5EKUA

Crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
343
Chain Sequence
RPPDAFVNRIDRNIPVPARLRHTPVSLIEAVNDFHYAMMNDEERNNFYYEVLKKHVTPETGVLEIGAGSGLLSLMAAKLGAKWVVAVEGSEELAKLARENIRANNMEHQVKVLHMMSTELKPKHLPEPPDVLLSEIFGTMMLGESALDYVVDVRNRLLKPTTKIIPQFGTQYAVPIECDALHRISSVSGWRDLDLKHMMTLQDTVSIVFAKHYGIRMNSVNFRRLSDPIELFRVDFSSSNRNDISRRKHFDVVAKESGTAHAMLFYWKVTDDEFVMSTDPEDTVNNFPRDMQWGQALQLLDASNGPLPTPVVFTEGKNYNFECNFSGDRVILHMQLCPEMTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Arginine N-methyltransferase, putative
publication title A glutamate/aspartate switch controls product specificity in a protein arginine methyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 104
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 5ekuA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ekuA01
2AOUB 2BR5A 1VBFA 4EKGA 2NNWB 3G2PA 4FSDA 5HEKA 5K0NA 3HCFA 3LGAA 4M38A 1RI5A 3BGVA 4KIGA 2GLUA 5BW4A 3VC1A 3KPUA 1DL5A 2HNKA 3EEYA 3FPHA 5K8VA 4OQEA 4GOND 4BY9E 2ESRA 5HIIA 3CJQA 1PRYA 4BLUA 9MHTA 3B3JA 4QVKA 1VIDA 1L3BA 2PWPA 5DT2A 4CTJA 4PYOA 4NECA 5T67A 3GXOA 2AN5A 1NW6A 4Y2HA 3LBYA 3LKDA 1NW5A 5KQRA 5DM1A 3LCUA 1QANA 1XDZA 2GB4A 1KXZA 1R8XA 5MHTA 3RODA 3UFBA 4DKJA 4RTPA 3LBFA 3T0IA 5EZSA 2BM8A 3RW9A 1D2GA 3HNRA 2FHPA 4RV9A 2ZLBA 5D1HA 2OPBA 3OU2A 1PJZA 5IKMA 2C7QA 2PVCA 5ICGA 2PWYA 1KPIA 2QY6A 4P7JA 4P58A 4RTNA 3DULA 5T6BA 1O54A 4KDCA 1TPYA 3DMHA 3C0KA 3LPMA 4DCMA 1XTPA 2ZBQA 1JG1A 1WS6A 4RWZA 3DTNA 2XBMA 3NTVA 3M6UA 3TMAA 3CCFA 1HNNA 3MB5A 5K0EA 2Z6QA 3EVAA 1Q0TA 1NV8A 4FT4A 4QQNA 4QQKA 1M0EA 1YB2A 3LDUA 4YV0A 1HMYA 3OFJA 5EKUA 3UA4A 5DRYA 4LWPA 3MCZA 5ICCA 1XCJA 3NW9A 4POOA 2PX5A 4RVGA 3KKZA 4HRAA 3FUTA 3SM3A 2YX1A 2QRVA 2IBTA 2O0LA 5E1OA 4RVHA 5CVUA 2BR3A 3P2KA 2IPXA 5KS2A 4HSGA 3TKAA 3X0DA 3P8ZA 4IKPA 4BP1A 3PLAE 2WK1A 3T7TA 3FTFA 5GOZA 4ER7A 2FRXA 1QAOA 2P7IA 4RVFA 2PGXA 2ZIGA 2KW5A 4GQBA 2WA2A 1H1DA 1KYWA 2AVDA 3P9CA 1KR5A 2OYRA 2GPYA 2P8JA 5GP1A 4RTQA 2JG3A 2JH8A 3GRYA 3ME5A 3B89A 2BH2A 3HVIA 5GWXA 1VE3A 3TM4A 5DSTA 5HIKA 4RTJA 1EJ6A 2VDUE 5K01A 3A25A 4KDRA 3U81A 4C04A 2UYOA 1OR8A 1RI4A 4C03A 3ANXA 5CVJA 2ZZKA 2AOVA 3BKXA 3UWPA 4PYNA 4KRGA 1G38A 3CGGA 1L1EA 1KYZA 3NDJA 2O57A 3NWEA 4PGGA 2O05A 3KQQA 4E2XA 3EMBA 1EG2A 4JXJA 3HCAA 2IDJA 3MGGA 4P7GA 4QVGA 3GCZA 2AR0A 2PX4A 4C07A 5C1IA 3TFWA 4YUZA 5K0LA 4ISCA 5EC8A 4F85A 5K0CA 2IFTA 4PCLA 1RJEA 4CKBA 5KVAA 2OKCA 3M33A 4RYLA 2P40A 3EMDA 4EKIA 3GNLA 2YR0A 3TM5A 5FTWA 3SSMA 3UJBA 5DTQA 5EMKA 5DTRA 4RTMA 3KPYA 2I9KA 4FGZA 3C6KA 1SVUA 2YQZA 2Z6UA 3NVKI 5EIWA 5EPEA 1WG8A 1RI2A 3LHDA 3AWIA 4R8SA 5FWDA 3VSEA 5E9QA 4OBWA 3KQSA 3R9XB 2G1PA 2XVAA 2JHAA 4MIKA 4M36A 2PSSA 5E8JA 1M6EX 2AOUA 4EQZA 4DQ0A 4YUYA 1I4WA 3HVKA 5K0GA 3PB3A 4QPPA 3AJDA 4GOMD 3UJDA 2G8NA 1FJXA 1BKYA 5B1SA 1BC5A 3O31A 4LWOA 5DX8A 1UFKA 3EGIA 1AF7A 4GC5A 5DTMA 5FADA 3EVGA 2XYRA 1VL5A 2XYQA 4DM3A 4DMGA 5E8RA 2HTEA 5FQOA 3B3GA 2CL5A 3A27A 3G5TA 2AOTB 4GOOD 1QZZA 5FHQA 3VYWA 2C7PA 4GC9A 2B2CA 3DR5A 4X60A 4M37A 1TW3A 2HV9A 3KPJA 3M6WA 4FSXA 4GEKA 1F38A 4PONA 2B9EA 5T64A 3E8SA 4ER6A 5K0JA 1FPQA 4OA8A 2C7OA 2VP3A 3JWIA 5CUQA 3HEMA 1JSZA 3P2IA 1L3IA 3PFHA 4BLWA 2AVNA 4RTLA 3RIEA 2CKDA 2AOWA 3I9FA 1EQAA 3BWMA 2EJTA 1X19A 2P41A 3G88A 1BHJA 3BWBA 1R00A 3HP7A 4FR0A 4KWCA 3MAGA 3V97A 3FYDA 4CXMA 3HA5A 3E7PA 4MQ4A 3UBTA 2QM3A 4HTFB 2VDVE 1ZQ9A 3SR4A 4AUKA 4Z2YA 2AZTA 1XDSA 3ELYA 4PINA 2NP6A 5FUBA 5DM0A 3OPNA 4XUCA 5EHGA 2ZFUA 3BGDA 1JTFA 1EIZA 3EVEA 3KR9A 2UYCA 4HGYA 3OZRA 5KYGA 1R74A 3PTAA 3E05A 5E2BA 3LSTA 1G6Q1 1P39A 3DMFA 5CD1A 4E31A 5DM2A 2Q41A 1VP3A 2H00A 4YV1A 4IWNA 2NXJA 3UJCA 3LECA 1VLMA 2ZBPA 1MHTA 5F2NA 2H11A 5K0FA 4FT2A 2ZVJA 3CVOA 4PYKA 2QE6A 3G2QA 3LL7A 4OA5A 4HC4A 3JWHA 3OCJA 2FYTA 4CTKA 3EPPA 2DULA 1FBNA 5LQAA 1F3LA 2BR4A 1N7JA 3BWCA 2I62A 3ID6C 5DXJA 2AOXA 4F86A 1O9GA 3HTXA 1DUSA 3A7EA 3NDIA 5C9ZA 2G71A 4RVDA 3IHTA 3DP7A 3FUVA 2ZSUA 4BP3A 2V74B 3THRA 2XVMA 4X61A 2GAFA 4PIMA 4EK9A 1WY7A 2ZZNA 2PV0A 4QDJA 4EMSA 5CCXA 5LQRA 5K09A 5DPMA 5JR3A 4IV0A 3DH0A 4AX8A 4YV2A 2ONZA 3TR6A 1NV9A 2P3LA 1WXXA 2JH9A 1NW8A 4U7PB 3GWZA 5LR6A 4LECA 1U2ZA 3KQOA 3HVJA 3FZGA 3OE4A 4HGZA 5K0BA 2YVLA 4KVZA 5CM2Z 5CVVA 4AZWA 2GA9A 2N47A 4PGHA 2I6GA 4P7FA 4E30A 3SSNA 4E70A 2G70A 4FS8A 3UJ9A 2OBFA 1ORHA 2HMYB 4QPNA 3KR1A 3Q7EA 2YXLA 3BZBA 4DA4A 1IY9A 5P8WA 4RTRA 4PYJA 4ER5A 1SG9A 2NXCA 2ZIEA 3UZUA 4E2WA 5K05A 2ZZMA 1L3CA 1P91A 3G8AA 3KR2A 3B5IA 2ORED 1JTEA 2E5WA 3LDFA 4GBED 4CWAA 2EFJA 1MJFA 3Q87B 2I7CA 3I53A 4RTOA 1UWVA 1ZG3A 1RJGA 3BGIA 4L7VA 1SKMA 2ZW9A 3DXXA 3FUXA 3TQSA 3GRZA 4AZTA 5K03A 1XJ5A 4GF5A 4IV8A 4KW7A 5JUWA 1IM8A 4DZRA 3SSOA 3V8VA 3P9NA 3B3FA 3VC2A 3SMQA 2Y1WA 1QYRA 1XXLA 1KPHA 3DXZA 3JWGA 3OFKA 2BZGA 2IH2A 4OX9Y 1SQFA 3DOUA 3L8DA 3THSA 1KIAA 1YUBA 5ERGB 5EVJA 3CJTA 2EG5A 2BM9A 5FULA 3UA3A 2ERCA 2OO3A 1G8SA 3I58A 4C05A 5F2KA 4O29A 5EMMA 3T7RA 4A6DA 4B17A 2NXNA 4ATNA 3FYCA 1D2HA 1AV6A 1N7IA 1T43A 2VZ9A 5EGSA 1R8YA 3M6XA 3KHKA 3KPWA 5E9WA 1SUIA 3MTIA 3PX2A 3P9KA 4R6WA 4H0NA 4C4AA 4R05A 3FPJA 3G5LA 3NWBA 5GINE 3G7UA 2UZ4A 4RSRA 1KHHA 3EVBA 3K6RA 4A6EA 4PYMA 2C7RA 1YZ3A 3GIWA 