1ID1A

Crystal structure of the rck domain from e.coli potassium channel
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
HRKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPDIILSPQLFGSEILARVLNGEEINNDMLVSMLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE POTASSIUM CHANNEL PROTEIN
publication title Structure of the RCK domain from the E. coli K+ channel and demonstration of its presence in the human BK channel.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 51
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1id1A00
2GDZA 4FBGA 3MJSA 3KLPX 3GT0A 4EEXA 4YAGA 2FRDA 5LC1A 1W6UA 4NFSA 3BMNB 3RKRA 3EMKA 3D0OA 3TZQA 1U3VA 1VPDA 3B6ZA 1EEHA 4M49A 3C3XA 5EPOA 4YXFA 3QVTA 5GY7A 2OORA 4B7CA 5BR7A 2X5OA 5TRTA 4D43A 3JQAB 5A04A 4INAA 4AJKA 1VJTA 3ZU5A 3OBBA 5I9MA 2X86A 1VL8A 3RFTA 1N2SA 4URFA 5IZ4A 1C0IA 4GPD1 1GPJA 4JQCA 2WDZA 4KDEA 4CM8B 5KOIA 1DC6A 1NPTO 5KCZA 1ADCA 3BMQB 2ZTUA 4ZA2A 4CQMB 2DFDA 3WYBA 4CMGA 4J1SA 2Y0EA 1O89A 2IXAA 3GVIA 2JCYA 1YS4A 1YBAA 5C37A 4FR5A 3T7EA 1TT7A 4IPTA 4E5YA 2O7QA 5TT0A 2R6JA 4DGSA 2CZCA 1GPDG 1YQGA 3G49A 2Y1EA 2ZB3A 1IL0A 2YUTA 4CMHA 2DBZA 5ENDA 1ZBQA 1HDCA 3WDSA 4Q3BA 2CVOA 1GV0A 4PN3A 4YTEA 5JCJA 2AHRA 4GQAA 1Y8QA 2DKNA 1WZIA 1Y7TA 2HK9A 2YQ5A 3DBRB 1DIBA 4LSMA 5KKAA 2CVZA 4A27A 1K3TA 3E8XA 2HSDA 2QRLA 3AY6A 1EFKA 1DHRA 4CM4B 1B3BA 2JCVA 4HNHA 4YT5A 2YQ4A 3JQ7A 2NLOA 1JN0A 1DIRA 1O9BA 4Z9XA 3QLJA 4W99A 4GI2A 1DFHA 1ADFA 4MJLA 5JXWA 3ZH2A 2ZB7A 4XQCA 4J7UA 4JP2A 4R3WA 4WLFA 2BI8A 3MJCA 2VWQA 4NU6A 1N7HA 2B83A 3GUCA 2CY0A 2F00A 4LRTB 3UCFA 3ZWBA 3BMOB 4BKOA 4L0QA 5G0SA 1I0ZA 1EUCA 4RVDA 1EBFA 3HSKA 4ITUA 3JQFA 1ZNQO 1SAYA 3PIIA 4WGGA 1LRLA 1T2FA 3L6OO 4K6CA 4QFCA 1ENYA 1RM4A 1HSOA 3PFWO 5DBIA 3AOEA 2Q2VA 3QHAA 3MTJA 5ENVA 1PJBA 2QX7A 2LDXA 4IDCA 1H6AA 4XR9A 2QZ9A 4UEKA 1GCUA 1H2BA 2EV9A 4E6PA 4XDYA 4ZRNA 4GWGA 3ZWPA 3FNEA 1OC2A 2CSUA 3AY3A 1PZEA 1MFZA 5U9CA 2ZB4A 5A05A 1EZ4A 3Q9NA 1GQQA 4CLOA 3C1TA 3V1UA 3AOGA 1HDXA 4OL9A 4OOFA 1HZZA 3INGA 1KVTA 5IXYA 5LDGA 2JFGA 3FPLA 3JQEA 5JAQA 4YT8A 3I9KA 4RVHA 1ISIA 3CE6A 4DRYA 4BKQA 1U2DA 3VTFA 4WCDA 4CLXA 3ZWWA 5GMOA 1I36A 4MDHA 2WEKA 3VZRA 2NVWA 4BNZA 2I3GA 4FPXA 1N9GB 2R00C 3L6EA 4IQGA 2BELA 4YJFA 3RFXA 3JD4A 4E2ZA 1VE9A 5KVQA 3JQ8A 1MGOA 4BGEA 2PZJA 4A2CA 1E7YA 5ICMA 3WGYA 1YJ8A 4GLLA 5EL0A 4IZHA 4XX0A 4RDIA 4QUKA 1DLJA 2BLLA 4GX0A 3W8FA 4BNFA 3QVSA 4WPGA 4KP7A 3WIDA 4AFNA 1N1GA 1OC4A 1AHIA 4R68A 1NWHA 3GR6A 3JD2A 2HKIA 3PP8A 5AOVA 1M75A 1A4IA 5THQA 1YH3A 1FXSA 1I01A 2FMUA 5DBGA 2DM6A 3KSDO 1R66A 3WIEA 3FR7A 5CAEA 1T4DA 1X7GA 2V6FA 4Z0PA 4AJ2A 4B8WA 4GGPA 3JCZA 4J1QA 1UAGA 3PHHA 5A5EA 1PZGA 1FDSA 4RF5A 3ZU4A 3RAJA 1I32A 2BFMA 1DBVO 1NR7A 4N7RA 4CM3A 3BTOA 4DTIA 1HZJA 1SZJG 2UYYA 3JQFC 4Y6SA 4CM6A 1SEVA 3I5MA 5CDGA 1XKQA 1YOVB 1XLTA 3U0BA 1TA4A 3AOEC 5AXAA 2I9PA 3ZW8A 2QQ5A 3C1AA 1U9JA 4Q3CA 5JY1A 4FOSA 4PLHA 3O26A 1DJQA 1WXDA 2VTDA 3WGZA 3AU9A 5KNLA 3LT2A 3DTTA 1DOHA 2H63A 2HMUA 3FWNA 4EUFA 1YB4A 2V6GA 4G2NA 5COAA 1IYZA 5H83A 4BNNA 1DHTA 1DO8A 2B4QA 4FDAA 2EP7A 4JBGA 1SEPA 2CF5A 3WFJA 2FZEA 2ZQZA 4OXKA 3VOSA 1KC3A 4BNHA 1UH5A 3WGQA 4CPDA 2Q2QA 3RUHA 2GN4A 2DC1A 3QE3A 1PX0A 4E0BA 2PA3A 2NTJA 2JJYA 2O2YA 5TGDA 3W1VA 1S7CA 3OH8A 1RYEA 4E31A 3V5NA 3PJGA 3IAHA 2PZLA 4KUEA 1PJSA 3D3WA 2H6EA 1T24A 2EERA 3DZBA 4OM8A 4R9RA 4WECA 3RSHA 5JC8A 1M66A 1M67A 1P31A 2O3JA 5DP2A 3IJPA 4J2OA 2JD0A 4FGSA 4M54A 3ZWAA 1ZSVA 1P3DA 2W2KA 4HFJA 4ZHSA 4C4OA 1JAXA 2Q3EA 1F0YA 3F1KA 3RASA 5IDWA 4QFDA 2EKPA 3L0DA 2C2XA 1LU9A 3QP9A 4Z9FA 5KKCA 2X8LA 4XIYA 4R41A 5T64A 5C7OO 4R5MA 5G4LA 4EI2A 1K6JA 3BHIA 4XKJA 1WZEA 1LTHR 4HFNA 3UW3A 4MVJG 3WMXA 4YRAA 1XSEA 2ZJ1A 3OJOA 3HG7A 4P4GA 4D0SA 4JJFA 3IMFA 2CNBA 1ZK0A 3VKUA 1B8UA 1M2WA 5C7IO 4IXWA 3E48A 3BMCA 3OICA 4GH5A 1P44A 1EVJA 2GERA 3S55A 2VNAA 2IZZA 3NDRA 3GZ4A 1P77A 5HS4A 2FPIA 4CQLB 4S3MA 5L9AA 1C0LA 3U09A 2QRJA 4FFOA 1YGYA 2WMDA 5ER9A 2A92A 1ZJYA 4L4XA 1GU7A 4PG4A 3HWRA 5B37A 4MIEA 4EYEA 3ZV3A 3EGOA 1I33A 4NQZA 1U3WA 2VNSA 2PD4A 4IDGA 3PYMA 2NM0A 3GDFA 4Z0TA 1PU2A 4LCJA 4CMBA 1BVRA 4DYDA 4IBOA 4TQGA 1MG5A 3AM3A 5A9SA 3G1UA 1JQBA 5JAIA 3TJRA 3QRWA 2DUUA 1MV8A 5IZCA 3U4CA 4ZVVA 1I3LA 1A5ZA 2YFHA 2BH9A 4HWKA 3HNPA 2NU8A 4NFYA 5U4QA 5BT9A 3RROA 2FP4A 5LCXA 4D7AA 3BMNA 1HETA 1T2EA 2C5AA 3FNGA 1P1JA 4FGWA 3A06A 3GVCA 5AXBA 4A0SA 3ANMA 3FCOA 4J90A 5DCYA 4RDHA 1ULSA 2X58A 3CXRA 5EMHA 1U8FO 2CF6A 2J5RA 1M6WA 1MX3A 2O3UA 3JQAA 3FPCA 2EHDA 2ILTA 1YONA 3K30A 4U6QA 1HDGO 4PCVA 3C7DB 1UR5A 2OP0A 4PGFA 3TQHA 4CM8A 1E1NA 1JTVA 2YY7A 4IDFA 1Y81A 3ZZNA 2NVBA 4A5OA 3BMQA 5HRUA 4CQMA 1WDLA 5C7LO 4BNTA 4CMIB 2TMGA 2HU2A 3WQSB 4DPMA 2NNLD 4GMFA 3WYEA 1LJ8A 1EDOA 2HQ1A 4E3ZA 4U0KA 2AE1A 4MVJM 3DO5A 3KB6A 3RUIA 4BNGA 3IIEA 2D3TA 5IN5A 2Q1TA 1UZLA 4MO2A 5A3JA 1X0XA 3VDQA 4UVDA 3D1LA 3IP3A 4EEZA 2P9CA 1T26A 4BVAA 1K6IA 1LQUA 2EP5A 2GGSA 2VUUA 4N5NA 3RFVA 3DBRA 5HTOA 3KETA 3VDRA 3KYBA 2JCXA 5CPBA 4XQGA 4Q3EA 4CM4A 3OETA 3QJ5A 3NUGA 1GYRA 1VM6A 4IMRA 4XGNA 2DU8A 3ADOA 3DZHA 3GA0A 1NWCA 3NEPX 4OXYA 4WNCA 5G0TA 1U4SA 2AMFA 4NIMA 1ENPA 2JAHA 2Q4BA 