40A 4AICA 2Z5LA 4N54A 2DFDA 1EDZA 1OBFO 6LDHA 3CSDA 4D7AA 2GZ2A 3ASUA 2B4RO 3U4IA 2DFVA 3F46A 4IJKA 4J4TA 2X9VA 1C0IA 1QXSA 5JFOA 3MOIA 4PLPA 1ZJYA 4BGEA 3BTOA 3QWHA 1YJ8A 2JKVA 4PG4A 2ZYDA 1IZ0A 3Q2IA 1W8DA 1ZH8A 2Q2QA 4TSKA 4WGGA 1V3VA 5BSFA 4CQLB 5BSEA 1AXEA 1OC2A 2WD7A 1P44A 3PLNA 4GWKA 5HS6A 5JPIA 4IMPA 4EZBA 1UXHA 4J4HA 2UVDA 3WQQA 3B20A 3K96A 4I9NA 2AQ8A 2JAHA 4DVJA 2BLLA 2P9EA 4J4BA 4AJNA 2CD9A 2E82A 3K2BA 2OBYA 2PTGA 5HWSA 3G1TA 3JD2A 4NR0A 2Q49A 4WLFA 5DOVA 2HQ1A 3GNTA 2FMUA 5I7SA 4ALKA 2RHCA 3Q9NA 3I1JA 1C0LA 4ESOA 4RJTA 3WGQA 2RH4A 2W2KB 1E0DA 4L4RA 4HFNA 3H3JA 5T6BA 3WLFA 3GHHA 3C1OA 2OUIA 2H5LA 3AFMA 1JWBB 2C82A 9LDTA 1X7DA 2RAFA 4K1LA 4WE3A 1E1NA 1PZFA 2QIOA 4WEQA 3DAGA 4X54A 2G82A 4HFRA 2JFGA 1R37A 4F6LA 1GL3A 4A5OA 1J6UA 3DOJA 3WJ7A 4BGUA 1K6IA 1SB8A 2XXJA 4I5EA 1ZUD1 3RKUA 4XZ3A 3RJ9A 5JDCC 2CDAA 2I65A 1U7TA 3EAGA 3B1FA 1L7DA 1LRLA 1NVGA 4M87A 4B3HA 1PJLA 3ASVA 4CQLA 4RPJA 4BNLA 1KEWA 3ZZNA 2DKNA 4GKBA 5JY1A 4DYVA 3RUEA 4CMIA 2NU9A 4NU6A 5HA5A 1PWZA 2ZTMA 3AOGA 2WYUA 1W0CA 1KVTA 1UZNA 3HDQA 1KBZA 4LN1A 3DL2A 5GZ1A 1KEVA 4YA6A 4DLAA 4J43A 1LBEA 1UXGA 2FRDA 4IIUA 4IZIA 2IZ0A 3WMWA 2BD0A 4QO8A 7ADHA 4HY3A 2BMAA 3VPSA 2O7QA 3F5QA 1NP3A 1C0PA 3DBRB 5BT9A 3RKRA 4IJWA 1N7GA 2O4UX 3W6UA 4NU5A 1CQIA 3I6IA 3RFXA 1ZCJA 3VAZA 4DYDA 4KQXA 4UUPA 1TB4A 3NDJA 4J1SA 3UXYA 4QFDA 3MWEB 4CMCA 3RD5A 4OKNA 2BRUA 5I9MA 4Z6KA 5IDYA 4YEDA 4RVDA 3B1KA 4BQPA 1R4MA 4XB1A 3GC6A 2VYVA 3ZNPA 1X7GA 5JMPA 5JAMA 2IRWA 4JP2A 4D42A 4BNWA 4FC6A 3GUCA 4B79A 1VL6A 4FW8A 3RUCA 3M2PA 4WNCA 2ZJ0A 4R68A 4TRJA 2EJVA 4IS3A 4MVJP 2HK7A 4GSKA 4NHEA 1LLDA 4GX5A 3BTVA 4XRRA 3WGOA 4GI2A 3F9IA 4H3VA 1IZ9A 3H6KA 4WOKA 5IN5A 1LQUA 3ZWXA 1S7CA 1P33A 1PX0A 2I6TA 3AK4A 5A5FA 1EMDA 3FWNA 1I0ZA 4TQGA 4Q9NA 2HSDA 2EF1A 2H6EA 3WJAA 3LT0A 4BKPA 1MA0A 4DMLA 3HN2A 1EUDA 2Z1NA 3LT2A 3F47A 4U5QA 5U4QA 4UULA 1ZNQO 4CQMB 5KNLA 2BFAA 4Z9FA 2UUPA 1F14A 3G17A 4BO5A 2FN7A 2GASA 3MJTA 4R3NA 2Q2VA 1GUZA 3JQ6A 5IDXA 1ZKMA 3GZ4A 4FFMA 4BNFA 1R16A 3QW2A 3AM5A 4O5OA 4URFA 1CIVA 4KDEA 4ND3A 1H6AA 5TJ9A 1ISFA 5I7EA 4RDIA 1DJQA 3MEQA 1GV1A 2CVQA 2B37A 3GFGA 3VKUA 3F1LA 3VTFA 4R9RA 3RC9A 1CWUA 3DMYA 1B8PA 1KERA 5CFZA 5COBA 3VPFA 2OMEA 3BTSA 1UDCA 3DR3A 4W9NA 1Y8RB 2VNSA 4MVJA 1GTMA 1OMOA 2YY7A 3NDIA 5GZ6A 1WZIA 3KXDA 1SMKA 1NX6A 3ZDFA 3QWAA 1FK8A 1PGOA 1N1EA 3RU9A 4CM6A 3GVHA 4GX1A 1UXJA 4HXYA 1PZGA 4M55A 3S1LA 3JQ8B 2WDZA 1PS0A 5EN4A 4D46A 3K8ZA 4Y6SA 1X1TA 6ADHA 3K6JA 3BAZA 3RBXA 4G5HA 2O50A 1EZ4A 1ZFNA 2B5WA 4WNIA 4AG3A 4FC7A 4WECA 1E6WA 1K6JA 2Q3EA 4DIOA 1CYDA 5L9AA 2V7PA 3HHPA 2V6GA 1QG6A 1XKQA 3OA0A 1Q7CA 2DBRA 4UVEA 2HJRA 5F5LA 4IQ0A 3O4RA 3RFTA 3W4IA 1IULA 4FFLA 3BYZA 2GUGA 2RH8A 5DCWA 1R0SA 4PN3A 1KY5A 2DC1A 5JCJA 3Q9UA 4GL4A 1NBOA 3AM4A 2FOIA 3EHEA 4YRBA 1K89A 3KBOA 1LXCA 2UUOA 4RL6A 1LDEA 1LSUA 2O3RA 1DO8A 1E92A 2D8AA 5ENVA 3ZCXA 3C85A 4YT8A 4Z9YA 4D43A 1XLTA 4CLRA 3ZWPA 3ENKA 4Z9XA 1IE3A 1Q7GA 4RPGA 3RWBA 2AHRA 4KTTE 1V8BA 2GN6A 1WDMA 3E9MA 4PG5A 4CUJA 4OOEA 3IUSA 3PHJA 1KYQA 3GZNB 1CDOA 4J0EA 2CDBA 3NJ4A 2YFQA 4ITUA 2EKQA 4OQZA 1ENPA 1I2CA 1OZAA 2DT5A 1B15A 2O48X 4CODB 1ZK4A 2ZATA 2V65A 4XGKA 1FXSA 4GVXA 4YRDA 4EW6A 4DWVA 2IEDA 4FGWA 1O8CA 1PL7A 4RCVA 1U8XX 2VOJA 2YV3A 3FSRA 5THQA 2B35A 4ND4A 1NTOA 4EUHA 2X23A 1ISHA 3JQAA 4U6QA 3LT4A 4TZTA 4BOYA 2B0JA 3B70A 1NWHA 3ZWNA 1VJ1A 4CL8A 5LDHA 3L6EA 4R9SA 4IUYA 1RM4A 2UYYA 3S55A 3S2IA 4NK5A 4UAGA 4IDAA 1M75A 2PV7A 3I83A 5KVCA 5JDCA 4LCEA 3G3EA 1DEHA 1E3IA 3O03A 2E6UX 2W98A 4JX8A 1V9LA 1OOEA 4GLLA 5F1PA 5FI5A 4YT5A 3ABIA 