1ID1A

Crystal structure of the rck domain from e.coli potassium channel
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
HRKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDVKTVLAVSDSKNLNKIKMVHPDIILSPQLFGSEILARVLNGEEINNDMLVSMLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords PUTATIVE POTASSIUM CHANNEL PROTEIN
publication title Structure of the RCK domain from the E. coli K+ channel and demonstration of its presence in the human BK channel.
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1id1A00
2TMDA 3NKLA 4R41A 5A1TA 3I9OA 1BHSA 2O4CA 3JQ9C 3WFJA 3KUXA 2NTVA 5COBA 1BSVA 3NV9A 4JNKA 2AG5A 1D1SA 3E1KA 3PQFA 3RUIA 3QIVA 5IZ4A 1DIBA 3DZHA 4YJDA 1ZK3A 3VH1A 1HDCA 3BMQA 4UVIA 5A02A 4WJZA 3ZWMA 4IZIA 1H6AA 2RIRA 3BMQB 3BHIA 5CEJA 4EEXA 3WR5A 4CM6A 2AEJA 1UXGA 4ZICA 4K6FA 2FPGA 4LVCA 2EKPA 2NU6A 3MWDB 2ZYGA 4EJ0A 1Y1PA 2E4AA 4ZQGA 1VJTA 1U5AA 4GMGA 1GD1O 3ZV5A 2NNLD 4NBRA 4MP8A 4OO3A 4CLXA 5HM8A 1C1DA 4E21A 1RKXA 5IDYA 2NVUA 4FBGA 3BMCA 5LCXA 2Q2WA 4YT8A 2I5PO 1C1DB 3DO5A 2VRCA 5BNTA 4JLWA 2NVUB 1QLJA 3DBRA 4Y8VA 4PIVA 2JFFA 2IZ0A 4FIZA 4PLPA 4RVDA 1F17A 3A14A 3DTYA 3TL2A 4CLEA 4CV1A 3DBRB 4E5PA 1M76A 3WGYA 1DFGA 4WCDA 1MC5A 2WE7A 1WW8A 3QVXA 4RO0A 1TA4A 4CM4B 2X1HA 1EBUA 5I7EA 2ZJ1A 3PLRA 2P4QA 5JO0A 1QV7A 2VRBA 4BB6A 3NGXA 4TWRA 5B4TA 1NWHA 4L4XA 1HDYA 5JCXA 2DUWA 3GEMA 4W9NC 4GWGA 1NHGA 4IMPA 4NZ9A 1TEHA 3GK3A 3H3FA 3WOHA 4DBZA 3MCVA 2Y1GA 2Z1MA 4Q3BA 3RBVA 3MJEA 3VPXA 4JJFA 2Q45A 4JIGA 1E6UA 2PD3A 1I30A 4ZHSA 3OA2A 3H9JA 4QQRA 1GYRA 2C7VA 5KCZA 4CODB 3CIFA 4CLHA 1B16A 1IHXA 3HDJA 4KQXA 2WYVA 1NR7A 5ICMA 5JS6A 3KLPX 3D4OA 4FOOA 1R37A 5JW6A 8LDHA 3WICA 3U4CA 1P33A 3TF5A 3FNHA 1PJTA 4J2OA 4RF5A 1EFLA 3GUCA 4BO5A 2DQ4A 3MTJA 1OAAA 1LBEA 5TT1A 4DPMA 3VTFA 1E7WA 3JQGB 3SLGA 1O5IA 1EQ2A 2E37A 4F3YA 5K0ZA 3RKUA 4BO2A 5TIIA 1NQTA 4YBZA 5DCWA 2JAPA 5F21A 2B4RO 4G81A 2HLPA 5JY6A 1LDGA 3M2PA 3WJAA 1QYDA 4YJFB 4BNMA 2IYPA 3M1LA 3OSUA 4R69A 3U4DA 2PFGA 1PTJA 2JL1A 1DC5A 4WKGA 4XEHA 4CL3A 1GV0A 4FFMA 2V6MA 3K31A 4EEZA 5B12A 4YQYA 2HO5A 1I2CA 2DTDA 3N7UA 2AEMA 5A3JA 5THKA 3NYWA 5GZ1A 5JY1A 1ML3A 2P91A 3TN7A 4CQLA 3JQFA 4J1NA 1ULUA 2X22A 1O95A 4CQLB 1U2GA 1PJBA 5AQ1A 4PLHA 4BNJA 5JDIA 3I9LA 4DYDA 3ENKA 4ALJA 2PZLA 1Z75A 5JO9A 4BNZA 1YRLA 4XIYA 2AQHA 5JSFA 5K6AA 1GPDG 3HQ4O 4MP3A 2W8ZA 3ROQA 3KRTA 1HE2A 3DHEA 1ISIA 2HK9A 5KWEA 2OL4A 2WWRA 3DTTA 2VWHA 4BHTA 1Z7BA 1PR3A 2EJVA 5G2OA 3BXXA 4ALLA 4B4OA 3CE6A 3GOHA 4JXKA 1Q0HA 4TZTA 5C7IO 1IY8A 2HRZA 4HNGA 3HNPA 4ZGWA 2IXBA 3ZU2A 3EK2A 1XA0A 3ZV4A 4E33A 1JA9A 4PLVA 3WWZA 4EITA 2UYYA 2J5QA 4AVYA 1K6XA 4L0QA 2GDZA 4D46A 2CF6A 3PQDA 1B8PA 1NYTA 4OAQA 1UZLA 3QLJA 3WYEA 4MIOA 2IYOA 1O89A 4AJEA 1S6YA 4Y6PA 1UXIA 4BO8A 1P74A 3R0IA 1IYZA 3JQ8B 4RORA 5EN4A 2QG4A 4CMBA 4OSOA 4XZ3A 1XDWA 3GMSA 3AFMA 3V2GA 4JQCA 5BQFA 3AW9A 1ORRA 4TROA 3UF0A 2DT5A 3CMCO 3VVCA 4EW6A 1EMDA 4NK5A 2QX7A 1B8UA 2NTJA 1C14A 1U3VA 1CYDA 4M87A 3KETA 2O3JA 3O38A 2YV3A 4FS3A 4IZHA 2I65A 4MVJA 3TFOA 5ILOA 3D4NA 5L95A 1ZXLA 3H65A 3L9XA 3LDHA 1E3JA 3JD3A 1JWAB 1Q7CA 2DPHA 1E3IA 4HFNA 4D0RA 1A27A 1T2FA 4TVBA 1A4IA 3MJCA 1LC0A 1DIGA 4J4TA 3RASA 4WLUA 2G5CA 5IDXA 3DBLA 2A4KA 5KKAA 1GL3A 3ZHBA 4BVAA 4CR7A 5KVQA 2CMDA 2CSUA 4NMHA 3ONEA 1OI7A 1U9JA 7ADHA 3BTVA 3DBLB 4RZIA 1OFGA 5B4UA 3C85A 4UREA 4Y6RA 1H9BA 4R4JA 3ULKA 5TC4A 2JCVA 5G4LA 3PGXA 5JLAA 1ZMOA 4ALMA 2Y1EA 1BRMA 5L4SA 1V3UA 2Y1CA 4ONEA 3DXFA 4LCEA 4WLVA 2V6FA 1A5ZA 1YH3A 3VH2A 3WSWA 4II3A 2R6JA 4WE3A 2C59A 4A5OA 3O8QA 3SXPA 3IJRA 3CSDA 3S8MA 4PG4A 1Y9EA 4XQ9A 3OM9A 3RKRA 3PHHA 1GQ2A 1ZSNA 2GO1A 3PWSA 4O63O 5CDGA 4FJ0A 3INGA 3OEWA 5DBIA 1OMOA 1NR1A 3L9WA 1PJ2A 3JQFC 2GRAA 3VZQA 1XG5A 4GX2A 4D3FA 1GZ4A 5CP8A 4YR9A 3E5RA 1LJ8A 2HK8A 5JDIC 3OQBA 2PLAA 3I9NA 2XF8A 4I5DA 4IQGA 3F6YA 4MVJG 2JFGA 4BMSA 3JV7A 5A04A 3BTOA 4BNWA 1DIHA 1KETA 3VH3A 4HKTA 3EAGA 1ISFA 3GT0A 4A73A 3Q9NA 3CTMA 5JCJD 4RDHA 3D4PA 2IZZA 1T2EA 3GVIA 4IS3A 2YW9A 5AXBA 2Y1DA 3W8EA 4RVHA 1TLTA 4A26A 4FD3A 1DAOA 4EUEA 1EDOA 3GDGA 4J3FA 3KLMX 3ZWOA 4TRNA 1DC3A 2B5VA 3LU1A 5U1PA 4GMFA 3HB5X 5U9CA 4CQMA 3F3SA 2ZYDA 3HWRA 4TQGA 4OMUA 4U0JA 4CQMB 1NFQA 1HRDA 1UXHA 2DTEA 3ONFA 4P4GA 1C0PA 3NTQA 2VOJA 4R5MA 1ISJA 1CETA 1PJLA 3ZZNA 1KEWA 2RBEA 1SO8A 4GX5A 3WLFA 3H5RA 3I3OA 1YB4A 1GUYA 4FGSA 1SB8A 2J5RA 1HZJA 2BGKA 3A1NA 1P1KA 2NSDA 5DZSA 4RF3A 4B3HA 4BNLA 1PL6A 1Y9AA 3UOGA 5L4NA 2JKVA 1BXGA 5G0VA 2GASA 3QWAA 1PGOA 5LDGA 4BNFA 3DZBA 3FCOA 5CEEA 4PLWA 3WQSB 1BXGB 1VL6A 4BNKA 1WZEA 2G76A 5F1OA 2VTDA 4I5EA 4B79A 1NPTO 2Y0CA 4DGSA 5BNIA 1GCUA 3PWZA 4CR8A 3HE3A 1IE3A 5IZCA 1N9GA 1QG6A 2Q49A 2GD1O 3KYBA 3AY6A 4CM3A 1JAXA 3HDYA 2DM6A 3ZNOA 1S7CA 4OXNA 4WCFB 3U3XA 2D2IA 3T7CA 2BELA 1A7KA 4FFOA 4DLLA 4YT5A 4N5NA 2OBYA 4GVLA 2X0IA 5F3RA 3TWOA 4TKMA 4TMFA 2BFPA 4E5YA 3ZI0A 2FWMX 4WGGA 1EK5A 1X1TA 3OH8A 4ZRNA 4NPCA 3WGZA 3RFVA 1R0LA 4IXWA 1P0FA 2QIOA 1RM0A 2BFMA 3AOEA 5TJHA 1JDJA 1ENOA 1E3WA 1LA2A 2A9FA 2AE2A 4RVFA 3NT4A 3ASVA 2HMTA 2O3TA 1GQQA 2QZZA 1Z82A 3S2IA 1E3WB 4ND2A 4LMRA 4ND5A 3PIDA 3S55A 4U5QA 5CPFA 2C2YA 4LMPA 1PJSA 