5EKUA

Crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
343
Chain Sequence
b'RPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKPKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDISRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLCPEMTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine N-methyltransferase, putative
molecule tags Transferase
source organism Trypanosoma brucei brucei
publication title A glutamate/aspartate switch controls product specificity in a protein arginine methyltransferase.
pubmed doi rcsb
total genus 104
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5ekuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ekuA01
5EVJA 1X1DA 2O0LA 1WXXA 4OBXA 3O4FA 3KR9A 2Y1XA 2NXJA 3IYLW 2EX4A 3OFJA 3REOA 4Y30A 1O9HA 4RVDA 1NE2A 2GH1A 5F2NA 1NV8A 4GBED 5FADA 5KVAA 10MHA 1VPTA 1XJ5A 3G2OA 1JTFA 3SSMA 3UA4A 4C06A 1ZKDA 2YTZA 3K6RA 3SVZA 3LCUA 1G38A 2G71A 3NDIA 3KPWA 1YFLA 3UZUA 1XCJA 5FQNA 2B3TA 1P1CA 3FPEA 2R6ZA 5DX0A 1PJZA 3DH0A 4PCLA 3JWJA 4E2ZA 2ZZMA 1N7JA 2AVDA 5DM1A 3UJ6A 5E9JA 2I7CA 1JG3A 3R24A 3D2LA 3ELDA 3DTNA 3R6TA 4P7JA 3X0DA 2IGTA 3M4XA 2IBSA 4H0NA 4QPNA 5EMLA 4RVGA 3ERCA 4ER6A 2AVNA 4RTNA 3HCEA 4GOMD 4DMGA 4ER3A 3BWMA 1KYZA 2C7OA 1FJXA 3KQWA 3VC2A 2ONYA 3C3PA 3C6KA 1UIRA 2AN3A 1KP9A 2AR0A 3I58A 2EJTA 2ZWAA 3NW9A 3RIEA 4QQNA 3HCBA 2GS9A 3BUSA 4FGZA 3KR2A 4M7RA 1KPGA 2QM3A 3CKKA 1XCLA 4KVZA 1G6Q1 3Q87B 4P7FA 1JQEA 4MIKA 3BGDA 3A4TA 5CCXA 1WY7A 1WZNA 2ZW9A 4FSDA 1AV6A 2P40A 2PGXA 2GAFA 2ZLBA 3F4KA 4HH4A 5DRYA 4X60A 1QYRA 1KHHA 3ANXA 3LPMA 1I4WA 2ZZKA 3B5IA 3KQTA 4QVKA 4XUEA 3TR6A 3SSOA 3CVOA 3HNRA 4RSRA 3C0KA 2Y1WA 5CM2Z 4GQBA 3UA3A 4PONA 3FUTA 4DQ0A 1NW8A 2BZGA 4QTTB 2OY0A 3R0QA 4A6DA 5BW5A 4RX1A 2NXCA 3GNLA 3SR4A 3DMFA 4XCXA 3JWIA 1WS6A 2WA1A 3KQVA 2H11A 1F3LA 2VDWA 4FSXA 5F2KA 1UFKA 3QV2A 2R3SA 2BR5A 3M6XA 5GM2A 3FTEA 4PGGA 5FA5A 1L9KA 3BWCA 4RVFA 2PLWA 4Z2YA 4E2WA 3A7EA 3PLAE 3SMQA 1NW5A 5HIMA 3LL7A 5M5BA 3P2EA 3LGAA 2ZBQA 3KPJA 2Z6AA 2AOVA 2PJDA 2YX1A 3G5TA 2P3LA 3T7RA 2NP7A 3EVCA 3MHTA 2OYRA 3KR1A 1QAOA 2ZFUA 2YUIA 3OU7A 4AZTA 4XUDA 2ZZNA 2Z6UA 4KW7A 2FYTA 1EJ0A 1L3BA 1R8YA 2FK7A 3GCZA 2GA9A 2AOTB 3CJQA 3KQPA 1SQFA 1VIDA 3DLIA 5GP1A 4EVIA 4P7KA 2O57A 4OQEA 3EMDA 4CKCA 5LQCA 3IV6A 2CKDA 1JG1A 1WXWA 3MTEA 3UJ8A 4E2YA 1I1NA 1DCTA 3C6MA 2A14A 1JQ3A 2N47A 2QY6A 3NDJA 5HZMA 3E23A 3EEOA 3TLJA 4OA8A 1UWVA 3KQOA 5EIWA 2NXNA 1YF3A 3B3JA 5FQOA 3AXTA 3KPUA 4PIPA 3GWZA 3UJCA 3PTAA 5LQAA 3KQMA 5K05A 3BGIA 3CJRA 4CWAA 3GU3A 3KPYA 5EC8A 3BWBA 4DM3A 5LQJA 7MHTA 2O05A 4E31A 1EG2A 1AQJA 2QYOA 2IPXA 3TMAA 3R9XB 4FT2A 3E8SA 1IXKA 5IH3A 2XVAA 1FPQA 1XDSA 2BR4A 2OXTA 3HCDA 3V97A 4AUKA 3AY0A 2XYQA 5KQSA 2E5WA 2V7EA 4PINA 2UYHA 3OFKA 2FK8A 5DX8A 2VP3A 1FP1D 4GUAA 4A6EA 3DXYA 3JWHA 2ZTHA 3B7PA 1XVAA 5G02A 2IP2A 4MWZA 2QE6A 4YV1A 2PX8A 5HIJA 1M0EA 5FWDA 2BR3A 2YQZA 5ICEA 2BH2A 3NVMB 1VE3A 2OKCA 5EEGA 1JTEA 1P1BA 2AN4A 5EGSA 1NKVA 2AN5A 5DTMA 5E2BA 3P2IA 5DSTA 4FR0A 2H1RA 5EKUA 3EVFA 5CVDA 2IDKA 5IKMA 4YV0A 5DTRA 3DULA 1YUBA 3UWPA 3T7SA 5EHIA 5E1DA 1D2CA 4AZSA 5K03A 5BW4A 1EJ6A 1M6YA 4BY9E 1JR4A 1ZHFA 2ZWVA 3MQ2A 3PVCA 5DXJA 4EQZA 1ZG3A 3UFBA 1EAMA 1VQ1A 1RI3A 2P7IA 3BZBA 1X1BA 3P2KA 1G60A 3B3FA 4BLVA 3BWYA 3GDHA 2HTEA 3FUWA 3HVJA 4GC9A 1IY9A 3SXJA 1SKMA 4HGZA 2BM8A 4LECA 5C0OE 1TPYA 4EKIA 1KR5A 4RTQA 3OCJA 2VZ9A 3M70A 5EHGA 4AX8A 2OB1A 4FS8A 5LQKA 5EZQA 4PYKA 3ELYA 5CVEA 1QAMA 2PKWA 2OO3A 2P8JA 2NNWB 3SGLA 3VSEA 2AOUB 4C05A 3KKZA 4L7VA 5K0JA 4KIGA 4RTJA 2IH5A 5DM4A 2UZ4A 4GF5A 1F38A 5K8VA 5C1IA 4LWOA 1L3IA 4OBWA 4KRGA 4YUVA 4OX9Y 2VDVE 1N2XA 4OA5A 2ZBRA 2V74B 2ZIFA 3DP7A 4PYNA 3UJBA 2XYRA 2I6GA 3ELUA 1U2ZA 1R18A 1KYWA 2K4MA 3ME5A 4R8RA 5E2AA 4AZVA 2UYCA 1T43A 1SUSA 5HEKA 2NP6A 3CJTA 3HP7A 4WXHA 1BKYA 3OZTA 3BGVA 2PT9A 2YR0A 3P71T 3FZGA 4GOND 5E9QA 5ICGA 1SUIA 4CTJA 2P41A 4E30A 1IM8A 3SM3A 3U81A 3NJRA 1Y8CA 1O9GA 1SG9A 1ZQ9A 3TQSA 1TW3A 2JH8A 5KYGA 5BP7A 3H2BA 1DL5A 2ZBPA 5FWAA 1EIZA 3EVBA 1NW6A 1YZ3A 3BKXA 3HA3A 2ZIEA 2HWKA 4IWNA 4PYIA 4RTLA 3B89A 1I9GA 2ESRA 3IEIA 4GEKA 4U7TB 3M6UA 3GRYA 4XUCA 4RTOA 1RJGA 1R00A 1M6EX 4G56A 4FT4A 2O06A 1V39A 2G72A 1OR8A 2QRVB 5EMMA 3KU1A 5CUQA 3EMBA 1L1EA 3I5UA 8MHTA 5F2OA 3VC1A 3G2PA 2F8LA 3UJ9A 3BKWA 3OU6A 2P1DA 4QDKA 4X61A 2DPMA 5EKXA 4CTKA 1VLMA 3GJYA 3P97A 3TPZA 4RYLA 3FYCA 5K09A 2ZCJA 5FCDA 2B25A 5DM2A 3CGGA 4RVHA 3B3GA 2ZIGA 3FRHA 3OZSA 5T67A 5FHRA 5EQJB 1NW7A 4YUXA 3MCZA 5E1BA 5CIYA 4EK9A 4DCMA 5KS2A 3M33A 3GIWA 3DMHA 2IBTA 4C08A 2B9EA 2JH9A 3UBTA 2OBFA 4DF3A 1JSZA 2EJUA 1R8XA 3EVZA 3K0BA 4K6MA 4PGHA 4RTRA 1RI2A 2Q41A 3LKDA 1O54A 5P8WA 3LCCA 2BM9A 3FUVA 3R3HA 3DR5A 5HILA 5D1NA 4HG2A 5E8RA 2CWWA 3DOUA 3DUWA 4DCGA 2JHPA 4R6WA 4E33A 1YB2A 3L8DA 1FP2A 1JG4A 4PIMA 2HR1A 1P91A 3EPPA 1XXLA 4ISCA 5E9WA 2JHCA 3G2QA 2IH4A 2PX4A 5E1OA 1RJDA 2ERCA 1BC5A 3NWBA 3P9CA 2G8NA 2C7PA 3O31A 1D2HA 2GPYA 2O07A 3MGGA 2PVCA 4RWZA 1KPHA 1PRYA 5E1MA 4P7GA 3A26A 2B78A 4LG1A 4U7PB 2ZVJA 4YMHA 1Q0SA 3T7TA 3FPGA 5DX1A 3KQYA 3LSTA 3G5LA 5HOQA 3A7DA 3FPJA 4RTMA 3KPVA 4R6XA 2PV0A 4PYLA 1XTPA 1VBFA 3A25A 