5I9LA 4BUCA 4NQZA 3R6DA 4PLYA 5G0TA 4EEXA 1X0VA 2WD7B 5TNXA 3ZNQA 3BA1A 4FFPA 4MOWA 3UCEA 4D41A 2Y1GA 3P2OA 5G4KB 4CPDA 1PGQA 1JKIA 2DTEA 1GQ2A 4E31A 2FP4A 1EE2A 1K3TA 3P19A 3AUAA 3E5MA 3IAHA 2ZQZA 2QRKA 1YRLA 2QG4A 3SEFA 4BHTA 1PL6A 2PZLA 4WCFA 1GZ3A 3GK3A 2OOSA 1DAPA 1E5QA 3IP3A 5CDTA 2EV9A 1I10A 2W2KA 3K5PA 4S3MA 4CMGA 1WXDA 2FWMX 3GOHA 2CSUA 4P4GA 4W9NC 4D3FA 5CDGA 5FEUA 3GEMA 3QWIA 2PD4A 5DBFA 5CG2A 4U0JA 1GYPA 1ADFA 4B3IA 1DHTA 2PK3A 3JQDA 2NTVA 4Q3NA 4YJGB 5EESA 1W73A 1BG6A 1U2DA 4HFMA 5K6AA 3ZW8A 3LC7O 2HMTA 4YAKA 1LC3A 1NR7A 5G0WA 2AQIA 1C1XA 4I08A 4YAIA 3TPCA 3WQSB 4CV0A 2NLOA 3MTGA 3IOYA 1EVJA 3AOEC 4PCVA 3NT4A 1PZHA 2G17A 2VZ9A 4NBTA 3KSUA 3AI2A 4OM8A 2NVWA 2BELA 3HB5X 2DBVO 4FBGA 2PKQP 1ID1A 3QWFA 4J3FA 1VLLA 3HQ4O 4XYMA 4I8XA 3L6DA 3UFXA 3PHIA 2AEFA 4WKGA 1Z6ZA 1HYHA 1H0KA 2V6MA 3A1NA 3RC7A 1I24A 3HG7A 1ZSYA 3CTMA 4EITA 1I3KA 1YDEA 3EK2A 3ZU5A 3V2GA 2WE8A 1YQDA 2HDHA 3BMNA 1P77A 3K30A 3I3OA 4YJHA 3UVEA 5A9RA 1GDHA 3H5AA 4ND2A 4WEOA 4RVUA 1ULSA 5DN9A 1GYRA 1E7SA 4CMAA 4PG8A 1Z74A 1C1XB 1GAEO 4LMRA 1SBYA 2G76A 3K9QO 4RLSA 3GG2A 4ONEA 4PGFA 4D3SA 4YR9A 3WMXA 1ADCA 1FDWA 1YL5A 4OHUA 1E7RA 5KJCA 5HRUA 1BDBA 4A03A 1LEHA 3NRCA 3KSDO 3AUTA 1H2BA 1LDGA 2VWPA 4YWJA 3A14A 3C24A 4PZDA 1Z45A 2Y1EA 2AW5A 5ILGA 3DAFA 3UCFA 1N9GA 3KEOA 2PZKA 4XIJA 4YQYA 3RC2A 1UDBA 3OFSA 1J5PA 3DOOA 3ROKA 1MXFA 4E4YA 1KIFA 1MB4A 2HUNA 2NADA 5A02A 4DL9A 1ZEJA 4DLLA 1YB1A 3VDRA 4DQVA 2NQ8A 3VH4A 4CM3A 1P45A 3JV7A 1A9ZA 3H2ZA 4PLFA 1RYEA 3JSAA 1JDJA 2FZEA 5C7IO 3QVTA 1JA9A 2J5KA 4KUEA 3E9NA 2H63A 1LDNA 4OJNA 1P74A 2WEKA 2VZ0A 1LDMA 4WOJA 4N5NA 3FD8A 1Q0QA 3JQ9A 3NV9A 3A06A 1SNYA 4UVIA 3I4FA 3DHYA 4PFJA 3EUWA 4FD3A 3WOHA 2Y0CA 4KUHA 3LYLA 3GAFA 2IE0A 4NMHA 2AMFA 5ER6A 4UVGA 4XDZA 4ZJUA 5A9SA 5I8WA 4OXKA 3VZPA 1YL6A 5ICSA 1E3LA 2YYYA 1FDSA 3LVFO 4BB6A 5CEJA 2E37A 1NASA 5ITVA 1IPEA 3JYLA 2YHUA 4K9DA 4BV9A 4E30A 2JHGA 2FR1A 2GN9A 3E9QA 4IXWA 3SJ7A 4ID9A 2DM6A 3D4PA 4E13A 4XRGA 4ZQBA 3JQFA 2P4QA 3TQHA 3W8DA 4YCAA 1I3LA 1NHGA 2G5CA 3D3WA 5L51A 3RFVA 3IQDB 4HNGA 4BO7A 4GLOA 1K5HA 5HS4A 1YOVA 3D3WB 1C0KA 3RUHA 4CMKA 4EUFA 3PGXA 5HTOA 1EQ2A 4BS9A 4NZ9A 1EBUA 1IL0A 3L77A 2OORA 2QHXA 5T8KC 1K2WA 2CUKA 3PHGA 1F8GA 3M1AA 1B8VA 3CZRA 1N8KA 4QO7A 1AHIA 1EK6A 3HE3A 1ORRA 1ZIDA 3PHLA 1JVSA 4MVJI 2X5KO 4IM7A 2Q45A 2ZTLA 1HLPA 1ADGA 4ILKA 4RDHA 1Q7BA 2V6FA 3FBGA 4DXHA 3RUFA 4J1TA 3GGOA 4F6CA 1LRJA 1M76A 2NU8A 1EEHA 4JQCA 4L0QA 1DIBA 3JYNA 3L07A 3NT5A 1B3RA 4UEKA 3PYLA 4EDFA 1RYDA 3ITDA 4Q3AA 4CM5A 2ZTVA 3ZWCA 3D4NA 4GWGA 3GZNA 2OO5A 3FTNA 1KVRA 2DTDA 4W82A 4CV2A 2NM0A 3JQAB 3F1KA 1P1JA 2FPGA 4BNVA 3ZNOA 1P0CA 4EJMA 1I33A 2VUSA 2D2IA 4FJ2A 3QE3A 4HX5A 1SAYA 2XPCA 3I52A 5KJFA 1LSOA 4DQUA 1JAYA 2EJWA 1D7OA 3ZV6A 4IDCA 1BW9B 1HDYA 2F00A 3MJSA 5DCYA 1DIGA 3FR7A 4M1QA 4XR4A 5A04A 3JQ7A 1U5AA 1YBAA 3FHLA 2BH9A 2VYNA 3KYDA 3L4SO 3GVPA 3PWZA 4IINA 4OIMA 5T67A 3H7AA 3C1TA 3FR8A 3PLRA 3QV1A 4XYGA 3AJRA 3ZN2A 3O26A 4U6SA 3OIFA 4JIGA 1JTVA 4A10A 3U9LA 5G0SA 1GD1O 3ZWOA 4QTZA 1PR9A 4PLWA 3PXXA 1WDLA 1DDOA 1N7HA 4BMNA 2FZWA 1UZLA 1WNTA 3MJEA 1AUPA 2X8LA 2OZPA 3L0DA 1OAAA 4YB8A 4MPDA 1Q0HA 4CM4B 4GVLA 3MJCA 4NJMA 3EZYA 4YACA 2X0IA 4CLXA 1QV6A 2ZCUA 4J9UE 3TF5A 3TZKA 3DDNA 4NBWA 3ZU2A 3V1YA 2YHIA 3E1KA 5DZSA 4H15A 4PVCA 3FI9A 4DREA 1PU2A 4K28A 3WX0A 4MVJM 4GAEA 3JQEA 3LU1A 1XGKA 2QRJA 4A73A 3H9GA 4QEDA 2EW2A 1B2LA 3TZQA 3VKVA 4NIMA 1ZSNA 1GQYA 1T2FA 1C14A 1G0OA 1XG5A 2YV1A 4L74A 5A1TA 2Q4BA 4MIYA 3KRTA 3TNLA 1I2BA 1HEUA 1SPXA 4ZQHA 4E5NA 3GY0A 1BVRA 3VZRA 1Y5RA 2W4QA 2Y1CA 3R3SA 