1ID1A

Crystal structure of the rck domain from e.coli potassium channel
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
HRKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPDIILSPQLFGSEILARVLNGEEINNDMLVSMLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE POTASSIUM CHANNEL PROTEIN
publication title Structure of the RCK domain from the E. coli K+ channel and demonstration of its presence in the human BK channel.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 51
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1id1A00
4M49A 1JN0A 5GY7A 1U5AA 1YO6A 5AOVA 5ADHA 3ZU5A 3KSUA 3WGTA 2DTEA 1ZK1A 4DLLA 1H6AA 1HSOA 1P1KA 1ZK2A 5L45A 3Q0EA 1U28A 4HBGA 3NT5A 5DT9A 3H9QA 1XSEA 1LDBA 4MP3A 3WQRA 2YQ5A 2PKQP 3P7MA 4YR9A 3OMLA 3TZHA 1CERA 3B1FA 2NVUA 4NHEA 1A72A 4J2OA 2J5RA 3UH1A 2UV8A 2BH9A 4J7XA 4IDAA 5I7VA 4UULA 1OI7A 1N5DA 1VSVA 2DUWA 3QVWA 3I9LA 4RZHA 4TRRA 1TT5A 3ZWCA 5A3JA 1PJTA 4I08A 1K0UA 5BT9A 1JKFA 1NVTA 3AY6A 4OO3A 1HF3A 5JDCC 4FB5A 4GH5A 2CDAA 4XB1A 2P9EA 4R01A 4KDFA 4R9SA 1Y81A 3MTGA 3AI3A 4R68A 1JTVA 4ZJUA 2V6BA 1DFGA 1Y9AA 5THQA 4G81A 4IINA 4R4JA 4BO3A 2D2IA 2Q3EA 1I3NA 3RFXA 2GASA 3JSAA 1B3BA 1PZEA 5F1OA 4NK5A 2WYVA 2NU7A 1EE9A 1TXGA 1S7CA 3GR6A 1RM4A 2JCYA 4LRSB 4D0SA 1SCUA 2Y68A 4P4NA 1E1LA 1CF2O 1N2SA 3H5RA 1EK6A 2I76A 2VNAA 1E3JA 4N5NA 4H16A 3UCEA 4HWKA 4FPXA 3OEWA 3DBRB 4R3WA 4DUPA 2CNBA 4DBVO 3DBHA 4TSKA 3FNGA 1A27A 4Z9XA 1N1GA 4AJIA 5C5IA 8LDHA 5JDCA 4LSWA 2DAPA 1XU7A 3DHEA 2AHRA 5ENDA 1ZUD1 1PWXA 3VH1A 4CL3A 3U5TA 4YA6A 1B2LA 2OL4A 2NU8A 2BF7A 2ZATA 4YVFA 5JLAA 1PGOA 3ZU4A 3U62A 1I01A 4N54A 4AVYA 2QX7A 4KUEA 4DQXA 1C0KA 3H4VA 1AHIA 4CMGA 4YRDA 4CQLB 5CEJA 4YRBA 3W8DA 1P1FA 2EERA 1YGYA 3OETA 1B26A 1PL8A 4K28A 4IDGA 3RAJA 3GHYA 1UH5A 4OMUA 1WDKA 2YJZA 4A73A 1B8UA 1DEHA 4CLOA 4BMNA 2EGHA 1VM6A 3ZGYA 4Z3KA 4PLTA 1S6YA 4WOKA 4EW6A 1IUKA 2AEFA 2BGMA 2Q4EA 4FDAA 1NWHA 4U8GA 2LDXA 2WYWA 3ADPA 1ZXLA 2VQ3A 4CM1A 3IIEA 1YWGO 3IQDB 4K9DA 4AG3A 1JDJA 4XJTA 4PG7A 1MXFA 2J5QA 4ZGWA 5L4SA 1NNUA 4KQXA 5THKA 2EV9A 2Q2QA 2YYYA 5U4QA 4E32A 1ORRA 1KVUA 1LRJA 3RFTA 4NIMA 3PWKA 1NHWA 1R4MB 4DQVA 2E4AA 2JJYA 4U6QA 3FPLA 2PR2A 3GVXA 1ONNA 1FDWA 4BGUA 3WIEA 5I7FA 2Q46A 3ABIA 5EPOA 3BHMA 1E1NA 1LTHR 4O59O 4Q3CA 1X0XA 1P33A 4UEJA 4XCVA 3JQCA 2ZJ0A 3K73O 3TL3A 1JKJA 1E7WA 1ZMTA 2GF2A 1F8GA 5EMHA 2ZB4A 2RAFA 4EEZA 2E48A 2FZWA 4UREA 3RC7A 3QVSA 2HSDA 2WTBA 4QTZA 1E3WB 4CMIA 3NRCA 1E92A 3M1LA 3A06A 2HMSA 4N7RA 4O1MA 4WCFA 2QG4A 2XPCA 3H2SA 1EBUA 1Q7CA 4CMBA 1GQYA 4TRJA 3R3JA 2NVUB 4B7UA 3OH8A 3INGA 1T2CA 3PP8A 3V1UA 4XQ9A 3ZWXA 3F4BA 3LK7A 2HJSA 4CUKA 5BNIA 1UP7A 1V3UA 5JMPA 1UXJA 2FPGA 3LQFA 3KTDA 2H5LA 1O6ZA 2HMTA 1TT5B 2GZ3A 3L6EA 3PTZA 1MGOA 4ALJA 3JQFC 1QYWA 3B1KA 3G3EA 3GPDG 2PH5A 1XYGA 1NQTA 1E7SA 1T24A 1V9LA 1T1RA 2HMUA 2RIRA 5FYDA 4BO6A 3ORFA 4JJIA 4NBVA 5G4KB 1LDNA 1H6CA 1E5LA 3U49A 2Q50A 1QP8A 1KVRA 2FSVA 3DZBA 3ROQA 2AEMA 3F1KA 1EDZA 4P4GA 1DC6A 1MXHA 3AU8A 4M89A 4NK4A 3ETDA 3ROPA 3F47A 1ENOA 1M76A 1EQUA 4UVEA 4EUHA 1JQBA 2PZKA 4CLDA 1NXQA 2XOXA 3KUXA 4RO0A 1E3LA 3TFQA 4BNMA 4ZHSA 1XU9A 3UF0A 2D4AA 3RUIA 1Q7GA 4P38A 3D4PA 1F8FA 2BI7A 5F5LA 4BKPA 1K6XA 2Z5LA 1X14A 3KV3O 1GDHA 3JQFA 3Q2IA 5A9SA 1WAMA 3JD0A 4MIEA 4EJ0A 2EF1A 3IS3A 2PZLA 1LXCA 2VCYA 4J4BA 5HWSA 3ETEA 1JW9B 2AQIA 2Y0DA 1X7GA 2ZK7A 4FN4A 4MKXA 4TVOA 4ZN6A 5ILOA 4Z0TA 4LMPA 3DC2A 4NG5A 1A9ZA 3DTYA 4DBZA 1PS0A 4GGPA 1ZEMA 4F6LA 3HZZA 1OFGA 1C3VA 2HO5A 1K6JA 4IJKA 4PLVA 1C0IA 1FF9A 4IDFA 3ZU2A 3DZHA 5IDYA 2P9CA 3P2OA 2FSSA 2HCTA 3FR7A 2FPPA 3PYMA 1FDSA 4AICA 2HKIA 3KOUA 3HB4X 3AY7A 2GUGA 5B37A 1NTOA 3RJ9A 4JLWA 3O26A 1H6BA 2VNSA 2AG5A 3QWIA 1O9BA 3GAZA 3DFUA 4A10A 3L07A 2GERA 4GGOA 4PG8A 1SZJG 2ZQZA 4AJHA 1EK5A 2UVDA 3CSDA 2HK9A 3JQAA 1MC4A 2EEZA 3K5PA 3QWAA 2E6UX 2DFDA 1U3VA 1Y8RA 1EEHA 2TMDA 5KOIA 4FFOA 4GMFA 1Y8QA 4J90A 1BW9B 3ZWOA 3I9NA 4MIOA 3CZMA 3LT4A 4FOOA 1T2DA 3MJCA 3I52A 4WK6A 1X15A 1E7RA 3Q9UA 4DQUA 1HE5A 5HTOA 1O95A 1ULSA 2O7SA 4RZIA 1Y5RA 4MOWA 1Z45A 1HYHA 4GX1A 1C14A 4E6PA 3ZHBA 3ONEA 3GFGA 4ZVVA 3MCVA 4R5MA 4PZEA 2OBYA 4Q39A 4WE3A 4CV1A 1RYDA 4CLHA 4XJSA 4XRGA 1Y5MA 3RWBA 4L74A 3UCXA 2IODA 5A03A 3FRJA 5CDGA 4U6SA 5A5EA 2AG8A 3GMSA 2W2KA 3NDRA 1I24A 1C0PA 5F3RA 3H9JA 4IDDA 1CJCA 2JAHA 4GWGA 4QEDA 5DCYA 6LDHA 4ZQGA 4FIZA 4DMMA 2O48X 3VZRA 4CR6A 3JD4A 4RLSA 3U9LA 2CDBA 1HKUA 2QW8A 4Z6KA 4CMIB 1ENZA 3WDSA 4X54A 3DOJA 5IJZA 1YH3A 1E3EA 4D3FA 2HRBA 2Y67A 3K8ZA 4WLNA 1M6WA 2IZ0A 1U3TA 3L6OO 1FMCA 3WGIA 4GSKA 3ZNPA 3HDJA 1G6KA 1YBMA 2TMGA 2ZYAA 4D0RA 4B8ZA 2RHCA 4LISA 4RPJA 2W90A 2D8AA 3QE3A 1P1RA 2ILTA 4RDIA 1B14A 5BSGA 1ZZEA 5AXBA 1I8TA 3BMOB 3COSA 1UDCA 1XG5A 2XXJA 4EEXA 1MX3A 1ZMOA 3HN2A 3AFNA 2H6EA 3E8XA 2QYSA 1ZIDA 3AJRA 1HLDA 3H9EO 3KHUA 1ADFA 3PDJA 3DMTC 2NLOA 3OM9A 1Z7EA 3CUKA 3EHEA 3C7AA 1PX0A 4Q3EA 5JBIA 2D59A 3BXXA 2C82A 3NTRA 1PJ4A 4CMKA 1QXSA 3FBTA 1JVBA 4WJZA 3IAHA 4YYZA 5MDHA 3MJVA 1G0NA 3NV9A 4G5HA 2B5WA 4RL6A 1KOLA 3TF5A 2Y1GA 4YJGA 1HE3A 3B6ZA 3AW9A 4R3NA 4YT8A 1YQDA 1QV7A 3RBXA 3ST7A 4BNKA 1DDOA 3LDHA 1EUCA 3OA0A 2FPIA 2J3IA 3KSZO 