2QRVA 1X1AA 2PT6A 4MQ4A 3PX3A 4EMSA 3HA7A 5EPEA 1ZGAA 2I62A 2PXCA 5HIKA 2G1PA 1VP3A 2OPBA 3GRUA 5EG5A 4MHTA 4X63A 5K0FA 5CVJA 5JR3A 1X19A 3P9KA 5ICFA 1RJFA 4ER7A 4KWCA 2CMGA 5DWQA 3HCFA 4YUWA 4X1OA 4PYMA 5K0EA 4V0QA 5FULA 2EG5A 4EKGA 1RJEA 1X1CA 2YXLA 4GOOD 2PBFA 3AWIA 3I64A 1H1DA 5FUBA 3FPHA 1Q0TA 5FHQA 5CVVA 2FPOA 1MHTA 1JQDA 4IV0A 1D2GA 3DLCA 5ICCA 2XYVA 3UJ7A 5BXYA 1YFJA 3FUXA 4LWPA 3LECA 1KPIA 3QOXA 2LD4A 1VL5A 3CCFA 3FUUA 5K0NA 4DKJA 3KR0A 4PYJA 5EEHA 4FZVA 5H02A 4DZRA 1AF7A 3LDGA 5K0CA 4HSGA 5CVUA 3TM4A 2ZULA 3PFGA 2YXEA 2IIPA 1RI1A 3CBGA 3TM5A 5FTWA 1Z3CA 4GOLD 2H00A 4DA4A 3LDFA 4QPPA 4CXMA 2PWPA 4F85A 3EGIA 4YV2A 5EIFA 1AQIA 3LDUA 3I9FA 2GB4A 2G70A 2UYQA 2OB2A 4C04A 3EGVA 3G2MA 4IKPA 5EMJA 2P7HA 3EVGA 3MERA 1JG2A 1FBNA 3C3YA 3TKYA 5LQNA 4X41A 3FTCA 5DPMA 5GIOE 4OQDA 2HNKA 2JJQA 4R05A 3RODA 4M36A 1B42A 3GRRA 2CMHA 1MJFA 1YZHA 3EGEA 2Z6QA 2VDUE 1TW2A 4QDJA 3O7WA 3PB3A 3G89A 4QVGA 3HVKA 2C7RA 4O29A 2FHPA 2PXXA 5D1HA 3DXZA 4BP3A 1NV9A 1VP9A 1ORHA 3V8VA 4PCAA 1ORIA 4PWYA 1XDUA 3PX2A 4WVLA 1INLA 1SQGA 2WK1A 3MAGA 2EFJA 3BXOA 3TOSA 1BHJA 5T64A 4B17A 3NVKI 5LSAA 3S68A 3G8BA 1L3CA 4HTFB 5DT2A 3GO4A 3SX0A 5C9ZA 4C03A 5GM1A 2P35A 4IV8A 3HA5A 5DTQA 4YUZA 5U4XA 2AZTA 4PYQA 1QZZA 5CCBA 3AJDA 2IDJA 3PT9A 4M37A 3KQSA 3E7PA 1HNNA 2AOWA 2PY6A 4RTSA 2JG3A 3PFHA 4HC4A 5LQUA 1WG8A 5HFJA 4CKEA 1QANA 4RTPA 3DXXA 4CKBA 4E2XA 2NXEA 4FP9A 5E8JA 4QTUB 4C4AA 2XVMA 3HVIA 4PYOA 5EMKA 2GLUA 3OPNA 3OE5A 3GXOA 3G8AA 4HRAA 2B2CA 3NWEA 1XDZA 5DM0A 1BOOA 4P58A 2PWYA 4ZTBA 3THSA 5K01A 2KW5A 5LQRA 2PSSA 2PX2A 3LCVB 3LBFA 3VYWA 9MHTA 2AS0A 2YVLA 2AOXA 3HM2A 2CL5A 2PXAA 3FYDA 3OU2A 1JSXA 4NECA 1G55A 1G8SA 1NBHA 4MTLA 3TKAA 3ID6C 3GGDA 3HCCA 4YUYA 3MTIA 4RTKA 2PX5A 4AZWA 5JUWA 1N7IA 3E05A 3EVDA 3IHTA 3ORHA 3G7UA 4E32A 3UJDA 4YMGA 3SSNA 3G88A 1R6AA 1RI5A 2WA2A 5EOVA 5K0BA 2P3OA 3HEMA 3GRVA 5EZSA 5GOZA 4HTFA 2DULA 3PS9A 2I9KA 2C7QA 2HV9A 2JHAA 4KDRA 4ER5A 1QAQA 3KQQA 1RI4A 2ORED 5B1SA 3HTXA 5DXAA 3CC8A 3DMGA 3OZRA 4Y2HA 5T6BA 3I53A 1KIAA 1DUSA 3GRZA 1NT2A 2ADMA 2ZSUA 3TRKA 2UYOA 5DLYA 5K0LA 5DRTA 3EEYA 3AXSA 4F86A 5LR6A 4V0RA 1SVUA 3UJAA 3A27A 3KHKA 3M6VA 4ER0A 2YXDA 1NBIA 4UOEA 4BLUA 2P3QA 5MHTA 1NW3A 4M38A 2FCAA 5HIIA 3P8ZA 4ATNA 4KDCA 4BLWA 5KQRA 3HCAA 4RV9A 2OZVA 3M6WA 4R8SA 4F84A 3P9NA 5GWXA 4QQKA 2AOUA 3WSTA 3ELWA 5DSXA 4PNEA 5GINE 2AOTA 5FA8A 5CD1A 4KIFA 3FPFA 1G8AA 3OE4A 3NMUF 1HMYA 4GC5A 3HVHA 3MCTA 3Q7EA 3EVAA 2XBMA 3RW9A 2HMYB 1P39A 3LX6A 5K0GA 3T0IA 3MB5A 3BT7A 3LBYA 3LHDA 2IH2A 3FTDA 1ZGJA 3P9IA 3EVEA 5ERGB 2VS1A 1KXZA 3NTVA 2IFTA 2NYUA 4JXJA 3JWGA 4E70A 2FRXA 4POOA 1R74A 3QOWA 1EQAA 3TFWA 3FTFA 2ONZA 4C07A 3THRA 5GIPE 3LKZA 4HGYA 3ER9A 3ER8A 4BP1A 3FRIA
chains in the Genus database with same CATH superfamily
1A8SA 2ZRNA 2ZUDA 3UH1A 2OGSA 2Q3HA 1OYOA 3REOA 1XCBA 3FPSA 4TRMA 1FS4A 1VJCA 4LRYA 3OESA 4RVDA 4DHWA 1MVOA 4DG5A 3TYXA 2WQ6A 2OMEA 4O4LB 1LBEA 3FHJA 5FADA 5CEFA 2ZJ2A 3ZWQA 5JSQA 1XDGA 3D8BA 5I9LA 4UFNA 5DBEX 4DYHA 4D45A 4O2BF 3IILA 4YCJA 3WJAA 2L82A 2VXCA 5FQNA 2Y1KA 1KO7A 4OXQA 2GPNA 1FCJA 1LF0A 3U9SA 3PSHA 2P2CA 4BMNA 3E1GA 4KQGA 4NNJA 1RQRA 2YV4A 2QUAA 1J0BA 4M1WA 2ZJOA 2FVXA 3BMOB 3NYWA 3F7NA 5ANRB 4NDZA 4NXMB 3F96A 4TMYA 5EWMB 2LR0A 2AVNA 1XVUA 3NTUA 2YZ2A 2TMGA 2LP4Y 2O5VA 1JIJA 5L51A 1WVGA 1J42A 2PL5A 5FUVA 5CBPB 1WCWA 1PLKA 3I58A 1XVTA 5C8ZA 1CJTC 1E1KA 4G5FA 1B00A 2FN3A 4FINA 1XCLA 4HLUA 4PBRA 2PH7A 1Z6XA 2JFVA 2DSTA 2FUCA 1S6YA 2H29A 4JC0A 4F3RA 2BFWA 5LN1A 5DRYA 3U0BA 1IY1A 3I9NA 1Q0ZA 2JGAA 1FTWA 2RHHA 3FPKA 4GH5A 4HDKA 2YMQA 2H92A 3B5IA 4NOMA 5DGHA 4OD0A 1NE7A 5JROA 3URKA 1XNJA 3AM3A 5CM2Z 2DQSA 1YOVB 1FQWA 1OAOC 2QTGA 4MITA 2PL9A 1NKTA 3MC1A 1FUUA 4AS1A 1NG1A 3G9XA 2HW8A 1GNSA 4Z7JA 4PBSA 4XR4A 3TDNA 5IHPA 1E2KA 4GKKB 3WNBA 1MX1A 2OXRA 4LY3A 4NPHA 4B2PA 1FU4A 4J0KA 3KKOA 1N0HA 4UMDA 4ALJA 1O77A 2YNMC 5AKEA 1OI3A 1SVWA 2RGUA 4NZZA 1YDWA 5BPHA 3FTEA 2JFFA 3DOFA 4X20A 4WRRA 4CT5A 3ZC3A 3LL7A 1ESMA 4BMYA 1XZQA 3VO9A 4M9XA 2J3JA 3S3TA 3BJRA 3UAZA 4WY2A 2ASVA 3FDFA 4L4SA 2P3LA 4KQJA 1NJ5A 4LYFA 2I1QA 1NQTA 4MKFA 3LRPA 1SVMA 2WD7A 1GRVA 1JG7A 1FLNA 1HT3A 1NU8A 1IN6A 1QG4A 3TRFA 3TZKA 4RF2A 2LWIA 1F1BA 1K86A 1X8XA 3ANSA 3C41J 2DPGA 3GD5A 2AOTB 3H05A 3LT4A 2PRZA 4G85A 4I5DA 3VC3A 1LNQA 3OCXA 5A5VA 3RUAA 4L4ZA 1CCWA 1V25A 3CU5A 4BU1A 4P08A 4PLVA 1QJ4A 3R23A 3VGJA 2AJTA 3RAGA 1W19A 3EFOA 4C7BA 1TVEA 4KQMA 2CNWD 3W1EA 1Q1BA 5EJ8A 4RHEA 4AJLA 3R5KA 1SHUX 1V11B 2PH1A 1OYYA 2RGDA 3ESXA 5ITZA 4DDHA 2CL7X 2XEXA 1RHQA 2AL7A 2JHGA 4QLAA 4CDGA 5LVAA 2FX5A 4XVUA 2NUPB 3KNZA 1M2NA 1XVVA 3NETA 4PPGA 4XEUA 5ARCA 5G0TA 4C3OB 1V8BA 4MSUA 2XOKA 4KNVA 4FT2A 5J2TB 2HNAA 3GUYA 1JEQA 5IYZF 4QGGA 3DHYA 3U0VA 5SYNA 3KUUA 2HCJB 4REMA 4KFRA 4AZ3B 3SE7A 1Y89A 4ALKA 5LP6F 4EUKA 4G1FA 5BVGB 3JWHA 1THMA 4R2IA 1X1RA 5G40A 3OT1B 2A0KA 4OI4A 4WKCA 5FWDA 4XSVA 4D9FA 3P9ZA 4OV6B 1YR9A 4Q1DA 2OKCA 3RRBA 2BEWB 1TJ3A 3NNNA 1H8EA 8LDHA 5I4BA 4CODB 1BFDA 4GOKA 1T2FA 5I9TA 4ZVNA 4CLHA 4H17A 1Z4MA 2ZSFA 4P4TA 4YJKA 2K7ZA 1YR1A 4LV8B 2LNDA 3AR3A 2AE2A 2P6NA 4GLJA 1S2LA 1Q1QA 1MDBA 2QHXA 2VJOA 