2NU9A 1E92A 5IDYA 3KVOA 1H93A 3C1OA 4YJGB 1KBZA 3MTGA 2Y68A 1UP6A 5L7WA 4PLFA 3LU1A 1NX6A 2B4RO 2Y1CA 4YYZA 3LT0A 3SLGA 3BMOA 2C0CA 3JYOA 3SJ7A 3H3FA 1JKIA 2QHXA 3QY9A 5IZCC 1BTOA 1HLPA 4JNKA 3GUYA 2FHSA 1A72A 3MEQA 3R6DA 1CRWG 3EW7A 1BXZA 3C7AA 3K5PA 2VYVD 4CM1A 5CDYA 1GY8A 2GZ1A 4CV2A 2NQ8A 3BYZA 3E82A 3CPSA 4BKRA 4IXTA 1V9LA 4M89A 1XELA 4Q3AA 5EJ2A 3KV3O 2XOXA 5J23A 1F8GA 1LLCA 3TZHA 1QYVA 2EKQA 5IAAA 1U2GA 4CR6A 3E18A 3K96A 5JYEA 1F17A 3GF4A 5L4LA 1C1XB 4S1VA 3WFIA 3G17A 1BXGB 1KEWA 1MC4A 4F46A 1I24A 3D5QA 3EC7A 2CDCA 3K73O 4OSPA 1KVSA 3PPIA 1SNYA 1K89A 2YJZA 3LSYA 2VUSA 1YKFA 2NSDA 3V2HA 4F45A 5IF3A 1NBOA 4KZPA 4CMEA 4IDAA 1B8PA 4HFRA 1NHGA 4P8RA 4WEOA 1N9GA 3ANNA 3VVBA 2ZQYA 3U4DA 1Y9EA 4PG7A 4E21A 3R1IA 4D0RA 3NTRA 5EESA 4FJ2A 2IEBA 3EK2A 2PGDA 5MGBA 1U4OA 1YWGO 1WLYA 3GH3A 3WBFA 4PLWA 3H2SA 4QTZA 3WNQA 4GVLA 1I3KA 2RIRA 3SJUA 4E30A 1NAIA 3TPCA 3U5TA 2I65A 4Q3DA 5JLAA 3I4FA 3LT1A 1E1LA 2I76A 4W9NA 3S2GA 1Z6ZA 1O5IA 2AG8A 4DLBA 4F3YA 5A06A 1Z7EA 2AQKA 4II2A 2QW8A 1R15A 3U9LA 4DLAA 1YBVA 3QQPA 3WMWA 2CVQA 1PJ4A 3JD0A 3KO8A 4DVJA 4P38A 2C07A 2BGLA 3LF1A 4I5DA 4O63O 4W7IA 3W8DA 3DOJA 3FI9A 1L1FA 5DT9A 2CD9A 3JQDA 4CM5A 3TWOA 4XA8A 1OBFO 2CDBA 2WM3A 3BTUA 3UCXA 1D8AA 1ZIDA 4E4YA 2X0IA 1ZJZA 2RAFA 4E2YA 3CUKA 1T2CA 1U3TA 3WOHA 1PGJA 3A4VA 4OYRA 3E9NA 3LLSA 3OQBA 4XIJA 4CL3A 2JL1A 3TOZA 4MVJD 3L07A 4LCEA 4CODB 4DQXA 1YOVA 2B5VA 1M6HA 3D3WB 5HBRA 2D8AA 1YJQA 2JFFA 2D59A 4IM7A 4FCCA 4D3DA 1DRVA 2GUGA 3AUSA 1IZ0A 1KEUA 3W8EA 4CM7A 1TLTA 3ZWMA 1E7QA 1GAEO 4TMFA 2X0RA 2LDBA 4AJEA 3AK4A 3IDSA 5CEFA 3WGTA 1ISGA 1IUKA 4D44A 4RF4A 4ND1A 5EN4A 1O0SA 4LMRA 2AQIA 2NTNA 3PGXA 4UVIA 1GZ3A 1IE3A 3VZSA 3DZFA 4E2XA 5DP1A 4H16A 1F8FA 1W8DA 2H5LA 5KIAA 3PJEA 5C5IA 1W0CA 4NDNE 4WLVA 1PZFA 4UUOA 4CMEC 1I3MA 4GBJA 1V8BA 3TZ6A 3ZGYA 2BF7A 4UEOA 3T4EA 3B1FA 3WQRA 1FDWA 2E4AA 4YA6A 4YT4A 2B37A 3E9QA 3BTVA 1JW9B 4MKRA 3FNFA 3DOCA 5AYVA 3PRJA 4CUJA 1E3EA 1B16A 4XRGA 3GOHA 4XZ3A 4I9NA 4Y6PA 3VPGA 1DIAA 1IY8A 2UVDA 3JQ9A 4QO7A 4YWJA 1ISJA 4J4BA 5FYDA 1R6DA 1Z7BA 3ROQA 3MZ0A 3PHGA 1U5CA 3OIDA 3EVTA 3JD1A 4L75A 5T67A 4L9RA 3RC1A 1ARZA 3WICA 1GUFA 3JTMA 3N58A 1H94A 2OXIA 1QLHA 2UUOA 5K6AA 3P19A 1NNUA 1NYTA 3C24A 2YDXA 2I66A 3MOGA 4TWRA 1GZ6A 1PZHA 3E5RA 3RIHA 5A9SB 1B3RA 4QQRA 4WE3A 2JFHA 3ETGA 2Q1SA 4XWYA 4Z9YA 4AJOA 1MG0A 4LW8A 3PWSA 5G0UA 1TEHA 1KETA 5TX7A 1PSDA 3OMLA 3OJFA 3PQDA 2X0JA 4BMSA 2NVUB 4MKXA 4IDBA 4ALIA 3DAGA 2FOIA 3KUXA 4OH1A 3EZYA 3HE3A 4TSKA 1IB6A 4AICA 7MDHA 5F1OA 4XR4A 1LRKA 4CQLA 1TXGA 3IL2A 3CMMA 2VQ3A 3OJ0A 1BMDA 3LK7A 3FRJA 3FHLA 4YRDA 3GGOA 4NJMB 3WGGA 4IY1A 5HS6A 2NADA 5IDXA 4BGIA 1V35A 3DMYA 4Y9DA 3X2FA 2Q45A 1ZMTA 3WBBA 5L4SA 1ZO8A 1D3AA 3V8BA 1C0PA 2HAEA 5JYDA 5KJFA 4IJUA 2DQ4A 2DTXA 5I7SA 2UDPA 2VRCD 3SBOA 1Z82A 5ADHA 2C7GA 4PLYA 4XYGA 4U8GA 2HMVA 1BHSA 2NV6A 5JPIA 3RCBA 4M87A 4IIUA 4RLSA 3FTNA 4E5PA 3F47A 3SXPA 1E1KA 1H9BA 3A1NA 2PK3A 5JC1A 2R00A 3VH4A 4BO4A 1ISHA 1QXSA 3RUDA 4O0LA 4BUCA 1HE2A 4BNLA 3VVCA 2GN9A 3OQ1A 4TZTA 1KEVA 2W8ZA 2XXBA 3RVDA 4DC0A 3NDJA 5L7YA 3GZNB 3IKTA 2AG5A 1QORA 1VSUA 4LVCA 1ZSNA 4C7KA 3R0IA 1ZSYA 1PQPA 3WTCA 2EGHA 4ND3A 1P74A 4D42A 3ENKA 3KEOA 1LSUA 2ZTMA 3RBZA 3PHIA 1WPQA 3DDNA 4BO0A 3NT4A 4XDZA 3B20A 3GEGA 1QR6A 1VLLA 4WKGA 3JQ9C 2A35A 1I30A 4FFLA 4KDFA 4WLUA 2P9EA 2B36A 2FPPA 1G0NA 4J43A 4CMIA 1RWBA 5FWNA 4L4RA 3I23A 2OBYA 5K6AC 2DVMA 3BTSA 3GNSA 3PHLA 3JD3A 4AJJA 4BV8A 5JDCA 4PVDA 2Z95A 3HDYA 1JAYA 1XCBA 4J4TA 3S2IA 3ZHYA 5COQA 3AWDA 3RUAA 7ADHA 3H9EO 2Z1MA 2D1YA 4BNWA 1N8KA 4PZDA 4GX1A 3DHEA 4TVOA 3SLKA 1CYDA 3F9IA 4GMGA 1HXHA 4D41A 3TSCA 1E77A 1DB3A 2YYYA 5DF1A 1KEPA 2RHCA 2Q99A 1VI2A 3VPHA 2YDYA 4R4JA 1NFFA 5CP8A 1JKJA 2PKQO 1HF3A 3F4BA 1ADGA 3BXXA 3GVHA 3L9WA 1QV7A 3K31A 4DA9A 5L4NA 1UJMA 1A7KA 3KZVA 3R3JA 4YJGA 3ADPA 3V1YA 1ISFA 5A03A 1YL6A 3BHMA 4ND4A 4YPOA 3ROMA 3O9ZA 4YAKA 3NAQA 5L95A 4BGVA 3EUWA 3WSVA 2X6TA 1FDVA 2TMDA 4LN1A 1KVQA 2WYWA 1GR0A 4WASA 4J9VA 5BSFA 2VZ8A 2QG4A 1AXGA 4WOJA 5TNXA 4QO8A 3PVZA 1I2CA 4H15A 1BW9B 1E0DA 3LF2A 5K0ZA 2PZMA 2Y0CA 4OGWA 4NU5A 1KOLA 3DR3A 3ZU3A 3O4RA 3DHYA 4XD2A 1FJHA 3D4OA 3S2FA 3OECA 4ZN6A 3ZNNA 1A4UA 3GEDA 1UP4A 4K28A 4K1LA 4L76A 4RZHA 3QA9A 4ALKA 2P4QA 4DPLA 4FB5A 4XYMA 4D3SA 1C1XA 2AEJA 2P2SA 4FIZA 4PRLA 4BNYA 4A03A 4I5GA 4I9UA 4B4WA 1BXGA 3FBGA 4FQ8A 4U6SA 1NVMB 3FN4A 1ZK3A 4G5HA 2VYVA 4EUEA 3PK0A 4MVJI 2UUPA 3QWBA 3CEAA 3VPSA 3UICA 1LRJA 4YDRA 3I3OA 1NR1A 3NT5A 4N5LA 4TRJA 2PGJA 4FFPA 2G5CA 3ICCA 4DLLA 2UV8A 2QRKA 5JDCC 3IKVA 1PWZA 4FS3A 2E37A 1H2HA 3WNVA 1HKUA 2FWMX 4JROA 4CUKA 1ENOA 3RC2A 2BMAA 2EW8A 2O3SA 3GHHA 4NH4A 2JHGA 1XDWA 2EIHA 3HDHA 1DRWA 1AN9A 4M55A 4RO0A 3QV1A 3H7AA 1R4NB 2VUTA 4IGFA 4CMKA 1LDGA 4OIMA 1UDAA 5AXDA 4CMJA 4GLOA 1XQ6A 2R2GA 4DBVO 3PGJA 3SEFA 3UUWA 4B3JA 2HRZA 1G6KA 3WWYA 1U3UA 3OJEA 1PJQA 4EITA 4EJMA 5AQ1A 1RM0A 4FOOA 4JLWA 4NMHA 4XQEA 4BO1A 2EKLA 4FC7A 5KVSA 4OJNA 1LBEA 4BB5A 5L51A 1YL5A 4OOEA 4YQZA 3TF5A 3ANLA 3ST7A 4W6ZA 4O1MA 4OQYA 4YEDA 3JQ6A 3IC5A 2JKVA 4ZU3A 4NBVA 4LK3A 2XXJA 3JQGB 4J1NA 2GYYA 1KVUA 1R12A 3DBLB 3MJVA 