4L8VA 4FSHA 4CV3A 3I1JA 3GZNA 1D3AA 1Y9EA 3HDQA 4YAEA 2WWRA 4ND4A 4XEHA 4BNLA 3L9XA 4IDEA 4LVUA 3S2EA 1QKIA 1PJ3A 3M2PA 2YHIB 4P22A 4YRAA 1T4BA 3FNHA 1TEHA 1NFQA 2O50A 1NQOA 1I2BA 1Q0HA 4J0EA 4CQMA 2X9NA 4YXFA 3D1LA 4I9UA 3GUYA 4B7CA 5KKCA 4BB6A 4BKQA 3DMTA 4D44A 1TVEA 2ZTVA 1O5IA 3C3XA 3C7CB 9LDBA 2EJWA 3E5MA 3BTOA 1HDYA 3JYQA 3BYZA 1HDOA 4F3YA 1DAOA 2EKPA 4CMCA 1PZHA 1GZ3A 3F1LA 3PLNA 5JY6A 2UUPA 5JDIC 3TQHA 1M6HA 5JC8A 1P3DA 3CZRA 3Q2KA 1QG6A 1NPYA 1M66A 3LSYA 3CEAA 4DPKA 2ET6A 3GDGA 1GUZA 4OAQA 1U9JA 2NVWA 3ZN2A 5A1TA 2J6IA 2Q99A 3ANLA 2UUOA 1LDMA 2ZB8A 1IE3A 3MOGA 4G65A 3ON5A 4E3ZA 1HXHA 1H9BA 2B4QA 1ISHA 2AQHA 3D3EA 2NWQA 1DIAA 3JQAB 3TN7A 1LSUA 4IM7A 3D3WA 3E9MA 4RPLA 3WOHA 5T5QA 2ZTLA 1Y8QB 3RI3A 2NUAA 2CVZA 1B8VA 2IXBA 3K9QO 2JHGA 4PZDA 2VN8A 2ZKLA 4HFNA 1R15A 5JCJD 3MWEB 4MVJF 1LQUA 1GUYA 4Q3BA 2VYND 5KNLA 5L3ZA 3WGZA 2O2SA 3EYWA 3IMFA 4YB8A 5JDIA 2EIHA 1GFSA 5FEUA 3H7AA 1Z74A 3ZNNA 3UW3A 4BMVA 2O3QA 5DNAA 2B4RO 2P2SA 4NFYA 2HJRA 4CUZA 2I65A 5A4DA 1G1AA 2X5JO 3GNTA 1I2ZA 4JGBA 1XHLA 1ISGA 1VL6A 1DB3A 1U3UA 4FD3A 2C0CA 3G1TA 3BMQA 2D5AA 1H93A 2GN8A 5I7EA 2PD6A 2X1HA 2RH8A 3SJ7A 4J6FA 4NBWA 4XZ3A 3C1OA 3WG9A 5MGBA 4DC1A 2VWHA 1R16A 1Y7TA 3NX4A 2V6MA 4E0BA 1ZXBA 2OORA 4HY3A 4XR4A 4B3IA 4FFPA 1E6UA 1PEDA 3DBRA 3GMDA 3WGGA 2LDBA 1YL5A 4YJFB 4BGEA 3R6DA 4OOEA 4ALNA 3WMWA 4MP6A 1SO8A 3QA9A 4KUGA 1ZK4A 1DC3A 4K6CA 1P77A 4MJLA 5K9ZA 4JJGA 4CV2A 1W4ZA 1WVGA 3LT2A 2I6TA 3OP4A 3FR8A 5DBFA 5DULA 3H9GA 3WNQA 4XDYA 4DYVA 2P5UA 1O89A 5ITVA 4AL4A 5HA5A 1N1EA 4BV8A 4ONEA 3QVTA 4J7CA 2DKNA 4BB5A 1K5HA 4NMHA 3EVTA 1DIBA 4ZICA 3VHRA 3FNEA 3PHJA 4CM9A 3I6IA 4IBOA 3S55A 3ONDA 3P5SA 2IEDA 1EQ2A 5DF1A 1LLUA 1OBFO 3ETGA 5TT1A 3AUTA 5KJFA 1DFIA 2X5OA 4UVHA 3ANNA 5TNXA 3U4HA 1NX6A 3VPSA 3X2FA 1FDTA 4EZBA 1WZIA 3M2TA 4KWIA 4GI2A 1QRRA 3K6JA 4DIFA 2Q49A 1JAYA 1ML3A 3MWDB 4HNGA 5FI5A 1BXGB 4I1IA 2IXAA 4HKTA 4E2YA 2J3JA 2DM6A 3GEGA 2VZ9A 5JAQA 4CQMD 3LYLA 1O0SA 1OAAA 4RVHA 4Z9YA 4PVDA 2ZIZA 4XIYA 3NYWA 1GL3A 3HADA 4NU5A 2NACA 3DAPA 1U2GA 3PJFA 4YPOA 4XD2A 3CMCO 4GLOA 2FP4A 3UICA 3HHPA 5TLSA 1DHRA 4JK3A 5DP2A 1YE3A 4ALIA 1I3LA 4CLRB 1PJBA 1R66A 2PLAA 4NZ9A 4CM4B 4RJTA 5U9CA 1Y1PA 1R4MA 1UXHA 4NBTA 3VTZA 2YFQA 3PVZA 3W4JA 5A05A 3S1LA 3NJ8A 3EGOA 5CP8A 5JXWA 2VYVA 1ISJA 4YWJA 3QWBA 3T7CA 3PZBA 3UKOA 1X1EA 4WOJA 5KTKA 4B8WA 3KB6A 1JA9A 4R69A 2EGGA 1WWKA 5JAIA 5CG1A 2BFOA 4DA9A 1I3MA 1ZW1A 4RF2A 5JO0A 4RPGA 3R3SA 1XELA 3CE6A 3RKUA 3GT0A 5GZ1A 2BLLA 3TZQA 3O4RA 4DLBA 4BKUA 3NDJA 1E3WA 4RF4A 1NPTO 1XR3A 2H63A 3PXXA 2Q45A 3MZ0A 3HG7A 3E9NA 5F21A 3N58A 5EINA 2YW9A 3FCOA 4J4TA 1LNQA 4I9NA 3H2ZA 3D3WB 4XWYA 3VH4A 5JW6A 2VUSA 2ZJ1A 1LDEA 3IP1A 3A4VA 1OC2A 3TOZA 2G82A 5BR7A 3BHJA 1KVQA 3BA1A 3PRJA 1PL7A 1B3RA 5AXDA 1ADBA 1HZZA 3U3XA 5TX7A 3H65A 3L4BC 5ILGA 2BELA 4AJPA 2PA3A 3GH3A 3K2EA 4PLHA 3L77A 3WLEA 3OF2A 3EVNA 3HFGA 2YUTA 4PG6A 1LRLA 4YCAA 1HRDA 2DUUA 3GDFA 3LZ6A 4TVBA 2PFGA 3PGXA 4QQRA 2CY0A 1IB6A 2GZ1A 1HWYA 1YB5A 3DEYX 2Q1SA 1Z6ZA 4L9RA 5G4KA 1KC1A 1RKXA 3CH6A 4UVGA 3W1VA 4EUFA 4CM6A 1F17A 3BMQB 3UN1A 2RCYA 1QLJA 3EC7A 3PIIA 2HMVA 5EQFA 2Y1CA 1E77A 5H82A 2G1UA 3E9QA 2FMUA 3D0OA 2BHLA 1I2CA 3PIDA 4IPTA 3JD2A 3ZV3A 4E5PA 1LDYA 2PZMA 4AFNA 1ZSYA 4BO7A 4N18A 4MVJA 1HE4A 1Z7BA 3L4BA 3R0IA 4OHUA 1EVZA 1LQTA 4IUYA 1NR1A 4QFCA 4E2ZA 2NTJA 3O03A 1LI4A 1YDEA 3OIFA 4R1UA 2EKQA 2PZJA 1VI2A 5C7OO 4IY1A 4MVJP 3IP3A 3SBOA 1BSVA 1QMGA 2OUIA 4Z3DA 4MVJH 1LRKA 1IL0A 3ZWPA 5T8KC 4UVDA 2O4CA 1HDZA 2BGLA 4JROA 1Z73A 4CM9D 3GPIA 3NEPX 4E31A 2EHDA 1A7AA 2C20A 3BMNA 1ZNQO 3DL2A 3AM3A 4BO4A 4BNVA 5IG2A 2HQ1A 5DDIP 1E1KA 2EWMA 3KLPX 5L7YA 4LGVA 3K92A 1GV0A 4U0KA 3Q1LA 5JS6A 2HDHA 1B15A 4OSPA 3RU9A 5CDSA 2C7VA 5L4NA 4Y67A 1UAYA 5DCUA 1NR7A 2FHSA 4YACA 4YJHA 3WGYA 5L4LA 1H2HA 3OQBA 5F5NA 5HM8A 4M54A 2O7QA 1DRUA 3C8MA 1SEPA 3FHLA 4W7HA 3RJ5A 4DPMA 3KSDO 2GN9A 3RUHA 3U0BA 1KETA 3G17A 1AE1A 1NHGA 2NQ8A 3LVFO 4IQGA 2HAEA 3V1TC 3WBBA 2VWGA 3LU1A 1ENPA 3BZUA 3EMKA 2OO5A 3RBVA 3D4OA 2V6GA 4O5OA 5TC4A 4TWRA 1BW9A 5T8KA 2B0JA 4AJ2A 3ZW9A 3V2HA 2NTNA 1IZ9A 3PQFA 4JNKA 4DPLA 1DO8A 3TL2A 1CETA 4QX6A 4GL4A 2VYVD 1DJQA 1NAIA 4GVXA 1EE2A 4H3VA 3TRIA 5T64A 4BNTA 4B3HA 5AVOA 4KTTE 5AYVA 1GPJA 5KJ1A 4DXHA 1GU7A 2H1SA 5LDGA 1DXYA 3VPFA 4MVJM 4D43A 4DIOA 2P4QA 1GEGA 1XCBA 1XKQA 3D5QA 4HUJA 4BS9A 3OIDA 5FFFA 4DREA 1JAXA 1K2WA 5H83A 3QV1A 3ZWYA 3B20A 3I6QA 3QVXA 3LC7O 1EFLA 2H9IA 1NASA 4LK3A 2WD7B 2JFHA 1DRWA 4ROSA 3ZV5A 2PK3A 1FDUA 2QRKA 3I23A 4QO7A 5C7LO 3CIFA 1Z75A 3Q9NA 4TMFA 2B69A 3BTSA 1EUZA 3QIVA 4IJUA 2Y1OA 4MP8A 4O63O 4WEQA 1YJQA 3I9JA 3QLJA 1C1XB 2I67A 2GSDA 4CUJA 4FJ0A 4PLFA 1DC5A 3EZYA 3AK4A 1DLJA 5CG2A 5CEEA 2NNLD 2NV6A 4RPHA 3RQSA 1ID1A 4U5QA 1SEVA 1B16A 4LN1A 5G0SA 1ARZA 1JWAB 3GOHA 4H15A 4IDCA 4EJ6A 2VHVA 1NQAO 4XGNA 4YAIA 3BMOA 4MVJG 5EQDA 3R1IA 3LLVA 3WNVA 1PTJA 4TKLA 3GC6A 1NM5A 4BNZA 4PVCA 4XA8A 1UXIA 1T25A 2AQKA 4N5MA 4RQUA 3GVPA 3U4IA 4EJMA 1EVIA 4W7IA 4E5MA 3GAFA 2P9GA 1IZ0A 4E5YA 4R1NA 2VHXA 4KTVE 1YBAA 4MPDA 4PZCA 3RUCA 1HLPA 2C54A 3DBLB 4NQZA 4RVSA 4MVJD 5L7WA 1P0FA 1UP4A 2VT3A 