2CNBA

Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with nad and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
383
structure length
366
Chain Sequence
SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVETRENVARKLQQSDGPKPPWADRYAALEVGDVRNEDFLNGVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTNAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIGEHYQGSTHLIPIILGRVMSDIAPDDKRMPIFGTDYPTPDGTCVRDYVHVCDLASAHILALDYVEKLGPNDKSKYFSVFNLGTSRGYSVREVIEVARKTTGHPIPVRECGRREGDPAYLVAASDKAREVLGWKPKYDTLEAIMETSWKFQRTHPNGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE-4-EPIMERASE
publication title Trypanosoma Brucei Udp-Galactose-4-Epimerase in Ternary Complex with Nad+ and the Substrate Analogue Udp-4-Deoxy-4-Fluoro-Alpha-D-Galactose
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Epimerase
total genus 130
structure length 366
sequence length 383
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cnbA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2cnbA02
4DL9A 1NX6A 2ZK7A 5T57A 3F9IA 1KBZA 2V6BA 3HN2A 1KVUA 2DBRA 3LT0A 1D1SA 1KS9A 4G65A 2H1SA 2AMFA 2HU2A 4CMEC 1AN9A 4R01A 3GHYA 1E77A 3WSVA 1RJWA 2QW8A 4YYZA 1B3BA 3CIFA 3NDIA 2HRBA 5A05A 3UW3A 5KJ6A 3GN1A 4EZBA 2OBYA 3DBLB 1YOVB 4J91A 2BH9A 2A9FA 3I9LA 2VZ9A 4GLLA 3RUCA 4ESOA 2IEBA 1U2GA 3GUCA 3DAPA 1N1EA 4IDCA 4HBGA 2AQKA 5JMWA 2D3TA 4IGEA 4IXTA 5J23A 1PQWA 2DVMA 3PDUA 4J43A 4J4TA 2BMAA 3OJLA 4BS9A 4O1MA 1I2BA 5DBFA 4Q39A 3KZVA 4HADA 1ISGA 3CUKA 3QVTA 3JQEA 4HV4A 1YB1A 3FHLA 3INRA 1WDLA 2VYNA 4OOEA 5G2OA 4CMCA 1U3WA 5EMHA 3TF5A 2Y66A 1NVTA 4CQMB 5KWEA 2VHVA 1SC6A 1ISFA 1RM0A 3GQVA 2W4QA 3PPIA 1JDJA 3GT0A 4KMSA 3KM0A 2I6TA 2OP1A 4O6VA 4FS3A 4RF2A 3GDGA 1IHXA 4PN3A 1DC6A 2EWMA 2YDYA 3COSA 3ZCXA 3L9WA 3KEQA 3ZNOA 1EUDA 3OM9A 3T7CA 1DOHA 1QV6A 1R6DA 2XAAA 1LRLA 3A06A 2I66A 2ZB4A 1Q0QA 1EK6A 4ZVVA 4ZQGA 4I08A 3AY3A 5ILOA 3PJFA 1O95A 2ZB8A 4DRYA 1NR7A 4J6FA 3Q1LA 5A4DA 2GYYA 5IDXA 3HWRA 4J7XA 3AK4A 1YBVA 1YBAA 4BQPA 1UDAA 3AFNA 4HNGA 4IBOA 3DZGA 4CV1A 3JYLA 5IFLA 5THKA 4GAEA 4AL4A 2NACA 3WMXA 4C4OA 4YXFA 2X86A 4E30A 2OMEA 2NU9A 3R3SA 5L4SA 1U7TA 2CFCA 2CNBA 4O5OA 4P22A 1WXDA 3H3JA 3Q2IA 3W8EA 4ZQBA 4RF3A 2B5VA 4MPDA 4XA8A 3FNEA 5I7FA 1B14A 4PZCA 1CERA 5G4KB 3UXYA 3VH1A 4GGPA 1FMCA 1ZSNA 3H5RA 2IXAA 3BHJA 4LISA 3U0BA 4IY1A 4PZDA 3ZHBA 3GH3A 4E0BA 1Z7EA 1XG5A 2HRZA 4LRTB 3WTBA 1ORRA 2BLLA 4ID9A 3JQAB 1A4IA 3AWDA 1KYQA 1M6HA 2EP7A 2IZ1A 1LXCA 1V3TA 1U7HA 2X9GA 4W9NC 3UCFA 4OQYA 4BO1A 1SCUA 2W2LA 5F1OA 5IDYA 1L7EA 5GY7A 4QECA 4E21A 1CWUA 5G0VA 9LDBA 5KCZA 1KC1A 1P1IA 4HWKA 3WR5A 1ONPA 4GLOA 3AU8A 3I9OA 3S55A 3ZU4A 4IINA 3E6AA 1TT5B 1ENZA 2B4TO 4EEZA 1C14A 3AY6A 3N74A 2Y1OA 4OSOA 5EN4A 1NPYA 3DBVO 3U5TA 3EHEA 1PJQA 3RC1A 5COQA 2Q2VA 3GK3A 4KTVE 3VKVA 2GUGA 2O3QA 3PDJA 4IQGA 2PH3A 4BNLA 5FWNA 1MA0A 5JY1A 4RPKA 1ISIA 2VTEA 3Q9NA 3JQBC 4O0LA 1YBMA 1GPJA 3DXFA 4LGVA 3RBXA 1ADFA 1YL6A 5BSEA 4CMEA 3OIDA 1Q1NA 5KVSA 1I8TA 3JQFC 4WKGA 3F1KA 4FC6A 1T25A 2AEFA 5A03A 4BO7A 2C2YA 2E49A 4Q3EA 4E3ZA 2EW8A 4TZTA 4U7WA 3MJSA 4XB2A 4CM8B 3QY9A 1J5PA 