1D4FA 3R3JA 4R01A 2HRBA 1N7GA 2I66A 1E77A 1QSGA 4J0FA 1XHLA 3C24A 3PK0A 4HNHA 4YJGA 5IJZA 4NH4A 4PLZA 1BVUA 1KBZA 2OOSA 5IN5A 5COQA 1NHWA 4YJGB 4I9HA 1VSVA 1YS4A 4Z0PA 4EUHA 4DIOA 3DWFA 5IAAA 3UGKA 2FSVA 3BAZA 4BKOA 5AXCA 4BQRA 5K9ZA 2O2YA 4UUPA 4OXKA 3HZZA 2Y1OA 3QVTA 3ZWCA 3H7AA 1XR3A 5TX7A 4LVUA 1T2DA 1KYQA 2Z5LA 2C5AA 3B70A 5F5LA 1NPDA 1A9ZA 4R16A 4RCVA 2UUPA 3WYBA 2GN9A 4BNGA 4CR6A 4IDAA 1YBMA 3M2TA 2HK7A 3I4CA 4J6FA 4P22A 3WFIA 3RWBA 4GH5A 2FZWA 2LDBA 3EVTA 1ONPA 5DULA 3CZRA 2X23A 3HUDA 4IMRA 2J5KA 2DTXA 2IEBA 1EVIA 3TFQA 3GVXA 5IN4A 4Q3NA 3QV1A 3ZWVA 4R1UA 1ZJZA 1I3NA 1YDEA 3BMNA 3C1TA 2PZJA 3DFUA 5CDSA 2OBNA 1EZ4A 3FNFA 4TRMA 3ENNA 2RH4A 3BMNB 5KJ6A 4OGWA 3I9KA 4E5MA 2CDCA 4P4LA 2QW8A 4NJOA 4CV2A 4UEKA 5I7VA 2JCXA 4M89A 2O2SA 4G65A 2YZ7A 4RPKA 3AK4A 4DL9A 1R4NA 2D8AA 2RHRA 1NAIA 4CUKA 3RUCA 3KM0A 3HFGA 5IZCC 1I3MA 2I3GA 4RGBA 3DFZA 1ZFNA 4N5LA 1R4NB 1EE9A 2VWPA 3GEGA 3I23A 3K6JA 3ZWBA 2ZB7A 4LN1A 1H5QA 2YQ4A 3BHJA 3GRPA 5T57A 3AU9A 2OZPA 3GAFA 5ENDA 3L0DA 3PFFA 4N54A 1T24A 3A4VA 1N2SA 3I6QA 2CFCA 2X8LA 4HADA 3PYMA 1PWXA 3HN2A 4Z3KA 1B3BA 4DLAA 4J1SA 4XX0A 3V2HA 3ORFA 3QP9A 2CY0A 4K9DA 2YHUA 4Q39A 1JKJA 1SB9A 1A7AA 1WNTA 3VPFA 4AJ1A 1ENZA 3F1KA 3WSVA 1GADO 4CMGA 3WNVA 1KS9A 3AOEC 3T4EA 3GQVA 3LF1A 5L51A 4J9VA 1BXZA 4ZA2A 3INTA 4XGIA 1UP4A 1EK6A 4FDAA 3QE3A 3RQSA 1X1EA 4OM8A 4OKNA 2GUGA 1X14A 2B5WA 4EZBA 5T64A 1PS8A 2C07A 3NDIA 1YOVA 3VDQA 1DEHA 1P1FA 4P38A 1YE3A 2GZ3A 3V1TC 2B37A 3L6OO 1HEUA 1PGJA 1NVGA 3RU7A 1R4MA 3GVHA 5A5EA 3DZIA 2EF1A 1DRVA 1B15A 3DQPA 4GLLA 3JQ7A 5L7YA 2YV2A 5IXSA 2G0TA 5DP2A 1E3EA 4KWHA 1B14A 4DIBA 1LLCA 4KDEA 2ZQZA 1UP7A 2O7QA 1Y8QB 2HDHA 5EINA 4GX0A 3RVDA 3EUWA 2W2KA 4MP6A 1UZMA 2B69A 2FZEA 2J6IA 2DU8A 4D41A 1KC1A 2EP5A 4XA8A 2W2KB 3O26A 3IC5A 3FRJA 3O03A 4YAEA 1DB3A 4PZDA 1LDMA 2QRJA 2X0JA 2YFQA 2NTNA 2V6GA 3QQPA 1XKQA 2EGGA 3IMFA 4A2CA 1PU2A 5CHEA 3NRCA 4LGVA 1I33A 1AHIA 2DBVO 5AYVA 3VDRA 3W8FA 1EE2A 4XB2A 3COSA 3ZU5A 4UEJA 1PWZA 1YKFA 2JHFA 1DPGA 3GMDA 2VOEA 2XAAA 1MX3A 3CXRA 2P68A 3MTGA 3PJFA 2D5AA 3DZFA 1LQUA 4BQPA 5DCYA 3TZ6A 4GI2A 5I9MA 5C3MA 3GAZA 4DXHA 5I7SA 4P4NA 4XQCA 3AUSA 1HKUA 3GGGA 1HDRA 2P9EA 6LDHA 3PHLA 4QO8A 1ADFA 4IY1A 4NJMB 1Y5RA 1MB4A 1DAPA 3D7LA 3GGPA 1HLDA 2G1UA 3C7AA 5CDUA 1OC4A 5GMOA 1P9LA 2D0IA 2GN4A 4FC7A 4IINA 1TI7A 1G0NA 3JQCA 1HYEA 1B0AA 4NG5A 2O7SA 4JBIA 3MZ0A 3VPHA 1QYCA 3W1VA 2GZ1A 1JQBA 3LQFA 2OFPA 3LYLA 3KYCA 1ZEMA 4RDIA 5AXDA 2G17A 5DP1A 3GA0A 3AY7A 1XIVA 2PD6A 4L9RA 2EW2A 4IDEA 1NNUA 3QW2A 7MDHA 3KYCB 4PG7A 1GZ6A 3IJPA 4BNTA 3OICA 2ZK7A 4L74A 1FDUA 1PS9A 4TKLA 3WTBA 4PG6A 4XDZA 2C2XA 2CNBA 4GQAA 3B6ZA 1VKOA 1N1EA 3DB2A 3RC9A 4J49A 2X5KO 2PGDA 4JK3A 3W4KA 4CM8B 1KERA 2HMWA 2A92A 2VYND 3WTCA 1CWUA 4C4OA 4WLFA 1M6WA 1U7TA 3H9GA 3H9QA 1GY8A 3Q0EA 2FHSA 1P44A 4W4TA 5L4LA 3TQHA 4DQVA 3VPSA 1GYQA 1YQXA 5DNAA 3H3JA 4YAGA 2VNAA 3LF2A 2X58A 3GF4A 3AUUA 3GNQA 4E4YA 4TZKA 1WMBA 2FRDA 2I6TA 1RJWA 3AY3A 2GPTA 4KQWA 4KZPA 2AXQA 4IDBA 3EZYA 1NP3A 1J4AA 4J7XA 1PL7A 1DJNA 3G0OA 2FR8A 1U3TA 3PJGA 4OJNA 4FW8A 3PHIA 4B4VA 5BSEA 1H93A 1LSUA 2D1YA 3P5SA 4ITUA 3OQ1A 1W0CA 3NJ4A 3U9LA 3UCXA 2QYSA 5A9TA 3BMCB 4OHUA 2IXAA 1PGNA 4J7CA 5JBIA 2IDZA 2YUTA 4PLFA 1ISMA 1LDNA 3FWNA 5THQA 4X54A 4BV8A 4O0LA 3WBBA 4C7JA 1WXDA 1C0LA 2YQ5A 3G3EA 4Q3AA 2UVDA 1DHRA 2O3RA 3ETGA 3GHYA 4OOFA 2V6BA 3QWFA 4I5FA 1IUKA 4BMVA 1YDWA 4I1IA 3E48A 1ZKMA 2VUUA 3M6IA 1E7RA 1DRWA 3OP4A 1ADBA 2Q4BA 1YXMA 1PJ3A 1U28A 1UAYA 3E82A 4KTTE 5ITVA 3JQDA 1MG5A 1UJMA 3NGLA 2GYYA 3ONDA 5FWNA 2PV7A 1GV1A 2ZYAA 5JCJA 4FFLA 1J6UA 3OJOA 1MGOA 4AFNA 1SMKA 1KVSA 4E6PA 5H83A 1ENPA 4IGEA 4QO7A 4J1QA 1P45A 2JD2A 1VLLA 3TOXA 4I8XA 5F1PA 4YT2A 3LLVA 4J16A 2BKAA 4XQEA 4PN3A 3BIOA 2WMDA 1IZ0A 1TVEA 1A72A 3LT0A 2Y1FA 4HUJA 5HA5A 1UAGA 4BKPA 4WNIA 3CINA 2EXXA 1LLQA 3HHPA 2ZCUA 1HZZA 5ILGA 4CMIA 3VKUA 5IG2A 4EYEA 1B3RA 4L76A 5I7FA 1T2CA 2ZTMA 3JQAD 1X0VA 3GRKA 1EQUA 4AG3A 4PLCA 4CMIB 4DREA 4CL8A 2O4UX 1QRRA 1I3KA 3RJ9A 3NTOA 4NDNE 4DC0A 3IQDB 5I9NA 2VZ8A 3AI2A 1MXHA 3ETDA 5T6BA 5L7WA 2VNSA 4FFRA 5HRUA 3KYDA 1WDMA 2O3QA 3C7DB 3U4HA 3Q11A 3OHSX 4FSHA 3RUFA 5IXYA 1MFPA 3E18A 2CVZA 1JTVA 3K8ZA 3WGTA 2WEKA 5B1YA 2EV9A 4NBVA 5FF9A 2Q1WA 1Q7GA 4CLDA 4JJGA 4D44A 1D7OA 2NACA 2GZ2A 3R1IA 1MLDA 2HMSA 3IP1A 1I24A 1LRKA 3VAZA 4XRRA 5DT9A 2B4TO 3GVCA 3OQ6A 5CAEA 1BDBA 3TZKA 4BGIA 4BIIA 2HJSA 1UH5A 2CVOA 3OFSA 3CPSA 4ND1A 2AEFA 3KOUA 4XJSA 3I5MA 3KXDA 3BTSA 2NU8A 3EW7A 4E13A 1IPFA 3FNGA 5L3ZA 1O8CA 3T7EA 4ZD6A 4IJVA 3F5QA 5JXWA 2YDYA 5KJCA 2FN7A 1U8FO 4LCJA 1WPQA 4GSLA 3ZWAA 1PSDA 1YO6A 2H1SA 2EWMA 1LDYA 4E30A 2VN8A 1ZH8A 1ARZA 4XYMA 1O94A 4WOJA 2BFAA 3KV3O 4INAA 3VHRA 1PQUA 1V6AA 5L9AA 4Z9FA 2BLLA 5LC1A 5FYDA 2W90A 3JYPA 1NFRA 4J4HA 3WQQA 5ITWA 2X6TA 3SEFA 1EVZA 4R1SA 4YVFA 1LI4A 4J91A 3TZQA 1KOLA 2EERA 1QKIA 1O0SA 2RHCA 2P4HX 4ZU3A 3UHAA 3AFNA 1GEEA 4GGOA 1XQ6A 1H6CA 4XKJA 2WSBA 5AOVA 3HB4X 2VHZA 3WS7A 2OHXA 5A03A 5EERA 1RYDA 1KEVA 2FR1A 5TSDA 2BH9A 4H7PA 4ROSA 1SCUA 1M2WA 1BW9A 3V2UA 4N5MA 3DHNA 2W2LD 5JE8A 1U7HA 1NXQA 3F4BA 2PD4A 2NU9A 3IDSA 1BW9B 4KP7A 