4IY1A 5EIOA 1U4OA 2AQHA 4AJJA 2J3IA 2FY8A 3AUUA 1PQWA 2HRBA 3F5SA 3IC5A 3KOUA 3UH1A 2IXAA 4DGSA 1U1IA 1FDTA 1ZO8A 3Q3CA 1SCUA 4J2OA 3OIDA 3OJEA 4XJTA 5FF9A 1R4MB 1VL0A 2YZ7A 5ILOA 3PJEA 1BHSA 1E1MA 3TJRA 1JN0A 1YH3A 2JHFA 4P4NA 3HSKA 3M2TA 4TWRA 1DFHA 1U5CA 4D79A 1G0NA 3AUSA 3CMMA 2Y68A 1CEQA 1E1LA 4IQ8A 2BFMA 2JL1A 2YHIB 3ZWAA 1GPDG 4OSOA 5L45A 3L6OO 3UGKA 3V1TC 3WNVA 1E6UA 3IMFA 3K92A 1F0YA 1A9YA 1NPTO 1MP0A 1PZEA 1HLDA 2VWGA 2I3AA 1ML3A 2DU8A 3HFGA 4Y6RA 3ZV4A 3ZHZA 3MCVA 1A27A 4YT2A 1VL8A 4FPXA 2VHYA 1NAIA 1UP6A 3MWDB 4I5GA 1H9AA 4CQMA 1U9JA 3OQ6A 3LSYA 4J1QA 3BHIA 5BSHA 4NBVA 2J8ZA 1LSSA 4WUVA 1F12A 5AXCA 5JCXA 3RIHA 4Q3EA 1DIRA 4XX0A 3QVOA 2E4AA 4MP3A 5AVOA 1E7YA 2GPTA 4RLHA 2Y1DA 1UZMA 2C2XA 3DHNA 3H9QA 3P5SA 4J9VA 2IZ1A 3TZCA 2VHZA 2GN8A 3HADA 5A3JA 1I32A 1EVYA 3SLKA 3WWZA 1ZZEA 1CRWG 5TSDA 3GNQA 4ZICA 1BXGA 2J5QA 3QSGA 4B4VA 3SC6A 3OETA 1QYDA 1YB4A 4ZQGA 2JD1A 3GDGA 2GLXA 3I4CA 1I8TA 1GZ4A 4BO2A 5BQFA 2C0CA 5DP1A 1QLHA 1PIWA 2Y05A 1XELA 1C1DB 4XJSA 4GX2A 3AU8A 2EG9A 4W7HA 5G0UA 3ROPA 4CM8B 3AWDA 4BVAA 3AU9A 4CLOA 3K31A 3WIEA 5C5IA 1LC0A 3UKOA 4R16A 3UW3A 2FHSA 3PP8A 4OXYA 1HDZA 3DQPA 3B6ZA 1WLYA 1GZ6A 5L95A 1ENYA 3JQGB 1XU7A 3E48A 1JW9B 3KZVA 3LF2A 3EW7A 3HDHA 4D0RA 5JSFA 3V2HA 1H2HA 2EP5A 5JCJD 3HJAA 3FCOA 3AY7A 5TIIA 2B5VA 4MVJE 4MKZA 2C2YA 4LISA 3SBOA 1YB5A 4BKRA 5JY6A 1I30A 1XR3A 3I5MA 1YBMA 1I01A 1LRKA 3Q0EA 2ZB3A 5GZ3A 1UAGA 2Y93A 3O38A 4FS3A 1ZEMA 4U8GA 1HSZA 2PD6A 2A92A 5IFLA 3GGGA 3NGLA 2ZK7A 1DHRA 2Q1WA 4M89A 2QX7A 3HNPA 4LW8A 4CM8A 1E7QA 4S1VA 3ZHBA 4OQYA 3ANMA 4NH4A 5L4NA 2DPGA 4FFNA 4B7XA 2H9IA 1TLTA 4UVHA 4ALNA 3IL2A 2ZKLA 1V3UA 4MVJD 5KJEA 2JD0A 2BHLA 1LLQA 3V8BA 5F1OA 2VHXA 1P1FA 2IDZA 3DBLB 3PZBA 1LTHR 5TGDA 4OL9A 1T1SA 1TT7A 3GHYA 3ORFA 1Q0LA 4GMFA 4KZPA 3V5NA 1U4SA 1VKNA 4MO2A 5H82A 1QV7A 4BO3A 3T7CA 1UXIA 2NU7A 4F46A 4BIIA 1ISJA 4MP6A 4CR6A 5A4DA 3PVZA 2ZTUA 4R4JA 1D1SA 1DSSG 3KHUA 4JP3A 1A72A 1LSJA 2O7SA 3D4OA 1T1RA 4BNXA 4CV1A 3GMSA 1NFQA 2VRBA 2TMGA 1A4IA 3INGA 3KUXA 1CERA 2VTDA 1VC2A 1JQBA 4M8SA 3MZ0A 1HRDA
chains in the Genus database with same CATH superfamily
4X92A 4BE9A 1G2QA 3BFKA 2DUMA 2VPZA 4TZKA 3WDKA 5A4AA 3BJEA 2VWQA 1WMFA 4I1OA 3A1FA 3AILA 4EY8A 1XHFA 3TKYA 2QT9A 3K9GA 2G4LA 3KLMX 3Q5EA 4P0TA 1A9XB 4QGFA 3ZZ1A 4EHNA 1W44A 1RPNA 2Q3HA 3NXSA 2O8EB 2H16A 3E53A 4QELA 3GDOA 1HNWB 1UAYA 1NF9A 3KVNA 4OCZA 3T4EA 3PDUA 4DZTA 2Q07A 3FF4A 1EDEA 2PLAA 2VBIA 5CDFE 5EWMB 4OQFA 2Z1MA 4MQ6A 5LQUA 3MT7A 1YI1A 4O0LA 4RXTA 3OE5A 5I7RA 3IPYA 1JVBA 3O9ZA 3H9EO 1C4XA 3Q7TA 5D7BA 1Q91A 5DPMA 2WHPB 3ZXIA 2CV2A 3RRJA 2HRZA 2J1LA 1JF8A 3NM5A 1Z7WA 3FPLA 2YOGA 2W58A 3I2KA 2VPTA 2ZYAA 4EA7A 3IIJA 2OFOA 2A5GA 5G3ZA 1T0PA 2ZB4A 4U7GA 5B3JC 3MGKA 3ZE6A 1GKYA 3GCWA 3Q7PA 4HDNA 2X5NA 3ETEA 1G1AA 1TEHA 2J9RA 3UJNA 3VHXB 1M8KA 3O2JA 5BRAA 1S8OA 2WKPA 5D6NA 1M7HA 3ZWDA 4CGZA 2N47A 2Z6UA 4FSHA 4QBTA 2HHAA 3PVCA 4FQ8A 4F9FA 3K9NA 3QJ5A 4OHXA 4YRQA 3HFSA 3N8DA 1GV0A 4RLQA 3QTBA 2HAEA 2NNLD 5F1YA 4H3HB 3TL3A 4H7PA 2ZE6A 5KYWB 5GIOE 4LJKA 3WLSA 3CH7A 1P6UA 1AQNA 1H42A 3RFCA 1N57A 1RTTA 3WGTA 5HX7A 2ZBEA 3SJBA 2G07A 2BGJA 4UTPA 2ACEA 4XIGS 5A03A 4BO9A 2W6JD 4DRYA 5P21A 1J2TA 1FRVA 2G4VA 1I3MA 1R5BA 2R8XA 1JX6A 3HXLA 4N3BA 4RHTA 1UBMS 2Q5QA 4L9SA 1FNDA 2AL7A 3E9EA 5LQMA 5EUQB 4OKIA 3GLTA 1TA9A 2VUUA 3A32A 2VJPA 4GIBA 3PGA1 4QE3A 3QHQA 1Y98A 1KDYA 1ZGHA 4O3MA 3ZIDA 1KAMA 3OM9A 2JGKA 4HNHA 1Z3IX 2YL2A 2AI3A 2JFNA 3EC1A 2II6A 5FV7A 5CB6A 5ARCA 3U4HA 2DHEA 1FOEB 5DX8A 3EFOB 4WGFA 1OI2A 3LGAA 5JU6A 1FFAA 1ISMA 4PNHA 