1DAOA 4W7IA 4HFRA 3WGTA 1ZK3A 3VZRA 1KETA 1KEPA 4J3FA 4NJMA 2HUNA 4OIMA 1HZZA 1ZXBA 4MKXA 2FZEA 4KWIA 4OXNA 1ZK0A 4PZEA 1JQBA 3D3WB 2Y05A 4NBTA 4A10A 4J4HA 4AJEA 5EPOA 3R6DA 1AHIA 1BMDA 2DKNA 2HAEA 2O4CA 2JHFA 3QQPA 4I8XA 4BKQA 4XIYA 4D0RA 4CR6A 4H16A 2I76A 3GA0A 2J3JA 5KJFA 1UDCA 1BW9B 3RC7A 4UEOA 4YJFA 5I7SA 4XQGA 4DC1A 5G0UA 2YV3A 4J1TA 4UUNA 4IDEA 4BKOA 2OBNA 3ZV3A 4KZPA 3S2FA 4FJ0A 4D42A 2G5CA 5CEEA 5JDIC 1DFIA 1H6AA 1R0KA 4PLZA 4RORA 2QX7A 3GEDA 2X5JO 5A9RA 1N92A 2GLXA 3AY7A 3V1TC 1PJTA 3D7LA 3DMTC 1U3VA 2O2YA 3MJVA 4OYRA 5BNTA 4JQCA 3RUAA 4BGIA 3ZHZA 3F47A 4XGNA 5BSHA 1Q7GA 5CDYA 4CQMD 4TMFA 1MG0A 4FOOA 1NR1A 4A03A 4BKUA 4CM9A 7MDHA 5HRUA 2I3GA 3OEYA 3L6OO 4L4XA 4ZICA 1I10A 3P7MA 2VQ3A 2C07A 3VDRA 4PG7A 3ICPA 4R51A 4AJOA 4B8WA 1FDSA 2VNAA 2Z1NA 4B4VA 1P1FA 3ZNNA 2VTDA 3ONFA 4QXMA 1VJTA 1UZNA 4U0JA 3B1JA 1C0IA 4GH5A 3QP9A 4R1UA 4XEHA 1V35A 4R68A 4DBZA 1MB4A 4JROA 4ITUA 1YS4A 3ZU5A 4YAJA 2VOEA 4CM3A 5KTKA 3E9MA 4AJ1A 3ULKA 1ZMOA 1F8FA 3IJPA 2DUUA 4LMRA 4Z6KA 1YDEA 4ALMA 3ADOA 4Y8VA 3WGIA 1Y8RA 4A0SA 3UGKA 4G2NA 4YJGA 4CJXA 5DBIA 4CLEA 2NVUB 4DLBA 3O8QB 4GMFA 4PRLA 3TJRA 3DZFA 5JPIA 2Q4EA 4IJUA 4LCEA 1MGOA 2E6UX 3VPSA 3WWYA 3ONEA 1XU7A 1DXYA 4FFPA 2NVWA 3ASUA 2WD7B 4W9NA 1BWSA 4AJ4A 2VRBA 1H2HA 2CDCA 2IZZA 1VLLA 2RHCA 1ONNA 4RL6A 4OKIA 4WGGA 4NU5A 4M55A 3G1TA 3D4OA 3TFOA 3TRIA 3ZZNA 3GFBA 3BYZA 4E2ZA 1W0CA 3JQ8B 5IDQA 5DOZA 4BV9A 4NH4A 1WDMA 4I9NA 3JQAD 1YKFA 4QQRA 3DBHA 1YVEI 1J6UA 2GGSA 2NVBA 1B7GO 5KVQA 5CG2A 1DJNA 3VVBA 2AQ8A 1DIAA 1PQUA 1DHTA 1IPEA 3G0OA 2R6JA 2QYSA 4BMSA 2ZTVA 4CLRB 1HDOA 3WBBA 3QW2A 4NBRA 4CM4B 4JLWA 1MFZA 4MVJG 3ICCA 3GNQA 5IZ4A 1BXGA 2X5OA 4XQ9A 1C0KA 1H6CA 3GDOA 1KVSA 5CAEA 1HXHA 4M8SA 5T8KC 2H63A 4JN6B 3WYBA 1GEEA 3GZNA 4H3VA 4QUKA 2X9VA 2WMDA 2X5KO 3NT2A 2I65A 4GSLA 2FN7A 3B6ZA 4YT5A 4MOWA 1A5ZA 1XR3A 4MP6A 2D59A 2ZKLA 2J3KA 1YH3A 4OH1A 1RYEA 2PK3A 3M1AA 3DL2A 4IZHA 4S3MA 4RF5A 1IUKA 4KOAA 4YRBA 3AU9A 2EHDA 1ONOA 1DFGA 2V6FA 5L45A 2PY6A 4O63O 3DONA 3JQ9A 3IMFA 2J5RA 2ZYGA 4OXKA 3T4EA 2W2KB 3NTOA 4K28A 2A35A 4RVHA 3SBOA 4TWRA 1YDWA 4TSKA 5DDIP 3MJ4A 3DBRB 4WASA 2BELA 4FGSA 3RBZA 3WICA 4YTEA 4IJWA 3GVHA 1RYDA 1OC2A 4H15A 5A3JA 5JDCC 4JP3A 2BD0A 4JJIA 4NG5A 3UHAA 4CMGA 1E6EA 3IDSA 2R00C 3HE3A 3L4SO 1XSEA 1YGYA 4PLFA 5I8ZA 3RUEA 4E12A 4Y6PA 4BNNA 2UDPA 2BFMA 4IXWA 2F1KA 3W1VA 4BQRA 1DEHA 2EGHA 4ZQHA 3TZHA 3EZLA 4LSMA 2YHUA 4Q3CA 2OFPA 4ND2A 5CEJA 1GUYA 5K6AC 2SCUA 4IGFA 3AUSA 3CE6A 4IPTA 3ZV6A 1V3UA 3ETGA 3GG2A 4JNKA 1XGKA 1KEVA 2Y0DA 5ICMA 4Y9DA 2WYVA 4DUPA 2HK8A 2EJVA 3TWOA 1GL3A 2EP5A 4CQLB 4K26A 2HO5A 4ZQEA 4O59O 4XGIA 2JAPA 5IF3A 4U0KA 4AJIA 1F14A 2UAGA 3ZH2A 2PNFA 3FSRA 4EBFA 4A27A 1ENOA 5F5NA 5ITWA 4W99A 2VNSA 4KWHA 4BB6A 1ZZEA 5KOIA 1DRUA 4IDGA 5TJ9A 5IZCC 3W4IA 4CUZA 2Z95A 3CKYA 2WDZA 3E82A 3B1FA 3WS7A 2Q2QA 4Y6RA 4BL5A 4YT4A 2GN6A 3GEGA 2PZKA 3DZHA 1E3LA 3K8ZA 1OAAA 1T2AA 1X1EA 5L7WA 2O3RA 3G17A 2BHLA 4B7CA 4BIIA 2YW9A 5JSFA 2NU8A 1DIHA 3HADA 3OIGA 4FPXA 2V6GA 1GQYA 1QKIA 3IKTA 4OQZA 1V3VA 1E6UA 1HTBA 2YFHA 3O03A 4EYEA 2V7PA 3BTVA 4ZRNA 3RJ5A 3OEWA 1LDBA 