2YZ7A 2DPGA 1EFLA 4BNMA 4KUGA 3D5TA 4I5FA 4LSWA 3PI7A 4ZQBA 4YAJA 8ADHA 3JQBA 3DL2A 5JY6A 2D2IA 1DJNA 1PR3A 2XAAA 5JMWA 1H6BA 1DFIA 1YVEI 2E6UX 2O4UX 3KEQA 4GL4A 1IOLA 1FDTA 2OZPA 3HQ4O 3OA2A 3HADA 5IJZA 3D3EA 4J9UE 5JSFA 2X5JO 2YW9A 4BO6A 1V0JA 2P4HX 2VHWA 3LQFA 4RPGA 4ALNA 1V6AA 3AFMA 4MVJA 3RWBA 3DHNA 1ZK4A 4MINA 1NQ5A 2C7VA 1W73A 3WJ7A 4EGFA 3HN2A 1UZNA 2OL4A 3W4JA 1RPNA 3M1AA 4GX2A 3RBXA 2VHYA 4AJ1A 1RJWA 1UDCA 5JMPA 1ZMOA 2PNFA 4KMSA 3U49A 1RKXA 4RPLA 2X9NA 3VKVA 3K92A 3VZPA 5L53A 2PD6A 3OA0A 4BL5A 2WSBA 3QVXA 4NG5A 3PQEA 2VWGA 1MXFA 2BD0A 1E7MA 2ZYGA 3NYWA 4PRKA 3RC7A 1Q7GA 4W4TA 4A7PA 3GN1A 1NPYA 2WE7A 3GNQA 4UVHA 1U5AA 4MVJH 1T2DA 3PYLA 1ZK1A 1X7HA 1KIFA 2ZCUA 4A26A 1HTBA 1EQ2A 4B7UA 1AE1A 1E3IA 2Z5LA 1U7TA 5COBA 3EY4A 5EQFA 1NQAO 5G4KB 3ON5A 1UXHA 1C14A 1SOVA 4IJVA 4CLEA 1HWYA 5B4VA 4NK5A 2X9VA 1Q1NA 2ZB8A 1FF9A 1Z75A 1ONNA 1IPFA 1T2AA 4GSLA 4DIFA 1AUPA 3F1LA 3UHAA 4KWIA 3F4LA 1YO6A 4RVFA 1HYHA 4Z3KA 2AEFA 4MOWA 3PZRA 5FF9A 1PJ3A 4HUJA 3Q0EA 2P68A 5TF4A 1GQ2A 4GSKA 1R4MB 1XQ1A 2NVUA 1E3WB 3KRTA 5I9LA 1B14A 3MCVA 2B35A 3PLRA 2Q1UA 3JYNA 5I9NA 2O3QA 4MVJP 2NU7A 1MXHA 5TJHA 2Y1FA 1EDZA 1BRMA 5GZ1A 3HB4X 2Q4EA 3HDQA 1MUUA 4ILKA 4PLTA 3UAGA 4NJMA 1KY5A 1I8TA 2X7HA 3JQBC 2AEMA 4WJZA 2X9GA 3CZMA 3DQPA 3QW2A 4R51A 1LUAA 5U1PA 2OGUA 1Z74A 4R69A 1IHXA 4CV1A 1I2BA 2G76A 3OQ6A 3DZKA 1ORRA 4GKBA 4EW6A 1ZZEA 3DZGA 1LNQA 3WGOA 1NM5A 4DREA 3OSUA 3NRCA 1LDNA 4GGOA 3GRPA 3OHSX 1LC3A 1LLUA 4G65A 4ND2A 3WR5A 1EMDA 4HXYA 1BXKA 2J3IA 4TVBA 3I6IA 3MJ4A 4NJOA 1DLIA 1ADBA 4HNGA 4EJ0A 4IQ0A 3ZWOA 3Q2KA 5F21A 4BIIA 4BNKA 3S1LA 4BNVA 3GZNA 4GWKA 2IODA 2VRCA 1Z45A 4J2HA 4TRMA 3TL2A 1NTOA 4JN6B 5T8KA 4CR8A 3KBOA 3I4CA 3UGKA 5KVCA 4FFMA 1A9YA 1X7DA 4BO8A 2GLXA 2D5AA 2G0TA 1R0SA 4NK4A 4BO5A 1ZEMA 1WMAA 2EJWA 3C85A 3RKUA 1UXJA 3GFGA 5BSHA 1N1EA 4RL6A 4ALMA 3Q9UA 1E6UA 4JBIA 2VYND 3F5QA 3ITDA 4AJLA 4D3FA 1H0KA 1GV1A 4HFMA 2XF8A 4AJNA 3FWZA 2D5CA 1L7DA 3TZKA 4DYVA 2J8ZA 1YB1A 3HHPA 3NT2A 3AJRA 2BGMA 3G0OA 2A4KA 4LVUA 2AQ8A 4DXHA 5F1KA 6ADHA 4OQZA 3AW9A 2PKQP 3H2ZA 4IIVA 4KTTE 1WW8A 3U3XA 4NBUA 2YHIB 3IP1A 3GC6A 4XYLA 5LDHA 5L7TA 3LYLA 3I1JA 3Q1LA 2JHFA 1GL3A 3CTMA 3WGHA 3IJRA 3LLVA 1PGQA 1F12A 5TT1A 3CIFA 3RUFA 2JD2A 2IXBA 3OM9A 1RM5A 4RPKA 3RUCA 3JYQA 5F1PA 2C54A 2CUKA 3AI2A 1LI4A 3EAGA 4LGVA 1JKFA 5IFLA 4UUPA 2DTEA 3DAFA 1NVTA 2A9FA 3HUDA 2A94A 2IE0A 3AI1A 3VPFA 3CINA 4YAIA 1VJ0A 4EBFA 2FZWA 1KC1A 1HE4A 1UUFA 4ZRMA 1B26A 2W2LD 3CSDA 3LDHA 2ZYDA 2FSSA 2HDHA 5EINA 1ID1A 4EDFA 5BNTA 3V1TC 1PR9A 4NFHA 3PIDA 3PWKA 1XGKA 2CMDA 3DB2A 1PWXA 3OJLA 1IULA 4TRNA 1PS0A 3B70A 3MWDB 1K2WA 2YHUA 2O48X 2FN7A 5TC4A 4E2WA 3JYPA 3M6IA 4XB2A 4RORA 1BW9A 2EF1A 5FEUA 4L8VA 3ETEA 4CMAA 1CEQA 2V7PA 4K26A 3ZDFA 1GCOA 2ZJ0A 2RH4A 3WTBA 4MKZA 2BHLA 2IDZA 3INTA 2WWRA 3M2PA 3UOGA 3KYDB 5T8KC 3I9NA 2YV2A 3PTZA 3WSWA 4RVGA 1YDEA 5A3VA 2FSVA 3G79A 4RQUA 1DDOA 1H6CA 3B1JA 1DAPA 3ZHBA 2CDAA 4I5EA 3ZHXA 3WXBA 3JV7A 4DMLA 5F5LA 5A9RA 1U8XX 1EVZA 1GUZA 3WG9A 4ALJA 4K6FA 4C7JA 5B4UA 5ITVA 5GZ6A 1QYDA 4FFRA 3NTOA 4BKPA 4M8SA 3P2YA 4CV3A 3KLMX 1MFPA 2H9IA 2HRBA 4OHUA 2VN8A 4PLZA 4E12A 4LMPA 3H5AA 4PLCA 2RCYA 3QWAA 1QYWA 2DUWA 1E5LA 1HSZA 4G81A 3DXFA 4NI5A 3PWZA 1CETA 2VCYA 1Y8RB 5TQVA 1EVYA 1Y5RA 5KJ6A 2VHXA 2OBNA 1GADO 5FI5A 4E5NA 1R4NA 3K6JA 1LSJA 3JYLA 4A73A 1C3VA 3L4BC 3ONEA 5THKA 2NU6A 1DIGA 3ZV5A 1CDOA 2ZCVA 3INRA 3COSA 1Q7CA 3T7CA 2ET6A 2P9GA 3I9JA 3L77A 1MB4A 2B5WA 2I5PO 1LDEA 1E5QA 3JQCA 1T4BA 4RV9A 1F14A 3HFGA 1YQXA 4B3IA 3H65A 1LC0A 3H9JA 5KJCA 5FI3A 4IINA 4MP6A 4Y67A 4BQPA 2YV3A 1UXIA 3DONA 1C1DB 1BDBA 1GQYA 2VT3A 3PFFA 1ISMA 4O59O 5TIIA 2GF2A 1D1SA 1UXKA 1H9AA 1ZFNA 2OHXA 2GASA 2J6IA 3I9MA 3JQGA 4L73A 3PXXA 4HP8A 4ZQHA 3DBLA 5B4TA 1A9ZA 2WYUA 3R3SA 2I6TA 1ML3A 2GD1O 3I6QA 1F06A 4EJ6A 1EE9A 4FJ0A 3WS7A 4YT2A 2HO5A 3ZWVA 4TROA 4RVSA 3OFSA 4UVGA 3ZI0A 1NFRA 2VT2A 5A9TA 3TNLA 3GAFA 5K9ZA 1E3SA 1B8VA 3ONDA 3S2EA 1MP0A 1OZAA 4J16A 2ZTVA 1NFQA 1PJCA 1OMOA 2W98A 1QV6A 1UXGA 1JDJA 3F46A 3KSUA 1HT0A 2HUNA 4NBRA 2BRUA 3NKLA 3CZRA 3U4IA 4J49A 4RGBA 4MIOA 3I52A 1H5QA 2O7SA 4FFNA 1EBUA 3ICPA 3EZLA 2I3AA 4ZICA 1AXEA 3NTQA 4OSOA 4B4OA 1NVGA 3AUTA 4PG5A 2OFPA 2WD7B 2Y1GA 4PZCA 2DLDA 1ZXLA 4ESOA 1HYEA 4ALLA 1GFSA 2GNAA 4RJTA 1VRWA 2C20A 4WCFB 1LLDA 3OEYA 4HKTA 4GVXA 3ULKA 3Q3CA 2YFQA 1VKNA 4WK6A 5KJ1A 4P22A 4OKIA 1HDRA 2C5EA 1JWAB 1PTJA 4LISA 3WLFA 1K0UA 4IJWA 4PG6A 3PJDA 4RPJA 4U0JA 4BHTA 3EDMA 4DWVA 2OUIA 1D7OA 3W4KA 3M2TA 1Q0LA 3V2UA 1LLQA 2I99A 1BDMA 3TOXA 4J0FA 1LQTA 4CUZA 3FD8A 1XA0A 3NV9A 5G4KA 2O4CA 4YBZA 1PL8A 1PS9A 3JQAD 1XHLA 3AY7A 2GZ2A 5JO0A 5I8WA 2FY8A 1XR3A 1X0VA 4AJHA 1PL6A 3UKOA 2PLAA 5F3RA 3TL3A 4CQMD 5DCWA 4CV0A 4JXKA 2Y1DA 3KHUA 1YE3A 4OXNA 1TT5B 2FPGA 5BSEA 5JBIA 5BSGA 4BNIA 1EUDA 2AE2A 1R4MA 1CQIA 2GRAA 2DBQA 1E3WA 1Q7BA 3A28A 1BVUA 4XJTA 4BO9A 2QIOA 3ZNOA 4UREA 4QXMA 2JAPA 3E03A 4M1QA 2WE8A 3ZN2A 1U28A 3GAZA 3KM0A 4JK3A 5KTKA 2FR1A 1YB5A 1Y5MA 1UAYA 4YB8A 4BV9A 1D1TA 1QKIA 5BNFA 2PZKA 3RC9A 4BQRA 1MLDA 2C29D 1XG5A 2GZ3A 5I7VA 1WAMA 1KS9A 3RU9A 1HRDA 4XCVA 3DZIA 1JWBB 3ZWNA 