5DXAA 3OE5A 4HG2A 4PYIA 5DX0A 3GRRA 4HH4A 1Q0SA 2AOTA 2LD4A 5F2OA 2VS1A 2IDKA 4P7KA 1KPGA 5HFJA 3C3YA 1NT2A 1JG2A 2P3OA 2G72A 1BOOA 2NYUA 5LQCA 4RX1A 3CC8A 5CVDA 1ZGJA 2FPOA 3E23A 5CVEA 2PLWA 4FZVA 4WVLA 1X1DA 1INLA 1RJFA 1Y8CA 3AXTA 5LQUA 4LG1A 4R6XA 1RI3A 4V0QA 4X63A 5HILA 5LQNA 3OU6A 2NP7A 5IH3A 2PXXA 3TLJA 4X41A 4XCXA 3O4FA 1AQJA 1JQDA 1NKVA 2P35A 1EAMA 1QAQA 2ZTHA 10MHA 3DUWA 3EGVA 3LKZA 4HTFA 5DX1A 2ZWAA 3QOXA 5ICEA 4GOLD 3AXSA 5BP7A 1ZKDA 5EOVA 3UJAA 2GH1A 3DMGA 3EEOA 3TKYA 3FUWA 3UJ7A 2UYQA 5C0OE 2XYVA 3HM2A 1JQ3A 1RI1A 5HIJA 2H1RA 3EVCA 3A7DA 3AY0A 2EX4A 4QTTB 4C06A 1ZHFA 2JJQA 4YMGA 5LSAA 2YUIA 2P7HA 1YFLA 3UJ6A 2IIPA 3O7WA 1NE2A 2CWWA 3LCCA 1I9GA 2P3QA 3HCEA 1XDUA 3JWJA 1VPTA 3QOWA 5FWAA 3CKKA 3KQMA 5GM2A 5EG5A 3KR0A 5GIOE 3P97A 5EMJA 1FP1D 1G8AA 3GGDA 2R3SA 1JG4A 1X1AA 4G56A 3MTEA 4PWYA 3SGLA 3GJYA 2CMGA 2P1DA 3LDGA 4ER0A 3BKWA 2HR1A 1JSXA 5EEGA 4BLVA 4ER3A 5BW5A 3CJRA 2K4MA 4PYLA 5CIYA 3HA3A 3EVZA 4M7RA 4RTKA 3KQPA 3IEIA 1ZGAA 1R18A 3GO4A 4V0RA 2IH5A 1SQGA 2EJUA 3NMUF 1I1NA 3R0QA 5U4XA 2IGTA 2YXDA 2YTZA 5FA5A 3SXJA 3KU1A 4Y30A 3EVDA 3ER8A 3H2BA 4E2ZA 3BWYA 1YF3A 2JHCA 2PT6A 1O9HA 1V39A 3ELDA 4ZTBA 4YMHA 1D2CA 2PXAA 3OU7A 2Y1XA 5EMLA 3CBGA 2O06A 5GIPE 3ER9A 3T7SA 5ICFA 1NBIA 5FHRA 5HIMA 3FPGA 3KQVA 4FP9A 5GM1A 1YFJA 3C3PA 3R24A 1G60A 3ERCA 4X1OA 3R6TA 5E1BA 4QTUB 3SX0A 4YUVA 2AN4A 3TOSA 4XUEA 3PVCA 3P9IA 1NBHA 1EJ0A 2OY0A 3ELWA 3HCDA 3KQWA 5EZQA 3TPZA 4EVIA 2ZIFA 2WA1A 1AQIA 1KP9A 3FUUA 3I5UA 3MERA 2PX2A 3NVMB 2IP2A 2QYOA 3DLIA 3KPVA 3KQTA 3OZSA 3OZTA 2PKWA 3P2EA 4QDKA 3FPFA 5DLYA 1ORIA 3REOA 1RJDA 2IH4A 4DCGA 1G55A 2HWKA 5EEHA 3NJRA 3PS9A 4XUDA 4CKEA 3A26A 2B78A 3C6MA 4F84A 3LCVB 5LQJA 2AN3A 2QRVB 1JG3A 3WSTA 2OXTA 3B7PA 1XVAA 2NXEA 3M70A 3PT9A 1P1CA 2B3TA 3ELUA 3GDHA 4PIPA 3FRHA 5G02A 3FRIA 4DF3A 4UOEA 1Z3CA 3UJ8A 2DPMA 4YUWA 3TRKA 3EGEA 2UYHA 1UIRA 4C08A 4OBXA 5DWQA 1SUSA 1P1BA 3DLCA 4RTSA 2R6ZA 2ONYA 3FPEA 3ORHA 5EIFA 4R8RA 5M5BA 3R3HA 1B42A 4YUXA 4MWZA 3BXOA 5LQKA 4PNEA 3A4TA 2OB1A 2PJDA 1YZHA 3BUSA 2PX8A 2ZBRA 1WXWA 2AS0A 3G89A 3M4XA 1X1CA 2V7EA 3HCCA 2FK7A 2PXCA 2ADMA 2JHPA 3EVFA 1NW3A 2FCAA 1XCLA 5HZMA 4OQDA 4PCAA 4AZVA 1DCTA 2IBSA 5HOQA 5EKXA 3I64A 3HA7A 3GU3A 3FTCA 1VQ1A 5FCDA 4E33A 1N2XA 1M6YA 3HVHA 3PX3A 2OB2A 1JR4A 3S68A 1JQEA 2YXEA 3PFGA 2GS9A 4U7TB 1R6AA 3D2LA 8MHTA 2ZCJA 3MCTA 4K6MA 4GUAA 3FTDA 5EHIA 4MHTA 3F4KA 5BXYA 5D1NA 1NW7A 5DRTA 2VDWA 2F8LA 2ZULA 5E1MA 2FK8A 7MHTA 2A14A 5FQNA 4E2YA 1QAMA 3K0BA 2ZWVA 1X1BA 5E1DA 5DSXA 5FA8A 3MHTA 3IYLW 3KQYA 1FP2A 5H02A 3FTEA 2PY6A 3HCBA 1TW2A 3M6VA 4E32A 2CMHA 2O07A 3LX6A 4PYQA 5DM4A 5E2AA 3P71T 4MTLA 3QV2A 3SVZA 2OZVA 4KIFA 2B25A 2Z6AA 3BT7A 1WZNA 4WXHA 5KQSA 5EQJB 2PBFA 5E9JA 3IV6A 3G2OA 3GRUA 3G8BA 1IXKA 3DXYA 3MQ2A 4AZSA 5CCBA 2PT9A 1L9KA 3G2MA 3GRVA 4CKCA 1VP9A
chains in the Genus database with same CATH superfamily
1UBOS 3VVCA 1YI1A 1F2TB 3F78A 1JLLA 1GQQA 2WJHA 5I8ZA 2NO9A 5AW2A 2JB9A 3W8DA 4D96A 4Z6KA 1SWVA 2AF3C 3ICQB 2P2DA 3BDIA 3PYLA 4O4IF 3UAXA 4IIJB 3USES 4P53A 3D7RA 3UUGA 3MTDA 3NV9A 5K3SA 2HCRA 2PMFA 2IWRA 4OQEA 1HBJA 2MR5A 4LMBA 2C1ZA 1RW4A 4F9GA 1NN3A 4TKMA 4WRRA 4EPVA 1JWAB 1PJTA 2VDQB 3QITA 4HAVA 4BFVA 1Z4IA 2J1LA 3QLTA 3SC3A 4EMTA 4PBRA 2Z8XA 4V0MA 1QE0A 4B2IA 4ZI3A 2WTXA 5CLHA 521PA 2AN5A 3SAJA 1DLIA 2IOYA 4CR6A 2DBVO 1XVTA 4TXLA 1YRHA 5CVCA 5YASA 1RZ3A 2E4YA 3U80A 1SH7A 2CMDA 4IG9A 5BQ3A 2RI0A 3JVIA 4ES6A 1J8FA 1R8XA 2DWOA 3MD9A 1EXWA 3NGMA 3TL3A 5EIAA 1DC3A 3WB1A 3WLTA 4CKYA 4DQKA 3GBPA 2G7MC 4J1TC 1V1RA 4QDUA 1E6CA 3WB2A 3LWZA 4IINA 1QCZA 3FLMA 3PZBA 1H9CA 2EKPA 4RKFA 2FR8C 1U0BB 4PEVA 3UANA 3GH3A 1TZBA 4KFTA 3SIWA 1CW2B 4KSCA 3U3DA 4D99A 2JI6A 1O9BA 2OCDA 1QIHA 1XTPA 4RWZA 4N8DA 4HGRA 2HJHA 1PG0A 4QGHA 2QB5A 4IG4A 3G8YA 1EDDA 3IVGA 3M6UA 5ECDA 2GHTA 2EU8A 3H1EA 1Z2EA 2VQFB 4ITUA 1DKLA 2JVKA 3A6EA 3AZQA 4NZ9A 5EQFA 4JLNA 3TB4A 3HP1A 5F4ZA 3TYXA 2O8FA 1CUXA 1RD4A 1YQDA 2ZJ7A 4XTCS 1EYZA 4FDTA 4IJ5A 4P31A 4E5NA 3AUUA 4F8JA 1Z8FA 5ICCA 4RVUA 1C4WA 5H3CA 421PA 5FYQA 4UFPA 2JLYA 1PFYA 1OLXA 1YU9A 2HO5A 3L18A 4JQZA 2GJ9A 5E1OA 1XMOB 1U2SA 1S8NA 3JQEA 1GAXA 1GN9A 3O90A 1UDRA 2OO5C 4MIEA 3WK4A 3RYCA 1EE2A 2HHLA 3BWDD 1YA4A 4QBGB 1I0IA 2W43A 5GGYA 2WK1A 3MPUA 5F1OA 5GOZA 1W1UA 3UKDA 1BROA 3RRJA 3E2PA 5EFZA 4Y7DA 3C3JA 2FEAA 4WUVA 1IXSB 4TL9A 3TFOA 1LWOA 3W1EA 4NMLA 4H7KA 4FD2A 4RULA 4Q93A 3G59A 5U1PA 1M2FA 5KWEA 1S7CA 1AGXA 3JD0A 1PLKA 3GR6A 4FE7A 1VJ1A 3RK1A 4BE7B 4H3SA 2QVYX 2JZOA 4RS3A 4JX9A 3KV3O 4OK6A 1C1DB 1ZK1A 1ZGCA 3NEPX 4KE8A 4C03A 2O8EA 2F8MA 3FUCA 1T2DA 4AK9A 1CUEA 3JZFA 3KYJB 3O3NB 1AIPA 4MWSA 5I4IA 4Y9RA 3LYAA 1CEXA 1CY0A 2YZ7A 5I5GA 4HDMA 3MBKA 3CRZA 4N0EA 3A9TA 3OQ6A 2R00A 1QOPB 1NXOA 2A9QA 2C84A 3HCAA 4I50B 4LXGA 3S27A 2J0SA 4M89A 1CX9B 4LYHA 1IDN1 3OJ0A 4NV1A 1OLOA 5BOVA 5A4IS 4RYLA 2Z43A 4W5TA 2V4MA 1RAHA 1SA0A 3IMFA 3VPHA 1UQTA 4BN0A 2RMKA 3QG5A 4KBFA 2OQIA 3TM5A 3WGKA 3G82C 4Q1FA 2Q3HA 1ORWA 5IW8A 3RRMA 5EJFA 2BGLA 2P9BA 4Y2YA 3N2KA 1L4YA 2V1UA 2PR2A 1JL3A 2WPNA 2V5UA 1R9MA 4E03A 5JY1A 1II8A 3HVUA 3KB1A 4H1HA 5FWDA 3M89A 5EI5A 1KJYA 5JTTA 3SQDA 1ECBA 