1MP0A 4WOKA 4R9RA 5A3VA 5THQA 5A9SB 4FJ2A 2P4HX 2NTVA 1V8BA 3NDRA 4BNXA 3LT4A 1PJ2A 1ZH8A 4R69A 1QV7A 2QYTA 2JAHA 3D0OA 3EUWA 3ROPA 4BO5A 2YQ5A 2GZ2A 3WGYA 4GVLA 3FTPA 1PEDA 1DC4A 2J3HA 2P4QA 3ST7A 3FNHA 1P1HA 1T4DA 1GPDG 3R3JA 4ND1A 3HZZA 3UAGA 1ENPA 1GUFA 3Q9UA 4GX2A 2OXIA 3KYCB 1PL8A 4WCFC 5KVCA 4MVJF 1PJ3A 4JGBA 1UP4A 4RF4A 2G0TA 3H4VA 5JO9A 1M2WA 2Q50A 3JQ7B 1IE3A 2DUWA 3MTJA 2NQ8A 4S1VA 3PGXA 5I7EA 4JXKA 5TC4A 1Y8QB 2Q2WA 2X0RA 3GG9A 2HK7A 3KETA 1A71A 4A5OA 5I9NA 3I52A 4DLAA 2XF8A 1ZNQO 4ILKA 4IMPA 4UVEA 3KV3O 3TFQA 1IHYA 5F1PA 2YY7A 3JD0A 4FFLA 2HCTA 3C1AA 4RDHA 3QIVA 1I2ZA 3WDSA 4ZU3A 4DYDA 1JVBA 1E3JA 3RC9A 4YCAA 1IOLA 4E32A 1MLDA 4PFJA 1E7YA 4TRMA 1GAEO 5IN4A 1CIVA 1EUCA 2GO1A 5ER6A 3SJUA 3WX0A 3H5NA 2Y1EA 2ZTLA 1M6WA 1P0CA 2IYPA 4XZ3A 4QFDA 4INAA 1T26A 3QVSA 4FBGA 3AFMA 2B5WA 4Z3DA 3ZWWA 2PV7A 4GQAA 4XWYA 3CXRA 4MVJH 1NTOA 3WYCA 4BO6A 1EFLA 2PD6A 4FFNA 5FI5A 2DQ4A 1C1XB 1NVGA 1L1FA 2ZYDA 3UF0A 5A06A 3DTTA 1U8XX 4R16A 1ARZA 3ZWYA 4NIMA 4QX6A 1P74A 4YRAA 3GAFA 3UKOA 1G0NA 4I5DA 4XDZA 3P2YA 3RJ9A 2X22A 3JD1A 4B3IA 4BNUA 1LX6A 3NX4A 4R9SA 1YONA 3KHUA 1O0SA 1X7GA 3IL2A 3FBTA 1K89A 3WGZA 3WJAA 2G1UA 4JX8A 3KYDB 4DREA 2Q45A 1YO6A 4J4BA 2UYYA 4DIBA 1X15A 2FR0A 3STHA 3PWSA 1PWZA 1ID1A 2XXBA 3AM3A 3BAZA 3FPLA 2GZ3A 3D5QA 1GYPA 3RAJA 5KVVA 5DP1A 3G1UA 5HM8A 5BR7A 2EGGA 1RM4A 2XXJA 3PGJA 2Z5LA 1G6KA 2YDXA 1C1DB 1DC3A 2EG9A 4WK6A 2YFQA 3ZV4A 4YWJA 4N5NA 3KXDA 4EJ0A 1I30A 1PS8A 1T24A 3LT2A 4BMVA 1BXZA 3C7DB 3GF4A 5JAZA 5C7IO 3JQGA 1UP6A 2ZB7A 2OZPA 4CLOA 4RCVA 1WP4A 5MDHA 5L53A 1PWXA 1IZ0A 1T2CA 1YB5A 4EDFA 1LSOA 2JKVA 4R1NA 1HF3A 3NTRA 3LC1O 4GMGA 3UICA 1NQOA 3OIFA 4WLEA 5F1KA 3OJ0A 3DOJA 4J2OA 4EUFA 2ZATA 3WLEA 5JCJA 1V0JA 2D0IA 4JBHA 1HYGA 4KTTE 4W7HA 5G0SA 3I9KA 3MZ0A 2VRCD 3VAZA 2J8ZA 3UCXA 3TDKA 3BMQB 4HFJA 5TSDA 4BNGA 2B37A 3DBLA 1YOVA 4KDEA 4XR9A 1PTJA 3RIHA 3RROA 3LF2A 4WCFB 5JCJD 3JYNA 4YJDA 1JTVA 1H94A 4GWKA 2V6MA 1QYVA 1RWBA 2O3TA 2X7HA 2Y0CA 2AQHA 3BMOB 2E37A 1OFGA 1CQIA 3LC2O 4P8RA 2TMGA 4NHEA 3PQFA 3KO8A 3V2HA 3VPFA 3RUFA 5EINA 4UVIA 3QVXA 2O2SA 2IDZA 2UV8A 4CQMA 4MIEA 4CMIB 1MX3A 3L6EA 4PCVA 1E3WB 4GI2A 3WWZA 1UJMA 3WIDA 5IJZA 4Q3DA 4I9UA 3WBFA 4WCDA 1EQUA 2DFDA 1PGJA 3ITDA 4KQWA 2HK9A 2WWRA 3NGXA 2Q3EA 3HQ4O 5EIOA 3NT4A 1SBYA 3D5TA 1U5CA 1VPDA 3D3EA 5F5LA 4HY3A 4KUGA 1H5QA 2YHIA 1IYZA 1LLQA 2PZLA 1Y5MA 1WZEA 3KVOA 2VHYA 5GZ1A 3TZKA 3W6UA 4OL9A 2VHWA 3OQ6A 3U9LA 1BSVA 4BNIA 4MO2A 3MEQA 2D4AA 1BVUA 4MIYA 1R4MB 4E5PA 4U5QA 4AJHA 3M1LA 4WLFA 1A72A 2TMDA 4TKLA 3PRJA 4BNJA 4CODB 4RLSA 1LDNA 5JYEA 3V1UA 1GY8A 1ZUD1 1LLDA 3EC7A 2EF1A 4TRNA 5JBIA 1T1RA 2DTDA 4ZGWA 3WJ7A 1LEHA 2V65A 1DIBA 1GYRA 2DPHA 2QZ9A 3AOEC 1Z82A 1TEHA 1YE3A 1E7QA 2JJYA 1XIVA 3I83A 3W8FA 2FY8A 2PZJA 4AJ2A 5G4KA 4BNWA 3Q11A 2UUPA 1QRRA 5F21A 4OKNA 2PWZA 3I9MA 4YT8A 1JAYA 4Z9FA 1LDYA 3PJEA 2QRKA 3K96A 3OA2A 3SXPA 1XEAA 1Z7BA 1YQGA 2X58A 4HP8A 4XR4A 2OHXA 3QJ5A 5L3ZA 5DOVA 1YXMA 3JQAA 3UFXA 1PJBA 3PQDA 1DC5A 1F12A 1IL0A 4NDNE 3RC2A 5L7TA 4L74A 4K1LA 1LA2A 1QYCA 2DC1A 4DVJA 1NYTA 4E5NA 3WQRA 3GAZA 2YJZA 1E5LA 5GZ3A 4FC7A 