5DDIP 2NV6A 4IQ8A 4YWJA 3W6UA 1QP8A 2VUTA 4GVXA 3Q2KA 3RUHA 1K5HA 1TB4A 4IJKA 4LK3A 4ALKA 1VPDA 5F5NA 1Q1NA 4O6VA 4UVDA 3MJVA 2VYVD 4XD2A 1P1HA 3OA0A 3IL2A 1SOWA 2ZQYA 2Y93A 4IGFA 4URFA 5ENVA 2VTEA 3ZH2A 4AJOA 4NIMA 4R1TA 1HWYA 3IAHA 2GR9A 3K92A 3O8QB 1E3SA 2AMFA 1OBFO 2WD8A 2ZTUA 3R6DA 3T4XA 2W98A 3JSAA 3UICA 3ZCXA 2TMGA 1HETA 1D8AA 1C1XA 1KVTA 5A9SA 4NI5A 1U3WA 2IZ1A 3I52A 3KO8A 1C1XB 2DBZA 3D3WA 3ZU3A 5COAA 1Q7BA 1W73A 2BRUA 2EKLA 3D3WB 2HAEA 3VZSA 4AJKA 2IRWA 1E3LA 3F4LA 4NU6A 5TT0A 1SAYA 5K6AC 3ZNQA 4OQZA 3OECA 4YJHA 3NDRA 2WYUA 2VRCD 4RPHA 3ZU4A 1DSSG 3E9NA 1GAEO 2Y05A 4IUYA 2D59A 4Q9NA 2O3SA 3OBBA 5EL0A 3C8MA 2WD7A 3PZRA 1P3DA 2Q2VA 4OSPA 4AJ4A 5KOIA 4B8WA 3U49A 2I3AA 5IF3A 4OL9A 3RCBA 1OOEA 5JC1A 3GFBA 3WG9A 1N5DA 1O9BA 2WD7B 4Z3DA 3E6AA 2CDBA 2Q50A 4M54A 4MDHA 4JBHA 1G1AA 1WP4A 1LQTA 4PLTA 1CEQA 1GUFA 2BMAA 1KVRA 3MEQA 3PJEA 3ZGYA 4E0BA 4EDFA 2BGLA 4Y9DA 5JYEA 4K1LA 3IUSA 3RBZA 4CMHA 2IEDA 1E1MA 2V65A 4RVUA 4U0KA 2J3KA 2VHXA 3DAFA 5G4KA 1UDAA 2VT2A 4LISA 2W4QA 1MG0A 1NVMB 4E3ZA 3BA1A 1KY5A 5G4KB 3FSRA 5I9LA 1ISGA 1E5LA 1DJQA 4J4BA 3JYNA 1MXFA 4HWKA 1ONOA 3X2FA 2PZKA 1C3VA 3AM3A 3TSCA 3UUWA 2PNFA 2RH8A 3MOIA 2A94A 3AI3A 2A35A 1TT5A 1YL5A 3JTMA 3E8XA 4FJ2A 2QRLA 5B37A 3H5NA 1G0OA 4XR4A 4GX1A 2GSDA 1TT5B 2X5JO 3B1FA 3FBTA 3G1TA 1N9GB 5IDQA 2ZATA 1VJ1A 2BI8A 4IDFA 5U4QA 1HXHA 3C7CB 3RUAA 1DOHA 5A5FA 1YB5A 2NU7A 4QXMA 5KVSA 4XQGA 3SJ7A 3FTPA 4CM5A 4OOEA 3MOGA 1M6HA 2JJYA 4O1MA 5EMHA 3OIFA 2SCUA 1F0YA 2HU2A 4U6SA 2OGUA 3ZW9A 1UP6A 3VZRA 3IIEA 1Y5MA 1QYWA 3L6EA 5H82A 3PYLA 3S2GA 2NUAA 1X7GA 1X7HA 4Z0HO 4F46A 1PZGA 3GEDA 5L45A 1BTOA 1AUPA 4XR9A 3UW3A 1WDKA 5DOZA 3PVZA 4YYZA 3WDSA 2PR2A 3PRJA 3U62A 3PWKA 2DBQA 3IP3A 3HDHA 3VPGA 3FPLA 1ZIDA 1IB6A 1U1IA 3KZVA 4BV9A 4E2YA 4FB5A 3V8BA 5JFOA 4W6ZA 4YAIA 1ZMTA 1QXSA 1ZO8A 3PI7A 2ZCVA 2E82A 5TF4A 4DPLA 2ET6A 3TNLA 5L7TA 1MUUA 1WLYA 4BOYA 4Z9XA 1YBVA 3DBVO 2VYNA 3ITKA 3MJSA 1HYHA 3ANNA 3WWYA 1F8FA 1XCBA 4E2ZA 3IS3A 1XSEA 1E1NA 3RAJA 3E03A 5JMPA 5L53A 1J0XO 3RIHA 1I2BA 5ADHA 1DLJA 3W6ZA 2C5EA 4DIFA 2XXJA 2UDPA 4RLSA 3HDQA 4PLYA 2DPGA 5JAIA 2Q1UA 1K6JA 3EMKA 4MKZA 5FI3A 2Q4EA 3TOZA 4BKQA 2HMUA 3KSDO 1XLTA 4XDYA 4BO6A 2AW5A 4D79A 4DYVA 4NBWA 1SNYA 2Z1NA 3VVBA 4BKRA 4B4UA 3DOJA 3FF4A 2XPCA 4CJXA 5CG1A 4L4RA 3U0BA 3WBFA 5A3VA 4TVOA 1PJQA 3G79A 5IDWA 3D3EA 1AXGA 2I76A 4GAEA 4M55A 3ZWYA 4U7WA 2J3IA 4DLBA 3B1JA 4P8RA 4D43A 4DMLA 4NBUA 2X4GA 3AM5A 4G5HA 4HXYA 6ADHA 2VZ9A 2E6UX 4MVJH 5EIOA 1BVRA 1E6EA 1K3TA 3GG9A 1HSZA 1V0JA 4CM9D 2Q3EA 1BWSA 5KVVA 3FR7A 3DONA 4IDGA 3ZWPA 4CMJA 4Z0TA 1RYEA 4PRKA 3ZW8A 1E92A 3WNQA 4RF2A 3EVNA 4UVGA 4LSMA 1WVGA 4UUOA 3QJ5A 4M1QA 4YDRA 1F14A 2ZIZA 2AA3A 1DDOA 3E9MA 1VSUA 2X5OA 3OF2A 2AHRA 3GLQA 5AVOA 2OXIA 1CQIA 1PQPA 1JW9B 4B7CA 1UXJA 1PIWA 4MKXA 2VUSA 4E31A 1XYGA 5TQVA 4D42A 3DR3A 1ULSA 1GUZA 1SBYA 1BMDA 1DBVO 5JAQA 2QHXA 2NVBA 3EY4A 5CDTA 4LSWA 3NUGA 4QECA 5MGBA 1T25A 4IJWA 3H2SA 3GY0A 1LLUA 1TXGA 4KUEA 1L7EA 4NQZA 1PX0A 3GN1A 4JGBA 3LT2A 2UAGA 3SBOA 4N7RA 4PRLA 1KVQA 3UN1A 1HTBA 3FWZA 2VZ0A 1K89A 1YGYA 3JQAA 1I10A 1NTOA 3FPCA 3WQRA 3LLSA 4DA9A 1ZJYA 4MOWA 1X15A 2X7HA 3BMOA 2FOIA 1VL0A 1YOVB 4XYLA 4RPGA 3A06A 1B26A 3HJAA 2VHWA 2YV1A 4PFJA 1FK8A 1T4BA 3PYXA 3PEFA 4G2NA 3DZJA 4RZHA 1LU9A 1R4MB 4R1NA 1QYVA 1Y7TA 1E7MA 2OO5A 1YB1A 1ZSYA 3JQ7B 1J49A 4N18A 1XU9A 4ALNA 4EGFA 1T1RA 1I5RA 3H9EO 4W7HA 4B3JA 5I8ZA 1VE9A 5EJ2A 5C5IA 1CQJA 4B7UA 1NASA 2HSDA 4CQMD 1HSOA 1P1JA 1PGQA 3H4VA 3L4SO 2D3TA 1LNQA 2YJZA 4EUFA 4F6CA 3IKTA 1GZ3A 4IXTA 3K2EA 1DLIA 1I36A 1T2AA 3PIIA 3KEOA 3KVOA 4Q3DA 3TRIA 2EKQA 1CJCA 3VOSA 3ZV3A 2F00A 5A4DA 4OYRA 3Q3CA 3QWIA 2WJPA 2H63A 3PHGA 4EBFA 1PZHA 3P7MA 1V3VA 1P1IA 4HX5A 4BNYA 4CPDA 4I5GA 3LC1O 3KSUA 3SX2A 4LRTB 4BS9A 1DO8A 2P5UA 1MC4A 3RU9A 4B7XA 4I9UA 1ZNQO 3A9WA 1N8KA 4IPTA 1FJHA 1Z45A 3D5QA 1KC3A 1IHYA 4AICA 1PJCA 5G0WA 3IKVA 3QVSA 1ZBQA 5EESA 2GGSA 4E2XA 4RPJA 1WAMA 2FP4A 2B83A 1AE1A 4YCAA 3Q1LA 3WX0A 4BNUA 1AGNA 2OP1A 3OJ0A 4NFSA 4D3SA 2WYWA 1YVEI 4YTEA 4AJJA 3LT1A 4NNJA 4WUVA 1DC4A 3WIEA 1SEPA 3PZBA 9LDTA 1H6BA 1B2LA 3ST7A 2P9CA 2EHDA 3NJ8A 2DFVA 3TJRA 3IUPA 3F5SA 3U4IA 1JLLA 2C82A 4XGNA 3QWBA 1V9LA 5A06A 1Z73A 4Z9YA 2JD0A 2DFDA 2VCYA 1AXEA 1I32A 4I9NA 4MVJM 1H2HA 2AQIA 4FFNA 1MFZA 4WK6A 4AJPA 4NFYA 4PZCA 4WEQA 1GCOA 4NHEA 1HDZA 1PEDA 3BYZA 4JROA 2FR0A 3JCZA 3K5PA 1FDSA 4OIMA 1NQ5A 5I8WA 3JYQA 2CD9A 1ADCA 4J90A 2ZB8A 2OMEA 2VYVA 4CMEA 4M49A 3K2BA 3O4RA 1I0ZA 3CZMA 4WLOA 1JN0A 4YRAA 2UUOA 3H5AA 1CIVA 1SC6A 1QMGA 3I9JA 1LTHR 2R00A 3K73O 1ZK0A 2E49A 1Z6ZA 2C20A 4MJLA 3H9UA 1XELA 1JAYA 1HE5A 2O23A 3ADPA 1R16A 1LSSA 5KJ1A 3RC7A 2GF2A 3CUKA 4DMMA 4II2A 5KVCA 3RFXA 4B3IA 4TRJA 1VC2A 4MIYA 1UUFA 4YRDA 3VZPA 3CMMA 1K0UA 2IODA 3OIDA 2VQ3A 4IS2A 1U4SA 5TRTA 3DZGA 1J5PA 1T4DA 4YRBA 2X9GA 1LXCA 1XU7A 3ZNNA 1JU9A 2PKQP 4L75A 1N7HA 3ROMA 2GCGA 3RBXA 1KEPA 2QRKA 4BL5A 4WLEA 2PKQO 3F1LA 3DOCA 3N74A 4CM4A 3EDMA 3NEPX 4GGPA 2X0RA 1NQAO 2C7GA 4ZJUA 3HG7A 2CVQA 4K26A 1NWCA 3FTNA 4A27A 2NVWA 3ANMA 4OH1A 2FPIA 2NLOA 4RQTA 3L4BA 4BUCA 4Z6KA 3P2OA 4IQ0A 1XGKA 