4OGKA 4ZVRA 3R9XB 4MR7A 2G1PA 1GHTA 2B98A 3N87A 3DO8A 3TBFA 2IHJA 3H2GA 1I4WA 4ZMRA 2JGNA 3DDHA 5HKAA 1JYSA 1ES9A 1NASA 1KDRA 2X5NA 1HSZA 3AJDA 3F46A 2E3JA 3IP9A 3LF2A 1C4KA 3O31A 4LWOA 4WJLA 1N75A 4EHFA 1JEYA 2F1JA 2IJGX 3D6MA 4ZI7F 5B36A 2R6HA 2Y8EA 1UIMA 1HC7A 4YXWA 3VYWA 2A5YB 3S0JA 2NYVA 1PAUA 1YHZA 4C7OB 3M9WA 5T64A 1EVJA 3ESRA 2B9EA 5E7QA 3OE1A 4OYLA 2VHUA 2FOIA 4E46A 3HEMA 5A4AA 3ZGYA 3L8HA 4ILKA 1EWTA 4IY1A 4RTLA 3QMPA 2FG7C 3R1IA 1T2NA 3SEZA 3UAOA 4DJEC 1YE8A 3WWPA 1BHSA 2WHEA 3GV0A 4MDYA 4ZARA 2AH5A 1HT3A 3UBTA 2GEFA 2YQ4A 2J5BA 2W4IA 1ZOPA 2VSFA 2C2XA 2NU6B 4OQMA 2IVZA 3NG1A 3RUAA 2BMFA 3X1KA 5PGMA 3RTEA 2JAQA 4TTQA 1H2FA 1RRGA 1U8FO 1XAJA 2HRZA 2J07A 2ZFUA 4QTYA 4NCBA 3DD1A 1YQUA 4HGYA 2EW8A 4TX1A 6ADHA 3L4BA 4R5HA 1G3IA 2GBLC 4C5BA 1IUKA 1E32A 1XYGA 2IYRA 2Q41A 3FMGA 3JSXA 3LC1O 4J9UE 4ALLA 4CPDA 5KNCH 5EUMA 2RGNC 4OJNA 1R6TA 1SHLA 4OMDA 1AN9A 3KYDA 3UQZA 4P32A 3U09A 1WPGA 2EX1A 4HAWA 4PYKA 4ENUA 4OYRA 2EWMA 4ASUA 2Y68A 3OCJA 1AQUA 3ZK8A 2V5VA 2R6GA 2VHQA 1TIPA 2VTBA 2WVJA 2GZ1A 5DXJA 1ULAA 4E11A 5AM3A 1U1EA 3LL4A 4KR0A 1KSJA 2E2WA 2G71A 2JLZA 2GPBA 3HDHA 1Q0HA 2GAIA 1L4BA 1NYLA 1B43A 4QEZA 4RLSA 1EUDB 5JH7A 4A0FA 1I3LA 2VLIA 4KN5A 1YBAA 3W5DA 1DWOA 1PWEA 5IDWA 3WQHA 4LUCA 3EZ6A 3C3DA 4KUEA 3WKCA 1RLJA 1ESZA 1KY5A 2AFHB 4ND1A 1UANA 4N40A 4N9WA 1BJRE 2AJCA 3V3KA 1TT5B 3PIDA 1SUAA 1X38A 1IBSA 2PRIA 3HS3A 4RE6A 2C96A 2P3LA 3F3KA 4F56A 1WXXA 4B85A 2W37A 1PFGA 1LSOA 3D8SA 1U2ZA 3P5SA 1MVNA 3OE4A 2HLNA 4QOHA 1JHVA 4JSYA 4X71A 5CM2Z 5AO9A 3EK2A 2FMFA 3VJLA 4DKXA 3K6SB 1T0PA 2I6GA 5C5EA 4IHKA 4BX2A 4QSHA 1IMJA 1C14A 4AJPA 4QPZA 3R5FA 5G4KA 4P4UA 4GZMA 5F3RA 1FDIA 5A9SA 4EDHA 4PYJA 3K9WA 4ER5A 2HQBA 4OV6B 3FCCA 2X0EA 5KMGA 5JNTA 4YCNA 1KZ4A 1SG6A 1XCGB 4N12A 3CUYA 2BDUA 3QIVA 1UBRS 1ZJJA 1PWYE 2DBYA 4IPTA 4YRNA 3QRWA 4XWTA 3SZLA 4XTRA 4F85A 2BONA 2DQYA 3I4FA 4IV8A 2C3OA 5BQFA 1U98A 3GZJA 3IUBA 4WBSA 5JAQA 4PLPA 1L5SA 1RKXA 5BORA 4MYCA 3DAFA 3V1MA 2M32A 5DGTA 3DHYA 4MINA 2X40A 3L8DA 1BQ3A 1CSEE 2XPCA 2VCYA 3PWSA 1KAGA 3RTGA 5B30A 3U4MA 2DLNA 4Q16A 4GU5A 4O29A 2YBEA 2XMQA 5B7PA 4P7BA 4MYTA 4EPTA 1CYDA 2AEMA 2W2VA 3FROA 1KMMA 4ATNA 5T7BA 4UJ5A 4W1SA 1EFRD 2OA0A 1X42A 3N59A 1SFRA 3WIBA 4BECA 4HFNA 3IBCA 5ALZA 4QVIA 1UPCA 3L49A 5JQGF 5KNCD 1PNRA 1OSNA 1MJNA 3FF4A 2QW1A 2DHRA 2OWEA 4BC0A 2IE0A 4OK5A 5I8PA 3QX9A 2VQEB 3B2NA 3L7OA 3TWOA 3DEIA 3RRXA 3TGWA 3SOZA 2WF9A 2QROA 4U4AA 1YZ3A 3NP7A 4NJEB 5FOTA 1UKYA 2YN2A 4UVEA 1NBWB 3EOAI 5KX5B 5B6IA 2AOTA 2LD4A 1NHWA 5CDFE 4OMUA 3OETA 1AGPA 5AOVA 1UKZA 4UZFA 3HVRA 4MWCA 5L53A 4RX1A 5AUOB 1JPUA 3W5IA 4QJIA 3LU1A 1KWKA 1ILEA 4Z4HA 3OPMA 1AHNA 2XUGA 4XM1A 3PEYA 1INLA 1Y8CA 1Z4KA 3I23A 1KMCA 3NJ4A 2VUUA 2ZYVX 3IHWA 1O5IA 1RHQA 2GZ3A 2X6RA 2XNSA 1E2QA 3I2YX 2Z98A 4X41A 3U7QB 1EAMA 4GOXA 3WBBA 4A3SA 3M1YA 4Q00A 1BFUA 4ZVNA 3EGVA 2ZWAA 3WDMA 3M3PA 5ICEA 1A50B 2C29D 2OGSA 1HYBA 3PSAA 1IG0A 1E1MA 3QH4A 4WJZA 1WUTA 2VDPB 1X80A 4RK6A 2EJWA 4GP9A 3UJ7A 3RV4A 3DL2A 4KX5A 4CCYA 1POWA 3HM2A 1RI1A 1V2HE 1Y1KE 3FHLA 3VC3A 2JPDA 4HNHA 4U2KA 1LLCA 4RESA 4C06A 3OMLA 1KK3A 2BL4A 3TINA 3UCFA 4B3XA 4BX8A 4A5SA 3RVDA 4PC1A 3DMDA 1NE2A 5ITZB 4M9RA 1I6WA 1OPRA 3EZ9A 1AKWA 4WGGA 2H4HA 1RYYA 3ZY6A 5FWAA 1LEHA 3P7MA 4Z0NA 4ENWA 2PWAA 5GIOE 2IYLD 4MVJH 2ZI9A 3EIFA 3IXLA 3H2KA 1G0OA 4IDBA 2P0EA 4J0FA 3W9YA 2H1IA 4CMBA 1W5BA 5EJ2A 2Z83A 3QENA 4V0LA 2EDAA 4AYXA 4LZLA 3IULA 4OLFA 4DL9A 4DLWA 5BOSA 3KZOA 3DOFA 1ORTA 1HLPA 3PNMA 4HBGA 1Q21A 2NT4A 1W9MA 3B7WA 3DYVA 3H9GA 3QF4B 3A9WA 4KH0A 4AF7A 5JATA 5A6SB 5CIYA 4MJXA 5KNDH 4O0MA 3AQ4A 3WXBA 3I5MA 2IXAA 4OQLA 2WD7A 4FQ8A 5ABPA 2HA5A 3GJZA 4XIYA 4NU0A 2IHNA 2E18A 4B81A 1J9ZA 2FWRA 4K7JA 1VPDA 4M9ZA 2VJCA 5KAPA 5TRTA 3D4OA 4GRAA 2BE7A 4YRZA 4XYGA 4PS1A 3ELDA 3RS0A 2AFHE 1ZH6A 3OU7A 3WO0A 4TTTS 3B1VA 2QR5A 4JB3A 2Q3BA 1NU8A 3ETHA 1XQYA 2HF2A 4YP0A 1K0UA 5CK5A 3C3PA 3GYGA 1WQ3A 2D54A 3LNCA 2O8DA 3FGOA 1BCRB 2RSLA 2X41A 4XGIA 2OCYC 2B37A 3PVCA 3ZNQA 2FW9A 2ZVPX 2IHBA 1H93A 1N5RA 2JLAA 4EVIA 3FZNA 3H2ZA 3TEJA 1QK3A 4K9PA 1N36B 4LYFA 3VKUA 3GARA 1CUVA 3WSWA 3K70D 4L76A 1GPJA 1W0JA 2G5GX 3JS5A 3PXUA 4HL6A 1U28C 4XWAA 4JNCA 5K4AA 3CZ4A 1L0BA 1P61B 2XWQA 4P9NA 3BD9A 2JBWA 3SF8B 4BMSA 4EUNA 2NVOA 4BIIA 3C6MA 3HBAA 1X7WB 4D4IA 2QZPA 4RK4A 3EDCA 1NDHA 4NBLA 4A26A 5CG2A 4WOPA 4DV0B 4MCIA 4XI9A 2FUEA 2CE7A 4PTLA 3RVJA 3KJIA 3N07A 2UXBB 2FI1A 1HDYA 3SICE 3JYQA 1B2RA 1HQCA 3GFFA 2OPHA 4V1CI 2RJ3A 1UIRA 3R75A 1SUFA 3QPCA 1KFEB 2C58A 2LKCA 3LA8A 5A5FA 3DE4X 1QYDA 1OU4A 1KDOA 2GX6A 3TUIC 2VH2A 4YRCA 3NWPA 2P90A 2J08A 2PX8A 2JATA 4DLKA 2PMWB 3UXYA 3DVAA 1ESMA 1RIFA 3GRKA 1S3GA 2CLKB 2LGJA 4CQMA 5CA0B 3H04A 1MTOA 1DCTA 3JQCA 1AZLA 2QK4A 4D4JA 4IMPA 2WFMA 2WOJA 4E33A 1N2XA 5TQ0A 1T9BA 4OHYA 3KQUA 4ID9A 4MVJD 3IUQA 3VR5H 2J6BA 2GS9A 3GT7A 1R6AA 3HN7A 3QXCA 3EC2A 4NATA 4BFWA 4BWFB 4TQ9A 2ZCJA 4BVBA 1NRWA 1MOSA 2A57A 2XNHA 3ETLA 3VR3A 3R3UA 4GP6A 4I4TA 4P4SA 5DRTA 3WISA 1JDUA 5EZYB 1O7JA 1E4VA 3K0EA 5KNDD 1R0YA 4DANA 5I7SA 5TGTA 3K0BA 4E2YA 3KC2A 1QHNA 5FA8A 2VQSA 2X5JO 1IZ8A 3IYLW 1JKIA 4I3GA 5FTNA 3RSSA 3M6VA 7REQA 1QG4A 2FDXA 