5A5FA 1X1TA 4CJXA 1J6UA 3DZJA 4J7CA 4OO3A 3HZZA 2CFCA 1I2ZA 5ICSA 4IS3A 1WDMA 1HLDA 1A7AA 3OEWA 3KYCB 3IUSA 3O03A 1K6XA 3TZCA 1J4AA 2J3HA 4O6VA 4YACA 5G0VA 3DMTA 2NTVA 3BHJA 5JW6A 5ER6A 1QYCA 3PZBA 4N18A 1ZW1A 3GDOA 4Q9NA 1JVSA 5DULA 2POQX 5KWEA 1M76A 2O3RA 3V2GA 4L4SA 1XEAA 4YJHB 4OKNA 3ZCXA 3ETDA 1I5RA 5AVOA 1PJTA 5HM8A 2PTGA 3L6DA 1PQWA 5CHEA 1GTMA 4XRRA 2NQTA 1V3UA 1PGNA 4PFJA 3W4IA 4BGUA 3FSRA 4E13A 1HL3A 1VL0A 4ZGWA 2PGLA 4NNJA 3GHYA 1Q2XA 1ONPA 1E7WA 1PJLA 2W4QA 4XYEA 1N7GA 3H9QA 4HX5A 1HYGA 2BKAA 5ILOA 3GNTA 3GGPA 3WLEA 4MP8A 2HLPA 3ORFA 4WLNA 3E9MA 4MPDA 4Y6RA 4RVUA 3AUUA 1P9LA 4B79A 1OOEA 3K2BA 2O50A 3FTPA 2NUAA 4B7XA 1X13A 4NBWA 4UEJA 4CM9D 1SB8A 2D0IA 1CQJA 2YHIA 4H3VA 1T1RA 4CLDA 5TS3A 4BO3A 3AU8A 1X15A 4N54A 2VYNA 4RLHA 1B15A 3X2EA 4JGBA 2FR0A 4KQWA 4RCVA 2PR2A 2Y0DA 1A27A 3E1KA 1SPXA 4TKLA 2IEDA 4GX5A 1O8CA 4EZBA 3ABIA 5CDTA 3KSZO 4J1TA 2VHZA 2VWHA 3MJTA 1OFGA 1P1FA 3U62A 3RUEA 2OP1A 2EEZA 4BMNA 2WD8A 3C7CB 3GN2A 1E6WA 3RJ9A 1FMCA 1DPGA 2C82A 1AHHA 2X22A 1R16A 4BB6A 3QWIA 2VOJA 4DIBA 1O94A 1XWFA 5A02A 5IDQA 2FR8A 1G1AA 3OF2A 1FDUA 3DOOA 3GEMA 3GG9A 2ZKLA 3IS3A 3DMTC 1OAAA 4H7PA 3LZ6A 4MIYA 4WUVA 2Q1WA 2NACA 4KOAA 3MOIA 3E6AA 1EK5A 5KJEA 2Z1NA 2GO1A 1E3JA 4R1NA 4KUHA 2AXQA 3RD5A 2I67A 3FBTA 3GDGA 2W90A 2W2LA 2X0NA 3LC7O 3KYDA 1HDYA 4II3A 4P4LA 1WDKA 3TFOA 1GD1O 1LSOA 1YQDA 3K9QO 5F5NA 3DFZA 1X14A 3DEYX 4QECA 3TN7A 3TRIA 2OOSA 1LEHA 4WLEA 3KXDA 4QSMA 2PKRA 4YRBA 1EVIA 3JSAA 3NX4A 2GN6A 1GYPA 4UULA 1PL7A 2B4TO 2AW5A 1ULUA 4CLRB 2YV1A 3PHJA 3UH1A 4YQYA 3SX2A 3RI3A 1P33A 3FNHA 1QMGA 4J6FA 1CF2O 1XYGA 2AA3A 3U4HA 4BKUA 3GLQA 3HDJA 1SO8A 3DTYA 2G82A 3WYCA 4Y8VA 4TKMA 1UDBA 2DBVO 3LT4A 2ZK7A 1Y1PA 1VSVA 1ZKMA 2UAGA 1Y8RA 2Y1OA 1U7HA 4NPCA 5IG2A 1B2LA 3F3SA 3O8QB 3HFSA 2G1UA 4R3NA 3HB5X 2QYSA 4R1TA 3A9WA 3H8VA 4R1UA 4RZIA 4UUMA 1PQUA 2VZ9A 4BO2A 1DIHA 1E1MA 5DCUA 5H82A 2GCGA 3CH6A 4ZD6A 3NGLA 3AM4A 1D4FA 2HJRA 3W6ZA 3Q11A 1QSGA 2GSDA 3GFBA 4FSHA 4DIOA 2BFAA 3D4NA 4FD3A 4HADA 3H9GA 4BMVA 2X5KO 1PIWA 4W82A 1SB9A 1RYDA 1VKOA 1XU7A 2B0JA 2Y05A 5TLSA 1YRLA 4ZQGA 3ROPA 1R0KA 4DMMA 3WB9A 3QVOA 1C1DA 5FFFA 2AQHA 3QIVA 5DOVA 5B12A 4EUHA 2X1HA 3SVTA 3MWEB 1V3TA 1W4ZA 5CFZA 5T57A 1E6EA 1HDZA 3H6KA 4QX6A 3SC6A 5T6BA 1VJ1A 5CDSA 5JE8A 4ZQFA 2C2YA 2WTBA 4I08A 1WP4A 2PH5A 3H5RA 4JCOA 3WX0A 3QSGA 1P0FA 3WQQA 1ONOA 1P45A 5G0WA 2ZYAA 2E49A 3DC2A 3VHRA 4LRSB 1BG6A 2OO5A 5DZSA 5BQFA 5L45A 2B69A 4E32A 3DBHB 3SC4A 3UF0A 3VAZA 3HN7A 1XIVA 1Y9AA 4GKVA 1KERA 3B1KA 1DC5A 4JP3A 3IQDB 3L4SO 4NBTA 4XJSA 4BS9A 4RQTA 2RH8A 2Y66A 1NASA 4IDDA 1DSSG 5L3ZA 4I9HA 4R1SA 2WD7A 3STHA 5A4DA 1FK8A 1KY4A 4Z6KA 1GEEA 4YJDA 3VTZA 5HA5A 5CG2A 4P4NA 1I3NA 2E82A 4WCFA 1ZK2A 5ITWA 2O3TA 3I83A 4IQ8A 1PGPA 3LC2O 5A1TA 1VL6A 2F1KA 3FF4A 1DRUA 2PV7A 2X23A 3PDUA 4AJ4A 1J0XO 1DEHA 2IRWA 3QVWA 3VC7A 4ROSA 3ZV4A 4E5KA 1LA2A 1ZXBA 4YAEA 5JCJD 1BSVA 1T1SA 2GPTA 1YDWA 1QG6A 2X4GA 3BAZA 2J5KA 4DPKA 4J4HA 2NWQA 4PVCA 3WGIA 4N5MA 3NJ8A 2PD3A 2Y93A 1H6DA 2DT5A 4KWHA 3RU7A 2EGGA 1SC6A 3A14A 4B4VA 4U5QA 4MVJE 4Z3DA 1SOWA 2EWMA 4OAQA 1ZH8A 3P7MA 1J5PA 3DBVO 3VH1A 1Q0QA 1TT5A 5AXCA 2EG9A 2Q2WA 4DL9A 1Y8QB 3F6YA 3PYXA 2P91A 3ITKA 5HWSA 1HE5A 3ZV6A 4HBGA 1HE3A 1GYQA 2PY6A 3ENNA 3PDJA 4NHEA 1ZVMA 3OIFA 1R37A 2C59A 2VWPA 5JNLA 2V6BA 3JQ7B 3LC1O 4O5OA 5EIOA 5EQDA 4ND5A 1ZCJA 5BNIA 2G17A 1KVRA 1KYQA 1UZMA 1P1RA 3D7LA 3OIGA 4YR9A 5G2OA 3BA1A 4I8XA 4JJIA 2PWZA 3RJ5A 1TB4A 3D64A 1IHYA 5ES3A 3I9OA 4PLPA 1K5HA 2Q49A 3GMSA 3K8ZA 1NQOA 5TJ9A 3DFUA 4AL4A 4HY3A 5CG1A 5JCXA 2DAPA 3AFNA 3UFXA 4ZJUA 1V3VA 5H81A 1IPEA 4XB1A 3H9UA 2Y99A 1VC2A 4UUNA 4A10A 4JJGA 2GN8A 3C8MA 2VTEA 4OMUA 3KYCA 2D4AA 3WWZA 2J3KA 3VZQA 1ENZA 3GG2A 5I7EA 3G1TA 1RM3A 1WMBA 1A71A 3H5NA 2WJPA 9LDTA 1R0LA 4Y98A 5KVVA 1E3LA 1GUYA 3PEFA 4YJHA 3H3JA 3ZU2A 4WCFC 1CIVA 4PZEA 1TVEA 3O38A 4ZQEA 3QWHA 4NR0A 1YXMA 4I1IA 1LXCA 4DC1A 3GVPA 4K9DA 6LDHA 3L9XA 4AVYA 3TDKA 3QWFA 3EVNA 4CLOB 3P2OA 3F5SA 3L4BA 1DAOA 5DNAA 1G0OA 1JVBA 4UAGA 4ID9A 9LDBA 1P1HA 4FN4A 1P1KA 1Y6JA 1DFGA 2VZ0A 4CL8A 1U1IA 4Q39A 4R16A 4QEDA 4TRRA 5CDUA 3EYWA 2DPHA 4XGIA 1N92A 3VH3A 1OI7A 1TI7A 1WNTA 1LDYA 1O6ZA 3AI3A 4IDEA 4AJPA 4D45A 5IN4A 4YJFB 2IYPA 1GEGA 3AM5A 4IJKA 4L74A 3UN1A 3ZWCA 4GAEA 3JQ8B 4RF2A 4F6LA 1P0CA 3UXYA 4JX8A 2BFOA 4MVJF 1J49A 3MJEA 4RPHA 3GK3A 1PGOA 5MDHA 4X54A 4XGKA 4CR7A 1X1EA 2Q46A 3K2EA 1YBMA 5L40A 3GPIA 3GRKA 2ZATA 5TSDA 5JO9A 4J91A 5DN9A 3W6UA 1P1IA 2BGKA 3GY0A 4IGEA 4IMPA 1SMKA 4FJ1A 1EK6A 1WVGA 5C3MA 1S6YA 3NJ4A 1GDHA 1LSSA 3BZUA 4E33A 1LDMA 1NHWA 4BNJA 3P5SA 8LDHA 1DC3A 1PJ2A 1QP8A 3GVXA 4CM9A 2HMWA 3ZW9A 1B0AA 2RBEA 4B8ZA 3H4VA 3OP4A 4J3FA 3T4XA 1NP3A 4M86A 5DDIP 3LVFO 2XPCA 3VPXA 5I8ZA 3ZNPA 4BNXA 3ZWYA 4R9SA 2E48A 2VHVA 4CLHA 5JDIA 3ZHZA 2QYTA 3DWFA 2P5YA 4WLOA 3FR8A 1GZ4A 4WOKA 3IOYA 4YCAA 2BI7A 1LX6A 2WYVA 2PH3A 2DFVA 1E7SA 4J0EA 1CWUA 1LDBA 1BWSA 2GR9A 5JAMA 4B4UA 2HJSA 5T5QA 1C0KA 3BIOA 2HCTA 4D46A 4BNUA 4FC6A 4XQ9A 3RQSA 5I7FA 4NZ9A 2O23A 4D79A 1NXQA 3N74A 3PLNA 1DXYA 3CMCO 4KTVE 2IZ1A 5CEEA 4RF3A 4DBZA 3N7UA 4U7WA 5EERA 4KQXA 4DQVA 3TFQA 