1LRJA 1ZCJA 2P9EA 1E7SA 2OL4A 1K3TA 4E31A 3FI9A 2O7QA 2AQIA 3KLPX 5K9ZA 1XQ6A 1K6IA 2FWMX 3HSKA 3VHRA 4BGVA 2HSDA 1ZW1A 4DGSA 2YZ7A 2VZ8A 4IDFA 1SOVA 4N18A 5T67A 4J90A 4LRSB 4KDFA 2UVDA 1JVSA 3V1YA 1WZIA 3GNSA 4RLHA 5JAIA 3C1OA 2EIHA 4BNHA 5FYDA 4DQUA 4QO7A 2WTBA 3HDQA 1MV8A 2EEZA 3ADPA 3HHPA 2NTJA 1Y9EA 4ALIA 2GN8A 3DZJA 3X2EA 3MJTA 4YAEA 4CM8A 1P77A 1ZK1A 2FOIA 4W82A 1LSSA 1O89A 1LDMA 3BTUA 4UULA 3DAGA 3H9EO 4ND5A 1ZK4A 4NK5A 1SB9A 4OM8A 4GBJA 5I8WA 3K5PA 4QTZA 4K6CA 3ROMA 1LI4A 3BTSA 5FF9A 2G76A 4XB1A 3D3WA 2YYYA 4DPMA 2JD2A 4DYVA 1C3VA 5KJ1A 1P45A 3LF1A 1D8AA 1KVQA 3GC6A 3A4VA 4BVAA 3LT1A 4EGFA 3RUHA 2Y68A 1BW9A 3V2UA 1MXHA 3WFJA 3C85A 3EK2A 3RFXA 4DPLA 3EW7A 3UVEA 4XQCA 2X6TA 3QWFA 1ULSA 4I5EA 2FHSA 1N1GA 4YVFA 4XQEA 4JBGA 3M6IA 3KEOA 3ZN2A 1O8CA 3OH8A 2I99A 5DNAA 4ALKA 1M75A 4FFRA 1CJCA 5JW6A 5LDGA 1OC4A 1GDHA 5ES3A 4YJHB 2P2SA 2BF7A 2EKQA 4AFNA 1UZLA 2X9NA 3PEFA 3PTZA 3WGGA 4D7AA 4N5MA 5HS4A 1XHLA 2X0IA 2J5KA 1BGVA 2YV2A 1GR0A 2I67A 4XYMA 1QMGA 2HLPA 1KVRA 2GR9A 4WUVA 4OMUA 4RPGA 2X1HA 4DXHA 1ZBQA 2F00A 1LTHR 1DIRA 1Y1PA 4UVGA 3F3SA 4FR5A 3H2ZA 4LMPA 4CV3A 4BV8A 3BZUA 1GEGA 3IS3A 1UP7A 5CDUA 1HETA 2LDXA 3AOEA 4MKRA 3FF4A 4II3A 1UDBA 3BHMA 3L07A 2Y1CA 2AXQA 4IDBA 2VYND 1F17A 3DZBA 1M66A 2P68A 4B7XA 1N5DA 1X0XA 3T4XA 1DLIA 1F0YA 5ENDA 3ROQA 2NVUA 4MP8A 3O8QA 4HUJA 1P44A 5JC8A 4CMKA 3ANMA 4DIFA 3H9UA 5I9MA 1T2DA 1C0PA 2CD9A 2VWPA 4RPJA 2I3AA 2JD1A 2A92A 4WE3A 2VCYA 3CTMA 2WD7A 3CMMA 3GOHA 3PFWO 4IJVA 5C7LO 4L76A 2CVZA 3AI3A 2C59A 5AQ1A 3Q2KA 4YPOA 3NYWA 3F6YA 1PGOA 1HDGO 5JAQA 2ZCVA 2C0CA 1EVJA 3DTYA 2ZQZA 1SEVA 4GL4A 1HRDA 1WW8A 4YJGB 1R4NA 4LW8A 4GGOA 1XYGA 4M49A 3EVTA 3TOZA 3SVTA 1X13A 2IZ0A 1AE1A 4X54A 1E7WA 2QRJA 4J9VA 2JD0A 2X4GA 3OETA 3HN7A 3O9ZA 4UVHA 3F5QA 5EESA 1IULA 1GV0A 2DT5A 3JQBA 3RD5A 3ZU2A 1T2EA 3EVNA 2GDZA 1MC5A 5L7YA 1I01A 1N8KA 3QVWA 4CLRA 3IIEA 4TZKA 3FBGA 4CM4A 1KIFA 2QZZA 4CMJA 4IQ0A 3Q6IA 3WGQA 2ZJ0A 1BTOA 1M76A 1SAYA 1UXIA 3JQFA 1PR3A 4RVFA 3GRKA 3PYMA 2ZCUA 4DC0A 3GMSA 2O23A 2ZTUA 4YB8A 4RPHA 2GD1O 4IDAA 2ZIZA 1QYDA 3QE3A 4R1TA 5LCXA 5B4VA 3ZWCA 1ZEMA 4CMHA 2WM3A 3DMYA 4AJPA 3LU1A 3LK7A 3L6DA 1VKNA 3ROKA 2C54A 4D3DA 1E7MA 3TPCA 5H82A 4WLOA 3DQPA 3SJ7A 1F06A 5TQVA 5L95A 3L9XA 3I1JA 4YA6A 1ZJYA 1BDBA 3NAQA 2X0JA 1O5IA 1NM5A 2PLAA 1SZJG 3GN2A 2FPIA 3GZ4A 3MJEA 2XPCA 4XKJA 2FP4A 4CL3A 3TN7A 3AI2A 4F6CA 1ULUA 2Y1FA 2EV9A 4BHTA 2W2KA 3NEPX 2GPTA 2WSBA 1EE2A 2PKQP 5KKAA 4GX1A 3MTGA 1WMAA 1H6BA 5U1PA 2X8LA 5JDIA 3PI7A 1X7DA 2IODA 3DBRA 4JJGA 3ZNQA 2DBZA 1HE4A 2AG8A 4MP3A 2GZ1A 4RQUA 5JCXA 5U9CA 1WVGA 2DFVA 1UXJA 1P1JA 2QIOA 4NQZA 3DMTA 4B3JA 1N9GB 3QRWA 1QORA 1TI7A 1OMOA 4FCCA 4NJOA 3P19A 5T6BA 4RO0A 3QWAA 4YAKA 2NUAA 1VM6A 4IUYA 2RAFA 1HYEA 1CQJA 1HSOA 3DDNA 3PWKA 3TQHA 3S2EA 1D1TA 3WYEA 5TX7A 3HDYA 5IDWA 1H0KA 2AW5A 1ZVMA 1H6DA 4MKZA 2NM0A 3I5MA 6ADHA 4J7CA 1VKOA 3PZRA 3VVCA 4D46A 1JKFA 5TF4A 4XX0A 3GFGA 4IM7A 4HFNA 4CL8A 4FSHA 4NFSA 3AOGA 3QHAA 2BFPA 4IS2A 4MJLA 1WMBA 4CQLA 2VT3A 2AEJA 1LQUA 5JS6A 1LU9A 1GADO 3TZ6A 4CR7A 4L9RA 3IQDB 2RCYA 3NJ8A 4C7JA 3ZHXA 3NKLA 3AUTA 1J49A 