5EKUA

Crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
343
Chain Sequence
RPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKPKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDISRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLCPEMTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A glutamate/aspartate switch controls product specificity in a protein arginine methyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords Arginine N-methyltransferase, putative
total genus 104
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5ekuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ekuA01
3I53A 3THRA 4RVFA 3SR4A 1JSXA 2YTZA 4KIGA 3O4FA 3HVIA 1KP9A 1VP3A 2NYUA 4FZVA 4E2ZA 4PNEA 2PGXA 5CVUA 4FGZA 1O54A 2IDJA 3I64A 4FSXA 5BXYA 1VPTA 4CKBA 1EG2A 2EG5A 2ESRA 3MCTA 4RWZA 2VP3A 3R9XB 1OR8A 5DX0A 3UBTA 1UIRA 3MTEA 4H0NA 2PKWA 3LKZA 3UA4A 1UWVA 4FT2A 1JQEA 2PX2A 3LDFA 4R8SA 4PYJA 4YUZA 2DPMA 2WA2A 5DLYA 5ERGB 4G56A 2FPOA 5FA8A 2UYOA 4UOEA 4QQKA 2B2CA 5EMMA 3P2IA 2BR3A 4P58A 4RTJA 3JWHA 4AZSA 5IH3A 5LQNA 3KQVA 4FR0A 1NW8A 3SSMA 2VDWA 4PCLA 5FWDA 2ZSUA 3LECA 2GAFA 1NW5A 4FSDA 3QV2A 5CUQA 1F38A 2ZVJA 3BGIA 1KXZA 5EG5A 4DQ0A 3KPVA 4MIKA 5GP1A 3NDIA 4M36A 3ORHA 2P3OA 4V0RA 4C08A 2XYRA 2IBTA 1KIAA 3JWJA 2NP6A 4ER5A 2PY6A 4YV0A 4M37A 2QY6A 4LG1A 5DSTA 2ZTHA 1VIDA 4V0QA 4A6DA 3CCFA 4GUAA 4P7FA 5CVVA 1X19A 4RTSA 2PT6A 2Q41A 3OFJA 1KPGA 5DPMA 4RTNA 4BLWA 2ZBQA 1AQJA 4Y2HA 3I9FA 2UYQA 5DT2A 4E32A 5LR6A 1JG3A 1RI2A 3DLCA 3AXTA 3P9IA 3SX0A 2YXLA 3R3HA 2FK8A 2PXXA 3HCCA 5DSXA 5HOQA 2AOVA 3G2MA 5DX1A 3MCZA 5MHTA 4A6EA 5FULA 3HA5A 1RI1A 1RI3A 5EKXA 2A14A 4EKGA 2OBFA 3OU2A 4XUEA 5DM0A 5C0OE 2G1PA 1H1DA 4QPNA 5KQRA 3AY0A 2R6ZA 1O9HA 5E9WA 4CTKA 1BHJA 1Q0SA 2AVNA 3EGIA 3G8BA 5EMJA 1L3CA 2I62A 2XYVA 2B9EA 3DUWA 4RV9A 3DMGA 1XDZA 2YUIA 1QYRA 5EHGA 2K4MA 5FTWA 4RTQA 5LQKA 4PONA 2P35A 3KQOA 5CCBA 3M6XA 3EGEA 1G8AA 1WG8A 3BKXA 1WY7A 3AXSA 1AF7A 3KR2A 3CKKA 4QTUB 2Y1XA 2ZIGA 3GJYA 1N7IA 1XTPA 4BLVA 4YUYA 5EGSA 2HWKA 3UJDA 3ER9A 3EVBA 1JG4A 2O57A 3SVZA 4RVDA 3GU3A 3TRKA 2UYCA 3FPHA 1YFJA 3BKWA 5FA5A 4C05A 2ONYA 5GOZA 1YFLA 3LPMA 4X61A 4DF3A 4GC9A 4OA5A 3DLIA 1NW6A 5K0JA 3PTAA 4HSGA 2V7EA 1XVAA 4DZRA 3UZUA 4RVHA 1ORHA 1V39A 5CVJA 3TKYA 4YV2A 1P39A 4GEKA 2ZULA 5F2KA 3TPZA 1P1BA 3G7UA 4C03A 3GGDA 2AR0A 3DXZA 3OE4A 3VSEA 4AZVA 4CWAA 1N2XA 4JXJA 1HNNA 3DXYA 4KDCA 5T64A 4YMGA 3EMDA 1NE2A 3G89A 2AS0A 5K0GA 1AV6A 3AJDA 4QQNA 3WSTA 1NV9A 3MHTA 2PV0A 1JQDA 2AN3A 3IYLW 4R05A 2C7PA 3DMFA 2HR1A 5E8RA 4R6WA 4XCXA 3BWBA 1DUSA 2FRXA 1NW7A 5BP7A 4E31A 1M6EX 3V8VA 3TLJA 4PYLA 1YF3A 3P2KA 4EQZA 3G8AA 2VDVE 2CMHA 3PVCA 4PYMA 1ZGJA 3REOA 4OBXA 5H02A 3G5LA 2Z6UA 3HTXA 4K6MA 3MQ2A 3TQSA 2GA9A 2IP2A 3CBGA 1G6Q1 4X60A 3FRHA 4OX9Y 1EAMA 3NVKI 2C7RA 2PT9A 1QZZA 4ER7A 3M6VA 3OU7A 1RJEA 2YX1A 10MHA 5K09A 8MHTA 1WXWA 2IH5A 1HMYA 3M6UA 4WXHA 3T7RA 5EZQA 3HVJA 3ELWA 5E1BA 4BP1A 3R24A 3OCJA 2AN5A 4C07A 3O7WA 1ZG3A 5DXJA 3EEOA 2P3QA 3LSTA 1VP9A 5K01A 4AZWA 4F85A 4Z2YA 4EMSA 1JTEA 2OKCA 1EQAA 2P7HA 2CWWA 5GIPE 2AOUA 1X1AA 5K0FA 4DMGA 3IV6A 5EIWA 1BKYA 4CKEA 2OO3A 2I7CA 4EVIA 1U2ZA 3NMUF 2ZZNA 4GOLD 4PGGA 4X63A 3KQPA 3GRUA 2BR5A 3B89A 5E9QA 1YB2A 3FYDA 5DM1A 4OA8A 1FPQA 4MHTA 3A7EA 2XYQA 2JHCA 3C0KA 5FCDA 2OB1A 3KHKA 2G71A 2P1DA 2YXDA 3KQMA 2P3LA 1MJFA 2IBSA 2Y1WA 4Y30A 3KR1A 2ORED 4C04A 3SSOA 4RVGA 4PYKA 5BW4A 4AUKA 1QAMA 2JHPA 2HV9A 3P9NA 3DOUA 2NXCA 5CD1A 2YR0A 3LX6A 4YMHA 2G72A 5LQAA 2PX8A 3GDHA 1NV8A 3UJAA 2IH2A 3G5TA 5DTQA 3TM5A 2DULA 2BZGA 5M5BA 1Q0TA 2BH2A 5B1SA 4QDJA 2AOTB 2PVCA 3A7DA 3TMAA 5E1OA 2B3TA 2HTEA 2ZBPA 1JR4A 4KIFA 2AOUB 5LQJA 2CL5A 3FUTA 2PLWA 4PIMA 2WK1A 2XBMA 3ELYA 3NVMB 5FUBA 4PYQA 4C06A 4YUWA 3M70A 2EX4A 3KQSA 3UJ6A 3DXXA 3K6RA 4E70A 1IXKA 2YXEA 1XCLA 3EVFA 3KPJA 2CMGA 2FCAA 2QYOA 1VE3A 3HNRA 4ZTBA 2I9KA 2ZCJA 4FP9A 4MQ4A 2ONZA 4P7JA 1AQIA 1R00A 3FTFA 3LGAA 5DM4A 1YUBA 3HCEA 1RJGA 4O29A 2PSSA 4C4AA 3B3FA 3MGGA 5DTMA 4EKIA 4IKPA 3EEYA 2FHPA 1D2HA 3HM2A 4E2WA 3FPJA 4ER6A 3P2EA 3KQTA 2ZLBA 5C1IA 1TW2A 2O06A 5ICCA 5EEGA 4GBED 1NT2A 3DH0A 3TR6A 2H1RA 5DM2A 2P8JA 4GF5A 3D2LA 3LDGA 3RODA 3IEIA 5GM2A 2YVLA 5LQRA 3PT9A 1QANA 3G2PA 5K0CA 2P41A 4RX1A 2ZZMA 5ICGA 3GWZA 3L8DA 1MHTA 5EHIA 3KKZA 3EVZA 1NBIA 2P7IA 2JJQA 1Y8CA 1SVUA 3SMQA 1PJZA 1RJDA 1KHHA 3GRVA 5FQNA 3ME5A 1M6YA 3PX3A 1T43A 1EIZA 5EC8A 5HILA 4IV8A 4M38A 4ATNA 5D1HA 4YV1A 4BY9E 2JHAA 1IM8A 1N7JA 4F84A 3B5IA 3R6TA 5FWAA 1IY9A 1FBNA 5JUWA 3A26A 2G70A 4RTOA 2EJUA 1NBHA 5KYGA 4OQDA 3CGGA 2AOWA 4YUXA 3NJRA 3P9CA 5T67A 2ADMA 3K0BA 3KR9A 3TOSA 4E2XA 3G2OA 1L9KA 3EVEA 1SQFA 1XDUA 4PGHA 5EKUA 3HVKA 1VLMA 5ICFA 3U81A 1SG9A 5P8WA 5D1NA 2XVMA 3M33A 5K0EA 3FYCA 3GO4A 3EVCA 3HP7A 4XUCA 5GM1A 5T6BA 4BP3A 2E5WA 2ZZKA 1ZKDA 3HA3A 3KPUA 4GOOD 3RIEA 2WA1A 1PRYA 3GRZA 3LKDA 2CKDA 2QM3A 1ORIA 1TPYA 3ELUA 3C3PA 3KQQA 3FTEA 3HCFA 5K8VA 5FQOA 1RI4A 1L1EA 2OY0A 3GRYA 3NWEA 3QOXA 5E8JA 5CM2Z 1P1CA 3HCBA 4GQBA 2F8LA 3OE5A 3SGLA 3DMHA 3P71T 2GB4A 1BC5A 3A27A 3EMBA 2QE6A 3BWYA 3FZGA 2ZW9A 5K05A 5KVAA 2QRVA 5LSAA 1O9GA 3BXOA 1JTFA 