4QT0A 2ZIZA 3I9LA 1QRRA 2RHRA 4MP3A 5CPFA 2EW2A 2HK7A 2HMSA 2IZ0A 4Q3NA 3GMDA 3NDIA 3KOUA 1SBYA 4CMCA 4WEQA 4CLRA 1QLJA 4UVEA 1QYXA 3ROKA 1CERA 2DBRA 4AJIA 1MC5A 3ASUA 3EHEA 3ONFA 4JIGA 1EQUA 1ZEJA 2EXXA 4AG3A 3DAPA 2J5QA 3ASVA 2EJVA 4J7XA 2DTDA 2JD1A 1PEDA 1Z73A 1T25A 4WNIA 1O95A 2O2SA 1I10A 4R01A 2W2KB 1Q0HA 4R5HA 2Q50A 2IYOA 5ILGA 4E5MA 1B7GO 3O8QA 2HK8A 4DQUA 1XU9A 1JLLA 5JAZA 4BO7A 3ZNQA 4W7HA 1NAHA 2SCUA 1CJCA 2QZZA 4B3HA 2ZTLA 1SCUA 5JS6A 3UCEA 3GPDG 3PJFA 1PS8A 5CEJA 3HJAA 2Y67A 2P5UA 5JFOA 2V65A 3NGXA 4HV4A 5B1YA 4Z0HO 3BMCB 1EE2A 1E7RA 3ZWXA 4PLVA 5IXSA 5JDIC 1WWKA 3G3EA 3S8MA 4XYBA 1DC4A 1ZUD1 5GZ3A 1HEUA 4PLGA 3KTDA 2J3JA 4TZKA 3RBVA 3UVEA 3VH2A 1JU9A 2VRBA 1N5DA 4XEHA 1JA9A 2V6MA 3Q2IA 3WJAA 4DUPA 2BFPA 1AGNA 3M1LA 4W9NC 3GQVA 3Q6IA 4IZIA 2HMTA 4BOYA 3PQFA 3IUPA 2PFGA 2VOEA 1IZ9A 4F6CA 4PG8A 2H1SA 4R54A 1MA0A 3DBHA 4YVFA 3GGGA 1HDOA 1BGVA 1UP7A 1YL7A 2OMEA 5DBFA 4IS2A 4PIVA 3E5MA 1EUZA 3CKYA 4JBHA 4IUYA 3AUAA 5DOZA 1NPDA 1L7EA 3D4PA 4FW8A 4ONEA 1NQTA
chains in the Genus database with same CATH superfamily
4FBGA 1J8YF 4IJMA 4L2IA 4GEGA 5LP6B 4EEXA 3FCAA 1VG1A 1M9NA 2CNWD 5LC1A 1EXNA 1JLSA 2VPZA 3I3SR 4Z7OB 3BICA 1VPDA 1Y82A 3DD5A 1R8SA 2BSAA 1TKRA 4U2GA 3B6ZA 4M49A 5KQGA 3TE7A 4BLPA 3FCUB 2JJ2D 2UVPA 4IUBS 1OJLA 1YZVA 2W9XA 2G4VA 5D00A 5TRTA 1MZVA 2CXRA 2ERYA 5A04A 4WJLA 2WIDA 1O95C 1IBKB 4OJKA 2ECPA 3C3BA 1C0IA 3TQRA 3REQB 4JQCA 2CL6X 4HSGA 4MR8A 4BQQA 4R1OA 1DX4A 3SM9A 1ADCA 4PTLA 2DFDA 1I1NA 1E96A 3L1KA 1W6RA 4N3AA 1I4WA 2WG1A 1O89A 3NDBB 1V1RA 4P3YA 2YWDA 4FR5A 3T7EA 4C43A 1R8JA 4X8HA 4ODIA 3T12A 1Q77A 4HWPA 1N8TA 1IN1A 4LDZA 3SICE 1YACA 4PU0A 4BQEA 1XYVA 4MA5A 1V8ZA 2FMHA 2CZCA 5ALRA 3G49A 4N6GA 2ZB3A 2MJLA 3BJEA 2SHKA 5ENDA 1EFRD 3SE0A 1DBQA 5EUBA 4AX4A 3TTXA 2WWGA 2PH7A 1JT2A 1IRIA 3N9IA 4PN3A 3GEPA 1PEYA 2DKNA 3JZFA 2YXBA 3F5MA 2J41A 4ZEWA 3AEQB 1Q84A 1DIBA 3B6IA 2K5UA 1M83A 4A27A 5BQ5A 4Z7JA 2D5BA 3C39A 4QATA 4XFKA 3ZVLA 1G8AA 3AY6A 1EFKA 5BNWA 1DHRA 2JCVA 3B7GA 3H18A 1UM9A 2ZXEA 2NLOA 5M04A 1JN0A 3FCCA 1DAIA 1DIRA 4PQYA 5EXEA 2BFBA 4Z9XA 4OLBA 2P6NA 3K72B 4EMSA 2WHPB 3STYA 2COUA 3S27A 3ZH2A 2ZB7A 4J7UA 1V45E 4KB5A 3GZJA 2XVMA 5JCPA 1B23P 2VWQA 2ZRNA 4OI1A 2FE1A 5F52A 4K6HA 3K6RA 4TLBA 1PT9A 2RONA 4DVGA 1M1YB 1QLWA 3ZH9B 4HUTA 4PN7A 5KU7A 3NPMA 1EUCA 2G7ZA 5HSGA 2C4MA 1E5XA 2HF8A 4IKPA 4JUAA 3UAZA 1LK7A 4YP7A 4TMYA 1ZNQO 4HGNA 5LZ5A 1GGKA 3ASYA 5BUZA 2WUGA 4K6CA 5E6UB 2FDCA 1E94E 1ENYA 1RM4A 4RACA 2C83A 3ZGXA 3QHAA 2YNMC 5ENVA 2R4QA 4RE5A 1JR3A 2ZJ3A 4UHEA 3UQZA 4BFSA 4G0ZA 3OLWA 2J07A 2ZJFA 4XR9A 2FAXA 4R3UC 2QZ9A 3UBMA 5AW5A 4OA8A 4E5UA 1H2BA 2EV9A 3UC5A 4E6PA 1M1XB 4LHXA 4XDYA 3KQNA 4ZRNA 1ODFA 4GWGA 3ZWPA 1II8A 4EUSA 1OC2A 5MF6A 3L0OA 4CEHB 2CKDA 4DSNA 1KMCA 1XDZA 2IY7A 3IA2A 5AHKA 3Q9NA 2OZEA 3C1TA 3V1UA 4BPRA 3I62A 4OL9A 2BUCA 2XDQB 4LBYA 3MMNA 3RVMA 4P3PA 3R3ZA 4V0MA 1OYOA 5EHZA 3PS9A 4DARA 4UPDA 1QR2A 4N41A 1ISIA 4ZCTA 2WTXA 4Q9DA 1L5YA 2C8LA 3E9RA 2WWTA 3VTFA 3HR4A 2E4UA 1X7WB 3L7KA 3BHNA 3PXDA 4MDHA 4GOMD 4MYTA 3JASB 1GGFA 3IAFA 4X5OA 5CK4A 1XJQA 2PUCA 4Z4FA 2J46A 4YC7A 1N5KA 2H07A 1QX3A 3UATA 4YMWA 2ATEA 1N9GB 3U4AA 3IELA 3DEFA 1YD7A 2Y9MB 3MWYW 2BELA 1R2QA 4NS4A 1ODCA 2WKQA 4M98A 4MQEA 3AGPA 4NECA 2ZQ5A 2ZVQX 4W1SA 4YJFA 5F1YA 3SJCA 3X2SA 1T0UA 2QN2A 1MGOA 2I29A 3PUHA 2PLRA 5FUVA 2C31A 3NHFA 3N75A 3DEKA 3V8QA 5EL0A 4HVCA 5AI6A 1QH8B 1JG1A 2AZMA 2OV3A 4IZHA 1JMYA 4NABA 2IFTA 4YCDA 1AK9A 2VSYA 1ZMRA 1O08A 2BLLA 2PAAA 3MELA 4UCQA 5CT4A 3S28A 3W8FA 4WPGA 5CB6A 1BVYF 2HOQA 3MT9A 1AHIA 1NWHA 1IFXA 3L1JA 3MTDA 2OBXA 5AOVA 1M75A 1A4IA 2W6NA 1NLMA 2EBUA 2HA6A 1SUEA 2B6NA 2IXEA 1YH3A 3IESA 2V9ZA 3LQ1A 3QPWA 4GVPA 3TSWA 2QD5A 4G0UA 4KBGA 4KQEA 2IE8A 3PBKA 1ST2A 2O59A 3N6XA 5KOHA 5CAEA 2I2BA 3LG2A 1UDRA 2V6FA 5DWQA 4D5GA 3ZTWA 1UJ6A 4I1VA 4JA0A 4DJDC 5BXYA 4AF6A 3JCZA 3NNNA 1UAGA 4WZAE 1PBNA 1PZGA 1UANA 4LDJA 5A5EA 1ZH4A 2ONCA 2QSJA 5CNJA 1T3HA 2J6HA 5KZMB 3P9SA 1NI3A 1XZGA 1O6BA 3EEYA 3ESAA 2GA8A 1GGVA 3V4SA 5KU1A 5EZYA 2PO7A 2YZMA 2DWPA 1R0RE 5CVJA 5CTAA 5I7HA 4OX9Y 3TMKA 5BN3B 4KIUA 3VDXA 4BFYA 4DLVA 4EABA 1E6MA 4HH4A 1DQZA 4I55B 5BVHA 2PUHA 2NIPA 1U7DA 2RJNA 1HZJA 1SZJG 1YA4A 4TTJA 4MR7B 2YX1A 4DR3B 1OB5A 1AUVA 1QG2A 1UBHS 5CDGA 3BUSA 4AIRA 1XKQA 2PX5A 3H0CA 5B53A 2M6RA 3MJRA 3WDKA 5A4AA 4X93A 1WB9A 1TYDE 4NCHA 3RTEA 5EMLA 3DLPX 3C1AA 3T7JA 4Q3CA 1EP1B 3THXB 5ED0A 5BOSA 4P7GA 5B58T 4G5SA 4B6RA 1NIJA 3NHLA 4ZJYA 1W52X 1X7YA 4PLHA 2ZBPA 1NW9B 3QEKA 1MV5A 3OLZA 2XB9A 4MKGA 4Q3OA 3LJKA 3WGZA 4A16A 1OJ7A 4B5KA 5KNLA 1SUBA 2C3OA 2HMUA 3QEMA 1JJAA 4IHJF 3DUFA 3LFHA 4QNMA 4IXNA 1JLLB 1GGMA 1SKUA 4JI2B 3P4XA 4P83A 3TXAA 4JJ4A 2OD7A 3TL6A 5I5GA 4GDMA 1JHYA 2BEUA 2EP7A 4NOMA 1SEPA 5AVUA 4G5XA 3IMCA 1R6XA 2FZEA 1YK0A 1KJ9A 2UZ3A 1C30A 4H7JA 4OXKA 4QIHA 3W8RA 1W4RA 4QKQA 5K0CA 2YKGA 2JH9A 1AQYA 1BHJA 1K4YA 2DCUA 2V8BA 3C45A 2X41A 4DJEC 3TEMA 4X91A 1Q0RA 3QE3A 1WXIA 1PT8A 4JENA 1OXSC 1SUSA 2P69A 2JJYA 3N3BC 4N5DA 3W1VA 3N2EA 4HRVA 2H7VA 2DX7A 1RYEA 3W90A 4C7BA 4E31A 5C80A 2PZLA 3CVVA 2BT4A 3CQ9A 4ZOLB 2A5GA 1T24A 4R9RA 