1DTSA 5F1OA 1U9CA 2IX9A 3CR8A 4FMCF 2Q4RA 3C7DB 3LA6A 2OKGA 3HVJA 4TTTS 1TQ8A 1T6NA 2BELA 3GLHA 4HNAB 3DQZA 3LS2A 4NONA 4AF6A 1EI9A 1V43A 2PGOA 4X62B 3BJEA 1KR5A 2CLDX 3G68A 1RRCA 4ZJYA 1ONSA 1UT6A 3OCJA 4ZFNA 1XF1A 4F9FA 2GDZA 1T0BA 1B0UA 4JBYA 4PYKA 3L84A 3N59A 3P9PA 1CNFA 1GGVA 3GLQA 4DLUA 4FFLA 4HN9A 3VBCA 5K0JA 5JS2A 4J16C 2ILTA 4BV9A 2UUBB 2DHEA 1T3SA 2VL7A 4IRXA 1WU8A 5F64A 3OZFA 1I0LA 4A0HA 3HCPA 1E9FA 2QN1A 2F1OA 1E9EA 4HDSB 2I6GA 3P9RA 2B98A 4FGJA 4R8RA 5BV8A 4KN6A 1NYRA 2A9OA 3OWHA 3PP8A 2WSMA 3D5TA 4TXHA 1DCKA 3A32A 5A1TA 1DWPA 2JIRA 2QX6A 5BQPA 3HY4A 4G0QA 4N9WA 5A7HA 4BP9A 4RACA 3RYCA 1A7KA 3W5SA 4Y98A 1U2GA 2CW5A 1NI4B 3SDZA 1GTRA 2A0UA 5J2UF 1E6UA 3OJLA 2XGGA 1L5RA 1NMYA 3FLMA 3FCSB 3K32A 5TMPA 3VR4D 1FTGA 3V2IA 1PWZA 5TDHA 2RAUA 4GM4A 2IF0A 1MC4A 3GV0A 2OHOA 1DLJA 2OXFA 5FWAA 2HMUA 3HR4A 2C5EA 3F7OA 4XIYA 2K6GA 3G9UA 3TX6A 3QMVA 4NENA 4OJKA 4U7TB 5E3HA 1LSOA 4IILA 1O7JA 3A6ZA 2CDCA 1BCRB 1RCFA 2ZI4A 5IMSA 3I9V6 3RVDA 4EYSA 5HDBB 3OZUA 4YMSA 4Z4CA 2ZSJA 1MXFA 2O1WA 3BG5A 4G2NA 3NAMA 2VUSA 3IAS1 3F6BX 3SSAA 2WD7B 2AF3C 1Q11A 1H69A 1G2IA 2O9JA 1GPMA 2CB0A 1O89A 3I4LA 5AM1A 3BGWA 4AN4A 5K09A 4JH0A 4LI0A 4RH0A 3WNDA 2OLKA 4LW8A 2V8BA 4PVDA 2EF1A 3KTAA 5EXDA 4F8JA 1ESZA 1SUCA 2Q5OA 4D9BA 3IP8A 4IJ6A 1SVKA 5LOVA 2IBTA 3G5UA 3OOEA 3KKPA 1LRKA 1PT7A 2E6KA 3GZJA 3W6UA 1BMFA 1EE2A 4NBUA 2WTAA 5EI5A 5HW0A 1ECFA 4ESHA 3B70A 1RTKA 1RI2A 3E7DA 3LKDA 3QIVA 4I1OA 2W00A 1CVIA 4B48A 1TM4E 4HLNA 2XZLA 1T2VA 5HILA 3DDZX 5D1NA 2H57A 1E60A 1RXIA 1WEHA 2B82A 2FGJA 5C1BA 2WJPA 4MWTA 5HBRA 2H4JA 3W6ZA 2WSIA 1T1EA 3CBQA 3DB1A 3F47A 4MEAA 1PVOA 2D1QA 2VPZA 1ORRA 3EGOA 4OUDB 4EUNA 3R3UA 4QUAA 3A6EA 1IUOA 3WRYC 1LDEA 3A1NA 3SP1A 4JGBA 2GPYA 3ZGYA 3SBOA 2PVCA 2ZRPA 1CIVA 2PIDA 2NG1A 2RHOA 2ZJFA 3A26A 2G4LA 1FX1A 3L7YA 2ZVJA 4ZANA 5TEWA 4HNUA 1RHJA 1EVJA 2B61A 5DHFA 2VCEA 2XB9A 3RTAA 5LU9A 1G3RA 1E7SA 3DMYA 3G5LA 2EU8A 3IKLA 1I24A 2QJRA 2Z2YA 4MA0A 4OVKA 4PYLA 3SXUA 7REQB 2WJYA 1XYGA 3KWFA 3HJAA 1HE8B 4F38A 2D7CA 3SJZA 1KOJA 5EIOA 3UEOA 2G1PA 1C0PA 1ZGAA 3IKVA 1V8FA 3D43A 3PK0A 3UY4A 2Z1MA 1UDXA 3TOVA 1NLFA 3R5JA 5AI8A 4BWVA 1EQUA 2W43A 1X19A 1Q7EA 1ZD9A 2E48A 1COWD 2P27A 2C2OA 4KXMA 1H85A 1U99A 3COSA 2AH5A 2ZRGA 3A4YA 3PR2B 1DIAA 4M0FA 5F51A 4EZEA 1Q1EA 1QHHB 2QNIA 4Q21A 2FN4A 4B44A 3FAKA 2PBFA 2WAXA 4LRTB 2OCIA 4YAGA 4EBFA 4YMVA 3JALA 2ACKA 1ECLA 1C0EA 3ZVNA 1LPMA 3RIYA 3V8MA 1ILWA 4CIYA 3KOZA 1M74A 2RHGB 3UMYA 2IE8A 2ZDHA 3JZAA 3ADDA 1GYPA 1EGMB 3AEXA 4MUBA 2G77B 5CU7A 5D5HA 4J2HA 5KDLA 4D5EA 5EY5B 1GM5A 3AFIA 1OWOA 1NJ8A 3FUUA 3P27A 1U1IA 1KP3A 3CLRC 3Q15C 5KX5F 1N33B 1SVOA 1WKCA 2YCLA 3RAJA 3TL2A 1AF7A 3LDGA 2BFBA 3FE2A 4RA6A 4OXXA 3TKLA 4Z9FA 3SN6A 2PZLA 4IFEA 2X9LA 3BILA 3E9CA 1XL0A 5FJJA 1FFSA 5KKNB 1XX6A 2H00A 1KSHA 1YIOA 1PFGA 4V0NA 4D4IA 3QVJA 5K4GA 1XQWA 1SBYA 3EQ7A 2GB4A 2NT3A 2WU3A 3CXUA 1CQWA 4PSDA 2FXVA 1TEHA 2VDQB 1R0SA 2ZBFA 4QBIA 4F9GA 3ZDYB 1LJUA 3GFTA 3C3YA 5HMLA 3U3XA 2YIDA 1SH7A 3BE8A 3BH7A 4LXYA 4NPAA 2IS1A 1JJBA 2UKDA 3EGEA 1UF9A 3K70C 3E81A 1HTBA 2VXBA 3WLFA 4O29A 3JASA 4G1VA 1NV9A 1P9OA 3EZ9A 1I0IA 3D59A 3AMVA 5CJ2A 4BZWA 1I36A 2H2DA 1T1JA 5MFPA 1CU1A 1VHQA 1L7VC 3FYTA 3L8ZA 3DZCA 4M8LA 1M2KA 1R8SA 2ID7A 2V98A 2XH8A 1PQYA 2ZWMA 3IVGA 4K81B 1S2GA 3SDSA 1HSZA 2VCHA 5DOZA 4MUYA 3TJRA 4FFBA 2C20A 1H9BA 1X13A 4AUNA 5C37A 4OUKX 2BE9A 3C24A 5D3MA 5JDCC 3M1AA 4N3GA 1P8AA 3NTLA 3WYNA 5BV1A 4PNHA 3L7OA 4FCCA 3SM9A 3ZE1B 3MJSA 4C3VA 5IWCA 2Q8PA 1Y8RB 3SLRA 2WSYB 1Z4LA 3H0KA 4ZHSA 3E9YA 1J9EA 5ALDA 1ITZA 1WR8A 2XNCA 3R41A 4W5RA 4MK4A 3AG5A 1P3DA 4KJXA 1IZ7A 4RJJA 1VA4A 1T3ZA 4ND3A 1SD2A 2VAVA 3L0YA 2XOXA 4C4AA 4L0CA 5DLDA 2G1UA 1XD8A 4O4HB 1K6XA 2P2LA 1BDBA 1SBTA 1BOOA 2XSZA 3INRA 3W2HA 1Q6ZA 1UBSB 5TMEA 1BEEA 2ECFA 3M6IA 1EHIA 4HBZA 4D9JA 5EXXA 3GDFA 2KBFA 2IELA 4DZTA 3SC4A 3GP5A 2AX4A 2DLNA 1P7VA 2B37A 3MYRA 1MJHA 3I52A 3N87A 3CZ5A 3S1AB 3VYWA 5K2OA 4K9MA 1V16A 3RU9A 5YASA 2EL9A 1O8CA 1XC7A 3K15A 2VDLB 4JT8A 4PG8A 2HSGA 5KWSA 3ZNQA 4HDMA 3W2GA 4B3BA 1Y9ZA 5KCMA 3ZIAA 1JHVA 1H05A 4YUYA 4ZT7A 3MTIA 3R9IA 5KYUB 2O7SA 5CYPA 2DE0X 4QQ8A 1JALA 4K28A 4DGQA 1U2TA 3QTBA 2QW0X 3AYXB 3RFCA 2Q3MA 4MVYA 1SPXA 4UE6A 1B6GA 1QYWA 1R6AA 3HXPA 5K0BA 1KP2A 3C43A 3U62A 3QX3A 1KI4A 1TVKA 4GU5A 4KBYA 5BNZA 1XT6A 2ZTUA 2EERA 4PXAA 3T7KA 4RYDA 3HJHA 3TJZA 2DULA 3WMWA 2ZYVX 2Q7XA 1VHDA 3A28A 4MX8A 1K8RA 1QAQA 1TMGE 1W2WB 2NTVA 4FOPA 2X0EA 3S0JA 4M6WA 2C9CA 1ZD1A 2IL1A 2P9FA 5T6MA 3RD5A 3WL3A 3U4AA 1JAHA 2LDBA 2F00A 2PJUA 1R6UA 3SJCA 3I53A 1W36B 1PGJA 4V0KA 1FS6A 1K7XB 4BFXA 4RLHA 1T8YA 4MQFA 1GU7A 2UYOA 1ST3A 1EBFA 1Z83A 3BIWA 3BWDD 2PA3A 3RWMB 5MGNA 1XMQB 1T15A 2SICE 2V03A 4F4CA 2LUOA 2E1RA 3MWYW 2XNDA 3H9JA 5ITVA 4Q15A 4M0PA 1Q7CA 1E0KA 1U9YA 4N5DA 1H4QA 2PVSA 2V7BA 2I67A 1Q3HA 4TKLA 1PP4A 4RGYA 2R7MA 4YK7A 4WASA 1HL3A 3KFVA 4I36A 4GRIA 1BNCA 1R9GA 2V9PA 2VRWA 2PS1A 1OAKA 1G8MA 4PZ0A 4G4GA 2IPMA 4WIAA 2I80A 3MMNA 5ELMA 2DFLA 2VSQA 2YFYA 3WO1A 4EJSA 1G98A 1R0XA 2HDNB 3PNSA 5EP4A 3HKCA 4GPIB 3T0IA 5AESA 5KYXB 2ORVA 3WZMA 4MWDA 3EVEA 4TXNA 2VS1A 4P0TA 3O26A 4HNRA 