2O07A 5ALPA 3SNKA 1IHOA 5FKJA 1AUPA 1QFJA 5CEEA 1KJNA 2J6CA 4YAIA 1H0SA 1P7WA 2A9PA 2B25A 4JLKA 3LQKA 4KLAA 4NZZA 4DN6A 3QHAA 4S1PA 4Y9DA 2P6UA 3RVRA 4E7PA 4II2A 4YYZA 2EGGA 5CCBA 2IEYA 2JK0A 4R2IA 3MWJA 1DXQA 4G3XA 3FNIA 1N9GB 1VP9A 3FWKA 4R1NA 3H6HA 3JYNA 4XPIA 3G0OA 3ETGA 5K6TA 2TSYB 3II6X 1WPRA 2D4AA 2VZEA 2O2CA 1IVNA 1NG1A 1NQUA 4KR6A 2HDWA 3FWPA 5IVIA 1GQYA 3C7TA 3I0MA 3EMKA 1T0JB 4R7GA 3FPHA 1BXGB 3STUA 3VI3B 4DVJA 2YZ2A 3EDRA 3OLXA 4HN9A 3PNLA 5BMVB 1J5EB 4BNIA 3K2IA 2JFUA 1JDBC 5ALJA 1EFLA 5JSZB 2GSWA 4UD6A 1EM8A 2NUTB 5IVKA 4RK5A 3UXHA 5FR2A 3D7SA 1OYVA 1UPUA 4P8RA 5C80A 2GB4A 1QOQB 2JRLA 2BRUC 2O9JA 3A3NA 5C35A 4DKJA 1U5BA 3QVGB 3JQBC 4BASA 5JAMA 3RW9A 1E3MA 3QXGA 1D2GA 3EXIB 3TQHA 4NOMA 3Q0IA 3HFRA 3GAAA 5LDDC 2PWYA 3DPIA 4FBMA 2FWIA 2WF6A 2UVPA 3LQFA 3C98A 2AG6A 4KQ6A 2GLTA 4KFSA 4OGFA 3GFPA 3SDSA 4DJ5X 5JARA 2NXWA 1IONA 3MN1A 4ZQFA 4CUJA 4L27A 3DFIA 4NTZA 3HZOA 4KH1A 2CXRA 3GQBA 2YVKA 3VR5D 4EW2A 4NH4A 5F98A 1W35A 4QQNA 4CM8A 4QQKA 5K8JB 4DILA 4DHEA 5I9BA 1PS0A 3C4VA 1IZ7A 4JR2A 3OFJA 1IY0A 1PEKE 1W4ZA 2X2FA 2RGRA 2XADA 4QHSA 5CNKA 5FOWA 4NOKA 3HXPA 4Z49A 4CEIA 3RREA 1KK0A 2PX5A 2OXFA 2RGUA 3IPAA 4RHYA 4HV4A 2NUPB 3MMNA 1KH1A 3T5DA 3DCJA 2BR3A 3GP5A 4Y2TA 1CFJA 3CM0A 4FJ1A 3C8HA 5ITSA 3O9ZA 1QNLA 2IIVA 3JYHA 5JC1A 4DSUA 5F76A 1Y8QB 2R1TB 2O4CA 3QFFA 4TMYA 5C3UA 1I8TA 1NC1A 2RGDA 1JHAA 2XA9A 4OYYA 4QODA 2GPAA 2O50A 4J75A 2B82A 2KM1A 4CFYA 4XH9B 1J5XA 3H5OA 3B3QA 1AVTA 5E6SA 5JDCA 1EJ6A 2FOLA 2V45A 1QLWA 3ENNA 1DX9A 4G41A 4CQNA 1KIMA 1X87A 3EFHA 2VAWA 1GSHA 1KZHA 4CT5A 1TEZA 5A0TA 1U31A 5DK6A 3C3CA 2EP5A 3DQZA 4LYGA 2O1SA 1TXGA 4GVPA 1VMAA 1X8JA 3LHFA 1JWBB 4FHFA 4IJVA 5HXAA 1KVTA 3KQQA 3AJ9A 4LW8A 4CHGA 1EUQA 3DDCA 1EG2A 3PITA 5EHXA 4J0IA 3COYA 4NP6A 4P7GA 3NYQA 2BFPA 3KTDA 3KE9A 5C1IA 2IHZA 2YWHA 4JIGA 4K6FA 2JIDA 2OLKA 3SQLA 2VT2A 1MB2A 2Z2JA 3K0FB 3VHQA 2Y0PA 4O4JB 1IWPB 3ESBA 1SBTA 1D09A 3WIOA 1RRCA 2BGWA 2AN9A 4QD3A 2A86A 2FPGB 3U62A 3OZUA 3LX8A 3H0KA 3HXLA 2GO1A 2H29A 3AW9A 3D8BA 5DTRA 3SSMA 4RTMA 2B3DA 2ON6A 3J80A 4FB5A 2WTBA 2X6QA 1Y81A 3BM5A 3EIEA 3MIIA 3A6FA 4GR4A 5LBTA 3AYZB 1GTJ1 4FWIB 3RS5A 1T4CB 3PNKA 4IOLA 1KMIY 1OFHA 1T1JA 3RC9A 4COKA 3UJHA 1ENYA 4CM7A 3AC0A 1LCIA 2GO7A 5HE8A 4ARCA 2UYYA 4MUBA 3N6XA 2GN9A 1GZ6A 3IQXA 4OBWA 3WFIA 1ZEJA 2QL7A 2RB4A 4G24A 2JJ2A 3HUFA 2AOUA 2NUBA 3QBVA 1ISJA 5AOCA 4RD1A 1SPXA 4WZAA 4CMGA 3OIUA 2QP3A 1N32B 3LDAA 3IDFA 1TK9A 2HA7A 2JCBA 3K1TA 4GWKA 4RF5A 4WI1A 5DX8A 4WY5A 1RJ9B 1CY7A 3C2QA 1QV6A 4KN8A 3R7WA 3ZHVA 1VL5A 1EFVA 3L1VA 1P5HA 3LUGA 2IC5A 4ZCPA 4TWZA 5KVCA 1DFGA 1RWNA 1NUPA 2II6A 1K8XB 2F1OA 4HP8A 5AJZA 2H65A 3NEYA 4ER6A 5AICA 1P2VA 1RPTA 2JARA 4RZ3A 1U0JA 1XQ6A 3AESB 2HCBA 1LJ8A 3C5HA 2AW5A 4JB8A 1VOTA 3G2IA 1GNRA 4UULA 3UGJA 3PXGA 2ODAA 1GSAA 1B1CA 2VPTA 2H0AA 3OM8A 4YQFA 1BS2A 2P41A 2Y92A 4FR0A 1BHJA 1QQ7A 4M0DA 2JL1A 3IHLA 1QIJA 1W75A 1XZQA 4FYKA 5IP5A 3HA5A 4S04A 1S2GA 4R9VA 3RSOA 3E9EA 4MRSA 3UAWA 4ZKDA 3A58B 1FXWF 1TU0A 2AQKA 2AZTA 3JATB 4PINA 3ELYA 2PUEA 5FPYA 5FPKA 2XE8A 2DH5A 3WKAA 5KTTA 1N2IA 2GKOA 5L4SA 2J9FB 2UYCA 2NT3A 2YCBA 2R6JA 5E2BA 4ZEOA 4IO1A 4ZALA 1FTSA 4HK4A 5TVGA 4F4IA 2DY1A 3NX4A 5JSQA 5CD1A 1ZN2A 2ZI7A 3LVBA 4L73A 3IUMA 3K20A 3QQ5A 2KX7A 4PAOA 1KQNA 5CFMA 1S2IA 3F9CA 1KI9A 1RKBA 2G0TA 3EIXA 3OIDA 3U1TA 1GPH1 3LC2O 4HDSA 4TYWA 3IAFA 5EXEA 4LVCA 4CTOA 4RLHA 2MCFA 5LLTA 1P18A 2BLNA 3FAZA 5K5EA 3EG9B 4W9RA 2YXBA 2RHJA 4OXRA 5TEVA 3K1JA 1IE3A 5JS1A 2YHBA 5BUCA 2QR3A 1TC1A 2ANBA 2FW7A 3JCZA 2F62A 3A4VA 4D6YA 2FWNA 3FTNA 1SIBE 2R8RA 3U3ZA 3E3LA 5A03A 4ZMSA 3Q7SA 3OCXA 2OHVA 1BO6A 1NYQA 1V8ZA 3NB0A 4G63A 1TEVA 2P9EA 1UBJS 2GBGA 3H84A 3R3VA 4X1IB 5K1ZA 3T61A 3W7BA 1G2QA 1H9AA 2YY5A 4QDJA 2BKEA 4BMDA 1V4VA 2GETA 1XR3A 2DKFA 1UT6A 1P81A 3DH0A 2MSEB 4ZRDA 3BRCA 1R0LA 4RY9A 4CIYA 2EL7A 2C0QA 2X13A 2CDBA 3CTMA 1HR0B 3TQCA 1XHEA 1MT3A 5LP6C 1SN7A 3TJRA 1JB9A 2IDMA 2OBYA 5EKDA 4II3A 4EVSA 1WF3A 4Z8YA 2ZSJA 4KACA 2DXIA 2YVLA 3W77A 1DC4A 1T9ZA 4LTMA 1KOFA 2LIPA 2QF7A 2YHIB 3FHOA 4AZWA 2X5KO 4E30A 5TJ9A 4E70A 3I62A 3N28A 1PDWA 2OBFA 1Y4AE 1QUEA 4JLDA 1XMQB 1MIHA 3S81A 2BFAA 4P82A 4LF6B 1MOQA 5JDIC 4WEQA 1HL3A 5EVCA 2O2GA 1DDOA 2Q6LA 2GASA 5AR1A 1YCHA 1C0EA 3B5IA 2F67A 3HBMA 2CXHA 2POCA 2WU1A 5C8YF 4ILEA 3G8CA 1QYXA 1ZXXA 4UNQA 4F96A 1R6XA 2BCGY 2OHXA 5A7GA 3CUEF 3NUZA 1LNZA 2WSLA 3IP5A 4L7VA 1BTOA 4OUKX 4QUIA 1MC5A 3FYHA 1K9SA 3HB0A 4G0WA 4A1OA 1AH2A 3SSOA 2PNFA 2QU8A 1S2LA 2FUKA 2BMVA 2H5IA 3OHSX 5AK5A 4WESA 3V80A 1C9EA 4ZK2A 2QTVA 3N2ZB 3L0CA 4UNSA 3LXUX 2BM9A 3JRXA 4B6RA 4Z99A 3V8NA 1GCIA 4LHZA 1K3FA 5DULA 1Y34E 2C78A 3Q5GA 4JGGA 1ISSA 3O8OB 2C7GA 3EFBA 5EYPB 3NAMA 1W1IA 4CM3A 4QGSA 2AT1A 4LJYA 1N5LA 2Z3ZA 4XD7A 5E9WA 4Y0NA 1KZGB 2JFOA 4Q1BA 4Q47A 4CFZA 4EL0A 5JJBA 5GZ3A 4G4JA 3IDOA 2XUPA 1HM5A 2BCEA 2ZGVA 3O4IA 1PR9A 1JHYA 2XR1A 2ZXFA 3I2JA 3IXMA 3OWOA 3T4EA 2WG1A 5IJAA 3X3HA 4ALJA 2DFPA 4Y2QA 4A73A 1V71A 3QVUA 4BL5A 5JLJA 2XUAA 4WOBA 5BR4A 1LQTA 721PA 4W5QA 4FPXA 3RU9A 4NBVA 4QC2A 4D5GA 2EC5A 2V3VA 1XHFA 3OUTA 1E60A 4P1ZA 2CLEB 3G8DA 4Q7LA 1VHTA 4ZOLA 3C3EA 1WIWA 1JX6A 4F97A 