5EKUA

Crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
343
Chain Sequence
RPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKPKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDISRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLCPEMTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine N-methyltransferase, putative
publication title A glutamate/aspartate switch controls product specificity in a protein arginine methyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 104
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5ekuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ekuA01
2JH9A 4OQDA 3ELYA 2QRVB 3FPHA 5HILA 3TOSA 3T7TA 2ONYA 2Z6UA 4F85A 3P71T 2H11A 1KP9A 2OY0A 5E2BA 4QTTB 3O31A 3HCEA 2GA9A 4E2YA 4OA5A 3B3GA 1DUSA 2AOUA 4R6XA 3NMUF 5ICCA 1D2HA 3GRZA 5F2OA 3KQSA 2Z6AA 5EMJA 3X0DA 2V7EA 1AF7A 4PCAA 4BY9E 3TPZA 3BZBA 1JQEA 1G60A 2ZBPA 4PYJA 3NDIA 1FBNA 3OFJA 4UOEA 5HOQA 5DM4A 4M37A 4XUDA 3UJ9A 4L7VA 4YMHA 3JWHA 4RVDA 3GWZA 4RTMA 1VL5A 2QM3A 2ZZNA 3P97A 5IH3A 3RIEA 3B3JA 1MHTA 4EKGA 1X1BA 3UJ7A 3UJ8A 4PIMA 5EIWA 1VE3A 4YV2A 3F4KA 3PB3A 3E23A 2ZLBA 2PKWA 3KQWA 3B7PA 1KR5A 4QDJA 4ER0A 1WG8A 1YB2A 2CMHA 4HTFA 4POOA 5U4XA 2WA1A 4LWOA 2H1RA 2JHCA 1NV8A 3KKZA 3M6XA 1FP1D 3A27A 3I5UA 5BW5A 10MHA 1WXWA 3KR0A 3TRKA 2BR3A 5CVDA 3IV6A 4BP1A 3TLJA 3LKDA 5EPEA 3P9CA 3FUXA 5M5BA 5DX8A 2BH2A 3P8ZA 4CXMA 2PT9A 2OKCA 1ORIA 2ZULA 2P41A 5E2AA 3AJDA 4HGZA 2C7OA 5DM1A 3EVCA 4CKBA 3OE4A 4XUEA 1YFJA 3K6RA 2PXAA 3DXXA 4X61A 3PLAE 4U7PB 5K8VA 2PXCA 1EJ0A 3LDFA 3B3FA 3FTCA 4MIKA 2F8LA 1UWVA 2FK8A 4M7RA 3G7UA 4OX9Y 3ER9A 3PS9A 4PYMA 3CKKA 4FP9A 3KHKA 4RTPA 3FRIA 5EHGA 3EVZA 5GWXA 4FSXA 5E1MA 1ZG3A 5GM2A 4CKCA 4OBXA 4IV0A 2QY6A 2CWWA 1PJZA 4XCXA 5BW4A 3QV2A 3ER8A 2LD4A 4AZTA 1YF3A 3Q87B 4C05A 5CM2Z 2YTZA 3DLCA 4HC4A 3FZGA 2XYQA 3MCTA 1UFKA 2FK7A 2YXEA 5CCBA 3UBTA 1JG2A 4KIGA 4ER3A 1AQJA 2ESRA 2YXDA 4PYLA 4AX8A 5K09A 5GIPE 5MHTA 3GCZA 2JG3A 3QOXA 1N2XA 3EVBA 1O54A 3P2IA 5E1OA 5EOVA 5EVJA 8MHTA 3GRVA 5DM2A 4H0NA 1VP9A 3UJBA 4X41A 5EMKA 4E70A 1EQAA 2HMYB 3DR5A 1VP3A 4WXHA 1O9GA 3GNLA 2QYOA 3NJRA 4A6EA 3GXOA 1KIAA 4KVZA 1QANA 4AUKA 4KDRA 3KR9A 5EEGA 5FULA 4FGZA 4ISCA 4QDKA 1D2GA 2P40A 1ORHA 3AY0A 3HCCA 1YZ3A 3EMDA 4R8SA 3DUWA 3R3HA 4BLWA 3AXTA 3P9NA 1NW7A 2P8JA 3KQQA 3ELWA 4ER5A 2IBTA 9MHTA 5CUQA 3UZUA 2P3QA 2Q41A 2UYOA 4U7TB 3BWYA 1X1CA 2IGTA 4EQZA 5DXJA 5GOZA 2BZGA 3KPJA 5FQNA 1VLMA 2OBFA 3GDHA 1G38A 4PGHA 3MTEA 4Y2HA 3G88A 4KIFA 1R00A 5FWDA 2XYRA 3G8AA 2VS1A 3UJCA 7MHTA 1KPHA 3KPWA 3MHTA 3FUWA 3V97A 1N7IA 1BHJA 1L3IA 2ZWAA 5DTRA 1P1CA 5EHIA 2JHPA 2NXNA 3UJAA 4GOMD 1YZHA 4RSRA 3LKZA 4OQEA 1VBFA 4HRAA 4DCGA 5K0NA 4YMGA 5KVAA 2ZBQA 1F38A 2P3LA 4C07A 1M6EX 5K0BA 2XVMA 5LQUA 1RJEA 1MJFA 2PX2A 2IH5A 1IY9A 1KPIA 5BXYA 1EAMA 1WZNA 4QQNA 3OE5A 3HCAA 3JWGA 5CD1A 4CWAA 5DLYA 5DSXA 5ERGB 1QAQA 3G2PA 3GU3A 5EIFA 3TKYA 4V0QA 2G72A 4PIPA 3OZSA 1HMYA 1R18A 2PJDA 3G5TA 4JXJA 5ICGA 3KPVA 2V74B 1Y8CA 2GPYA 5DTQA 2PX4A 2AVDA 2PBFA 3M33A 4RTKA 3VYWA 2YX1A 1M0EA 4QVGA 4PONA 3FPGA 3GRRA 5LQAA 3IYLW 2EG5A 5DRYA 4C08A 3LECA 1JG3A 3HM2A 4P7KA 3U81A 4GQBA 1WY7A 2PGXA 2UYQA 3I53A 1L1EA 4FR0A 3HP7A 4YV0A 4WVLA 2ERCA 2EJUA 5EG5A 5K0JA 2CKDA 3HCDA 5HIIA 1Q0TA 4Z2YA 3KR1A 3VC2A 3FUUA 3DXYA 3AWIA 5DXAA 2N47A 1TW3A 2R3SA 2ZIEA 2HNKA 2AOTB 5DRTA 1NBHA 5LQCA 3LDUA 3SXJA 1RI5A 2G71A 2UYHA 1SVUA 3GO4A 2IFTA 3EVEA 1KPGA 4G56A 4PYIA 1SQGA 2DPMA 1NT2A 4R8RA 2IBSA 3C3YA 3CJRA 2Z6QA 2BM9A 1JSZA 3AXSA 5DWQA 5C9ZA 4O29A 3EEYA 3P9IA 2ZZKA 3UJDA 3ME5A 2GH1A 1NW8A 5E8RA 5HIJA 1NV9A 4NECA 3P2EA 2NNWB 2BR4A 2E5WA 4GOOD 5D1NA 1I1NA 2O57A 5E8JA 2ZBRA 2IH2A 3DULA 1G55A 1IXKA 2JHAA 3UWPA 4GUAA 3LSTA 3RW9A 1ZGAA 5B1SA 3R9XB 1RI2A 3G8BA 3LCCA 1P91A 3LCVB 4YUXA 1PRYA 2G8NA 5E9QA 3THSA 4FT2A 5K0GA 1G8AA 4QTUB 1TPYA 2P1DA 3D2LA 1AQIA 4QPPA 3FYCA 1JTEA 5E1BA 4RTOA 3A26A 3HA3A 3KR2A 1M6YA 1XXLA 3VSEA 3UFBA 1YUBA 2ADMA 3EVDA 2PV0A 2ZW9A 3BKXA 4FZVA 4HG2A 3EGIA 5HEKA 2PX8A 2PXXA 3SR4A 1R6AA 3HVJA 4LG1A 4RX1A 2C7QA 3FTDA 2XBMA 3GRUA 1NW3A 3KQTA 1XCLA 2QRVA 3GGDA 4RTQA 2GB4A 3TR6A 2GS9A 3M6WA 4KWCA 1KXZA 3CJQA 3LL7A 3VC1A 5BP7A 2YXLA 5LR6A 3BWCA 2C7PA 1EIZA 2IH4A 5FQOA 3K0BA 3HA5A 5FHQA 5DTMA 1DL5A 4MWZA 1NE2A 2AS0A 4HH4A 3UA3A 1L9KA 3OCJA 3OPNA 3FRHA 4MQ4A 5E1DA 4E32A 1QAOA 5LQRA 4RTJA 1ZGJA 4E31A 4ZTBA 5KQRA 5HIMA 2XVAA 1QAMA 1G8SA 2OB2A 1HNNA 2AOXA 3KQVA 4FSDA 4MTLA 4PNEA 3PT9A 3T0IA 2P35A 3A25A 2I7CA 2PLWA 1JTFA 3FUVA 4RTNA 2IDJA 4CTJA 3EVAA 5LQNA 3PVCA 3A7DA 4LECA 4XUCA 1R8YA 3C0KA 5H02A 2AOTA 3BKWA 4M36A 1P39A 3M70A 3BUSA 3PFHA 2CMGA 4GC9A 4KW7A 1T43A 1XJ5A 3R6TA 4DM3A 2AOUB 1X1AA 2AZTA 3IHTA 3ID6C 5FA8A 1X19A 3REOA 4RTLA 2VZ9A 5LSAA 3LPMA 5D1HA 3KPYA 3SSMA 5LQJA 3FTEA 3TMAA 5EKXA 3IEIA 1XCJA 2AN4A 3BT7A 2YUIA 3UJ6A 3T7RA 2IIPA 5CCXA 5C0OE 4YV1A 4DF3A 5K03A 3R0QA 3CGGA 1RI4A 2P7IA 1SUSA 1P1BA 1WS6A 3EPPA 3MB5A 4BP3A 1SUIA 4K6MA 3OFKA 3ORHA 3NWBA 5CIYA 4X1OA 3G2OA 1BOOA 2HV9A 1D2CA 1JSXA 3H2BA 1SQFA 2AVNA 4PYKA 4DQ0A 4B17A 4GC5A 5EMMA 3NVMB 4QQKA 3R24A 3TM5A 4F84A 5K0FA 2EX4A 3I58A 