1FJHA 6LDHA 3NJ4A 3IP1A 3OJEA 1E6WA 4IIVA 1Y9AA 1QSGA 4KQXA 3GNTA 4FDAA 3Q3CA 1NVMB 1R66A 4FQ8A 1I32A 3QLJA 3W4KA 5A5EA 1E3SA 1BXKA 4LSWA 5CEFA 3OQ1A 4RGBA 1A4UA 1I3MA 3PFFA 1P3DA 4GX5A 3E5MA 4FFMA 4YACA 2BI8A 4UREA 3ZW9A 4DIOA 5GZ6A 4E5KA 3JQDA 4YT2A 5JXWA 1W6UA 3I6IA 3KTDA 4OXYA 3R0IA 1NWCA 2NSDA 1DAPA 3KUXA 4JBIA 4W4TA 3EDMA 1GCOA 4E2YA 1NHGA 7ADHA 3HNPA 4KUEA 1JKIA 2PZMA 4RVUA 1KERA 3MOIA 5KJEA 4U6SA 5A9SA 3GPDG 1EFKA 3ETEA 3F5SA 3PJGA 3ZWAA 1JA9A 1CEQA 1E3EA 4XRGA 1GUZA 3WGOA 4ALNA 4DWVA 4NI5A 3E9QA 3RU9A 4DMMA 5CFZA 3I9NA 3N58A 4TRRA 4ND3A 3PIIA 4BO8A 1JKJA 3JD4A 4CUJA 1HLDA 1X0VA 3DB2A 5JYDA 3ZW8A 5L4LA 3M2TA 1IPFA 2P5UA 4AJJA 4YBZA 1HE2A 3CEAA 3PHHA 1CDOA 1KY4A 1NQ5A 4TQGA 1YWGO 1SNYA 4B79A 3KYCA 5BNFA 1FK8A 2B36A 4PLCA 5ER9A 4CR8A 2HMUA 5T8KA 1I5RA 5CDSA 1VRWA 5IAAA 2PGDA 2IXBA 2Q4BA 3JCZA 3KSUA 4YRDA 1WDKA 3PWZA 3OJFA 5ILGA 4NFHA 4RVDA 2OUIA 3ENNA 4DTIA 4EUHA 1N7GA 2P9CA 3HFGA 3PHIA 3B20A 1LLUA 4UAGA 1DRWA 3C1TA 3RCBA 1UXKA 3GGGA 4D3SA 2POQX 3O4RA 5DCWA 1L7DA 2X0NA 4F45A 4F46A 4I5FA 4D45A 1Y6JA 1R0SA 2PGJA 4NK4A 1JLLA 4AJNA 4DA9A 4WEOA 4RJTA 3AI1A 1PS9A 2D2IA 3OJOA 3H2SA 3K2BA 2VHZA 4FW8A 1B0AA 1B26A 5U4QA 1B8UA 1HE5A 5BSGA 2DU8A 2O3JA 2Z1MA 2AHRA 1D7OA 4CMBA 5JDCA 4UUPA 1GZ4A 1XDWA 2R00A 3ITKA 1EK5A 2EERA 3S2GA 1S7CA 2VYVD 4R1SA 4UEKA 1A7KA 4J2HA 3TSCA 3PJDA 1HDYA 3DOOA 4UUMA 1QYXA 1MC4A 4R3NA 3O26A 3R1IA 4XGKA 5A9TA 1C1XA 2NADA 3QV1A 1KVTA 4YQYA 2VT2A 5K6AA 4BMNA 2B4RO 2JHGA 1H93A 4NBWA 3U09A 1DRVA 4L0QA 4E33A 4WEQA 1PJCA 4HX5A 1LLCA 3ZWPA 1EBUA 3INTA 1W73A 1KY5A 4OO3A 1DB3A 2GERA 2NWQA 1HDRA 4E2XA 2FPPA 2O3SA 5TRTA 4WLNA 1GZ6A 2P5YA 3KYDA 4E13A 4HFMA 1O94A 2JCXA 3JQCA 2O50A 4EW6A 2CF5A 2DPGA 1QG6A 1DJQA 3E18A 3GVIA 2HDHA 2RH4A 3H65A 5B1YA 3JYOA 4RPLA 4XYGA 5ENVA 4E4YA 3QSGA 2PD3A 1DBVO 2C7VA 2QHXA 2EKPA 4RZIA 5IZCA 1EEHA 2NU7A 3V5NA 4Y6SA 1NNUA 2Y0EA 3DWFA 3F4BA 4NMHA 2OGUA 1B16A 3ENKA 1C1DA 3H7AA 4LN1A 5H83A 3ZGYA 3DHNA 5CHEA 5HA5A 4E5YA 3V2GA 3CZRA 2X23A 1YRLA 3H6KA 1H2BA 1HZJA 5IXYA 4J1SA 4U6QA 5I7VA 1A7AA 1PL6A 3PP8A 5CDTA 4Z3KA 2NTNA 1MUUA 1OOEA 3OECA 1ZKMA 4YDRA 4MIOA 3GY0A 1E1LA 1KEWA 1VJ0A 3NTQA 4ZD6A 3W6ZA 2GNAA 3DHYA 4JJFA 5HBRA 3FPCA 3KYBA 3NV9A 4PLGA 4EI2A 2E4AA 3GVCA 3WG9A 3BMCB 3U49A 3WQQA 1U4OA 5L9AA 1Q0HA 2GN4A 4PLPA 2RBEA 3CINA 4IIUA 2B0JA 1NWHA 1ISMA 2JFFA 3BMNB 3WSWA 2B35A 1Q7BA 1SEPA 5FI3A 2Q99A 2WJPA 1ADGA 3GGPA 3OICA 1EE9A 1P33A 1PIWA 5TNXA 3RUIA 4A73A 3BMQA 1AUPA 1LDGA 2ZQYA 3NUGA 1SOWA 1E1NA 1PL7A 1X14A 1ZIDA 2DTXA 1GZ3A 1V9LA 2FSSA 3C7AA 3CH6A 3LC7O 4WCFA 4B7UA 3E8XA 3TZCA 1B3RA 4EUEA 2WYWA 5TGDA 3H9QA 3GPIA 1LNQA 1DPGA 3BMOA 2HJSA 5JAMA 2OOSA 1Z75A 3L77A 4MVJI 1U8FO 4R41A 1XLTA 1ZEJA 5AXAA 2G82A 1ISHA 1A27A 2HMTA 3DZIA 1PU2A 1FDWA 2D8AA 4FJ1A 5AVOA 1KEUA 5F3RA 1LJ8A 1NAHA 3I4CA 3FWZA 3AJRA 1CRWG 1ML3A 2Q1SA 4CMIA 5A5FA 3JD3A 1E3WA 1DDOA 3H8VA 3KLMX 1VE9A 4OJNA 3GUYA 1JW9B 1P31A 3BXXA 3F1LA 1I3LA 4WNCA 3K31A 3ZWXA 4GPD1 2VN8A 2PA3A 1LDEA 3OHSX 4TKMA 1E7RA 1ZJZA 3T7EA 4P4LA 4L73A 5GMOA 2RIRA 2NLOA 3PK0A 1X1TA 3U4IA 5CPFA 5JMPA 1QR6A 2IE0A 4BNZA 3AM4A 3IOYA 