2PGLA 1NFFA 2PY6A 1ZUD1 1D3AA 4KMSA 4XYBA 1XWFA 4NR0A 1UXKA 2ZB4A 1K2WA 4A03A 3JD2A 4BNHA 1VKNA 3OJFA 4ZQHA 2BD0A 2H5LA 3ABIA 4CM1A 3UXYA 1B7GO 3QVWA 1W6UA 3FN4A 1WWKA 3NTRA 3OJLA 1HDOA 1MV8A 4RPLA 4CMCA 1IZ9A 1Q2XA 1EUCA 3B20A 1ZK2A 1R6DA 4R9SA 4J43A 4DUPA 2OORA 4O5OA 4XYEA 4FCCA 5BNFA 3EHEA 4YB8A 2C29D 1T1SA 3E5MA 4BO3A 3C1OA 4FOSA 5BSHA 5HTOA 4K6CA 4CUZA 4AJNA 1R15A 3JQGA 4A10A 1SEVA 4R51A 1JWBB 2VT3A 1V8BA 1WDLA 2EEZA 3QHAA 4R54A 5L40A 1XQ1A 2NQTA 1N1GA 3EZLA 3KYDB 2J3HA 2PKRA 2BGMA 4XYGA 2YHIA 2YY7A 3AU8A 3AUAA 3G49A 4FGWA 4KUGA 5GY7A 4AJHA 3QA9A 4YJFA 2F1KA 1LLDA 2YHIB 4L8VA 3WYCA 4E12A 3DEYX 1NM5A 1LDBA 3ETEA 4YA6A 1IOLA 4DRYA 3RI3A 2Q1TA 3DMTA 3RFTA 4CMEC 4QX6A 3PXXA 3GH3A 5G0TA 1EFKA 1ZCJA 2R00C 3D0OA 5G0SA 2VHVA 4QTZA 3TL3A 3ZHZA 3V5NA 3ICCA 1T26A 1E1LA 1E0DA 3GNTA 4MKRA 4RV9A 4BGVA 4BNIA 1IPEA 2UV8A 1HDXA 1EUDA 2WE8A 3JQ6A 3PDUA 3P2YA 5JMWA 3DZKA 3A28A 4B8ZA 1ONNA 2P5YA 3DC2A 4F6LA 5DN9A 2XOXA 3DAPA 2CF5A 1EEHA 1SZJG 1FDVA 1E6WA 2QZ9A 3AI1A 4MVJE 3R3SA 1P0CA 4GWKA 2G82A 4ZQBA 2CZCA 4LRSB 4YAJA 4A7PA 3CEAA 3LSYA 1M75A 4IBOA 1E7YA 1PZEA 1KIFA 3I83A 1QV6A 5KNLA 1L7DA 1CRWG 3VTZA 4ZVVA 1ZK1A 2FY8A 3U09A 4MPDA 4EI2A 5CEFA 5G0UA 1GPJA 1VI2A 3LT4A 3AOGA 3L4BC 3PQEA 3PTZA 5TLSA 1XEAA 1LRLA 1CDOA 1M67A 4E32A 4D7AA 4PGFA 4BKUA 3JYOA 1HLPA 3PDJA 3ZDFA 2DC1A 3PPIA 1F06A 4BO7A 2RAFA 1NPYA 1VRWA 5FI5A 2VHYA 2Y68A 2YYYA 1O6ZA 2GN8A 3JQ8A 4PG5A 1Q0LA 1U2DA 1PQWA 4PCVA 5BT9A 2NWQA 3LZ6A 2B36A 1EDZA 2X86A 1H2BA 3FR8A 3GZNA 3WMWA 2HJRA 4CMAA 5ER9A 4CV3A 1NX6A 2I67A 1LC3A 1GTMA 2JHGA 3AUTA 1I2ZA 3EYWA 3D64A 3GZNB 4R9RA 4RF4A 3UCEA 3ZN2A 5C7OO 1FDWA 2V7PA 3WGGA 5DCUA 2B35A 2WTBA 4U8GA 2JAHA 2O3UA 1V3TA 2BI7A 2E48A 3PLNA 4JCOA 4CM9A 5J23A 1LRJA 2LDXA 3X2EA 5H81A 2ZKLA 3RROA 1TT7A 2BFOA 3DAGA 1DIAA 3LK7A 5BSFA 3GUYA 4KOAA 1A71A 3SC6A 4PLGA 1H94A 1YL7A 1GR0A 3FI9A 3W4JA 1FXSA 5BR7A 3PP8A 4RVGA 4YAKA 3S1LA 3QWHA 4IIVA 3RD5A 4FQ8A 2BF7A 4MINA 4WNCA 1I3LA 3DMTC 3MJ4A 1VL8A 4O59O 5DOVA 2JD1A 1PR9A 1U3UA 1LEHA 2PH3A 1ZXBA 5DBFA 4BGEA 2EGHA 1HE3A 3L07A 5A9SB 3QRWA 1R66A 4ZQEA 3L6DA 5T8KA 4ALIA 2DKNA 2PH5A 1UDBA 1P1RA 4H3VA 5FEUA 2PWZA 4WPGA 2ZJ0A 4R3WA 1HYGA 1NQOA 4E2WA 1Y6JA 3FHLA 3QSGA 3GDFA 3JYLA 4CMKA 3ICPA 2C54A 2PK3A 4BNVA 1NAHA 4E5KA 4ZRMA 1LX6A 1H6DA 1JVSA 1PZFA 4GKVA 4YJHB 4BNNA 3GHHA 3HSKA 4BGUA 5C37A 4K28A 2Y0EA 5B4VA 2H6EA 1JKIA 5EQDA 2Y0DA 5DBGA 4MVJF 1YONA 4R3NA 2ZTLA 2DVMA 3S2EA 3D5TA 4DVJA 5BSGA 3GR6A 4UUNA 3G17A 4DPKA 2GERA 1SOVA 5T5QA 5JAMA 4XGKA 3WIDA 4BO9A 1P31A 4F45A 3O9ZA 4ND3A 4XJTA 3GN2A 3GNSA 1BDMA 1DRUA 1C0KA 1RPNA 4HP8A 4DTIA 2D5CA 3GDOA 4UVHA 1W8DA 4Y98A 4D3DA 1LSOA 4MVJP 4H16A 2HKIA 4Q3CA 4OQYA 4J9UE 3GPIA 1ID1A 1KY4A 5KIAA 1DFHA 4XCVA 1HDGO 4UULA 4WOKA 4ZN6A 1KEUA 2X9VA 2PTGA 3WGQA 5HS4A 3WGIA 4QFCA 3RSHA 1U5CA 1WZIA 4KTVE 3JD1A 2EW8A 4DQXA 5ES3A 2Y66A 1GDHA 3OMLA 4RJTA 5TS3A 5IFLA 1RM4A 2QYTA 4WEOA 4JP2A 2Y99A 1N92A 1EBFA 4WECA 4Y6SA 2GNAA 3Q2IA 3OETA 4HY3A 4DC1A 9LDBA 1BG6A 1E7SA 1ZZEA 4QFDA 2DAPA 4AJIA 3K96A 1UR5A 3C1AA 2NM0A 2RCYA 4GPD1 2QQ5A 2FPPA 3ZHXA 1C0IA 4HBGA 5HBRA 1B8VA 4WCFA 2FSSA 1D1TA 1OC2A 4Q3EA 3ZV6A 3PHJA 3RUEA 3JQBA 5JYDA 2EG9A 3DBHA 3OJEA 1LSJA 4XIJA 5GZ3A 5CG2A 5JDCA 3DBHB 4W7IA 5JNLA 1DIRA 4PVCA 4QSMA 3AM4A 5LDHA 1ISHA 3UAGA 3GC6A 4MO2A 3JD4A 1ZSVA 2JFHA 5T8KC 3GG2A 3HN7A 3UFXA 1GFSA 4NFHA 4IM7A 1YL6A 5CDYA 1PGPA 3P19A 4W82A 4JBGA 4MIEA 1ZK4A 3I6IA 1Q0QA 3GPDG 3AWDA 3PFWO 1ENYA 3KTDA 4R5HA 3JQEA 3KSZO 4XWYA 3EGOA 2D4AA 3F46A 4I08A 4CUJA 1DHTA 1RM3A 3ASUA 4RLHA 2HMVA 1DC6A 1YJ8A 2OUIA 3WMXA 1ZW1A 1L1FA 2HCTA 2I9PA 5EQFA 3W4IA 4ZQFA 3NT2A 5T67A 1HF3A 3V1UA 1HE4A 4S1VA 5TNXA 3TZHA 4M86A 1X13A 1YQDA 1FF9A 3PJDA 4FN4A 2AQ8A 3CH6A 2ZTVA 4OKIA 4BO0A 5C7LO 3NT5A 1IL0A 1V35A 2EIHA 2POQX 3B1KA 4YXFA 1BXKA 1FDTA 1PL8A 1HT0A 3I1JA 4FC6A 4YEDA 1U4OA 3VH4A 4JX8A 3DL2A 2VWQA 4PVDA 1UZNA 2BHLA 3DDNA 1GEGA 3DMYA 4LW8A 5CFZA 1Y81A 2HUNA 3F47A 3HFSA 4J0EA 5KJFA 4YPOA 2Z95A 1DFIA 3D1LA 4XRGA 2H9IA 5ER6A 3FNEA 4AL4A 4TRRA 2NQ8A 1CF2O 4CLRA 3BZUA 4WASA 4NBTA 4BO1A 3STHA 4AJLA 3AJRA 4MVJD 3UH1A 3GGOA 4KWIA 3ZHYA 3F9IA 1NBOA 3S2FA 4CLRB 4YQZA 3UCFA 2YDXA 2AQKA 1EVJA 4ESOA 1R0KA 3UKOA 4BO4A 3ADOA 3I9MA 4NU5A 3LC7O 3WLEA 4QEDA 4GKBA 4JN6B 4J1TA 4B4WA 4C7KA 4DBVO 3RC1A 3ZWNA 1F8GA 4FJ1A 3E9QA 4U6QA 5HS6A 1YJQA 1Z7EA 3PGJA 1BGVA 3OEYA 2B4QA 2GLXA 2Q99A 5HWSA 1YQGA 1GU7A 3MWEB 1I8TA 5JC8A 4HFRA 3CKYA 4QUKA 2X0NA 3KB6A 4GLOA 1I01A 1HL3A 1RM5A 4HFMA 2ILTA 4WCFC 1R0SA 3JQBC 4W99A 2R2GA 4H15A 3WGOA 4EJ6A 2DUUA 4GSKA 5JDCC 3GFGA 3C3XA 3KHUA 1CERA 5JAZA 1R12A 3NAQA 4UVEA 1LDEA 3SC4A 1JKFA 2C0CA 1W4ZA 2AG8A 2O50A 4CLOA 5MDHA 3H2ZA 1EUZA 1GYPA 3IOYA 4YACA 2GN6A 3FBGA 1WMAA 1H0KA 4JP3A 2VWGA 3JQAB 5ICSA 4CLOB 1ZVMA 4S3MA 3LC2O 3TZCA 4RL6A 2YFHA 3GVPA 1E5QA 3H8VA 3BMOB 4DWVA 1U8XX 3OIGA 5TGDA 2CDAA 3JQ9A 3UVEA 2HQ1A 4HFJA 5TJ9A 1UDCA 4RQUA 1QLHA 4RVSA 4FR5A 3ON5A 3BHMA 4IDCA 1NVTA 2OP0A 2X9NA 3BTUA 1H9AA 5AXAA 4L73A 3N58A 2AE1A 4PZEA 3I4FA 2Q1SA 4KDFA 1DXYA 1X0XA 4IJUA 1ZEJA 4HV4A 3FD8A 5EPOA 3NDJA 4QT0A 4BMNA 1MP0A 4L4SA 3VC7A 3ZWWA 