1Q0SA 1INLA 2PSSA 2BR5A 5FHRA 1DCTA 2BM8A 2B25A 3V8VA 4AZSA 1ZKDA 3G5LA 5T64A 5EC8A 3M6UA 2ZVJA 1WXXA 2OYRA 3PX3A 4IWNA 2KW5A 1JQ3A 2VP3A 3E8SA 1Z3CA 3EGVA 3T7SA 3HEMA 3SSOA 2FYTA 4RVHA 4RTRA 2WK1A 1RI1A 5KQSA 2C7RA 4BLUA 4GBED 5F2KA 5IKMA 1RJGA 4YUZA 3HCBA 4Y30A 2NXCA 4HSGA 3MCZA 2DULA 3BXOA 3I64A 1U2ZA 5ICFA 5CVEA 2NXEA 4GOND 2Y1XA 5EMLA 3CCFA 5DX1A 3NDJA 3KPUA 3HTXA 2AN3A 5KS2A 5GM1A 4EVIA 4GOLD 3SMQA 3KQPA 1XTPA 3O4FA 1O9HA 5FADA 4BLVA 3P2KA 2EJTA 1EJ6A 1XDZA 2HR1A 3EVGA 2YR0A 4EMSA 2B78A 5G02A 4RV9A 3EEOA 4C4AA 2IPXA 3GRYA 2P3OA 1KYWA 3JWIA 3OZRA 4FS8A 5K0LA 1JG1A 2NXJA 2YQZA 1XDSA 2Y1WA 3PX2A 4IV8A 4R05A 3TQSA 4RYLA 5K0CA 4OBWA 2B2CA 3DTNA 5LQKA 3WSTA 4R6WA 1ZQ9A 2IDKA 2WA2A 4A6DA 3Q7EA 5K05A 1YFLA 3E7PA 2NYUA 5FWAA 4X63A 2OXTA 3BWBA 3LBYA 4E2WA 3BGIA 5EQJB 3MGGA 1XVAA 2ZIGA 3M6VA 2EFJA 5C1IA 3DOUA 5ICEA 4KDCA 3FYDA 2VDWA 5T67A 4RWZA 3SM3A 5DX0A 2FPOA 2I6GA 1H1DA 1L3CA 3HVKA 4PGGA 2YVLA 5FA5A 3NVKI 5FCDA 2ONZA 1JG4A 5GP1A 4E33A 5DSTA 3EMBA 1RJDA 1TW2A 5EGSA 5T6BA 4E30A 5KYGA 4AZVA 4F86A 2JJQA 2GLUA 1B42A 5JUWA 2IP2A 3MERA 2VDUE 3ANXA 1EG2A 2ZCJA 2R6ZA 4FT4A 1NW5A 5EZQA 4P58A 3OU6A 5P8WA 3BGDA 3E05A 4EKIA 1QYRA 3HVIA 1BKYA 3C6KA 2G70A 2ZSUA 3LGAA 2FHPA 2XYVA 3DLIA 3C3PA 1UIRA 3L8DA 3HA7A 1SKMA 1SG9A 4PCLA 3ELDA 3G89A 3ELUA 1KYZA 5DM0A 2K4MA 2ZTHA 2ZWVA 3OU2A 4RVGA 2UYCA 4RTSA 3TKAA 5F2NA 5CVVA 3KQYA 2I62A 3NWEA 2B3TA 3O7WA 4PWYA 3OU7A 3QOWA 4RVFA 1ZHFA 3FPJA 3HVHA 1L3BA 2UZ4A 4ER6A 3A7EA 3BGVA 2ZZMA 1IM8A 1NBIA 2CL5A 2ORED 3EVFA 3CVOA 3G2QA 3A4TA 3TFWA 3MQ2A 2PY6A 3HNRA 5JR3A 3NTVA 3SSNA 2PVCA 3KQMA 4QPNA 4DMGA 4GEKA 4YUYA 4ATNA 4C04A 5HFJA 1RJFA 3SX0A 3OZTA 4C03A 2GAFA 3LBFA 2OO3A 4EK9A 3BWMA 4OA8A 5EZSA 4GF5A 3ERCA 1FJXA 1BC5A 2OPBA 4PINA 3G2MA 1FP2A 4CTKA 2PX5A 3FPEA 3SGLA 2HWKA 1R74A 3MAGA 4DZRA 5E9JA 4DKJA 1RI3A 3THRA 3EGEA 4X60A 4YUWA 1N7JA 2O05A 2G1PA 5FTWA 2HTEA 3P9KA 5K01A 2I9KA 4M38A 2VDVE 2O0LA 2ZFUA 2AR0A 2ZIFA 3LCUA 3LX6A 5DT2A 4PYOA 3LDGA 3FPFA 4P7FA 2FRXA 2O07A 3JWJA 1X1DA 3I9FA 4P7GA 5GINE 1OR8A 1FPQA 1I9GA 2H00A 1V39A 3RODA 3S68A 3TM4A 3CJTA 5K0EA 1NW6A 1JR4A 2JH8A 2OB1A 1I4WA 2QE6A 3FUTA 4HTFB 3MTIA 5HZMA 1VIDA 3KQOA 4DCMA 5GIOE 4E2XA 4IKPA 4KRGA 4C06A 4PYQA 3B5IA 5HIKA 2P7HA 4YUVA 3B89A 4DA4A 3CBGA 3FTFA 5CVUA 3GJYA 3HCFA 5E9WA 4LWPA 1JQDA 4MHTA 4E2ZA 3UA4A 4HGYA 2AN5A 1VQ1A 5CVJA 3GIWA 5FUBA 1XDUA 2AOWA 3DH0A 4PYNA 3C6MA 4V0RA 1NKVA 3KU1A 4AZWA 3DXZA 2PWYA 4CKEA 2AOVA 1AV6A 1KHHA 2A14A 5EEHA 1G6Q1 3CC8A 2PT6A 1QZZA 3M4XA 4QVKA 5DPMA 2NP6A 2NP7A 1VPTA 2O06A 3PFGA 3DMFA 4ER7A 1F3LA 2OZVA 3SVZA 2FCAA 3DMHA 5EKUA 3NW9A 3LHDA 4P7JA 3PTAA 3DP7A 2PWPA 2B9EA 1R8XA 3DMGA
chains in the Genus database with same CATH superfamily
1YQUA 4KXWA 5JCJA 1M8FA 1JKJB 3FPHA 4N01A 4YB8A 2CJXA 1L7BA 3GFQA 3OZBA 1R7RA 1G8KA 2ONYA 3M1IA 4R9RA 1V2GA 3DYVA 3WTCA 4AJJA 4B4UA 1H9BA 2XHEA 3GFRA 2BI7A 3DCIA 3MWDB 3HPRA 5D3MB 5E2BA 1PWZA 1X42A 3FYTA 3HCEA 3ZCTA 1KZ7B 4A91A 1S8AA 4P38A 4IZ6A 1JNXX 4I50A 5HMLA 3MAJA 4QWMA 5T41A 1K98A 3VR2A 3ZDYB 3ZE6A 2ZCVA 3EWIA 3BQMB 3O8CA 1SIBE 1JKIA 2QYHA 5T57A 2RK6A 2C5GA 1N9ZA 3IIJA 1V3QE 2FUEA 2FDCA 3FWPA 4PW0A 4NG5A 1FU4A 4W7SA 2QQEA 1HTTA 3L7DA 5LB4A 3OFJA 1V5EA 4UUNA 2O9JA 3C45A 1FTNA 3TRIA 1ID8A 1U02A 2BEJA 2H08A 2C97A 3FMGA 3IDFA 4L7VA 5TPZA 3RSZA 3TUJC 5CIWA 2IF0A 4OXNA 3TNJA 3EB9A 2ZRAA 1QZXA 4E07A 1ZH0A 3C3CA 3DR3A 5T4BA 2A94A 2MYUA 1EWQA 3I4FA 1VE3A 4XQ9A 3SQLA 1VKNA 3TB6A 3D8HA 1MNQA 2PGOA 3JQFA 1FS4A 1XRSB 4RJJA 5FPQA 3SCZA 4DMMA 4ER0A 2XXAB 4GMFA 3TIGA 3AVYA 3NHJA 3G2HA 5E0KB 7MDHA 1NLFA 1H6DA 4BO4A 3GEBA 1NA5A 4WXMA 1M74A 1T9CA 2GVZC 1I32A 2IUYA 4MR9A 4LOKA 3OQOA 5F51A 3NYQA 1ORIA 3TMKA 3AVTA 2AEMA 5F1PA 3U31A 3O74A 4NHOA 4E46A 3FSEA 4KG7A 2QTGA 3PFCA 3QVVA 4L6IA 4O4HF 4C01A 1OZ0A 1UINA 1QGZA 2VRBA 1KSHA 2Y76A 1XHLA 4Z8XA 1XJCA 3LDFA 3UFXB 1KYTA 1SOAA 1GP2A 1RQ2A 2BMFA 1Z6YA 3OBBA 2DUNA 1HTWA 2OENG 1UWVA 1RQGA 3JAWB 4MR7B 3NASA 4PC2A 5ADHA 2Q50A 3CWZA 3KZVA 3I4LA 3PS9A 4K03A 3UT5B 2EW8A 1UBRS 2IUFA 3OQBA 3IUEA 2C99A 3E5HA 3EVZA 4FVTA 4JCOA 5DIFA 5BSMA 1AKRA 3WBJA 4DANA 3QPUA 2V1XA 2JZCA 4HJXA 2CXSA 4Q3CA 4UTVA 1X1QA 3GI1A 2QVZX 3SZ3A 1DGQA 1W59A 1YF3A 5IXYA 4RW0A 4KR0A 5GAJA 5JO0A 4F11A 2FK7A 5CCBA 2DE0X 2ZANA 2NTEA 2DY1A 2Q2QA 4MW4A 3QNUA 4QYIA 3GJ3A 5B3AA 3WGVA 4C3ZA 4HEHA 4ER3A 3M81A 2GBLC 1IZYA 3C7TA 5M3BA 5IM4A 1EQUA 2IPMA 3TQCA 5AM1A 3SJBA 2FKAA 4O1IA 1R5BA 4XX0A 3EX7C 1A95A 1FRZA 1U3DA 3BSWA 1B00A 3N05A 4BNDB 4MKHA 3DM9B 1VP3A 2GYYA 3EXIB 4D9CA 3MRXA 3BD6A 2VYQA 9ABPA 2LR0A 1IUPA 1N5KA 3BWXA 4KVZA 1U9YA 2Q2WA 1ZK1A 3NEJA 4GR9A 1PYGA 4X1KB 5DHPA 4ZWNA 1HWYA 3UGTA 1BO6A 1RLIA 3U4DA 3PFBA 3D0QA 1UDRA 2LDBA 2HF2A 3CZRA 1LSOA 3LUDA 1LVGA 3N58A 4V0ME 1L5WA 2DWOA 3LVFO 1FTSA 4OMFG 5DULA 1DC8A 4QU5A 1RM0A 2GZRA 3AUYA 4G2NA 3UZUA 5HUJA 4H6VA 4FR5A 5IMBA 1V1JA 1HZZA 4B2YA 2PTHA 2Z8YA 1GITA 2HHJA 1PF7E 3DKRA 3HCPA 4N0QA 4DMFA 3WDKA 1G1MA 3NEYA 4G0ZA 4EAQA 2BFDB 2IHVA 2C59A 5I6DA 3OE7A 5B6IA 3CH4B 4YMWA 1QGED 3IKMB 5DTRA 3KALA 3TKLA 4EHBA 1ZRSA 2G06A 1SKAA 3DVLA 3NHZA 4AMUA 3HV2A 5CA1F 1KH3A 2XZDA 