3JYLA 3ICPA 2IRWA 4UEOA 3E82A 2X23A 3GVIA 1HYEA 3H5NA 1M75A 1IHXA 4C7KA 3GY0A 5CPBA 3KYBA 2EP5A 2AXQA 4OKNA 3ZH2A 4E2XA 1DIGA 2XXBA 4J1TA 3ZZNA 1HDXA 1QSGA 3AI2A 1R12A 1HETA 3T7EA 3TZKA 2GCGA 1SB9A 2VOEA 2YHIA 1VJTA 1YL7A 2CDCA 1P31A 3PWSA 2YY7A 7MDHA 4OYRA 1Q0QA 3JYOA 4KDEA 1CQIA 1P9LA 3EW7A 2ZTUA 2W8ZA 4PN3A 1EVYA 3UUWA 3RASA 4QXMA 4TKMA 3SJUA 4RVUA 4WLFA 1ISIA 3BMNB 3OECA 5TJHA 1D1TA 2JFFA 5B12A 1YRLA 1GCOA 3WFJA 5I9NA 4LSMA 2D1YA 1RYEA 3VPHA 2I5PO 3I4CA 5G2OA 4UVIA 1RWBA 3PQDA 4BMSA 4CM5A 4XGKA 1IPEA 3SC6A 1M2WA 3W4IA 3TNLA 3RKRA 4YJHB 2VWPA 4R41A 3L6DA 2C2YA 4RPKA 1TLTA 1X7HA 1YONA 2PD4A 2ZB7A 3HNPA 3JQBC 1GQ2A 2AA3A 3K30A 4FBGA 3WSVA 1SOWA 5IZCC 5KIAA 1XQ6A 3HJAA 2FY8A 2X9GA 4TZTA 3D64A 4PIVA 1ZJZA 1WPQA 3UVEA 1ZH8A 2CD9A 4BOYA 4EBFA 3WTBA 3TSCA 2GO1A 3PGJA 2CVQA 4IJVA 4LVCA 1WMBA 4L73A 1VE9A 1YBVA 1P1IA 5DOVA 5CFZA 2OOSA 2Q4BA 4KWHA 2ZCUA 2PGDA 3HB5X 2NTVA 3ENKA 5EESA 4R5HA 3JQ7A 3DZIA 3GNSA 5ER9A 4HP8A 3I4FA 2CFCA 1PJSA 4R51A 4IS2A 1CWUA 1AXEA 1SOVA 1VL8A 4OKIA 3SEFA 2PH3A 4TZKA 8ADHA 2X4GA 1WDLA 4IIVA 4KOAA 3WWYA 2C7GA 4E30A 2IE0A 2NM0A 4BO8A 5AXCA 5T57A 4S1VA 5L40A 4WLVA 2G5CA 3JQBA 4BGVA 2YFHA 3QVOA 4BO0A 4CR7A 2C5EA 4XR9A 2X86A 4A7PA 4AJEA 4PRKA 4OXKA 2GGSA 1YJ8A 1R4NB 3ZNQA 3DOOA 4TRMA 2GN4A 2VTDA 3EZLA 4ZU3A 5I9MA 4B4UA 1CRWG 4HV4A 2GLXA 1LJ8A 4LMRA 3VVBA 2WYUA 2X7HA 3I3OA 3S8MA 3JQ9C 4IMRA 4YBZA 4EI2A 4GX5A 4MIYA 1LU9A 5B1YA 4RQTA 3V2GA 1U8FO 1NFRA 4LCEA 3EK2A 4YJFA 4XYBA 1PWZA 2J8ZA 4BNIA 1TA4A 2PTGA 1BVRA 4ND2A 1ZSNA 3JYNA 2QQ5A 2B35A 3VDQA 5FF9A 1GZ4A 1HTBA 3RCBA 3KRTA 4GMGA 4PG4A 3WXBA 1GY8A 4NBUA 5A9TA 3FD8A 4PLGA 4A2CA 3GGPA 4ALLA 3BMCB 3UAGA 4NH4A 4J3FA 1JKIA 4U7WA 1MFZA 5CDTA 4XIJA 5L95A 1IULA 4K26A 1J5PA 2V65A 1Q0LA 1KS9A 3B1JA 1DJNA 3DOCA 3DMYA 3BAZA 1K3TA 4GPD1 1MV8A 1WP4A 3C24A 4LRTB 4J1NA 1VC2A 1UUFA 4HADA 3NJ4A 1EVJA 1J4AA 4W9NC 1ZK3A 4YQYA 1BXGA 2VUUA 3WGQA 4A26A 1AGNA 3GG2A 3V1YA 1X13A 2HU2A 4II3A 4OM8A 4OQZA 1QYDA 1R0KA 4FQ8A 3WYBA 4NJOA 3G0OA 4BQRA 3STHA 2VRCA 1BRMA 4IZIA 2G76A 1E1MA 1R37A 3UHAA 4XYLA 1JWBB 2O3UA 3WB9A 4A03A 4DRYA 4FJ1A 2YDXA 3L4SO 2A4KA 2Y05A 4RF3A 3C1TA 2A35A 3D5TA 1UJMA 1VKNA 2X22A 4CLRA 4OQYA 4CMJA 3FPCA 3GGGA 3PHIA 1Q1NA 4LCJA 4CM4A 1R0LA 4GBJA 3VTFA 5A06A 5BSHA 2JCVA 2Q1TA 4FFRA 4XRRA 1T2EA 1UZNA 1D8AA 4I8XA 2QYTA 5JE8A 4Y6RA 5KVCA 1WZEA 1D7OA 1KEPA 1T4DA 4W9NA 2IYOA 3GVCA 4G2NA 1UDBA 4J9VA 4E12A 1XDWA 3JQAD 4PLPA 3DONA 4Y6SA 3MJTA 3VZPA 3MJEA 4K6FA 1BDBA 3IOYA 3NKLA 4BL5A 2PV7A 3KZVA 3PWZA 4WECA 2WEKA 3AI1A 1A5ZA 3FI9A 3JQ8B 3RC9A 1PQUA 3EDMA 3WGOA 1PJCA 2NSDA 1ZK0A 4Z0HO 3S2GA 3JQ7B 4UEKA 4OH1A 3OHSX 3W4KA 3GN1A 4J0FA 5TIIA 3HDYA 3ICCA 1PR9A 3BTVA 4D3SA 4URFA 4R9RA 4ZRNA 4YQZA 3UFXA 3WJAA 1BHSA 1P1HA 5EN4A 3TZCA 4RDHA 2BRUA 1FK8A 1WNTA 2I99A 3V2UA 3VDRA 4LW8A 2A92A 2NQTA 5CEFA 3QSGA 3T4EA 1I30A 3K96A 3ZWWA 3OJOA 5TQVA 1ONPA 2FR0A 3ZWNA 3ASVA 4QUKA 4KQWA 2ZB3A 2W98A 3OQ1A 2Y1DA 1OZAA 1A4IA 3FSRA 1DFHA 5G0TA 3RBZA 2YHUA 2GPTA 3VOSA 3AM5A 4UUOA 1H9AA 1E3SA 4BQPA 1UAGA 3BTUA 4DYDA 1DIHA 4HFJA 2GR9A 3DZFA 2EW2A 1E6EA 1KVSA 3ZHXA 1H6DA 2HMWA 4IXWA 3M6IA 3ZDFA 1LUAA 5BSFA 1ZCJA 3NGLA 1L7EA 1MUUA 1N8KA 5F1PA 2C59A 1OC4A 2JFGA 1EDOA 4DMLA 3UGKA 2CMDA 4M55A 3ZHZA 1PR3A 1YOVB 4XGIA 4O0LA 3LT1A 3E18A 4FCCA 2X0JA 4WNIA 3WICA 4BNWA 2PKQO 1QYCA 3D7LA 3U4CA 3WR5A 1NYTA 2X8LA 5TSDA 1YXMA 4J9UE 1CIVA 4AJKA 1P74A 3ZI0A 4MDHA 1WMAA 4D46A 1PL6A 2DQ4A 1SAYA 3E48A 2F00A 3OSUA 1PIWA 4YTEA 1LBEA 5JY1A 3P2YA 1PJLA 3G1UA 5HS6A 1HZJA 2AMFA 2DC1A 3E5RA 1E7QA 4J4HA 4B4OA 4W99A 3DWFA 4QT0A 2JAPA 2Q1UA 4NJMB 4RVDA 1PQPA 2GYYA 1UDAA 3HUDA 1JVSA 3L9WA 4HFRA 4I5GA 3ZWAA 2Y0CA 4XX0A 3HE3A 3GA0A 1DPGA 2W2LA 3AUSA 1JU9A 2GZ2A 1LSSA 4KP7A 3GRPA 2Z95A 4L4SA 2YV1A 1CDOA 2DBQA 3E6AA 1V0JA 4K1LA 5COBA 1XWFA 3PI7A 3Q6IA 5JYDA 1ENYA 3QQPA 2A94A 2RHRA 4J7UA 4I5FA 4PGFA 4EGFA 3WSWA 4UAGA 4D79A 2QZZA 2DLDA 4YAGA 4YT4A 1SBYA 3T4XA 4F46A 1AHHA 3HSKA 1U2DA 4GKBA 1P1JA 1I10A 2WSBA 2JD1A 5DOZA 3JV7A 3GGOA 5AXAA 1ZKMA 3FWZA 1PS9A 3PHGA 3OJLA 2G17A 2AE2A 3INTA 3F46A 5DBIA 1ISFA 4CLXA 5IFLA 1EUDA 1V6AA 3DXFA 4CJXA 3ZV6A 3HFSA 3EUWA 3H9UA 1QYVA 3WWZA 3IKVA 1YB4A 2WD7A 2DPGA 5L51A 3UCFA 2BD0A 3F6YA 4PRLA 5T67A 4BNNA 1N9GA 2RBEA 4D41A 1GZ6A 3E1KA 4W82A 4ILKA 5JSFA 3GRKA 1N7GA 3TOXA 2VT2A 2V6FA 2CVOA 3W6ZA 1C1XA 2P4HX 3PDUA 3ZHYA 4DLAA 1XEAA 4E21A 4QO8A 1A7KA 1VL0A 3JCZA 4WASA 3H3JA 1BGVA 3AU9A 1DRVA 1MB4A 2BMAA 4RVGA 2C2XA 3HN7A 1JLLA 5IAAA 4Y6PA 2JL1A 4IXTA 1HDRA 1LSOA 2NU9A 3CXRA 3TPCA 3GLQA 3NTOA 1XA0A 2OZPA 3C1AA 1VJ0A 4NFSA 3PJGA 2X0IA 3VPGA 1W6UA 4IDBA 4ZQFA 1GPDG 4NDNE 2Q2WA 1CYDA 1TT7A 5COQA 1CEQA 1HT0A 4RGBA 3GQVA 4ZA2A 4JCOA 2B37A 4UUNA 3QP9A 1I36A 1FXSA 1PQWA 3TDKA 1A71A 2BFPA 1PU2A 4MKRA 3ITKA 1LC0A 3DFZA 1U4OA 1A9YA 1VSUA 4HNHA 3DBLA 5F1KA 3E03A 3OJEA 3G49A 1F0YA 2UDPA 3PJDA 3MJ4A 3FWNA 3PHLA 4PCVA 3I5MA 4CPDA 4YAKA 2WJPA 2O2YA 1E5QA 1TB4A 3SX2A 1BWSA 4FC7A 3TWOA 3W8FA 4NPCA 2YDYA 4WNCA 5EIOA 1LLDA 4A0SA 2D0IA 3EY4A 4RORA 2HK8A 3ZWVA 4E33A 4M87A 1KVTA 5JYEA 5HBRA 4M86A 4OL9A 1C1DB 3IUSA 2P68A 3W6UA 3L0DA 4CMEC 4FGWA 