5EOVA 1XDSA 2AZTA 3FTDA 4QVGA 1ZHFA 3KPYA 3BGDA 5DWQA 4HRAA 4P7GA 2XVAA 5FHRA 2GH1A 1XXLA 4ER3A 3OU6A 2G8NA 2ZWAA 3V97A 2IFTA 1TW3A 4IWNA 5GWXA 5F2NA 5HZMA 3PFGA 2NNWB 3CVOA 3FUVA 3I58A 4FS8A 4HGYA 4M7RA 5GINE 1DCTA 3GXOA 3FUUA 2V74B 5LQCA 2C7QA 4E33A 2PJDA 5CIYA 3UWPA 3P9KA 1I9GA 3CJRA 5K0NA 2PXCA 3LCCA 2O05A 3A4TA 3FPFA 3SSNA 5JR3A 3GNLA 3NDJA 2VDUE 3E05A 3F4KA 4KDRA 4PWYA 5E2BA 5DRTA 2OXTA 2PWPA 3OZTA 5DTRA 3UJ9A 3UJBA 4POOA 1D2CA 3HA7A 2AVDA 4KWCA 3E8SA 3VC2A 4DA4A 1FJXA 1R8YA 5EEHA 5HFJA 5EMKA 5E9JA 3AWIA 1G60A 2H11A 1UFKA 4RSRA 1INLA 2BR4A 3KPWA 4X41A 4L7VA 4RTKA 2KW5A 2GPYA 1ZGAA 3DP7A 3EVAA 1M0EA 2NP7A 3SM3A 1D2GA 4QDKA 4MTLA 4WVLA 3ELDA 5CVDA 2JH9A 1JG1A 1B42A 1QAQA 3PX2A 1G8SA 1L3BA 3M6WA 1KPHA 3BGVA 2B78A 3HCDA 1FP2A 1R8XA 2HMYB 2IGTA 3LHDA 3NTVA 4FT4A 3UJ7A 3C6KA 2ZIEA 1I4WA 4LECA 5GIOE 3LBFA 2IH4A 2AOTA 2ZBRA 3P8ZA 2GS9A 2FYTA 2BM8A 3BWMA 5CCXA 3PLAE 3UA3A 3B7PA 2EFJA 3IHTA 4CKCA 2ZFUA 3HCAA 4DCMA 2OB2A 3FRIA 5EMLA 2EJTA 4R6XA 3ER8A 3LBYA 1R74A 3E7PA 3T7TA 4DCGA 2PWYA 3RW9A 4AZTA 7MHTA 3HVHA 3DR5A 3B3GA 2IDKA 3JWGA 3NW9A 2ERCA 4IV0A 4E2YA 1JSZA 2VS1A 1SUIA 3A25A 1X1BA 1SQGA 4EK9A 4AX8A 2JG3A 5HIMA 1F3LA 1R18A 5CVEA 2NXNA 4CXMA 4HG2A 4RTPA 3JWIA 2N47A 3R0QA 1JQ3A 2ZWVA 3KR0A 3TM4A 1G55A 3KU1A 3DTNA 5EPEA 2R3SA 9MHTA 4NECA 4LWOA 2BM9A 3ANXA 3LL7A 5EQJB 3PS9A 5HIJA 2OZVA 5K0LA 2IIPA 4KW7A 1FP1D 2UZ4A 5KQSA 3KQWA 3VC1A 2PX4A 3FPEA 4OQEA 5E1DA 2AOXA 3LDUA 1YZ3A 3GCZA 5EZSA 3B3JA 4HGZA 5EVJA 4OBWA 3M4XA 4RTRA 1KR5A 3OPNA 4RTLA 3S68A 1RJFA 2QRVB 4HTFA 4QPPA 1Z3CA 2OPBA 4PCAA 5KS2A 3LCVB 3UJCA 3CJQA 3EVGA 3X0DA 4ER0A 3T7SA 5DX8A 2IPXA 2PXAA 4U7TB 3E23A 3T0IA 2Z6QA 3GRRA 1WS6A 5FADA 1EJ6A 4RYLA 2PBFA 3CC8A 4U7PB 5DRYA 3TFWA 3EVDA 3PB3A 3LCUA 3UFBA 4E30A 2P40A 4BLUA 5HEKA 2JH8A 1RI5A 4XUDA 2PX5A 1VQ1A 5LQUA 2GLUA 3KQYA 1SKMA 5F2OA 4PYOA 4RTMA 1G38A 3OFKA 1KYWA 3G88A 2B25A 2C7OA 1X1DA 4KRGA 3FUXA 1KYZA 3BT7A 5BW5A 3BUSA 4HH4A 1WZNA 1I1NA 2NXEA 4GOND 3TKAA 1XJ5A 3SXJA 3BWCA 5EIFA 5HIKA 3EPPA 3CJTA 3MTIA 1L3IA 4DKJA 2Z6AA 4YUVA 3G2QA 5DXAA 4PINA 2ZIFA 1QAOA 3OZRA 2O0LA 1KPIA 3GIWA 1SUSA 3Q87B 1XCJA 4QTTB 4LWPA 5G02A 1DL5A 1EJ0A 3C6MA 4GC5A 4HTFB 4MWZA 2OYRA 3I5UA 3ERCA 4R8RA 5U4XA 3HEMA 3MERA 3DULA 4GOMD 1JG2A 3FUWA 2LD4A 4PYIA 1ZQ9A 5FHQA 1VBFA 2UYHA 4PYNA 1NKVA 2YQZA 5HIIA 4CTJA 4HC4A 4F86A 3O31A 4KVZA 3NWBA 3FPGA 2O07A 1WXXA 3PFHA 5E1MA 1YZHA 2VZ9A 1BOOA 2I6GA 2NXJA 1P91A 2FK7A 3P97A 3THSA 2AN4A 4DM3A 2H00A 4ISCA 3MAGA 3QOWA 5IKMA 5C9ZA 3EGVA 4X1OA 4PIPA 3UJ8A 1VL5A 4QVKA 3VYWA 3ID6C 5K0BA 1R6AA 3C3YA 3BZBA 4P7KA 5E2AA 1X1CA 2HNKA 3OZSA 3Q7EA 3MB5A 4B17A 5ICEA 3H2BA 1NW3A 3FTCA 5K03A
chains in the Genus database with same CATH superfamily
3LVBA 4P3NA 4JLMA 2AF4C 2ZB4A 5E38A 1P7PA 4KO4S 3ICEA 3OHPA 3QITA 4MYTA 3VDQA 1ZN9A 2JANA 4M99A 2K7ZA 4KACA 3CX7A 3NGMA 3WZ2A 3FYUB 4CM6A 1S1MA 3Q7SA 1EP9A 4RY9A 4FEAA 4DLNA 2AFHB 2ZUSA 4MX8A 2NM0A 3MMXA 1WHTB 5FLKA 3MRTA 1VPTA 4ACAA 4S1PA 2OUKA 2JAOA 2JGJA 1GLNA 2OO7A 2X0KA 4G1EB 4UAVA 5BQXA 5AJTA 3ZWCA 3N0XA 4RKQA 5EPOA 3QEAZ 5KSOA 2RB4A 3ENZA 1V4NA 1XEWX 1YE5A 5DP1A 5UKDA 3IEVA 1MX3A 4HPJB 5KYNA 4FOPA 3D81A 5EJGA 5ERGB 2P9ZA 2UYOA 4UOEA 3OJEA 5ETJA 4H6WA 5IH3A 5DFAA 4CKZA 3ZBTA 4LI0A 1IK4A 1SKYB 4Q02A 1C41A 4DVGA 3JZMA 3IHKA 1UK7A 4EW6A 3Q10A 2VJMA 1H5QA 1LPSA 5FFNA 3R4CA 4IIYA 4TKZA 3ZCSA 3K7EA 5LXTB 4KL8S 4C08A 1NLFA 1E9RA 1J0EA 5DN6A 5IU6A 2H18A 5LYJF 3FNFA 3CEJA 3NHJA 1DWQA 2PY6A 5JY6A 4QELA 3CUTA 1IAVA 3LO8A 2ZIVB 3L6RA 2SHKA 3TLZA 3NHUA 1HLDA 3QV1A 5CVVA 4QFBA 4RK1A 3TTUA 5DT2A 5LR6A 3GNSA 5J43A 3NTXA 2BMFA 3AXTA 1M6HA 3H3FA 2FK8A 2QTFA 3AERA 3FF1A 3HCCA 2F1HA 1PUIA 4TZTA 5ECGC 4EWLA 5BV2P 4YIHA 5ALFA 4GSLA 1E0KA 3UGTA 3L0ZA 1V7CA 2D0IA 2DETA 4LF5B 4Y6RA 4R2IA 5L7TA 4XUEA 2WM8A 1XQVA 1JEAA 4WK6A 4BJ6A 3AY0A 1FYWA 5BUSA 1PT7A 4HWPA 1EP3B 5IDWA 3SVLA 2NACA 3KE8A 4PVCA 4R98A 3V2HA 1N2GA 4RTQA 4GYKA 2PSDA 3A4YA 4ETIA 1EK2A 3FPSA 4HUTA 4YR7A 1Z39A 2GN0A 3AP2A 2HJSA 3BL6A 1JP7A 2IYPA 4AO6A 1WY7A 1J24A 1HEYA 1VHDA 2PFKA 2Y1XA 2XXJA 2ZIGA 4PW0A 4ALJA 4O4IB 4BLVA 3K9FC 4Y2JA 3TZKA 1MH9A 3O1HB 4UBLA 2XMDA 1U9CA 4I1RA 1OHHA 2YXPX 1OFUA 2ZBFA 4UM9B 5IXYA 2W37A 4LK3A 3F73A 3DE3X 1T15A 1N6IA 5EJIA 3EC1A 1RP7A 1SHUX 1PUXA 1TA0A 3K73O 5EJFA 3SXPA 4D4MA 1EU1A 4ZAWA 5ECYA 3M5CA 5I4BA 4LXYA 4IQ4A 1XVAA 4DZRA 4D92A 4IJ6A 1D1QA 1KY3A 5A7HA 5JAOA 5JC8A 3BZUA 1HY3A 3NHZA 5BQ3A 1W0JD 3G13A 3UXHA 3FDZB 2C0CA 2ZUFA 3ZOKA 4FGWA 4DR4B 4OKNA 4CWAA 4UCXA 3KQHA 1A27A 2WV7A 4LI3X 3N5CA 4GL2A 3QJYA 4LTMA 3E9EA 3OOSA 4QQNA 1BVRA 1E9VA 3CW2A 3WBJA 4ARZB 2XITA 3ANTA 1XRJA 4XUGB 4AS1A 5F9HA 2V7TA 1L6RA 2PH1A 1RJWA 2PSEA 4HXYA 1RW4A 1KTVA 1Z62A 2C7PA 2A9KA 3MRSA 4K9LA 4BBPA 1H69A 4Y0NA 1DG1G 4BV2A 3BC1A 1YR3A 2WJVA 4EQZA 2VEDA 5AK5A 3STYA 2GN4A 4LX8A 4KYUA 1KYIA 2PR7A 1Y8RA 3K3PA 4M9RA 3AU8A 5ALMA 4N7JA 3UNXA 4B45A 1TOAA 1MPXA 3E22A 1QNLA 4U6SA 3A2NA 3WVNA 4BZQA 1CEYA 1XO1A 5GADl 4X60A 3I8OA 1HFKA 3F3YA 4YLEA 5ALYA 4BEWA 3T9BA 4ED9A 2D1TA 4NWIA 1LA2A 3HL0A 4HQOA 2TSYB 2CXUA 4UPVA 3CE9A 2P9BA 4OKIA 5IULC 3KXKA 1EA7A 3TQTA 2IYAA 