2RONA 4ZQFA 2QZ9A 1VI6A 3DOCA 5ICFA 3QHPA 4EDHA 4JDPA 4B6PA 2NWQA 3DPSA 1YMVA 4GHWA 3I04M 4TQUS 4EKEA 3I1YA 2BZSA 1IY9A 2K87A 2ZYVX 4IOJA 4Z8YA 1H8HD 5IAKA 1VKOA 1CB0A 4R3UC 1Z7BA 3FPFA 4KRXA 1ZNWA 4QXMA 4FS8A 1BX0A 2X14A 1HSOA 1BTOA 1RM5A 5FL7D 4RVSA 5CXSA 1KC1A 4XB6B 4CMHA 2RH9B 1MIOA 1TQ6A 3A6ZA 1A96A 4LZLA 3G8AA 3LPLA 1U3DA 5IDQA 1PNRA 4BRZA 1T25A 3LP5A 1WCV1 4LGCA 3RIGA 1YDFA 2ODQA 4OMUA 3BMNB 5B4UA 2BKVA 4EDFA 1P7VA 1X3SA 3IUQA 3SX2A 3U56A 1DV1A 4K9RA 4F56A 1CUZA 1YFZA 1LNQA 3AL2A 3OPYI 4LXYA 1KSJA 3C16C 4U2EA 2WB2A 1R9GA 2GRUA 2HCBA 3BXHA 2D00A 4NKRA 1EWQA 1E66A 1MFPA 4Y1RA 4KYUA 4ZOEA 4EGFA 2NX2A 5FI1B 3TJZA 2FR8A 2J3LA 3QY0A 5ALIA 4GYWA 2XWJI 3GT7A 4L02A 3K9HA 4M0PA 4UMDA 4GI1A 4BWYA 3QLTA 3UXHA 4Y2PA 4E7PA 1I5RA 1NKVA 3FOWA 3AT1A 1Y6JA 2A4KA 5EFOA 1Q77A 2VVTA 5AUPB 2I6SA 1EP3B 1KDOA 2X4DA 3OLYA 3P4XA 2K5UA 4ITVA 2B7LA 4KGXA 4G1UC 2O0KA 4G0MA 5EP1A 3RGGA 4DMRA 5A9SB 5B3AA 1RKQA 1WZNA 4BQRA 2FE4A 2I1WA 5DHRA 3GLRA 5IAAA 5CAEA 2CMGA 2GBIA 1IHYA 2Z43A 4ZOLA 2P8SA 2D4AA 5T4EA 1YAHA 4Q4JB 4DLXA 2A1TS 1FX1A 4D0SA 2VQDA 4XM0A 2O54A 5CX4A 1OTXA 3FKSD 4XKJA 3WZMA 4RWEA 3UAOA 1W5SA 1EA7A 4CLRB 5BOSB 5CITA 5AK3A 1PHPA 2P9GA 4MUKA 4PY2A 1NTRA 4LSMA 1J56A 1VLVA 1YZYA 2B7BA 4OJKA 2Y71A 5IDWA 3Q15C 5EC8A 1N2EA 5LYJA 2OXFA 3NNSA 3DONA 4UEJA 3PDIB 1D09A 1ZW6A 5JV5A 3FZEA 1J09A 2B4TO 2WAOA 1RLOA 4JCOA 3DMDA 4ND7A 4Y1RB 2J3MA 3M5DA 2O23A 1QKIA 1RT9A 2R79A 2VT3A 1NW6A 3DO8A 3GW8A 2HXYA 2F4VB 3STTA 3KKNA 3VJRA 1L0BA 2N46A 4JA0A 1AB6A 2Z2XA 1Z5VA 3MW8A 5KINB 4J0FA 4FR5A 4A2CA 4YRNA 3WBKA 3OIGA 3G0BA 3N7TA 1CUHA 1KH1A 1IN6A 1U28A 2XZPA 4QXQA 1UJNA 1B7GO 4JGIA 4HV4A 2W2NA 3H4TA 2QZSA 2FW6A 2G71A 4ENVA 3ZY2A 1THGA 1FYWA 4M60A 3H18A 5ITWA 5KTOA 2FPPA 1G8YA 3HO8A 1EG2A 3E35A 3ET4A 5DM2A 4JBYA 4KUGA 1WMEA 3VH3A 1E5LA 2FWRA 2OQ2A 3EG5A 1JSXA 3FTCA 1RXYA 1MJHA 1GADO 3A0UA 4IJVA 3NOQA 4DRZA 4BO0A 4RMGA 1NUSA 3LIIA 1WP9A 2XA1A 4EQZA 3KLNA 2D54A 4ZQCB 1GCOA 1QGAA 1VYUA 4C4XA 5GIPE 5COAA 2BM1A 4LHXA 1ZRMA 2Q8QA 3EXAA 3ZLBA 2YKGA 2BGMA 2H2HA 4C07A 3ON5A 2PKEA 1UPAA 3E03A 3D7KA 4RAOA 3OY7A 3H87A 2NZXA 3PFKA 3QEJA 1SULA 4FYPA 3ZGYA 4HX2A 4LJRA 4YDRA 4EVRA 3CF6R 4U7JA 3VR5A 2H1SA 3VH2A 2O1SA 1XSEA 3DLAA 3QUCA 4P93A 4E3WA 1OZHA 3ICQB 3EEOA 1NWCA 1PFYA 4RL4A 3UC5A 4E5KA 3ZU3A 5JMWA 4BLSA 2O8BB 4R8MA 3UICA 3OZEA 4J3JA 4C0XA 3WLEA 1M10A 1AF4A 2YJGA 4I99A 1QHIA 5ADHA 1NW9B 4WLEA 4BTEA 1EU1A 3O90A 2FMHA 1QR6A 3H9UA 5IKMA 2BFBA 1Z8HA 1XWFA 4EWLA 1G3IA 3AKZA 3A05A 3AEUA 1S2IA 4PC3A 4HVLA 2I3GA 3O6VA 4A36A 1DKOA 1I14A 3G0IA 3Q6IA 5BW4A 5FI3A 3X44A 4D6YA 3ZUPA 4QQFA 4MK4A 3NC1C 2FPSA 3P2MA 1DAKA 5SZJA 1UPBA 2VSXA 4ZVSA 5BUQA 4GOKA 3EJ6A 1P3JA 1A97A 1YGYA 3ICEA 4MAAA 2X4GA 1X9HA 2HA3A 3CT4A 4HBZA 4O08A 4XPZA 4EY4A 5KX5A 3AF0A 1X74A 5CDUA 1HFEL 4FJ1A 3MLAA 1IB6A 3UN1A 3E05A 2HA4A 4HYTA 3LI2A 3WK7A 2X5OA 1KS2A 4B3JA 1O94A 2C2ZA 3A3PA 1WW8A 3L8GA 4FYMA 3NVMB 5E1MA 2VDOB 2Y9PB 2VYCA 1N92A 3A0RB 3QPBA 1KOLA 1NG9A 3DKPA 3W4KA 2HEGA 4DC0A 4DILA 3IKTA 1RRVA 2NXWA 1QYWA 2MWMA 1V26A 4I4TA 1NI4A 3JAKB 5J1SB 4GOMD 4M38A 3PTZA 2HCFA 3N6XA 4ZC8A 1Q16A 4TVBA 3U3DA 2OHXA 1SCAA 1T24A 3VC7A 4PX3A 3VPGA 2RGBA 3R2JA 1KP2A 1LCIA 2JCXA 2PZJA 4M53A 2RHBA 4IH1A 4MVJG 3ZV3A 4CIXA 4D0NA 2ZM5A 4ZRMA 2YWDA 3JPYA 4JKOA 3T4XA 2G1JA 1FLNA 2H1WA 1HLFA 4BP1A 1C9NA 1ZY2A 2NU6A 3OIYA 4B3MB 3G8CA 4ARAA 1DBSA 5G3YA 5AI6A 2KX7A 2FPIA 3ZWYA 4OGWA 4MYDA 2EQAA 3M6WA 1NATA 2C1ZA 1Z2OX 4WK6A 3UPUA 2Z2KA 1TJ4A 3CINA 2JJ8A 1EK2A 4ZYYA 7MHTA 3SOZA 1UJ4A 3EGEA 3G49A 3I2FA 4X20B 2CD7A 3KM0A 1T2UA 2ZWMA 