3JWGA 3U13A 1WETA 2ON6A 4DW8A 4ADSG 5AH0A 3LZDA 2FUEA 1ZGCA 3WE7A 4BMPB 3GGCA 3RYFA 5EVJA 5IM4A 5FNVB 2F43A 1MENA 2VHVA 3IIEA 4CMEC 4W82A 1WLSA 2WVGA 1WCXA 2VNKA 5IZ4A 3EPLA 2C7GA 2GCOA 4HD8A 2O3SA 4R0MA 3ICOA 1QKJA 1ULUA 4MUJA 5CFMA 1JB1A 3KWJA 2YL2A 10MHA 3G2OA 1V9SA 1W44A 3CX6A 4H1HA 2AI3A 2G9ZA 1NM5A 4Q48A 5BVGA 2DWOA 3DDSA 3M6FA 4YR7A 2G1JA 2HFJA 4DQLA 2D7DA 2XY4A 3RKUA 3UXEA 2B9VA 3CSDA 5DX0A 2VJYA 4PCLA 2AMVA 2A5GA 5JNVA 3PPXA 4AO6A 4ASUD 4FN4A 4EECA 2I7CA 3GUVA 1U7UA 4HVTA 4LF7B 1N9GB 2REXB 3Q2OA 5F9FA 3EPKA 4B35A 3FETA 3RUDA 4MMXB 3L4JA 4MI9A 4GW3A 4DCJA 5C8YB 1T9KA 2QUBA 4J3NA 4DLAA 4N5LA 4HB4A 1UWCA 5IJ0B 1FDRA 1T0IA 3O47A 2IXTA 4HTAA 3KQWA 2WP8J 4E4TA 4CMBA 5JSYA 4Y2UA 3QELA 4QQNA 2GS9A 3D1JA 3SNHA 3QXJA 3U3DA 4YO8A 4D81A 4A91A 4IP0A 5BY2A 5CPBA 3X2SA 4PC2A 5FBZA 2ZJ4A 1EDDA 3L43A 4Q4AA 3Q6MA 4GI5A 4E5MA 3K1AB 4XUEA 2FSFA 3C1UA 2OD2A 1A1SA 4TRNA 4LMRA 2WYVA 2WUFA 4B85A 1L5GB 2ZBGA 4YAIA 1DIBA 4P8RA 4JMPA 3DKVA 3Q7SA 4ZU1X 3ROQA 3QBTA 1SXJD 4U02A 4EG6A 2CJWA 2FY8A 4CG3A 3L6BA 1JA1A 3E9QA 1RQ7A 5A02A 3LL4A 5B58T 2H11A 1V7ZA 2R66A 4N12A 1UBCA 2RBGA 2YVAA 4M49A 3DD1A 1SQSA 1YOBA 2JFHA 4JHXA 4QOSA 3VV3A 3ROXA 1IU9A 3D6UA 2GJ9A 1ZRNA 1SCAA 4BE9A 1XRPA 1M8GA 2NOAA 2IU0A 1NW5A 3WFJA 1Z6ZA 3AY3A 3G2LA 1ND6A 2GBGA 4YIKA 1U8AA 3HZOA 2REQB 3O9ZA 1T3HA 1GTZA 1QNLA 1FP6A 1U7DA 2YASA 3DMDA 3HBLA 5FBQB 3JS5A 1NSYA 3WY9A 1G7SA 4FMCB 4DQXA 3KR1A 1R9MA 4DT1B 1NMXA 2PT5A 2UZ1B 4MGYR 5T4EA 2Z6UA 2UVPB 3GRAA 5B55A 1BQ4A 2YDYA 4KYUA 2HLDD 4QPZA 4CM8A 1AKMA 4M8KA 3PRKE 1L7NA 3CJQA 1DVRA 3DLIA 4AT1A 3ZJTA 2Q1WA 4G63A 4OQEA 3BH6A 3ESAA 3DTVB 2ISQA 3OAAD 4LNHA 4BCDA 4B4DA 4HEHA 5I47A 3ZIDA 1D5CA 1RQXA 3F67A 5DNAA 1TI7A 2G09A 2JLQA 4RZUA 1W5TA 3TTUA 3KAQA 1J70A 5LBIA 3VKFA 5BQXA 1W4CA 4U2GA 2IZ1A 3EZXA 4HJRA 2V1UA 2JIOA 1N3IA 3N6RA 4L0DA 4R98A 1NBME 3R6DA 1WB9A 1HOXA 3BGIA 4DM3A 4TYNA 1JE1A 7MHTA 1GEEA 2IXFA 1JQBA 4FOSA 1JBQA 1EG2A 1U1EA 1Y3FE 3MCUA 3ZU4A 1NQ5A 3SICE 2Q9AA 5FFNA 4A8JC 4YMUA 7REQA 1RWQA 1IXKA 4LSMA 3JY6A 1XTKA 2BR4A 2C92A 3KS9A 2NU9A 5KQSA 2ZE7A 1BDJA 1PJCA 3GEHA 1OBVA 2ZJ7A 3B78A 5AVQA 4ZP1A 4R7TA 5B2ZA 1U8EA 2JB9A 4UNRA 3L5KA 2CDRA 4Q19A 1P5RA 2X8AA 2WEKA 2C8JA 4JUDX 3RS5A 4DA6A 1KDVA 4FMDB 4YV1A 1DAOA 2NLOA 5GAJA 1MAVA 1Q1NA 4O2RA 5KOIA 4LDNA 3KT3A 1KEPA 2XUPA 4LC0A 4X6XA 4TTVA 2B6NA 2VOEA 4BVFA 2E55A 4XX1A 4YCNA 2O8EB 3TH5A 2HU5A 1ZUNB 4PFJA 4PX2A 4CN8A 3V1KA 4WOCA 4EWLA 1JZQA 3UWPA 1VIAA 2QYHA 1YS9A 2A9QA 2GKGA 3LD9A 3N0RA 1BDIA 2CDNA 5B6IA 1EFPA 1FFDA 4D8XA 4QG7A 2G5CA 3DBVO 1JPJA 5FEUA 3R3SA 1KFEB 3KOYA 4M54A 4P2GA 1C50A 4XKJA 4AF7A 2ZWVA 1KVRA 1I5EA 4QXPA 2C96A 5DHUA 3AP3A 2H1WA 3PHBE 2DRIA 5FR1A 1MB0A 2Q0HA 3GDHA 1Z88A 2BFNA 3QI2A 4M8NE 3QM1A 2KWIA 3Q4GA 1KI8A 4N03A 5M2QA 1I14A 1P9NA 3NHJA 3ZI4A 4C7KA 3FHOA 4NHEA 3BD9A 4DLSA 4Z1OA 2HMTA 3GGGA 4AX8A 4P7BA 2Q3JA 4RM2A 2CLHB 2JGIA 4MW0A 2HSJA 1GG5A 3NATA 1TT7A 4UUMA 4IXTA 4LF5B 1XMPA 4PRLA 1Q77A 3GEPA 3O1JC 1TYZA 2IUYA 2ZRDA 1KMIY 1CRZA 3ECCA 3O4RA 2AKYA 2BSAA 2BI8A 3SI7A 2OQRA 1FYFA 3O7MA 2V0NA 3T06B 1VIVA 1R1DA 2RB5A 3CVWA 2VN8A 1ZISA 3MPUA 4K86A 5DP1A 5JD5A 4MIOA 3PQ6A 4BEWA 2BJWA 1KEKA 1YRWA 2PTGA 2WF7A 5FBLB 2ZR8A 1MJGA 5E3IA 5EIHA 4KITB 3TRDA 3GEGA 2BKVA 2YHIB 4Q6BA 4DYVA 4KVAA 3OTGA 1KVQA 3FNIA 1Y8CA 3LGXA 3MMZA 4PPYA 3T12A 4WL0A 4CFYA 1OH8A 4XGRA 1ZQ9A 5JS1A 2MOKA 4KE8A 2GM9A 4R1OA 3TQSA 1EWVA 1ORTA 1TCAA 2WKPA 4L4YA 3MERA 1A0OA 1DC6A 3UV7A 1QNFA 3U7JA 4EY5A 5KYTA 1N78A 1RPTA 3D02A 2IITA 3T3NA 4OHFA 8ABPA 2W2LD 4M3NA 1RJGA 3MWJA 3ZCTA 4QTYA 4Q4HA 4UBKA 4BATA 4LOHA 2O8CB 2GXAA 3NUZA 4RHUA 5CUQA 4B82A 2G9VA 4M1QA 5AT1A 1DQYA 2UZIR 3ANMA 1L5YA 1YZNA 1ZCAA 3F71A 1KY4A 1TU3A 3VC1A 3EC7A 4KLRA 4WNAB 3IAHA 3UHAA 1J23A 2XUJA 1E6EA 4BFSA 3VVLA 5HQ3A 4W7HA 2B25A 5KUTA 3LG2A 2F8TA 2XRZA 4GI3A 4O4JB 1U3TA 1TUBB 3QYFA 4M1OA 4O5OA 3IUYA 3RPEA 2QP9X 2ZI7A 3IP5A 4LGCA 3FWYA 4M89A 5ADUS 2IX3A 5FNVA 4ID3A 1NMSA 1RXCA 4KI0A 3T9DA 4EUFA 1H4VB 2XUFA 3DLPX 3IUMA 1TUBA 2RH8A 2Q41A 3OJ0A 4JLWA 4DR5B 1CJCA 3ZD9A 3R3HA 2WFAA 2KBEA 2W90A 1CZUA 3BDIA 4IYRA 2PYDA 4JS0A 2AMYA 4KAXA 4NRDA 1W75A 2OCDA 2ORYA 3JRWA 3V7FA 5K0TA 1U28A 4R9SA 4UKDA 1JLHA 1UK7A 3B6KA 2GASA 1ND5A 4ZXFA 2J9ZB 1TVMA 2PM8A 1EEHA 1DXHA 1KAHA 3AYZB 4KZPA 1O97D 1IK4A 2ERCA 1EP1B 1M54A 1UXIA 4AAYA 1GIAA 2G6BA 1W29A 3GRFA 5F1YA 1ZIDA 5TRTA 1L5MA 2CNDA 2EGHA 2WFZA 3JQ8B 3O31A 3PUKA 4I6JA 3T1VA 5KKCA 3MGGA 2FOXA 3OG9A 1YDEA 4J9UE 5CVCA 1G7TA 3U17A 4DXAA 2XXJA 4J75A 1GUBA 3NFRA 4MUNA 3RBAA 1M0WA 5CFNA 4LTNA 2SCUB 1Z5NA 2DR0A 2VHJA 3KPVA 5AKHA 3B9QA 4XASA 4LBWA 1MORA 2WUWE 3DLBA 4J0FA 2JCVA 1D8AA 3BVPA 2YCBA 4RMHA 1OGIA 2UU9B 3EEBA 1W9HA 3QU5A 3KJEA 1JHQA 4QHSA 2YZKA 4Y9UA 4LE2A 3CLTD 3K73O 1CE8A 4G1EB 4P54A 4HEJA 1D8TA 2DETA 2Q1XA 2DFTA 1XDDA 3HCFA 5C81A 1NRXA 4OGWA 1H4TA 3A1FA 4D57A 1W5SA 1K5GA 3AWIA 4G9BA 2VPWA 1EP2B 2G5PA 4OOFA 2PUWA 4NULA 2NUBA 2FPOA 3A6GA 4YJGB 1GZ6A 1KQPA 3MUEA 1QV9A 2PO5A 2NZJA 3T7JA 5LWHA 2GR9A 3P0RA 4BKRA 2I3GA 3V4FA 5HJEA 2A6PA 1CQJB 1Q50A 2VYQA 1BU5A 3D8UA 3EGDB 2I0FA 1CDDA 4OAQA 4F6RB 1M2VB 2FQQA 3A9TA 5BOSB 1O95D 