4D4GA 1WBJB 2QJTA 3O8DA 4V0QA 1GYRA 3Q5EA 4IS2A 3UK0A 1ADFA 2CNBA 2QDXA 1HPLA 3N5CA 5G53C 1I3MA 2CJXA 1L8AA 1NTOA 4IEFB 5FPHA 3BMQA 3B1XA 4D9MA 2VJYA 1XPOA 1W19A 4NU5A 2GH1A 2PTHA 3W3AA 2ZPTX 5EUBA 3RSQA 1OAOC 3NBFA 4IH1A 3KJFA 2GNAA 2VZ0A 1WQ4A 2WD9A 5JD3A 1EB9A 1JPNA 3ECSA 5I7UA 2X5OA 3G9TA 1SD5A 3B6JA 2ID8A 5DTJA 3RFVA 4RF4A 3HCEA 1E7RA 1QO0A 4WL0A 4AUNA 4RV4A 3NFRA 3KQMA 3F71A 3IIJA 5F4BA 5A5EA 1WAMA 3GRFA 3H3XA 3KLBA 4Y8VA 5JZMA 4U9HS 1J2EA 1C5KA 4W9NA 4YBZA 5SZKB 4BLPA 4ML3A 3E9NA 1EXVA 3H83A 1ZN9A 2H1LA 2NNLD 3AKYA 3AR7A 1Q1AA 3BZUA 4TWBA 3WSVA 2C4NA 4AL4A 4ER0A 4XFDA 1A0OA 1CR4A 1YKGA 4BLVA 1FNSA 5ESXA 4BUJA 2DWCA 2IQIA 5BMOA 1L7VC 1Q6YA 2HZBA 1A9XB 4JXKA 4K6KA 3TOCA 4C2TA 4D4LA 3A0RB 4ADSG 4EPXA 3C7KA 1NAIA 3E15A 1R0KA 4X7MA 2WWGA 1Q0ZA 1XZPA 1XEXA 5CHEA 5FO1A 3RVNA 4AG6A 5CBKA 1DI0A 4GR9A 3EB9A 4DIUA 5LBIA 4Y30A 2ZUBA 4CG3A 2UUCB 3RTDA 4AWBA 1T5HX 3GJ7A 2HW8A 2A4KA 2ZANA 4MS4B 4KJZA 3HJUA 3EPLA 1UXKA 4GDMA 1I1HA 3OZIA 4KXVA 3ZHCA 1DINA 4TXNA 3CUWA 1DTWB 1ENZA 3OJLA 5IH7A 2A30A 1BDJA 3B2QA 1AGNA 1OD6A 3W5VA 3GLGB 4QO8A 3I39X 3C8DA 4P81A 4CR7A 1V2GA 4UXJA 3AEKB 5AJHA 3U0VA 5DHRA 2WJAA 4R9NA 4EIWA 1FNNA 3FSGD 3TPZA 4X95A 3D7LA 4TSRA 5KWVA 1P62B 1KJZA 1GRVA 1O8BA 1X1TA 1GFIA 3VR6H 1IJKA 4LJ5A 3B20A 2H0QA 2ZSHA 3DLIA 3OG9A 3PQEA 4LNHA 2BZSA 3NEAA 4N0DA 1JLHA 2G04A 4G4GA 3TZKA 2D2XA 4ZYVA 1OREA 5B58C 3ZIUA 4TLMB 5BN4B 2WJJA 2FPRA 2HIAA 3OPXA 3PXXA 4FVTA 1SULA 1QH8A 4IRMA 4D79A 5LQJA 2QRVB 2BFDA 3PHJA 4MPPA 4WBXC 1KJJA 4BNHA 1JSRA 2CNOA 2HKIA 3SZUA 1NI5A 4EB0A 2J09A 1WB5A 3CZMA 1OI7A 2OC9A 2XMSA 1YB6A 3VPSA 3ZZ1A 3X1DA 2YNMA 2IKQA 3FETA 4GBJA 4QLBA 2XE4A 3IT3A 1AG9A 3H42B 4PVCA 5AW9A 4R8RA 4CIXA 4MWZA 4AMZA 1QBKC 4MIOA 3MJSA 1A7JA 2Q1UA 3J81A 2QN8A 5FBQB 1U7PA 4ITVA 1GILA 2I7TA 4RXUA 1FY2A 3M9XA 2PZLA 4I1OA 4XR4A 3UFBA 1JEEA 3EA0A 3EY4A 3TBHA 2IBSA 4EO4A 2FE4A 3NPMA 3HA7A 3UKOA 1C4XA 4H7PA 4FEEA 5JBQA 2XW6A 5IMBA 2J9ZB 1JQEA 2I7VA 4OHRA 4B74A 1LX7A 3PFGA 4DNOA 5P21A 4KE6A 4EKNB 1ONPA 1E66A 4K6MA 3QYJA 1OZHA 2UDPA 4EHLA 1Q3KA 5LVAA 1IB0A 4O6VA 1HY3A 2XYHA 2VZLA 4ZYTA 4HQKA 4CM4A 4PZUA 3AI3A 5FIUA 5GGXA 3T41A 3VZSA 1OXSC 2R7MA 3UCEA 4H08A 5IHXA 3DAOA 1LS1A 1E1QD 3BAFA 3IIMA 3PLRA 1P2FA 1OJLA 3GXBA 1Y7PA 2Q5JA 4FC7A 3VU1A 1CVRA 2Z6AA 3FKJA 1KE2A 1U63A 4DSZA 1KTIA 1GPDG 3WYGA 4JKYA 2C2YA 1RMYA 2O6LA 2XDQA 4IFEA 4KLRA 3UWOA 1ZM4A 2YMPA 2D0IA 2VJMB 3X1JA 1UOPA 1KDPA 1D0SA 4GLLA 4X97A 4AZSA 2VDMB 2AI3A 5LB4A 3SCZA 3AEQA 1UAAA 1C41A 3GVXA 1D4FA 3X1ZA 4LSZA 1VBFA 3WNBA 3ZWYA 2QL5A 2ZBEA 1WULS 1FA9A 1B76A 2I22A 1XKXA 2NYAA 4FSDA 3A9UA 4OJMX 4OOEA 4BUZA 1KQFA 2P11A 4AO8A 3G1UA 1Z8NA 3Q9NA 4I9GA 3VR6D 2Y3IA 1XNRB 1IHPA 2I4LA 2VF5X 4WD3A 4B4VA 1VBNA 4X20B 5A6VA 2ZXUA 4D3XA 1WWKA 1GNSA 3FOCA 3LVQE 3JQQA 4Q9HA 4D9JA 1BW9A 4N5HX 4XASA 4H9GA 4MEJA 1Z7BA 4DBZA 4PYOA 3NZEA 1OI2A 2HGSA 3ICPA 1RYHA 3NVAA 3PC7A 3V1UA 1EJ2A 1Z37A 2HNBA 3PEWA 4Y2HA 3KRTA 1KY4A 4RK7A 5CA1A 4DRXA 3C6YA 3UK1A 1FFDA 3SVLA 1N6HA 1QV9A 2ZBUA 4KV9A 3S2FA 4L8YA 3UTCA 3PXDA 4Z4CA 2J87A 1L7MA 1Y4UA 4GWLA 3MLAA 1N25A 2CVPA 2A5FA 4OL0A 5FORA 2RE8A 2GVDC 3R4VA 4NS1A 3CR3C 4H6XA 5EZSA 4HNAB 3N0XA 2QSJA 2FHPA 2JGAA 5D1HA 1XTTA 1VCIA 3ZK7A 2IX9A 4WCDA 4B44A 2HK6A 1PJZA 4C4TA 4CFSA 3GPBA 4BQSA 1R4NA 1WL8A 4N03A 4NMXB 1NJ1A 2QAGA 2R4UA 2GEKA 1VMIA 1NIPA 3NQ41 4P58A 5AJWA 2FUNB 1UQRA 1AN0A 1P6XA 1ULUA 1DQRA 3AHDA 1JT2A 3DMHA 3IUYA 3RYHB 5WRFA 3A1WA 3DJFA 2QEQA 4M60A 1R0ZA 3TMAA 2QW0X 5D8DA 2PXHA 4F06A 3R23A 4ND2A 4D44A 2CFTA 3DMTC 1NPTO 5F23A 3PNBA 3Q15C 4KWTA 3R3JA 1IEWA 4GVXA 4LE1A 3U4GA 3ND8A 3GLGE 2Q7OE 1F0YA 3OT1A 4P35A 1MT0A 2WAYA 4N7JA 1D2NA 1VECA 3EIHA 1PNTA 2VEOA 4Q4AA 4DWVA 1KVRA 2IYPA 2OD7A 3DZ8A 1H0HA 4QELA 1WDLA 1JZTA 1T6ZA 3KSRA 1YC5A 3NHPA 4MR8B 5AM0A 3X43A 3ZWQA 4WLEA 1V95A 1U11A 2D1RA 4UCQA 2GAAA 1KI6A 3FTFA 4A2QA 3INNA 3NLLA 4S1WA 5FL3A 5TPZD 2B1IA 3GEMA 4R5MA 1Y6QA 1NQWA 4J0DA 1RXEA 4D02A 4MS1B 1TZ2A 4WKBA 3QU2A 1AJEA 1SBCA 2FEPA 3MA0A 2UUOA 5KVVA 3KLPX 1XLUA 3NIBA 4G67A 1CR0A 1SEVA 2BH9A 4FM9A 2JIZD 1CJVC 1TVKB 3R77A 3K8OE 3IP1A 2HJRA 1ZJYA 3PA8A 3V7FA 4EEKA 3QKSA 5IJ9B 1I2MA 1LDBA 1V7QA 3KWFA 4C4SA 3MILA 5ECGC 4QYWA 2GPSA 2EJVA 4BVHA 3L04A 1A5SB 1E3QA 1DC7A 2ZRQA 4R9SA 4KRFA 2O14A 2J67A 1NDQA 3EZNA 1L7AA 1WLYA 3U19A 2HU7A 1U6KA 4L4XA 3JQ7A 2C0PA 3HB9A 1JZQA 1M1UA 1HKHA 3UB3A 4CKBA 3U17A 3ZH9B 3WBKA 2FZEA 2EFYA 3GFSA 1S8FA 1A4RA 3C87A 3I72A 4KWEA 2B30A 3AINA 2J9YB 1BA2A 3DE7X 3H11A 1YS2X 1C7EA 1MPXA 4IMJB 1J6UA 2QTLA 5BN3A 3I52A 5CR9A 2H2HA 5DBHX 5TC4A 4NDNE 1TUBB 1ZLYA 3SS8A 3ND5A 2H9IA 4PR3A 4FCWA 5DCUA 3ESCA 1EDZA 1JEQA 2WIKA 3KQSA 3ZK9A 1TTTA 1RYMA 4G23A 2JLCA 1F2TA 3BQ9A 2QLLA 4HAIA 1SBYA 4MQFB 3RIGA 2J45A 2WNIA 5KOHB 3H1FA 3DZIA 1I3NA 5B1SA 4AECA 5JAZA 4R3WA 4D97A 3N2YA 3KIPA 3EGIA 1FLAA 2VYVD 3SY8A 3BF8A 1U8AA 2OV3A 4IIJA 3H18A 5C5IA 1CULC 3J7TA 1Q95A 4LRSB 3F98A 4X3CA 4AS1A 4GOOD 4TVOA 1E5QA 1E2UA 1UDXA 2PWZA 1LD3A 1F5SA 4WQMA 4GKKB 1ADGA 2ZJ5A 3A05A 2HV9A 3SYTA 2FZ4A 2RK3A 3IQGX 3IMKA 4MUGA 3X1YA 3QHPA 2YC4C 3EA5A 4Q03A 4BE4A 1F48A 5KO2A 1S9HA 5HP4A 4HPXB 2C7OA 1H4VB 2E49A 3ZWBA 1CLEA 