1WD5A 1RWNA 3NXKA 2BTOA 4EMUA 3WDSA 1E5LA 1P2GA 1RYMA 3OTOB 3R24A 2VVTA 3EXG1 3D7KA 3G6WA 3ZVMA 4EYOA 1VHJA 3R1IA 1SD1A 2R7NA 5K01A 4RXTA 1CE8B 1QTRA 1MTZA 8LDHA 1YIOA 3ZBPA 4F3TA 1YJ5A 3V4PB 4V0KA 1NP7A 3EY9A 1NBAA 1TIBA 3PPWA 2JJMA 1VGRA 3QIVA 5FF9A 1WB6A 3ZU6A 3AI3A 3W2EA 1F0NA 1TMGE 1R0ZA 1XDDA 2XV1A 4HAXA 3VI4B 3QXSA 1MQAA 2G77B 4DBLC 2QN9A 3A7EA 3EHEA 3OQIA 3VJRA 1NVVR 4JH0A 2B8WA 1WHTA 4EG1A 3HVRA 2ZUBA 2YXDA 2YJNA 3CPJB 3V1NA 1X1TA 1G21E 4X20B 1YL7A 3FOWA 4J4BA 1C1XB 2GF9A 2HF7A 5JECA 1XRPA 1ISHA 4MVJA 1HETA 2JKYA 1FXSA 3HGQA 4LDRA 3HBJA 3FB4A 3NALA 1QGED 4CEHA 3CUKA 1R0CA 4R2KA 3B9QA 2NXCA 3RSFA 4C4YA 5CFRA 3UUEA 1EFPA 3VJMA 3EF0A 2BFPA 2HGZA 2OC4A 2O8BA 1OIVA 4HAOA 3UANA 3DLHA 1B6RA 3NOOA 5ANRB 1SUAA 4UBIA 2B1QA 4FIZA 2OZLA 3O8LA 4LYJA 1MR3F 3EXHB 3T7KA 2BZGA 1E6CA 1MC4A 3FWHA 5IDXA 3KQKA 1IBMB 2JDIA 1E1CA 4WZZA 1CR6A 4L0QA 1OXKB 1TO6A 1O3YA 1CRQA 1FYFA 2AOUB 5THKA 1Z56C 1W1WA 1PEAA 2WD7A 4S0XA 1AIPA 3ASVA 4L72A 4ZRMA 4K86A 1RWPA 1XZQA 1X7DA 1UDCA 1YBAA 4A1FA 2FUEA 2AXEA 5CMLA 2NU8B 1D6SA 2H2IA 5FP0A 1SVOA 3RYTC 3GDOA 1TMKA 2UZIR 1PTJC 4Z99A 2HEIA 1AF4A 1YIDA 3H11A 4ZTUB 4EMTA 4OG2A 4W82A 1C3VA 4B6PA 2Z2YA 1XX6A 4H17A 3SHTA 2WKRA 5JFGA 1UXIA 2C5FA 2PTGA 3UGQA 2WAYA 5DM4A 5WRFA 2C7BA 4ZGWA 1H94A 5JTUA 1PVOA 3FH0A 2Y1KA 4IMIB 2HHLA 4ZZIA 1A4IA 1VE7A 2HGSA 3TZQA 3VNAA 2O2YA 2J6CA 3DOIA 3VOSA 5HFNA 1TW2A 1KAHA 2FPIA 3JYQA 4LDJA 4GBED 1OZ0A 2O2CA 2OOSA 2OZLB 1HLGA 4BNMA 2G1KA 4DABA 1ZA1A 1HYEA 2UUAB 5CDGA 2IPAB 4TKVA 2IE8A 2VFAA 3G9UA 5CFLA 3KVNA 1QRDA 1UINA 1W29A 3GWZA 2IY9A 4JLUA 5DYYA 1T8WA 3KKZA 3H04A 1V8ZA 2Q3LA 2VXYA 2C8LA 2HDOA 4HO1X 4O4IA 1QH8B 4RYDA 1R4MB 2H9YA 3QU7A 2AYXA 3O8CA 2QV7A 2R25B 4WWHA 4XWGA 1X92A 2A57A 1WU7A 4IL5A 2CV0A 2QLTA 2YWHA 4FOOA 4NK5A 2FPPB 3O2QB 2C3MA 3T7AA 1KMHA 2M6RA 2BGTA 3U1VA 3CEHA 3OPQA 1EGQA 4X7MA 2C4VA 3WHPA 3D6VA 2HAEA 2N42A 1B43A 4GYJA 4DT1B 1KEWA 1CVLA 2P8SA 3KR9A 5NLLA 1TEXA 2I6TA 2GYUA 3KT3A 1GL3A 1YI8A 3G79A 3K5WA 3T9FA 3LX5A 2V98A 1SG9A 3CF4G 3U81A 3ZHQA 2D5AA 4JI5B 3AEQA 3EVCA 3R3UA 2Z58A 2FQ1A 3ZBQA 1YFKA 4PAQA 3A6KA 3RPEA 1PNOA 2R6AA 3GFGA 1J90A 3GRZA 3LKDA 2CKDA 3PSHA 4D9EA 4TYNA 3Q9SA 5JE8A 1L9XA 3ZQUA 3GPLA 3QWHA 1DUIA 4FKMA 3AHGA 4XE5A 3QX7A 3QOXA 3ZTTA 1L1EA 3RUPA 5K8CA 1P1CA 1PK8A 2F8SA 3N2KA 1JVNA 4BZXA 4JB2A 1MDFA 2NG1A 2VDKB 4QO7A 2WSIA 2WTAA 4B2YA 3DM9B 3IB6A 4L08A 3ZDYB 3MMPA 2WJGA 1GCAA 5JAQA 1HQYE 3TSWA 2ZXEA 4QBGB 4QVGA 3AR8A 4D8YA 1COWA 1R27A 3CUYA 1ZYUA 3ADCA 4HDMA 4HRAA 2IS4A 4BNDA 1TM2A 1IZ9A 3DOJA 1HKHA 1R10A 2H7YA 3OU6A 3CBQA 3A4LA 5BNFA 3HI4A 2WWXA 3M6IA 1USGA 5LBIA 2VJLA 5G40A 3VR4H 3BXFA 3TVYA 5AM2A 4XB6B 3KDPA 1A2QA 5DXFA 3LZ6A 1PQWA 1LFAA 2GVZC 2A1UA 2HJRA 2XUIA 1Q0ZA 4UUQA 4Y8VA 3TDNA 1A69A 1UAGA 3KSAC 3RF7A 1I2BA 1A9XB 2OAEA 5GPBA 2OT3B 4H4DA 7AT1A 2DF8A 1LDGA 3PUYA 5DRTA 4RNCA 5DTRA 2QAGC 2QRZA 2GAOA 5JRDS 4YC7A 3AVWA 1EUYA 3ITEA 1ETHA 3LGSA 4IHKA 2ODWA 2WUGA 3EA0A 4KMRA 5I5GA 3EE6A 1FJXA 3ELBA 1C7FA 4YYZA 4AJIA 1QC5B 4L8LA 2RAFA 3BILA 4HQFA 3U31A 4X41A 5PGMA 4RQTA 2GCOA 5L9AA 4OQ4A 2FPSA 3V55A 4L75A 2V4UA 5CVDA 5JSQA 2JH9A 1B42A 2HK9A 1UJBA 3PX2A 4D0GA 1TZJA 1UMKA 3HCDA 1GQFA 3DBIA 3U4QA 3ND8A 3JQAD 4ML3A 1UPAA 4A92A 1I4WA 5JXJA 4RFVA 3SQXA 3EWNA 1DIGA 4J7UA 1Z37A 5TT0A 4MARA 2OXRA 5AJYA 1G5QA 4NSNA 4QOJA 1CK4A 2JAHA 4K1XA 4AULA 4RM2A 4E1VA 4WT7A 3UAXA 4MJXA 4F71A 5CG2A 3HB4X 4ZCQA 3KAPA 4RD4A 2MSDB 4PC3A 3HPRA 3QF7A 2C99A 1CHNA 2ADOA 2MYNA 1KYVA 3KZXA 4IP0A 2R8BA 1SELA 4TV9B 3T3DA 3UM9A 3WZLA 2O2JA 3G3EA 3T54A 4HG2A 2C3YA 2QMUA 2AK3A 3AVVA 3C5WP 4IO1A 1B14A 2BM9A 2GJ4A 3CNNA 3OH8A 2BLLA 2XF2A 1YB6A 1ZIDA 3JR7A 3V2GA 1FP1D 5JEEA 3STVA 5JAPA 4KYTA 2FRVA 2BFCB 4RKYA 2WHPA 3DL0A 3BMXA 3SIRA 3B52X 4YI5A 421PA 3MT7A 2W6NA 4F5DA 1DAKA 2CYBA 2DFPA 3HO6A 3EBLA 1ZC4A 3DPIA 1YNSA 2WPNA 3QOFA 2VJYA 1WXQA 4RL6A 5D3QA 5ALIA 2JLRA 5HQ3A 1WUHS 1B23P 1Z16A 3ZDXB 1IN6A 2R1TB 1RIFA 4GFDA 1EGHA 4I9NA 4E03A 4ZQHA 1Z4KA 1SBZA 3CH7A 3IMEA 4O0MA 3R8CA 1YJ8A 1TUBA 4PHTA 3RVBA 1WF6A 4BHTA 3WBKA 3SLGA 1PP4A 3KWJA 4IH1A 1Z0IA 2FX3A 2XUQA 2MCFA 5IXSA 4ADSG 3C39A 1I4OA 1PYOA 2I34A 4G1VA 1MZPA 3FI9A 3GRKA 2VPZA 4J76A 3TL6A 4E5MA 4RZ3A 5MN6A 1G38A 3OFKA 2XGMA 2ZS7A 1G3MA 1P2TA 3IV7A 4MV9A 4BNHA 1CQXA 4HVLA 4X9XA 1ZXBA 1NYRA 1EIWA 4HKTA 2JLUA 3DZJA 4F5YA 3J81k 3N76A 3C3EA 5F3WB 3LRPA 3EXHC 2W5UA 4RORA 1NQWA 4N3CA 5EA2A 1F8YA 2C1XA 4ZVSA 2XCIA 3G8YA 1L3IA 3GVIA 4KSYA 2F9MA 4LZPA 4N6OA 4YUVA 4PLHA 1D7AA 4AO8A 4RKWA 1YHNA 2QI9F 3RC3A 5JQWA 1DIAA 5BUCA 1QIEA 1VCHA 3GIWA 1AMOA 2JDID 1XCJA 3PHLA 1DL5A 1U02A 4LZOA 1E3WA 3OIYA 2FPRA 4R8KA 4C0JA 2Q0SA 3ZGVA 3ZHYA 3DULA 1R0YA 3NHLA 3ZBUA 4C0XA 4N48A 1KMQA 3GLIE 5G0WA 1KFCB 2JIZA 2HHHB 1B8OA 1Q74A 3PR2B 4BECA 5JZSA 2DKFA 4I81A 4WE3A 4ON9A 1VI6A 4XB1A 1GG9A 4QJ3A 3SC6A 4ZJUA 2NZJA 3R5TA 4NFHA 4JGIA 4ZP1A 4BJ3A 4IHJA 2W0MA 3HCOA 2VZ9A 2FMXA 3K15A 5DWDA 2O2IA 4V0SA 5D3MB 2Q62A 3NCTA 2GZHA 9LDBA 1XVLA 3I1YA 4OFBA 4X1OA 3S44A 2R00A 3Q7IA 3BWDD 4H3SA 1ZPDA 3QY9A 4B3BA 2O8FA 1LBTA 3R6DA 4P3OA 4B17A 1JYSA 1YQ9A 4FHZA 1FSZA 2LRHA 4PC2A 2VCYA 5K03A 1KEEB 