4P8RA 5DN9A 3RFVA 2VZ0A 2WE7A 3ULKA 4Y98A 5HRUA 3H8VA 5KJEA 3KXDA 3O8QB 2OP1A 2X6TA 5KVVA 1E0DA 2YZ7A 4ESOA 1KEUA 3GG9A 4C7JA 2VHWA 3PYLA 5BNFA 3KETA 1KBZA 1MP0A 2UYYA 1IPFA 3W8EA 5L53A 1BMDA 3UXYA 1WXDA 5G4LA 3VKVA 3WFIA 2W2LD 4D42A 4J1SA 3HQ4O 3AOEC 4JJFA 3ZNOA 1PGJA 2EXXA 2ZCVA 1EZ4A 3DZGA 3Q11A 4R54A 1YS4A 4WLUA 4I9HA 2WM3A 1GYQA 5DZSA 5L9AA 4IGEA 3H3FA 3OJFA 2IYPA 4IQ0A 4NI5A 2NVBA 1T2AA 5KCZA 2AEJA 2WDZA 4RVFA 2O3RA 3V8BA 4DL9A 4XYGA 4TQGA 3EAGA 3S2IA 5TS3A 2X58A 2IDZA 2EW8A 3GZ4A 3TJRA 4CMEA 1YDWA 1I0ZA 3U4DA 1GADO 3ZV4A 1HL3A 3WLFA 2P5YA 3WYEA 1QLHA 5B4TA 5I7SA 4J1QA 3WIDA 3LC2O 1NVGA 2BGKA 3K2BA 5ENVA 3DB2A 2D3TA 3WMXA 3LT0A 1KEVA 3PFFA 1EFKA 1G0OA 2HUNA 3B70A 1SMKA 4XQGA 4BHTA 3DAGA 3VPXA 4IIUA 2DFVA 3QW2A 1MA0A 1ZEJA 1A4UA 1MLDA 1CQJA 2B83A 3OQ6A 2DVMA 3AOEA 4CM8A 3DBVO 2O4UX 3MJSA 4WEOA 3CINA 1K89A 5CPFA 2ZQYA 1QV6A 1VJ1A 1D4FA 4WPGA 1XGKA 1WLYA 3C85A 4KZPA 3QY9A 2AE1A 1LEHA 5FWNA 1P44A 1KY5A 1R4NA 4WCFC 1FJHA 3PQEA 5DBGA 2PKRA 3HDHA 1N9GB 2Y66A 4FS3A 2OP0A 3VZQA 4BO9A 3ASUA 2W4QA 4L4RA 2J5KA 3RUEA 1HYGA 3QWFA 3GEMA 1DBVO 1MG5A 3JQGB 5C37A 5ES3A 3WGHA 3F5QA 4ZQEA 3CKYA 3VZSA 1IY8A 1QYXA 3N74A 2QZ9A 4PLCA 4JBHA 4B3JA 2I3GA 5EERA 5ICSA 2PGJA 1H2BA 3WBFA 4XKJA 4GX2A 2XF8A 4DWVA 4CL8A 4BVAA 5FI3A 1LSJA 2OXIA 1DOHA 1YQGA 1J49A 4RCVA 2E49A 3I9MA 3QHAA 1NBOA 2I3AA 3ZWMA 1O8CA 2Y99A 1B0AA 3UOGA 4JIGA 4ZQBA 4FFNA 1NAHA 3ITDA 1R6DA 4ZD6A 3BMCA 5BSEA 2GRAA 3I9KA 3RROA 4Q3NA 4IQ8A 4FFMA 1YVEI 5B4VA 3TFOA 3NUGA 3LC1O 3ZWBA 5I8ZA 1U8XX 4ND3A 5KWEA 3U09A 4GKVA 5JPIA 4NR0A 3MTJA 4TRNA 1YKFA 4W6ZA 3V5NA 4CV0A 5J23A 3OJ0A 4HX5A 3MOIA 3JD3A 1V3VA 1T26A 1BVUA 3RUFA 5BQFA 1ZO8A 2X0NA 2WD8A 3JD1A 4DGSA 2AW5A 4FJ2A 3FN4A 1QORA 2O3JA 3DDNA 4MINA 2AQ8A 4JX8A 4E13A 2X5KO 5ICMA 2V7PA 4YT5A 3RC2A 1RJWA 1I3KA 2ZYGA 2B36A 3JQDA 1XQ1A 1OOEA 3OFSA 4HFMA 3WTCA 4CODB 4EDFA 4CLEA 2R2GA 2CF6A 4EUEA 1T2FA 5GZ6A 4IS3A 5DCWA 4Z0PA 2G0TA 2OMEA 2CSUA 2EKLA 1R0SA 5TF4A 1LX6A 1N92A 4E5NA 1GAEO 3PK0A 4I5DA 1WDMA 3SLGA 2FZEA 4FW8A 3I83A 2SCUA 5ITWA 3ZCXA 1DIRA 3CTMA 1KEWA 2OFPA 4BO5A 5LDHA 4QSMA 1DSSG 3MEQA 3WJ7A 3F9IA 3GFBA 4N5LA 3JYPA 3DBHB 2VTEA 2JD2A 5HS4A 4YT2A 3RC1A 1UP6A 1L1FA 1BTOA 1PZGA 2HLPA 1UR5A 3C7DB 3PHHA 4OSOA 1I33A 4BNGA 5IDXA 5A02A 5TT0A 3ONFA 2CZCA 3SVTA 1O94A 5G0WA 3WQSB 1Z82A 3JQ6A 5K6AC 3KLMX 3RUAA 2O3TA 1N7HA 1Q7BA 2YV2A 2R6JA 7ADHA 1VRWA 2R00C 1Q2XA 1HE2A 1X1TA 1UZLA 4WLOA 4QECA 4AJLA 5IXYA 4ID9A 3JQ8A 1NP3A 3AOGA 4P4LA 1J6UA 3VVCA 1ZBQA 5IF3A 1LDGA 4FR5A 3BHIA 4R1TA 3RSHA 1VLLA 1SNYA 1FDVA 4O6VA 4OGWA 3LLSA 3ZW8A 5LCXA 2C29D 2QRLA 1GTMA 4Z9FA 5JFOA 4IJWA 1ZSVA 1QR6A 4BUCA 4CMAA 4E4YA 4CLOB 4ND5A 3X2EA 2IZZA 3ENNA 2C07A 3AY3A 3FTNA 4CM8B 5B4UA 1C0LA 2VHZA 3LF2A 4W4TA 3AUAA 2B5VA 3GHHA 4GX0A 4PLZA 5IZCA 2VRBA 1Y6JA 2E37A 1P45A 4RV9A 1F06A 5K6AA 3K31A 4AJOA 5IZ4A 3KBOA 1NPDA 2R00A 3QJ5A 2WE8A 1ADCA 3GVHA 5TJ9A 5G0VA 5AQ1A 2IZ1A 3OBBA 1B7GO 3IUPA 4MKZA 3VH3A 5JCJA 5I8WA 3PEFA 1TI7A 1EBFA 4ITUA 3BIOA 2VYNA 4BKOA 4B7XA 2YQ4A 2ZYDA 3OIGA 2POQX 1XIVA 1U4SA 1J0XO 2DBZA 5IN4A 3NTQA 3CPSA 2RH4A 3NDIA 1HDCA 1E3IA 1W0CA 1YOVA 3G79A 2HRZA 1PSDA 1ISMA 3OA2A 5KVSA 3VKUA 4U0JA 4M8SA 3ROMA 5IXSA 2HK7A 1E6WA 4GLLA 1IHYA 1WW8A 4MO2A 4WCFB 4EYEA 4IMPA 4B4WA 4J91A 3PZRA 3QWHA 5IDQA 1PGPA 1LLQA 1YB1A 1MFPA 5A5FA 2DBVO 2QIOA 3RD5A 1W73A 2PNFA 1GV1A 1MC5A 3JQ9A 2DU8A 3GN2A 4R16A 4NJMA 1IOLA 3FTPA 4L4XA 4J43A 1H0KA 4RLHA 1I5RA 1E7MA 5IN5A 2YV3A 4PG5A 1SPXA 4BNYA 1RM0A 3M1AA 4BO1A 6ADHA 2PWZA 4WCDA 4XYEA 3AUUA 2BFMA 5CDYA 3KO8A 3GDOA 3KVOA 4Q3AA 2VOJA 3DZKA 1RPNA 1BXZA 3F4LA 1IYZA 2EP7A 4OJNA 1GUFA 1V8BA 1W8DA 5CAEA 4Y8VA 4Q3DA 2PD3A 3KEOA 3RU7A 4PLYA 2PY6A 4XB2A 1UXGA 4B4VA 1BG6A 2OGUA 3H6KA 5BNTA 2VUTA 3FNFA 3Q3CA 3IC5A 4YAJA 4L76A 4JBIA 5CHEA 3P19A 4F6CA 2CF5A 2FR8A 2FRDA 4WKGA 5DP1A 5A04A 1B8PA 4OXYA 4DC0A 4E5KA 5GMOA 2EG9A 3PPIA 2A9FA 1YQXA 4E2WA 5A9SB 4ALMA 4FFLA 4FOSA 3DHNA 5ER6A 3RIHA 3IJRA 1KY4A 5JCXA 4J49A 1ULUA 1U7TA 4CMHA 5A3VA 1RM3A 4NFHA 4MVJI 4B79A 1AUPA 3AFMA 1D1SA 3KEQA 4AJ4A 3KYCA 1MG0A 3GNQA 4DTIA 3WS7A 4YEDA 1T1SA 3WYCA 1H94A 3KYDA 2J3KA 4L75A 4S3MA 3SLKA 3ADOA 5KKAA 3INRA 3AWDA 3GF4A 2JHFA 1PJ2A 2Q2VA 3AM4A 1DC4A 4RF5A 4UUPA 4EITA 1KIFA 5I9LA 2Y1EA 4TROA 5TRTA 4F45A 5IDWA 4Y9DA 4D45A 4GAEA 1I32A 3NT4A 5KJ6A 4L0QA 3VH2A 1EMDA 1L7DA 2X9VA 3DAFA 4HXYA 4AJ1A 4CM7A 2FR1A 3IL2A 1ADGA 3A14A 4I5EA 5G0UA 3O9ZA 1U1IA 2I9PA 4XQCA 1SC6A 1K6IA 4XYMA 3RUDA 2FN7A 4ND1A 2IEBA 3DZJA 5H81A 4BGIA 1Y8RB 2DBRA 4XDZA 3A1NA 2WMDA 1U3WA 1HDGO 2UAGA 2Z1NA 3TZ6A 1PGQA 1ZVMA 2JD0A 3FBGA 3H5AA 4JP3A 1BXKA 1DLIA 5T6BA 2NU6A 5U1PA 3PJEA 3A9WA 3NT2A 5TGDA 2DTXA 1LA2A 4AJNA 1DAPA 2C5AA 2O23A 4JBGA 1NQ5A 1ZJYA 2Y93A 3CMMA 4NBRA 5JO9A 4CM3A 3NAQA 4YJDA 4A27A 1H5QA 3VAZA 5GZ3A 4WUVA 4GVLA 4DIBA 1V3TA 4ZRMA 2GNAA 4IZHA 4JQCA 4NNJA 1OMOA 3WX0A 4BO2A 5JMWA 3F5SA 1PZFA 4XQEA 3RVDA 5CDUA 3I9OA 2W2KB 3IDSA 3ZU3A 1UZMA 1X7DA 2EJVA 2I66A 5A9RA 2FWMX 1ONOA 2GD1O 2GN6A 2OBNA 3SC4A 4GSLA 5K0ZA 1M67A 1U7HA 4UUMA 1C1DA 3F3SA 2BKAA 2Y1FA 2VZ8A 3OICA 4BNHA 2Y0EA 4R1SA 4DVJA 5C3MA 2NADA 5L7TA 