4LF8B 4XDGA 2NTJA 1I94B 3BCUA 1FLDA 4GLLA 1XGKA 2ZUFA 1Y6ZA 3FPBA 4GXRA 4XFJA 2COKA 5WRFA 3FOWA 4OLBA 1JQ5A 1KDRA 1J20A 5TQ2B 2CFCA 1GXSB 3WQQA 3EXG1 2BZSA 1NIJA 3PLNA 1UDBA 2VZLA 3CG0A 3EGVA 4G1UC 5GGYA 5HMMA 3D8NA 3KQKA 1OYVA 3NB0A 5FWXA 1XELA 5BRAA 1QYIA 4TV8A 4M36A 1E9RA 5FXMA 3DZKA 3I1YA 4D9GA 3PR3A 2FR1A 4B3HA 4DA8A 3UPDA 3RJTA 4HXGA 3K1AA 4PO3X 2BMFA 1EGHA 2WTBA 2YYAA 1ZCBA 4BKMA 5IHXA 4XWWA 2JCSA 4L5JA 4ARCA 3K6SB 2BZ0A 3B5JA 4K6FA 5CHYA 3VTAA 3QNWA 5C4MA 3RTDA 3V8VA 4G81A 4ARZB 2J3EA 2XQKA 3MAGA 3PXBA 3QKSB 1ENYA 5DFAA 5JI2E 5J2TF 2E87A 1FOEB 5G4KA 3QOYA 3UHFA 1ABFA 1YQWA 4Z3KA 1SWWA 5CB4B 1NONA 5DI9A 2OXIA 3U2QA 4ARZA 2X0FA 3S68A 1Z39A 4OHWA 4R81A 1OHHA 2FGKA 2VP6A 3GO4A 4LDQA 3EDRA 1M0SA 4QDZA 3W8FA 4DCUA 4DIKA 5JW6A 4IV8A 3W77A 1A5ZA 2YV3A 5G41A 2C61A 1W96A 3U44B 1PWEA 3PD1A 4RMNA 4M37A 1ML4A 1F60A 2REQA 3E7PA 3GYBA 4NYIR 3V4RA 3HEBA 4M1MA 4D3DA 1NVWQ 1XU7A 4NAVA 2JG3A 3PVZA 3TOXA 4EP1A 3C70A 3PTLA 3AHFA 1C30A 2ZT8A 3DQPA 5KU1A 4E2XA 1R4NA 5E6RA 3B9BA 1YB4A 4CMKA 4FFRA 2FEPA 2I7TA 4UE3S 5HA5A 2P6PA 4V0SA 2GRUA 4XGIA 1EVIA 2O8NA 2VF5X 3FCYA 3IR7A 4PZUA 2VQEB 5F77A 1KRHA 1UEIA 2XGSA 1GQRA 3ODPA 3HZRA 4OLJA 1NUSA 2BFOA 3ISTA 2ADOA 4ZVLA 1MRNA 2KW5A 2Y1EA 2BEVA 2PSSA 1T2CA 4KLZA 3TTVA 1P6QA 2XA9A 4J0IA 1R4AA 1TAUA 3FYDA 4XYMA 3BQMB 3EMVA 3HY6A 4RDHA 4N0QA 2I87A 5FFMA 1M75A 5FUYA 4N5IX 4MVXA 4TMVA 3LWZA 4YP9A 4CQLA 3P32A 4H7EA 2C83A 3NANA 2YXBA 3GPLA 1KSJA 3Q0TA 3SBDA 1GTG1 2C9BA 5KYXA 2JS7A 4RLQA 4Z7QB 3QPDA 3D6VA 5EAIA 4QPDA 2BKXA 4QFBA 2ZCUA 1GY8A 3QBEA 4ITVA 4DY6A 4P5PA 2X13A 2Y3IA 5HZKA 4YJ2A 3CRNA 4MINA 4R1QA 3OQNA 3LQ1A 2I2BA 4G26A 1HR0B 2PXHA 4MUFA 4BJHB 2X5OA 5CRIA 3VR6D 2WT8A 3DL2A 1VDZA 1TK2A 4WXYB 1XZHA 2BJHA 2XTJA 1CV2A 4G0XA 2AZDA 5F1KA 4WECA 1RCTE 3R3WA 1VZ2A 1KFCB 2JD2A 2Q3FA 3AUSA 4IUCS 3OTOB 1CW2B 1OIXA 1KXJA 1ZCFA 3L0BA 4P3NA 3UJAA 4C0JA 4ENWA 3TTWA 2YXDA 2MSCB 2B4KA 2P11A 3EIOA 4I1YA 2VF4X 3A11A 3C6YA 4LQ4A 1XOIA 4B80A 4QAJA 3T5CA 2ATEA 3SJAA 4L5YA 4MVCA 3RSCA 5CFPA 1IWPB 4FFWA 2C3UA 1CUHA 5ESRA 4PNEA 1KA9H 2QK4A 1E4OA 4QELA 3JATB 1GPYA 1UXJA 4S1OA 4DXHA 3ZXUB 2GA8A 4ALNA 3C3DA 4MJ3A 4WFQA 2OTCA 3OE4A 3ZDDA 1SFRA 2GPWA 4GBGA 4R9RA 2WWRA 3BXXA 3TPFA 2WWXA 1NF3A 4A8HA 9GPBA 3ODGA 2IY7A 1XZJA 1V5EA 1P39A 421PA 4MUEA 2PLNA 5ISMA 1NAHA 3PXUA 1BN7A 4DDVA 2CCJA 3LHDA 2DY0A 3FTDA 3DMTC 4PYRA 3I5YA 1VLJA 4B0PA 2C4KA 2ZRCA 5AW8A 3L4SO 4EB0A 3DW3X 1QSGA 4JXJA 4OQLA 1B0AA 1RHKA 1W6RA 2ZP1A 2EJWA 4X7MA 4JQCA 4CF3A 5GIPE 2BHSA 2C2WA 4HGYA 1WPQA 4G86A 5DW0A 4ENSA 5L4LA 4ZVOA 4RORA 1XZFA 3ZVMA 1WDTA 2PUJA 1XZEA 3IYLW 4LNUA 4X6UA 2KQUA 4ITRC 1DC4A 3B6ZA 3T7AA 3CNLA 3VX3A 1WB6A 1E9SA 1ZGGA 1MH1A 2GH1A 2R7KA 4WKPA 4UEKA 4EARA 1SCIA 5F52A 3RVPA 4LJKA 1XN1A 2JW5A 2QYSA 3E53A 3WWEA 3G2HA 3ZK7A 4Y2TA 3RS0A 4YV7A 3EWIA 1C1DB 3I04A 1FNCA 2WC1A 4RA9A 1TL7C 3OUUA 2BLNA 1N5MA 4AN0A 3OLCX 4ZCRA 4C21A 4HNAA 1M1ZA 3UN1A 1EQ2A 2ZRBA 3GFQA 3CIFA 4J1TC 4HVAA 4H9GA 4KDEA 3L1VA 4LZZA 3TLEA 5KTRA 1PT9A 1X8KA 4KH0A 4NFSA 4ON9A 1WCV1 1ANKA 5E9JA 5I51A 1HFJA 3HDJA 2RG7A 2JAOA 2JZCA 3JCZA 2HBRA 4QU9A 4NPCA 5KIAA 3SXPA 1AGRA 1XZIA 3C74A 3OT1A 5E7QA 1L5LA 3HU3A 3N2LA 3NONA 4ZJUA 1SKYB 5JCZA 2HDHA 2SCUA 4DMGA 5CGQB 2C9MA 4C2UA 2DKOA 3EOBI 3GJ6A 1REQB 1Z5WA 3DBRB 3L79A 1IXYA 2SECE 2PFGA 3L0SA 4D56A 1GZHB 1JWBB 1SU4A 2QZSA 3VNBA 1BDHA 5LQSA 1NQVA 4DV5B 4AJPA 3CKKA 5IRCD 1F8YA 1HKUA 2QU8A 1X7HA 1FP4A 2EP5A 3KT8A 2ZW9A 3GVXA 4LJLA 4WWHA 3RJZA 4AIRA 1TKCA 4BNWA 2OO5C 4AG3A 1A9SA 2ZIXB 3GMSA 5LIRA 1JDZA 3GC6A 2GTIA 1GADO 1YHZA 2KI5A 2ZZKA 3P9XA 2ZM5A 2YJ4A 1BEZA 4EDFA 1MKYA 3IQDB 5ALVA 5THKA 1QIEA 2EAUA 2GXSA 3OOWA 1VBNA 1K6MA 3OLQA 4PONA 4Q0MA 3VKGA 5K51A 4A73A 3FYHA 4JK3A 1ODSA 1O3YA 4U7GA 5KSOA 5JTUA 2AYYA 5JATA 3OSUA 3VU9B 2DAPA 2Z09A 4O2AB 3G8YA 3LRXA 3QPVA 3GROA 3MCWA 3PXAA 3WYCA 4A15A 3IAM1 3U40A 2FMXA 3SMQA 5HIMA 4KX3A 1RAIA 3P2EA 2IEZA 4JB8A 2HA3A 1UMDA 1NJGA 1PTJC 2I3DA 1JR3A 1B6SA 1EM8B 2HRDA 1H2FA 2QAGC 2QTVB 2YX1A 3QMPA 1B43A 4K7JA 4MW7A 4PTZA 5K0SA 2WIBA 2G88A 4MQUA 1OFGA 4X7RA 3RCBA 4CG2A 2HMSA 1TZCA 2Q5JA 3OU7A 4AZTA 3HJTA 4N0EA 4CM9A 1BWRA 4YP0A 5J40A 3VR4A 2GA9A 3A1VA 4EH1A 5L3QB 5J4LA 4JV5B 4ASUA 2D4HA 4PS0A 3TF5A 4E09A 4UQOA 1EGVB 4KQ6A 3WLAA 2HY7A 1S4MA 3F5FA 3GFVA 4Y3UA 1QWOA 3HNOA 4Y9TA 7YASA 1YZQA 1ZICA 1W0KD 1EBBA 4JJFA 1TO1E 1TB4A 2J0VA 4YDRA 1UWVA 2Q7DA 4MARA 1FYWA 3EF3A 2VKTA 2NTYC 3P19A 2VQSA 3S55A 2EARA 4CUZA 3PTAA 3DUFA 3NORA 1M7GA 4I50F 5FOTA 1HRDA 2IYXA 4MVJH 1GA4A 5EC8A 2ZE5A 3I01M 2ZRQA 1MG5A 1ZOOA 3LT0A 1URPA 4KQKA 2Q4DA 3RYTC 3VR3D 1W36C 4INOA 1JU9A 4I0WB 5IH3A 2V7UA 1OU4A 4M46A 3JX9A 4X8OA 3LY7A 1TJ5A 3LPLA 4BVGA 5B1YA 2NU9B 2VRCA 4L0QA 4N8SA 5KOHB 1CZRA 2C03A 1F9AA 2OXCA 3ZD7A 1UOPA 1A8PA 2I4TA 2QD5A 3OOHA 1XVAA 5G02A 2I5PO 1ZMOA 2PSDA 1BW9B 1T9DA 2R47A 4ZVUA 2JLSA 4D3SA 2H1SA 1NTRA 2Y6UA 3OQJA 1EE9A 3OQIA 5KZMB 4BFYA 2FPWA 1GFZA 5E2BA 4HNVA 2VYVA 4H31A 2D6FA 4MI1A 1IHUA 1EEXB 3MGCA 2PKCA 3Q6IA 4N7BA 1DRKA 3MRSA 4HRVA 3R8FA 4LDAA 3IQIX 3BMOA 3TI7A 3VH3A 4BKOA 2XNDD 3EBLA 1R15A 4QATA 1K97A 1NASA 1IB0A 3PVCA 2C29D 1G63A 5AKYA 