3KFLA 3EGWA 1QQ5A 2G5GX 3QXHA 2JLZA 1ANKA 1RHRA 4KNWA 4RVFA 3ZYZA 1JHZA 1OZAA 2ACEA 4DHWA 3AFHA 1RZ3A 5AXBA 1NX9A 3QWBA 3VH1A 4IEIA 3ZDFA 3RS9A 1EWVA 3BIWA 2PL9A 3M6AA 4MO2A 4XIGS 5JFOA 3AEKB 3E9QA 3RKUA 4BKQA 4LF8B 2W58A 1RXWA 1MABB 3RG8A 1OLSA 3QU2A 1VECA 4D56A 1J42A 1WZEA 4F3RA 2W42A 2ESRA 1CDOA 1O77A 3MWDA 4BMVA 1NLZA 4Q3AA 1OR8A 3WDLA 4OQLA 5AM3A 1ZVKA 2VHWA 2REQA 5ALUA 3D4IA 4DLYA 5A06A 1OI3A 1DRJA 4L6IA 1B6SA 5JSUA 1P5ZB 4YUZA 5EP4A 4CMAA 4FNAA 1AK9A 2XCOA 2GCOB 2QPLA 1L7VC 3II6X 2Z2JA 3N6RA 5CX1B 1NKSA 3AF4A 3CFYA 1TC2A 1ZEMA 2NO7A 4WBNF 1VYVA 2GEUA 1XSEA 4DQ0A 3PSAA 2R7MA 4JLDA 4KQIA 4KWIA 4NR0A 4QLOA 3T1YB 1RLIA 4O1IA 4YV7A 1QE0A 4JJIA 3UT0A 1SULA 5HF6A 5MGNA 3TFOA 1O97C 2ID7A 4DW8A 1CU1A 3F97A 2D74A 3I9OA 3T9CA 1DEKA 4DLBA 3LUBA 3C1TA 3DYIA 3ICCA 4V0QA 1TQ6A 3CCFA 4XGQA 4XJVA 3S28A 4BO7A 4BX0A 2Q41A 3PHBE 4BQEA 3W1WA 1XRQA 2PLFA 3Q11A 4JI6B 4FPXA 3T3OA 1FP4B 3IVMA 2PA3A 4JASB 4QA9A 1G3RA 1XBTA 2E4AA 3I2GA 2NIPA 3G2MA 4EENA 2AWOA 3W90A 1FDTA 5EKXA 4AKEA 4NK4A 1NUHA 4FFSA 5JARA 3QEBZ 1EFVA 1UDXA 3PRKE 3JQRA 4EEZA 2FZVA 1MV5A 2HOQA 1E94E 4Q19A 2R6ZA 2F43B 3OFND 4S1VA 4Z9AA 2RH8A 1OWMA 4RHCA 2PUDA 3I37X 1CDDA 4CG1A 2WKSA 2GPBA 1N9ZA 1DXYA 2Q1YA 1C1XA 1NBEA 3CISA 3NBUA 2W2KA 5TMBA 1ZXXA 3LPDA 3EWSA 4IH9A 4Q24A 2ZUCA 2BONA 1XJCA 5CXQA 1FW6A 3QSYA 4YRJA 2W6IA 1DG9A 2ANCA 1HO3A 1RMQA 1B1AA 2IHUA 3H8WA 1TCUA 2CLMB 1EK0A 1G1AA 2XE6A 3JZFA 1USKA 2PPLA 2V9ZA 1CY6A 1V26A 3ABIA 5KTPA 1B41A 1HH4A 4V2IA 4BX2A 4NBSA 4DF3A 3KJXA 5EQTA 3TECE 4NPAA 4OVKA 4JJ4A 4EHIA 2YOHA 5B4VA 3STHA 2N46A 4F12A 1TCCA 5CVJA 1TU3A 5FOWA 5REQB 1ZP6A 3O26A 2XY4A 4EGSA 4W5HA 2ZP1A 3VHXB 5B6PA 4JJ7A 2CHVA 5AVVA 1Q1EA 4YMGA 5JNWA 3CT6A 1BH2A 2CJYA 3CSUA 5JJBA 3DTVB 2WFZA 3AJDA 1AJEA 3PBKA 4GWGA 4GECA 5DHUA 1DAEA 4RETA 4I08A 3SLRA 3GN1A 3R7BA 3ZZUA 3V8NA 4EUKA 2Q6OA 4XCXA 1OGIA 1TKBA 4MV6A 4TQ9A 5GJVC 3V8VA 3FTNA 1JTVA 3GCWA 4QPZA 1IZ8A 4KJZA 1VFNA 5E6UA 5KWVA 5B36A 1N8TA 4KUHA 5AKLA 1UXHA 2CNKA 3U3XA 2D3WA 3F7TA 3G5LA 3PIIA 3QLVC 4BPRA 1BE0A 1K4KA 4F2WA 3E8XA 3CR7A 1Y4AE 2LKDA 2AG0A 4DIBA 3DAHA 5A3VA 2XD9A 4DIEA 2IL1A 4L8WB 4LOLA 2PD3A 2WABA 3E9CA 1RJEA 4I6EA 1XNQB 1JG7A 1IC6A 3LXRA 3W5BA 5EAIA 1FMLA 3BJZA 2LWIA 1H42A 3B3QA 2HTFA 2WINI 3GGCA 5AK3A 1PD1A 5IH7A 2R87A 3B1ZA 3NKFA 3VR2A 4I1SA 2RGGA 3TPCA 4PXYA 4C07A 3CVVA 2Q4TA 3CLTD 5DXJA 4BGIA 1VP9A 3HFJA 2YNMD 1T35A 1YOBA 8GPBA 3PGKA 3R0XA 5IS2A 2DPGA 1VRWA 3NNNA 4CM4B 4LF7B 4UPDA 4XD2A 1FRFS 4G5FA 4Y1RB 4G5SA 4Z2AA 4NBLA 1NVMB 3X43A 1VHWA 2VJQA 3R5FA 1RHKA 4YJ3A 3TQRA 4ENWA 1MABA 1R2QA 1D8AA 5DHSA 3UJ3X 3GBPA 2BGJA 2BMWA 4NU5A 1H2YA 4PVDA 3PFKA 2CXTA 2Y1WA 2ZM5A 1Z2EA 1P73A 2HSGA 4P34A 3O8QB 1RM0A 3HUTA 4KLAA 5COBA 1QRUA 1YONA 4N0PA 1HG1A 1X2EA 3G2LA 5LP6C 2OP1A 3DA8A 4LOKA 5J2TF 5B30A 5HUHA 2FLWA 4HFMA 3VR6D 4EYQA 5LP6F 4NI5A 2FG6C 1EVQA 1Y3HA 5G1OA 2COUA 1KDVA 3W9SA 1H2BA 3U7QA 1I8TA 2R68A 3PNSA 3TN7A 1QGAA 4CDMA 2IEDA 4BZWA 1SCKA 2IW3A 2KS6A 1WX1A 2WF5A 2ZRCA 4HYQA 1XMXA 3EC2A 4X66B 1ZR4A 3H9UA 3FMGA 4IVPA 4D99A 5DW3A 4C21A 4TVOA 3G5UA 2AB0A 2Y99A 4MK4A 2X4DA 4DB2A 4U6NA 3AF3A 1Z29A 2GEJA 4CQMA 3FSGA 5AW3A 1Z25A 4B09A 1F5SA 1ORTA 2HEGA 3CINA 3IULA 4JX8A 4YGYA 3Q8MA 1Y1LA 1WW8A 3N2GA 1RBQA 1A82A 5FI5A 1WUTA 3L04A 1HE3A 5LYYA 2EX4A 3JQFA 4Y98A 3FZNA 4Q7KA 4TWIA 2FOIA 2EIHA 2NUAB 1U8UA 3BFJA 3SSAA 3WSVA 1MC5A 4B6GA 2QYOA 3LY8A 1VE3A 1DADA 4YQEA 4ILEA 4MQ4A 4Q01A 3LT0A 3QPWA 2Z5FA 4D9GA 2WIAA 2WMYA 2XGSA 5H81A 1E1KA 2OM2A 3AYZB 3OMWA 3FOCA 4J0JA 3F1LA 3LLSA 4PZDA 4R7TA 1PNVA 3DLBA 1P0PA 2O0KA 3TS1A 1FFWA 3Q7PA 5A71A 2W2NA 1IM5A 1KQOA 1KEKA 3N8KA 1K6MA 4DV3B 1WSWA 4MDEA 4YT2A 3PHJA 2X6RA 5DM2A 3WK5A 1ZK2A 5JMPA 3BMQB 4UBJA 2EFEB 1O95A 4ISBA 5CIQA 3IS3A 1V4BA 3NNSA 3ZWKA 4AU1A 3T15A 5CB4B 2YINC 4JOCA 1WA5A 3T5TA 4Z6KA 4Q4JB 1H22A 1DAPA 1MHTA 1OFTA 4EL5A 1F2DA 4P22A 1KYYA 1NBIA 3AG5A 1P3DA 3CTPA 4YJGA 1V37A 1Z5OA 4L4XA 3WLEA 3EZYA 3EEQA 3KEMA 2B8TA 5TQJA 2IKSA 1EIZA 2QE7A 5FOQA 4D9BA 4D3SA 3O1JC 3K8YA 2XZOA 3WXMA 2HFKA 3U1BA 3B5IA 4IQ8A 3HYTA 1MB2A 1HYGA 1SHZA 2WU8A 2HCTA 2VBFA 1W5BA 3LT2A 4GLJA 2C5EA 4U3JA 4EW3A 5FOSA 2O2SA 5JUWA 1YA6A 3F4LA 2FNAA 3ORYA 1NBHA 3GJ8A 1KMIY 1ZU4A 2AOWA 1GSHA 5IYZB 1SXQA 2NXWA 2PGJA 3WK7A 4TM7A 5D51S 5ICFA 3HVKA 3NAQA 4FYPA 4KFUA 1CYEA 3CUEF 3F5DA 4KFCA 3LUAA 2V6MA 1QORA 4HFRA 2ZZKA 1KU6A 2D7DA 3ZOZA 1GPKA 4EAQA 3EWIA 1I32A 4O2BA 1Q22A 2GESA 1ZUNA 4NHOA 4Y67A 1O97D 4KVAA 4G2NA 5JAIA 5BQFA 1KARA 2KJQA 4WOPA 1KJNA 4XGRA 2QNRA 2QZJA 4BVEA 5K1ZA 4C5CA 4K6KA 1E5QA 4HB0A 5F7XA 1DXOA 3COWA 2YOGA 2JW5A 3SBOA 1FDVA 1A9ZA 2O19A 3EUEA 3BQMB 4HFJA 2XEDA 1SU8A 1ZRMA 1ZHFA 1YDFA 2H54A 4KQHA 3TAUA 4C6HA 4HBZA 3KB6A 4J0DA 1GTMA 4R81A 1XXLA 2FOXA 3EJWA 4XASA 4HXEB 5CB4A 4K6FA 4E1AA 3I5MA 1UBRS 2RD2A 3HDYA 3PFGA 1VSVA 3T1TA 1R6DA 2H6EA 3GLFA 4EW2A 1OH6A 1VBNA 1QVVA 1E1QD 1FYEA 2ZS9A 3PJEA 5IRCD 4AT1A 5LP6A 3U7JA 4JC5A 4G5HA 4L22A 4WCFC 1FX0A 2O6LA 5JS2A 3C4VA 4BNJA 3ICOA 2W8ZA 5TY0A 2I1QA 1ZINA 3PDJA 3NGLA 4RDHA 5GZ3A 2D5BA 3B60A 5IJ9A 1J1UA 1VIVA 1FNNA 1SXJE 3EN0A 4KXNA 2Y6VA 4TMTA 1L7BA 5GMOA 1C4XA 3ER6A 