2WM3A 4IIUA 1JVBA 4JJIA 4GBJA 2P9GA 1Y8QA 4BB5A 1YBAA 4MVJI 2DLDA 3ZWXA 3RC2A 1RWBA 3RJ5A 4ID9A 3TPCA 1YWGO 4D45A 4PG8A 3M1AA 2FMUA 2WDZA 3K9QO 1E7QA 3WB9A 2P2SA 3SJUA 2J8ZA 1GQYA 3G1UA 3MJTA 4FPXA 3ITDA 2I99A 3Q9UA 4D0SA 8ADHA 3V1YA 4Y67A 1PJ4A 2ZB3A 1OZAA 2CUKA 3DOOA 3VKVA 2Q46A 1KVUA 1K6IA 4FFPA 4UUMA 4J2HA 5CPBA 3U5TA 1PS0A 3LVFO 5KKCA 4KUHA 4BNXA 2DBRA 3JD0A 2EJWA 3DHYA 3HADA 4XB1A 3W8DA 4IDDA 3Q6IA 3K30A 4R68A 4W9NA 5A05A 3SLKA 2Q2QA 4EJMA 3ROPA 3SVTA 2XXBA 1VJ0A 3WJ7A 2B0JA 5JPIA 4GL4A 1M66A 5GZ6A 3WXBA 2PA3A 4CM7A 4DQUA 2NADA 4WLNA 1Y8RA 4TSKA 4NJMA 1SPXA 2Y67A 3QY9A 5KTKA 1QORA 3RUDA 1X7DA 4ILKA 5A9RA 2EP7A 3QVOA 1IULA 1Y8RB 4CV0A 1A4UA 3EC7A 1VM6A 4YT4A 1E1KA 1G6KA 2IE0A 1FMCA 1MA0A 4J7UA 3ROKA 3KBOA 4UEOA 4A0SA 1AHHA 4NK4A 4OXYA 1P77A 3WGHA 4UAGA 5KJEA 3ANLA 1F12A 2PZMA 4E5NA 2W2LA 1EVYA 5F1KA 3TDKA 2J3JA 1A9YA 3L77A 1ADGA 4M8SA 1QYXA 3ZNPA 2PGJA 3KEQA 5DF1A 2O48X 3INRA 1Z74A 5FFFA 4ND4A 1LUAA 4AJ2A 4CM8A 3NX4A 1QR6A 1AN9A 3H6KA 3GZ4A 2JCYA
chains in the Genus database with same CATH superfamily
1VIVA 5DPMA 5FHQA 2Q6LA 5J2TA 1BU8A 5EE1A 5A1TA 1Q0SA 3I9OA 3KZKA 1U63A 1G20E 2XUKA 1K63A 1XMPA 3ENZA 4F5ZA 1H3NA 2H08A 1GG9A 5GAJA 5C4MA 5COBA 2KI5A 4MUHA 2QTNA 1M2HA 1NVEA 3GJSA 3IUBA 3PQ4A 4HLUC 4IR7A 2X3YA 4JNKA 3HUEA 2WB2A 5BUCA 2OD2A 4O4LF 4Q4JB 3OE5A 1DIBA 1Z2DA 4HN9A 3TTXA 3DZHA 3T1HB 4YJDA 2E4WA 1MA3A 1CC1S 1XZGA 3BWDD 1HDCA 4UVIA 3LH5A 3AF2A 3QPAA 5J63A 3VH1A 5A02A 5BORA 1KI9A 3KP1A 4IZIA 1MOPA 4PGHA 4AZ3A 5IHPA 3UB4A 1X39A 1SUCA 5DGIA 3Q8XB 4EEXA 4X41A 3I53A 3KTFA 2YHSA 3DE2X 5IM4A 3CUWA 2CJXA 1NN1A 1SXJD 1UXGA 4P93A 3DE1X 2FPGA 2W2VA 3WIBA 4ZICA 1LJUA 3D3NA 2NU6A 5CLFA 3D2AA 1Y1PA 3OLZA 2NVOA 4A16A 1LQ2A 1AN0A 2XOKD 3AL0C 2YRFA 4LBWA 1J2JA 2NNLD 4LC9A 5FR2A 4CLXA 3SYTA 1EX1A 2B21A 4GYJA 4E21A 1FCJA 1RKXA 5HM8A 2NVUA 2ZDGA 5LQJA 3WHIA 3WWOA 2I6GA 3PDIB 4YT8A 1TQ2A 4JLBA 2ZBGA 5BNTA 1WTAA 2O14A 1HG1A 4PIVA 2XXAB 5ALUA 2JFFA 2IZ0A 3W5BA 4K7JA 4DB4A 3N2ZB 4MR8A 3CLKA 3WGYA 5KO2A 1JDSA 3X2SA 1MC5A 3BXEA 3SEQA 2WE7A 3OTHA 2XJ9A 2Z43A 3B3FA 4L28A 2C0QA 2Q07A 2H06A 3OWHA 1TA4A 1W9MA 4JELA 2V4MA 2X1HA 4YAOA 5GPBA 1HNWB 4B87A 1EBUA 5C80A 4MWSA 4MS4B 4R6XA 1J97A 1UJNA 1NWHA 1HDYA 1QTRA 1LW7A 3P4UA 4PQRA 2C84A 3ONWA 5TQ0A 5KTRA 1IEXA 2ZRPA 3V8NA 4GWGA 4GMDA 1NHGA 1TEHA 2GD2A 4G85A 5JS8A 3H3FA 1XTBA 4N76A 3MCVA 4M3NA 1BA2A 1X7ZA 1U99A 2Z1MA 4LZZA 3RBVA 4LRUA 3MJEA 4TLBA 5EWJA 1XYYA 2VL7A 2HLDA 1P72A 2XDWA 5C46F 1Z6XA 4F04A 1E6UA 3ZDBA 1YBFA 1VCNA 4PO8A 1OLOA 2X19A 3MK31 2C7VA 3VC2A 1P2VA 1P2GA 3B38A 5KPDA 2SNIE 5KCZA 4IDNA 4CLHA 4B2YA 1EA5A 4BVBA 1L6IA 3HU5A 2H18A 5AJHA 3HDJA 1JQJC 3GLHE 1NR7A 4KQEA 4TL9A 2DECA 3L0IB 3AP2A 2ZBDA 3D4OA 5JW6A 5TXGA 4DIKA 4HEHA 1RI5A 1R1DA 1SD5A 2A9RA 2H0AA 3U4CA 2II6A 3L7NA 3UAXA 3VNAA 4WACA 1M8KA 5JNTA 3GXOA 2IPLA 1Y4SA 3L8FA 1ISPA 3LCRA 2R1TA 1OAAA 4ZT3A 3VDMA 3QX8A 4UTVA 4C7OB 3QU2A 2G1PA 4MA4A 2Y2UA 2ISSD 4IIYA 1ZAYA 4FLEA 3V8PA 2QNBA 1A7JA 3DDUA 4D4LA 3IVAA 2VQ6A 4KJXA 4K9KA 4O5AA 2OA0A 1UMBA 3WJAA 3WLHA 2H31A 3CVVA 3N07A 1JG2A 2R7KA 4BNMA 2IYPA 3M1LA 1C7EA 2EWWA 4R69A 5F1YA 1YJAA 2PFGA 5KAMA 3I92A 1XNGA 5LPNA 3AXSA 3TINA 1WO8A 4FE4A 2LCFA 4PO9A 4CL3A 1GV0A 1Q12A 2QLFA 2XMZA 3GJ7A 3QUAA 4QG7A 2V6MA 3AHIA 4ILEA 3K31A 3ZDXB 1XVVA 2RHLA 2ZJ6A 3L8GA 2D00A 2HO5A 2Z9CA 5DH9A 5HUQA 2DTDA 4WNYA 5A3JA 5JNVA 5JYCA 2HA3A 2F1IA 1W29A 2P11A 2BFFB 4B9AA 2P91A 3TN7A 2INGX 4CQLA 3JWEA 4R0MA 4E6EA 4J1NA 1ZI9A 2VJCA 2Q3JA 3MS2A 5DW3A 3OZXA 3SIPA 2AR0A 2A30A 1V6CA 4HLQB 5EOVA 3UMMA 4EENA 5JDIA 3I9LA 4AW9A 4CKEB 4R05A 4A2QA 2F8SA 1THTA 1YCDA 3UUFA 4DV6B 2I7DA 1X1RA 2AQHA 2VYFA 2A9OA 3M5PA 4Y2RA 1O0BA 3LMKA 2PX0A 4JBXA 5ETJA 3GRRA 5EHQA 2ETVA 3KRTA 4E4TA 3DHEA 7YASA 3BBLA 5IAEA 5KWEA 2OL4A 2WWRA 1NRWA 3DTTA 4FI3C 3REQB 3NWPA 1XKXA 5C5DA 2EJVA 2B8JA 2I6SA 2MYTA 2RGXA 3BXXA 4IMJB 2GM9A 3A3KA 1NJ6A 4JXKA 1Q0HA 3V4SA 2ECKA 4HNGA 4PC7A 2MYUA 2D1QA 4DADA 1HR0B 4W5NA 5KNCA 4CTMA 1MB3A 1TTPB 1TUBA 4K05A 2IXBA 2VHUA 3RVLA 3DNMA 2BWJA 4YIHA 1L5SA 5DYWA 2IHJA 4MKGA 1L4BA 1ZU4A 4PLVA 4UE2A 4TTSA 4DUGD 2UYYA 4AVYA 4R2IA 5EZQA 5F2EA 2EOAA 1K6XA 2GAFA 3GWGA 4L0QA 4MEBA 1HE1C 1TJNA 2O2XA 4RQAA 3VKGA 1B8PA 5DASA 1PVOA 4ZVRA 4Q66C 3GRYA 4NESA 3TVTA 4OAQA 5AM2A 1UZLA 3QLJA 4ZC1A 5H80A 1K86A 1FIUA 1ZUHA 4BO8A 3HA3A 4RORA 4PPNA 4K0RA 3DXYA 1MQ8B 3OT1A 4LDZA 4OSOA 3WMEA 3F73A 2JG3A 2PIDA 3URMA 2ACWA 4BAZA 4I5IA 4EW1A 1PQYA 3OPQA 2O8CB 3IAAA 1STOA 5BQFA 2QR5A 1NW9B 3UF0A 4W7SA 3U48A 3FHOA 3VVCA 1BD3A 1JYFA 3BKWA 4LYEA 3H0CA 3AL3A 1GGHA 3N2YA 4M87A 1N6PA 2YV3A 4FS3A 1R8QA 1R74A 4NE2A 3T5MA 3WNCA 4L9AA 1KDZA 2JB9A 2WIDA 2ZVPX 3N86A 1E3IA 4F4FA 4D0RA 5K1ZA 2J0SA 1A4IA 2BLNA 1N0IA 2GZAA 4J4TA 1KDTA 2AN1A 3NIWA 1ONSA 4IOKA 4PPQA 5GONF 3V2IA 3W3ZB 3KQNA 1ATZA 1A9TA 1AT1A 1NW7A 5JAHA 2RGWA 4ZEVA 3NDPA 3CLTC 1N2HA 3CLUC 3Q6MA 4KN8A 3TL6A 3W9BA 4B6FA 7ADHA 4KR6A 3DBLB 4LWZA 4UREA 4Y6RA 1OB2A 1Y63A 221PA 1E0AA 3BIWA 4QPZA 3COJA 4HH4A 1ZMOA 3ILXA 4J0IA 4KIWA 1KQNA 3ZXUB 4ALMA 1BRMA 3MJRA 4ONEA 4FYYA 1THMA 1XYVA 4B47A 1JB1A 1A5ZA 1D09A 1YH3A 