4CKCB 4EQZA 2D5BA 1CBUA 2JKZA 1EK2A 1QYDA 3K35A 3P2KA 2PUCA 1YHNA 4NDAA 2ZJ1A 4BLVA 3AEKB 4AY4A 1SZCA 1SKMA 1K9VF 1T26A 4GOXA 4BEJA 2MINA 4MWEA 3NV7A 3OI7A 2CSXA 1G1AA 4WZZA 3TQTA 1VJDA 1CUJA 1WIWA 1WM1A 2XEDA 1FNSA 3N7AA 2QPTA 4FGLA 4X94A 3ITKA 4WKGA 2OO3A 2QTAA 4J7UA 1B74A 2ZTVA 4NAUA 4F3KA 1DBIA 3ZGOA 2C1ZA 1I3KA 3LSYA 3ZHBA 2CYCA 3SQOA 4TWAA 3QHAA 2BIFA 1LPAB 1S8NA 2R79A 3FIUA 5DIZA 3GXBA 4YUVA 3BQNB 3HBJA 1N2IA 3MS7A 4JBLA 2MYNA 2ZIFA 3NUQA 4EABA 1XI2A 3WSVA 3I6QA 3ETGA 5HJ2A 3VI3B 2DPHA 1LD3A 2HWXA 3HLYA 2MWMA 4J3JA 4B2LA 1WNTA 5KYVA 1KEZA 3QEAZ 2QSYA 2XT0A 4Q18A 5CJPA 3ZIUA 5IK2D 3QE9Y 3KD3A 1LPBB 1F0NA 4DUGD 3AINA 2QOEA 3SZMA 1F2DA 1M0TA 4NFYA 3DSRA 4TTAA 3W8DA 1R16A 2QMHA 2TS1A 2D8AA 3GL9A 1U2RA 4OYHA 5GJBA 5T3YA 4YRLA 4HB0A 4X8HA 5ALMA 3DLTA 5KX5A 2GARA 1BH6A 1DAMA 3RRXA 1JEOA 4FHGA 5DMXA 1GUYA 5TC4A 2ZIEA 3E70C 4U9IS 1C14A 3LA8A 4XGQA 2HO5A 1KYYA 1VIYA 2QZZA 2YWCA 2BZ1A 3F6CA 3M6UA 4IM7A 1RYFA 1UCFA 1E6LA 4BRUA 2RGRA 1GXSA 5KC8A 1KIMA 2NAFA 2VAWA 4NU6A 3HB4X 1NG9A 3KU1A 3NOQA 3EMBA 4EGQA 1W9MA 3LYHA 1R0CA 4BQFA 1G21E 1DBWA 4Q7MB 1E1DA 2D2XA 3PQ8A 3UMFA 1C3XA 1JXMA 1RXYA 2M6RA 4RXTA 4FQ7A 3ZWMA 3M1LA 2RCYA 3VDXA 3ESYA 3HKEA 3IMKA 4WKOA 1DI0A 3JR7A 1M8JA 3FOAA 4IQ0A 3LV8A 3RABA 4AMUA 3ZHXA 1KYIA 3CGGA 1SXJE 1ZNZA 1S3GA 1ZJ6A 3EARA 3FWHA 4RMJA 2OHGA 2OFOA 4U6NA 5GONA 5HYVA 1HG0A 2XF8A 1PT5A 3D3JA 4XQCA 3QVUA 5DWVA 5H80A 4DCMA 3TZQA 2GOYA 1VXOA 2WSBA 4R8VA 1WP4A 3VR1A 4PGHA 4PQYA 4K6MA 2V0GA 1O2DA 3IE1A 4KN5A 1JEEA 3QYAA 3DR5A 3NQ41 3R5FA 2CWWA 4OH1A 3UC5A 4BE4A 5IVHA 2XMRA 3ZWPA 2HI0A 4GM1A 2Y71A 1B8VA 3GF4A 4IJ5A 3U49A 3BL8A 4PIMA 4GT1A 2TMYA 3JQPA 2D0DA 1ZFNA 3AKYA 3ZQJA 4YRBA 3UCXA 2VT3A 5AOCA 2IQ5A 3VXKA 5DHRA 3HO6A 3FGNA 3PQ2A 4FCWA 5F7OA 4IX1A 1BD3A 4XOUA 3R9WA 4LSZA 1X92A 2PK3A 3V8BA 4BCCA 2KB0A 2O07A 2HA4A 2GRJA 2DHRA 3MTQA 4CEJA 4QG3A 3TDMA 1SM4A 4DCOA 4J4TA 1IN1A 4ZJZA 4HQNA 3COPA 5CK5A 1N2BA 1BX0A 1MO6A 5FBHA 1SAYA 5B64A 1YQEA 2WAMA 2RSLA 1N4AA 5I7EA 3HADA 2PBLA 2XD9A 3RIHA 2NSYA 3O2JA 3R77A 3WL5A 4D3ZA 5J58A 2PT6A 1FVXA 4RPHA 2BTEA 1QHIA 3GCWA 3GJTA 2IVFA 3A1EA 4KODA 4P4NA 3PHGA 4EA8A 4NMLA 4ENUA 4YQFA 1QTQA 2P9TA 1L4LA 1KO4A 4HNSA 4PS1A 4MHTA 5K0FA 2RHDA 4QBFA 4K6CA 2WJ3A 2DVMA 4DV3B 3ULKA 1NI3A 1OWLA 4BECA 2BDUA 4XPIB 1JBEA 4EKGA 1H9AA 2G1AA 3KKKA 3O95A 1KO5A 4L27A 4NI5A 1JIKA 3V2HA 1H1DA 3SQDA 5HKOA 3GJZA 4F3CA 5CB6A 1Q0TA 1QH0A 3IDAA 1ZJWA 2GERA 5CVVA 2ECQA 1KH3A 5BQFA 1MZVA 1CD5A 3N76A 1Z45A 4NATA 1O6FA 4EFLA 3KALA 1CC1S 2QM0A 1YFJA 2IYUA 2QG4A 4UEQA 4BLQA 1LLUA 3OX1A 3EYAA 4O2AA 1FY2A 1UMBA 1CZHA 3H5VA 3LTNC 3F3SA 3NOXA 2BRUC 4DZRA 1N77A 3N8KA 2P4UA 4TL7A 1NXVA 2HM7A 2OECA 2IYLD 4BV2A 5B30A 2RJNA 1RP7A 5TQVA 3DFMA 3TM5A 3WYDA 3ZE7A 2CF6A 3WISA 4ETMA 1KC1A 2HH9A 4EELA 4CLOB 5HM8A 4NYJQ 1RC8A 1ATZA 2YWEA 4RABA 5GJWC 1ECCA 3DPUA 5DDIP 1CF4A 2I76A 2RGGA 2WOOA 3EVTA 4UDOA 1AMOA 5FORA 1SC1A 2W4MA 2Y99A 2WZDA 3ENNA 3OOSA 4CLEA 5BQ5A 4C04A 6GPBA 4LYHA 3K70B 1GA6A 4IKPA 1JYFA 1H2BA 1H0SA 1YNSA 5AHKA 4CR6A 5J23A 2ZSDA 3AHIA 5DPMA 5LQNA 3USZA 1N6NA 4MRNA 4DRXB 1FQOA 2H0RA 4IEEA 2R6GA 1NVVR 5KWJA 4MV7A 3PC8C 1N6RA 5UKDA 3K8ZA 2JGFA 3LVRE 4JXZA 1ZW6A 1Q16A 1P18A 3RWOA 3NKLA 2V0CA 3QBDA 4RKFA 2GSWA 1G8FA 3ZHOA 4JGIA 2DSNA 2OD7A 4OO3A 3EZ6A 2M32A 3ZVRA 5B3LA 2IT1A 4M8IA 2RHBA 4BTEA 4HWOA 4CGYA 3DOEA 1UH5A 1S89A 2JCBA 3KAKA 4S2UA 3ENWA 1HXHA 3KB1A 1MQ9A 1R0LA 3MIZA 5ULLA 3WZLA 1QU2A 4MPJA 4MR8B 1NJ2A 1OHHD 4V0OA 4IIJB 3RS8A 3SK0A 5AYVA 4PN7A 1AY0A 4TSFD 1NF8A 3O2NA 2RK3A 4BGVA 3NHBA 3K1YA 5U4XA 1F48A 4FFVA 1OBFO 3W4IA 3AJ8A 4PLPA 4RM3A 2GUGA 1GT91 4XFDA 3KM0A 4BXOA 1K5HA 1E0AA 1EFTA 1MBZA 1Q7BA 1T8WA 3EUEA 2X8LA 2CXUA 3FUCA 1XHFA 4YRIA 4ARAA 1Q20A 2BKUA 4IAOA 4K3UA 1I2ZA 3SHFA 4ZCTA 5F4BA 3R3YA 4QTUB 4XGNA 5E8JA 3PHIA 1T8RA 1PVDA 2GLUA 2QVLA 1J5XA 2J3DA 3DJFA 3GXOA 3OPNA 1HEUA 2IYYA 3OY7A 3K0CC 4RZIA 4DQVA 4UNIA 1FC0A 5KB3A 3I5XA 2VDJA 2R8BA 3EWSA 4Y1GA 3FN4A 2R0QC 3OP4A 2JJ2D 4Q3BA 3I4FA 2OILA 3N05A 4ZTBA 3OIFA 3PI7A 4QT0A 1U3UA 2IQIA 5IH7A 3DD5A 1HDOA 4RSGA 1GRQA 2C07A 1L7DA 3A6JA 3AJ9A 1DZIA 1OLSB 1RWXA 1T91A 2EIXA 4JLSA 4TTJA 5CT8A 2QT0A 3W5JA 4P2BA 1G55A 4HDKB 5AJXA 1JZTA 3FKSD 3M3PA 3VMFA 1UAGA 3BK7A 5CP8A 4LJRA 1DC5A 4AQDA 4FTWA 3RKSA 4EJSC 1JDBC 3V1MA 3PRHA 2BGTA 2CXNA 4KXYA 2X8JA 2ZU6A 4XWGA 1U7ZA 3HGQA 3K9CA 3QK7A 1YFZA 3DBOB 3F4BA 2FSVC 4ZVKA 4Q37A 1TAHA 4N6OA 1CJKC 4CDRA 3AVXA 1TIPA 3S28A 3ER6A 4V3BA 5LP1A 1VKHA 1QF9A 2Q5HA 3HO8A 2FPKA 2OO7A 1N8KA 3BRSA 4KE7A 2C88A 3FAZA 3TZBA 4KIUA 3OFVA 1N8TA 4IKOA 4QUEA 3AGQA 3MS4A 2Q2NA 2DB3A 1E3MA 5TLSA 3RNLA 3DYIA 3WMEA 4FJ2A 2AG8A 5AOBA 4K9KA 3RV3A 4BYGA 1ISPA 4DDWA 2HXGA 5G3ZA 4DA9A 2B8WA 3ICEA 2I91A 3BMCA 3K2EA 4BUCA 3KBBA 4KDFA 2ECOA 2EFDB 4K8RB 4V0RA 3GRPA 3RU3A 1DC8A 3A27A 1OV6A 3W7VA 1SG6A 3ZY2A 3TSWA 4ER0A 1S9HA 4PW0A 5JZMA 4Y2YA 1FJGB 3WIBA 8ADHA 4HAUA 4EPVA 3KZCA 4RV9A 2OGTA 3RRFA 5KU7A 4YRKA 3IXMA 4C7MA 1E5DA 4D79A 2O4CA 4DC0A 3U56A 1FF9A 1ID1A 2JFUA 1Z6TA 5C5EA 5IG2A 1PN3A 5HE8A 3UNXA 1TZMA 4M9SA 4CF6A 5KEIA 1QZXA 4K9PA 2CFTA 3ESDA 3K8OE 4M21A 4NZMA 2GAJA 1HMYA 5TPWA 