3SFTA 2YYAA 2DQYA 4NH4A 4ESVA 5BSHA 4M9SA 3FOZA 4EPXA 3QE3A 5D84A 3HN2A 3Q12A 3AF0A 1DAMA 4QD3A 4OLHA 3ZW7A 5KKCA 1T1RA 2DLDA 1C4OA 3DAFA 1UEIA 1WPGA 2DLCX 1UXGA 4B80A 1NVWQ 1KVQA 1AZTA 2JCGA 2MJLA 4I1OA 3T5DA 5DIZA 3UY4A 2BBWA 4RFSA 1MIHA 1C14A 1HK7A 2KI5A 2ZSDA 4LHEA 5TEVA 5L3SA 2JIOA 1FUUA 5DASA 4EEKA 1HE1C 1KIMA 3QBEA 2I6XA 5JWHA 4OU4A 3OUZA 1ZGGA 2O2GA 1AMUA 1XNRB 1WNTA 2FW7A 4MW6A 3ER8A 5KYUB 3I2HA 2FSGA 1SKAA 2YZNA 4UNIA 3E7PA 4C0SA 3IHWA 4PPFA 1VLLA 4CUJA 1UBMS 3HO1A 2CVFA 3FPKA 3EIUA 2Y9PB 4L51A 5G41A 4PG5A 5JPCA 5H4HA 3L8CA 4RY0A 1U8ZA 3TDKA 2IUFA 1JEJA 1W88B 1V48A 3EJ6A 3IAS6 4HWKA 4P32A 1R9JA 3BCSA 4AJ2A 4C3ZA 2ZRPA 4NBNA 3CY6A 1HSZA 4QOFA 2I2XB 2KPOA 3PXAA 4BV8A 4F56A 1PF7E 3OTIA 2BM0A 2WF6A 1LX7A 4UHEA 3RS0A 3BXXA 2Q2VA 1I51A 3BX1A 3OZIA 1T5LA 3DHEA 3ZWBA 4DY6A 4HNVA 4OQEA 2CK3D 1SCBA 1K8ZB 2ZYAA 1YZ3A 4ARAA 2ASEA 1MVOA 1TZMA 3E35A 2HHJA 2J8ZA 1BHSA 1ZZEA 4JP8A 2JGNA 3ZW8A 1JFVA 2P65A 5IAAA 1QO0D 1NLMA 4WZBE 3ANSA 5BV7A 1ILWA 1X8LA 5IVKA 2REOA 2IZ6A 4QU0A 1TT7A 2AFIE 2J6BA 1UMDA 2FQXA 2FOLA 2VPYA 4C3VA 4UTVA 2BJWA 3IXLA 4S12A 3OZAA 1SXHA 4G86A 4JYMA 4M9UA 4QEKA 3I39X 1YJXA 2VNJA 3PC3A 4FYWA 1R4AA 2JA1A 3R6WA 4JR1A 2HCJB 3EVDA 5AESA 3JRNA 2Z5LA 3IP6A 2P40A 3ESRA 4JBXA 1UF9A 4L8YA 3N59A 2YVQA 1FUEA 4TTJA 3ZCPA 1R4NA 5FRDA 4NZOA 3OTHA 5EKDA 1R16A 3D4NA 4XA8A 1PVDA 2FUNB 2JKZA 4P5EA 4IHJB 2IITA 4PC7A 4PNPA 4AXBA 2CV1A 4MIYA 5CA1F 3IDAA 3GI1A 3C5VA 1FS5A 3EGCA 4LV6A 3LX8A 5EZYF 2ZTUA 3TI7A 4OXNA 1AH2A 4EJMA 2FWJA 2VJOA 4E5UA 1XOIA 5BVHB 2Q5CA 1F2TB 2NPIA 1XR3A 4GNRA 5KYXA 1C0LA 5K8JB 1LRKA 1CJSA 3UAOA 1LTHR 1EJ0A 2VP2A 3C6MA 3QTBA 5E0OA 3KSDO 4GICA 4J7CA 2JJ2D 2D00A 1IXSB 3CNOA 4NYIQ 5FJIA 3IAEA 1R4MA 1TQDA 1H2HA 2YQ5A 1N5RA 1Z0KA 1Q11A 1ZUNB 3O31A 1GRQA 3GUHA 1X9HA 4XLLA 1WCIA 1TUGA 1VPEA 2A94A 1ZM7A 5AW2A 2IY7A 3GGSA 3J7TA 4E3WA 2UYGA 1VSBA 2GEFA 2QPOA 5J23A 5E7IA 3ULKA 2B4RO 4GVPA 5F4ZA 1BD4A 3OZXA 5KKAA 3THSA 1J97A 1WL8A 1ZONA 3PUXA 4KLCA 3OIGA 4N49A 5JD3A 2PUCA 3EGVA 1WB9A 1N4DA 1ORRA 3Q1LA 4B5KA 1RWMA 3SZUA 3RSSA 3EZNA 4D42A 2HJVA 2WM3A 2WV9A 2Y2VA 3AM1A 4EDHA 5D7BA 3A11A 3BMCB 1D04A 1E32A 1QH1B 2BFFA 4Q21A 4EVQA 4U9UA 1JMKC 4JA2A 1BWSA 3P2MA 3M6LA 4CLRB 1V45E 5CK4A 2CXPA 4IILA 5BV0A 3RU7A 1KP9A 1CB0A 3TW4A 4E2ZA 4X8HA 1ZD3A 4KMMA 1OJ7A 4B2PA 1O54A 2O1WA 5DCWA 1E62A 3K9QO 3HWRA 4KE7A 3QLUA 4R2HA 3DKPA 5K6AA 4BMCA 1JECA 1MNAA 4KH1A 1XMIA 3TMYA 2EFDB 3CZCA 1IE3A 1L4UA 4NMXB 4C0QC 2BKUA 4ZQGA 3R9XB 3INNA 3KEOA 1ZIOA 3M49A 2PKWA 1RABA 4H0NA 5C53B 1OXTA 3TR5A 4G26A 3DVQX 2PX2A 4EJFA 1KH1A 4GLLA 1NAHA 1Q92A 1P62B 3I92A 4QQKA 3P2IA 2OFFA 3HXKA 2YS7A 4AZSA 4ZN6A 3VPGA 2C9OA 1TEHA 2FE4A 2DUWA 5DB4A 2C00A 2ZSUA 4AF7A 3FCAA 3KWMA 4NAUA 3GT4A 1F38A 1YT5A 4U2BA 2Z3VA 1K9VF 4KFSA 5CLLA 1QYWA 1H4TA 1ADJA 1F6WA 2XYRA 4ZAVA 1P3JA 1PS0A 3DEFA 3WOHA 1V5WA 3KKNA 1XZKA 4GKVA 5KYUA 4HJRA 2V3WA 3DNFA 3I3SR 1TLTA 2EKDA 3MWYW 2WJJA 4EY7A 1EVJA 3ITKA 3OFJA 3LQYA 2F90A 3CZ4A 1ZFNA 3BGSA 3QTTA 4L27A 821PA 4Y2HA 1L5QA 2ZSEA 3FLMA 4XH9B 2QRQA 4OJQA 4AG6A 4MOWA 3AI2A 3SHWA 2YCLA 2ISQA 5DISB 3R9XA 3IAXA 3LIIA 5EWLA 4ECAA 4OCZA 5EJMA 3TUIC 5E6SA 3VC3A 5ADUS 5KX5B 5DDIP 4ZOQI 4GR4A 5IBRA 2A1TS 5IC5A 3ZWNA 2ZUWA 2PMEA 2GNOA 1M1YB 2J3MA 4QPNA 5KSYA 1O9HA 1KNQA 5DBFA 2PWAA 4IIGA 4H3HB 4YCDA 5FOUA 4IIFA 1AKYA 2XYVA 4KAFA 1MOQA 2XIQA 5EHGA 3WGMA 3NRBA 4ZKDA 3EZXA 3IBSA 3U3KA 3PC4A 1Y3FE 4W9RA 1Z0SA 4A8TA 1TTPB 2D0DA 2REBA 4QYSA 3TBFA 4DFDA 1XNHA 4MWOA 5C18A 4EITA 3PFFA 4OGGA 3ST7A 3EVBA 2PKXA 2GA8A 4RXUA 4TKMA 1G9TA 4RVDA 1KP2A 3MXOA 4NJMB 1DBWA 3KX2A 3MJTA 5CK5A 5JZOA 1FU8A 2YC4C 4XPIA 4RCVA 2YXBA 3M1IA 1AKVA 1Y80A 2BKEA 3HJBA 5KWEA 1QWOA 2Z08A 2YWCA 1P39A 2W4MA 4GEKA 4GM4A 3OBBA 1K4YA 1LWOA 2CB0A 4AP6A 4UKDA 3G7UA 2AR0A 5M7EA 1V8OA 3AJ8A 2BEVB 4TLLB 2FZKA 3AETA 1KP3A 5EUMA 2EW1A 3ZGOA 2IYYA 1FFYA 4DIDA 1OFIA 2YMPA 1OX4A 3E5HA 4PLZA 3RIGA 1G42A 1E3DA 1KI6A 2IOQA 3BF8A 3Q3VA 2GBFA 1X74A 1DUSA 4E31A 1M6EX 1JT2A 2AW3A 2G63A 2ZRNA 1LTKA 1QYDA 3IIEA 3KAQA 2QX9A 1G8YA 1XKLA 3Q6IA 1P18A 3PU6A 3T4XA 3KLBA 3L40A 2X6QA 3C1OA 4N65A 1O5IA 4X6YA 3HYNA 5JANA 4OYLA 1P6QA 4K6MA 3UCXA 3V4RA 5JNUA 3TJRA 3GQBA 4UBOA 3QFRA 2B5OA 3ZUPA 5LZ2A 2FEOA 1L4NA 3M8KA 1CIJA 1HDCA 1QE3A 4YYEA 3S1SA 1OI4A 3V1KA 1H3NA 2BMVA 3E9DA 3ZCXA 4UM9D 5TB5A 3QELA 3WWZA 1RLUA 3NHBA 2PEYA 3KOUA 4N0QA 4KR9A 3U4DA 4JU9A 5ED4A 3OQMA 3H19A 1XZPA 1REQA 1E2EA 3D1VA 4LJ6A 5JD5A 4JAVC 2MYPA 1PFGA 2ZCVA 3DKIA 4K9SA 5DO9A 2WFMA 3SYLA 2DXIA 4QXQA 4F85A 4BPBA 3WGLA 5CLFA 4Q47A 3SLKA 3A10A 4BOYA 5CFMA 1GGEA 1Z4IA 3IV6A 4YVFA 3FNIA 4QJ5A 3LKVA 1EAYA 2H0QA 5KOHA 3L5OA 1CUGA 2KM1A 3GRUA 1UKAA 1T8UA 3M83A 4UD6A 3WS7A 4TN1A 1A8IA 3S81A 3VVCA 2DFVA 1VE5A 5JCZA 1RM3A 4JLWA 1FPQA 1XTZA 2Q0HA 1JF8A 2XYQA 2GVDC 1IOZA 5JH7F 1HLPA 4MGYR 3IIJA 4O2AB 4JR2A 1J1IA 2PSFA 3KR1A 5JC1A 3DGFC 3PI7A 5B64A 1IB6A 3PD7A 3ZE7A 4HLDA 1SPBS 1TCBA 2YR0A 3DFIA 4MKFA 4QDZA 4A23A 8ADHA 3ONWA 4HZGA 4WPGA 1VLHA 4YO8A 2PJUA 1LBQA 1WY5A 4PPNA 1LTQA 4NABA 1Z17A 2JIPA 1S96A 2R96A 1BXGB 3HFGA 3L77A 3Q2IA 4LY3A 3DWEX 2XMZA 2HTEA 3H9QA 4CKEB 1X1QA 1EUQA 