2PGLA 1GQQA 4GQAA 3O8QA 1GCUA 4QFDA 4OOFA 3HWRA 3JQEA 1NFFA 3DTTA 1YL6A 4D7AA 2P91A 5KVQA 4PLWA 1AXGA 4BNFA 4M1QA 1U5CA 4KUHA 2ZTMA 2Z1MA 2CUKA 3OEYA 3DQPA 3PLRA 3PFWO 3O38A 2DTDA 1GYRA 2QHXA 4A5OA 2VHYA 5JNLA 3PYXA 1F14A 2DT5A 1SB8A 2BI8A 2QRJA 4FGSA 1GR0A 1AN9A 2VRCD 3JTMA 4ZQHA 1V35A 3VC7A 4ALKA 1KC3A 3NGXA 1GYPA 1GD1O 3GK3A 5LC1A 5KJCA 3DO5A 4WLEA 5EL0A 4CQLA 1NVMB 4BNJA 1DHTA 5JAZA 2VWQA 1KYQA 1VKOA 4JXKA 9LDTA 2Q1WA 2X0RA 4KMSA 1HSZA 1GEEA 1E7YA 4YJGB 2O3SA 2BFAA 3DHYA 5EJ2A 3SXPA 3D4NA 4BIIA 2B4TO 4AJJA 3A28A 4YDRA 1LLCA 1ZFNA 2J3HA 4OIMA 2DPHA 4GWKA 4NU6A 4H7PA 2GDZA 1BDMA 3GZNB 4JN6B 4MVJE 2D5CA 4BNUA 3GEDA 3IKTA 3GUCA 5C7IO 1PGNA 4BNXA 1XLTA 3S2FA 4IGFA 4CR8A 1RM5A 4OXNA 3ROKA 4BKRA 4CQMB 2FOIA 1UXKA 3IJPA 3LF1A 1LC3A 3ANMA 3N7UA 4FC6A 2OHXA 1KERA 3DR3A 1P0CA 4J2HA 1X0VA 3QRWA 2E82A 4WGGA 2JKVA 1F12A 5JC1A 2XAAA 4C4OA 3WQQA 3KYCB 1VPDA 4J16A 4INAA 2JCXA 1HEUA 3JQGA 4D3DA 1PJQA 1PS8A 1NWCA 2F1KA 5COAA 3FF4A 4PFJA 4BV9A 3KYDB 3KM0A 5JAMA 4Q9NA 4II2A 4JP2A
chains in the Genus database with same CATH superfamily
3CRMA 2Z8ZA 2IEGA 3DR5A 4TMYA 1YO6A 1QB7A 1UPUA 1CE8A 3BQ9A 3B3AA 3GU3A 4IFTA 5IKEA 4BC1A 2OCPA 5ADHA 2J32A 1VGQA 3IP5A 3ZU5A 1KYWA 4EPYA 2DTEA 4DMRA 3HEBA 3I2KA 1IY9A 4MYRA 3BHNA 3T95A 2ZJ8A 3NS7A 2EJCA 3UQYS 1U28A 2ZUEA 3GROA 3H9QA 1RWWA 2XZLA 1LDBA 5EHXA 1JHVA 2C4UA 4L5BA 4M0DA 3ENWA 4QYIA 2VO1A 1NSTA 3OMLA 4B5KA 1N2CE 2ZU0C 4RV4A 5F64A 4JX9A 1FS4A 3ZXYA 3O4FA 2IJGX 2NVUA 1A72A 4J2OA 2HMYB 1L1EA 2JI4A 4QG3A 4L9AA 4P7KA 3T3GA 3UH1A 5JALA 2XVZA 2YXBA 3SR0A 2GS9A 3A9UA 2RIPA 2XUDA 3T5PA 4UULA 2IUSA 2NU6B 2G83A 4HMPA 1Y3CE 2IDKA 2PA0A 4RZHA 3MT0A 5TQJA 3ZWCA 1PJTA 1NUPA 3T9AA 1W48A 3ABZA 2M6RA 3FLMA 3KDAA 2OZKA 1Z68A 5BT9A 4JLSA 4O4IA 4HUQA 1I6LA 5F78A 5LA6B 4KO8A 2G5TA 4FB5A 2CDAA 3K94A 3SHTA 3V1LA 3ZV7A 3JR3A 1JTVA 2B4AA 3J7TA 3KZCA 3QBEA 3GXOA 5EWLB 3CUSA 2Q3EA 1VPEA 1I3NA 2CGEA 5D7BA 1KGSA 5E38A 3RFXA 3SGLA 4DF3A 4ECAA 1MIOB 5AW4A 1K4KA 3ENQA 1OZFA 5E3JA 2K4MA 1B3BA 3DUFA 2FQ1A 1PZEA 1D7AA 4P53A 2JIBA 4NATA 5K0EA 1TXGA 1E8NA 1N5KA 1TMYA 3GR6A 3HLYA 2GCIA 4K2AA 3RB8A 2KYRA 4A5SA 1GG9A 3AP2A 4LRSB 2W00A 3FRHA 2C3MA 2I55A 2J5XA 2CUZA 4P4NA 1EFHA 4DFDA 1E1LA 1DEOA 3OCZA 2IYRA 4DMUB 1U8CB 2F17A 3S68A 4NBNA 4WA8A 1OBCA 1U3DA 4WW0A 3UCEA 4H16A 3PNYA 4LGMA 4EYOA 4Y2RA 3T6KA 1RC8A 5JT1A 5BWLA 4KSYA 3OE7D 3UTCA 1ND5A 3DBHA 4Q4AA 3FNGA 3TQSA 2VPXA 1PQYA 5HQTA 4Z9XA 1N1GA 4TKVB 4AJIA 5C5IA 1J2RA 5LQAA 2J48A 3JRWA 2B4YA 1XU7A 2XA9A 3ZPXA 2QRHA 2AHRA 5CW1A 3IO3A 5F7ZA 3ZIUA 5KSZA 3DW3X 3EPLA 4KR0A 3FVVA 4DLVA 1PWXA 4YAFA 4CL3A 3BUSA 2Z83A 2ZSKA 1SG9A 3O73A 1QGAA 1N7IA 2RHBA 4P08A 5K3EA 2YRXA 3LHDA 4RTMA 3EIWA 3LWZA 2DR0A 3P71T 1M2OB 2BF7A 2XMRA 5T4FA 2MSWA 1VB3A 3H8SA 3LL7A 3B3FA 3LFUA 3VR6D 4DB4A 4FOPA 1C0KA 1EFVB 1NZDA 1UBCA 2ZI3A 4LI0A 3INYA 4C20A 1F7UA 2A33A 2Y92A 1AHIA 1XDUA 2FW0A 4OMCA 4YROA 1ETHA 4I36A 3I0NA 1JG7A 4KREA 3W8DA 4Z54A 3EOBI 5TPZA 3OETA 3PUVA 2RJ3A 2FSUA 5ALNA 3TMYA 3ZTWA 1C3XA 1ORDA 2Q5JA 3N2EA 4GPAA 1LD3A 1C9KA 1JJ7A 4IDGA 2HJHA 4J0HA 3RAJA 4BDSA 4FGLA 1P5ZB 3QV2A 3TXAA 4KACA 4JI2B 4K0KB 4JEMA 3S2UA 2GKSA 1CRLA 3FCEA 4MRAA 1NUQA 2G3YA 5JSZB 2BZSA 4BMNA 3ZGYA 4EVSA 5I3CA 5DGCA 1N2CA 3NWBA 4CT0A 4XM0A 2YXLA 2UVQA 2BY4A 1EKXA 1R1DA 5DPMA 3VNRA 1XTSA 2JJQA 4CFYA 2JF0A 3VNBA 1NWHA 2LDXA 2JEYA 4TVSA 2WYWA 3AERA 5KDOA 2QMHA 4CM1A 2VQ3A 3ZD6A 3IIEA 3QPVA 4G0QA 1Q15A 3IQDB 4WXPA 4V1CB 4NDAA 1JXOA 4BFZA 4PG7A 1MXFA 1CLEA 3OKAA 3RT1A 2C5HA 3TNFA 4ZGWA 5EFZA 5EEHA 5GOTA 3KSMA 2EV9A 2YYYA 5U4QA 2K5UA 1Y33E 4RVNA 4KBYA 3L06A 4NIMA 3KKEA 1NMEA 4YDHB 2OHHA 1NQXA 4FDVA 5JMTA 1AJEA 2E4AA 2JJYA 4U6QA 3RFUA 3FPLA 1Y89A 2PVPA 3KHTA 2PXHA 2ZFUA 3AZOA 3CXUA 3N05A 4IF6A 3VTAA 2PAAA 5HP4A 1BMQA 2OC4A 4MS1B 4YFVA 1SD1A 1H2YA 2JAQA 4HNAB 1NVVR 1RYNA 4IXNA 4P31A 4UEJA 4UNSA 3JQCA 4L85A 1EVKA 2BFFB 2REQB 3PNKA 3QG1A 3TBHA 4B34A 3FOFC 4Y0NA 2ZJ0A 5BWNA 2VSYA 4NH0A 5E7IA 1JKJA 3AHCA 3IMCA 3HXMA 5KYXA 5EMHA 2NPOA 3B1YA 3PNBA 1W5EA 4DJTA 5KTMA 2RAFA 1CYEA 4EA9A 2FZWA 3SC3A 3O83A 3PX2A 2HIHA 5KC8A 1T4GA 3QVSA 3RC7A 4ARAA 2VXYA 3N0RA 2WV9A 4QPCA 3V34A 4DV5B 3NRCA 4DV1B 4UUAA 3K0CC 1RCTE 3GFVA 4O1MA 4P2GA 4TZ6A 3IT2A 4CKCA 1IH8A 1TFUA 2AGVA 4KPGA 3LOQA 3H2SA 4O2LA 3P9PA 4F93B 4HQFA 4MMXB 1KI1A 5LDDC 1AY0A 2D2EA 3DKRA 2ZIAA 3E4CA 4XLTA 2AYZA 4B7UA 1MPTA 2FFHA 1J8DA 2XE7A 3PP8A 3V1UA 2QBYA 3PPWA 3AB7A 3AIKA 1H05A 2E7ZA 3ZWXA 4DLRA 3F4BA 2V7XA 3V4ZA 5BNIA 1V3UA 3IODA 5GP1A 3EOZA 2NPIA 3PQ2A 4F9TA 4JC4A 3P96A 4JOSA 1FYEA 4OG2A 4KLRA 1F6BA 1TT5B 3FKJA 4G9BA 2GZ3A 3T34A 2TRSB 3D43A 3GCXA 2XD4A 4ALJA 3JQFC 1QYWA 5DM1A 5JROA 2AFHA 3B1KA 1CY6A 1ZLXA 1NQTA 4DARA 1E7SA 5KTSA 4G97A 1U8ZA 3FF1A 4PAOA 2RGGA 2RIRA 5FYDA 4FYWA 4L15A 1X8KA 4KQ6A 1CX9B 4BO6A 3OQIA 3IXQA 3UWOA 1A98A 1E4EA 2YJ4A 3WKAA 2Q50A 2VRWA 5JZBA 2CNWA 1NSFA 1SU4A 1TA9A 4FT2A 3KHSA 1JIXA 3ROQA 1HMYA 1E9CA 1EDZA 1SJ9A 4YMIA 2XUAA 5DNWA 4ETNA 1ZM9A 5KSOA 2Y1XA 4M89A 3AU8A 4AZ3A 4O4HA 2INGX 2OLEA 4G01B 4UXHA 1UJ2A 5LUAA 1EQUA 2YMLA 4QNNA 4URUR 4YO7A 1AQJA 1CUCA 4WZ6A 4LDZA 4EUHA 2AMVA 1U6KA 