4PS1A 3PI7A 5KX5B 1WCIA 2VF5X 1T9BA 3B1VA 4Z4CA 1RJGA 4MVJF 1FP2A 5DI3B 1R6XA 2IOQA 3CRZA 1GFSA 1NAHA 3KB6A 4PRLA 2IFTA 3PUWA 2ZR8A 4HLNA 5EQJB 1CY0A 3IAM1 3CKKA 2BFCA 2QZPA 4Z0PA 2VWHA 3R0XA 2EFCB 4OHKA 3TTTA 1KO1A 1W96A 5AW9A 3SZ3A 4QD3A 3SM9A 4WLOA 5JO0A 4RTRA 1F8YA 3S7ZA 2H06A 1NR1A 3FG9A 3MVEA 2L82A 2QLNA 2YZMA 1H5NA 3ZQKA 2WF7A 2ZYGA 1KR5A 1KFCB 2ZI7A 1LI4A 2PZMA 3JQ9C 4UHBA 2R4TA 3W9SA 4EY6A 2HSWA 3BWMA 3FYSA 4PLVA 4Q19A 3W6PA 3T9EA 5KVVA 4LHYA 1AURA 1GAWA 1EJ2A 3M5PA 2IEBA 2Y0PA 2J9FA 4U9UA 1MT0A 1H8ED 1VTKA 3O9VA 2YRWA 1ZKDA 5HQ3A 2PR7A 1QGZA 3KWLA 3S1AB 3U48A 4OHWA 1X8JA 2MHCA 1NDQA 1NVVR 1WD5A 3PCTA 1AGXA 3P9CA 3ZHSA 2YQZA 4XJXA 4F4IA 1YOBA 2AF4C 3ZQJA 4LJSA 1JBEA 4RMJA 2H2DA 3FBTA 1V1JA 4XUEA 5ALDA 3WK4A 4DDVA 4J29A 3PQEA 2ODEA 3BULA 2PGIA 4PQFA 4UTZA 3WR5A 5F9HA 1V16A 1QUFA 4HWPA 4P98A 2AQKA 4WY2A 3T1VA 3TSWA 1OASA 1OV4A 3FNHA 4X6XA 5ECDA 4ZVKA 3IIMA 2IW1A 1KK0A 2ON6A 1HDOA 1NZFA 4R3WA 2JASA 5AYVA 2X0DA 4NMXB 6REQB 2VAWA 4M86A 2ZPAA 1K4YA 4NFSA 3ROXA 1W2GA 3SN6A 5EERA 3ENQA 4DCCA 1Q17A 2IHVA 1QOPB 4DJJA 4F5ZA 3J81k 4XVRA 3CZMA 4E2ZA 3U0VA 4ZAWA 5HUHA 2HBZA 1IOZA 4AULA 1RRGA 3K09C 1SUDA 3VPHA 2C94A 5BN4A 5KTMA 1V9SA 2MSNA 3GN2A 2G5PA 1QLJA 3DEHA 2LTAA 2MMCA 3U19A 4HR7A 1P5ZB 4KO8A 5DN6D 5MHTA 1G66A 2GF0A 4D4GA 1N5IA 2OP0A 3MFYA 4KKXB 1JFLA 1MN6A 3TSCA 1MD9A 1PI3A 4N40A 1AVTA 3EC2A 3GYBA 2YUTA 3PJFA 4C78A 4E12A 3WFJA 4KTVE 5H3CA 4LGVA 3THYA 3HO1A 2O2ZA 3C6KA 4OB8A 4IDGA 4PPYA 3PTLA 4EUEA 5K0JA 2W6CX 3OJOA 4JT9A 4YWHA 1DIHA 3DHWC 2D7JA 1T4GA 2FLWA 4MWZA 1SBZA 5C3MA 3HB4X 1I7SB 4NOMA 3C4VA 4DV3B 3TVTA 1W4RA 2NTNA 1U7OA 5DYWA 3K6SB 4FI3C 2CWDA 1U6JA 5BV2P 1FNMA 2NTYC 2Q1UA 3DGEC 1WAMA 4GMHA 3KSRA 2YXLA 3NHMA 4CF6A 1DV2A 1NRIA 1JPNA 2R66A 1V71A 2CVPA 4UUOA 1HH4A 1OGIA 3UQZA 3PICA 4G37A 5JQWA 1RQLA 5K0NA 4RGBA 1T6YA 2VNAA 2I1QA 2VH2A 5KWEA 2WU0A 3HEMA 3V1MA 4LJAA 2KWIA 3Q3HA 5ED0A 5F2OA 5DM60 2IPOA 3WKBA 1CRLA 4C9BA 2PA0A 3IQIX 4AIRA 4Z7NB 4FIZA 4ZOBA 3LCVB 2V58A 3U13A 1R9JA 5C3UA 1LF5A 2IZ7A 3NP9A 3TL6A 1QGUA 1CZLA 2J6IA 4L16A 1T2CA 5J5CA 3TQTA 2ID4A 5KREA 1CHDA 2AZTA 2ODBA 3HKCA 1YZUA 2R8EA 5JBQA 4YN3A 1U1DA 4M8NE 4FGLA 4XXHA 5ANRB 3EMKA 3UF0A 5CEFA 1G7SA 1E96A 2PV0A 3FOBA 3QJYA 1L4NA 3L5OA 4PC6A 1DG1G 5DNYB 4AP5A 5BQPA 1FF9A 1R9NA 1DC8A 4WH0A 5DNAA 5G4LA 3T61A 4I9UA 5L3SB 3K71B 3HP7A 1NW4A 4O4JB 2D1YA 1PR3A 3MUEA 1O95A 4EQ6A 3JWEA 3DVQX 4FJ0A 4JBGA 2XYVA 3O4FA 4DDMA 1Z2AA 1JLLA 3RASA 3CVVA 1YR6A 4FMCB 2B30A 5DJ5A 1IWPB 3BEOA 1GNSA 5IARA 3WB1A 2J3KA 3LRPA 5TPWB 3NX4A 4BVEA 1LQ2A 3AV3A 3SQDA 4YAFA 4MCAA 1N78A 4TLEA 1XZIA 2D7CA 5IP5A 3UGJA 3D5TA 2NUAB 2IF2A 2EBWA 4EARA 1AGYA 2HK6A 2J7PA 3LNCA 5ALRA 3UJ3X 3VGJA 4N0DA 4EF6A 4MNTA 4HLUA 1OIVA 4TVOA 5DTQA 1Z34A 1J8VA 3C8HA 2O3UA 2YHAA 4GNRA 4M0CA 4B85A 4JK3A 3KEGA 1V7CA 1Z7YA 5F2KA 1QQTA 3DD5A 4AB1A 2GCOB 2IK8A 3LD9A 3NBXX 1AOXA 4C0BA 1A5BB 1U1EA 2VRCD 4OMFG 1XMXA 4HH1A 5K4AA 3QVMA 4HEA1 1WMDA 4F4JA 2ZJ1A 2ECOA 2VDWB 2YZGA 4V1CA 3DLHA 3L7MA 1D2AA 3O74A 3K0HA 4QODA 3U80A 1R6UA 3NVAA 4MEJA 1N9GB 1DBWA 2W6QA 2F67A 3BQMB 2C03A 4ZQEA 1G20E 4BLVA 4LBYA 5C1PA 5T7BA 1VBMA 2Q0HA 3S99A 5IJZA 3LBYA 4GRAA 1ECGA 1P1BA 1U1GA 1O4WA 5JECA 2R4UA 3DZFA 2YIDA 5E3IA 4BMVA 1B6RA 4B74A 1DRUA 4WACA 3WNDA 5KC8A 4R5HA 1OAKA 4ND8B 1N5DA 4R05A 3W5DA 2XIJA 3B5EA 3L3BA 5GV8A 1FFYA 2JHPA 2HL6A 1YO6A 3GFFA 4AKTA 1TTHA 2W2LA 5FBWB 5E1DA 2JLYA 1GP2A 3N74A 2NUAA 5L3VA 1LDYA 4J2HA 1C3VA 2C5HA 4QLAA 3KEQA 1H1LB 1QAQA 2ZETA 1LLUA 3M1LA 5GVSA 4P3KA 2ID9A 2GXSA 3DS8A 1H6DA 2QSZA 1VE5A 2V7XA 2ZBVA 3K35A 3KG2A 