1LS6A 1D4OA 2V7GA 1STOA 2X7JA 3IDZA 3KQLA 5JVDB 1AM4D 4H16A 2R85A 1ZXLA 5KHAA 1QZUA 4TVSA 5CLJA 1FPMA 2R2GA 8ATCA 1B8NA 2AC4A 2QZ4A 4PLVA 1JLLB 1RS0A 4K3UA 3UJ6A 1JHUA 4G36A 2GYYA 3O47A 2IXDA 3CYFA 3RFFA 1N5DA 3ZGLA 2XF8A 3NM5A 3ROXA 4B4UA 2B69A 1YC2A 4LYDA 4O2AA 4OHCA 4MS1B 4X1YB 5D3KA 2VT2A 4K46A 3WLQA 2B83A 1X9IA 1P1JA 5KHOC 5JZVA 1MZVA 2NTJA 3CM0A 1U7OA 4MJLA 4E2FA 2FDCA 2Z4RA 3A3YA 4R1OA 4ZOBA 4X92A 1TVEA 1P3Y1 4JQZA 2P2GA 2XVXA 1X38A 3MUOA 4RF5A 3UQZA 3BVPA 1LDMA 2QS9A 4QBIA 5FTNA 2C0QA 5LZ8A 1M0WA 4CM4A 3QIAA 1IJKA 2H1RA 2NADA 4EP1A 3QKTA 4YPFA 3R7FA 1OCEA 1W2HA 2OQIA 4MWBA 1DC5A 3X2FA 4N40A 3PX7A 3EGDB 4FC6A 3UB2A 2FSFA 5B58T 4Y2XA 4EJ6A 4AY6A 3P19A 4K6GA 5KSZA 1TU0A 3GRVA 3GLGB 2I7DA 1O5OA 1P5FA 3C3DA 5GV8A 1IVSA 2JHAA 2OG1A 1ZI6A 3AEUB 4ZZ1A 3S27A 3V8RA 5D5PA 4OK5A 3GL9A 5F2EA 4CEIA 3UK7A 1VJDA 4BO5A 6REQB 4CMCA 3KVRA 5C4MA 2O8DA 3H1PA 3NTOA 4OQDA 1GSOA 1UBOS 3RD5A 2PNFA 5JV5A 3H2YA 3OSZA 1T8PA 1WULS 1M5UA 5AVZA 2BGUA 2EKLA 1VLMA 3N2NA 2XIJA 5HM8A 4QTXA 4AK9A 3AJRA 1E60A 2WB4A 5AK4A 1C9EA 1GRNA 2HPAA 1UBEA 3C97A 3HP7A 4YQZA 4E51A 5KDDA 4C2TA 4G4JA 1K1EA 1UK8A 5JDCA 5JLJA 1NRWA 3GP3A 3QA3E 4L0DA 4JD5A 1KI6B 1U1IA 5F35A 5JAHA 4HQ6A 3L7AA 3ZU2A 4UXJA 4UCFA 1UBJS 2ORIA 3AVTA 5MHTA 4BRWA 1IHXA 2BMDA 2FDXA 3CLSC 5AXCA 4Z7OB 5LMUB 3QE0A 3A05A 5KYKA 1YU6A 2G0TA 2JD0A 1US8A 3CONA 4RJ2A 1R6VA 1UXKA 1F0YA 1ZX1A 3HP1A 4ILKA 2Q9CA 1W0JA 5DTEA 3R7LA 2FVXA 3WFIA 4DRXB 3BXPA 2BF4A 4X20A 4GBMA 2VNIA 1KSGA 1UWCA 2X3YA 1Z68A 2WIGA 4MRNA 1G59A 3INRA 4DJTA 1N7HA 3O2SB 3JQ6A 4CNBA 3R8XA 2J9ZB 3UK0A 4PG6A 1ZNWA 2CY0A 1P75A 4B8YA 1I7DA 2WSBA 4GXNA 2GCGA 3JSAA 1A9SA 3FUUA 4UOZA 2OLEA 2CFIA 3AZQA 2Q5FA 3BE8A 1KO1A 2PUBA 4JYPA 1SCNE 3VRHA 2J32A 1SIBE 2PJDA 1ZLXA 5CIYA 4JBIA 1N9KA 4C29A 1HYBA 4FMCF 5HTKA 3A1SA 4IRMA 2NO9A 3E82A 4E5DA 4ARZA 3GFOA 3HM2A 2AHRA 1QCZA 4HNAA 3WYNA 3ZHVA 1LDBA 1VFPA 3R0VA 1LPBB 5EIBC 1C80A 2YJ4A 4QG7A 4KWCA 3SC2A 4Q82A 2Z4TA 2CJPA 5JADA 4EELA 2H8KA 5EMKA 2XDWA 4LSWA 5G0VA 4J0HA 4AKHA 1OT5A 1Y6ZA 2QTCA 2SKCA 3MUNA 4Z4HA 3W6ZA 2EDCA 2SKEA 5ENVA 1R9NA 4Z4IA 3VSBA 3T99A 4G0QA 2PR2A 2XAAA 1ECCA 2HC9A 1OBHA 2WE7A 2ZWPA 3A6GA 5JXHA 2IHYA 4Z53A 4HQ0A 3TDMA 1KQGA 1WDMA 3MT8A 2JFPA 2QTRA 3BZWA 3L06A 2HL6A 2J09A 3CZAA 4QO8A 4XEHA 3WLJA 3BHJA 5BSRA 5GIOE 3QVMA 3I45A 3H3XA 5IAJA 2KBEA 2D2FA 2UZ1A 4XRRA 4XWKA 1A0OA 2EFJA 4H7HA 4UHHA 4WLUA 2J4DA 5DHFA 4D5EA 1RPJA 2EJTA 2QNIA 3B36A 5KTOA 3OEHD 4IMJB 1JI3A 1VMEA 1FSFA 3QPDA 2PUHA 4W9MC 4R7ZA 1KMHB 1N2SA 1OREA 2P5TB 5C37A 5TPWB 2ERCA 2EU8A 2W8BA 3VZPA 3MBKA 1M83A 2DCMA 1Z7WA 3ZWXA 1KEEA 3IDFA 3F6YA 3L92A 4QU5A 1VM6A 1HA3A 1BX3A 3IKMB 2I29A 2H51A 2I4IA 1WZ2A 1CUSA 2C2XA 1W34A 3F8WA 1R8QA 2I3ZA 3EDQA 3H1FA 1A1SA 3IVCA 3PUHA 4IBOA 4JMLA 1SXJD 1THMA 2D1FA 3TM4A 3TNYA 4F0JA 1XPOA 1CUHA 2YRWA 3KJEA 2Q3EA 4UTRA 3F6CA 4B33A 4DDWA 2GCIA 1NSFA 3PS9A 3NHKA 4RIFA 4EARA 5AI5A 1RLTA 3C74A 3O4HA 5E1DA 1M72A 1GQSA 1XMJA 4BTLA 3AHEA 3GZ4A 3SE7A 1CNMA 5IDYA 2FLKA 1MB4A 4MRVA 1GZUA 4IDOA 4H7DA 1I9CA 3CNHA 3UMJA 1GTL1 1ONBA 3OPNA 3MOGA 4A0HA 2Z5GA 3NB0A 4KQ2A 4NS1A 2YFHA 1C9MA 5D87A 3S68A 3MNFA 1Z07A 3W5AA 4N0DA 3UJCA 3JPYA 4XIIA 1AGPA 5KPDA 2V97A 4XZ3A 1KI7A 1IK6A 1CP3A 4FBLA 2ZDGA 1WMFA 2VAVA 2YHIB 4POAA 2PT5A 3A4NA 4RGYA 4WXMA 3RASA 2WU0A 3D6HA 2JLCA 1U3GA 3K9BA 5H0IA 1TYBE 4H6PA 2ZAMA 3VDRA 5BSTA 2XE7A 2DOKA 4D3XA 5JJKA 2PO5A 2RHRA 2RI0A 2WSMA 1J8DA 4YJ3F 1PZNA 3SDBA 2PO7A 5BVGB 4ZQCB 1EVLA 2I1WA 4YT4A 1NVUQ 4PYOA 2ZIUB 4QUIA 1I10A 4ZYUA 1J2YA 1DLIA 1DAIA 1DZ3A 5LA6A 2CN1A 2WSLA 3I8SA 1DKMA 1UT5A 2VHCA 2XDQA 2NNLD 2TMYA 3RYFB 4JLVA 4JWTA 4KU4A 4X1KB 3WKCA 1I1NA 1DZIA 1RKUA 2UXCB 2P2DA 4WOKA 3O8RA 1T6YA 1HT2E 4ZZ3A 2V58A 2IWRA 2G5TA 2JI8A 1ESDA 2ODPA 3CT4A 2ZIFA 4MLPA 4WZAE 5HTOA 4JEIA 5EJ7A 4CKWA 1FDUA 3HY4A 2HNBA 3ASZA 1E3WB 4JJ6A 5G02A 4XXHA 4GL4A 5KTNA 2GFHA 3HFSA 3PENA 1P7ZA 2NUBA 3K72B 2VPIA 1KGDA 2M6SA 3DCIA 3W4IA 4TSFA 1VKZA 4PYIA 5CB6A 4XIYA 4EI2A 4XCQA 4MS4A 1KAOA 2AXQA 4QXMA 1NM5C 1TYCA 4TKVB 4MV8A 2A9RA 1QHHA 4ZI5A 2HB6A 1Q19A 4UFOA 2W4IA 4J6FA 4KCGA 4J0GA 4N01A 2IXFA 3GW8A 1BE6A 4EABA 3ZGYA 1ONSA 1WABA 2Q5LA 2XOXA 1PWYE 4PIPA 4QVKA 4J0QA 4TT3D 3PQCA 4AZ0A 2EX1A 4OP2A 3FBGA 3BZBA 4P7KA 1WDKA 4YH1A 3MTDA 3PYLA 2K7FA 2YY5A 4I50A 1UJ4A 1QHSA 4YRLA 2C2KA 4MW9A 2GM3A 3FIUA 3GWGA 3UOWA 1YQDA 4MVJP 4EA8A 2H1FA 4YAKA 1TQ8A 1SZJG 4BNLA 4IPTA 1P33A 2BRUC 2JFZA 2ZTVA 2O9JA 2YKGA 4YRFA 2FW6A 4X64B 1OJLA 2ZRMA 2OVBA 5IZCC 5CVUA 4JP2A 3WE7A 1BRMA 3LQRA 1AKRA 3ZCQA 1BKSB 1O94C 5BXYA 3NH9A 4HSEA 1KR2A 2OGSA 2QRJA 1JQJC 3MCTA 3H4IA 4XM0A 1JKIA 4P3KA 4FKBA 3FGPA 4QWMA 4RSMA 1MEOA 3THYA 3C3AA 4G0MA 4A91A 3EG9A 1O5TA 1V5EA 2WTBA 1XDBA 5LDHA 3A1CA 4F6RA 2OBXA 1A9RA 4PAMA 3OE7A 3U61B 3F1KA 3DBVO 3MJEA 1GPAA 4QOEA 1V1JA 4HS4A 2BWJA 1P2VA 1Y9JA 1UBFA 3SMVA 3RVQA 5JSZA 3WRVA 4AY2A 1OSNA 1X7XA 3FAZA 3O2JA 1YU9A 4FFWA 3WJ2A 1H8HA 1XTBA 3E27A 1Z6AA 1W4AA 1PJCA 1TECE 2H2DA 4AYWA 3LPNA 2PYZA 3I2JA 2OYSA 1O9BA 2E3JA 4G0YA 5ERYA 1P8JA 4TMFA 4Y18A 2W70A 3UW3A 4OIFA 3WADA 3P9RA 2QZ9A 3W5JA 5AWFC 1XB2A 2V5VA 2JFBA 2Q8PA 1L8LA 3BJEA 