2V6FA 4AWAA 3KJEA 1X8JA 4HR7A 3E8SA 3EY9A 5B7GA 2C59A 2QMHA 5C1DA 3I6BA 3IJRA 3OD5A 3LFUA 4PINA 3TUZC 2LUOA 3RRYA 3C74A 2IYSA 1XXHE 1BEZA 1GQ2A 1ZSNA 1YB7A 1RVV1 3DCNA 5BWOA 4U8HA 3TRDA 4ENQA 1A04A 2D2VA 4UUBA 3VGPA 5JYBA 3UMFA 4FJ0A 2ZSIA 1V11B 3H2HA 1V8OA 4L6AA 1QF7A 4PR3A 2Q28A 3VJLA 4HNSA 2EW1A 1EESA 1LS1A 4G0ZA 3NJRA 1XG5A 4HDKA 4BX0A 1VLJA 1EGQA 1O95C 2G06A 4OP1A 5JARA 1CS0A 1LJ8A 3LFHA 1E9CA 4BVGA 1SUDA 3LBYA 5EXTA 3B5IA 1XD9A 4EHLA 4MGYR 2JFGA 3FYSA 3M89A 3TR0A 1O7JA 2YVUA 3VH3A 3WRYC 3I76A 1ISFA 4FMDB 3CF6R 4X3PA 5EE5B 5FL7A 4G1EB 3ZH9B 1XZPA 3DV9A 3MWFA 5JLJA 3CTMA 2ACVA 2KLBA 2XTJA 3HGMA 3GVIA 2JBHA 1W85A 2OD9A 2P3SA 3G8YA 2W7TA 4V1CA 3LUGA 1F51E 2Y1DA 3G8AA 4TWZA 4FD3A 1FRZA 1DAOA 2VRNA 4V38A 1JQLB 5ALZA 1PFGA 1GO2A 1UEJA 3R5HA 1AGXA 2I8AA 4TN5A 1Z2EA 4FR2A 3ZWOA 1DC3A 2AJBA 4Y7DA 1SKYE 1GAXA 3AUKA 2ZI9A 4KNWA 3BJZA 3MYRA 4GMFA 2W70A 3WBKA 1YRWA 1NBMD 2G9ZA 1QANA 1U0OC 2KX7A 3IAM1 3VPAA 1QGAA 4DCJA 1HTTA 1N6LA 1HRDA 1NFQA 3ITNA 3K9CA 3QE0A 3R20A 4D4GA 5BV2P 1PJLA 3E7XA 4TLDA 1KEWA 2CWWA 2RBEA 4GX5A 4BFCA 2G9VA 3QYFA 4RLQA 1K2VN 3A2MA 3TGWA 1Q0PA 3VKFA 1YB4A 2E4YA 1ZIXA 2R8RA 5IX8A 2QD3A 4M1ZA 2Q7DA 5FBVB 8ATCA 1PL6A 5L4NA 5E2BA 3UOGA 1VZ2A 1IQPA 5CIYA 1BXGA 2AMLA 3QWAA 3A32A 1U0RA 2CJYA 3R6LA 4RNCA 5E95A 1E6CA 5A7FA 3NM4A 5J4LA 4RL4A 4PZLA 3SAJA 5F1OA 3HCCA 5BNIA 2XIJA 2Y0CA 4YFYA 4E70A 5FPTA 4DHWA 4E2FA 2D62A 2OCPA 3PNSA 1N9GA 2TYSB 2J7KA 4GQIA 1X1SA 2FOXA 4FKZA 2GD1O 4X8OA 5FI1B 3RIXA 5EP4A 1WUTA 1YQTA 4RHXA 2XA1A 4NJEB 3ZNOA 3SOZA 4LZPA 1DWQA 3U3XA 4CRWB 4DCGA 2I71A 1XTQA 2BELA 1A7KA 1NUSA 4BLUA 1N0UA 2OBYA 3R5XA 4Q3KA 3DD1A 4TKMA 3LY5A 1DUVG 2BFPA 1Q0ZA 3EDRA 5EQTA 2ZBQA 3EPKA 2R79A 2OCAA 1SXHA 1KI2A 4NPCA 1JILA 3AHFA 3B9BA 1EAYA 3RFVA 3QKRA 1KK0A 4O2AF 4M1TA 3M4XA 1SBHA 1YNSA 2PWBA 4QWWA 4L22A 1P0FA 1X19A 2D8MA 3OX3A 3I5XA 1RM0A 5TJHA 3K70D 4M83A 5A6SA 1ENOA 4M1OA 2A9FA 1JXAA 3IQZA 4RVFA 4XE5A 3TNYA 1GQQA 1Y3CE 1WW3A 4FYWA 3QPBA 1FMTA 1E2FA 2VAPA 4QARA 4ND2A 1GA6A 3OIVA 4RHCA 4LY0A 4GI5A 1I1HA 4AMYA 4B43A 3S55A 1EU1A 2NZUG 4EFKA 4LMPA 5GWXA 2H4XA 2I66A 2Y9MB 2AN9A 2GYWA 1KSFX 1DV1A 4MI9A 1OLSA 1N5MA 3HR8A 1XHEA 3BJMA 3KKKA 3O2JA 4NH4A 4PLZA 1VPEA 5IJZA 4WK4B 3D02A 1NHWA 4EMBA 2LIVA 4PZAA 1OPRA 1YS4A 1QAOA 1ZP6A 2A58A 2GBFA 4DIOA 3O4GA 4OP3A 5REQB 5IAAA 1JSLA 2DWQA 2FSVA 2O2YA 2HO4A 2VQDA 3GJYA 3QX9A 2EBHX 4JA2A 1T4CA 3QUSA 1KQPA 1XZJA 2IU3A 2COUA 2RAPA 1D2CA 1U94A 1NMZA 3BQNB 1QZTA 1RABA 3JQQA 4NYMQ 4TGLA 3ZWCA 4Y3UA 5FTWA 2QTZA 3FLEA 4CDRA 1VPVA 1UJ6A 2ZJFA 5FPPA 3K9BA 5BWCA 3VX3A 2FFBA 1PSWA 2OESA 1ZISA 4FFVA 3WLKX 2JLYA 1NPDA 2XVAA 4RCVA 2UUPA 1PUIA 4KO3S 4ZHQF 4YMUA 2RD2A 5DTMA 2C77A 2FX5A 4B8YA 1V1JA 4J6FA 4AWBA 4TMKA 3LPDA 5CB4B 1NP7A 2FZWA 4RHFA 3FOEC 4ENSA 5B30A 5DO9A 1E79A 1XZLA 5BVHB 3FGOA 4FZ3A 5DGXA 2ODEA 3WADA 3GCWA 1MAUA 4BB0A 2X23A 1RS0A 4IMRA 4M6WB 3UJBA 2IEBA 4LRYA 3RYIA 3VSCA 1GJRA 1T29A 5GQSA 3TFQA 4G1BA 3NVKI 4MR7B 1ZZGA 2QUJA 4Q3NA 3WKDA 4DQKA 5IJ9B 5HNKA 2PJRA 4RWEA 1UKEA 1RJFA 2XMQA 1G8SA 3Q6NA 4HZUB 1Q21A 2JFQA 4BMDA 3FUXA 1G7TA 1QZ3A 3P9NA 1N6OA 3ENNA 3ZZ0A 2QXTA 5ALIA 3PEWA 1T8PA 3M9LA 2AZXA 3I9KA 5SYNA 4CN8A 1TIKA 4X71A 2I29A 5I7VA 2O2SA 3IRVA 3NOXA 2GXSA 4G65A 3RSQA 3AK4A 2ZIXB 1P60A 2XWPA 4EATA 1V2GA 5KNBD 1H0RA 4JI0B 1UFVA 2D8AA 1DXHA 2X1LA 3EULA 4CUKA 4Q4CA 2PUGA 1L4GA 2WT9A 3HFGA 1I3MA 5IZCC 5JD6A 4DLRA 3DFZA 1ZFNA 2DFNA 4M7WA 1P9RA 1SQSA 3ESQA 3GEGA 3I0NA 3K6JA 4H1UA 4LTMA 5DMHA 4LA4A 3TEJA 3O73A 4OUDB 1H1DA 3AU9A 5SZIA 1UFOA 5DISB 3LUPA 2D74A 3LLCA 3O7WA 3Q7RA 5DM2A 1MX9A 3ZKWA 5HILA 5IBCA 4OJMX 5JRDS 5GOZA 5KDDA 1CG6A 4XDHA 3OQPA 4EELA 4JYBA 2BTEA 1AKTA 3CBQA 4WZZA 1N2SA 5AW1A 5IULC 4CBVA 3DLAA 1FTQA 4KAFA 1PWXA 3TW8B 3NLLA 4ER6A 4TV9A 3NNSA 4HXFB 4JP5A 4ZZ2A 3TQFA 5TDHA 2CY0A 2O1EA 1W47A 1JE0A 2YHUA 3PGMA 3H5TA 1T43A 1U0FA 3K09A 1YZVA 3EZ6A 1SB9A 1A7AA 1JE1A 2QTGA 2V6IA 3P27A 2O1WA 4G07A 4LUCA 2Z5GA 2WNHA 3KSBC 1RWKA 1Z6QA 3G0IA 1KS9A 1JKJB 4EARA 2D2XA 3BN3A 3ZJ5A 3L0ZA 3QE4A 4KGZA 3ZHTA 1SM4A 4KQ2A 1BXZA 1DQNA 2Z8YM 3BF7A 3EJWA 4NNPA 3UANA 3O8LA 4XGIA 1TYAE 4FDAA 3MD9A 3RQSA 1ZC3A 1Q44A 1X1EA 1DOZA 3LP5A 4DXAA 4G24A 1ES9A 1CY7A 2P6NA 4O29A 4YCJA 5FA8A 3DEZA 3LDGA 1ULZA 2HA6A 1GT6A 3H3XA 4GHWA 4COOA 1IN8A 1DEHA 5I7HA 3AFHA 3HV2A 4EPVA 1YE3A 3IH5A 1TE2A 4D9NA 1PR4A 1YSCA 2RGNA 1KMHA 3V1TC 3HLYA 1W5AA 4HTFB 1NVGA 3SF0A 3ICVA 3H8SA 2MJLA 1MQSA 3DZIA 2EF1A 3MJFA 1B15A 4GLLA 4G0YA 5A5EA 3AEZA 3UBTA 4QJBA 2QP3A 2BOVA 1AUOA 2V98A 2G0TA 2ZI7A 1B2RA 1B6GA 4KWHA 2BFDB 3AV3A 4DMHA 4JLOA 1B14A 1IHUA 5B55A 2LZ0A 3ELYA 1GA1A 4KDEA 4ENWA 5EP2A 2ZQZA 1JALA 5FX2A 1Q14A 2HDHA 2YZ2A 4HX2A 3EUWA 3V8MA 4BFSA 1D04A 1RC1A 1P7CA 1ECJA 1GUAA 1UZMA 3A7DA 3BE5A 4OD0A 4DJ5X 4XA8A 2EP5A 2WR8A 2W2KB 3ZGVA 2QAIA 3NHPA 1FEZA 3VU3A 2DPYA 3VR6H 2R8OA 3KPVA 4ED9A 3LNTA 3EXAA 3P2MA 2QRJA 1KPGA 3S3TA 3EE6A 3DULA 3T9AA 3VMFA 4A2WA 2NTNA 2V6GA 4CF5A 4ER0A 4W9MC 1FNCA 1MDBA 1T5OA 2KMLA 2A8YA 2BDEA 5CHEA 2GN2A 4YP9A 1AHIA 5AYVA 1B0ZA 3W8FA 3F9RA 3SU8A 2GTIA 2IS1A 4K03A 3ZU5A 1YKFA 3GZJA 4GUAA 1AKEA 1XPRA 2XAAA 1MX3A 