3T3HA 1M66A 1BX1A 1NNLA 2V74B 3H6HA 3IVXA 5CK5A 1E5VA 4UDYX 4CQJA 2F9MA 3O0DA 2WA1A 4J2OA 5SICE 1JEEA 3G2IA 3RREA 3VOAA 1F9AA 5FUQA 1ZCBA 4HDNB 5K3DA 4M54A 4YJ3B 2R1VA 2A9OA 2PGNA 4HMQA 4TVSA 4BKMA 1H2YA 5CB4B 3LO8A 4FYMA 4FX2A 1G5TA 1F0YA 4CCSA 4EGJA 1C1HA 3WMRA 3QP9A 2ZI3A 1MO4A 1GL7A 5KKCA 3ZDRA 3DOFA 4JJ7A 1UK7A 1ZN9A 3HDVA 5C7OO 5CD1A 3UJBA 4URXR 3U6BA 3LPLA 3GRVA 3AR4A 4G0OA 4EQ6A 3U3MA 3RSSA 4URVR 3GARA 4F92B 4MQMA 5EJMA 4HFNA 1QK5A 4RULA 4MVJG 1JQ3A 1OBHA 4Z4IA 2ATCA 2P5TB 1JEYA 4YRAA 2EFYA 3ZJUA 1XBTA 3DJYA 4UASA 1RQXA 3HG7A 3ZZ0A 2D6FA 4HJRA 5H3LA 4JJFA 1BU8A 3IMFA 1IJEA 4MQ5A 1N34B 2WLSA 3SQWA 2CNBA 4G24A 4INPA 1II0A 3B36A 4QARA 5GVSA 4HDOB 3FVRA 4IXWA 5M34A 1E79D 1COWA 2GERA 3R9XA 1FPMA 3ZE6A 2PX0A 3VYVA 4FYWA 5HS4A 3CRW1 1NONA 1G64A 4S3MA 4PZ0A 1QAQA 2ZJZA 3SFTA 1Y1TA 5L9AA 2PS1A 5BPFA 2ZT6A 4FFOA 1RCUA 5ER9A 4AZ3B 2A92A 1S9HA 1YASA 3D7NA 4OBWA 3WGGA 4HGRA 2QRQA 4A2QA 1PV4A 2OB1A 4X20A 4OF4A 3ZV3A 3EGOA 3B9BA 4D8WA 4QTYA 1Y8AA 2AR7A 1N3YA 1U3WA 2EZUA 1W44A 2IZOA 3DOEA 4DNPA 3JALA 3PYMA 4URZR 2OTCA 4OVKA 4UOZA 3VV2A 6REQB 2C2OA 5E8JA 1AD2A 2H1RA 1BVRA 3SSNA 5BP7A 1I7QB 2VQEB 3U4QA 4TQGA 1MG5A 1JDPA 2WNHA 3GRFA 2CVHA 5A9SA 3G1UA 4WY8A 4JHLA 1TEXA 2HPZA 3VKGA 4FDVA 3ZXYA 2ZVDA 5IBCA 1ILWA 3K9HA 4URUR 3FUUA 3PKIA 1FP4A 2ZYVX 4QREA 1I3LA 1VJ5A 1A5ZA 1DTSA 2A9QA 3H6GA 4RIHA 4HWKA 4N12A 4QELA 3HNPA 3A1DA 3TS1A 1U2TA 1V43A 5BW5A 3D2LA 4YR7A 4Y2HA 2VEOA 4WBSA 3M8KA 3SF8B 3L8HA 2ZBVA 2XWJI 3PR3A 5CM2Z 2AFVA 4KSCA 3PGLA 3PTLA 4FGWA 1OVMA 1WETA 4UC0A 1SBNE 3V8RA 3WHKA 4B44A 2GN0A 4K3UA 1P6XA 1B1AA 2AVDA 4D4KA 3FCOA 2IHVA 3OKAA 2C8VA 2DHQA 3FYSA 2X58A 5DCYA 5IPFA 1GTSA 5EMHA 3H1BA 2GWHA 4JL8A 2XZOA 2XHZA 2P2LA 3BH0A 3JQAA 4R2LA 5DTRA 1MC8A 1Q0SA 2D1FA 1SULA 4G0WA 4QFBA 4U6QA 4UXIA 4ZANA 1TAUA 2AJ8A 4F04A 1V1MB 3EQ9A 3IMEA 4L8YA 4NCJA 2V6IA 4X97A 5E7MA 1Z8FA 4C2UA 1MAUA 3WLSA 1LVUA 1X8XA 3OFVA 2NVBA 2CNWA 3BMQA 1U7WA 1GNSA 4EPTA 1NW4A 4IFEA 4BNTA 1YJCA 4MR9A 2TMGA 4CMIB 3R44A 2BR5A 2HRCA 5FPQA 2NNLD 3K0EA 2XDYA 2YWGA 2Z2IA 4QUBA 3MT7A 4X45A 3AHJA 1JSRA 3I61A 2EJCA 3MIIA 4IIDA 3IULA 1AS3A 2GPSA 4C5BA 1UQTA 1JGTA 2Z3ZA 2OESA 3KB6A 4BNGA 2CLCX 4MO2A 1LI7A 4RJKA 3GJSA 3FYDA 1VPEA 1XNGA 4A6DA 4UVDA 2HPAA 1QHNA 3B9PA 3R4CA 1WUIS 5ALYA 4BFVA 2P9CA 1T26A 3QEOA 1BE0A 1QE0A 1U65A 3MHPA 4MS3B 5LMUB 1VQ1A 1H69A 3FTDA 3IV9A 3K6KA 3KETA 1QCZA 4F6RB 4FOLA 3VNRA 5CPBA 2F6RA 1EK0A 5JV5A 3LCVB 3HNOA 1AZWA 3OETA 3QJ5A 5J2UF 4JEUA 2F2TA 3NUGA 2FTKE 3GO4A 2RHDA 3OCZA 3ZVMA 3BGVA 4IMRA 1T8WA 2DU8A 4LHYA 3HPRA 4OXYA 1NWCA 3OOWA 1VIYA 4QDZA 4WNCA 5G0TA 1Z0SA 5LB2A 4HAYA 4KR9A 3WL3A 1I1HA 2PRJA 4XQ0A 2FG7C 3SR4A 3P2JA 4TS1A 1H93A 3Q3EA 4HGYA 4RPCA 3MTGA 4UM9B 3V7FA 4CIWA 1UP6A 4WADA 4Q9KA 3FJ1A 3H16A 1UWLA 3G5MA 3QX9A 4PLFA 1XA4A 5J1SB 3QJYA 3VR6A 3ONWA 5DYNA 2XKBA 4YYZA 3LT0A 4BEWA 3JVVA 1UJCA 5DXAA 3JYOA 3H3FA 2HWXA 3LKVA 2JJ1A 2ZE7A 4IUDS 3MJHA 5IFKA 3E27A 3ZDDA 2ODPA 2WNSA 1VSQA 1BTOA 2ZIVB 3OE1A 2AOTB 1PI3A 4GNKA 1Q20A 4JVNA 1A72A 4ZU1X 4BV2A 3AV0B 3FFWA 5FLXA 3QI2A 3V4VB 2OAP1 4B85A 3EW7A 1GKLA 4CEJA 2P0YA 3IBTA 2GZ1A 3QHPA 3BYZA 3E82A 5BMVF 1AGRA 3CPSA 3CSUA 2P30A 1OXKB 2W6CX 1XELA 4P5DA 2GEKA 1JALA 3NHAA 4F2PA 2QAGA 1QHFA 2BKVA 4YJ2F 3AHGA 1MW9X 1Q12A 4PS0A 3QYJA 3TD2A 3EN0A 4D74A 3D1JA 2MYUA 3RM3A 2GXAA 3WB2A 2CFIA 3E18A 1NP6A 4YUXA 2G6TA 2E85A 4KN8A 4HNVA 4HWSA 3F2VA 1SXQA 4IH1A 1G7RA 1ODJA 2R11A 4S1VA 2YJNA 2VRNA 1BXGB 1MC4A 2XUDA 2ZAIA 3CEHA 3C3DA 4P54A 3D5QA 3EC7A 4URYR 2CDCA 1KVSA 1UF9A 3T52A 3PPIA 1N4DA 1SNYA 4QASA 3QITA 1S5PA 3BFXA 4WY2A 2GCEA 3IHWA 2SICE 3JWGA 4MI6A 4RHYA 1NBOA 1FS5A 4CMEA 2QR3A 4FYVA 2RKBA 3IALA 1WPRA 4XEUA 1RQRA 2P2ZA 3C7TA 3A1FA 4EARA 1AQJA 1YZGA 5D3MB 1Q50A 2R7KA 3GNLA 3R1IA 1Y7PA 2H0QA 4FJ2A 2IEBA 3KZKA 5JROA 5MGBA 4YDSA 5G53C 2NXCA 2AC2A 1FQKA 4IXMA 4YRJA 3QY0A 1P8JA 1I3KA 2GB4A 2XVAA 3T3OA 3QI7A 2WQ7A 1NAIA 3B38A 3OE4A 4OUKX 2PQ6A 2REOA 5JLAA 5I4KA 3I4FA 3ZDZB 5K0LA 5G3YA 1FEZA 2PMDA 1DI0A 3EDQA 1O5IA 4W1QA 1HOTA 1WOYA 2XUJA 2I9KA 2BEKA 3EXAA 4F3YA 3KZ1E 3A6PC 1OLXB 4Y9UA 2ORIA 4M7PA 3AP1A 3QQPA 3SNKA 2F67A 3WMWA 2CVQA 3MB5A 4HLCA 1VBKA 1E1CB 1PR1A 1TMYA 1JEQB 3LF1A 3LL7A 3R8CA 4AMBA 3NB0A 3H13A 2X15A 3FI9A 1L1FA 3JQDA 3TWOA 1WBBA 4F96A 4C3UA 3IP6A 1MB0A 3BTUA 1TUGA 2YMPA 3GLGE 1L4HA 1YHNA 2QMYA 2RAFA 4DM7A 3CUKA 4O4HB 3SVZA 4ER7A 3IDFA 4MAFA 1U3TA 5DW0A 4F71A 5KREA 4DM3A 3WDMA 3ZW7A 3A4VA 4OYRA 4TOIA 3OQBA 4B7ZA 4F4HA 3K0HA 3LUKA 5CLHA 4Z4CA 3L07A 1VXOA 4NE2A 3VKHA 3G68A 3X44A 1JFVA 3CZQA 4KXVA 4Q18A 1G55A 1XLUA 1SA0A 1HRKA 3A1TA 3D59A 5ALNA 1XAGA 2HTFA 2JFFA 4OLFA 3WV5A 1LF5A 2AMVA 3V9PA 4FCCA 2GUGA 4BP3A 3C2QA 3DDUA 4BU0A 1G8FA 2QAGC 4G0PA 1TLTA 4JYCA 3ZWMA 2VTBA 1E7QA 1GAEO 1RAFA 1RWXA 2X0RA 4FHZA 4TMFA 2AG6A 3MJDA 1CVRA 3OP1A 5ADVA 3IDSA 2P3OA 2QLMA 3LCJA 5ULLA 2IF0A 1KOJA 3HKDB 5EHIA 3K70B 1O0SA 4HQ6A 4LMRA 5CLFA 3PGXA 3Q40A 3K9BA 2QRPA 3ORYA 2I2FA 4HC4A 4ZDKA 1J1ZA 4FNAA 4EFKA 5KIAA 1W8DA 2Z4RA 1QAMA 4DT1A 4L5IA 2H1WA 4NDNE 1P2DA 3HABA 2A6PA 2OAQ1 4ZCLA 1V4VA 4CMEC 5JQWA 1ZI8A 3OEED 3ZX5A 3IPAA 2JLWA 3KOOA 