1VIAA 2GTHA 3ZWWA 4BLWA 1Y37A 3ZQ6A 3GN1A 5E3IA 4MQEB 4TM8A 4C4ZA 4YPOA 2C54A 5DCWA 1LBSA 1U0HC 2QGFA 2JFFA 4JLMA 3AFOA 1BVUA 2E4VA 3QKRB 3H8SA 1ESEA 1U0TA 1VSVA 1YR3A 4OQZA 3OTIA 3VDNB 1E59A 2X86A 2RHTA 2AD1A 1EFRA 2AWOA 3CHYA 3DB1A 4IIXA 5I7HA 1FIUA 3JQ9C 1EIZA 3BA1A 3OKCA 3T9FA 4Q3DA 1P2BA 4P2GA 1P1IA 4OHPA 2VP2A 4BZZA 3ZX5A 1DJNA 2PSFA 5B3KA 2EQBA 1U2QA 2IS4A 2H00A 1KVSA 2CXUA 3W7VA 1UK7A 1QV7A 2VDLB 5F2NA 3R6WA 4UVHA 4WZ6A 4M0FA 1VYUA 1BVYF 2HDNB 1WD5A 2NVUB 4AJJA 3BDVA 2DULA 4MH0R 1L5RA 1WUKS 3SR0A 1Z6QA 2M98A 4FK8A 3R8CA 2Z08A 3A7EA 1OI4A 1WXHA 4EW1A 1C9YA 2LE0A 3UMFA 4AFNA 3L7CA 1DPFA 1A5BB 4QLOA 3ML1A 1P4GA 2DAPA 1JSLA 4IRXA 3K72B 1CJSA 3ZHSA 1L4LA 4K9KA 4LJLA 4B75A 4DA6A 3O3CA 3LPLA 4G8JA 3OPQA 4YMUA 3MC1A 5LQRA 3L8GA 1KKLA 4DC9A 4L4RA 1QIIA 4WX2B 1VKZA 1HEIA 2P2SA 1B6RA 1VJ5A 3KJHA 3NR2A 1OZFA 1T4BA 4JLAA 1JW9B 2JH9A 3U26A 1GIAA 3GWZA 4LVUA 5ICMA 2YC2C 5T3YA 3LP5A 3T12A 1O0SA 2ACWA 1VHDA 5K4GA 4M9SA 1MLDA 2Y1KA 4PGHA 2IWHA 3FCYA 4PQYA 2NO4A 1DU4A 1X15A 1C1DA 3HLKA 3A1SA 3SPXA 5JYDA 4YBRA 3GUUA 4BKMA 3JRWA 4HADA 3G1TA 2RJNA 1YT5A 2YWEA 2ZSBA 1I30A 4PGAA 5G4LA 2ZIEA 3VJMA 1QONA 3FMOB 5DU2A 3SBEA 1QPZA 3EPHA 2D59A 2XKJE 1ULTA 2FJ0A 4HHEA 2RBGA 1MJFA 1B73A 1ABBA 1RP1A 1FMCA 1HURA 3FNFA 4EF4A 1SXPA 4RZ2A 5TEWA 2VJBA 1ZZGA 3WJAA 4DR1B 1OHHD 1RAGA 2FKNA 2ILTA 3ZXIA 3GGCA 1YVEI 2V96A 4OO3A 4XX0B 1KQPA 1QGED 3OFKA 1HL7A 3BILA 3P0EA 3DL4A 2GD6A 3WLQA 4EGJA 2CDNA 4OREX 4KO4S 5B7QA 3BQNB 5EVJA 1RRMA 3NGXA 2BUAA 1TCBA 4J1TA 2O7SA 5AKJA 1HE2A 2ACKA 1GPUA 2P9CA 2FR8A 3P0IA 5B3JA 1OLUB 3LUFA 4NCXA 1LS6A 4ENSA 4K9LA 2XB8A 5LA6B 1Q84A 3CPJB 1GN8A 1M6VB 5EGSA 2PMCA 4LAFA 4J76A 3R9XA 3UPDA 3HG7A 1V37A 2CLIB 2X8BA 3I1FA 4JK3A 1SUIA 2GJAA 1FUKA 4WINA 3RNLA 2FPIB 2IYFA 4JR1A 4L9AA 1XWFA 3W8EA 4C4AA 5AWFC 3URKA 3L7KA 4H18A 5CDFA 1PK8A 4EATA 3AVYA 2QX4A 4HNGA 1PFKA 2FMIA 1KHHA 3F5FA 2GRJA 2QWXA 4DXAA 3OJXA 3ZH2A 4E15A 4B6GA 1DEAA 1ORDA 4ND5A 5TQ2B 1X1SA 3Q3HA 4N82A 1Z33A 5JQWA 2AX4A 2Y66A 5KTPA 5BV8A 2IZ0A 1JH9A 5B12A 2G72A 2W9XA 2ZBVA 4IS3A 3ZHBA 1R3UA 2AQ8A 2FXVA 1UZAA 3G23A 4JUBA 4RNDB 3OJWA 5M04A 1E2HA 2YYAA 1NVXQ 1LK0A 3FPCA 4X63A 3B6IA 5JROA 3STVA 4FGKA 3ZJTA 5IH3A 2NZJA 1SHJA 1XF9A 2PXXA 3L7AA 1YZYA 4URZR 1C2TA 2WUDA 4WECA 4QE3A 2P35A 1RLOA 4PSVA 1QOZA 1XZMA 2CDRA 2CLLB 1CLUA 2REBA 4U8HA 1P60A 3BIXA 4O8ZA 1GKYA 4HEQA 2CXPA 3UJAA 1Z18A 2QN7A 5I3ZA 3GZNA 2QTHA 1A9TA 4PLZA 4IDFA 3RO7A 5BSEA 2UYQA 4UVGA 4G5HA 3ZQJA 4XVRA 1HFJA 2AG1A 4DMFA 1GR0A 3OIYA 3GFRA 2IPNA 3ENQA 2GRAA 4OHKA 5HIJA 4XW2A 4UBMA 1GZ4A 2EX4A 1FNDA 5HUQA 4CCWA 4QUDA 3LRXA 2P7HA 3A1NA 3W8RA 4URYR 4Q3CA 4NF2A 3LCCA 4MVJA 3ONFA 1DHTA 2VQ6A 2P78A 2VP4A 3H16A 4RANA 3H4TA 4RVOA 4EG8A 3HHPA 2CB0A 1H65A 2WWRA 3EF3A 4OLJA 3P2OA 1TF2A 2OXRA 4MITA 4HUQB 1O89A 5ULLA 3RNOA 1QZXA 4Z0HO 3RC8A 3SGLA 4S2EA 2LW7A 2OCPA 3G2LA 1ESNA 4DLSA 3FFXA 4DMHA 4MVXA 3W5BA 5EEGA 4OIFA 1EUDA 2XGSA 3NU1A 1L5VA 1TOAA 1XSEA 1A8SA 3OLWA 5TPWB 1ZVVA 1D5CA 3IEIA 4M49A 4TKVB 4TSKA 2IH5A 4J2HA 3CLTC 3L3BA 2AFHA 4RVSA 4TV9B 5ARDA 2YTZA 3PGKA 4EJ6A 1TT5A 3ZTWA 2H5JA 1OI3A 1D0VA 3H2BA 3OM1A 3OLYA 1EA5A 3O3OB 1ZCAA 3WE7A 5H80A 2Y1XA 1W47A 1EA7A 3UAZA 2AE1A 2R66A 3K6SA 4F4DA 4YO7A 1E96A 1KY3A 4INZA 3COJA 3C14C 3AVWA 2PQ6A 1QNFA 4EUHA 3OMXA 4O2AF 4BX9A 4TV8B 3HE3A 2R87A 3R6TA 3K5HA 1M83A 2IXEA 4QTUB 5E1BA 3VVMA 4XUEA 1QU3A 1CUYA 3R8FA 3BIFA 1FS5A 2H92A 2I5PO 3LY7A 4TTJA 3SX2A 2Q9CA 3TZBA 3ABQB 1TECE 1GSIA 2YYSA 3CNOA 2PX2A 3L0DA 1E5LA 3OZSA 3MGCA 2PKWA 3E58A 3X1MA 1YBHA 1H05A 4DLPA 3A37A 3IOYA 5H82A 1PUIA 1SUBA 1CRZA 1TA9A 2JI7A 2MJLA 3HMKA 3WLHA 2DECA 5F9MA 5H70A 5LMCA 1ODIA 3ELUA 1JAZA 2JGDB 5G02A 2WZBA 3DKIA 3ST7A 5CDHA 1C8LA 1MV5A 3L05A 4IQ4A 1WCWA 1Z7YA 3LBAA 1PTJA 4H4EA 1MOPA 1E89A 1E7SA 4I5DA 2FPSA 5BSKA 1O96B 3HCWA 4RTSA 2P5TB 1BVHA 4KWIA 3AR3A 2XUDA 1E2KA 1VE1A 4DRZA 1IPHA 3AR9A 3DEZA 3F3MA 1M7BA 1IN6A 4D57A 4B5KA 3BE6A 4BBPA 2ZBRA 4ZDKA 4B7AA 3GAMA 1J9GA 2I2DA 3X1WA 5MFPA 3PDCA 5AVWA 1XWIA 4FONA 3DMPA 2WSSD 4AIRA 4ZJPA 1T5LA 3NKLA 1PDOA 3KKOA 4AZVA 3VR5A 1GDTA 4Q7KA 4IGFA 4XCVA 4AO7A 3WLIA 1ZCZA 5HBRA 3AUKA 1PR1A 1Z5UA 3WJ1A 3S68A 4NJEA 2AYZA 2I99A 4TMFA 4IDEA 3KOMA 4JOBA 5KX5A 1XTKA 2J3QA 4RCZA 4EENA 1EP9A 1NONA 2WWTA 3LOUA 4FC6A 2IHYA 4L8GA 2Z30A 1HYHA 4FGUA 1Z7WA 3CZPA 3I01M 3LZCA 1T5DX 2X1LA 2FQQA 5DLQC 3OE7A 2H85A 4IQFA 3CX3A 4TPKA 1TO6A 2WZDA 3STYA 1HDIA 1ZGHA 2V03A 5HCIA 3R8XA 4D74A 2JC3A 3VR1A 1BVRA 4D9NA 3NTQA 1D3AA 3U7QA 3MGAA 4E32A 4LNAA 4I3FA 3HWSA 1CIJA 1T2CA 1PR3A 1RE1A 5JO9A 3GEBA 4YDQA 2A7QA 5CFLA 1J2UA 3PFKA 4E5SA 2XOXA 3B1KA 2GILA 1U6JA 2BKUA 3E1GA 3G8BA 1EP3B 5IVHA 1CUUA 1R3DA 4ZHQB 5FWNA 2PT9A 4QU8A 1L5HA 1L5OA 2OAQ1 3G2MA 1J8YF 1CF4A 4UHEA 3Q1LA 2RBEA 1P31A 3UHAA 4Y6SA 4ESEA 2B99A 4BV8A 1GFSA 4R7ZA 2H1VA 4PLTA 1F8FA 3VYUB 3WGOA 3NNNA 4M55A 1QX3A 1SKAA 1S8OA 4QGGA 4IEEA 3Q98A 3GLFB 4FNGA 1ABFA 4ON9A 5ILQA 1D1PA 1M8KA 2ISSD 3AGPA 2ZIXB 4GECA 5T4EA 4BIMA 3L1IA 3R44A 2PRKA 1VIDA 3ABZA 4KKXB 2B5OA 2GAJA 4RSGA 1OXUA 4B87A 1LDNA 3BXGA 3U7JA 1JHRA 3KB2A 3QF4A 2OVFA 1NW6A 1M6WA 2RGCA 3GP3A 4IXMA 1T25A 3T3PB 3Q3GE 1DT5A 4FCVA 