1BWRA 1JQBA 1DPFA 1O1YA 2A9PA 4GUAA 4E5UA 2CC2A 2NQ2C 3DBOB 3LUDA 2H4YA 1V5EA 3GGDA 3HCCA 3PFIA 2QT0A 3L7AA 1OTYA 2QPOA 1VMKA 5HOQA 4GDFA 4M38A 4PPYA 4Y9SA 3JASB 4E14A 4J8PA 4JXZA 5IVPA 1RRCA 2BHSA 3KV3O 3JQFA 1M2FA 1WD7A 2R8ZA 4MIEA 5IVDA 4JJZA 3R7LA 3GEBA 4BAGA 5HWSA 3LQKA 4M83A 2OVFA 2I29A 3MERA 1U7ZA 4HDCA 1LH0A 2ZK7A 4EF5A 4TVOA 3GQBA 4R6WA 2ONJA 4PW0A 4Z0TA 1UPXA 2GJSA 2R65A 4WOBA 4ITRC 1E3TA 5LP1A 4NG5A 2AN5A 2OWEA 3R4VA 3OZTA 4CT5A 1SG6A 3ZLJA 1PS0A 4GGPA 3QNUA 3QPDA 4MV1A 3HZZA 4F6LA 3WLOA 1C3VA 2HO5A 1S2GA 1K6JA 1GO2A 1Z56C 3HCWA 3IAXA 3NEJA 1YVRA 4IJKA 3KTFA 3LHIA 1PSWA 4KGVA 1FF9A 2A1IA 1Q5PA 4BDTA 4LTMA 2CEKA 3H2YA 2P9CA 2V4UA 3RYTC 4D9KA 5B36A 2FSSA 5K0BA 4O2AB 4YMGA 3F8SA 1FDSA 5L3RA 4AICA 2HKIA 3NNSA 1E1CA 2R7NA 3AXTA 3HB9A 4YCBA 2ISQA 4ISBA 2H29A 1NTOA 3BQNB 2RGXA 4JLWA 1H6BA 3SP1A 1A8PA 2AG5A 3QWIA 4ON9A 5CITA 3GAZA 4HAOA 3P9ZA 3R7DA 1J70A 3N39C 4Q34A 3AYXB 2BM0A 5D7NA 3HO8A 4QPDA 2JFNA 8MHTA 4B0OA 4EB8A 2ZLBA 2PXCA 5TDHA 4XDGA 3RGWS 3UWMA 5ELMA 5KYWB 3N53A 1F2TB 4WESA 1ZHHA 4BB0A 1MN6A 1KAOA 1YA8A 3JQAA 1SA0B 3MUOA 2EEZA 2P9JA 4FW9A 5DWQA 3K5PA 3UM9A 3LUHA 3QWAA 2RKOA 4YONB 5F77A 1Y8RA 3U81A 4HWSA 2IHYA 4C5AA 3K0AA 2X8JA 1E3QA 4J90A 1BW9B 3I9NA 2DPXA 1Z88A 3ERCA 3LT4A 3M6XA 3STVA 3HXTA 1JIIA 2FLKA 2ZTHA 3AX6A 5JYCA 3RYCA 5LQCA 5HTOA 1E7RA 2PL5A 2WQ6A 1HE5A 1ULSA 3R09A 3V9AA 4RZIA 3FTFA 1GKKA 1BJRE 1V9SA 1Y5RA 3AUJB 4MOWA 2PMKA 1HK7A 3IP7A 4GX1A 1NLUA 1C14A 2KWIA 1X1SA 1YZFA 4LJ9A 4LNAA 4CDMA 4CEJB 4CV1A 3EWNA 1A9PA 4L74A 1DKMA 1YQQA 3BE4A 3UCXA 2A0KA 3OLWA 3L7JA 4WZBE 1Z83A 3RR2A 1RXCA 2W2KA 5AUNB 2QVBA 3TLXA 4YAUA 5E8JA 4B76A 3L7LA 5KU7A 2QTBA 2XJ9A 2XJ4A 5ALYA 3H4TA 2UZIR 3G7NA 2V1XA 3OMWA 3OHPA 2FLVA 1C0PA 1XK7A 4L8GA 1E2EA 5F3RA 3KQHA 1QAOA 4QEDA 1G5IA 2A4MA 3M4JA 4K81B 4CR6A 1AHPA 2ALJA 1GTJ1 2WAOA 1ENZA 4G0YA 3WDSA 5IJXA 1WQ1R 2A5LA 3ILVA 4OI4A 5K3FA 3FYTA 2ZBVA 2WJAA 1SXPA 4IG9A 2G1JA 2ZBGA 2Y67A 2CNKA 3EZNA 4MWCA 3KLOA 4RTLA 2IZ0A 2P6MA 3DXZA 1EK0A 1NRWA 1OLUA 1U3TA 1YQUA 2VH1A 4R8LA 2B8JA 3ZNPA 3KNZA 4O4LB 2H1OA 5EMNA 2AMJA 4QPZA 1XVUA 5C4IA 5LR6A 3ZDZB 4HQLA 1QKJA 2QPAA 1E4VA 2R6DA 1NJ6A 4RA9A 1CIJA 4IEEA 1XCLA 2JATA 3O91A 5AXBA 2C3UA 1BYIA 2XXJA 1ZMOA 2BP7A 1WXQA 4K6GA 1EBBA 1QIMA 3QPCA 4U7JA 2GCOB 1FQKA 2GHRA 4F3CA 3BF8A 2H0RA 5TMDA 3R7WA 2HM7A 5C35A 3TG2A 1CNFA 2QXYA 3PDJA 1G5RA 2OFWA 3DMTC 4Q1FA 2NLOA 4EZIA 3CUKA 5FNVF 3KKQA 4N6OA 2I8AA 4UM9D 821PA 5ALRA 2D59A 3AEYA 3I04M 5JBIA 4D74A 1S3IA 2DSNA 3E3NA 3NTRA 1QXSA 1SY7A 3IP8A 4TKUA 2DECA 5FPYA 2HLDD 4M9QA 1DBIA 3UJHA 2Y0PA 1GKYA 1JJFA 4P4UA 2XNCA 2FUCA 3MJVA 1G0NA 3A32A 4G5HA 4ZO4A 1L3CA 3TF5A 1GRQA 3II6X 4YJGA 1NN0A 4IG4A 4OP1A 3RK0A 3UIEA 3B6ZA 4ER6A 4X44A 1GTVA 1N0UA 1WM1A 1YQDA 2VUIB 2WR8A 2AH5A 3AW9A 1NN3A 3MWDA 3RBXA 3ST7A 4LF5B 2LRHA 1DDOA 4B6RA 4DEVA 5CCXA 3OA0A 4L8VA 3I73A 1Y42X 3IALA 3GZNA 3EQ7A 4ND4A 4XEHA 1T0IA 1R3UA 4DSNA 5IF9A 1PNTA 2HLHA 4KO2S 2WF9A 2YHIB 4XOIA 4YRAA 2SECE 5LJLA 3FNHA 1TEHA 3EJWA 5EIAA 1N8TA 1B6GA 3RYIA 3SCZA 1LF0A 1RQLA 2XGSA 2PT9A 2GNPA 1G60A 1H85A 1Q0HA 2QE7D 3BZWA 4IWXA 3OQOA 2FMIA 1Z2CA 3G7UA 1HQDA 4GRDA 2DWCA 4B7CA 3A2MA 2VDLB 2DULA 1LPAB 4H17A 4WH0A 5HE9A 3DMTA 3TD9A 5E4YA 3A4IA 5BSWA 1JYFA 2F9LA 4IDOA 2ECFA 2ZTVA 3EAFA 3C7CB 1YNOA 4P2BA 4RDCA 1E2IA 1GKIA 4EGSA 3VDMA 3DV0A 4TKZA 4A23A 3CLUD 3HTXA 1KJYA 3SHOA 4MGIR 3OT1B 1V1JA 5A0VA 1L5SA 2ATVA 3LT5A 4DG8A 1FMTA 1RWXA 1YBHA 1CZKA 1MJHA 4NSNA 4H1UA 3ZDYB 2PUDA 4MUHA 3TQTA 4D96A 2H2GA 1XRRA 4WZBA 2UUPA 3TQHA 2BRUC 2GO7A 4HPWA 3TZLA 3C48A 3UG7A 1XTVA 3WJ1A 4F2PA 3GP8A 5LZ7A 3RGGA 3WQBA 4YMVA 1F8YA 1E1DA 3FSJX 3AVTA 1ZQ9A 1U9ZA 2WSYB 2W6ID 3BULA 4NONA 3PC7A 4DMHA 3B7WA 1M66A 2WFMA 1TK9A 2V7QA 3GDGA 1GUZA 4LJ8A 4OAQA 2ZUBA 2NVWA 2J6IA 3EOAI 3SPXA 3MS7A 2CXHA 2X4LA 3TIVA 2WUVA 2ORED 2UUOA 2EJUA 1J09A 3MGGA 1N5LA 1TTHA 2CJPA 2V5VA 2VF2A 2ZTSA 2W8BB 3TN7A 3IV6A 1LSUA 4IM7A 1L7PA 1KYVA 3E9MA 3M9WA 4C4SA 1RW4A 3O74A 4N7JA 3W5CA 1SVNA 4ZTBA 1Y8QB 2EQ5A 4G24A 3W7VA 4RTRA 2IPNA 2IOHA 5AVKA 2IYVA 4ZJZA 1K66A 1KSHA 2A9JA 4UCFA 5LN1A 5GV8A 2C1EA 3J80A 3EVZA 3W78A 3FDFA 2VYND 3MT8A 4KW7A 4M8LA 2OK7A 3CT6A 3IMFA 4IFIA 2WIAA 1BEUB 4YB8A 3UHPA 2FLWA 5FEUA 5EZYA 3TAUA 4EPXA 3AESB 2W6PA 3UW3A 4PE5B 1V41E 3NBMA 4F91B 3A8TA 3U56A 5FL7D 4M0EA 2DHEA 3SVZA 2FOLA 2I65A 5A4DA 1G1AA 4TMTA 3GNTA 5HBGA 4C0JA 3IDFA 1AMNA 2QJRA 3Q4GA 1UBOS 1W29A 2R1TA 3PDWA 4LYFA 4DNFA 5B2EA 1C7EA 1SVWA 3KKKA 3N5CA 2JJ1A 3N28A 5HEKA 4TTVA 4IIHA 4NWIA 1W75A 4N5IX 1XNGA 2XSZD 4MWBA 3WI7A 3H99A 5GWXA 3SJ7A 4XGQA 1ORTA 3JZMA 3WG9A 1K4MA 2H8KA 1SZDA 2VDOB 3IMKA 2H00A 4QQKA 3OCUA 3WK7A 2B2NA 3I34X 1ZXBA 2OORA 3CEHA 4HY3A 3HCRA 4MARA 4TM8A 3F78A 4B6EA 1SC9A 1ZNZA 1FFWA 1JHUA 4JEHA 1H4SA 2IXTA 3HNOA 3W34A 2VDWB 4NS4A 3OZCA 3RQIA 3T3NA 1YL5A 3D2LA 3HS3A 2ODQA 3DL4A 3O4VA 1R8XA 2ON6A 2GJ4A 3R6DA 4OOEA 5K8TA 3HYRA 1QHGA 1N6OA 4AY5A 2DLNA 3FUUA 3FDXA 1BVYF 1QJCA 3D6AA 3QA9A 4HTFA 4KUGA 1OLSA 2HF8A 4XH9B 5F9FA 1P77A 1SCAA 4MJLA 1K92A 2M2IA 5K9ZA 3OOJA 1KDTA 1TCUA 1Z0FA 1Z7WA 2D2VA 1WB9A 1WVGA 3LT2A 2QF7A 3PPVA 3WWDA 4Z51A 