1ZKDA 1QG4A 1TW3A 1Z17A 2ZRNA 5AKHA 3NTUA 1QS0A 2B98A 1Z15A 4QDOA 5DK6A 1N9ZA 1OFUA 1VL2A 1ZCFA 4DJDC 2AVDA 5DCYA 1GG5A 4GI2A 5I9MA 1KS2A 5A1JA 3D2BA 1NN5A 1PLLA 4XQCA 4YJKA 2FQWA 3NBMA 4F6RB 5CFMA 5HQTA 1HKUA 2ASEA 1N8SA 2EX1A 2OHVA 3QK7A 2AR7A 2XYRA 6LDHA 3A8TA 4HDNB 3HJGA 1AQYA 1GQOA 1DAPA 2G1UA 4JU9A 1N36B 3MINA 2YMQA 1SOAA 1Q83A 3KC2A 5G02A 4XJVA 1AKWA 1RLJA 2CBZA 1MT0A 3BWBA 4NCXA 3RT7A 3JQCA 2G1AA 2H5EA 5HKKD 4NG5A 3D7NA 4JBIA 3IEVA 1QYCA 3CZPA 2GZ1A 3IHLA 3KOXA 4RDIA 3UT6A 3AY7A 3NHYA 1IM8A 4KR3A 4HQ0A 1I80A 3QBDA 3LUBA 4P3PA 4PG7A 1GZ6A 3IJPA 1TCCA 3EOBI 4JSTA 1FDUA 4TKLA 2I6QA 4GQAA 4ZU6X 5B3JA 1OZFA 3CV3A 4ZT2A 3KOOA 2VYND 3OLWA 1LNSA 2D1RA 3WTCA 3ZD8A 1ESMA 4JJ7A 1E1CB 2BFWA 3M3DA 4NYJR 4MMZB 4ZCTA 3LHKA 4P3XA 1M6WA 3L7CA 1GY8A 2I2WA 2FHSA 2GPBA 3KE8A 4QU0A 5L4LA 3TQHA 1OSNA 4DQVA 2NUPB 1EAMA 1GYQA 1XZIA 2B25A 3G0BA 3K6SB 3A4MA 3HI4A 1XRPA 2ZYTX 3LF2A 3GF4A 2X1VA 3R5JA 3TB4A 2R96A 1HPLA 4TZKA 4GDFA 3N70A 2FRDA 2WTXA 3F71A 2XCQA 3J7TA 1GPWB 4FYMA 2D2EA 4J29A 5DHTA 2IDJA 1CLEA 3X1JA 3OUUA 4J6EA 5HRCA 3EZYA 4KAXA 1O96B 1N2EA 2B0CA 5EHZA 3O8CA 1QVAA 2CJWB 4J7XA 3B1WA 2BY4A 4ETIA 5A3QA 3A2KA 3BGVA 4EJ2A 1V8PA 5BQOA 3DMPA 4XTCS 5E6RA 5A0VA 4OJNA 2ZXEA 1KEZA 2AW3A 1H93A 1UBLS 1LSUA 2HD4A 1HH4A 3M70A 5CYOA 5K3AA 5IEBA 1K68A 1JZQA 4OHUA 3AG5A 5ILQA 4FHFA 4QA9A 4J7CA 4RD2A 4XWYA 5EP1A 5EXDA 4F9EA 2JLXA 1DIOB 4DCNA 2OXFA 1LDNA 2BC9A 3IMCA 5JCZA 1NMYA 1D8TA 4X54A 2ZKIA 4KMRA 1BFDA 1SUFA 3CY6A 3QEJA 1P80A 4ZO8A 1GAJA 2DBYA 3VUFA 4C7JA 4Q3AA 2VKTA 2ZSJA 4BMVA 1E58A 3ANTA 1KQGA 3E48A 1ZKMA 3EVBA 1K3UB 3SY8A 1N34B 3DSRA 1C41A 1FPMA 2WOJA 4OHWA 4MUJA 1UAYA 3FCEA 3FYUB 3JQDA 3M3PA 1MG5A 4M1WA 4P5EA 2AH5A 4YJ3B 2JIDA 2FUG6 2PV7A 1TEVA 4FFLA 1J6UA 1E8NA 4OQ4A 4Q9JA 5J1SB 1MHTA 2GF0A 3QHPA 4KO4S 4AFNA 4HRAA 1UKBA 1G98A 1U0LA 1ZU5A 3CLSC 4IP0A 5H83A 1ENPA 3CJTA 1KE2A 4CIXA 3LHDA 3NBXX 1FXWA 3MRXA 4YT2A 2IYXA 4JJEA 1ZWLA 4Q4DA 1AMUA 5BSVA 3SYRA 1P9OA 4GBMA 3V8EA 4ECEA 1IZ0A 1UC8A 3ESXA 2IPAB 4FYPA 5C18A 5HQ3A 1ZCAA 1GFIA 1RQNA 3D31A 3HUTA 2Y2VA 4KL8S 4P4TA 3TRJA 4DDVA 3LXMA 3HB1A 3VR4H 1MCZA 5IJAA 4ZVLA 1XO1A 4QDXA 2I2XB 4LNUA 2WOOA 5TQJA 4DDMA 3OCZA 2RJOA 5CITA 1H2WA 2EXXA 1PJ8A 2P65A 2YXLA 4EBBA 5LJIA 1E8MA 5ILGA 3RW9A 3C41J 3VKUA 3WRXA 1VIAA 1EQUA 2V5VA 3D0RA 3I2FA 3L1JA 4X90A 4CL8A 2O4UX 4NYIR 3E0XA 4GOJA 3R7LA 3TIFA 2G8NA 4D8UA 2F3TA 2ZQ5A 1BEUB 3NTOA 2HW8A 2RI1A 1Z5WA 3AI2A 1KKLA 1V1MA 2K7ZA 3QKSA 1L4FA 1Q95A 5T6BA 3ER6A 1CXZA 5FO1A 2CLHB 2JEZA 3ND9A 3ZE2B 3RVJA 2PWYA 1SHKA 3GJRA 3GMIA 4TTIA 3UO8B 1WDMA 2VKQA 4MVXA 1QNFA 3U4HA 1QGYA 4ZI5A 1H4QA 4FLMA 1X74A 2YN0A 3QGMA 2P6UA 3OHSX 4L4UA 4MW7A 3RUFA 5C8XA 4PYMA 5I48A 1UBHS 4CGYA 5JROA 4Y1RB 3F8TA 1JTVA 4IRXA 4NBVA 3I1FA 3LA8A 1QHGA 1PJRA 2V45A 3DE4X 5FF9A 1IBRA 4JJGA 3L18A 5HHTA 1D7OA 2NACA 3JRNA 3W3AH 1MLDA 3VAZA 3VYTB 4DLZA 1W19A 1GPLA 1U98A 3P0FA 1G9TA 2YOHA 4JLVA 3RE1A 3ESCA 3FSGD 1T3SA 4BP8A 1ZQ9A 1PL0A 4RMIA 2BMJA 5CYPA 2MT9A 4DEXA 5L3QA 5EWMA 1G4AE 2CVOA 3GLHB 1NC3A 2KBFA 3KCNA 2FR8C 4ND1A 4UEQA 3OO0A 4LGMA 5C8ZA 3ZHCA 4AN0A 2ZRQA 1YTUA 3BTSA 5AW8A 3COPA 3KAQA 3LCJA 5HF8A 4JR0A 4EX6A 2J85A 3OLYA 4QELA 1HEYA 4XDGA 4E13A 1MQAA 2QGFA 4LECA 2ZU0C 2XQFA 2JIZA 1O8CA 1JQEA 3T7EA 1U2SA 4MZXA 2R8BA 3G2QA 1BX1A 3USCS 1UT6A 1FUUA 3EZ2A 1EUYA 1PYGA 1D2NA 2AN3A 3NHLA 1P0PA 4PGMA 5CLQA 1K7YA 3OPVA 2QENA 1U8FO 3WL7A 7REQA 1PFQA 4IIXA 1G9XA 1U6KA 1R0WA 2D0DA 2WTNA 1IIRA 3OPYB 1L4KA 3UOWA 3ZWAA 3ZX4A 1TUEA 1LDYA 2PUHA 8OHMA 4BX8A 1U1EA 5KU7A 1ZH8A 3D7MA 3KEMA 1B23P 1U28C 1RJEA 1U5BA 4EKNB 1AK1A 4YGXB 3MCUA 5C4GB 2FMIA 3T7JA 5I3ZA 1J23A 2BT4A 5L9AA 1GPMA 2A2ZA 3A25A 4C29A 5FYDA 1KFBB 3KAJA 3U17A 2W90A 3MJHA 4WESA 1D2RA 4J4HA 2QN6A 1RKUA 5CA0A 3SEFA 4R1SA 5E9JA 1E9AA 4RJLA 3UK1A 1ZRSA 3HP1A 3PQ5A 5LLSA 5I01A 3RVRA 2BYTA 1NULA 3TECE 5DNWA 5DI9A 1GEEA 1DCMA 1JI3A 1MAWA 1XQ6A 2ZZMA 4MQUA 2DHEA 3ZDCA 5FWYA 1UXOA 2WSBA 1OKKA 4RENA 2XNCA 2CHUA 2VHZA 1SC1A 3WS7A 2JATA 3EFOB 1LBQA 3OU6A 1C3EA 5EERA 2ZSEA 2FR1A 4XUCA 5FTMA 2I8CA 2J67A 2QNIA 1CEXA 1SCUA 2CYBA 2RG1A 1M2WA 1WY7A 2R4TA 5DRYA 4H77A 5C31A 2W2LD 1U7HA 3U4MA 2PD4A 1ZOIA 3UJHA 3OLCX 4R9VA 3UUGA 3QEKA 3QFRA 3T3EA 2NU9B 3THOA 3K1ZA 1OXUA 4J03A 3WAJA 1C30B 4IYJA 2VUTA 1WSAA 1EFHA 1JR4A 2GI4A 3Q2KA 4N40A 1K5HA 3PKIA 5EGSA 5F5NA 3D0QA 5DGHA 1Z0JA 1IDOA 1NMSA 2XE7A 1DJLA 2WUEA 4JDPA 3OA0A 1RR6A 3TXAA 1JHZA 5CB6A 1SOWA 3N2GB 4IGFA 621PA 1KL7A 5KOJA 3AQ4A 1YS1X 2VTEA 1YCGA 4RSGA 4TL6A 1EIZA 1HWYA 3IAHA 3P9RA 2PFKA 2X15A 4QGFA 4X8MA 3O8QB 2WFLA 4QNMA 3TW6A 3S81A 3ZCXA 1OBFO 2R3SA 2X3FA 5F52A 3OLVA 3UICA 4EJFA 4CG0A 1XAIA 2A1UA 4C01A 3RAGA 5KHLB 3IURA 1D8AA 1YI1A 3EPRA 1CCWA 3F6BX 4YCCA 1C1XA 2YR0A 5LD2B 1WMSA 2XRYA 3ZX5A 1T3LA 4N8EA 2O8VA 4C87A 1Z16A 1HT3A 4E5UA 2H2IA 1P4SA 4ZJPA 2VXBA 3F6EX 3ZHUA 3H04A 2A4MA 2Z0MA 4HNUA 2JLUA 1CRQA 1W73A 2Q2OA 2XTMA 2ZAOA 3I34X 2VNIA 2HAEA 1VCHA 2OM6A 2ZIFA 3DOIA 1E3LA 2A0KA 1ECCA 1ABBA 3TDMA 5TT0A 2JIMA 2WM2A 1RFGE 3OECA 2F3UA 4FIDA 3AF1A 2FNAA 3GT4A 2VRCD 4ZKDA 1DSSG 3T95A 1BHJA 1GAEO 1E4VA 1XZKA 3LE8A 4HGQA 2D59A 