5EP2A 4C0HA 1WXIA 1M34A 3JQCA 5FOQA 3HWWA 2J0EA 4IO0A 4MINA 5CNIA 4ZVRA 4QYMA 3DC7A 1N6LA 2OFXA 1XQVA 2VCYA 3BILA 4C2AA 4JA2A 4TRNA 1P0FA 2OGUA 5AW8A 5JDIC 2F3PA 3N2YA 1RYZA 3L7BA 4LRXA 1ZNZA 2LDBA 1E32A 1F38A 3EDMA 3N0XA 4UBNA 2O1EA 5K8IA 3VHRA 4EABA 2A1UA 1E2QA 1BCSA 4YAJA 4EFMA 3RV3A 2QU7A 1U2GA 4F9EA 3NNNA 1MUUA 1SWWA 5CB4A 3DMTA 1NT2A 1EGAA 4I5DA 2O7NA 2ZXFA 3E7XA 5CJPA 4C4AA 1E2GA 2AGVA 3KBBA 3RCBA 4BVGA 5ITSA 2GTIA 5LNK6 1G3QA 1CY1A 5HKOA 3Q5DA 3UJAA 3HR4A 3LCUA 4P54A 4UEOA 2E4YA 3QH4A 5B2FA 1G5HA 3LE8A 4ENQA 4Z7OB 2Q1SA 4OHCA 4UEWA 1NHWA 2IL1A 1P0MA 3ITEA 5AK5A 5E9JA 5EZYA 4YCCA 4E4TA 4ZZ1A 3THYB 2D1SA 3PFNA 4Q48A 4WZAE 5EHIA 5EZ5A 1BCRB 4YJHB 4NYJQ 2QORA 5CGQB 3LUAA 1AGPA 2FPLA 2ACKA 5C1DA 4E2XA 1DX9A 1QYVA 2HI0A 1Z2DA 4WJZA 1S8NA 1W94A 3IT1A 4TXJA 5E4YA 3E8XA 2JRLA 3D5QA 5D86A 5FTNA 2UVPA 1BHJA 3SHFA 2GCIA 8ADHA 1ND6A 1TTTA 2GO7A 2GRJA 1ZCZA 3BHMA 3PE6A 4NARA 2B21A 4QIHA 5LOVB 4OBXA 3NPAA 3IEKA 3TECE 2H57A 5IZ4A 1SXJA 4PSUA 5IS2A 2KE5A 3I30X 1E94E 3W1VA 2OCYC 3A3YA 3OMLA 5CCDA 3T9CA 3LDAA 4ERNA 1YBFA 3ZLJA 3M70A 3B1JA 2XODA 3WWEA 4OYLA 5K05A 1OZFA 2RGNA 4RCZA 3EY4A 4QICA 1NNLA 2VYND 2WZQA 4GSLA 2CCKA 1B41A 5CVDA 4ZCIA 5LMUB 3JVVA 1KAOA 1WXFA 5JYDA 3ER8A 2OG2A 3IDQA 1P3DA 3FFTA 3ANLA 4CM9D 2WVGA 3KB2A 1P29A 4MWGA 1FFXB 2PD3A 2XMSA 1N6PA 3WO0A 4AQYB 1NT4A 4Y6PA 4TMYA 1Y3CE 4AYXA 3N05A 3Q0TA 2KI5A 2VNKA 3EXIA 1OROA 3W79A 1NRJB 2IIVA 3DMFA 4LZJA 1OAOC 1R9MA 2A5YB 2B0CA 3ORHA 4CMBA 4MS3A 2DOKA 4O63O 3SE0A 2XMQA 5IVIA 4D8WA 4ARBA 3HC7A 4I1RA 5LIPA 1W36C 5E4JA 3PF9A 1KDVA 2WPNA 2LE0A 3UMGA 4OGGA 2O6LA 3IVCA 3QRWA 2J3DA 4XFKA 5A06A 3KD2A 3RBVA 1LJLA 3CN7A 1JIJA 4MUAA 1USVA 2A88A 3C7CB 4QFBA 4RKWA 4DMFA 4RJJA 4YR7A 5LOVA 1EXMA 2DUWA 1XJWA 3DNMA 4XYEA 4B46A 2BPOA 3QPCA 4QBFA 2BKAA 4C14A 3ZHVA 3DJFA 4E2FA 1G18A 1WXGA 2BFEB 3U39A 2HNKA 5HOQA 4O1MA 4Z9BA 3FGPA 2V0CA 1KMNA 2AYYA 4GBJA 2WM8A 4KMSA 4PO1A 3FSGA 3GJXC 3B51X 4FFWA 5IAEA 4C88A 4NAVA 1O9BA 3V97A 4R0VA 4RE6A 3UANA 2Y76A 4JP1A 4UTNA 1T3SA 1Z28A 3RS2A 1RM0A 5IMSA 3G6WA 4BKQA 3QPUA 2FZVA 2JIOA 3U3ZA 6CHYA 2GKSA 3A1WA 3F6PA 2EJBA 3EYAA 4FOSA 4CCAA 3PNKA 1G19A 1H69A 5EMNA 4CMEC 4L73A 3ZDBA 1JYEA 2Y66A 3LUKA 1P61B 4OBEA 4S35A 1TZKA 5EJIA 3ZBPA 5KTRA 1D0SA 2ZIFA 4FYYA 5EEGA 4GOXA 4ECEA 3P2YA 4X60A 5ICGA 5DNUA 3KKZA 3QU2A 4IVNA 4BFXA 2AE2A 2F62A 4LX0A 4PG7A 2O8FA 1H5QA 2BSXA 3T3DA 4AMVA 3V7NA 3GLIB 1WB4A 1YQGA 1HO3A 1TK3A 2LXNA 4RA9A 4HP8A 4QDTA 1FRFS 221PA 1OVGA 1SBHA 3OJCA 4LQLA 4QVGA 4FYXA 4YI3A 5EJ2A 3RARA 5HGXA 4KFCA 1FFGA 3M6MD 1XXHA 3RK0A 1RRMA 4IDEA 4K5QA 1NPDA 1DC3A 4JJZA 4QXPA 2DHDA 3MS2A 2ZB8A 3PI6A 5JVDA 3SD7A 1JPJA 4YLYA 1JHXA 4HNQA 1XP8A 1H1LA 4NRDA 2VT6A 3NTUA 4XWYA 5LXTF 3SJAA 1KOGA 3AL0C 1NL3A 4KFUA 2D3WA 5HCUA 5B37A 1S02A 1YZGA 2H4HA 3B60A 3ITKA 4XB2A 1AMOA 2ZSEA 2CV1A 3LTNC 5MGBA 4CT4B 4PRYA 5EQDA 3MERA 1T9AA 4IO1A 1NBHA 3N2LA 4X1OA 4B4WA 5H1YA 2KBFA 1KIMA 4JT2A 3ZD7A 3HMKA 1SOMA 4N47A 4PINA 3AESB 3UGTA 4CEIA 1Q0SA 1CZOA 4WBXC 2MSEB 4ZARA 1L5SA 1WJGA 3BVPA 2VH5R 4RKRA 1SXQA 3ZWQA 2CYCA 4AJOA 3R6LA 3GAZA 4PIMA 5AH0A 4WASA 5IVDA 4ILEA 3C3JA 4QG7A 4YRCA 3GARA 4R7GA 2R5WA 1Z4KA 3OF2A 4I1PA 1RWPA 1B6SA 1HTBA 4MVJH 2Q5FA 1YE3A 3PBKA 3U62A 4U2KA 1IZYA 1IRXA 1DBRA 5HILA 1OFHA 3UHPA 2AG0A 2UXDB 2FLVA 4RA9B 4G9BA 2EWMA 3R23A 2ZRNA 4IMRA 4YJDA 3NWJA 3O8LA 5PGMA 4OHBA 4DSTA 2VDKB 4DJTA 4F5DA 1JSLA 4B4UA 1NQAO 5DF1A 2F6RA 5BN3A 3EGXB 3BEDA 3FZYA 3L2OB 4J6FA 3V4SA 3O95A 5D00A 4YJGA 3MMSA 1A76A 2XOKA 5K20A 4DR7B 3U26A 3P8ZA 2RHLA 3OTHA 1XJQA 4MW6A 3WYCA 2C5FA 4UQOA 