4FOSA 1FDTA 1PGPA 1Y5RA 3WGHA 4J9UE 3IKVA 4Q3NA 3FNFA 4MVJD 4XYEA 3TL2A 4AJLA 3RVDA 1E1KA 1HE3A 1PS0A 1J4AA 4ONEA 2C20A 1R4MA 1N7HA 2RHRA 2WE7A 3DR3A 5DCYA 4BO3A 1PR9A 2ZB3A 2IRWA 1ADCA 3M2PA 1XU9A 1XA0A 3ONDA 1G1AA 4PLHA 1AGNA 2RH8A 4K6FA 3B1KA 1S6YA 1GU7A 1HWYA 4WJZA 1W8DA 4J49A 1IB6A 2CDAA 3G49A 4FFOA 4Q9NA 1HDZA 4PVDA 5CDGA 1SPXA 1Q2XA 4TROA 1A9ZA 1QP8A 3VZPA 4BO2A 2YHIB 3L0DA 4PG6A 3S1LA 4PG5A 4F3YA 3BIOA 1K6JA 3WTCA 1U3TA 3OMLA 3FTNA 2C29D 1N2SA 4G81A 2EW2A 4D43A 1UR5A 4XJSA 2VOJA 3OFSA 4E6PA 3E5RA 1M67A 1NFRA 4C7KA 3PVZA 4XD2A 1WLYA 2VZ0A 3G3EA 4N54A 5AXBA 4BNYA 1R16A 1JWAB 4GSKA 4DPKA 5JC1A 1FXSA 2EXXA 1LRKA 2DM6A 3FNGA 1RPNA 3FR7A 4PGFA 3S8MA 3P5SA 1NAIA 2H6EA 4IQ8A 1EDZA 2E48A 2JFGA 1U2DA 4M87A 4PLVA 3AUAA 5KJCA 4NNJA 2NQTA 4XDYA 1RM5A 1TT5A 2CVQA 3ORFA 2P9GA 2PD4A 3AUUA 4Q3AA 3HFSA 3DEYX 4MDHA 1K2WA 3K9QO 3IUSA 2DAPA 4QEDA 1UZMA 1GCUA 3F4LA 4N5LA 4L8VA 1TXGA 4Y67A 4B4OA 4RVSA 3B70A 3DO5A 1EQ2A 1H9BA 3FN4A 1BHSA 3PLNA 3D4PA 1MG5A 3U4HA 3DAFA 1TA4A 2AG5A 1HDXA 1VL8A 1T1SA 2JFHA 4IMRA 4UEJA 5C5IA 3IC5A 4M86A 1VJ1A 1DO8A 3CSDA 4ZA2A 4EJ6A 4DBVO 3WLFA 3QA9A 3KSZO 1VSUA 3OF2A 1ZSVA 2HQ1A 3DFUA 2BKAA 1DSSG 4FN4A 3VPGA 4AJKA 4CM6A 4J7UA 3RKRA 1JAXA 1B8PA 5COAA 3OP4A 4M1QA 1WAMA 3GRPA 3TZQA 3VPHA 3WOHA 5EL0A 3ZWMA 4Z9XA 2LDBA 1BDMA 5HTOA 4JP2A 4L4RA 1K5HA 3AM5A 3UCEA 4GVXA 3KBOA 2I5PO 4ZN6A 5G4LA 4W6ZA 3HB4X 4Q3BA 2ILTA 3VTFA 1DLJA 3A1NA 4E5MA 4NBUA 4CM5A 2C5AA 4LCJA 4TVBA 1YL7A 4FB5A 4WLUA 3K73O 4QSMA 3QWIA 1I33A 2O48X 3ANNA 3ZV5A 3I6QA 2ZTMA 4FD3A 4AVYA 4A7PA 4CPDA 4PLWA 4YAIA 5B12A 3ZWBA 1XELA 4ALLA 2VUTA 3H9GA 5FEUA 3VKUA 1XQ1A 2PGLA 2QG4A 4P4NA 3ASVA 3EYWA 3V8BA 1Z6ZA 2D1YA 3C24A 4I9HA 5BQFA 3IAHA 3WNQA 1GV1A 4NJMB 3FWNA 4CLDA 4KUHA 4CLHA 1EVZA 1NQTA 4OGWA 3VDQA 3Q0EA 1HSZA 4YJHA 3FRJA 3GR6A 3BA1A 2FPGA 3IUPA 4I5GA 4OAQA 2DLDA 2B69A 3JQ9C 1PGQA 3ANLA 4B3HA 1XKQA 5L4NA 3D1LA 1CF2O 4YJFB 1EBFA 5JY6A 3BTOA 4QO8A 2BFOA 1LC0A 5AXDA 1XWFA 2CSUA 4PLTA 5KIAA 1NBOA 4G5HA 1GFSA 2OP0A 4IS3A 2NNLD 4II2A 5CP8A 1PJSA 1PZFA 4BNMA 2Q46A 3PXXA 4PG8A 2VUUA 3DC2A 3RWBA 4IZIA 3GGOA 1CYDA 1WPQA 1EDOA 2EJWA 4PLYA 3TOXA 3F46A 1I2CA 3HDJA 5TLSA 3K30A 1NP3A 3GHHA 3KSDO 1UAYA 3H3FA 3O38A 4RZHA 2NV6A 1DFHA 4EEXA 4ZHSA 1JWBB 4FIZA 2C2XA 3ZDFA 4BNTA 2XOXA 4CV2A 2BI7A 4Z9YA 2CY0A 4BGUA 1TB4A 2O7SA 1LSJA 4YEDA 3GEMA 5C3MA 3MWDB 4UUOA 1R0LA 3LYLA 2GSDA 5JNLA 4JK3A 4BB5A 2H5LA 4QFCA 1YQXA 5L40A 1ZXLA 1EUZA 1O6ZA 3PYLA 1NPDA 1Y8RB 3VZSA 4BO0A 8ADHA 3NRCA 3WXBA 1Q0LA 1FDVA 5K0ZA 1IZ9A 1R15A 2PTGA 3EMKA 4DQVA 4L4SA 4P4GA 3JQ8A 3EGOA 4XIJA 1VI2A 4EJMA 1NPTO 4M54A 4NFYA 5HS6A 2IEDA 1P0FA 2OORA 4TRJA 4BUCA 1ZK2A 3CMCO 3MWEB 4GKBA 3SC6A 5TIIA 1NASA 3UOGA 4ZJUA 4H7PA 2CMDA 2P91A 2Y93A 1V6AA 5AXCA 3WQSB 1H9AA 2ZJ1A 3VH3A 3SC4A 1R4NB 1PZHA 5DP2A 1NFFA 2BGLA 4OHUA 4BOYA 1K6XA 3RI3A 1BRMA 3WB9A 1HDCA 1EVYA 1RM3A 2Y1DA 2O4UX 1PX0A 1AXGA 1GD1O 4ROSA 5ADHA 2Q49A 4XRRA 2EKLA 3DBHB 3C7CB 5I9LA 1ADBA 3DHEA 3CPSA 3JYPA 2W2LD 3L4BC 3G79A 3BHIA 4TVOA 4ZRMA 4ALJA 5A1TA 4R5MA 4D44A 3E03A 5AYVA 2GCGA 5JO0A 3X2FA 1YL5A 2WE8A 4CMAA 4RVGA 5JFOA 