2E2WA 4LQCA 3SQXA 4WOCA 1LTKA 4UBIA 2Q2VA 4I7EA 5KOIA 3DDZX 4TVKA 5IF3A 3MJDA 1U9ZA 5EZYF 5E0KB 1SCAA 3GFBA 1N5DA 1BCSA 1O9BA 1VLMA 1RIFA 2WD7B 1DG9A 1CK4A 1CNMA 1S89A 5IYZA 2CDBA 4U02A 1CQXA 1T8YA 3KQMA 3STTA 2QLLA 3V6LA 1G1AA 1Y80A 3NALA 1GUFA 1JA1A 1E1RA 3HL4A 4HB0A 1KVRA 1UM9B 1PZNA 4EDFA 1G4UR 1O94C 2BGLA 3SXUA 2EFHB 4IL5A 4K1LA 3R7AA 3IUSA 5LQRA 1TD9A 2IEDA 5FO0A 4KR2A 2EFGA 1K3FA 3M7IA 4O2AA 3SHFA 3LOQA 1CR2A 5JH7A 5G4KA 3EF0A 5A4FS 4PZZA 1E1DA 2IXGA 3OZIA 4CF7A 2XQIA 2W4QA 4AKSA 1NVMB 1SQ0A 4KBFA 3TAXA 3FSRA 4DDWA 4FGZA 2J5BA 5FBQB 1KYXA 3UJAA 3SDBA 5JI2E 1DJQA 4PAWA 1O6GA 5CHYA 2ILVA 3ORSA 4WKNA 1JJIA 1NRJB 3KKQA 3C5VA 4UPVA 3JQRA 1ZUWA 1IEQA 1ODLA 3BFKA 3NO4A 2RH8A 4M9CA 4TLAA 1TRHA 3A04A 4PCAA 1TT5A 4JEHA 3W7VA 3VA7A 2NPOA 2XVZA 3EXEA 3EOZA 3O0DA 4EQ6B 4HN2A 4DEYA 2GSDA 2WPDA 3CLHA 5KWJA 2QMYA 1WSWA 4HSGA 3BGOS 2YJ5A 1AMNA 1OUMA 3DO8A 4LAFA 4PX3A 1Y89A 3ZVLA 1I2MA 1A4XA 1BHQ1 1DBPA 3NWBA 4YAFA 3C7CB 3CLTD 1JR2A 2PL1A 3RUAA 1DOHA 3R77A 1YB5A 2NU7A 1PP4A 3B2EA 1R0ZA 4FMDF 1S8FA 3WO0A 1J25A 2LV8A 1BEEA 1LPSA 4KH0A 3TX2A 4CM5A 4MWOA 1NF8A 3EZFA 2L2QA 3HR4A 3WJ1A 4IO0A 4LJAA 5F78A 5EQJB 2SCUA 5E6SA 4U6SA 1SKYB 2RHJA 1GWNA 3IQHX 3RYCB 1POWA 5AH0A 3IIEA 3L6EA 1QYWA 3LGSA 1X7GA 1XTPA 3GLTA 4R2LA 1T3ZA 4KDRA 5DK4A 4F46A 3PX2A 2F62A 3D6FA 3I39X 1YR9A 1E9SA 2NUAB 3B5JA 4ASUA 4AZ0B 3VC3A 5LYJF 3MT0A 2OV2A 3K8QA 4EYKA 3N3BC 1ESEA 2QRQA 2ZI4A 1P9NA 4ITVA 4X24A 3H5VA 2JGRA 3AHJA 2KPOA 2DBQA 3LCVB 3CLRD 4H27A 4MB6A 3V48A 2L69A 3VPGA 2PS3A 4HAZA 5JATA 1ITZA 5AJUA 2UZ1A 2C7PA 3LLMA 4ATNA 1YZNA 2O2HA 3IQIX 1RBZA 2JBWA 3K9HA 3LT5A 2XUGA 1O95D 2IF0A 2VCEA 2C9DA 4YP0A 3K4QA 5SZHB 3I04M 4KIFA 1M1XB 3FVTA 1ODKA 1A50B 2E82A 5HDBB 5TF4A 2ET6A 3RGWS 3TNLA 1NDUA 3P9KA 3WP0A 4D2IA 5BN4A 2YW2A 1CRLA 1W4CA 3DBVO 5CB0A 1BE8A 4Q34A 2L18A 2BEWB 3WWYA 2AD1A 1T9GS 1GNLA 5C5CA 1XCBA 4JEMA 4E2ZA 2B8EA 1PHPA 1XSEA 2FVYA 3ZJ4A 1O77A 1C3LA 1JU3A 1T5LA 1P4RA 3KKOA 1P3Y1 3KAPA 2FDCA 1IC6A 4QWMA 3PPVA 5AQEA 2GXQA 1HORA 1P19A 3KVNA 2IUEA 3LGAA 4LI3X 4MUXA 3RIHA 1DLJA 4D6PA 3W6ZA 2C5EA 5F33A 1B0PA 3EUAA 4EJSC 1TOAA 2UDPA 1R6XA 1SGWA 4KVZA 2VAVA 4I4NA 3X1KA 4UBJA 2DPGA 1K8XB 3DLTA 5FNZA 2CVPA 2F8LA 1EFCA 3PD1A 1I6WA 3ISVA 4BKQA 1QGUA 3BL8A 5JNLA 1NLUA 1XLTA 3CT6A 5P21A 2AW5A 1JHAA 4Y2VA 4X0EA 4DIMA 1IXSB 1SNYA 2Z1NA 3HJUA 3VVBA 3O93A 2C8KA 4N0DA 9ATCA 1KO5A 5LMCA 1UK6A 3BX1A 2WHRA 1DKQA 2BE9A 1P8JA 5EMKA 1RCTE 2PJZA 3SN6A 5C1PA 2EYQA 4DV2B 4R2WA 5E2AA 1YMUA 4I55B 4RGYA 4JVMA 1AS0A 3D1JA 1E99A 2RARA 2R1UA 2OD7A 1E2MA 2I76A 2OFWA 3KPJA 4OVKA 5IBQA 4ADSG 3NBYC 3KB1A 1CLUA 3EVCA 1FSZA 3BEOA 4ZIRA 1J9ZA 2PZFA 1JJ7A 5DTQA 5MN6A 5HZHA 1C3XA 1RBQA 2X4GA 4G5HA 1Y1RA 2PMCA 4BVFA 1I14A 5IM4F 3KPYA 4KQHA 5EIOA 3I4LA 4PS1A 3VHLB 3TZLA 1RYBA 4RFSA 5LZ7A 1JHQA 1XK6A 1UEXC 4OTZA 4JT2A 1FTGA 3WYGA 1U7WA 3R3VA 4F7WA 1MKYA 2GH1A 1JHOA 1HYBA 3F98A 1FP4A 2B4YA 3KT6A 4IDGA 2AKAB 3ZWPA 4B71A 2G80A 2VH1A 1U1FA 1A3CA 1DKRA 1EFPA 5ICEA 2XSZD 3NM6B 3ZW8A 4WW0A 1NVAA 1XP5A 4RF2A 3OTGA 5FV4A 2GKOA 4OG2A 5LL6P 4ECAA 2QT9A 2V7QA 4QYIA 1IB0A 3EVZA 3MWEA 1CY2A 3QJ5A 2KYRA 2ZIZA 2AA3A 5CT4A 1DDOA 1ZMBA 1SOMA 2X5OA 2XKJE 2AHRA 3GLQA 5AVOA 2FUG1 3S28A 1KAOA 4C0SA 5IASA 1AMOA 1PQPA 1KI1A 1KJ9A 3QLTA 3CKKA 4F3KA 2XVMA 1FU4A 3AYXB 2H29A 1CQIB 2ZSHA 4YV0A 1RI1A 3B9PA 1WSDA 4ZZ1A 4OXQA 4Z7QB 1GUZA 3QIAA 1H23A 2ID8A 4I1UA 2RHMA 3HFRA 4CKCB 3NUGA 3N2KA 4IJWA 5T3UA 3SYNA 2X1MA 3EEOA 1G6HA 1LLUA 4DGQA 1KP3A 1J39A 4LE2A 1XAGA 4B6QA 2WYOA 4B2PA 3GN1A 5CB4F 1CZUA 1D9XA 2UAGA 1GZHB 4PQEA 1XD2B 3G88A 3RS5A 2VPPA 3TB6A 3UN1A 3AUJB 3FWZA 2VZ0A 3MTAA 1YGYA 3WQRA 5JZMA 1N2JA 3STYA 2ODQA 3BERA 3LLSA 1ZJYA 4OBEA 1JWLA 3KR2A 1WULS 4UHJA 3R4VA 5AVZA 2OQRA 4EKEA 3BMOA 3WB0A 2PUAA 4BECA 1B26A 1IDN1 2XQKA 5AI6A 4CT5A 2RK3A 2A78A 4ZI7B 2FYTA 4KFRA 2G9UA 1H1LA 2AYXA 2EKDA 3FM9A 4QHYA 2EIXA 2ATXA 4RZHA 1LU9A 3PUZA 1R4MB 4OJKA 3SC2B 1QYVA 2WZCA 2J0UB 3BRCA 3C6QA 3IERA 3EZNA 1YV9A 2C4UA 1NC1A 3JQ7B 4JL6A 4Y0NA 2OAQ1 1J8DA 2HADA 4MMXB 3QYJA 4Q1DA 4IV0A 4LYAA 4RCYA 4FLFA 3NPAA 1Z6PA 4EGFA 3TAHA 4LMAA 3W7BA 4MKFA 1I5RA 5JJLA 2WIJA 1FU7A 1JFFB 1O6CA 1FDRA 4QTTB 1TADA 4A6XA 3AVWA 3GYGA 5C5IA 1YA4A 3ZEIA 4HNVA 4JP8A 4B7UA 4JY7A 4DAEA 1TZKA 2HSDA 1XCJA 1U9IC 4D3YA 3L4SO 4Q37A 3VR6D 1LBHA 2D3TA 2AF3C 3EVAA 1P7ZA 4ZV9A 1GZ3A 2B94A 3P9QA 3DFFA 2PMEA 3WWPA 1HK7A 3TYXA 4G5GA 1CJTC 4UARA 3SVZA 5CU7A 3VOSA 4WVLA 4YUAA 1THZA 1OBCA 4FILA 3UV3A 1L5KA 4OYRA 3VI3B 3BVPA 4KLZA 4IXMA 3JR3A 3PHGA 1KOJA 1FNBA 2VT6A 2VBIA 5BW4A 1XCOA 4HX5A 1NI3A 2MIIA 3FDFA 1Q1AA 2R1VB 3QSYA 1C4KA 3SX2A 2GPAA 4LRTB 3E5HA 1W581 4GD3Q 1IVYA 1KO8A 4BS9A 5DM70 1DO8A 1LFDB 2P5UA 4FW9A 5DIFA 2BV3A 2R66A 3OFVA 3E23A 4GI3A 4C21A 2ZT8A 3H84A 4L2IB 5LIRA 1HKHA 1ZNQO 2J5XA 1FTWA 3MUOA 1SU7A 4I9UA 2C5GA 3HHEA 4OHXA 5KTNA 4P4SB 1KC3A 3OOHA 5B3KA 4Y1FA 1C9DB 1HMYA 4X93A 4DQLA 1RYMA 3VJMA 2UZ4A 2A0XA 1MNQA 1ZBQA 5AUOB 1B6RA 1M0SA 1E61A 1GNTA 4RJJA 5CNMA 2C58A 2CLEB 1EHIA 4K9MA 3U7JA 2V3CC 2GKGA 4BMPB 3GJ0A 3Q1LA 4BNUA 1WEHA 5JFTA 4I4TB 3OJ0A 4Y2YA 1PDVA 4PYLA 1H2ZA 3RB8A 3C48A 1ECGA