1KPIA 2IYRA 1RQ7A 4G1FA 4YJ2F 4E07A 2ZUCA 4XGNA 3DD1A 5BORA 4JBIA 4QUJA 2L0XA 2XCRB 3KQLA 5C7LO 4X97A 5F3RA 3SJZA 2EKPA 5B1DA 3KYCA 2EJUA 4ASUA 5K4GA 2E48A 2QRNA 5GMOA 4H6WA 4N76A 2NZVG 3L5KA 3M49A 5DT2A 3IPRA 2SCUA 2WJHA 3H2BA 4RQAA 3AF1A 2FWIA 2G09A 5JYCA 5A9TA 3DWFA 4YJFB 3TW8A 3M9WA 1DXYA 1QG2A 1ZMOA 3OCUA 4MUYA 2HC9A 4JLWA 4ZAXA 3IJRA 3I6ZA 2ANBA 4MYCA 4HNSA 1IAVA 3AV0B 1CETA 3R74A 2Z6VA 2GCGA 4J7XA 2CCJA 2J4FA 4AJLA 1HOXA 1S5PA 4A8JC 3M82A 2B4QA 1KGDA 5DCUA 2Q4RA 1X7YB 2RAVA 2Q3FA 2VHWA 3I0MA 2VDWA 3Q7IA 4HAWA 4V1CB 1A3CA 2BF7A 4MWBA 4D9CA 1ZVVA 1Y81A 5FOSA 1M1NB 2AR7A 3C3WA 5LUBA 3KVRA 2EAUA 4QECA 3X2FA 5KTKA 1JTEA 3OE1A 1BOOA 4Q34A 1OUMA 4FBLA 1M72A 1ZNYA 4BBJA 1O96A 1EFCA 4DUYB 1QFSA 3AONB 1EVEA 3IP8A 4EKGA 2OHFA 2YRFA 4HC4A 1B14A 3VHQA 1QBKC 3R7AA 1MO4A 1V9CA 2C9DA 1YJAA 2DKFA 3P0IA 4UUNA 1AU9A 2JI4A 4HDOB 4U9IS 5J58A 3RYCB 1JA1A 3PNMA 4EYGA 2ERXA 4FHCA 3O8NA 4MW2A 3OP1A 3KCQA 5KYYB 1JG6A 1YU6A 3VR4H 2I91A 4C6TB 4FFDA 2V1UA 3AFNA 3TXYA 2OHOA 1XCLA 2DB3A 2AC4A 1PUIA 4Y1GA 1P1CA 4WBNA 1HDEA 3GJTA 1UQTA 1PEAA 4XWAA 4NDNE 4MJ7A 4RIFA 4C06A 1EGHA 3TLKA 5KB3A 4QM7A 2XDAA 3FH0A 2NZYA 4G9GA 3OCVA 3WADA 2O05A 1ZUIA 2QL9A 1QO7A 5ES3A 3T7EA 2G40A 5DM1A 4IRMA 4F11A 4QOFA 3T3EA 5EIBC 3QFSA 4M7WA 5H5JA 3KU1A 1KI2A 3MRSA 4N12A 4Q1VA 2JS7A 4DBLC 5KZMB 3UK6A 5KNCA 3VGPA 4FHGA 1XAIA 2Y1OA 1FNNA 3QMWA 1K4KA 4GKVA 2QMQA 4J1TC 2AEMA 5AVZA 4JEIA 3PQ7A 4QJ4A 5IJXA 4UUAA 4HB2A 2FEOA 4FT2A 2VATA 5ECGC 4V2IA 3ZV7A 2WMDA 2WKQA 2ES4A 1SZPA 2IX9A 3REQA 2QMYA 3ED5A 2GD1O 1VMAA 4ID3A 3SKXA 1WB5A 5HQJA 2YMQA 4M36A 1P2UA 4Z5XA 1QMGA 1CULC 3OM0A 4AN1A 3OPNA 4BZWA 1L8QA 2WICA 3OKAA 2AJDA 1GPH1 3FYUA 2ZRAA 4QU5A 5A6SB 4G86A 3A3KA 1FW6A 3UIEA 1NSYA 1WPXA 4M54A 1N6NA 4DVGA 5K9ZA 2Z95A 5IRCD 1VGRA 3LLCA 1E9CA 1SHKA 1Y3IA 2GJ8A 1D7AA 3MWJA 1LTKA 1RW4A 3CUSA 4EA8A 1RKXA 1MLDA 2C0PA 3BJMA 3QNWA 4X7RA 2EGHA 3DHEA 3DZKA 1FYFA 4OATA 5KVSA 3CLUD 1IXZA 3IA7A 2HSJA 2V4UA 2W0SA 1AKYA 3VSDA 4DB2A 2Q99A 5K3SA 2Q6KA 2RHOA 2XMGA 4TS9A 3TFWA 2OCGA 1MA3A 3ER6A 4RPIA 2IU0A 3V2UA 1P2VA 1L9KA 5CIYA 3M8KA 2P90A 3BGOS 2WNIA 3RFUA 1EM6A 2PKQO 5D01A 3MF4A 1KVQA 3MIZA 4BP8A 5LBTA 4AUKA 5KU1A 1IZ7A 3CNBA 3EYWA 1FDVA 4PTLA 4X24A 5FBZA 3VKFA 4BWGA 2AN9A 1R4NB 4C7VA 2Q8PA 3CH6A 2QNRA 1Z5GA 3A1EA 1OF1A 5LB4A 4CKYA 4CR8A 5C35A 3EGXA 4X1KA 4ZCMA 3EGOA 1QZTA 3GL9A 4IKEA 5KQSA 4XCQA 5CDHA 2WWRA 3GEIA 3PG5A 3KLPX 5LKRA 4HSEA 5BNIA 2DQKA 1RU3A 1WZEA 2F9MA 3L79A 3QU4A 3PRYA 4M1OA 4BNGA 2GF2A 1YS4A 5DHUA 2WHXA 3R4CA 2Z3ZA 2XVZA 4EA6A 4D3DA 4D9MA 3WGYA 2VSYA 4PR3A 3L06A 3R3ZA 3T3OA 2P78A 3LHKA 1JT9A 3SZUA 4E94A 4MGEA 1X1DA 1T35A 1YQUA 2YJ4A 4GE0A 2HK8A 4HCJA 1V48A 3G5UA 3ND7A 4LQ4A 1OT5A 2AFIE 3A2KA 4ZAZA 1P9NA 1KE2A 2Q3LA 2XUKA 3K05A 3N2KB 4YRAA 1S4MA 3RT7A 2DPLA 4FWIB 3TO5A 4YV7A 4ND1A 4RYDA 1LWNA 2JLRA 4MJXA 3E23A 3ZC3A 3OICA 4ZCRA 3BMCB 1FMLA 4B7AA 2VDPB 1RJWA 3PJDA 2VP0A 4L7QA 3I61A 1HT0A 5EHXA 1XQXA 1ZW1A 2IV2X 3EOBI 1GHTA 3HYTA 3U6KA 2CMFA 1RR6A 3KQVA 5CDYA 1STOA 5SZKB 3RT1A 5K0TA 1T8RA 1BDMA 2X8BA 1U7PA 3CX7A 3D1VA 3H2KA 3PPYA 1GR1A 3DV0A 4YUAA 4TROA 5C9ZA 3JWJA 4NHOA 1E9SA 5TQ2A 1T1EA 3QM1A 1PR5A 5B58T 5LC1A 3SQNA 3TLYA 1COWD 3UJBA 5CDSA 5DWDA 2A30A 3REFA 3GEPA 1Q1ZA 5HJ7A 3A9CA 1C7QA 2EGGA 3HB1A 3VOBA 4A8PA 2P9CA 4BP9A 3H9JA 4ZO4A 1LDBA 2DPYA 3FGZA 3GLIA 3G0HA 4URVR 5ICMA 1VFNA 2Y99A 3K20A 5J2UF 5HE8A 1C9JA 2EIXA 4LI3X 4LRYA 3UT0A 1V41E 2IPMA 1IXSB 3WRVA 3GBSA 2BBWA 3ASYA 3A9WA 3GDFA 1WUKS 4RVNA 3W77A 1L5HB 3Q7SA 4HRAA 5JNWA 1PBTA 1SKYB 1EINA 5F2EA 3KV3O 2CFCA 3ZCVA 1W1IA 