1NLMA 5BYKA 1T6XA 4BLOA 1L5KA 3N8IA 4DYVA 5AVSA 1Z3CA 1E20A 1O89A 3EEYA 4F1JA 3R0QA 2JGAA 4AL4A 5HA5A 3EA0A 1WVIA 4AS3A 2UU9B 4BXOB 2TS1A 4M9RA 2IHTA 1KZ6A 5ES4B 1NJ1A 3EVTA 2HIMA 2AW3A 2QX8A 4ZICA 4MCIA 1Z2NX 2R5FA 5LP6B 3VHRA 2WLSA 3PHJA 1LF5A 2H1VA 1ZC4A 1VCIA 4O3FA 5JXJA 4L6IA 1EQ2A 4V38A 2DQKA 2X5OA 4R1MA 4EZBA 1V7CA 3HVIA 1NX6A 3VPSA 3X2FA 1FDTA 4WKBA 1CEEA 5EIWA 1WZIA 2IWHA 2LV8A 4BZXA 5IJWA 2PWPA 3K6JA 4L02A 1RXYA 4HNGA 1G3IA 3QKUA 1ZHOA 4Q7EA 1RSZA 3N2YA 3OJWA 4Y1RB 3GUUA 1Y6FA 2IXAA 1B1CA 4HKTA 2ZREA 4KLNA 3LDUA 2DM6A 3GEGA 1O0BA 2I4IA 4WY2A 5JAQA 4PONA 3A6JA 1U2PA 1PR2A 4CQMD 4ZGGA 5LYJB 2PJUA 1OAAA 4DNOA 4NBSA 4PVDA 2VT6A 3NYWA 1DWQA 2QTCA 3HADA 1BX3A 4PHFA 1DP4A 4G5FA 2I2BA 5IX8A 4M37A 3MXTA 2FP4A 3UICA 4UE2A 3ILSA 5TLSA 3IR6A 1KRXA 1AKNA 4GP6A 2ENUA 5DP2A 4NJEA 4KR3A 4PN7A 1I3LA 4LMAA 1AD2A 2AOWA 3QFFA 3V4VB 3IAM1 5AW9A 4C05A 2PLAA 4LNHA 2FEKA 2R0QC 4JA2A 4XCXA 1DAFA 1NE2A 1R4MA 1UXHA 5K8UA 2WKPA 4R40A 1XAIA 3PVZA 3W4JA 1Q1QA 4DS3A 2Q9UA 1OYWA 1XZGA 2QN7A 1ZH0A 5CP8A 5JXWA 2VJYA 3LFTA 2C2HA 3E8SA 4D9JA 1E64A 4D6PA 2GXQA 2CLSA 1NZJA 3IPYA 5SYNA 3O3MB 3TQQA 1RI4A 1BEZA 3NASA 4GRIA 4TN5A 2RK6A 3ZTTA 1F0NA 1NLZA 1QQ5A 4NBKA 3DNPA 2EGGA 3IOCA 4NVRA 3CWCA 4B45A 4DLZA 3U4QB 1JDUA 2P9QA 2XVMA 4MYUA 2ATXA 4ABYA 3GFQA 1UMBA 1RP7A 1W96A 4R98A 3F5DA 1Z26A 1D2AA 2DUJA 3GT0A 5ECGC 3SWWA 2CFIA 4MI6A 1EK1A 3VSCA 1N2HA 2O2GA 3S1AB 4IHJF 2GK3A 2GYWA 1U3GA 4JCCA 3UZUA 4IDPA 3SSAA 2H63A 1IXSB 1OTXA 4JI0B 3E61A 3UT0A 1YJ5A 1CK4A 4YQFA 2FKAA 3I9V1 5EINA 4RHEA 3WL7A 4J4TA 2PL3A 5HZGA 1SC4A 3Q8MA 2YMMA 3SYLA 1RPJA 2VUSA 5HUHA 3IP1A 3IIKA 1Z0IA 3ESRA 2FWNA 3A4VA 3U4AA 2JGIA 3TOZA 5M04A 2G82A 3PF8A 3BHJA 1ANKA 1ZCFA 1ADBA 4HPJB 1SQGA 4KFTA 3L4BC 2FRVA 2I2CA 3NCHA 4G8JA 1A2QA 2OFOA 2PA3A 4X6XA 1E9VA 2IW1A 3K2EA 4PLHA 3H18A 2LPMA 3OF2A 3HFGA 1MOPA 1G8MA 4WZAA 1X1RA 2PJRA 1KJ9A 2ODAA 1Z0ZA 3EG5A 1RWVA 3QE4A 1HRDA 4YCAA 2IV3A 3YASA 3RSLA 3KJXA 3PGXA 5B55A 1TZBA 2PYZA 3AVXA 5JAUA 3PNVA 3RYHA 3A10A 1HWYA 1VBNA 2JGDA 5FADA 1Z6ZA 4HVTA 4L9RA 4BNDA 4WD3A 1M74A 3VR5H 3PUIA 2CNDA 1VHWA 2WILA 4A8TA 3BD6A 4UVGA 3QEBZ 3OQHA 4EUFA 2PEYA 1NURA 1F17A 3BMQB 4Q9DA 2OCXA 5DTMA 2V74B 3EC7A 3AR6A 5EQFA 1V1RA 3RSZA 3ND6A 3PS9A 1W30A 3W5UA 3RHZA 3QKSB 4Q7QA 1GG2A 3M70A 3DT6A 2A1UB 4OMDA 4E5PA 2XCUA 1ZN2A 1G6HA 2EDCA 4JT2A 1VMDA 2PZMA 4ZOLA 2OVBA 1DXOA 3FYUB 3DJYA 4AFNA 4Z2YA 4OHMA 1PG0A 1JFLA 3L4BA 4QPPA 2G25A 1F8UA 1QIDA 3D3KA 3HCAA 2NVOA 4OHUA 1IK4A 2LTAA 3AETA 1G38A 5KQGA 3O03A 1LI4A 5F2NA 4YALA 4BRWA 5JH7A 3SHQA 3UT5B 2JFOA 4B1FA 1VI2A 1KZHA 2HH9A 3IP3A 1JX6A 2AUMA 1A2BA 3K5WA 3C1UA 1BSVA 2OO5C 3E1GA 5FWDA 4FE4A 1IN6A 2BOVA 1CP2A 3SFZA 4RACA 3B7GA 1HDZA 1RYYA 4FE3A 4WACA 3PC8C 1IM8A 1EXMA 3GPIA 2EHDA 5JZVA 1ORWA 2W6JA 3TR6A 1ST2A 3DL2A 4GI5A 3SZRA 2HQ1A 3O8RA 3K70B 4DM3A 3QSYA 5L7YA 1N6NA 3K92A 4LGVA 3RVKA 1GV0A 4FI3F 4KQHA 4LEIA 2PX6A 3UG6A 5FDFA 1YFJA 4IICA 1KMCA 1YZTA 4BC0A 1KJZA 5CDSA 4Y67A 3F6CA 4HBZA 3WWOA 3JU3A 4C43A 2D5IA 1H8HA 4KRFA 3TYXA 5HM8A 4RENA 1UC8A 2O7QA 1NYQA 4Q1DA 1HV8A 4KK3A 3FHLA 4WI1A 1ORIA 2E4XA 1G20E 5EIBC 3CUWA 2GN9A 2XGGA 1VTKA 2WAAA 4P98A 3RUHA 1C4OA 5BQ3A 4IQGA 4LQDA 4UDXX 1Y6QA 4IR7A 1QFJA 1PF7E 3REOA 5KINB 4GKKB 2PT6A 1OZ0A 2ASEA 3CJRA 2Q28A 4PS1A 1ENPA 2G0AA 1MRZA 4JJ8A 1GKLA 2MSEB 2V1UA 2OO5A 3D4OA 2BKVA 3E7DA 3NHUA 2QORA 2B6NA 1NVAA 2H4HA 3LYAA 3AY0A 4TWRA 4OREX 3WKBA 4BECA 1ECPA 3PHCA 3PC8A 4WDRA 5EE1A 3A9SA 1LW6E 4AO8A 1KI2A 2IUFA 4YQEA 4NCBA 1EHCA 1PFGA 1WUIS 1QM5A 1XCMA 3CNNA 1DO8A 1KH1A 1Y1KE 2GBIA 3HBNA 5FHRA 3TL2A 1EHIA 4GL4A 2VYVD 4TMZA 4QGFA 4H3VA 1KGDA 1C30A 1T13A 2QP9X 3LBNA 4M7OA 3CPJB 1PWHA 3NVMB 2YRFA 4JHLA 4GF5A 4LPSA 1XZDA 2IEIA 5AVOA 2HF2A 1GPJA 4KN8A 4P54A 3B3JA 4I50B 5LDGA 1LVGA 4EY8A 1K7FB 2J9FB 4DIOA 5AUPB 3B1VA 3PR3A 3D5QA 1SUAA 2HA6A 4U2CA 4BS9A 3OIDA 4G0UA 1T5HX 1JAXA 1O2DA 4DIMA 1RTKA 3OZFA 2O8FA 1ZP6A 3I92A 3B20A 3I8SA 1EFLA 4K9OA 2H9IA 2OGWA 1NASA 2H3HA 4LK3A 5HIIA 2PX5A 2QD5A 1SBHA 3IESA 3THYA 5DYWA 4RZSA 2QRKA 1JG4A 4PC2A 3KKPA 3KHKA 1ZXXA 3A2NA 3OPXA 4N0EA 4RSGA 2B69A 5A4AA 3BTSA 5D51S 1KO8A 4IV8A 4O63O 1YJQA 3FDIA 3EIXA 3I9JA 1Z4MA 1BMFD 2I67A 1ULTA 2ILVA 1IMOA 2GSDA 3W2HA 1Z4JA 2YWRA 3V33A 4PLFA 4F96A 4ZYWA 3EYAA 3G6WA 2CXUA 1QC5B 2JPDA 3NORA 3AK4A 4LOKA 1DLJA 2BE7A 1Y4ZA 2MINA 2JB9A 1T2UA 2QD1A 1KNQA 3VR5D 5TVGA 2X4IA 4RPHA 3RQSA 3O31A 1O9HA 1DXQA 4MQUA 1SEVA 4QIHA 1QCCA 2FYTA 1L2TA 1JWAB 4IDCA 4H15A 4YRLA 4GOLD 3JWHA 2QTWB 1Z5UA 4Q9IA 1XJWA 3ENZA 4Q9LA 4AECA 1HLGA 4EA6A 5LYJF 3AVWA 4LNUA 4YAIA 1HA3A 2YZ2A 3D0KA 2C5LA 3R1IA 5AVYA 2PKCA 3ED5A 3LLVA 5EXXA 2P75A 1CQZA 1E1QD 1HFWA 1KZYC 1RCFA 3R3YA 1SR8A 5ALMA 1NM5A 4XEUA 4EHIA 4Y7CA 4XA8A 1AK2A 1JH9A 1TO2E 3U7GA 3ZVMA 1T25A 4RQUA 1OX6A 1UFQA 2ESRA 3GVPA 4JC8A 4P4SB 4PHCA 4WXYB 5K2MA 5LMUB 1TAHA 1YR9A 4EJMA 1SG0A 1JDVA 1ZUIA 3UJ6A 4FK8A 3U3ZA 5ADWA 1IZ0A 4E5YA 1RMYA 4OQ4A 3ZDQA 2RDMA 3NOVA 3OO1A 4PXYA 4JB0A 2F64A 1N2GA 2ATEA 4PZCA 3RUCA 2CFRA 1UPTA 1HLPA 3HJHA 3L1VA 1TK3A 5F2OA 3ZBTA 5L3SB 1BA2A 3FUVA 2VT3A 1O4VA 2V97A 1VJDA 1XD2B 2HHAA 4BJ6A 3J81A 