3OSUA 2VWQA 4K9DA 1JN0A 5BT9A 1PZEA 3PQEA 1GQQA 1LC3A 2G17A 2VYVA 4BGEA 4PVCA 4WLVA 1I3NA 4D0SA 5DBGA 1BXGB 5KKCA 3ZHYA 3UH1A 1QXSA 1U4SA 4R54A 3K6JA 3N7UA 5TT0A 1KOLA 2HMWA 5AOVA 1BG6A 3NDJA 2OO5A 3GZNB 3JQ6A 5EERA 1EMDA 1D3AA 5BSFA 1OBFO 1CETA 1N9GA 1VL0A 3GLQA 3U4DA 5G0TA 5MGBA 1HL3A 1SB8A 2IYOA 2FZWA 3FD8A 1U1IA 4IJKA 1VL6A 4NU6A 2CZCA 2Q1UA 4NZ9A 3PYXA 4WOJA 1PJLA 4BKRA 4BNKA 1PJ4A 3SLKA 4R3WA 3SX2A 2O3UA 1Z74A 3JYQA 2H9IA 3I9JA 4YQZA 3IP3A 3LLVA 1TT7A 5IG2A 2PH5A 5LDHA 9LDTA 3HDHA 1R37A 4PRKA 4B8ZA 1A9YA 3HG7A 4R4JA 2C5EA 2HMVA 5EJ2A 1QLHA 4J16A 3RFVA 2DTEA 1T2FA 2UUOA 2WYUA 3I23A 4HKTA 3GVXA 2J3IA 2AEMA 3QWHA 2GF2A 4A2CA 3RBVA 1MXFA 5DZSA 3TNLA 3W4JA 3A14A 3OBBA 4CLXA 5LC1A 4PG4A 1JU9A 8LDHA 1I3KA 3JV7A 5C37A 4YAGA 4D3FA 5B4UA 3PZBA 4WECA 1G0OA 2PFGA 3QWBA 4RV9A 5BNIA 3GMDA 2VWGA 3JD2A 4JIGA 3LZ6A 3D64A 1HKUA 4MVJM 1XCBA 1B2LA 4CM1A 3ZNPA 3HB5X 4N7RA 5KNLA 1AHHA 3UN1A 3E1KA 4CM9D 3DOCA 2I9PA 1T4BA 1OZAA 2B83A 5DN9A 3VH2A 1X7HA 4Y98A 1B8VA 4LVCA 5IN5A 5T64A 4A26A 2W98A 3ETDA 4WPGA 5A02A 3TL3A 3VC7A 3K92A 2VRCA 3WMWA 3NGLA 3LSYA 1IY8A 2GRAA 4OOFA 2AE2A 3CZMA 3LVFO 3ON5A 3U62A 1QYWA 3WFIA 3LDHA 2FSVA 5CG1A 3JSAA 2JCYA 1P9LA 4Z0PA 3DFZA 4GWGA 3LQFA 5TJHA 1HLPA 4QT0A 1PQPA 3PHJA 2VHXA 4HXYA 3E48A 4KP7A 4RQTA 5DULA 4GX0A 5ITVA 2BFAA 2J5QA 2FR8A 1I24A 4BO9A 1J0XO 1SMKA 1DHRA 1ISJA 2A94A 2C82A 2DBVO 1Y7TA 5EQFA 1DIGA 2C7GA 1R12A 3FCOA 5CPBA 2YQ4A 1W4ZA 2HMSA 1ZSYA 4DMLA 2A4KA 4XJTA 2D5CA 1HEUA 3RKUA 1NFQA 2FMUA 3WIEA 3VOSA 4WNIA 1LQTA 4URFA 2Q1WA 3DZKA 2BGMA 5C7OO 1WNTA 4B4UA 2YV1A 3JQ7A 4XYLA 3L4BA 1HYHA 3RFTA 4CV0A 3SLGA 1Y8QA 4NPCA 3RUDA 4B4WA 4BKPA 4AICA 3EY4A 3RSHA 2VUSA 2Y67A 4CUKA 5A04A 1HT0A 4GKVA 5TT1A 1D4FA 4L75A 3JTMA 4RDIA 1TLTA 4XCVA 1SO8A 1PSDA 3IJRA 4MVJE 3LLSA 4MVJA 1VC2A 3I4FA 1ENYA 4NR0A 2QRLA 1YJQA 3C8MA 4NBVA 3VTZA 1AXEA 4DLLA 1K0UA 2E82A 3MCVA 1E1MA 3VZQA 1EZ4A 3RQSA 4LVUA 4U8GA 3KOUA 3ZWOA 2QQ5A 1UAGA 5L51A 3MOGA 1UH5A 3MJCA 1YB4A 4FGWA 2JCVA 3RU7A 3PLRA 1GYQA 2Y1GA 4P38A 3QVOA 1PZGA 1E5QA 2CUKA 1YQDA 4R5HA 2BRUA 4E2WA 1LBEA 1MFPA 4UVDA 3UUWA 4F6LA 1KC3A 4YR9A 4BNFA 1LSUA 4I1IA 2FRDA 2AA3A 5JLAA 2BGKA 1E3IA 3PHLA 1P1KA 1OI7A 2B4QA 1WWKA 1Z73A 4MINA 3EAGA 4EITA 2JL1A 1GQ2A 5DT9A 2W90A 1LUAA 1U3UA 4CM7A 3OA0A 4PIVA 4J0EA 5TS3A 3GDFA 4OSPA 3AW9A 5IXSA 3HJAA 1C0LA 1UUFA 3ZU3A 2R2GA 2YUTA 5HWSA 1PGNA 4Z0TA 3K2EA 3NT5A 4J1NA 1RKXA 3D4NA 2GN9A 1ZO8A 1Q7CA 2ET6A 1O9BA 3ABIA 5B37A 4J0FA 3H5AA 1UXHA 1I36A 1E0DA 4J1QA 1BVRA 1NQAO 5EQDA 4XYBA 3WNVA 4ZQFA 2ZYAA 2AE1A 4DQXA 3FR8A 1FF9A 3S2IA 4D79A 1EVIA 2CDBA 5COBA 2HJRA 1U28A 1ZFNA 1Y81A 3H9JA 4IDDA 1YJ8A 3C3XA 3SEFA 2PKRA 2HKIA 2Y99A 1NHWA 1GTMA 1UXGA 4M89A 5DF1A 3OQBA 2CF6A 2W8ZA 2FR1A 5G0WA 3U4CA 1FDUA 1TVEA 3ZWNA 3E9NA 4AG3A 3GVPA 1QLJA 1I0ZA 1U9JA 3INGA 5FFFA 1B15A 2GASA 1VSVA 3U3XA 2DBQA 4BO4A 3BMCA 3EZYA 4LK3A 3I3OA 5H81A 1P1RA 4HNHA 5ICSA 2WEKA 5T5QA 1Z45A 2NU6A 3HUDA 2VWHA 3BMNA 3PIDA 4BNVA 1E92A 1F8GA 2WD8A 3ZWVA 2CVOA 2D5AA 3VPXA 3PHGA 4JCOA 5JE8A 2PKQO 2J6IA 1ZMTA 4Z0HO 3W8DA 3P2OA 3ZI0A 3A28A 3A9WA 2PR2A 2Q1TA 5B4TA 1U5AA 3JQGB 3VH4A 3KRTA 4D41A 3KB6A 5DCUA 4CLOB 1NXQA 4MVJP 3RASA 4ND4A