5CYOA 4D92A 2VF2A 2Z3ZA 1FSZA 1KEUA 1MHPA 4UVDA 1EK2A 4FWBA 2FSGA 2IYLD 2WC1A 5FTNA 1ZW6A 2CLKB 1Q2UA 2W2NA 3R4CA 1EFVB 2WHEA 1EAYA 1Y8AA 3KG2A 1IN1A 3HKDB 1N5IA 3PDCA 4KSBA 4ZDIA 2WILA 4BE4A 3GWGA 1FP4B 4ZC8A 2YZKA 3V8NA 5BNZA 2NQ2C 1Y5IA 3JQGA 4JA2A 2HXGA 1OREA 2OMEA 1BX3A 2EGUA 3ZH9B 2MJLA 1GKIA 4HAVA 5CFLA 4DIEA 1RAGA 1JEEA 2VJMB 3DBHB 3B52X 2O2ZA 2WU8A 4HGPA 3E3NA 3P9QA 4HAOA 4HNUA 3LPNA 3NWOA 4WN3A 4GYJA 3ROGA 4EW2A 1JG3A 3W79A 2L69A 4PO3X 1XT6A 2CNKA 4D4GA 3FJ1A 3QBTA 1J8DA 2YHIA 1M2FA 4YAGA 2ERCA 4D82A 3C97A 4HDQB 4K8OA 5EP3A 5IVIA 2WIGA 1OXUA 2O14A 1Y4SA 3KKMA 2GHQA 3LHFA 2OBNA 2QN3A 4NPHA 4RDCA 5G40A 3AUXA 4ZYTA 4KCGA 3WA6A 2EJBA 2LKDA 2HJRA 3RYCB 3C8MA 1X80B 1QWOA 1G7TA 1RI5A 2XMRA 3EQZA 4AW9A 1G5IA 3ANLA 1M34E 1U11A 3FR8A 4NIMA 4PYIA 4TWAA 2DB3A 5IJ0A 1QLWA 4B4OA 4LKRA 4R8RA 4ZJPA 5FP0A 2ZIVB 3B70A 3O9ZA 3R23A 5K3AA 5BRNA 1XZMA 3Q2IA 1AB5A 1XCBA 2ECPA 1B2RA 3IE0A 3AF2A 1ZVMA 2JCSA 2ONCA 4G5FA 2X8JB 4QUJA 5AMXA 1XA3A 2GCNA 5EZ5A 5IF3A 2NNWB 2BR4A 3PUZA 1DEXA 4JYBA 4UTZA 4G07A 5DP2A 3A4VA 2C88A 2VHEA 4ZCPA 2ZBRA 2FSIA 3E6AA 3KT8A 4TRRA 2DETA 1JQJC 1WMFA 1XTBA 3DHWC 4GUAA 1WVMA 2Z5FA 2ZIXA 5EZYB 2NAFA 1YRQA 4BU1A 4HDNB 1TC1A 2ZPAA 3IVAA 3LPLA 3ZVLA 3U7GA 2ZYHA 2JK1A 5T4EA 4FT2A 3NI2A 3ZNOA 5HM8A 2D59A 1L5QA 2PLAA 4TQ9A 1D03A 2JFBA 2SKEA 1T9HA 3MAAC 4ZA2A 1ZH4A 1M1YA 3EUAA 3IQXA 1GKLA 4P5PA 3IBTA 1N6RA 2XKKA 4DV2B 2GNAA 4CMEC 2FW7A 1O8CA 3PEVA 5CBKA 1ZU4A 1GVNB 4TKZA 1JEQA 3RHZA 3BK2A 2XBMA 1LB1B 1USGA 3A6DA 1PWXA 1K8YB 4Y9RA 1E66A 1Z5PA 1Z6ZA 3GC6A 4KWCA 2E3JA 5ALPA 3A1EA 1WD7A 5BP7A 1VPWA 1AO3A 4NVRA 3LDHA 5ALVA 3F67A 1AA6A 1JMYA 1DQSA 1H9CA 1JSLA 4F06A 1D7OA 2QVCA 1NKTA 4KLAA 2QS9A 2ZSEA 4MWZA 2PKYX 3OCJA 4X3PA 1CUJA 5DT9A 2NO4A 5J5VA 3QKIA 3BE8A 5CHYA 4JJ4A 2YVKA 3PD0A 4M9QA 1HG1A 1M0TA 3K30A 4LJ6A 3ESRA 1WB6A 1Q1AA 2AXQA 1R50A 3AEKB 5DYWA 2IXAA 4QUDA 4EP1A 1SFRA 1ZGZA 2CBZA 3PVCA 5DBOA 4C3VA 2PFKA 1OKKA 1SPBS 2VP2A 3NBFA 3BKWA 4J4BA 4D6PA 4QJ4A 4ZCTA 2FLWA 4UU0A 1H66A 4DM3A 4ITVA 3E5MA 4OAOA 3TB4A 4HH3C 4YP9A 1SC3A 1HLDA 1NUPA 4PQFA 1HE3A 4MV3A 1MH9A 1D6JA 2LPMA 3FMIA 3GAFA 1YMVA 1IOWA 5KCZA 4AJ4A 4YRMA 3LQ4A 2C98A 5ALWA 3S8EA 2YHAA 4RD0A 1QO0D 4ND5A 1GM5A 4DF3A 2W2TA 3KZOA 2PHZA 2I2FA 4WKOA 3RHFA 5ITSA 2ZPTX 1LGYA 3ZDZB 2WU4A 2A3RA 3B6KA 3F96A 5BN1A 2HV9A 4YAWA 5TJHA 3R3WA 1ZCBA 2OZLB 3BX1A 3FSRA 3NHMA 2H1CA 2REXB 3HGTA 4ETMA 3K70B 3W5BA 2Z98A 2NSDA 3V5NA 1EHYA 1V16B 4YUWA 3R24A 4BMCA 3J80A 2GERA 3AUJB 5K0FA 4OOEA 3H9QA 2YC4C 2G77B 2ZWIA 3IPLA 3K4PA 1C0IA 4OQQA 2BM1A 2ZVDA 4PM4A 3WK9A 1NG9A 2BTQB 5I9LA 2QBYB 1PYOA 4K7JA 3TVDA 1KAOA 4PS0A 4F3RA 1ELOA 5C52B 4HDAA 4IMIB 1I10A 1QTRA 3MJSA 2JB9A 1WSWA 3Q7PA 1XL0A 4IWNA 1K1EA 2JIZA 4JBNA 3NT5A 2P6OA 4HV4A 3S1SA 1LJUA 2ZR8A 2FPLA 3NYIA 4RKEA 1SC9A 3EEBA 1UBCA 3B7WA 3CUWA 4BLUA 3KQLA 1H4SA 1KEPA 4UJ3A 1KYVA 5TPWA 1BXGA 2D5AA 1EYZA 1SCJA 4PZUA 3SS9X 5BSGA 1Y8QB 1SR8A 2Q6KA 1SU8A 1QHHB 1MABB 3PUHA 1K97A 3HXTA 4QUBA 1IEQA 4UBJA 2IX3A 1L5NA 4XGKA 5CXXA 4G5GA 3ZCXA 3SZMA 2JFYA 4PANA 3SNHA 4XD2A 4MPJA 3P20A 1B26A 1CS4C 3DFMA 3TIVA 1JLHA 2FEWB 1J8QA 5AR1A 3WYNA 4EMSA 5TQ2B 4JI5B 1XFDA 4C0LA 5E6UA 3RG8A 4D9BA 2BDUA 4U5QA 4RYLA 1YRLA 2H51A 1VKJA 4M1ZA 4D9FA 3V2HA 3V4OA 2X3UA 5EN4A 4X63A 3H5LA 3TJMA 4DRXA 2GFQA 3EOZA 4YMIA 5D00A 5EQJB 3BF8A 4QQFA 1RHJA 2BEKA 3B2QA 4KDCA 4B40A 4AN4A 2NU7A 2B6HA 4IYRA 1X39A 3IAM1 3ZTYA 1E6MA 1JFFA 2WWIA 1JKFA 1E0KA 3AJAA 3CZMA 1YD7A 3V8MA 3O83A 3IA7A 2B1JA 1JJIA 2XUPA 1XP5A 5JJ5A 2ZYSA 1VJTA 2V1UA 1CZNA 2WJJA 1R88A 4EY6A 4E6EA 1XQ6A 1DKPA 5EXTA 5IC6A 1N0HA 4CR7A 3KAJA 3ILSA 2FTKE 1WW2A 2BGLA 2R4UA 2JAQA 1EG2A 1AKUA 2QGFA 2VDKB 3FF4A 5EZQA 4K9KA 5EE5B 1YUNA 2O0JA 3B5JA 1NUUA 3PQFA 4LF4B 5BQ3A 5F98A 3QGMA 5BV2P 1P1FA 3RCBA 1PIWA 4MEJA 5A2QA 4HDMA 5A9TA 4MVJH 3C1OA 3K4QA 3RIHA 2R84A 1S8FA 3R75A 1PL8A 2EQAA 3ZC3A 1YOVA 2D4AA 3EQ6A 3I6BA 5B3KA 4G5YA 3BSSA 2WT4A 4D6YA 3AL0C 4KXUA 1G9SA 2WWRA 3O91A 2P9JA 3OEYA 2OO7A 3IIKA 2R7NA 4DMUB 2UZ4A 1BFKA 1T5IA 5JBIA 2FV8A 2IYNA 3KTAB 3DM5A 4C29A 4LRSB 1RWWA 2CL5A 4K5QA 4OGGA 3CVOA 1XU4A 5DWDA 1K4KA 4JOBA 5AWFC 1MC1A 2AT1A 3K0AA 1WLSA 1XRPA 3IP3A 1SBIA 4JI8B 2CF5A 1M2NA 3FWNA 3V8BA 3AHIA 4YN3A 1I3LA 2PKCA 3BJMA 3MINA 4FWIB 1JEOA 3QG1A 4LKOA 3T38A 3U0BA 2UUAB 3TNDA 1W48A 3DEHA 2NTYC 1F48A 3HDTA 2FFAA 3QPCA 2ZUFA 1FJGB 4HMOA 5CDGA 2E5FA 3PV0A 4EITA 5COBA 4JKYA 4EB3A 2RHJA 4N3CA 1U8XX 5L40A 1R9GA 4HLUA 3ERCA 2HA2A 3RUEA 5DDIP 4ESOA 3SEFA 4ROTA 5IDQA 2NU9A 3RT9A 1DTEA 1NHGA 1PUXA 2J07A 3IQWA 4RIGA 4TLCA 3C6BA 2JLRA 4O4IB 4ZXFA 1Q7TA 1ZEMA 2JLUA 5L3QA 3OTOB 1DC5A 4JNCA 1SHKA 5KTNA 4EI7A 2B8NA 5K3SA 3MNFA 2WW8A 3T6KA 1V25A 1XGKA 2EJWA 2O07A 3O8NA 1DFHA 4AECA 4DPLA 4YR7A 1DIBA 4Q7LA 4LXXA 3W2EA 1L4UA 3ED5A 3LXXA 4QG3A 4L4XA 1R3UA 1QTQA 3EHEA 5FBKA 4ZU6X 1NGSA 2QDKA 3HMKA 5GIOE 3C1AA 5HZMA 1M72A 4W1QA 3QJ5A 4KV9A 5U4QA 1IHXA 1P0QA 4FYPA 1DDIA 1G18A 1GQYA 4PLGA 4Y67A 5ICSA 4EA9A 5B7NA 4INOA 2EJCA 3DE5X 1NI5A 2CSUA 1T1EA 1G8PA 2LE0A 1AHNA 1DBPA 1T5TA 4FGUA 1T8WA 2FJ0A 5K3EA 3C6MA 4QTXA 4U6NA 4CM4B 4E03A 2JAUA 2PUWA 3K1TA 3RV4A 1PN3A 