5A6SA 3KS9A 4WXPA 1LPPA 5DM1A 2WWWA 3HXKA 3ZEAA 1YQWA 2E89A 2QP4A 1W5EA 3A2NA 1BDHA 1Q6ZA 1E5TA 3ZPXA 5HK9A 3GNTA 2RKBA 2BTOA 5DBFA 4DYDA 4FB4A 1KC1A 4ENRA 5I4BA 4D8UA 1LPSA 3OA2A 2JLQA 5UKDA 1AHHA 3T5CA 3VUFA 4MV3A 4C43A 1ZIXA 4J49A 1ZO8A 4KDCA 5J4HA 1CJKC 1QH9A 4KIJA 5JVDF 5CLIA 2QGZA 3IIEA 5TSDA 1JG1A 1RM5A 1V7PC 1WS6A 3EEFA 4OQXA 3WKDA 5A3SA 4RH0A 4FMDB 1BCRA 2J7PD 2NO7A 1S2MA 1DJQA 3JR3A 5HKLA 1L7DA 3WDSA 3VBEA 4L4ZA 1HDRA 4IJQA 4KAFA 4DA8A 2IYVA 1GT91 5IYZF 4CQLB 4EG7A 3B3AA 2C4UA 5JAUA 4DT1A 1K7XB 2QMOA 5IDYA 3SF8A 3ER6A 3AR2A 1M34E 4AJ4A 3KKZA 4HRAA 1X7WA 4KV7A 2P9JA 3AOGA 2O5VA 1E63A 3HJCA 3JD1A 3N74A 2Y6UA 4AY3A 3K2QA 4RQBA 3WMXA 1H5UA 3T7TA 2FG6C 1ZISA 2QTCA 1JU9A 5EKTA 1MVOA 1TTHA 2ZIGA 2ZIZA 2HY7A 4F2HA 5CLJA 1CY4A 4R9UC 3FPKA 5FBWB 5GP1A 3MK31 1IWOA 4D9IA 13PKA 2H8KA 1PLLA 2ZYDA 4H6PA 4D3YA 4MUIA 5IJWA 1N77A 3L0ZA 4E4YA 1EH5A 4LWQA 1VJ0A 4K0RA 5CA0A 1DDIA 3HRIA 3TLBA 4C04A 3G2HA 2HA0A 4MCJA 4OAQA 1RWPA 4OHZA 4PYNA 4YNBA 4BXOB 2VRWA 3CO0S 1KH2A 2JLRA 4KO8A 1L1EA 4RO0A 3T7AA 1LX6A 4RXTA 3GP8A 2HBRA 1FYDA 2FZCA 2XRMA 2YKGA 1YZGA 3VZQA 2CHFA 3MJVA 1CDZA 4FOSA 5ES3A 2VAXA 2A0UA 2HX1A 2VJOA 3PD0A 1RDFA 5EZYA 4AP9A 5KOJA 1MQAA 3CRW1 2YRXA 4HJRA 3WK5A 1V96A 2PYDA 4I1RA 2IS6A 2P40A 1IOWA 2G5TA 4YRIA 1I01A 1KZ1A 1UC8A 1XLTA 1YO6A 1N3IA 2QRHA 4K46A 1O3YA 3KL4A 4ZC8A 4AP6A 4LDJA 4RU1A 4CMEA 2XCTB 2W11A 2NSYA 1CG6A 1GLNA 2V7QD 3HYCA 2HSDA 5DP1A 5ARCA 3AJAA 2OHFA 5I48A 4JYZA 4UD2A 2YV4A 1H2WA 3QE3A 4YWJA 1HFWA 3PNQA 1Y80A 4Q3KA 1N9GA 3T15A 2VHEA 4QICA 1SXIA 1QIMA 3DLAA 4UBJA 2VAPA 3IOBA 4CL3A 2R8BA 2W58A 5EJAA 4GC5A 3RFFA 1EESA 4NG5A 1A9PA 1XCPA 3SWWA 4LF9B 3FHTA 2IF0A 5JD4A 4C0WA 2W2QA 5J9FA 3QY0A 4GC9A 1BXGA 3D4BA 4LFBB 3WWCA 1KVUA 5BMVA 2QMHA 1HTBA 1DCMA 1ZR4A 4QXRA 5JSZA 4IDCA 1ECGA 4JJIA 5IAAA 1GTRA 1K6IA 2Q7XA 2V54A 3H5TA 4N3CA 1Y1TA 2NUTA 1XK7A 4J16A 4WKPA 4TLDA 5M29A 3ELBA 1GUAA 2HSWA 1XJQA 1JR3E 2FQ1A 1RBQA 2Z5LA 2Z9CA 1Y8AA 3L9XA 5JANA 4TSFA 5GV7A 4DM7A 2QPAA 1DTSA 3QU5A 1E2MA 3QVGA 1X39A 1CTQA 4O0LA 1ZCJA 3EXIA 3HDJA 1KJQA 3HYRA 3WOHA 2Z1DA 3U31A 1G59A 1KF0A 3JU3A 1FP4B 4N5NA 3TQIA 1SC9A 2PSJA 5AKZA 1U8CB 2FJUA 2YOHA 3HRHA 1YS7A 3TLCA 4JJ7A 1YB5A 3GHYA 4EYKA 3IE0A 4HEHA 4JC5A 5JNRA 2WAOA 5CYGA 2C2BA 3L8CA 4P80A 4BZQA 3OFNA 5DOVA 3NVDA 3BJIC 4B35A 3CX7A 3EQ9A 3P9ZA 5G0WA 4RGBA 4TS3A 5A4MS 2G4CA 4X1KB 5IPFA 3LL7A 1B1AA 3EXFA 4FDMA 2XQIA 1JIXA 2Y27A 5KYWB 2QL6A 3NXSA 3N6VA 2C3MA 2MSDB 3BWCA 3PR3A 5A9TA 5EJ9A 4GPTA 2PCJA 4L02A 1J24A 1XOIA 4QUGA 5IT5A 1ILWA 3ZXSA 4QQRA 1RU3A 4DPKA 2YOGA 3MWGA 2OV4A 1NXVA 1W0KA 2V74B 3RRFA 4B4OA 1HZJA 1WY7A 4EX6A 5HRAA 3R7SA 1J56A 1GTL1 2HPZA 2IVFA 4N7RA 1BU5A 2VBFA 3C24A 1WR8A 2MIIA 1Z34A 3CLTD 4HH0A 1JF8A 1Z16A 2QM7A 4FYIA 2WKQA 1Y8QA 2R1TA 3R0ZA 1P5FA 2D8AA 3TX2A 3WQSB 4H6VA 3ZYCA 2GZAA 3TTSA 2B6NA 1GTSA 5ALOA 1W4AA 1IL0A 1GPNA 1FDVA 4KIWA 3BRSA 3DF7A 3U6KA 1UBMS 3Q9SA 1WW3A 4HWGA 1AMUA 2VUIB 1K3UB 4UDYX 4DLZA 4PRLA 3RHTA 2LP4Y 1RAAA 1RYBA 2CXNA 1YJ5A 3O95A 1ORHA 3PQ7A 5EE9A 4DY6A 2DJIA 3MF4A 4EVRA 1N6KA 3I9JA 3U7FB 3ORSA 3SYKA 1XVVA 4TVBA 1CHNA 2WIDA 4MV4A 7YASA 5AW4A 3D6TB 2PU5A 1ACJA 1Z5VA 1CZNA 4MW6A 1CP3A 4J3JA 3H0CA 4NPHA 2PMEA 1P7CA 1SBNE 3MFYA 1DAPA 4GBED 4JDPA 4Q3AA 5ADWA 3Q87B 3KUDA 2YVQA 3WKBA 5LUAA 2Q28A 4LISA 1OGIA 5TB5A 1ORVA 2QAJA 3OAAD 3QWBA 4NAUA 4R1SA 2R8EA 2TECE 4G1BA 4BVGA 1XJ5A 1XTJA 4UUNA 3RSLA 2YJNA 1MW9X 3V8VA 4J0JA 4DZRA 5JUWA 3H3JA 5CPBA 3OQ1A 2H4JA 4MNTA 4QKQA 3PNVA 1DAGA 4B6JA 4TLEA 5FX2A 2FPGA 3MJHA 1AKYA 2JAPA 1E3DA 1ECJA 1QTNA 2VPXA 4N39A 3ZGLA 2CLSA 1ONNA 2WMYA 3NTUA 4FUTA 4I6GA 5ERGB 1IRXA 2QTAA 2FRDA 2MSLA 3OQBA 4MUJA 4EDFA 4EZEA 1XPUA 3Q7PA 1TDJA 5F2KA 1HFEL 4E2FA 1E1DA 1MC4A 1T4CA 1U2GC 2G4VA 1M2VB 3VR4A 4B17A 3GDWA 4M9CA 4B46A 2G83A 1IB6A 2X8JA 2VZ9A 1U7TA 4MW2A 2FN4A 1XQVA 2YQ5A 3GC6A 3RGWS 4YT4A 3IEMA 3AVUA 4EA8A 1QKIA 4P98A 3PX2A 3WA7A 2XKAA 3KSDO 4D8WA 1K8RA 2HLDA 1M8FA 2B20A 2IITA 3V8RA 1QRAA 2RKWA 1PO7A 4DCUA 1YV9A 3PQ5A 3ICOA 3K31A 4EGCB 3FSGA 3OMWA 4U9UA 1RJ9A 4A6EA 2HEIA 1CERA 2CCJA 1PD0A 3GIWA 1C0IA 4QEKA 4ND4A 2PGLA 5TT0A 1VG0B 4V0OA 2IYAA 3WWDA 1DEHA 3WGZA 3B9RA 3GCDA 5FP0A 3ANYB 1XEFA 3M82A 5KKAA 3D2CA 4MHSA 4ZT7A 3WMWA 2JFNA 4LE2A 2E9SA 2RK4A 2VDWB 3CC8A 3ZJ4A 1ZM9A 3AESA 4FW8A 4IZIA 5CVEA 5FJJA 1TYAE 2XF2A 2NO1A 3IAUA 1FEZA 4JAVC 2W70A 3PC6A 3EA4A 3EZGA 2ZJ6A 3LT0A 4RJKA 2JJ1A 1WP4A 2Y0DA 3AEYA 5HILA 4G97A 2ZJOA 3GOHA 3OU6A 3TIIA 3K16A 5IDQA 3OP1A 4LYJA 3D9QX 2HF7A 4MYDA 5E38A 3ZJ5A 10MHA 4HKTA 1EK5A 2NGRA 2WKRA 3O93A 4D3SA 4RIEA 4E4RA 1E6UA 3C15C 3U44B 4GOLD 4FFVA 1RT9A 2HMUA 1UC9A 3JATA 1EDBA 4C4XA 2EV9A 4RHXA 1VMDA 3KYCA 5MFZA 4K6CA 2IY8A 4CTNA 2NLOA 3IAM1 2J9FA 2WT4A 4B3FX 2DPYA 2H1SA 3IH5A 4L85A 1YRWA 3F2IA 4PWZA 3K09C 4CKCB 2BGGA 2AYYA 1K7FB 2PRJA 16PKA 1ZH8A 2Q0QA 3CUKA 3NHYA 2V4UA 3DFZA 4HDQB 4UAUA 2C7BA 4YAGA 5L40A 1DIBA 2QT1A 3D3EA 1HE1C 2DZDA 1XAIA 3H65A 4LDZA 4RUKA 5GY7A 4RAQA 4I55B 2P3QA 2J5QA 4EY7A 4X92A 2B36A 1K97A 4OUDB 4JL8A 1I3CA 3IESA 3EG9A 4I4CA 4JZYA 5CLFA 3T1OA 3BBPA 1DC5A 1Z73A 3ZY2A 3GGDA 1XA3A 1TM5E 3ZI0A 1U90A 4ETWA 4DLTA 5KYUB 3MQFA 