1JLRA 3IDAA 1WS6A 1ZISA 2FR0A 4QUHA 2JI8A 3UAYA 1RDFA 4LXIA 5MFZA 2J45A 1B1CA 2XMZA 5IEBA 3GUHA 2A0WA 4B6OA 5K3AA 4DCSA 1PVDA 3QKRB 2BE9A 5E0KB 2VHQA 1KKLA 2QVXX 4BWVA 4R8KA 4YRTA 1DAGA 3CJQA 5TARA 2ZBRA 4YPFA 3KVOA 3SI7A 3MTDA 1ZM4A 3SS9X 2HDWA 4FFVA 4GPD1 5JT1A 1N8NA 1UF9A 5H81A 1WULS 2CHUA 4Y2JA 4U7HA 5T5QA 1IUKA 4CU5A 4EJSA 3IO5A 3AVYA 5BQ5A 4XLLA 1Z0AA 1Y42X 2Q1YA 4BE4A 1FMJA 3DWIA 2JJ1A 4MUBA 4DHEA 5I7OA 1DC4A 2JATA 1QAOA 4LDRA 3S3TA 1Y63A 4EMSA 3N7AA 3QP9A 4I1UA 2PE5A 2L2QA 3L4KA 1GR0A 3WMRA 1WPQA 1U9IC 2GBFA 3CISA 4WKCA 1OU0A 3H5RA 5JQGF 1L7NA 1NUAA 4L08A 3OX1A 4A6DA 5ERYA 2OGWA 3H99A 3THOA 3FNBA 1ADJA 2Z5LA 4PYKA 1P2TA 1SFRA 3QG5A 3RT9A 1QRUA 4C5BA 3RSQA 5IYZA 4FGJA 2GZ2A 2D0PB 3T41A 1JU3A 4AY6A 1M2OB 4KH1A 1GN9A 2YVUA 3FYUB 4IJKA 4J4TA 1KQ3A 4JI3B 1BDJA 1DO0A 2NO5A 2J6HA 2XJ4A 1JR3D 2XQVA 4PLPA 3IEIA 3SS8A 4BGEA 3G0CA 4AY2A 2HPAA 3T5BA 1IZ0A 4GSYA 4KAXA 3IAEA 4MQUA 4RC9A 2RAPA 5ESWA 1ONBA 3B9BA 4GPEA 4CQLB 1OC2A 1P19A 1C1HA 1GRCA 1P44A 3TQOA 1FUKA 3WHIA 5TR9A 3F9CA 3BSFA 3OE4A 3B20A 3K96A 1GTSA 2JVKA 2R6AA 4M99A 4AECA 4BQNA 2JAHA 5LU9A 4LF8B 4WZBE 4IJ5A 1JQ5A 3H6GA 3P27A 2DULA 4X95A 3K2BA 4AJNA 1XEXA 5HWSA 4MYUA 4NR0A 2Q49A 5DOVA 2BEJA 2HQ1A 3HI4A 2FMUA 4IWNA 4MV1A 3F6SA 1E2BA 1YBHA 1NVFA 5D87A 3EZ6A 3S29A 3W05A 4RJTA 4EHIA 4C4SA 1XDSA 3CF4G 2R25B 2RH4A 3IVGA 4LXUA 3RJMA 1YIOA 3EBPA 3WGQA 4QZVA 4L4RA 4Q4HA 4JXZA 4CIAA 1M2NA 3GHHA 4MWEA 1MDFA 1UBTS 2QXTA 1JWBB 2C82A 2JDIA 2JKYA 2OWEA 2C2KA 1X7DA 1JUDA 1XK6A 2RAFA 2VA8A 3D8HA 3O93A 4I81A 4NZZA 3G9ZA 4UHJA 3ZIAD 1E1NA 1E1CA 1Z36A 5FXMA 3GRCA 1GZ7A 3WL3A 1W25A 1P7YA 1CYEA 4HFRA 1WUYA 2H7YA 1A5AB 4TLCA 1CFJA 3RNLA 1PYOA 3FSEA 2VDQB 2HY7A 4BGUA 1NN5A 2J9GA 1F6WA 4MV8A 1ISRA 1PZXA 3RJ9A 4KLCA 1R88A 2B1RA 1QRTA 1U7TA 1X7XB 2RGGA 3B82A 3B1FA 3EAGA 1E2KA 2JH8A 3LPCA 5DCLA 3W2EA 4B3HA 4LHWA 4BX9A 3ILVA 1PJLA 1PVVA 5C4GB 4QT4A 1BZYA 5DFAA 4ZHQB 1ST3A 5JD5A 3MAAC 1VIDA 2JGDA 4BNLA 4EBBA 1OWNA 3ZZNA 2ZW9A 1F8UA 4L5AA 3PCXA 3RVBA 4QDOA 4JOSA 3OEED 2IXDA 4URZR 4ACBA 1WXHA 3FGOA 4PM4A 3PFGA 3LLUA 1W0CA 3HDQA 3G2PA 1DPFA 4AYTA 3LLMA 1KBZA 4LN1A 3UQYS 3B1WA 4DIUA 3FETA 3C5HA 4RZ2A 2XQKA 4KPUA 2EZTA 1NC1A 1FSGA 1JFRA 1TD1A 4RD1A 3ZI7A 4DDWA 2BGUA 1LBEA 4IZIA 4MRSA 4QXOA 5GJCA 2FUCA 4QU9A 3HDTA 3WMWA 3ZVRA 2P2ZA 4OP1A 1OFUX 4OP2A 3SF0A 5DN6A 1P9OA 4DSUA 2F17A 2PSJA 5HM6A 5TB5A 2Z8ZA 4WXHA 5DW3A 5BT9A 1Q0ZA 3CWZA 1E1CB 3LPMA 5DHTA 3WP1B 1N7GA 4AG6A 3D6NB 4MW1A 2PS3A 1IOWA 5IDVA 2ZJOA 3BX1A 3C6MA 2FRVA 1ZCJA 1GT91 3GXBA 3JAWA 4GP6A 3HRHA 4KQXA 4QTXA 2B8TA 1M2VA 5D85A 5EP4A 2FE1A 3LSTA 4J1SA 3AB7A 5ALWA 4DLPA 4ZTZB 2WIBA 3UXYA 4IOKA 1YZHA 2PLRA 1EUQA 1KSFX 1IPHA 2OT3B 3RRFA 5GQSA 4OKNA 3G5LA 1U9ZA 2Z2JA 1BWRA 2OV2A 4Q24A 2O5EA 4RVDA 2C84A 1E0JA 2P0EA 1R4MA 4LHZA 3O2SB 6NULA 3AKEA 1TUBB 1X7GA 3QVVA 2V5UA 1GL6A 1P5HA 4WFJA 2GYUA 5JMPA 4U63A 4D42A 1QKKA 1Q44A 1R8YA 2BJHA 4FW8A 5AO9A 4QGSA 4XUDA 4J75A 1QWSA 4WNCA 3TTSA 4I50A 2ORVA 5JXIA 4TRJA 2VJNA 5AW4A 1U8YA 1CZUA 2HK7A 4GSKA 4QWWA 4UCQA 1TYDE 5J63A 4ZI3A 2XMCA 2ZFUA 5JSZA 3BTVA 4HNAB 4XRRA 3WGOA 4MULA 6Q21A 2WF8A 3PEVA 2OVFA 4WOKA 2FWBA 4OTZA 4DLTA 1M2FA 1P33A 4KN8A 1J0DA 1M1XB 4P92A 4ZV7A 4S2EA 4EJSB 5A5FA 2GVDC 5LA6A 2D1TA 3H5IA 4GI3A 4UBJA 1I0ZA 4KWTA 3CY6A 1I1HA 4TQGA 3AR8A 4H08A 4Q9NA 4WI1A 2H6EA 1VYTA 2FK8A 3LT0A 1E5XA 1LLFA 4D57A 5DVZA 1OXVA 3ABZA 4Q9IA 1DNPA 1PF7E 1RAAA 5DWQA 2FN3A 3PT5A 3GEEA 3R0VA 1PW5A 4DG9A 4MRMB 5DIZA 1I51A 3TLGB 1GSIA 2BFAA 3T7DA 4PPQA 1QV9A 1QVAA 4I4TF 4G01B 4Z9FA 3NEYA 4IDQA 4RSHA 2XUAA 2UUPA 2C7PA