3Q4GA 4FD3A 3OCUA 1YS6A 1VIDA 2WP0A 2XBUA 1S2NA 3EBPA 3QNWA 4M6WB 4AKTA 2PMFA 3QHAA 4URYR 5JSFA 4IGKA 5EQDA 4MHSA 4ZKEA 4RHFA 2WKPA 3DT8A 2FH5B 3KC2A 3SX0A 2C4HA 1QVAA 2RGYA 5B3AA 1Z4JA 2X4GA 2OHHA 4PM4A 1U31A 4OQZA 3ISVA 1RI1A 4JXKA 2QTMA 4LBYA 4WFIA 2YJZA 3U2QA 1ZICA 4H9GA 1EFLA 2V0GA 1N5JA 3TRFA 4ARIA 3HN7A 5C0OE 2BSQA 3QUSA 4YJ2B 3TCKA 3P26A 1Q0SA 1OTYA 2ZBEA 2RBKA 4IFIA 4PZLA 1FTSA 1O8CA 3D6AA 3R9IA 1NSYA 1MQSA 2XUHA 4RNDB 4TXMA 2WTXA 3TJMA 1LDYA 1P1HA 4YRSA 2H4HA 2YZKA 5KZMB 4DB4A 1I33A 4NCAA 1IWOA 4A15A 4S24A 4X24A 4DCCA 1IFXA 2XSZD 2ZETA 3HUEA 2WIBA 2SECE 2VHUA 1ODLA 4B3XA 1F8UA 3UUWA 5IZ4A 2F59A 3LUKA 3AERB 1FP4A 3LE8A 4N7BA 3NR2A 4D9NA 4Z7NB 1BJRE 5J5VA 5BN4B 3KJQA 1P6XA 3OBIA 4UTZA 2ONYA 1YKSA 3KSUA 5FI0B 1L8XA 3NIGB 3UHOA 3RFCA 3FFTA 3PQ3A 1FA9A 3K9LA 1QKKA 3I9NA 2H52A 4RL4A 1JILA 3WJ1A 4RVHA 4TSKA 1V39A 3EHDA 1BDHA 4JCOA 4C3UA 1G20B 4L8GA 4NENA 4P86A 4HH1A 2WM2A 2EBHX 1S01A 3HU5A 3TSAA 3OE4A 4P80A 5F23A 3MOSA 5K0JA 4JXZA 4WN9A 1C7EA 1SUEA 2IXGA 3OIDA 1GPMA 4WINA 4W9NC 1AV6A 3PT5A 3RRBA 3UMFA 2C61A 5CNMA 3QSGA 4I50F 5FPSA 4E5PA 1G8JA 3DMFA 1JYEA 4R6WA 1XRRA 1LBEA 2NU9A 3T1OA 3T5CA 3NU1A 1VG0B 2CEAA 4OMFG 5BNWA 3TLJA 3EEIA 2O8VA 2GXAA 4DJEC 4O4JF 3OKAA 3VAZA 2JFFA 1J1ZA 2ZB3A 3D4LA 2EL9A 3TD6A 1F4VA 2IYUA 3QVGA 4OQQA 4Z9YA 2EZ9A 3KRTA 4W4TA 4E3ZA 5BNTA 3DE7X 1VJ1A 1OYYA 3QHPA 1B8UA 5CDFA 1HF3A 1QKIA 1ZWKA 1E1RA 5LU9A 4MVJG 1ZJZA 4KG7A 1VLQA 1EAMA 1UKZA 1V47A 1W4CA 3Q3HA 3QFTA 4LGCA 5JNTA 1P1RA 3OU7A 7REQA 8MHTA 2IH5A 1GN8A 1Z35A 1T9ZA 4UMFA 3CVYA 1EDDA 1QVRA 3NASA 2NQ8A 3E9ZA 3BREA 1KO8A 3VU1A 1L7PA 1Q0PA 3N5KA 4HHEA 4II7A 5ALWA 4QLAA 4JMPA 4C4PA 4WA7A 2VZ0A 3HN6A 1TCAA 2QMYA 3EH2A 3QEMB 4DYDA 4WACA 4X00A 2YZGA 3PV0A 2V4ZA 3BE4A 1QPGA 1S4MA 2XJ9A 2VI5A 1U1CA 2OO3A 2I7CA 1I30A 1OU4A 2WWFA 1ZGZA 2IXAA 4J94A 3VOAA 1Q3HA 1MENA 4J43A 4XW2A 1Q0RA 4XPIB 4NE2A 1QGZA 3OAAD 2OCPA 2ZSFA 3B89A 1GM5A 2OBMA 4KR2A 4JGGA 3V1TC 5M3BA 4FMDF 4QBFA 3ZJUA 4DG9A 1H85A 1MFPA 2VSYA 1N6LA 3SKXA 2QL9A 3FYUC 1QGUB 1TIPA 3P5SA 4XEUA 4ITRC 3EZ7A 1RP1A 4KBGA 4OGKA 2ICAA 2ZJYA 4MEJA 1JH8A 3PITA 3IQWA 3L8GA 1A9TA 4BNXA 5BOSB 4MGHA 1H66A 1GN9A 4XWOA 5CFNA 3ROGA 1U0EA 1Z0ZA 4ZQIA 4KE9A 4B43A 1SO8A 3MCWA 3HRIA 1E5TA 1JLKA 4JUFA 4O8CA 1L1RA 4PGMA 4N6GA 3DQZA 3KCNA 4YRIA 2ATVA 2ET6A 3O21A 2QL5A 3C6XA 3EEBA 5K6AC 4B4KA 1KXJA 2X0DA 5KAPA 1OB5A 2W93A 3ZV3A 5B1SA 4L4YA 3L6CA 3PNKA 3A7DA 4RD6A 2C1ZA 3NUQA 1RRFA 1ZNZA 2QD2A 2QAJA 3GT7A 4IKOA 5ARBA 5AI6A 4EGFA 3C3CA 3OPYB 3O3OB 3AUUA 1WR8A 2BGIA 3CLKA 5M2QA 5BN3B 1DC7A 2VSFA 4XSVA 1J09A 3LBAA 5FL7A 2OM6A 4CNQA 2H1OA 1BEZA 2RKWA 3KQSA 1GPUA 3WJ7A 2Z8YM 4ZI7B 1NYQA 1YB1A 2XA9A 3OQ6A 4QYTA 4BFVA 4MUAA 3HNRA 3T4EA 2GKGA 1Z18A 3D6MA 5KVVA 3GLSA 3W2GA 3U19A 3VJLA 1IZYA 4C2UA 1RJGA 2ZWMA 2ZT6A 3B2QA 1JSCA 1T6NA 3BF7A 2OCLA 3C41J 5DLEA 3VHLB 2IUTA 3AZPA 3UVEA 2Q7OE 3T3IA 4BKMA 3MWEA 1MC1A 2QU8A 1LB1B 1XVUA 3KQTA 1P5JA 3M4JA 3PUZA 3IILA 4BGUA 1Y6FA 1F51E 4UXHA 1U2SA 4GSKA 1BQ3A 1P6UA 5E2IA 2W9XA 1CUIA 2X42A 3THXA 1XTTA 5GM2A 2QAIA 2UXBB 1N1MA 2ZAIA 1ODIA 1JQAA 1PKXA 1G8HA 2FZLA 3LCMA 4EGJA 4KR0A 2JK0A 1D4FA 3PNOA 4Y9UA 1R4ZA 3IOMA 4FQ5A 4QECA 1PBNA 1T43A 2BCGY 3HBAA 4M38A 2B4AA 3HLKA 5LWQA 3U6BA 2XNCA 2IU6A 1JJBA 4UMEA 5FUQA 1ECLA 1QO7A 2Y27A 3AFGA 4ARCA 2ODBA 5HJ7A 2BDTA 3EXEB 5CCEA 4G5YA 1PAUA 3U0BA 1Z0UA 2HK7A 3PUKA 1NNSA 1MAHA 3FW1A 2XOKA 4HQRA 5CP8A 5BRNA 2O2HA 3I04M 2ID9A 3TOSA 3L79A 1G8PA 1XAJA 4ZAFA 3K92A 1I36A 3GDWA 2COKA 4KE8A 1IN4A 2LBPA 4F8EA 5ALXA 1HL7A 3GO4A 5T6BA 5KNDD 4QYMA 3WWCA 2ABWA 3DC2A 2JRLA 1ZKDA 1BE1A 4UHCA 3G2KA 4B7CA 4CM1A 1ZS9A 5EHXA 3ETEA 2QM3A 3AKCA 1ORIA 2AI1A 5LFAA 5MN4A 2GGSA 2VHQA 4ZK2A 4RZQA 5J2UB 1YS2X 3PCRB 4QARA 2OLJA 1K63A 1LK7A 1J5EB 1ICEA 1OX4B 5FBKA 5K3CA 3ROQA 4X90A 1CT9A 5LOVA 3GOHA 4ZYTA 5K05A 3LZDA 2IOFK 2ZW9A 1J2EA 5LZ4A 2MYTA 1U2QA 1OA0A 4BFUA 4LVUA 2QD3A 2QMOA 4P0QB 4FQ7A 4J8PA 2ILTA 4L02A 4P7GA 5ILGA 5DWQA 4IIJF 3ZH2A 3LWBA 3ROEA 3W5VA 1E7RA 2XJ4A 4MRSA 2ZI4A 5H83A 4MUHA 1SPXA 4NNOA 1N2OA 3NYQA 1T8YA 3PNLA 5AOBA 1QFZA 1XYGA 1QJ4A 2PFGA 3HJRA 5D3MA 1A72A 1K8RA 1TADA 4LPSA 4ZI3A 4MQEB 5HBGA 1WRBA 1Y7PA 2BP7A 1SCUB 3UIEA 3L6BA 1CQPA 1V1RA 3SSNA 1ZGHA 5NULA 2QHXA 2CHUA 1II8B 4MA4A 1ZUWA 4RD1A 4D6XA 5E4JA 2O59A 2PUFA 1OLSB 3F4KA 3TW6A 3KK0A 4DIUA 3QPUA 1E99A 1HBJA 2Q1WA 2RG7A 4TSFD 4DC1A 4DA9A 2J4FA 1YI1A 4PQGA 3TZBA 2AD5A 1R8YA 2OGUA 3DUFB 3PQ8A 1Z4MA 5HFJA 4ASUD 5ALOA 3RNLA 4DM4A 3D6UA 5TPWA 4TMKA 1LPOA 3VU0A 2H11A 4Q15A 2J0VA 1I3CA 2X1LA 2E4VA 2GPYA 2HMVA 3DP7A 3FROA 1VSTA 4YDHB 4BWYA 4XVCA 4WVLA 1PWZA 1M67A 2O5RA 1L4MA 3C15C 3DLTA 4ENSA 4G65A 4N3NA 4FT4A 4XD7D 5HXAA 2FEWB 4GQIA 5JT1A 3NLLA 3ES9A 5BSKA 3FIJA 3Q98A 3DWIA 3GBSA 4LUCA 4EY5A 2FYTA 3BWMA 1EXWA 2UV8A 2OE2A 5G2OA 2BAGA 4AMVA 3K16A 3O8DA 3R40A 4NF2A 4CKCA 5LJIA 2IE0A 5DBIA 2RGBA 2IBSA 2O8DB 4R6XA 2BFMA 4JUAA 2ZROA 1PL6A 2GBIA 3VO9A 3RAPR 4FMBB 3OHMA 2DCUA 3PWSA 3PWTA 4ZCPA 4UUBA 2IDKA 2NUPA 1Y42X 3DFZA 2FCRA 5C3UA 2WWIA 4BEBA 1US8B 2E21A 1TUIA 4CZ2A 1V43A 3AHIA 1GG5A 1VCIA 2FN7A 3VHRA 1UXJA 1GQQA 1XZGA 4RKEA 5J59A 2NXNA 