5KNLA 4UBNA 2CXUA 1BDIA 1XBTA 3IP9A 4O6VA 3RYFB 3O94A 2OP1A 3QKRA 4C4PA 3KUDA 2QLBA 4BN5A 2CMFA 1HT1E 2IL1A 3K8YA 3VH3A 2HWYA 4P7JA 3NW9A 1Z07A 4G0NA 1XTKA 3JAKA 1WQ4A 5LMUB 1D07A 3KXLA 2W43A 3HB1A 3STYA 1CUIA 5FBQB 1C41A 2QX8A 3PT9A 2ZAGA 1Y33E 2I7DA 4LDAA 5JDCC 1SGWA 1L7DA 1ZOSA 2O2IA 3SQNA 4QEZA 4BFTA 4B3IA 5T4HA 2PL3A 2CCJA 3EIUA 3AL3A 3L6CA 4FIZA 4H18A 4JWKA 4MUIA 4Q47A 1V11A 2O23A 3FVVA 3G13A 3K09A 5B2EA 3FHJA 3R0ZA 4HLUC 1IXZA 3FRJA 4LC0A 1X77A 4RK5A 1D1TA 3H42B 5KNDA 1N57A 2XMSA 3R6LA 4KSCA 3GYBA 1LK7A 2Q6OA 4PCAA 5ESDA 4DLKA 3KETA 4IDDA 1JQEA 1OLUB 5BR4A 3GXBA 2I76A 4N65A 4OUDB 2AYXA 3SR0A 4F7WA 1NYRA 1N7HA 3LHKA 4Q6WA 2O3JA 1CJSA 3WQBA 4EG1A 3OQ6A 3KD3A 4FQ5A 4BVBA 2GF0A 3CINA 3OHSX 4QFMA 3K9NA 1E3JA 3OPYB 6ADHA 3CN9A 2AH5A 3WJAA 5HZKA 4Z7OB 4MYTA 1NC1A 2PSEA 5JC1A 3T4PA 1NVTA 3GK3A 2QAJA 3H6GA 2QMHA 3UJ7A 1SHZA 2YINC 3OZWA 3VR6A 4DMKA 5LUAA 2I78A 1G19A 2HI0A 3W6ZA 5LWQA 4G1EB 4EA8A 4RK7A 4X44A 3KXKA 4Y2JA 4PLHA 2YZ7A 2QGZA 3LA8A 1YR2A 5LLSA 1RKVA 4HTFA 5I8WA 1K63A 4UUPA 1H85A 5AKJA 5AKIA 2IEYA 3QWFA 4QDUA 4JI4B 2GHIA 3E9YA 1AUPA 3AUSA 3JPYA 2Q6VA 1I51A 3RABA 4RSGA 5IC4A 3Q2KA 2C4KA 1C8VB 1LNQA 4AY4A 4QU8A 4XB6B 4YCBA 3R7LA 3RFXA 3GLQA 3T06B 1H8HD 3PA8A 4UM9D 3IL2A 1QRRA 1B1AA 4CKBA 5AW0A 5JMOA 1XQ1A 2YN2A 4F5YA 1FLVA 4N5NA 5EPOA 2DFNA 4O2BA 4P2BA 1DC6A 3EXEB 4M22A 2QPTA 3BXPA 3UMSA 3NHWA 4KJZA 4L8WB 2W2OA 4L4YA 3PL1A 3ZHZA 5D84A 3I05A 1GG5A 4JI1B 2PO5A 5IW8A 2Q7DA 4BRSA 2GFIA 1Z7EA 3CKKA 5J58A 1L5KA 1L1RA 2D0PB 1IWPB 5IDVA 5B6PA 4MLZA 5CAEA 2DJIA 3NEPX 3CPSA 2ONJA 1YCFA 3REQB 4NS1A 3BFVA 3QV2A 5DE3A 3K6JA 1I5OA 1KZ1A 3DDNA 4AZTA 1FE8A 1K8QA 1QIHA 2I3AA 2M98A 1TQ8A 4LI0A 4EHKA 2YDXA 4G9GA 5K2MA 4L8FA 2BD0A 4R71A 4NCBA 1HMPA 2ZUDA 4B0OA 4H77A 2QZ9A 3NUGA 2CLHB 1CY7A 2QEQA 3VDMA 5DMHA 2WQ6A 1BX0A 4DCPA 1QGAA 3K0KA 4A1FA 2PJRA 3DLPX 1KBQA 1KVTA 1P7WA 4M1YA 3KEFA 2BI4A 3SYRA 4D8XA 3HY4A 1PU2A 4YCDA 1J4AA 2G07A 1O9GA 3SYLA 1PSDA 2O50A 3OKAA 3MD0A 3D3JA 1O95C 3MLBA 4NZZA 4G0PA 3VPDA 1MVNA 2BGUA 2Q4EA 1YDWA 1TUBA 3LO5A 4YJ2F 1P72A 3TLEA 2FPIA 3A4YA 1OVGA 1B93A 4FCVA 4H4EA 2XH8A 4HRXA 4JR1A 2ANCA 1IOVA 4QAQA 4WSOA 5EAIA 3AUUA 3AY0A 3W9SA 3TN7A 1ATZA 4DRYA 1RZRA 2PBLA 1HQKA 4QJIA 4COOA 3I12A 3AFGA 2BTOA 2VZ8A 1C9KA 3E27A 3AH8A 3H1GA 4HYTA 1NLZA 1VLMA 2VPWA 3NHLA 2DGDA 1EVYA 2CMDA 1E63A 4GWKA 4CN8A 3VJRA 1EUCA 2O8VA 3OEEA 4MYHA 4R3WA 1C0LA 3WWYA 2AF4C 2X5NA 4RK1A 5TQ0B 3RVOA 3LTNC 4GOMD 1E5DA 5LYJB 1BXRA 5KVAA 2ENUA 1OLSA 3LS2A 5IDWA 2H1SA 1PLLA 2XVMA 4PC7A 3D7SA 2JGJA 3TIXB 4Z8YA 4X92A 3HV0A 2HMSA 1BMQA 2R2GA 2OLEA 3Q8MA 2I67A 4LF8B 1E2UA 1H6CA 2B2XA 4QXRA 1SO8A 3PHGA 4DJAA 1HE8B 2ZRNA 3SU8A 2JAHA 4BKUA 1ZICA 3UHOA 1AS3A 1EINA 2YX1A 3R1IA 1GTL1 1UBHS 2V6JA 4FN5A 4QVGA 1A50B 4MRAA 3SE7A 1PL0A 1YIDA 5IHXA 4KREA 1U94A 1ICEA 3UV7A 3BWEA 2BRUC 1LD3A 4UUAA 1AK1A 3EE6A 4RFSB 1C7JA 1D2EA 3DV9A 3PI7A 3UOAB 2CKDA 3HCDA 2LVBA 3WWCA 2J9FB 3F47A 1VLQA 2JJ2A 2N9UA 2Q3JA 3KR1A 5J4LA 4H3HB 1I7PA 1W96A 2HM7A 1V1MA 5IBRA 3CIOA 4JGGA 2GN8A 3RO7A 1NBHA 3IUYA 3NHKA 4HNGA 1M2WA 4DLAA 5LQCA 5LD2C 1SBNE 3TQTA 5J4YA 2IFTA 2X2EA 4C20A 3KBOA 4LFBB 2XOKA 1ITZA 3OQHA 4B1FA 2I9PA 2IBSA 4MWEA 4MKXA 3Q40A 3DEAA 5K99A 1TJ4A 1U90A 2WAXA 3AFHA 3CZAA 3MQ4A 4JKOA 4I3GA 1A4RA 3P2EA 5LNK1 3VU1A 1GTG1 3RUIA 1EBFA 3ZJYA 4BLQA 1QVWA 3H9GA 2IH2A 1EXMA 5BURA 4LXGA 3VVCA 2XE6A 3ECSA 1QE5A 2VQSA 1YB6A 4N8DA 4OXRA 3EFOB 3R9XB 3LUAA 3G8BA 5L4SA 3MUNA 1XMSA 3WL4A 5U9CA 2Z5GA 3N2ZB 2QUKA 1NOIA 3W5CA 1OILA 3H0KA 3RYHA 3U7QB 1UOEA 2V0GA 4WL0A 2ID7A 3A26A 1DRUA 3HA3A 1PSWA 1TFUA 5MGBA 3IBFA 1U0GA 3VJKA 3J81A 4I36A 1C7FA 1YL6A 3RF6A 1Z82A 1I01A 4TSFD 2BWJA 4IRUB 3EIHA 3I83A 3TCKA 3EMKA 4D9KA 1R6AA 3BK1A 2VP6A 5DNUA 1PZEA 5E3HA 3DV0B 1XCLA 1YJXA 4QC2A 1WF6A 2EZ8A 4A3SA 4AUMA 5BNTA 4I9GA 1ZS9A 2ZR0A 2P78A 2WMOB 2WVJA 1DKRA 2ZTUA 1U1FA 2PBZA 3CNQS 3OE1A 4MYDA 4RD4A 4XARA 3PD1A 5KYKA 4EUFA 1ZDMA 1WUYA 1AF4A 2AGVA 3DFKA 3IQFA 1AGRA 3K0BA 4BGIA 3C6ZA 1AB6A 5E1DA 2AI3A 3TXAA 4CM6A 5LQSA 5EIEA 3FGPA 2B7BA 1GDDA 1YS9A 4OKNA 5JH7F 4LHXA 3IALA 5L4NA 2I4TA 5KMGB 4NHEA 4BO1A 4P1ZA 4CFZA 1YS6A 3O8DA 2EFCB 2JCXA 4HXGA 1YFKA 3V8PA 1ILWA 3C0KA 3SNKA 4N54A 3BUSA 2B61A 2XHZA 4F1KA 4U7HA 4ZVVA 4I50B 1X1AA 2F3QA 2AUMA 5KPDA 3H84A 3ABIA 4V1CI 1I5RA 3A1VA 1KJWA 1ZL2A 1UR5A 2NNLD 3A11A 4Y6GB 1OI3A 3MTDA 4NCXA 3AJRA 2C5EA 3UJ6A 2I8AA 2O19A 3H04A 5C0OE 2VDWB 1DARA 4O4LF 4WFIA 2M6RA 2WHQA 3ZWQA 1RKQA 1XELA 4FFRA 3ZOKA 3CRW1 5TF4A 2CFIA 4R40A 3STWA 1IUOA 2PWAA 1CETA 5CNKA 3PQCA 1JQ5A 3WYDA 1GPH1 4DQ0A 5DLEA 4EO7A 1N0WA 2Q3CA 4QQKA 3CO0S 3NVMB 4QUHA 2MDTA 4KOEC 3VR5A 1G98A 1FZQA 1Q0SA 1TM2A 4E3WA 1E4VA 1VI2A 5KWJA 3DTTA 4R3UC 4XJSA 2Z8ZA 4N48A 1CJTC 3LC7O 4EFKA 1K5PA 3HU3A 4NBKA 5CYFA 3D0RA 2VTBA 1OXTA 2YFHA 1THTA 4R1NA 5AW5A 3RF7A 4S3MA 3U61B 4UOZA 2Z9DA 5HKBA 1C0PA 1R15A 2YUTA 3LL4A 4J0DA 4LX8A 4DV6B 4G5SA 1YVEI 2WTBA 4MV8A 3N87A 2HIHA 3MMNA 3OI7A 1FDWA 4MR9B 2FEPA 4C4ZA 1U8YA 2XEXA 5BYBA 3ZHBA 1F7UA 5F2KA 4F4UA 1T5BA 3CX6A 3IULA 1ZD3A 1ODLA 1V7QA 3BXOA 2FPGA 1HOTA 1FYVA 1ZD2P 3BA6A 3H2IA 4ND1A 1XEXB 4P9NA 5CVEA 