4KXLA 2WKSA 3FAZA 5T4HA 3GJXC 3G2MA 4WN9B 2IHTA 1RXEA 1FDWA 4N6NA 4EY3A 4UAUA 2ANBA 2FN4A 1G6OA 1USGA 3E9QA 4AU1A 3KTOA 3GXOA 1LPPA 3UXEA 5AYVA 4UD6A 3VGJA 3PRJA 1LBQA 4KRGA 4W8OA 1J0BA 4RNCA 5AVRA 1KDTA 5DLPA 4XRGA 5H4GA 2R6GA 2Z2KA 1NN1A 5DN6D 1D2AA 3CEPB 5DNDA 4B83A 1NXOA 2HHJA 4LOHA 4ITVA 4B31A 3ACDA 3WLPA 3JVUA 3BQNB 3EBOA 2XW6A 3PT9A 4MJ3A 2IT1A 3JD1A 4OHCA 5L4SA 1WCV1 3BFKA 1NC3A 1RE1A 3JTMA 1H94A 3N58A 5JXGA 3OIYA 1J33A 5CXUA 1NYTA 3ESZA 3PFGA 3L7BA 4IKOA 5JWHA 3VR5A 4DNXA 4AKGA 2WOOA 2P9QA 3Q3VA 3OFJA 4C87A 4DJTA 2NSJA 4ARZA 4QQRA 4DMCA 1Q15A 2Q1SA 1ABBA 4MWZA 4GUAA 3PD1A 3KPWA 2XE8A 2X0FA 1P5FA 1OXMA 3I6MA 4RTPA 4INJA 1TEHA 1XTQA 3R09A 3K9FC 2VUIB 1NV8A 4ZJZA 3E5NA 5FBZA 2XEXA 1XMSA 3FYTA 2NVUB 5JSUA 5DMHA 3FZYA 4MKXA 4ZCSA 3KKQA 5AJWA 3DAGA 4ZZ3A 3RYFB 4YAOA 1GUBA 2VJYA 1YKSA 3EZYA 3HE3A 3WK8A 3P0EA 2NU7B 4MI3A 5B3KA 4XR4A 5AVWA 3IL2A 2IXGA 2WHQA 1FMFA 1PSWA 4D9JA 4PSCA 3W9UA 4DR6B 3LK7A 1CE8B 2HGSA 2WVHA 5FT9A 3FHLA 3PNQA 1UJBA 1G6Q1 1UKYA 2IL1A 3L02A 3RVNA 3WAGA 3P94A 4FVTA 5BR8B 4DNOA 1N3LA 2Q45A 3WBBA 2X13A 1JFRA 4W6QA 2WFLB 3PV0A 1E79A 2HAEA 5ALXA 2H48A 4COOA 4ZOEA 4ZVOA 2NYAA 3FVWA 2B30A 2UDPA 2VRCD 4MUBA 5G02A 4HGPA 3SBOA 5I7SA 3MSXA 5ADHA 5IUNC 4PLYA 2YWJA 1T43A 1Z6AA 5JPCA 3AVOA 4WNAA 2NV6A 4HH1A 4MQFA 1UBKS 3I76A 1ND6A 4D9KA 4LOKA 1VHWA 2C96A 3FXAA 3SXPA 2PBRA 3A1NA 4MPJA 2B25A 1RLOA 1ZM7A 4TYYA 1A04A 1U02A 2CN1A 1ZVKA 2I6XA 3O8RA 4BUCA 2Q3DA 4RY9A 13PKA 3DXXA 3KKOA 4XI9A 5CH8A 4AMYA 3HGQA 1H3NA 4DC0A 4IZOA 3RVDA 3ZI4A 3ZVKA 4U7FA 4RIGA 3LCRA 3W2TA 3IKTA 1GPH1 4XIGS 1QORA 5FOTA 3T99A 4BN4A 4C7KA 4PBTA 5EP3A 2WSLA 2C99A 1X1QA 4D42A 4JKOA 3S2SA 3TQOA 1HL7A 3PHIA 1WPQA 2P0EA 2GK3A 3DDNA 3V3TA 3ZHVA 4KH1A 3JYHA 4ENWA 1VXRA 4XDZA 4PAQA 2VHCA 5BN3A 4EH1A 4GBMA 3GWGA 3MS2A 4J16C 1CEYA 3GYBA 3RIEA 2A35A 3F2IA 2WABA 3O94A 1I30A 2WMYA 2PUGA 2P9EA 2B36A 2FPPA 2GCPA 3A1WA 3P9CA 4A0RA 4CCYA 4EHJA 1YDMA 2VDOB 1LPMA 4ZMSA 1RWBA 4I81A 2GZDA 4OTZA 3RSLA 3I23A 1EAYA 1E2KA 4BAZA 2BP7B 2ZBFA 3BTSA 3PGKA 4QLAA 1Y6RA 3QVLA 1CZNA 3SKXA 2COKA 2RGDA 2JGNA 3FH0A 3JRWA 4PCUA 4BV8A 1DO0A 2VTVA 2Z95A 4KIFA 1JAYA 3HVRA 5BYJA 2FZLA 4Q19A 1PNRA 4CN9A 4HX2A 2W2TA 5AJUA 1R0WA 3ETCA 5EMKA 2QE7D 1P61B 1VI5A 2VJMA 3DHEA 2C5SA 1DXQA 1A69A 2FE4A 3GQBB 1CYDA 1XAJA 3TLYA 1NR5A 5AUOB 4AXBA 2E4ZA 4CHTA 3WIVA 3BCUA 3BRCA 1R4AA 3LT5A 5F2EA 2RHCA 2VSQA 2GJ9A 4RKFA 3OHPA 3VPHA 2FJ0A 3U16A 5KYKA 2R6R1 5KOJB 5AICA 1FB5A 2RGCA 3PQCA 4R4JA 3WJ1A 3VNSA 5EJAA 1NFFA 2AYXA 4M0KA 3IR5A 4YJKA 4EG0A 1HF3A 3F4BA 1MABA 3BXXA 3GVHA 3RADC 3H86A 2R7AA 3K31A 3OTWA 1UJMA 3R5SA 3KZVA 1R5OA 3NBMA 2XI4A 2NZ2A 3BHMA 3BAFA 4U7GA 4D0LB 3Q3IA 1TZCA 1O5OA 5ERXA 4YPOA 3PXUA 2BFCA 1UPXA 1V7CA 2W6ID 4KGDA 4QULA 4TTTS 5D87A 2GKSA 1F4PA 1XC7A 4HAIA 4LN1A 1N2JA 4LRQA 4MWGA 4WASA 4J9VA 5FWXA 3U3DA 3QLUA 1AXGA 3MSCA 4H18A 4P4UA 2WV9A 1JDNA 2QD3A 3P32A 4RLFA 4HZIA 4KK3A 4ZP1A 4RV4A 4A92A 2CYCA 5FL3A 3T61A 5EJGA 5LLDA 1I2CA 3AINA 1L3BA 3NV7A 3BK2A 1QV9A 1SCJA 5E2IA 2YTZA 3SYKA 1TTPB 4Q7KA 1B76A 3JARB 3LZCA 3RSCA 1FJHA 3S2FA 5AKIA 2AI1A 3OECA 5BSUA 3TAUA 3IOCA 3LP6A 3JSXA 4ZN6A 1FYXA 2PWYA 2RBGA 3D6JA 3EPPA 3WLOA 3E4CA 1GGJA 5CDHA 2PX4A 1WZ2A 4DPLA 1KO8A 1QGUA 1CUUA 1XMXA 5IT9A 3T1QA 1C1XA 2P2SA 4L4YA 2QVXX 4BNYA 4MEAA 4HLNA 3FNBA 3HPQA 4I5GA 3QNMA 4B4WA 5TMDA 1NVMB 3IKJA 3UKJA 3C6BA 1UC8A 2OC9A 4XFJA 2A0YA 3TB6A 1U7UA 3VO1A 3VNQA 4X6LA 5KYXB 4RTOA 1HC7A 1YI8A 1DEKA 3ILVA 3TI7A 2ZBQA 3T3GA 2YRWA 4KAAA 4Q9IA 3OO0A 3ZS8A 3M4NA 4QU8A 1VZ3A 2B1GA 4TRJA 2Q7DA 1JE0A 2PGJA 4EOGA 4ZGGA 2UV8A 3AJ9A 2GBPA 2QU8A 4DIDA 1U2PA 3NZEA 4Y30A 3ZWQA 1XN4A 4XFDA 1FXUA 4R0MA 5BXQC 4NCKA 1DAMA 1NVKA 2LWIA 4UW9A 4J76A 2FWMX 4CUKA 1K7EB 1N0UA 2OE2A 3K0BA 4YIKA 1ENOA 4CG2A 4MPRA 3GHHA 1D9ZA 4IRUB 2LR0A 4NH4A 1PJRA 1TIBA 1XDWA 2HU8A 3QTLA 3TRKA 4I4IA 3V6MA 4M55A 2JI4A 1IHDA 2VATA 3W9YA 6PFKA 1JBEA 5C9ZA 3IOEA 3IR7A 1TVMA 1Q0UA 2QDXA 2R2GA 2G67A 4HN4B 1VSBA 2C4KA 2HIMA 4M76B 4F84A 1PFVA 4JVMA 3L0YA 3JZAA 1RIIA 3SEFA 3UUWA 4D57A 1EGQA 3ED5A 2ZE5A 1P0IA 3OLCX 1OIXA 3QVJA 2VNHA 2HRZA 3D6FA 2XWPA 5FTLA 1PJQA 2RGUA 4EITA 3MUOA 4LTMA 4R81A 4JLWA 4NMHA 2JAOA 4XQEA 4KEAA 3SY8A 2QQEA 2VDVE 2D7JA 4L5JA 1DAFA 5GJBA 1YL5A 1AU9A 2EKZA 1HQYE 4OOEA 1H5NA 2IW1A 1UMKA 2E9SA 2JASA 2YJ5A 4YQZA 3T7KA 1F48A 1M2VB 3OM8A 4YEDA 1PLLA 2G63A 1UT5A 2P67A 3K5IA 3QLUC 4LRUA 2F8TA 2JKVA 4MNTA 3NRJA 2CFTA 3O7WA 2LIPA 4UHKA 3DBLB 3FY4A 3MJVA 5JVDB 3PUWA 3MTQA 1YFJA 1H3FA 3QA3E 4V0QA 2XLBA 4JB2A 3EWAA 3D5TA 4AMVA 3HU5A 3UAYA 3CX3A 3JQBA 5JY6A 1N57A 3HYSA 1UKEA 2QZJA 1A98A 4Y3UA 2DLCX 1DFIA 1FDTA 3HQ4O 4NU0A 5FEMA 5EIXA 1K88A 3VPBA 4TUYA 1N6KA 2CCKA 4C6TB 4LPKA 1P5JA 5BQPA 3AHCA 1LBSA 5TPWA 2DETA 1CUXA 1E99A 4HLQB 4AWXA 4C0JA 2VHWA 1OW3B 1FCJA 2QD4A 4ZAXA 4QYIB 1ZL2A 4UEWA 1WDTA 3WHIA 1UK9A 4TXNA 1UQRA 3AF4A 3HN2A 3T8YA 3MTAA 2I54A 3KL2A 2R3SA 4IF6A 2GNOA 2YH2A 3BVPA 4GX2A 5CVEA 4EGCB 2JHCA 4J03A 5BW4A 2XUQA 1UDCA 1WPGA 1QHIA 4V38A 1F2TB 4G63A 3I1IA 3ISVA 1U0JA 3BF7A 2QTNA 3QFCA 5L53A 4J07A 1GJRA 4NG5A 5TARA 3EH2A 2VWGA 3FPEA 2G1AA 1KYWA 1E7MA 4IL5A 