4D3YA 4UEOA 4GM1A 5AHOA 1ZBDA 1GL6A 2IY8A 1M75A 1ETUA 3ICWA 4OAPA 4UMDA 4RMJA 1OZHA 3RTBA 3L6UA 4LRXA 1IWBB 2AXQA 1XRJA 3ZH2A 3RS7A 5LVAA 4C0KA 2ZBPA 1S8NA 2QRZA 1SXHA 1DBWA 3C8ZA 2OM2A 2NUBA 3AR8A 4RKWA 1KOGA 1WCXA 3T7EA 1CTQA 1PUJA 2Q5EA 5D3KA 2ZI4A 5KTRA 1X7YB 3VZCA 1LK0A 1YL7A 3N0WA 4GKAA 5EGSA 3PWSA 2CN1A 2YY7A 2VP5A 1VYUA 3W5VA 7MDHA 2AWOA 3DEFA 4KDEA 3IP9A 4LXYA 3VZBA 1CD5A 4Q4DA 2ZTUA 5IW8A 2W8ZA 4GS5A 3NM6B 1EVYA 3W04A 2MSDB 3NVAA 4O2RA 4TKMA 1TIBA 3SJUA 2J5BA 4C6RA 4RVUA 1AKQA 1NSYA 3URKA 4B32A 3CJTA 1UKAA 1B00A 1W85B 5LKAA 5SY9A 3LRPA 1FEZA 2AIRA 3ORQA 5TJHA 4DT1A 1RZUA 5LDHA 1FJXA 2SNIE 5B12A 4HNSA 1NKTA 5CT6A 5I9NA 1E2LA 1QHHA 1AF4A 1SOAA 2WAYA 3R7BA 4BN0A 3X44A 3R9XA 3EEOA 3I6YA 1YACA 3KPWA 1IPEA 2VUHB 3QHQA 3UJDA 1CR4A 5IWCA 3TNLA 3RKRA 2QUIA 4YJHB 1U99A 4Q24A 4B44A 3L6DA 2I2FA 4CKZA 2PD4A 3TSYA 1VE1A 1YONA 2OAQ1 2ZB7A 4R2MA 2JLUA 5KIAA 4CCAA 1W4BA 5JD6A 1XQ6A 3HJAA 2SICE 3LNTA 4QOFA 1ZJZA 3UVEA 4NV3A 4QUAA 1ZH8A 2CD9A 2KQUA 3H6HA 2AI3A 3NWPA 5AVUA 1P4HA 2AVDA 1DKOA 4C14A 1VYTA 1V5FA 1GTL1 3CCCA 1JEJA 1GARA 4LVCA 2HPAA 3NBXX 4PQEA 4BQSA 4WBNB 1VE9A 1YBVA 2K6GA 1KZGB 1Q1ZA 4TTRA 1ZM4A 3IEXA 2J08A 1ODJA 1UEIA 2A0XA 2PGDA 2ZCUA 4NYIQ 1KAMA 3ZY3A 3MJRA 5JHGB 2HIGA 4OB7A 4QDOA 4DCUA 3OUUA 3GNSA 1X7WB 1MC1A 5KNCH 3DKPA 1IWPB 4UHCA 1VL8A 4ASUA 2PH3A 3BB3A 1XBTA 3L04A 4KHPB 1CFZA 2A0YA 1VDZA 1E2GA 3DZCA 1MJ5A 2AC7A 2VBGA 2ZT8A 3SU8A 4G1VA 4DCNA 2UKDA 3QVLA 4QL3A 4MH0R 3IQFA 4TTSA 2RGDA 4IVRA 2GAAA 3I61A 4FGJA 1W5TA 4Z1MA 3ER8A 2BWJA 2EWWA 1SVIA 1T36B 2G5CA 2F1JA 3M4XA 4RCYA 4UHKA 1WLSA 4RTNA 1SIUA 2X86A 3KEFA 4JBNA 4PRKA 2HZBA 1QGUB 1R4NB 2O2ZA 3HP1A 3DOOA 2CBGA 5BMOA 1FU4A 4A6XA 4ZU3A 3T3DA 2FWAA 2I3ZA 2AX3A 4P35A 5DLQC 4G5RA 1LJ8A 1L7QA 1NIPA 2WUWE 2W7TA 1QYIA 3LSTA 1SWVA 1FUYB 2XRMA 1MZVA 4NDZA 3VYVA 3ZQUA 1Z4PX 2NUPA 3BRCA 1GAXA 2ZRDA 5JSKA 4JGIA 2PPLA 3HB7A 4YBZA 4IHKA 3S99A 3Q7TA 2PGAA 3ZE2B 4EI2A 2NZVG 1V3QE 4G0MA 4HGRA 3EG9A 5B1YA 3V2GA 3K2IA 5LQRA 1S2MA 2DPYA 1PNQA 2IYWA 4YJFA 1I1HA 2J8ZA 5AJYA 4UNIA 1ZAYA 1NUSA 3M3HA 3EIUA 1BD3A 3U39A 3A6PC 3IEVA 1MOQA 1ULBA 2WJ4A 4PZPA 4BYMA 5IT4A 4CQNA 1BVRA 1ZSNA 1ULZA 5FBRB 3JYNA 3ZU6A 2C9CA 5AHWA 1NR5A 3MS2A 4KV9A 2ZWIA 1HOTA 4ZALA 3V9PA 3P2KA 3A3OA 1GZ4A 1PLLA 2V0GA 4DQ0A 1WD5A 2B30A 1OYVA 2Z2YA 3KRTA 5FWYB 4CNQA 1CB0A 3HJGA 3QJYA 1T2NA 3FD8A 4PLGA 1GGMA 4JT4A 2R6ZA 1WOYA 3I8XA 3ZWDA 1Q11A 4UC0A 4ZCTA 4NH4A 2D5BA 3R3UA 1UBGA 1MFZA 1EFRD 1V7PC 2QROA 2X13A 2OB2A 4I6GA 1NW7A 3MGKA 4JOBA 1A2OA 5FAXA 5AMXA 4KVZA 4F2HA 4DILA 5L95A 2V65A 3WLIA 2HJWA 2MJLA 3HKEA 4JBLA 3G8BA 2V0NA 2MSLA 2G4VA 3I4LA 3EGVA 2FWIA 2PU7A 2WV7A 2PUFA 4Q02A 1MV8A 1ZM2A 3C24A 4LRTB 4CT4B 2I1QA 5MFZA 1VC2A 5J63A 1FYDA 3ZE1B 4BE4A 5DYTA 4CHGA 5GJBA 1ZESA 3NJ4A 3PNMA 4TT3A 3RHSA 2XCQA 3IQEA 4X1IB 5D5HA 3A11A 4B3TB 1BXGA 2VUUA 2FUG1 2W6CX 1AGNA 2JLWA 2DWUA 1NJGA 3IAM6 3HV2A 2XA1A 4II3A 5M34A 2RAUA 4R2KA 2WTUA 4O3MA 1SQFA 3WYBA 4DLKA 1WP9A 3OLQA 4D4MA 3Q3EA 1DT3A 1J0CA 1BRMA 4LIPD 2QP4A 3V55A 2B6HA 4MRMA 5AKJA 4XYLA 3KD2A 4I9GA 3D31A 2IHJA 1IQRA 3IKJA 4A03A 2AFIE 4FJ1A 1PR4A 4L50A 3THOA 1IHOA 3Q10A 1Y8AA 3O47A 5CNKA 3WL6A 3K53A 3HJCA 2A35A 1UJMA 3VR6A 4RK6A 3BGDA 3Q85A 1NXOA 4Z2AA 5HOEA 2QLBA 3A4LA 3FSEA 4Z8XA 1UINA 3CKKA 3D2AA 3IRVA 5EJ5A 1EFAA 5BUZA 2M98A 3EGEA 4KMMA 3MRXA 4LCJA 1N3BA 3EZ9A 2Z3VA 4NABA 5JECA 2HHCA 3L1HA 4BVLA 2WBLC 4HLQB 4GI3A 1UKBA 4KIWA 5AM2A 4KPEC 2QMOA 2Q1TA 2AI1A 3LVRE 4JOQA 1NJ2A 3IUNA 1WJGA 4LWQA 4DKXA 2QYTA 2ZB2A 3OOHA 1OB2A 5JE8A 4I9FA 2VJMB 1QPGA 2OUKA 4BBJA 1L1QA 3I9V6 3NFRA 3NU1A 1RT9A 1HM5A 2BDEA 2IYOA 4FD2A 5BSVA 2PUVA 2FF5A 4LTNA 3FCUB 5KNCD 1FYFA 2CB0A 2WHYA 1UDBA 5BOSA 4HQOA 4E12A 1XDWA 5CT4A 4Z4FA 3AWIA 2FFRA 2G8LA 1J9ZA 2PH7A 1G2IA 3F6RA 4Y6SA 2QYHA 3MPUA 4GHWA 3OKFA 2VLBA 4FLFA 3UMGA 2EZ4A 3MJEA 4NU0A 2AC4A 2IY7A 2A5GA 2PCLA 4LJ5A 3TKAA 2F8LA 3EBLA 5K0TA 1XPOA 2PV7A 3PWZA 3K9GA 4WECA 5JXHA 2WEKA 3JRNA 1V8DA 3AI1A 3UV7A 3HL4A 1LGYA 3I6BA 4OV6B 3LXRA 1DTSA 2VG8A 2H7CA 4C1NA 4HDRA 1PQUA 1HTWA 3EDMA 4LJ7A 1PJCA 1VI6A 4O4IF 1G66A 4MYCA 4L7VA 5J5AA 2BGUA 4Z0HO 1A8HA 4XJXA 4BLWA 4OH1A 3W4KA 4G8CA 2A0UA 2R6HA 4LHSA 3QJGA 1JXAA 1TUBB 2IYUA 2V8BA 4OCZA 1WKCA 5BQ5A 2I4MA 3T1VA 5HW0A 3WJAA 4R9RA 5C8YF 4JIMA 4YQZA 4DLXA 2CWDA 2VAPA 3WE7A 2WWFA 1X77A 1QDUA 2X6RA 1D0VA 2BMVA 2PMDA 3D6FA 1B73A 1XTRA 1JIQA 4L1KA 2BGRA 4Q37A 4LW8A 3X1YA 1Z16A 3FWKA 3QSGA 3GJ5A 3K9NA 1I6WA 2C03A 3OJOA 3DTVA 4H3KB 1ONPA 4K1XA 3OFND 5I01A 3ASVA 3D3JA 4P7FA 2OGSA 1UOPA 4G0PA 3ZS9A 3G13A 1UK6A 2ZB3A 2W70A 3WBKA 2P3QA 3RF6A 1OXXK 3CPEA 4QGSA 4UCXA 3DC7A 4LJYA 2IU4A 4QELA 2WIKA 3WLAA 3OHMA 4WUTA 1T4CA 2GPTA 3NHSA 4WK4B 3OU2A 2GD6A 2L2QA 1JXQA 4DYDA 1N9ZA 4HFJA 1IEQA 3WVNA 1SFRA 3DZFA 1TYCA 4BKMA 1KMMA 4TXNA 2EW2A 1V25A 2MOKA 2QAGB 1Z2OX 2GRUA 5ULLA 3ZS8A 2HMWA 2BGNA 2P0YA 3TTVA 3TEJA 2PKXA 1YAHA 3JARB 3ZDFA 1LUAA 2JW5A 2MIIA 3CRW1 4V2UA 1ZCJA 3NGLA 3ROZA 3VJKA 5BSFA 4KMOA 1MUUA 3QUCA 5AW7A 1PEKE 5LQMA 1KQFA 5F1PA 2JLVA 4YN3A 5PNTA 4L72A 2QK4A 1OXSC 3B8HA 3LWNA 4FEAA 4GBED 5DWDA 1MAUA 4FR2A 2YMPA 2A0WA 3NANA 1F51E