2YY6A 4HQ6A 3WBBA 3NDJA 3RK1A 3VYVA 3DHVA 3W6PA 1ZK2A 2A0KA 4XWTA 4CM8A 5K51A 3VNUA 1M0SA 2QK4A 3U4MA 2FPPA 4S1NA 5F23A 2AEJA 3D6TB 1O9HA 1KA9H 1QS0A 2H65A 5G0VA 3P2KA 3ROPA 5I5EA 1Y9DA 2EJTA 2GEUA 5M7EA 1EJ6A 1UBOS 2ANBA 2XTAA 3WLJA 4MK4A 4V0MA 1S3FA 1ZJ4A 2Q0HA 3OEHD 4IF6A 4CTJA 4MB0A 1A5BB 2YQZA 1V8FA 4NJMA 1NN3A 1UBKS 2DX7A 3HZOA 4QPZA 2ABWA 3SM9A 4EPTA 5JJKA 2QRJA 2UYGA 5KNBD 2MMGA 3H9CA 1F9EA 3V34A 4CF4A 1J9ZA 1NZDA 3ZIDA 4J1QA 5I4CA 4Q1DA 4LV5B 3UV3A 3EFEA 3HUUA 3VSDA 1O94D 2JDIA 4IS2A 1ZH8A 3DOUA 4KRXA 4XX0B 4ES6A 1RWPA 2CLLB 5ALGA 3U44A 3E15A 1D5WA 1E1CB 2AD5A 2WWHA 3F6SA 3HWX1 4RWZA 3SM3A 4M89A 3HVKA 2FOXA 1EDDA 4IZOA 2HU7A 5LMNB 4QRHA 2BGGA 3NVKI 1F12A 1UOPA 3HJRA 3O1JC 1U7ZA 2ONZA 4LX0A 4UPDA 4IWXA 2V6FA 3KB1A 3AO0B 3TRJA 5EIBD 4ARVA 5H16A 2COEA 4MRPA 1T2FA 4RETA 5IKEA 1AM4D 4IQ8A 4MVXA 4P33A 4UMEA 3L7CA 3RVLA 3NUQA 5CFQA 2BGIA 2J33A 3R5KA 4YA6A 2ZCJA 3R40A 1RWXA 1NW5A 2DFPA 2O8DA 4B32A 3OU6A 1OOEA 1QHSA 1W2WB 1WUTA 2EFYA 3LFTA 1ZL0A 3RG2A 2G7ZA 2WWXA 3ZGZA 1OHHA 1BQ3A 4ZZ2A 4D0NA 3L8DA 3W4JA 1YRAA 2VEDA 1MPXA 5AVZA 2VZLA 3G89A 4EY5A 3HK2A 4MITA 2GJKA 3A2LA 3ETNA 3OJ0A 3IOBA 4JP5A 2XUOA 4MVJI 5JLJA 3ADCA 3NHYA 4IGAA 2E21A 2RGXA 4TMTA 4WBNF 2FN7A 1MBZA 5AVXA 1HRDA 1SKUA 3IAXA 4IEFB 4P92A 8AT1A 2ZJFA 4CM9A 2GKSA 4CG1A 4NMMA 1CG6A 1P29A 1WF3A 2ZOSA 1E3WA 4BAGA 1ORDA 1JQKA 1M34A 1VIVA 1N5MA 2C1EA 1A9QA 1QCCA 3AFNA 3FVRA 3HR7A 4GEKA 1DTWA 3H7AA 9LDTA 2HT1A 2OCIA 4P3YA 4QFDA 2O3SA 3FHTA 1ODKA 5AM2A 3T9DA 2H2FA 2ZP1A 4DEVA 1BW9A 2B69A 3BWMA 1FYEA 3GT4A 3KKOA 4MHOA 3HRIA 5EZSA 4FGKA 1WA5A 1MFPA 1LFDB 4RQAA 1P19A 3SEZA 2HRBA 4Z9XA 3WQQA 1NIJA 3MUEA 3NATA 1TA9A 3H8WA 2YHIB 4H1HA 4ZQBA 3ES9A 2VRCA 3G1UA 3OIFA 5K1ZA 4U2FA 1KI7A 4KQ9A 4DR7B 1FXUA 1XNJA 1MB3A 1B8NA 1A5ZA 2RBKA 4JBXA 3OJCA 4HZIA 4M38A 1L4MA 2QAGA 1BH6A 3MJVA 4LY9A 3LDGA 4WESA 1GAQA 3UIEA 5C8ZA 2DPGA 1JE1A 3HJTA 3JWJA 5B2ZA 5IJ0B 4AQDA 1KF0A 2FF5A 3W2HA 5BYKA 1TCBA 1L4GA 1VJ0A 5KI6A 4C6TB 1A8QA 4MUFA 3GBVA 1LW7A 2FW1A 4V38A 5M2QA 3KE9A 2VHZA 4GE0A 3ZEAA 3HWRA 1VIDA 3L8CA 3ET5A 3OCXA 3CURA 1AZSC 2GEVA 3JQEA 4M0UA 3PICA 2OGTA 4PYQA 5GONA 2E48A 2ZUUA 2H18A 4G63A 3FTFA 2GR9A 4K9PA 4EG4A 2FVXA 1BYUA 3VJLA 3V1NA 1XUOA 1ZM9A 3ZDQA 2ZIXB 2C9YA 4OHRA 4RXMA 4FYWA 3WKBA 4TM7A 4HVLA 1GV1A 1NRJB 3NDPA 4KVFA 4AZWA 4BX3A 3P27A 1MOZA 1VL6A 3LYUA 1JR6A 2FR8A 5B30A 1G6Q1 3DL7A 4I2VA 4AURA 1R4MA 1LTHR 3HDGA 2F8MA 1Q6ZA 5KHLB 1YE3A 2ZJZA 5H59A 2C9DA 2B8TA 3LHDA 5F5XA 3MW8A 1ETUA 1QCYA 2X1MA 2GYWA 2BE7A 4UBIA 1R9NA 4OQDA 1BD3A 3Q98A 3L05A 4YX9A 3FI9A 3P71T 1CXZA 3PCRB 4Z86A 1PWHA 1ORRA 3CF2A 5AJHA 4QTTB 3O31A 3O8OA 4PG4A 3GFVA 1DJOA 4R6XA 3ET4A 5IULC 2CNWD 2DPHA 3QX7A 3Q1LA 1W87A 3MYRA 3TRHA 3EASA 4DLWA 3F2IA 1ZUWA 4MGYR 2JH3A 4UDOA 3NDIA 4U2EA 4W6QA 5G3ZA 4FDAA 4HDSA 1DC3A 4DC9A 2IODA 4KBFA 2J32A 4KQWA 1DDOA 3A6JA 1VA5A 1Y5NA 3WGUA 2HLDD 4Q5IA 2H2DA 2GZSA 5ESWA 3ZHCA 4L9SA 4KRFA 1C1YA 1U5AA 2C9BA 5D51S 3OFNA 2OFFA 4URUR 3RIEA 3GJ4A 2H0QA 4A0SA 5K5EA 2UXCB 4PQGA 1DWUA 1KZ4A 4HZUA 1TTQB 2A5LA 2FEOA 3RT7A 5BSFA 4YV2A 1EESA 3I9V1 3W2IA 3OPQA 3KWFA 3DNMA 4C7JA 1UKZA 2P6RA 2VAVA 3DE1X 3I2GA 3PJGA 2O3TA 3E2IA 3WKDA 4LWOA 1JAHA 5DEIA 1YVUA 2PRYA 3Q3CA 1FP1D 3R5TA 5CFNA 2BHRA 1NVGA 3WX0A 2WT9A 1H4QA 4HDRA 5DBEX 3KVVA 3LPCA 3V00A 3FUXA 5M5BA 1LPNA 1A77A 1DQPA 1VPLA 3PWKA 4PFQA 4TTTS 3ZGVA 1KEKA 1VE1A 3AJDA 3QE2A 4ALKA 4ETIA 2H29A 2P9CA 3D3KA 1PR5A 2XNSA 3IC5A 4MKZA 2YFQA 1TEHA 1IN6A 1HT2E 4WBNA 1RWOA 1MB9A 2ODEA 2ORVA 2HL6A 2X9QA 3GMTA 4JP3A 2H4XA 2YYSA 3FH0A 4IICA 3ICVA 4IFTA 1J07A 1WPRA 1CC1S 2NG1A 4WK0B 5DBIA 2FXVA 4G4JA 4K9NA 4NTZA 4O1MA 3EPLA 4Q6BA 4B3JA 3HA2A 1CZRA 2UU9B 2N75A 2VHTA 5E1MA 3HN2A 4GZ6A 4X65B 2P77A 1LSUA 5TPWB 2CWWA 3EZXA 3T4EA 3R4VA 2H8KA 5BW4A 3OHPA 1PFYA 4MUXA 2H0RA 2D7DA 4DUZB 1KDTA 3Q0TA 4EJ2A 5D01A 2O0MA 3UAXA 2O2JA 5GGXA 1L4YA 2P4HX 1KDPA 4ZI5A 4YV7A 5A9SA 2O6HA 2W71A 4TS4A 4ZQCB 2BKVA 2FWNA 2RI0A 2YXDA 3JU3A 3NANA 3DAPA 3LBHA 3A28A 1HPLA 3GCZA 3QI2A 3L8EA 1KFCB 3EUWA 1A04A 1V1RB 5LZ4A 1PAUA 1AO0A 4KUHA 3IOCA 4JJEA 1M3SA 4M9UA 3ZDFA 4JOCA 2G1KA 4M1EA 5E6UB 5IEJA 4OBEA 4R8KA 1P1HA 1G8HA 4PC1A 3SZUA 4PNZA 2BFEA 3V9PA 3OX3A 3QUAA 1W35A 2ZCUA 4R0VA 2AJBA 4WT7A 1FFHA 5ALSA 4FGZA 4RVNA 5JXGA 3U26A 1W85A 2ZUBA 2G63A 4DRXB 5B3JC 3R3HA 1LLCA 3LG2A 5C5CA 2B4AA 2VNKA 3ZXYA 1S3SA 1E4EA 1I4TD 4PWZA 4H4CA 3EVTA 3UUGA 2ID9A 1U9CA 3GEHA 1VJ1A 3KOYA 2NU7B 3HYTA 4R1QA 3Q15C 3FLAA 4RA9B 1F5SA 5HUQA 1E98A 3F98A 3D43A 5DWVA 1JFFB 1RYYA 3A3PA 3ZWOA 1R00A 3GJRA 4LWZA 2GEBA 2FR1A 2VPZA 1P2FA 3S2YA 4L4RA 2IY7A 4ERXA 4DV1B 3SS8A 2ZIUB 1OZHA 5IF9A 3MHTA 2R66A 3EDCA 4PLWA 4EO9A 1P17A 1L3IA 1Y63A 2VH2A 5ALLA 2P30A 621PA 2JARA 3FPCA 4JT2A 3T3OA 1MEOA 3LKZA 5ANRB 4WZZA 5K0NA 5FWNA 1XRMA 4MINA 4W9RA 2ZAOA 1NW4A 1JZTA 1J8VA 1SCDA 2PX2A 4HNAB 1YDMA 5IYZF 3GJ0A 2NZ8A 3A4MA 3KYDA 1VOTA 1X0VA 4MAFA 5ED0A 2QMZA 4YT2A 4HDMB 5NLLA 4KE8A 4JELA 3OWOA 4MR8A 5DSXA 5LP1A 3C2QA 2VQDA 2XB6A 1C9NA 4R81A 1YOVB 4TYNA 1GA1A 2X1LA 4JXJA 3QJYA 2AL7A 2D0IA 2EKPA 3I2YX 4JIMA 4XIIA 1Q15A 4YCAA 3A6HA 3WFIA 2H0AA 4CFYA 1JU4A 4RTKA 