4M1ZA 4PRKA 1NLZA 4QPJC 1Z5NA 1Q7GA 3O6VA 3RFUA 3GN1A 5EXXA 4YRKA 5LP1A 1U5AA 1BD3A 4ZT3A 5G1OA 2WILA 5EGSA 5BO5A 1JIXA 1KIFA 3D8TA 3TW8A 2IYNA 1NE2A 1HTBA 4BMOB 3DC7A 3OEEA 4ZHQB 5HF8A 3S2UA 3FNIA 4MQ4A 1Z0KA 2ZWMA 4ITRC 2Z3WA 2APJA 3DULA 1DE0A 3LPDA 1CEXA 2ODTX 3N2LA 4MUNA 5G4KB 3IQIX 1QONA 1GGHA 2OGSA 2HMYB 1KDZA 1SOVA 4CLEA 5B4VA 4DJJA 3HA5A 5GIPE 1JSZA 2QIPA 5JRDS 1E59A 2A5DA 3QNWA 1FF9A 1UT6A 1F8YA 5A3SA 3RODA 1U1GA 4DIFA 4ZYTA 5A2QA 2R25B 1F2VA 2AZXA 3KE8A 3UHAA 1JZSA 4JAVC 3F4LA 3QKSB 4P1ZA 1YO6A 4Q4JA 3S4YA 1G2PA 4DDMA 1Z4LA 1V5GA 1HYHA 2O8DB 2Z98A 4MOWA 4YAFA 2XB2A 2R97A 3E58A 1NULA 4HUJA 2KMLA 1B6TA 3MMZA 2P68A 3HL0A 4UPVA 3ZHUA 1U81A 1R4MB 1YB6A 3KRTA 2JIDA 4GFDA 5I9LA 1B14A 3ICVA 4G5QA 2B35A 1N0HA 3D43A 3NH6A 3PLRA 4DDTA 4CEIA 5HIJA 4OQXA 1QANA 2HUPA 2QV7A 5GOTA 2Y1FA 4QG3A 1ZG3A 4BP8A 5CCDA 3OZEA 5GZ1A 5IJ9B 4C0XA 3AESB 3IVAA 2AOVA 3HDQA 2FWJA 1S89A 4PPYA 2HA3A 4TSRA 3KQMA 1JHOA 5FI1B 1MX5A 1KY5A 3CX8A 5HIKA 3JQBC 4WJZA 2X9GA 3FTCA 3CZMA 4QVKA 2IS6A 4R51A 5U1PA 1ZJ6A 3QH4A 1P60A 4CV1A 4KI7A 3U2QA 3U37A 4EAQA 1ORRA 1XFAA 4R1QA 5HZGA 1GPMA 2DUNA 3HJTA 2IYWA 1NF8A 4C89A 1NZDA 3ZJ4A 4YI5A 3PPWA 3KVRA 5LXTA 3G9UA 4HWRA 4P35A 4C0QC 1E2JA 2AFHB 1Y1QA 1E60A 3JXEA 4GGOA 4IFTA 4JLNA 5D3QA 2GEDA 5K3OA 5HFNA 2N9UA 1JBKA 2CE2X 3TCXB 5FKJA 1U7OA 3K9WA 3MUFA 4K8OA 1EMDA 5EIFA 3EGXB 3WR5A 1BXKA 3D4LA 3OU2A 4PC2A 4C5CA 4NJOA 3W2IA 5T3YA 1ADBA 3RR2A 4B8WA 3ZWOA 2PJRA 3Q2KA 3H1AA 1ZMXA 3FLMA 5JZBA 2YVUA 1UMDA 5D7NA 4BNVA 4O02B 1VSTA 1Q16A 2VRCA 4GI3A 4P08A 4TT3A 3B3GA 1I5OA 1JDBC 4JN6B 4R1PA 3I4CA 4HYYA 3UGKA 4G1VA 4XWAA 1S8OA 2GAJA 2GLXA 3EYAA 4J3NA 4QYMA 2YJ3A 2CE7A 2IHKA 4BO5A 2YRXA 3R6TA 4ZV7A 2Y4OA 3BRSA 2VDRB 1QP7A 3UJ7A 3T9DA 4B47A 5CFLA 1S01A 1Z38A 3FF1A 4UBIA 4B73A 1GFIA 3G59A 3GFGA 4JDPA 1K4KA 2ZXFA 3Q9UA 4WXHA 1WRBA 2VYND 4KOEC 4GPZA 2OQRA 3BD8A 2N1BA 3F5QA 4WRRA 4D3FA 2PUJA 4N01A 4ZI7B 1RYHA 4HFMA 5DGCA 4Q82A 2D5CA 3UT5B 1BRTA 2OCPA 2J8ZA 1UBMS 4HTFB 3HLKA 2FETA 1CYEA 3AJRA 4RMGA 2AQ8A 5E3IA 2CXTA 3P26A 2X77A 2FMIA 4O4LB 4WXEA 5H02A 4BRWA 1EUYA 3RJMA 1E2FA 3ABZA 4A23A 2H18A 2FHPA 3GJ6A 3P9IA 4GT1A 3KLNA 4OFWA 2EQBA 1KYZA 4M0DA 5L7TA 1NY6A 1W25A 1M5UA 1G41A 4B7AA 3L84A 3G5TA 4PSKA 3FPSA 3CIFA 1MVLA 3RW9A 4OQMA 3SBEA 1TO6A 2IXBA 1RQ7A 3NNDA 4M4SA 3VPAA 5HVNA 2VTKA 3QF4A 3OQHA 4DY6A 3ETHA 3WLRA 2VP5A 2ZYUX 1T9GR 3HO8A 4A6PA 3AI2A 1B6SA 2XGGA 2FQ1A 4LQ4A 5DTJA 5EUQB 1PZNA 3LY5A 3U60B 2X3UA 4D8TA 1KWGA 4UUPA 5FTMA 2Q21A 5CX1B 3DAFA 4U3JB 1SELA 1ESZA 1GPUA 2A9FA 2IE0A 2GUWA 3HUDA 4XXHA 3RYIA 1O87A 3VTKA 4AZ0A 1WHSA 2MOKA 2QE7A 2YICA 4JZKA 4YAIA 3ZHCA 1OWLA 5A7HA 5AKLA 1L7BA 5EY5B 4ZRMA 2WAMA 1ATZA 1F51E 3DYBA 3B6MA 1WX1A 1DVRA 1MEOA 2C4UA 3OHMA 4JCCA 5K1ZA 1Z36A 4TYNA 1ID1A 1KKMA 5J59A 1G291 1RWPA 2DKFA 2XNJA 4MRPA 3V1TC 3EVBA 3MJFA 3PIDA 2OSBA 3PWKA 2CMDA 4MHOA 3ZGLA 2P65A 2WJAA 5ALLA 3EXIA 4PSUA 5EE3A 4TRNA 5IKEA 3BFJA 5E6SB 2VBIA 1L5WA 2A59A 3JYPA 1CR2A 1X77A 1WY5A 2W2QA 4RORA 4XB2A 5FEUA 1I94B 5C2JB 4L8VA 3AR7A 2PSDA 3ETEA 1CEQA 3S68A 2RH4A 3WTBA 3AF3A 5E1DA 5HRAA 2H2AA 2OUKA 4FN5A 2RDMA 4G1MB 2GXSA 2YV2A 3PTZA 2X7XA 3DKRA 4YFYA 3HKBB 4BQNA 2PTHA 2MIIA 5CX4A 5KWJA 3F6RA 1TJ3A 4H7EA 5D5HA 3VYUB 1YDEA 1G60A 2WU0A 2QRUA 3G79A 2VBFA 1TA9A 1SHKA 4M21A 1DDOA 2GJ8A 3Q7QA 1XB2A 3NTUA 4UZFA 5DHRA 1DAPA 2OBLA 1V5EA 3ZHXA 4BTVA 4F11A 4GD3Q 3S8EA 2QQ0A 5F5LA 5A9RA 4FYYA 2ZDQA 1YU6A 4U7DA 5M2QA 2ZZNA 5CBKA 2QUZA 1EK2A 2NNWB 1M1YE 4JLUA 1YC2A 4OHOA 1XVAA 2XADA 5CVDA 1L4KA 2QI9C 4TGLA 5J9FA 4A5SA 4KX5A 3CGGA 3P2YA 4CV3A 1WSAA 3SSAA 2ONZA 3GBPA 1MDFA 3ME5A 4I7EA 4QBHA 3L7MA 2BDEA 4E12A 2CZQA 4PLCA 4UAVA 2F7SA 5DYGA 1E9CA 1KJYA 2XE7A 3O75A 4IICA 5ALOA 1Y5RA 5KJ6A 1V8OA 2WTAA 1UBNA 1GADO 1X7XB 2VP2A 3L1HA 3QFSA 1R4NA 2C94A 3G9QA 1LSJA 1OLUB 4A73A 3RV4A 2BGTA 4A6XA 3ONEA 1EX7A 5LP6F 5DW3A 1T8PA 1CDOA 2ZCVA 3INRA 4Z4HA 4ZTUB 5KSOA 3L7DA 3GCZA 3TLZA 3PEWA 1GQFA 1XEFA 1BWQA 5LD2B 3U61B 3I9JA 1Y3AA 4FHEA 4BVKA 4EHFA 1MB4A 2B61A 2J4CA 3DA8A 5HP4A 3UAXA 1P4GA 3MTEA 1E5QA 2HDWA 3I39X 4L6CA 2ACEA 4MGHA 3U7FB 4CETA 3RGGA 4B3IA 2BTQB 4BLVA 1GL6A 2GCOB 2PFKA 4ILEA 3H9JA 5EXSA 2SKEA 3W2EA 2QUIA 5LQNA 3I01A 3PPYA 2VAPA 4M1YA 3QUAA 4IINA 4MP6A 1SOAA 1ORVA 4MZDA 5JEEA 3NFYA 3UM9A 1UXIA 4EG5A 1OX4B 5U9CA 3AVVA 3DONA 4YCLA 1C1DB 3PFFA 2E2WA 3PPXA 2YQZA 3T1YB 3ZVNA 1XAHA 1JHUA 4RXTA 4L73A 3I9MA 3NVKI 2B2XA 1CZLA 3PXXA 1RHJA 1P7VA 2VC2B 4MV7A 4R2IA 3DZCA 4BUZA 4G9GA 3TG2A 5CM9C 4MCJA 5E4FA 1Z29A 2DRIA 3RTBA 3WS7A 4YT2A 1SFRA 2HA4A 3TW0A 1A9XA 9ATCA 5G1NA 5LYJF 1LD3A 2FU5C 5ECGC 2YJ6A 3EBLA 4A8JB 3THXA 3C4QA 5FA8A 2Z08A 1YZ3A 3HYTA 2HRQA 1KZ4A 3X1WA 5JISA 1MP0A 1SQFA 2JI6A 1PJCA 1X1SA 1TUBB 4EWLA 1S2LA 1RZ3A 4DA6A 2ZJ4A 1FQJA 1XDSA 2BMFA 2GM3A 3MB8A 4OEHA 3U4IA 1H05A 4Q05A 4RGBA 1P4SA 2BONA 4TWIA 1W75A 3KKMA 4Y7CA 3EGWA 1H5QA 1EBUA 1KTVA 2IYAA 3DAHA 3NTQA 3QPBA 4K88A 3GJ3A 3O7MA 4NDZA 2R6DA 4PG5A 4QBGB 5FA5A 1CX9B 1H8HD 2BCJQ 5B1SA 4ESOA 1PK7A 2C2WA 2DLDA 3OU7A 4RLQA 4EP1A 2C2ZA 3T3IA 5JECA 1T13A 1PT5A 1LLDA 4GYKA 2UYOA 4U7PB 4GVXA 4LAFA 2CKMA 3Q3CA 3UB4A 2IYXA