4DC9A 1R66A 1DXQA 1Z3IX 1A9PA 2M1ZA 2QQGA 2Z58A 3HVHA 3KD2A 3OJOA 4W8HA 5JCOA 3SX2A 5H3HA 3A6LA 3TEMA 4DLLA 5KNDH 2OAQ1 1HT1E 1J8DA 4O4JF 5J4KA 1E94E 2BBOA 2J08A 1J4AA 1KXZA 3I2HA 1XVIA 2FRXA 3QPWA 1WCYA 4PQFA 2JGMA 3GJRA 5IDQA 4UUNA 3UW1A 4H77A 1NXOA 5EXTA 5F23A 2ODTX 4EIWA 3P2JA 1GGHA 3O4FA 4QE3A 2XIQA 4KXQA 2A33A 4HZUB 3U7QA 1DAGA 1NE2A 1V3QE 1NV8A 5BV7A 1TAQA 3PDIB 3FKJA 1ABBA 4ZVPA 4KPEC 1WZEA 3OE7A 3UOGA 2YTZA 3U4HA 2WJGA 2PRKA 1FRNA 1IWOA 3EQ8A 3LQ2A 4QBTA 5EHQA 2XUQA 1JHPA 4XTRA 5BN4A 4Q1FA 4NWIA 2VP2A 3A6PC 1SXHA 4EFMA 3PC8A 1DC3A 2YS6A 3MCVA 3RSQA 4MR8A 2G0TA 1U7WA 4RL4A 3E5RA 3UTCA 4HEA1 1OXSC 4F2DA 2PAAA 5JPIA 3STVA 5K3AA 2JJ8A 4CM1A 2J6BA 3DTNA 4UMVA 1THTA 1TECE 2QP4A 4WI1A 3RKRA 5JBNA 5IN4A 1QHYA 1UBKS 1DBRA 2VJCA 2FZGA 2OBXA 4X1KA 4EYOA 5EMLA 4LQCA 5E6SB 4BJ5A 5KNLA 2D1RA 1EFVA 3BEOA 3CEJA 3ZCPA 2VAXA 3LUDA 4A0QA 2D54A 5E3JA 1KWGA 1HYBA 2QXYA 2GFIA 3HHEA 2WMOB 2J5KA 4MULA 4P0QB 1U4NA 1QF7A 3RIEA 1CJUC 1NWHA 1QOQB 1R64A 2OCLA 3IMEA 4D0LB 3J7TA 5IMBA 1X39A 1WQ4A 3VR5D 1KPGA 5M29A 2R5FA 2JL1A 3LOPA 4D8UA 3OE1A 1TQ4A 5KNBD 1DJPA 2FPUA 3GAFA 4BX9A 4IGKA 4HNTA 1KHHA 1X80A 2YWDA 1ZUWA 2F1IA 2EF0A 3HNRA 1E2EA 3OPYB 1DP4A 4BJ3A 4WD3A 1ZNWA 4OSPA 1WOMA 1XTUA 4LJSA 2Z1NA 3BMXA 4I1PA 5DKFA 1GGMA 2VNHA 3A37A 3HV2A 4CQMA 4KUHA 1HDGO 1UFVA 3SR4A 2P6UA 2PSFA 5LZ9A 2FJ0A 1CEYA 1KEEA 1T36B 1LSJA 2XV1A 1HZZA 2O5EA 4ND2A 3AM1A 2BUBA 3EA5A 1XLWA 3EHEA 1A7AA 3TRIA 2GYUA 3UGQA 4KU4A 4QA9A 4WZBE 4Y9RA 3RF6A 1WXEA 3K9LA 4LOJA 1DQZA 5C51B 3GCXA 1LVUA 5HHTA 1EDOA 1SBIA 1MGOA 1F4VA 1YA8A 3A2LA 2Z95A 3G0OA 1G5PA 3L8GA 4TVBA 1RS0A 2CXRA 4NJMA 1BZYA 2X5NA 1FMTA 2F59A 2HMAA 1AA9A 1ONNA 3N07A 4V38A 3ZHTA 1QAOA 1YBAA 5AR1A 3H11A 2DWCA 3VR2D 4F2HA 1O0BA 4C6HA 5IKOA 4X71A 1DRWA 3E22A 1H6CA 2HEGA 4MV6A 4Q12A 1T9ZA 1YRAA 1I7NA 3E0XA 4P7KA 2QRGA 1FA9A 4JQZA 4R2WA 3IP9A 2YUTA 2RAVA 1Z06A 4B71A 1JG1A 1S2DA 1IJKA 1VSTA 3LUFA 3U7QB 3ICQB 3QITA 4IIXA 1R3DA 3NTXA 4A1FA 1GKIA 2YJ5A 2H08A 1JQ3A 4FUQA 4UHBA 5EJFA 5ERXA 4BGDA 1JYEA 1UMCA 3GGPA 4BMSA 2AUTA 2H9YA 5A3QA 2WOJA 2JDID 4L3VA 5EIWA 1NPTO 4EG0A 4ZEVA 4J0CA 2ZBUA 3C1AA 1D2RA 2IKQA 4L8WB 4MKHA 4EG5A 2QTTA 4CWAA 4CKEB 5BMVF 2R1TA 4HFMA 5LQJA 1F51E 4MNTA 1HBJA 1K7EB 1GILA 4QUHA 3X1YA 1GHTA 4KQWA 3PXGA 3LQFA 4PZLA 1Y8RA 2CD7A 3E8SA 2J9FB 1FPQA 2OXTA 3V97A 2VZEA 1P9LA 5EJMA 4AUKA 2O8FB 2RH5A 4H15A 4TXLA 4Z8XA 1EFHA 3KZVA 4WUVA 5CXSA 1UC5B 3E5MA 2PZAA 4BIIA 2QORA 2IP2A 3BMNA 3E3MA 5KYWB 4PVCA 2YQZA 2OA0A 1IEQA 2IPNA 2V3VA 2YNMA 2Z8XA 3RREA 3NNSA 1WUKS 4PF1A 2Y0PA 5EKUA 3C45A 3MXTA 5TGZA 4YV0A 1DX4A 1YUBA 4Y67A 1E3QA 1VPDA 2VZ8A 2D5CA 2ZRAA 4Q01A 4OQNA 3BCHA 5K8LA 3JQGB 2EP7A 4LSWA 5EIXA 3K0FA 2A9PA 3QLTA 4QGAA 2DFKB 1J1IA 4QEKA 3K92A 4ZXPA 4EKNB 3Q3JB 4KRYA 4MYSA 3AVUA 3H1AA 1SA0B 3DWFA 2H4WA 1GZ3A 1OE0A 3B8HA 4MUAA 4TL9A 5CAEA 3EX7C 4FZJA 4OLHA 1QGZA 4Y1EA 1TKBA 5HCUA 1FUKA 3FZYA 2P6MA 3OLXA 2GAOA 2X2PA 2ZJ6A 3FZEA 1XSEA 2YNMD 4CQMD 5JZBA 3PXCX 4EHIA 4DABA 3A1CA 2Q2OA 2P2DA 3LW8A 4MUHA 5JEDA 1U9IA 2ENWA 1MC5A 3VOTA 2VDVE 1CJMA 1PQUA 4IMJB 4TLCA 3I2YX 3WP0A 2ZBRA 2P67A 5JTTA 3L49A 1AJEA 3UJBA 2CK3D 1GL7A 4AF8A 1HZJA 4OOEA 1EFLA 1JEQB 1BE0A 1SUDA 3DE3X 3JQ9C 4FYXA 3IV7A 5CJJA 5HP4A 3EQZA 1ACJA 3HP7A 1RD4A 3OZTA 5BN3A 2PD6A 5IYZA 1F0YA 3DLHA 1BJKA 3CR3C 2XQJA 1XA0A 2FUNB 1MTOA 4O08A 1VL1A 3CPHA 4JT2A 2ZYRA 3RC3A 4DDTA 6Q21A 2HPHA 3H2KA 3HBAA 3EG5A 3L1KA 1ZINA 4JKYA 3SQNA 4A0SA 2GZ2A 3LYAA 5DYYA 2BGIA 1DFIA 2Q0QA 1HORA 1WPGA 3NOOA 4WACA 1TMYA 2I34A 4ZV9A 1YZ3A 2IS6A 2ZYSA 3S7TA 3GBVA 4GXTA 4W5TA 4YQZA 5EESA 3WYFA 3JQEA 4UCXA 4JLOA 4RD4A 5HQJA 3CR7A 1BS1A 2I4OA 1OD6A 4X0EA 2ATVA 2JDIA 2HHCA 2B4RO 2G72A 2IPOA 1VKOA 3LM8A 1KH1A 5EA2A 4CM7A 4I46A 1YS7A 4MGIR 2V58A 3EHDA 1DLIA 5LLTA 4PG6A 5KYYA 1YVPA 2H59A 2XF2A 3BKWA 1N1DA 2P1DA 1X15A 4F4FA 2WM9B 4LX8A 5EKXA 2G82A 4YA6A 1O57A 1P2BA 1ODFA 2FFRA 2L2QA 3JZFA 4J9VA 1EX6A 3QE4A 3VZPA 1QDUA 3IAM6 3VSBA 2GMWA 4GSKA 4FWTA 5KDOA 1RYHA 3GLGA 3MJVA 4WK6A 4RPLA 2ZJ5A 3K0CA 5FHRA 2DCMA 1EFPB 5CIYA 1GPNA 4YN3A 4ARVA 1QYCA 4N82A 1RYMA 1VJ5A 3V32A 3AWDA 4FSHA 3MS2A 1R6VA 3JWPA 4MVJP 5E6RB 3KLNA 5SY9A 521PA 2Z3ZA 3GAAA 4RV4A 1Y9JA 3EIFA 1O54A 4CKZA 4I4CA 1PZNA 3FWNA 2JPDA 2JGDB 4D4KA 1E2HA 2NV2B 1E7MA 3T5MA 4E33A 4LAFA 1WMFA 3AUAA 2PDAA 5T7BA 1R0ZA 2FWMX 1RBYA 2JASA 3W34A 1I51A 1RTTA 4P1ZA 1P62B 4HWPA 4TV9A 4WGFA 3Q9UA 5B4VA 1SZDA 1Z36A 4BX3A 5KTSA 3VA7A 2C7PA 3HPQA 3L1HA 3T94A 3T1YB 1D2HA 3LWDA 2YIJA 4V1CB 2HF2A 2XVYA 5A0TA 1KPHA 4P7GA 1RRKA 4AXBA 1MLDA 4EG4A 3UWKA 1DDOA 3FPGA 4R68A 4I3GA 6CHYA 5G0WA 1L5KA 1U4SA 5E6UB 2ZE6A 221PA 2ZJAA 3T3DA 1SXQA 2O2EA 3MMPA 1WMSA 3DL0A 4C6TA 2IY8A 3HA7A 2I62A 2VH5R 1E1QD 1GZDA 1CNMA 5G4KB 2HYIC 1E1RD 2H51A 4POAA 2EKZA 5AHXA 4MVJA 4LWZA 1HDIA 2X2EA 1I33A 2W11A 2I55A 1RJFA 3BDAA 3DBLA 3IP1A 2CMGA 3BFXA 2ILVA 2WHPA 4X1OA 1E9AA 4BNXA 4NH0A 5GQSA 4AX4A 5I4CA 4A6PA 4DPMA 2F9MA 1Y1QA 3U1VA 3N8GA 2IYPA 2XQVA 1KJNA 4FE3A 2PYZA 1KZ4A 2G36A 5I7RA 2B5WA 1L8OA 1UJBA 1VLZA 2AUMA 2WG1A 4I50B 5CTJA 3UJ7A 1E0SA 4CRWB 4UAGA 4DNQA 1WJGA 1NDHA 1KQGA 4MYTA 4XX0B 3WV5A 4PNZA 5HDQA 3RYFB 