4HYQA 3VYWA 4Q19A 1JA1A 5CNJA 2H1VA 3PFNA 3G5AA 3IYLW 4PZPA 4EKEA 2EG5A 2BSXA 4HB3A 5DLQC 2MT9A 1ID1A 2EWWA 4OP1A 1VLVA 1JXQA 1WY7A 1XMIA 2PFSA 4UUBA 3K0AB 3UW3A 2R62A 1KVUA 3E70C 1M2EA 2YW2A 1TUGA 2G04A 2PANA 1JT2A 4C5AA 1H3FA 1SBCA 1UDBA 3QWHA 5B4TA 3AWIA 3I2JA 3MINB 4L95C 3VPHA 2FWBA 1XJWA 3ISJA 1CR6A 5IK2A 2IZZA 3VKWA 2YMQA 4URYR 1ZSNA 3KOWA 1XG5A 2QRUA 1CJVC 2GMWA 1XEAA 3STUA 4G81A 4BZWA 1V5FA 1GGFA 4RLSA 3SC4A 1Z4JA 1NT2A 1UEIA 2IYQA 4GE3A 3MTAA 4QT4A 3EUFA 3LA6A 2C92A 5A4IS 2FRDA 4P3NA 1JQLB 2BCGY 4O29A 1C7IA 4DSAA 3SX4A 1KAEA 5HIJA 4NECA 4RCVA 1N3YA 1KBZA 3EEIA 1G16A 1I1NA 3BGOS 3KZCA 3CLTD 4HWKA 1Z83A 4MW1A 5E8JA 4EDFA 3PEWA 4C0QC 5ALFA 1CQPA 3N59A 2H54A 1FNNA 2JGKA 2YXBA 4J49A 1MJHA 1SVLA 3NHRA 3BJIC 3NOXA 3M9WA 1JG6A 1JVNA 1DPFA 1A9YA 5BVGA 4XH9B 1E2FA 2KBEA 5AW9A 4DARA 5DYTA 4YHBA 4INAA 1FDSA 4U7WA 1YZFA 4JLVA 3IAS6 4KXLA 1YZLA 4PRZA 1Z63A 5BNWA 1T6YA 4URVR 5DMXA 4KRYA 3VSEA 4M55A 4MQUA 5HDBB 3QMMA 3EF0A 5FPYA 2ADMA 3IR6A 2BP7A 2PV0A 3FVTA 5J1TB 1Q1BA 5LOVB 4BCCA 1TECE 1LV8A 1WWKA 4JZKA 3X1WA 4J16A 3MPOA 3ILYA 3Q6NA 4PLPA 4PSUA 4E15A 4ZDJA 4WY8A 4QUKA 5DH9A 3NYWA 3G5UA 2P2LA 1FRQA 3IOEA 3DMRA 1TLTA 3A4NA 3GEDA 3HBMA 3BD7A 2CYBA 2NYAA 3QTLA 2WM3A 3BWCA 3TDNA 4DLTA 5IYZA 3B36A 3TXXA 2Z58A 3EULA 5I48A 3OPXA 3VR1A 4XWOA 4QXPA 5DTMA 3D1JA 2AS0A 1JJBA 2DVMA 4NV3A 3CLSC 3OQNA 4R9VA 3LO8A 4F04A 3JAKB 3ZDCA 2CL7X 1UQUA 2VPPA 2VK4A 3S2FA 1QH8A 4WZBB 3F3SA 4B73A 4OHYA 1KETA 4Y6QA 4UASA 4BJ3A 1DIHA 1V8DA 3DKVA 1QTNA 1YQWA 3KLMX 5KTTA 1CNMA 1E2QA 1TC2A 4ZO9A 3UMGA 5SICE 1KTIA 4MVWA 5AI9A 4YWHA 1V11B 1V2HE 3OMWA 3LBIA 3PRHA 3M83A 4LNAA 3UMJA 5LQNA 1R8YA 2Q3BA 2Z57A 2VDPB 4HGRA 3ED1A 3RE1A 2PJZA 1LA2A 3EVNA 3R6TA 1L7PA 4OCZA 2BMWA 3NBUA 3FGOA 1UOQA 3REOA 1TA4A 3O26A 4A6PA 4KR6A 5K6AA 1UBJS 1CUGA 5D1HA 2JLZA 3ETDA 3JY6A 2X19A 3KPYA 4L8LA 5ELLA 4RPHA 4KWEA 3RYIA 3R7FA 2JIOA 3AR3A 3NDRA 3QY0A 3WIOA 3LUJA 3IIEA 1I8TA 4URZR 2I1VB 3HB5X 2MR5A 2A30A 1RI4A 5CT9A 1N5JA 1SUSA 1T29A 2QZPA 4AIIA 4BP3A 4YYZA 3OFKA 3QWIA 1VPEA 4X1OA 4IJ5A 4BWGA 1BOOA 4AY3A 1BJTA 4DWJA 4DJFC 5BWMA 2DWUA 1RPTA 5UKDA 1T8YA 4UTNA 4FMPA 1SOVA 4WQMA 1RRGA 2A57A 4XJTA 3RUCA 1I4LD 1KC3A 1CUBA 3K7EA 2P4UA 3RNOA 2IKQA 1KFEB 3C3AA 4FOSA 4NJEA 1DCTA 2B25A 4E13A 1JH9A 1C1HA 4CIDA 1ZKDA 3G5LA 3B1ZA 3OICA 1PVOA 1QJCA 2KLHA 2YZ2A 3H8VA 3W5SA 1FTYA 2QLNA 3HQ4O 1Z3CA 5BSTA 1TA0A 4RVHA 2C5SA 2JIBA 3MJTA 2GLTA 3A6ZA 4C4OA 4WE3A 5IJAA 5KNCA 2RAFA 2C7GA 2QA5A 5AQEA 2G9NA 2A5YB 2QJTA 2H17A 4CLRA 3C7CB 1GSIA 2JGDB 4JVLA 4O2BB 4BKPA 4CKXA 2QTVB 1YTUA 4JYCA 1KY2A 4IG9A 5AIAA 3TL3A 2UUCB 1N6IA 3DLTA 4EVIA 1PEYA 1ULHA 1DJNA 1XDBA 3OWHA 1LLFA 1XTPA 2QTFA 3LQKA 4G8JA 3FIJA 5BRJA 3WAGA 5IVDA 1KAHA 2GK3A 4GU5A 1Z2DA 2PKQP 3I32A 5CAEB 2YWRA 1NQAO 3EEOA 1Y6RA 2B4RO 2O2HA 3DOHA 4O2AF 3L6DA 3OZRA 5CNMA 5JSFA 2HF9A 4CQMA 1E96A 1WP9A 1FFCA 2H5JA 3S2IA 2WV9A 3T54A 4BZZA 3L3BA 2LW7A 1WXQA 1VG8A 3WSTA 4R6WA 1N6LA 3GVXA 4ETWA 1AX9A 3PC4A 4QG7A 1QP0A 3TEMA 5JZSA 1PR9A 3ENWA 5LZ2A 1RJ9A 5LN1A 3BGIA 2XE4A 3HL0A 1IOZA 4RVUA 3AEUA 4UXJA 4I9UA 3DHNA 2GD0A 3RRFA 3V42A 3ZCQA 1NVBA 4R54A 5TRTA 4X62B 5EE9A 3PWZA 4HHEA 4L3OA 4HOYA 1TUBB 4R1UA 2RHWA 1P7ZA 4KUEA 1K7YA 2FPIB 4JDPA 4QD3A 4QQ8A 5B1EA 5ECYA 4HMPA 3QM1A 3NT4A 3K2BA 3L7JA 1PT7A 1W30A 1MV8A 2FQQA 5JUWA 1ZH6A 4ZXPA 2B36A 1ZOPA 4UNIA 1MA3A 3Q10A 5ALHA 3VR3A 4Z1OA 1P2BA 3O8RA 4ZFNA 3IQDB 3PHCA 4PGFA 1T2AA 1Q74A 2KMLA 3C6XA 3O2JA 3HDJA 4FEYA 4R4JA 3VKVA 3ZI0A 2V4MA 3E05A 3HXMA 4QBFA 4CEHB 2XGJA 2YJNA 2YW9A 2P79A 4TROA 5AOCA 4P54A 4RK6A 2QR3A 1G8MA 3N75A 3TOVA 1EUCB 2F43B 2IOHA 4WVFA 1KZ9A 2VI5A 3WJ1A 5LBIA 4KTVE 4ZVNA 1GXSA 4TYQA 4OHCA 4GMHA 3OU2A 4YJHA 2B99A 3DHEA 1LI7A 3ZDRA 4RUKA 4BLTA 1JTVA 4RVFA 3M5DA 1DXQA 3HRKA 4RABA 1BXRB 5DTJA 2RK3A 3Q12A 3AJEA 4N5LA 3TR0A 2VUUA 3A7EA 1PUJA 6LDHA 1ZM3A 3UWKA 2NZWA 3NFRA 1P2UA 1KS9A 4ZAFA 1XNQB 3H3XA 1CTQA 1UXGA 1ZVQA 1XRQA 1QFYA 1OI7A 4DMGA 1DNPA 1X0XA 2X0NA 4F2PA 2O7RA 4Y9UA 3ZIAA 1AGYA 1WZIA 1KZ6A 3O93A 1JIXA 1HZJA 3EN0A 3GNQA 3V2IA 3M6AA 2FLKA 1NR1A 1SVIA 3I2FA 2YWJA 1X8JA 2FSFA 4GRAA 2JIMA 4NLLA 5CFZA 4IOMA 3KZXA 3L6EA 1L4EA 4WFQA 1OT3A 1GHTA 2XYHA 1N1MA 2J5RA 1K0UA 1QNLA 3DZGA 2F17A 3HC7A 3KVOA 4GG1A 4I4NA 4RF5A 1NUAA 1XQVA 4IVQA 4G2TA 1W5BA 3T9BA 2QI9C 1KEEA 1ZBDA 4KL8S 1CRZA 1YB7A 2VLIA 3IO5A 4O2AA 1DAMA 1EP3B 4TSKA 1ULBA 1LBHA 3D7LA 4WFKA 1V1MB 4Y9TA 1F8UA 4MQ5A 3C43A 4ZEWA 3GJ5A 5DT2A 1M0WA 1W4ZA 4YCMA 7ADHA 2PNJA 4QYMA 2PGNA 3K32A 3OF5A 4DMLA 3BXHA 4KO8A 3RAEC 1GYQA 4BFYA 3UJPA 2IYPA 2I54A 5E0OA 1S2LA 2B4YA 2BF7A 3SFTA 5CNIA 3TG2A 1DAPA 3G0CA 3DXFA 4JS0A 1XVLA 2QTBA 5CJPA 4E2XA 1MIHA 4D74A 2QLFA 4WY5A 4PQEA 1MT3A 3C70A 4WASA 2C84A 3I3SR 3WRWA 5D7BA 3I8SA 3H18A 1YE8A 2YQ5A 1VL2A 2PEZA 1SKYB 3A31A 1VIYA 1SXGA 3IHWA 3JD3A 3NJ8A 5AD1A 1UMCA 3AQ4A 4UMDA 4BNJA 1PGJA 4IR7A 3BRSA 2HHHB 3BZUA 3QFRA 4D9GA 4LYYA 1Q22A 4PFJA 3ETEA 5EEHA 5JHGB 2E87A 3P9YA 1H3NA 4PXSA 1J25A 4QSMA 2PD6A 2B9VA 4PNHA 3SLGA 4F72A 1G2QA 2ZSAA 1F3LA 3EGOA 2BHNA 1ADJA 2D5BA 3OQMA 2HFKA 4NZPA 2O2XA 2ZI6A 3F8TA 4AJKA 5DLDA 3IMEA 3FYUB 3RARA 4LJ7A 1R8XA 