2BHTA 4GZ5A 4I55F 4M9QA 3ZWAA 4CQMD 1U8FO 4LJLA 3IJPA 3FWYA 5SZJA 5LWHA 3HFRA 4KO3S 4LXHA 4RO0A 1YMUA 4TYYA 1T9GS 2IVFA 1YK1A 2CDBA 4A0QA 5IK2D 2XGGA 1XLVA 2QR3A 2QN1A 4TUYB 3SG0A 5K2OA 1IYZA 3LL7A 1IB0A 3NV7A 5THQA 1XXHA 2C4NA 1XMVA 2ZIXB 2JFQA 3E84A 1QG6A 1IHOA 1RQNA 1B6GA 2W00A 3IP1A 1G8FA 1G3UA 4H15A 2YYSA 5EZSA 2F3TA 1GUAA 3EDOA 1GV1A 3W5SA 2YNMA 3ZKWA 5C51B 4RTRA 1E3LA 2IOHA 3F6SA 1KR5A 4W1PA 5B57C 4V0OA 3I0ZA 1I3KA 4F4FA 3P52A 2ZOSA 1XZFA 3NJ8A 3GD5A 2I4OA 1WMEA 3I2IA 4OO3A 4MRMB 3U0VA 4UU1A 3EVGA 3X0DA 1GZHB 3HKCB 3OMXA 1NQOA 1U7TA 4MWEA 3WWYA 4QDXA 3IUEA 3GRRA 4WRRA 3MCAA 3ZY5A 2VCEA 3QXCA 4J9VA 3N75A 1WKVA 4PHGA 3F78A 1A97A 3PQ5A 5HEKA 3QE4A 3UJPA 3DMRA 5TQ2B 1OPXA 5K4HA 2HDNB 4J1NA 1K6JA 4BVFA 3HJTA 3EPRA 3H5VA 1JIKA 3OJOA 2H08A 3EXIB 2QUJA 4EKEA 5J47A 3IIMA 2RHCA 4NNJA 4WXYB 4DPMA 3PICA 4I2NA 1BAPA 4HMPA 1QBGA 3ONNA 1W59A 3D8BA 3OWHA 4UDNA 4JBLA 4QJBA 5HIKA 5HPYB 5JYCA 4FFBB 2FR8A 1E7WA 2P68A 1LQUA 3ACCA 4RZHA 4V0MA 3V4LA 4WI1A 1E3JA 2W2QA 3ZEAA 4BCBA 3I61A 4OJKA 4PF1A 4U6QA 3M81A 4EK9A 4BN5A 1DU4A 2BGMA 1WEKA 2J3QA 3ACBA 3O8BA 2ZIAA 1LQTA 3HEMA 3C85A 1LK5A 3VNBA 5K0SA 3FDZA 4TOIA 4MITA 4PHFA 2G0AA 1FDRA 2VTVA 5FOVA 5BO5A 4AJOA 1WW2A 2M2IA 3HDVA 3ZHBA 1LJUA 1QIHA 3TTVA 4G85A 1EFRD 1FTQA 2B8EA 3RQIA 4BMPB 1PFYA 4HCJA 1M2GA 1MEEA 1ZJJA 4U4AA 4IJKA 2IK8A 4MGEA 5D00A 2O3RA 3V46A 5JJCA 1XQWA 1ID8A 4FZJA 1P60A 2GHRA 1LGYA 2A84A 2ZJ4A 4MB0A 3WZMA 2PRSA 1XZMA 2OD7A 4YJKA 1IN5A 2GBGA 2IXBA 5JNSA 5JRZA 4XDGA 1LCIA 1UP4A 1NGSA 4RMIA 3SM9A 1SXPA 3KEGA 2HA0A 4WLEA 1VZ2A 3OLYA 4DDKA 1UK9A 4I1YA 3KSZO 5I7VA 2VK4A 3OM9A 1O96A 4NOMA 5BMVB 1U5BB 3L43A 2NYVA 4K2AA 1ELOA 1CJBA 3R3VA 4EJSB 3WV4A 4DLAA 3CLVA 4KGXA 3ICVA 4E4YA 4NFLA 4BV9A 4QOIA 4B82A 1GGMA 5A02A 3NAMA 2XKKA 1GA6A 4DA0A 3K1AB 1CZUA 1WZCA 2GM4A 4CMEC 3QMPA 4RJJA 1X2BA 3PXBA 5HJ5A 3PEVA 3TW8B 1RKBA 3ZJTA 4UTPA 1SVNA 3LPCA 5BUZA 2H29A 1RNLA 3K31A 1TL7C 3LKZA 2ZYHA 4QICA 2QSZA 1DKOA 1M8PA 1J0AA 3PUJA 4HOYA 3RTBA 4BUJA 2R751 4PCUA 4PYJA 2XEXA 1T36B 5EESA 4W5OA 3KS9A 4ZJZA 5JVDF 2YV2A 4MW0A 4HF7A 4LAFA 3TB4A 4RTJA 2FKAA 3LHFA 4ZT4A 1CZKA 4D96A 3R76A 5KMGB 1NVDA 1PR9A 2QL7A 5KWIA 4J49A 3I6QA 4YJ2F 5FWYB 1Y8ZA 2ZVJA 4ZYLA 2ZB7A 4JYZA 3KPVA 1ZHHA 4G0UA 1QG0A 3E9NA 1CQIA 4D8TA 1SKQA 3PJRA 2R0QC 4FK8A 2OFXA 4X7RA 1C7JA 3JVDA 3PI6A 5A5GA 1VL0A 1GCOA 3Q6MA 4YI3A 1XGKA 2HUPA 1C7QA 2Y0PA 5DSTA 2JCVA 1G20E 4DJ5X 4FE4A 4OI1A 4YQFA 1G6OA 1DI0A 2DHQA 4NYIR 1CZHA 2QP9X 3G1WA 4J0EA 5IBPA 4Z54A 4ND5A 3AEQB 1U98A 4HEA1 1OW3B 2AMVA 3A8TA 4MINA 4E32A 1VE6A 1T5HX 4RIIA 2XMGA 2YFYA 3R3HA 3TW8A 1AKUA 3O1LA 5I3ZA 5KNCH 1Q1ZA 3IIIA 1Z12A 3QG1A 3O9MA 2Q6TA 3IPRA 1H65A 2XT0A 2BHLA 1ND6A 4KE6A 1M7BA 1S2MA 1USUA 4EKGA 3HU2A 2CXSA 5AJHA 3JQ7A 1ENYA 4Q16A 5JWOA 3U7HB 2Q4EA 1E2JA 5LB4A 1Y3IA 1Q7CA 2DWCA 5SY6A 4U7FA 5ESRA 3D7LA 4P4NA 1XMPA 5KJEA 4PRLA 2PUEA 3E3OA 3M6XA 2EZ4A 4QDTA 3G0CA 3BKXA 3E18A 1Q0QA 2V59A 1RC1A 5F9FA 1F0PA 5EQFA 4TLCA 5CJJA 1H1LA 1Z9BA 4LZNA 4O0LA 4BS9A 4J03A 2GJ9A 3N8IA 4B79A 2YCBA 3MJHA 5MFZA 3OPMA 1X7ZA 4LMAA 4BB6A 2UYCA 4AN4A 3WIUA 3NOQA 1WV1A 1A9QA 4YLGA 3SHVA 4FILA 3DLIA 5KNBH 1P4GA 4G4GA 1PR6A 1XTRA 3UWDA 3TG2A 1U65A 3I4FA 2CXRA 4EB0A 1N0WA 5IXJA 3CPHA 3O92A 4NEHB 2CVPA 4A0SA 2Q4RA 4YXWD 1C7ZA 5B3JC 121PA 1O08A 5CU7A 2XQVA 4P4SB 2ECFA 1T3TA 1NE2A 3H8JA 1FYVA 3NEYA 1DOHA 1A7KA 1CIVA 3WSTA 1CZNA 5C8YA 3CLRC 2J30A 5KAMA 1D0VA 1K89A 3RAFC 5F5LA 1V96A 2NLOA 3GPCA 4OH1A 4C0HA 4B9AA 4ZYVA 4HEJA 5LA6B 5HE8A 3D2BA 4HI0E 1LNQA 1YL6A 2XR1A 2VDVE 4PYMA 2WF9A 2AKAB 1K8QA 4XYEA 5TARA 1JEOA 1R6UA 3I9MA 2J67A 4Q1EA 2GM5A 3WI7A 3O4RA 1A7JA 2UKDA 1V7PC 1FLAA 1QUEA 1USVA 3MIZA 1YKGA 1X7GA 3FRHA 2RI6A 1VA5A 4BP9A 1TQ4A 2I71A 3GYGA 5HM6A 4UNNA 3M6VA 3M0EA 4TQAA 1A9OA 3BMNA 3OOYA 4W5RA 1RBZA 1R6XA 1WXWA 4ZWNA 3UK6A 5L95A 1X0VA 4G84A 1UJMA 2A33A 1XZBA 2XZTA 1YV9A 4X3CA 3AIIA 4TLBA 2ERXA 5JDIA 1YZQA 1RBYA 2A9FA 3QJ5A 5IN4A 3OA2A 4Q9KA 3H5RA 1Z8NA 3W8NA 2ZSIA 3CN9A 3LX4A 3DC7A 1JTEA 3R3ZA 2CWWA 2O48X 1W48A 3T61A 2X0IA 1EQUA 2VEOA 1WB5A 2W6MA 2WYWA 4P1ZA 5EIWA 4EVIA 1KORA 1GYQA 4GKBA 1KERA 3H2ZA 2WD8A 3HCRA 2WNHA 3FI0A 3HY3A 3UWMA 4B3TB 1NX6A 1RPAA 3TUJC 1EFRA 4U00A 3WGUA 2WG1A 3WQHA 2POCA 4OA8A 3O90A 4KR3A 1HFEL 2AJTA 1XL0A 1ZVQA 3RB8A 2CNWA 3VX3A 1N6RA 3IQEA 2J5KA 2EGGA 1CLEA 2GQ0A 3FGOA 2JAXA 2PKQO 3QKRB 4GS5A 2G76A 1NIPA 4Q1VA 3HJFA 2BEJA 1V3VA 4TMVA 2EKQA 2FXVA 1D6JA 4YRPA 5ABPA 2DMRA 2VPPA 1DIBA 3HMKA 4JHLA 1HQKA 1QAMA 1W44A 2VO1A 3WNQA 3F3MA 1LW6E 1ODTC 2P77A 3DOUA 1K8XB 3GNTA 1M74A 3OT4A 1OIXA 9GPBA 3SYMA 3R3XA 2IHTA 3COJA 2WD7B 2WWYA 1GJRA 4S1WA 2YXNA 2SKDA 4Y2UA 1PT9A 1XP8A 2B34A 1DAFA 1U3VA 4TL9A 3H87A 3A1EA 1NMEA 3V2IA 2BUCA 1EB8A 3K6JA 3IXQA 2B20A 4YJHB 3K0SA 3OMLA 4YMWA 4CGZA 2ZRBA 3D8TA 4KX5A 5AVWA 5SV2A 1AQNA 4YREA 5L7YA 4N8DA 3ZDDA 1FOEB 3ILSA 4LOHA 5DK6A 3WG9A 3JQGA 3OZ7A 3PRYA 4YP1A 1CTQA 1T3SA 1TRKA 3WNDA 5TGDA 1U0FA 1U6JA 4YJFA 1RAAA 4MWGA 3KPJA 3LG2A 1M66A 3DFFA 3JQBA 3MBIA 4A0RA 2NV0A 5E6RB 4C30A 1H9BA 1SHJA 2WT4A 3CH5A 2ONZA 4FP9A 3F8SA 4LJSA 2BKLA 4Y2VA 1BXKA 2HF2A 3U1TA 1NVTA 4EG0A 3IB3A <