4MW6A 1EKXA 4AKGA 3FXAA 3N0WA 4X64B 5JWOA 4A0GA 1E2DA 4MJXA 4O4JA 4KTTE 5FPTA 1KK0A 2YJTD 3ZLJA 2MSDB 5SZJA 1KJWA 1JLSA 2QL9A 1PTKA 2ZULA 2PPLA 3VR6A 5FTLA 3G5MA 4AM8A 3CBGA 4C29A 1ECBA 3C6BA 1KI7A 4ZAVA 1IEVA 1Q92A 4MPTA 1NBMD 1ICIA 2HU8A 2Z56A 4QSMA 3SJBA 3K20A 3L7NA 4MUMA 5JVDA 3AR6A 3U3KA 3GG9A 3O4IA 3SS7X 4L51A 2FLVA 2CL0X 4FJ0A 5EL0A 1W47A 3WX0A 1DJNA 5DYGA 2OB2A 1JHYA 3A9WA 3GRKA 3ICVA 4YWHA 4IFTA 5H9WA 1PR4A 2YDXA 1IEXA 1NX6A 3C1TA 1ODJA 1WZIA 1BTOA 1A4UA 1N2CB 2HNKA 2JJQA 4BNGA 4BQRA 3W8RA 1JS1X 4U1RA 4E12A 1QZTA 1OX6A 1X80B 4YPFA 4A7PA 1TW2A 1GRNA 1I4LD 1D3AA 1DQRA 1JQKA 2GWRA 4PHFA 4A8TA 2C7RA 2O2GA 1XAGA 3CX3A 2SBTA 2OUKA 2QRQA 3L06A 4FLMA 3DXZA 4NCIA 4NOKA 3W7AA 1T4DA 3WGGA 3DGEC 4EUHA 4DPLA 4PWYA 3H2JA 2VG8A 4G36A 3USCS 1ENZA 1OFUX 2P4QA 3CLTC 4ZO9A 4RCZA 5HUQA 5JMTA 1AHPA 2AV6A 3OAAA 4WPGA 1N2HA 1QO9A 2FUKA 4BMXA 3F3YA 3NVKI 2Q9CA 2PUEA 3ROFA 2QJTA 3L4KA 2QLLA 3GEIA 5KTMA 5IZCA 5FTJA 1Q22A 2AYXA 4MPPA 1LS6A 3TX2A 1XQYA 4ZZ1A 3KYDA 1NVAA 1QORA 3HA5A 4G8DA 3REFA 3EQ9A 1VJ0A 3O03A 1SXPA 2W22A 4RZ3A 4UJ5A 3R5TA 1RYEA 3U4DA 3RTGA 1J90A 4QJ4A 1L7BA 4GLFA 4NJMB 1QRUA 1SOMA 3H16A 1IJBA 4ES6A 2GZSA 2H4HA 2WP0A 3CONA 3L0CA 1I3NA 4CLRB 4IMPA 5TMDA 3BAZA 2EV9A 4UAUA 4E14A 4RQAA 5A5EA 1JW9B 4OP1A 1G5FA 1NA5A 3UWDA 3TGWA 4CGZA 3SEQA 3OE5A 2H8KA 4KYVA 2B2CA 3L9XA 4FFNA 4PLYA 4EL0A 3S1SA 2F62A 2WU4A 4BRZA 3S2UA 1FDUA 3RUHA 1YQDA 1RJWA 4CCWA 1JKIA 4DJAA 5K8IA 4F5ZA 2NSHA 1PKXA 2BGMA 4ZI7A 5I48A 3HGTA 5K01A 2C95A 4F2WA 1D0VA 2FEAA 2FFQA 5BYKA 1IWBB 2F90A 2XWSA 2CL5A 3EUWA 4L85A 5F98A 1KBOA 4NECA 3DV9A 3V4VB 1F14A 1G8SA 5JALA 1IZ0A 1TCBA 1EUCB 2FG7C 1JPVA 3AVWA 4K5QA 1O87A 4FE7A 2QV0A 4Z7NB 1NNEA 2GD6A 5K3OA 3H9BA 3L6UA 2BPOA 1AHHA 3H4TA 2XODA 3LPCA 4HMOA 3U16A 1ZBDA 3C85A 5BR4A 3E8MA 1AUQA 1T0UA 1Z26A 3DEZA 4IXDA 3EBPA 2R1VA 1OV4A 2C9OA 3L8EA 3B8EA 3E27A 4RXUA 3H4IA 3OQMA 1W1IA 3FLBA 1OPRA 3IFSA 1HSOA 1QONA 4WNIA 2MHCA 2PUVA 3LO5A 4EI2A 1O95A 1IN7A 5KQPA 5IT5A 2VHWA 4HWKA 3HTXA 1YJBA 1NUAA 4OB6A 1K7FB 1V7CA 1T5HX 2C77A 3HY3A 2WLSA 5ED0A 3NYRA 4RVSA 1I2AA 1D4FA 3VKUA 2J6IA 5AW3A 3W2IA 1V1JA 1XRRA 1XEWY 2IXAA 4Z4FA 1TE2A 5JC1A 5C52B 3X1WA 5BN4B 1ZDMA 2CUKA 1NSFA 3A2MA 3SHOA 1Z0AA 3HCAA 4F3YA 3AF1A 3QYJA 2JIPA 4KRXA 5KOJA 4N65A 4ZGBA 1ULZA 1HFWA 1WMDA 3QKTA 2MMGA 3DG9A 3I32A 4O1HA 1OILA 5GJCA 3T3IA 4QJ5A 1Z7YA 1W4AA 2HCBA 2J59A 3FNRA 1ONBA 3UT5A 3ESCA 5AFSA 2GKOA 4MH0R 4C5CA 1S5PA 4TROA 2W6ZA 2X5KO 1T1SA 2B2NA 4GHWA 1IHDA 1SMKA 3K6JA 1ZN8A 3ZH2A 4DLNA 4ZO6A 2PBZA 1NKSA 2R8ZA 2ZCVA 5JDCA 4UOZA 3OQ6A 3IPYA 1NN3A 1HURA 4PZDA 1UDRA 2RD2A 1GITA 4RNCA 1T8PA 3R5XA 1RXWA 3WK5A 1V6AA 2OM6A 3NLLA 4HZUA 1Z62A 3REQA 4KR2A 1R74A 2XWBF 3CMCO 2AC2A 1QHNA 1M6NA 3ER8A 1ACLA 3UUGA 4G5GA 3IUBA 1XP8A 3HABA 3R5SA 1WXXA 4CDMA 2HA5A 2DLDA 1DX6A 4LVNA 5DEOA 1GG2A 4L73A 3HJFA 5B3JA 5I4IA 5ELXA 5CITA 4WUTA 1V7QA 4CR7A 1F4LA 5AHOA 1B2LA 2A9RA 1E1CA 3PD7A 4OHXA 3UMBA 1ZKDA 3CKMA 1GDDA 2OZEA 3PZRA 4OGLA 5DNWA 3E4CA 2QRKA 2WUDA 2HBYA 1T10A 3B1FA 4YFVA 5KYNA 1ZNXA 2B3TA 3EISA 1BJRE 1LV8A 3FPEA 4X90A 3VYRB 3T34A 721PA 3L8HA 1GAEO 1EFDN 2B2XA 1GR1A 2FPMA 2RGCA 3NYIA 3C4VA 2AVDA 4RH1A 4I4NA 1SKAA 2GPBA 4TLEA 1XZ8A 2P30A 4OIMA 3SE0A 2C4UA 4GX0A 2C5FA 5HKBA 1CR2A 1PT8A 1L7QA 4M2LA 3R0ZA 1CUGA 2Y77A 4JI8B 3LE8A 4BB5A 3B9RA 4KGDA 3RLFA 4XQEA 5KYYB 4EHLA 3TD2A 5CGZA 5JCOC 1F2UB 1AUOA 5DI3A 1TPZA 2OPHA 2QGFA 1GNTA 4MMYB 4MRVA 1D1QA 2FN7A 2V6FA 4Q3EA 2FPRA 3MQ4A 1QYVA 3ND5A 3PNQA 2XYPA 2BFDB 5JIBA 1P6XA 1O0SA 1WXHA 3ZWKA 3A4TA 2V5AA 5EIBC 5IAAA 4D9KA 5L4NA 4IS3A 2CFIA 4O2BA 2NIPA 1EDBA 3HKDA 3WJ7A 1JVNA 1K98A 2NP7A 4ZYUA 3RIMA 1W6UA 2AZ4A 2GZ1A 2I6TA 2MSWA 2MTBA 2E3JA 5MF6A 4KX5A 2OHIA 1P4HA 1P1FA 2MMCA 1FMCA 4TMZA 3AHEA 4RFSA 1Z47A 1WDLA 1Y9EA 5LZ5A 4BB9A 1NW8A 1CY1A 3N39C 3IT2A 821PA 1QGUB 1EWKA 4IDHA 4UXHA 3NC0C 1F7UA 2BFCB 2V7QA 1N0WA 3GLKA 1EMDA 2P9QA 2ZTMA 1ZY2A 1G1MA 2Q3DA 3ABSB 4KJZA 3QZUA 4RANA 2H5LA 3UG7A 2PLRA 4NAHA 2QRLA 3DMTA 2QV7A 4LJ9A 3WKCA 1F6WA 3JSXA 1H22A 4PGGA 2R5NA 2PLWA 1E2NA 1GSIA 4F04A 2FP4A 1GDHA 2FU5C 4H08A 4RAOA 2XCLA 1BSVA 1UZNA 4N18A 5CNJA 1KC3A 1M76A 2IXEA 3BXFA 4JASB 4AFNA 4WCFB 3PQFA 4HQOA 2PUTA 4MP8A 3H1PA 1QIIA 4HH1A 5DYTA 2OYRA 3CNEA 4EX6A 1L7EA 2B94A 5BRJA 1QJCA 4XUDA 2D5LA 2WJ6A 3KOOA 1PSWA 3LP5A 3KDPA 3V80A 2E5LB 1R8YA 3R2JA 2MSKA 1QX3A 4HCJA 4EVIA 2IZZA 4U8HA 1BO6A 1A9RA 1LPNA 3CURA 5CK4A 4JC8A 3SZRA 3S29A 5E4JA 3H18A 3PUWA 4MV0A 4MRMB 1OASA 1GTJ1 4QBHA 5B6JA 4FKZA 5J1TB 3ZD8A 1AKVA 2LVBA 3OM0A 5CM9C 4LK3A 1HDCA 4H6PA 4EFNA 2QUIA 1DG3A 4I4TF 1CLEA 3STYA 1ULSA 1X87A 4Q5IA 3KJGA 1YRYE 3C1OA 3UJCA 1OXBB 2B20A 1RW4A 1DBPA 4NBVA 4DVGA 5K05A 4P98A 1TUGA 4JU9A 2GPTA 2X14A 4ZO8A 4D4LA 2ZIUB 5HK9A 3CB2A 3O8RA 3NRJA 2FWRA 4MMZB 4AVYA 3FF1A 4JITA 4KXWA 1KZGB 5J5VA 1BVYF 2P9YA 1TRKA 2Z8YA 1F8UA 2Y1OA 3E5HA 3LFUA 1B4DA 1B8NA 1P7CA 3PE6A 2DBRA 2E5WA 3AVQA 4PINA 3LHSA 4TLLB 1WKVA 1KDPA 1NVEA 3B1YA 1Z68A 1NDQA 3P52A 2A1TS 3CVJA 3KHSA 3QVOA 4XCQA 4UCQA 2ZJZA 3V4LA 4PFSA 3A1DA 3S8YA 2PX8A 2W9XA 4ZVRA 4PLCA 3JQFC 4MWSA 5CB0A 1NNLA 2OENG 1NLMA 2Q3EA 3OD5A 5EJAA 5THQA