5LU8A 1QV7A 4LZOA 1L1QA 1UADA 3C41J 5HOEA 3TO5A 2HWWA 5JCJD 3DCYA 3PL5A 4K6KA 4LA4A 4EHFA 4BNMA 1NVVR 1PWYE 4QOFA 1CHDA 3H19A 4XB1A 2X1VA 2HJVA 4D5EA 4E2YA 3K16A 3C8DA 4G1FA 1UPUA 1MQ8B 1XN4A 1DE0A 2HWXA 4PBRA 4EY8A 4YY3B 5ELXA 3II6X 4B43A 1RMYA 1XZBA 2P2SA 3VR2D 1FFDA 1JIQA 2P5TB 4UUQA 4B87A 1SCQA 1KH2A 1OX5A 2WMDA 3AFMA 1BEUB 3LGSA 4HLQB 4P36A 1QP4A 2BLLA 1I36A 1YS1X 3M6FA 3M7IA 5JAQA 4TTQA 2BMAA 2FSHA 1OWMA 3LD9A 1EEXB 4KSYA 5TPZD 3NV7A 4XQ0A 1FIUA 3P97A 5FXMA 1T5HX 1YL7A 2FZLA 4JXZA 2YWDA 1JN0A 4O08A 2R6CA 5SV2A 5EIWA 5J4KA 1E3QA 2X8LA 1Z4LA 3DCNA 2HHCA 3KQNA 2I65A 3AF5A 1J1UA 3KL2A 2TMDA 1DWPA 4BMSA 3JCZA 2DPYA 1S2NA 3R7DA 3SSMA 4HJRA 4EX7A 2J7KA 1DKQA 4NY1A 1PFQA 4IFBA 2BPOA 3IUSA 3P5SA 2ATVA 2F4VB 4YP6A 2HLNA 4BMPB 4RULA 5BUSA 5EPEA 1RIFA 3T0FA 3U4QA 4NF2A 5AW8A 2HQOA 1T9GS 4H9GA 4NK4A 2J3DA 1E5XA 2XMBA 4ETNA 2WKSA 1B0UA 3ZOZA 3DBIA 3S70A 2JATA 1A5SB 4PSVA 1DELA 4FYIA 3TQOA 4EFMA 4EYSA 2WAMA 2QL9A 1ML3A 3BIOA 4YHHB 1VJRA 5D2CA 2WSSD 1C3XA 3DEIA 1EX6A 1N4DA 3HB7A 4ITRC 4JC8A 1T9GR 3IPCA 4YXWA 4OX9Y 3ER9A 1RAFA 1YJAA 3RHTA 4O8CA 4C78A 1CCWA 3F6EX 3L8HA 3GL9A 4HRVA 3R7BA 3S1AA 4CKCA 2FZGA 1KC1A 3ENVA 3GPIA 3IA2A 4JR0A 4KN5A 4UUOA 5FUMA 1C4KA 1FDOA 3H3JA 3VOSA 3TNFA 2FPGB 1KBOA 4A8JC 2EAUA 4CEJB 1KKMA 3YASA 3Q7TA 4OTZA 4IX9A 2CW5A 2DOKA 1YBFA 2XYQA 4KI0A 4RJKA 4CM8B 2HYIC 1PJLA 2ZDGA 3DYBA 5AJYA 4X00A 5GVSA 4M1SA 1RLTA 3E9NA 4IIDA 4PYLA 4GVXA 1QS0B 3GEIA 1JJVA 1Y4ZA 3ITDA 4IUCS 4TM8A 4IIGA 5DM2A 1ZNXA 2QTLA 5FOXA 5EWMA 3DAHA 4ZT6A 4D56A 1G64A 3OJXA 1CDOA 1DQYA 4FGLA 2ZI7A 1DT3A 4EJSA 1QANA 3LK7A 4NJMB 5CYPA 4FOTA 1CNFA 1V5IA 1WM1A 4S0XA 1V47A 3Q7IA 2IHKA 4UE6A 4DXAA 2V6IA 3FJYA 4A0FA 5I47A 1K92A 5CR9A 1Z8HA 3BCSA 4DBZA 1IVSA 1BWRA 1PR4A 2PT7A 3UK6A 4MQMA 3K1YA 1X1CA 2IGTA 3L0DA 5JMWA 4TLAA 4RF3A 2FW0A 3RI3A 3TW4A 3M2PA 2F3PA 1NXPA 1EP1B 1A72A 2R8EA 3D6VA 4M87A 2XYRA 2EXXA 1ZX1A 1ODCA 4EY4A 4OLHA 1XAGA 2NN3C 4ZCIA 4AMZA 1ESEA 4O0LA 4URFA 2A5JA 1A7KA 3DEFA 4U2DA 1LDYA 2OV6A 3VDRA 3EAQA 3KDPA 2Q45A 3OE7D 3X1JA 4TV9F 1QZUA 1YZHA 2OYCA 4RSRA 1CLUA 1A9RA 1N5DA 3I6ZA 3LXMA 4A7PA 2WSLA 3NUZA 2JAXA 1AG9A 3DO5A 1G2OA 3WK8A 4NWIA 4NL4H 2DBQA 5AI8A 3GLGE 2HRCA 2DEUA 2O8DB 2VN8A 1DHRA 3HXKA 2ETVA 1CR2A 1C7QA 2F1RA 1VJDA 1WABA 2NOAA 2WU3A 4WOBA 3EXFA 3KJHA 3PC3A 3BORA 1VL1A 2CCGA 4NCJA 2VXYA 1QH0A 4MAAA 1RHUA 4YP5A 5EIFA 4ZRDA 3IDOA 3OZSA 5HSGA 1JIVA 5CFMA 2QQFA 1YH3A 4PGMA 4FWTA 4AMGA 4B79A 2V74B 1UJ4A 1EKXA 3N7AA 4GXNA 3B8EA 4NNJA 1M5UA 1QONA 2FFRA 5EKTA 1RFGE 1BN7A 2GF2A 4KYVA 2ATIA 4PONA 4MP3A 4XD7D 2CHQA 5KZMB 2H1OA 2DRIA 3FETA 1Q3HA 1VKOA 1V95A 2ACVA 3IAM6 1NYTA 1TT7A 3FCSB 2DFDA 3KYIB 3NYRA 4MQBA 1DAIA 1MJGM 2FE4A 2PU5A 2PZLA 1CJMA 2UYQA 1TYCA 3NJ4A 2BCEA 3IQHX 4FR0A 1IXRC 2YC2C 4NC9A 1QRTA 1E3WB 2FMUA 3B20A 4N0DA 721PA 1M34B 2XUHA 3GEEA 4JLWA 5F77A 1QORA 2A6PA 1DTWB 3MJFA 4PAQA 1F8XA 4G4IA 4KNWA 2E49A 4I4LA 2XWBF 1OYYA 4RHCA 1RQ7A 2B5OA 1AIPA 1TW3A 1WDWB 2AMFA 3KKQA 3DZKA 3LSYA 2AOTB 4WBSA 4FXOA 3ZZ1A 2HA0A 5C80A 3W6NA 5KO2A 4DYVA 4ZQGA 1U0JA 2LWIA 1BW9B 3NU1A 3EVEA 2V98A 5T5QA 2C5AA 5DNWA 1TOAA 3TW6A 3N8KA 1NQXA 4MVJA 1XLTC 1GSHA 2O1XA 2BM9A 2QP4A 2YN0A 3ABSB 4QDOA 2ZDQA 4FDUA 4Y7CA 2GH1A 1NW8A 3DEZA 2P6NA 2P2DA 1IYZA 2E5WA 2O1WA 1RP7A 3NEAA 2C4HA 3U39A 1KKLA 2Q29A 4J0CA 3DULA 3KM0A 2QAGB 1CYDA 1LPPA 1IVNA 1LC0A 3L40A 4JBLA 3LSTA 4IDCA 1YBVA 4KLZA 3RW9A 5G0WA 4BZQA 1C0KA 4Q4LA 3IURA 4GBMA 2C4UA 1E6UA 1GRRA 1NVMB 4IVPA 3WMWA 4JI3B 1GYRA 3DO6A 2W93A 2V0CA 3PKZA 3CLHA 3ROFA 3UB3A 5KSPA 4GNRA 4Q7KA 3FLMA 3R9WA 2X8BA 1KERA 1TD9A 1HFJA 3H5OA 3JQDA 1XN1A 1M6YA 1XXLA 3DDZX 1F3OA 4X6XA 2QLMA 1C4WA 3WNQA 3MZ0A 2G25A 3LAWA 3M34A 6YASA 1PV2A 3G68A 5AXCA 4OXYA 2WAYA 4GI1A 4YUAA 1UBNA 3E7DA 1PD0A 3KQTA 1SAYA 1ZM2A 1O5IA 4RL6A 3OY2A 1G4HA 5FI0B 5JNWA 1QG2A 4HAYA 1NZJA 4Q4JA 3O4GA 3VUFA 2ZQYA 3FNGA 2EDCA 3VC1A 4DBLC 1T2DA 2IYSA 3CNHA 5AI6A 4BVAA 1JYEA 4P81A 1R4MB 3HHPA 4JEMA 1TCVA 1LCIA 1ZGCA 4Q4HB 5E7IA 3KXPA 2CBGA 4R84A 3T1NA 3T3PB 2HU2A 4HH4A 3OPNA 1BSVA 4ZRMA 3AHHA 4X20A 2X0DA 1GKUB 1ZGJA 1MJNA 1DBRA 3KEQA 2NT3A 3GR6A 3U13A 1A1VA 1YKFA 5J9FA 2JZNA 3KQVA 2J9ZB 3FSJX 4BJ1A 1X8LA 1ZIOA 3COYA 4NU8X 2P27A 3QOYA 1PVDA 1E1DA 3FUVA 4OHUA 4S12A 3R0IA 2IDJA 3RRXA 3WADA 1JU3A 4IWYA 3OHMA 4ARIA 3HFJA 5H02A 3O8OB 4LYGA 5IARA 4F5EA 2RJOA 4CLDA 1WDTA 4O02B 1OKKD 2WJZB 3WNDA 1TQ4A 2DHEA 2IYYA 2G3YA 2ZVPX 3K6SA 3UM9A 1KQ3A 2G83A 1GTSA 5L8VA 5ALJA 1I30A 4KWIA 5WRFA 3P96A 4LBVA 1P5HA 2DKFA 5INTA 3TLGA 1S7CA 4HDSB 1KQOA 2A9KA 3LQYA 3IR7A 1AUQA 3ZEIA 3IT2A 4CL8A 3U6BA 2EG9A 1NOKA 3N2GB 4H1VA 2VNSA 3ORHA 3GJSA 1FLAA 3NWBA 3WRVA 3FDFA 3QEKA 3RVQA 4B6JA 2GRAA 1KJQA 4CKWA 4XWAA 1QO9A 4WINA 5H8WA 4HZUB 4PYKA 1KDRA 3WL6A 2CV1A 5BV8A 1IM2A 5KVVA 1UWKA 3Q9UA 3V1MA 4EW6A 3PP8A 2O20A 4FHEA 5IJXA 4DZTA 3HCOA 4NBWA 5JDIA 3KAKA 1YA6A 2BR5A 2E55A 2YHBA 3MUFA 4PU0A 1GA4A 5A7HA 3V2UA 2HCFA 4HZGA 3W8RA 4AZSA 1G5PA 2AN1A 1OBFO 1YDGA 1Q57A 1QIIA 4HFNA 5REQA 3OZEA 5JPDA 3PHIA 3A37A 1CB7A 2OOSA 3PGA1 2EEPA 1OE0A 1Z5ZA 1F8GA 2C4NA 2NX2A 2NVOA 2OSBA 4CIWA 3HEMA 2A0XA 5BNFA 4CV1A 2HSEA 5BN5B 