4RFVA 1R66A 4B8ZA 3AB8A 3DXFA 1YIAA 5FV4A 2BFBA 2AKAB 5BSTA 1IUNA 1CUBA 3KKNA 4NEQA 4WOJA 2GBPA 4NFYA 4B7ZA 4QAQA 5BW5A 1X7ZB 1RLUA 4GWGA 3HV0A 3DTTA 3I6YA 2JGLA 4RJLA 4NU6A 2X9LA 5GQSA 1YI0A 5KSYA 2HB6A 1H9BA 4PSUA 3FHJA 4EL5A 1I2CA 1NR5A 3HUEA 1BE1A 2YXDA 4KXNA 1X7YB 4YP6A 3TB6A 3ZDQA 2OP1A 4BZXA 3O73A 1A76A 3NTRA 4AICA 1F6WA 3WKEA 4GKBA 4N6GA 1W44A 3G68A 1YZFA 3F73A 2LV8A 2PMKA 1DIRA 4N7MA 1ZFNA 4MW7A 1XNQB 2YHIA 4GICA 3LZDA 3OURA 5FRDA 1ZI9A 3VO2A 2I2BA 2ZYHA 2FF5A 4KMMA 4G07A 1WCIB 5B1EA 1J1UA 4UUPA 3HN2A 3CXRA 1O1YA 2YFKA 3CEHA 1NFQA 3DAHA 2ZIUB 2WUEA 3FOEC 2G25A 4MYSA 3FGPA 3ZHTA 1J23A 1SCUB 5LWHA 3TH5A 4RLQA 1L2TA 3D2BA 3K1AB 2XXAB 5F33A 1NN5A 1U0EA 1P45A 3LPCA 1F5NA 4CIWA 1Q15A 3PI7A 4K6GA 3RVLA 1FMTA 4HD8A 1Y5NA 5KTMA 1N33B 2HA6A 1JG3A 3OY2A 4LK3A 1DO0A 4IUYA 1KGDA 5CJJA 3TR5A 3TSWA 3FLEA 2XRZA 2A3NA 4DSOA 4HNTA 3UYKA 3PQ6A 3QNWA 3L82B 4RK1A 4DF3A 1WUHS 1H8HA 3KQKA 1BGXT 2I4OA 3QM1A 3L02A 1PQYA 4Q7QA 2HWYA 4ZCQA 5AVTA 2V4ZA 2J3LA 3FKSA 4I7EA 4U2GA 1P1BA 4MP8A 3VTAA 1EGHA 1X3LA 5HWSA 4RQUA 4JJGA 3O8OA 3DQPA 1RM4A 3AUFA 1X1QA 5EYPA 2OUIA 5REQB 4HXEB 3HCCA 2JLUA 2PXCA 3CLHA 4AN4A 5B2EA 1Y7TA 2JFYA 4QXAA 2R1VB 3CMMA 3T5TA 4AXXA 3EGOA 2XZDA 1ZAKA 1QDUA 2ARKA 5EJ5A 3BH0A 3H9UA 4QGAA 1WB9A 5A0VA 4DNXA 4BBJA 3UUWA 2FDCA 3R74A 5K2MA 1P1RA 4CXMA 5LMNB 5LOVF 1WD7A 4NHEA 4TTPA 4OAOA 1J2RA 2C3UA 2OORC 3F4KA 5EHIA 5JSUA 2WG2A 2YL2A 5FWXA 4X62B 4C2UA 4GD3Q 4GL2A 3I9KA 3CW2A 1VB5A 3OH8A 4WCFB 3R7AA 1Z45A 2CZGA 1YI8A 3CURA 2Q2WA 3OD1A 5H3LA 3RKUA 3L07A 4RXMA 4YCLA 2ZWVA 3EGWA 3ND7A 1TKBA 3AW8A 4XYMA 3CG4A 1U4SA 4P0PB 3HCBA 4J0KA 1F60A 4D9HA 1E1YA 3LF1A 4G5RA 2XEDA 4KOAA 2HRCA 3RAGA 3AHHA 3WYEA 3IL2A 5TPZA 1UKVY 3PFFA 1FW6A 5CFNA 2B94A 2OZVA 2W6PA 2CV1A 1B0PA 2HDHA 2RC5A 4IJUA 2B8NA 5EQJB 3V32A 4B4KA 1B26A 1J2TA 1L5WA 3TGPA 2W98A 4HXGA 1JUDA 4IILA 4KYUA 3WXMA 4H7DA 1U1FA 4F21A 4TS1A 5IFKA 2PAFA 2JA1A 2JIZA 4R84A 1F3OA 1P2TA 4ZO8A 1E77A 1XJCA 4G86A 1JIVA 4L4SA 3TL6A 4NCJA 4XJXA 4L7QA 3BYZA 1KWGA 2PA0A 2Y4OA 3RTBA 1UJNA 2HT6A 3TD2A 2JVJA 3S4YA 1ESCA 1RVV1 2SHKA 4U8GA 1G8GA 2I78A 3K4PA 2BM0A 2IU0A 2ZRCA 1LC0A 3A9SA 2H1CA 3UK7A 3QXHA 4P83A 3RARA 1DL5A 1PJQA 4DV4B 1PL6A 3IO5A 4M8KA 4URFA 5ECWA 5TT1A 3VSDA 5H9WA 5FTKA 3OIFA 1HT1E 3QE4A 4FFMA 9MHTA 1N2HA 4N5LA 4PZ0A 5E4TA 3D3KA 4A8HA 4PANA 4EG3A 3W9UA 3UAGA 2G67A 1FYVA 1MXFA 3W2GA 1PGOA 1VCNA 2YWGA 4W7SA 1AKUA 2JCXA 2X8WA 1LPMA 4FX5A 3HCPA 4MEAA 1JMYA 1D5WA 4R01A 4D8TA 3GFQA 4M8SA 2QTRA 3RODA 2QL9A 4OXIA 4BNMA 3KZ1E 1XO1A 2QD2A 3H4VA 5JLAA 3D1JA 3NWOA 1JKJB 5L3QA 3U1BA 1JRLA 1ODTC 2BZ1A 3LUDA 1I5EA 2CMFA 1CWUA 1ZP6A 2QY6A 1DXHA 2Q50A 4JBIA 4BKPA 3O4JA 4CW7A 4RTNA 3TRIA 1RZRD 1TPYA 1DTWA 4E51A 1MEJA 3C0KA 4IH4A 4YDSA 3V9PA 4NENB 3BHMA 4YMSA 3V5NA 5HKKD 3GLGA 1ZK0A 1Z2NX 3E2IA 3OPVA 2VYVA 5C18A 3AEKA 3QFCA 1GU7A 1B8OA 1XDDA 1Z3IX 4ZAFA 3DLTA 3RASA 1SQ0A 4CG0A 1RQLA 3B85A 4R41A 4P2BA 4ZVKA 3ZC3A 3ZCTA 4RAOA 4L8FA 1OY1A 2NMVA 2DKOA 1TAGA 2CD9A 1VI5A 3JQDA 3NT5A 5JCOA 1WP9A 1L8OA 3MCZA 1O03A 2OBLA 2YCLA 3IVAA 3S2SA 3QUQA 2FMUA 5BN4A 2CNLA 2SKDA 4KGVA 4HQ0A 4YT5A 5IAEA 2QRVA 2VNHA 4FOPA 1A8HA 3WGYA 3TLXA 1YQ9A 4F1WA 2F9LA 1GZUA 3FZYA 3X0DA 1UMCB 2G17A 3JTMA 2E5LB 3AVXA 1QP8A 3L93A 3P9QA 4HVLA 2D5LA 1EUZA 1Z0IA 1ZH2A 2FRXA 3KOUA 1NKSA 5I9SA 2PGXA 4Q66C 5IUKC 3L8EA 4L6CA 4R8MA 1OAOA 5AH0A 3MTBA 4NAHA 3R0XA 1E9EA 4NS4A 4R83A 4C0AC 4RW0A 5GZ1A 2CFRA 3BH7A 1CIVA 4JY7A 4MJ3A 1MKYA 3HBFA 3ME5A 4MKIA 4UTZA 2BH2A 3RJTA 1CS4C 3N39C 4RGYA 4EUSA 1XMPA 5HK8A 1CK4A 5EPOA 2QJFA 4AM8A 1E1NA 5HJEA 1GT6A 2QV0A 3IAM6 1PF7E 1T3SA 4DWJA 1DRKA 4CL2A 3PFBA 1R9GA 3WK9A 1GV0A 2GM3A 1N5OX 2FN7A 4B3CA 1G5IA 4FDLA 1I3KA 1L1FA 1CJBA 4HLQB 3M81A 4MV8A 5JPCA 3SSAA 2PKRA 2ZB4A 8AT1A 5IJZA 3KZVA 3N8KA 1GG9A 2V7VA 4E6PA 2KI5A 3PGXA 3IX7A 3PQCA 3TFWA 1Q0RA 4B6SA 2QSYA 1LRJA 2IFTA 5C1PA 1SXJC 2OCXA 4G2NA 2JI8A 4MWDA 4RETA 1USIA 1FTYA 1W581 2H2WA 4UTRA 1U9IC 5AOBA 4D26A 5JADA 1AA6A 1E3TA 1W8IA 4LF8B 1UM8A 1DBSA 2YXNA 4IAOA 5E0OA 4PFQA 5TXGA 4H17A 5JZ9A 1WCXA 4LHVA 1E7WA 4TTAA 1M73E 2X0NA 3GG2A 2QN1A 2GEVA 4C3OB 1SVUA 4LA4A 4PO9A 4II7A 5C8DA 5CYPA 3UUFA 4OB6A 3D43A 3HL4A 3IAHA 3PIRA 2E85A 3TW4A 3NHMA 2N46A 1J8QA 1JIUA 2Q4DA 3G02A 3VSEA 3QSGA 2VUHB 2VJMA 2DFDA 2XMCA 4J07A 1J25A 3MT0A 2Y93A 2JHAA 2Z57A 3I9OA 3JQPA 1T9HA 4G0ZA 1TMGE 1C3XA 4GZ6A 3PB3A 4H77A 1WZEA 1R64A 5DMXA 1UWCA 3NHWA 3LOQA 5EMNA 1BC5A 2P8SA 1TZJA 4D41A 1S01A 1DEOA 5HIAA 1UFKA 5FADA 1NSTA 1O95C 4RPIA 1KERA 4P84A 3FWNA 5KPDA 3QEKA 3UY4A 2P75A 3RYTC 3H4IA 1U9YA 3A6KA 3PTLA 2A94A 4EF5A 1J21A 4ZI7A 4X20A 2CSUA 2HXSA 2OLEA 5L4LA 4UCFA 1OHHA 3GRPA 4JI7B 4EJMA 2CVHA 2YHSA 2OCAA 1UMDB 2ZTSA 4L50A 2WU3A 1T9KA 2B4QA 4R1MA 3RJMA 3SLRA 5FUYA 1UPBA 3MRVA 2AKEA 1T2UA 5CEFA 1GFZA 2AYXA 4XWWA 3KEGA 1BWPA 5KJFA 3E9CA 3KL2A 1LTHR 4L9SA 3EQ7A 4RJJA 2JLBA 1KYTA 4P08A 1A8IA 3E8XA 3K4HA 3SR4A 1KQGA 4HNAA 4NBSA 2NP6A 4PFJA 2ZJFA 1HNWB 4NE7A 4G0VA 1JLLB 2O48X 2PFKA 4KFRA 5DGXA 4ND6A 5FAXA 1TKCA 1B93A 3RYHA 5ICSA 2CYBA 4MWTA 1TADA 1T5IA 3P20A 1P39A 3G1WA 3DEKA 3L1KA 3QA9A 4XWKA 5KREA 1EE1A 3RS2A 3C1UA 3FNHA 4AIIA 4JHXA 3LECA