3I9LA 4EWLA 2JIZD 4GKJB 5KHOC 2C82A 2IQ5A 2V7TA 3KFVA 4DA8A 2QLJA 3VH1A 2HKIA 5FWXA 1F9AA 1R0XA 3MCZA 2FETA 4YRRA 1TO6A 5EKDA 4CR6A 2AX3A 1RVV1 2B94A 3SHTA 2JLSA 5EMLA 1QVAA 1M1ZA 1LWOA 4BQPA 4DJEC 2WTUA 4LK2A 1AV7A 2VQ6A 4DIKA 2B5WA 5ISMA 5AH0A 1JLSA 2Q3LA 3NAMA 4MS4A 5TMPA 3WO1A 3HBFA 3L79A 1ZH2A 4TLMB 3U6KA 2HCJB 2I6TA 3QLEA 1LRLA 4PSKA 4AMVA 3QYAA 4IXWA 2OAQ1 3SF8A 10MHA 1QMGA 4NE7A 5K0CA 4H08A 3B1XA 3HO1A 3KC2A 4NOKA 3PIRA 4TWBA 3BE5A 3A9VA 3N0TA 5A6SB 3D6MA 3FSGD 1GNVA 3T1OA 3MGBA 4UFOA 5A9SB 3ZY3A 4O2LA 1NOJA 2A2ZA 3H6HA 1NASA 3FCEA 3GLVA 3LYLA 4FMCB 1XLWA 3LBYA 3OZUA 1AU9A 1UJCA 4ZI2A 1XVAA 3K4HA 4ZT2A 2DQ4A 3K9BA 4J3FA 1WUJS 1N92A 4JLBA 4UHFA 3RLIA 1XMQB 2H1IA 1O6BA 2P2ZA 1H5NA 1TTTA 1MJ5A 2C2XA 3I52A 1UK9A 4HPJB 2EP5A 2YS6A 1U4SA 2BFEB 4I2NA 3SF0A 4DLYA 2RKBA 3LYAA 1UMDA 3I0NA 4HLNA 3JYQA 5DSTA 2N46A 3BHNA 5FL7A 3SP1A 3V7UA 1SHLA 4IFEA 1WQ1R 3PE6A 3BCHA 5KYGA 2QG9A 3FOFC 4QBKA 1W85B 3UHAA 3Q72A 3JYHA 3PTZA 3CTMA 4OL9A 3CXRA 1LBSA 1E4EB 1BGWA 1HDYA 2WIDA 1YJ8A 2Z83A 2QU7A 4AI6A 5KYXA 4EKIA 3UNXA 1NM5A 2CXNA 4II2A 1V8ZA 3ZIUA 2R751 2VHCA 3PVSA 1N6HA 3U60B 4BUJA 2Q2OA 3H86A 4DQLA 3DNFA 4E09A 2RFLA 4IDNA 4M49A 2P3SA 4XOUA 3K5WA 3ASVA 2QOEA 2R11A 3H9UA 3PNYA 4PCUA 4Z7QB 1JA0A 2GZHA 1FQWA 1S01A 3OQJA 4P6VF 1I2ZA 3E35A 1FP6A 2I62A 3JQBA 4WA7A 2VTEA 4FE3A 3FKSD 3H5NA 4MLDA 2HZBA 4Y6OA 3GJZA 1ZR2A 3GCWA 4W1SA 2XIQA 1F1BA 1Z06A 4J4HA 1N78A 2PUVA 2CNDA 2RGNA 3IMKA 3KYDB 4FLEA 4MEAA 3RM3A 3KSMA 2CHVA 2DTEA 3V1LA 3K05A 4E2FA 3KB6A 1ZMTA 3ZCUA 3CNBA 1W4RA 4N9QA 4HKTA 3AU9A 1R0BA 4B47A 1WKBA 3FKQA 5HNKA 1L5LA 3IVRA 4BASA 1GTJ1 4REQA 4BNLA 1GEEA 5BSVA 2YKGA 4M3NA 1GKKA 3G1WA 4UU8A 4WNAA 4EG7A 5A7FA 1LSSA 4PAWA 3GMSA 5JJBA 5JI3E 5K0ZA 1RU3A 2A9FA 3OTHA 1TZBA 2V3VA 3HCRA 3N0XA 2QG4A 5AICA 4LCBA 4IH4A 3R76A 1U0SY 5IKPA 1HE5A 3FNIA 4B80A 2JA2A 4IX1A 2R8RA 5B4UA 3LZDA 2OCBA 5E9JA 5AJUA 2R4QA 4DILA 1FU7A 1Z2PX 1FVOA 5F7JA 3DWIA 3WIUA 4B74A 3CNNA 4HP8A 1JECA 2AFVA 2KI5A 3W77A 3CPEA 2ROQA 2RAPA 3HJBA 4FFBA 1PKEA 1PQUA 4PZEA 1GPNA 4NNPA 4DQVA 2RG7A 3HWSA 1AZLA 3HWWA 4G5OA 3EEFA 3MFQA 3SFVA 1E8NA 4D1YA 3E4CA 4RIIA 1E79D 2ZJ0A 1N1DA 4PN3A 4RK4A 3F9IA 4J29A 2PWZA 3BM5A 1N4AA 5DN6D 4LNHA 4DCMA 1LDBA 2R7KA 2WSBA 3T95A 1GPKA 2YDYA 1D2MA 3VYRB 4D0RA 1F51E 1T9AA 2NPIA 3MYYA 5AW7A 3MCVA 3QLTA 5I3CA 1NONA 1GUFA 1QH9A 1B1CA 2VSNA 4WXRA 1VQ1A 1WKVA 1AQ6A 4MIEA 2B1IA 3EQ7A 5BVGB 3LC1O 4NP6A 5SY6A 3VNQA 3SJAA 4PG8A 2B2NA 5CXQA 3GDFA 4IEEA 1WXGA 4EB8A 4HR7A 2B21A 3PFGA 1J2JA 3L7OA 5JFGA 3HR8A 4ZGGA 1YI8A 2BP7B 1KDOA 2FPUA 5JZMA 4JXXA 3C8ZA 1EWRA 4XIFA 4EI8A 5KC8A 3H2SA 3JX9A 3FCYA 4EHLA 1XNGA 2CK3A 4RHYA 1OB2A 2EFDB 2CL0X 2R44A 4C21A 4WCDA 2R8BA 3VA7A 1ADBA 2EFGA 3AUFA 3EHDA 5AJTA 2DFKB 2YZNA 5IYZB 3FOEC 3WXMA 4TS9A 4I46A 3AW9A 3T5CA 3ONFA 3VO8A 5LNK6 3L02A 2JANA 2JBHA 2AUNA 3GEPA 3RV3A 4DHWA 1ULSA 5KNDD 1GFSA 1RS0A 1P4RA 3IH5A 1NU6A 1QH8B 4ZAGA 1SRRA 4K9LA 4B7CA 4UQPA 3PNLA 1Y3AA 5LMCA 4LF7B 2RH8A 3QU4A 1JDJA 1V0JA 1JFRA 1HI9A 2XPCA 3I42A 2IU4A 1TUEA 2VAMA 2PMFA 1Z62A 4URXR 5C37A 2GPWA 2QM3A 1YVPA 3B3JA 3L49A 4EKGA 1X1BA 2Q5IA 2DFTA 2GF9A 2UZ3A 1ULUA 3SKXA 1F06A 1GA6A 1JH8A 4FJ1A 4Y1RA 3VR6D 4EEXA 2PQ6A 4TTAA 3RYIB 2BH9A 1F6DA 4Z9BA 1H4VB 4FDMA 1YB2A 2CMHA 4NATA 5A3SA 5G4KA 2P1ZA 2LIVA 3HPQA 4F7DA 2E4UA 4NZYA 1BVUA 2PMEA 2ZU0C 3TZLA 1O8BA 2MSCB 4KITB 1ZYUA 5D3KA 2YV2A 3U7RA 3LUBA 3P9CA 5K8LA 3OA2A 2FFHA 3ZHVA 1U6IA 4YRNA 1XWWA 2GKOA 2ICAA 1I4EB 5JCOA 2EVWX 4IO0A 3ZKWB 4HPXB 3D7NA 3NNDA 3CUTA 2OD7A 4X61A 1U2RA 2PXCA 1CP2A 4YC7A 3MJCA 5FRDA 1GLVA 1LDEA 1G5QA 1Q0QA 2GEKA 3VX3A 1YR3A 2HC9A 2OCKA 3GQBA 4MRRA 1K3UB 1B6SA 3G0GA 8ATCA 3BEDA 4Y0VA 3C87A 3B6JA 4GAEA 1KQNA 3PR2B 2DFLA 1G8FA 2X9LA 1SM4A 4PFKA 1WTCA 3HRHA 2V7BA 4XI9A 3UY4A 1LDMA 5CD9A 1G5FA 2AKEA 4HB4A 4FSXA 4BFWA 5A03A 1VHJA 2V7WA 3D5TA 1VMKA 2F48A 2W8ZA 2HW8A 5DW3A 5AXDA 5C18A 4CT0A 3AR5A 3D3WA 3EFHA 5AHXA 5KJCA 3PEFA 2LD4A 1FS6A 2EZ4A 4KBYA 4BFLA 4S1TA 1KVSA 2C0QA 2FI1A 4HC4A 3QLUA 2A84A 2FZEA 5IJ9A 2H9YA 1MENA 4X71A 5B4VA 1GPDG 1PBNA 4BNNA 5IUKC 3ZLTA 1T1SA 2OGSA 4O4JF 1KO5A 3EQ8A 1XB2A 1F1JA 1U8AA 4EX6A 3GRVA 5JS8A 5LLTA 4JI2B 3M5PA 2NVUA 4LZNA 1P44A 4OKSA 13PKA 1ZQ1A 1KIAA 4CQMB 3G5MA 2RH9B 2OHHA 3V1KA 3VKUA 3ROTA 2JVIA 2IS4A 3HACA 2P40A 2QZSA 4JQSA 1YZ3A 3IVCA 3RVNA 4MGKR 2X42A 2WJGA 3KYCA 1RJ9B 4Z3KA 1RLOA 1KZYC 1R5JA 1RXVA 1SHJA 2IXBA 2X0RA 4JP2A 2UYOA 4JD5A 4AJ2A 4DXDA 2OVBA 4BXOB 1GPYA 4WWHA 2AZXA 1YK1A 3R8XA 4LXTA 2PTGA 4NDAA 3ZQKA 4DV5B 3MTEA 1RBYA 4Q9HA 5JVDF 2VZ0A 2WUEA 3RWBA 3W04A 2D62A 3TLBA 2FMFA 3L7MA 3UJCA 2PH1A 4BMXA 4BO8A 3RADC 2R6AA 4L3VA 2ZAMA 3M3HA 5IT4A 3LQ2A 3AM4A 1AS2A 1LBIA 1NYLA 4IH9A 1SWVA 1C50A 3KUCA 5DSZA 5B64A 1N2CA 5AXBA 4DCTA 2BLNA 3RK0A 3SBXA 4HRAA 5ARCA 1YAJA 1OU0A 4XDZA 2XCQA 4CIXA 2PUJA 1SG0A 2XWQA 1IY9A 2HCTA 1TYEB 3E7WA 4PSDA 4BTVA 1SVOA 4BVGA 4CWAA 4RF4A 2FPMA 2PX6A 3NIWA 3CG0A 3L4SO 3GU3A 4AJ1A 4PIPA 4GZ5A 1GXSB 3OAAA 1JHYA 2C0PA 2PJDA 3ABOB 4MVYA 4AU1A 2VDRB 2ETXA 4EHJA 4QM7A 5DTQA 2ATEA 5CB6A 1L4BA 1IEVA 2AVDA 1ZWKA 4HNHA 1Q0PA 2H1LA 1BHSA 2WUDA 3H2JA 4INZA 3UMVA