chains in the Genus database with same CATH superfamily
4DL9A 5IKXA 5T57A 5HZMA 3F9IA 3A26A 1KBZA 1LZKA 2EWWA 1JHQA 2A0YA 2RGNA 2V6BA 2DBRA 2QN2A 2V7BA 1SUSA 3RIEA 4GBGA 4AB1A 4KPYA 1KI9A 2ZZKA 3UT5A 1BRTA 4P54A 2NZUG 2PXAA 3UY4A 1P4SA 3GRVA 2MSKA 4TYYA 3AEQA 3ZHVA 1NW4A 3ZZUA 3P1JA 1UAAA 1JDZA 3MT8A 4B9AA 1CUZA 1HV8A 2NN3C 3UM9A 2H1HA 3GN1A 5KJ6A 1P5RA 1M1UA 4GZMA 4J91A 5KMGA 1S01A 4OLFA 1BX1A 1ZH4A 3CLUD 3HCEA 4A5SA 3NPAA 2VZ9A 4ESOA 2O8BB 1COWD 3D7KA 1DP4A 3UW1A 3DAPA 1CS0A 2GZDA 2G77B 4X62B 1KGDA 2VDOB 4HBGA 2GCOA 2IHZA 2NUPA 5JMWA 2J08A 1IHUA 2C4KA 3IESA 3MJFA 4KGDA 2DVMA 3ML1A 1QX3A 5LZ5A 2DWOA 3B1YA 5F7ZA 2BMAA 1L4KA 3Q85A 1CQIB 5JIBA 4K81B 3PGVA 3I5XA 1A9SA 2BEVB 4FNMA 3EG9A 3KZVA 2OOKA 4JOBA 3EZFA 3JQEA 4M0DA 4RADA 4IO0A 3KUDA 3PQ4A 1LF5A 5G2OA 4UTVA 4CQMB 5KWEA 2FDXA 1OLXB 4OQPA 1ISFA 1RM0A 2C5SA 3GQVA 3JAWA 3R5JA 3PUZA 4MYUA 1IZ8A 2OO3A 1K86A 2JH9A 4HMQA 3QFHA 2OP1A 4NMMA 1FLNA 1K75A 1P1CA 2QTBA 1K27A 3HS3A 2WFLB 4FS3A 5DEIA 3U2QA 1IHXA 3UAXA 1IOVA 3QX8A 4M99A 2EWMA 4DSZA 1MQ8B 3PC8C 3CH4B 3WA6A 2FZGA 4HQ0A 2J0EA 2WJWA 2ZKIA 4O3FA 4QL3A 2PRKA 2XZOA 3OM9A 1H3NA 2JGDB 2P65A 4XM1A 1EJBA 1KO7A 3FKQA 2QW1A 4DLPA 1JSLA 2A1TS 2V6JA 1AZSC 5HZHA 3ROGA 3KV1A 1AQIA 3W2IA 3G2IA 3UTDA 3KT0A 3DV0A 1AO3A 1BN6A 1O95A 1QKJA 2ZB8A 5F2KA 1KU6A 1NR7A 4GMHA 2OYRA 5A4DA 3AF6A 3UAZA 4H31A 2FN9A 3PQ8A 3AK4A 4MMYB 1YBVA 2ZSUA 5EIBC 4BJ1A 1HNXB 1OYVA 5AVYA 1YACA 2EFEB 3AFNA 4GECA 2ZSDA 4FGZA 4GYKA 1PT7A 3P4UA 3WQHA 4URVR 5JLJA 3QXSA 2BUAA 5EHXA 1IWBB 5FUWA 4FEAA 4GAEA 3ZLUA 7ABPA 2XCLA 4YXFA 4L9AA 2IHKA 2O0JA 2OMEA 1PR0A 2R5FA 3N70A 4BC0A 2QUAA 3RABA 2NO4A 1AJEA 1ICEA 1K1EA 2P1DA 4X5OA 3U44A 1YDFA 2EC5A 4HWGA 4HMOA 1RBMA 3H3JA 1YSCA 4I2NA 2QX8A 1GFZA 3RWMB 2B5VA 5CK4A 1E61A 4B2YA 4MPDA 4UPEA 1P9OA 2DCUA 4NS4A 2Y6UA 4PCLA 2QN7A 4XA8A 3FNEA 1RAFA 3VHLB 4PZCA 1BKYA 1SKUA 5EUMA 2AYZA 5TS2A 4LSZA 3SZOA 3SYRA 2VDWB 3TLAA 3AM1A 4K88A 2XOKA 1ZSNA 2AI2A 4DNPA 2W6PA 4JUCA 1QFXA 3QE0A 1J23A 3U0BA 2RH9B 3FNQA 4QJBA 1VJDA 3G5MA 3NNNA 3WTBA 4HX9A 3SHVA 2ZJ7A 4RD3A 4Y2PA 1V3TA 2LCQA 1IHDA 4BO1A 4X41A 2HRQA 4L4UA 1Z06A 4IMJB 3BEDA 5G0VA 3JSXA 2OD2A 1P1IA 1XCGB 2W83A 3EXG2 3QNWA 4JUAA 2RGDA 2WTMA 4IVPA 4D5GA 2YXNA 4S05A 4DA7A 3ZU4A 3AL0C 4LHSA 1H23A 2JIQA 1QJCA 1TT5B 1ENZA 3EXFB 2ADMA 2KX7A 3SF8A 5CK5A 1Y63A 2OE2A 1YS7A 4KG7A 2CYBA 1N2EA 2NZ2A 1R7RA 3EHEA 3EIHA 1TUIA 4MWDA 5HGJA 3T5MA 2GUGA 2O3QA 3L02A 3LBFA 1I4DD 1TQDA 2PH3A 4FBLA 4I1OA 3OU2A 4BUZA 5BPFA 3BJZA 2LIVA 4QOEA 4V0ME 2YJTD 1ZGZA 4O33A 3C2QA 3LM8A 3GFQA 1SU8A 2YCLA 4RWZA 3RBXA 1YNOA 4L57A 3IR7A 1TEXA 3NTVA 3FOEC 3WLRA 3I62A 1WSWA 5JMOA 3RS0A 1GAXA 1ADFA 1FDOA 1EFAA 3THRA 2PX6A 5A0VA 3LP8A 2WAOA 2XZPA 1P9NA 1Q1NA 5KVSA 2XNCA 3NBXX 2OWEA 2P7IA 3DVLA 3GP5A 5BWMA 1NZFA 3CVWA 1JSZA 1KTVA 1B0ZA 5A4AA 1SG0A 4FU0A 4OHZA 3F1KA 3MA0A 1U81A 5HIMA 3T94A 4ZIRA 5BOSA 3GJQA 4XWKA 2AEFA 2QVBA 5D3MA 4BO7A 2C2YA 5A03A 4PIMA 3MVEA 5EJFA 3WWPA 1K5DA 1G2PA 4LJSA 4O4HF 3C3YA 3GFRA 4RZ2A 3OZAA 2OAEA 4O1HA 4TZTA 1RZUA 2PUHA 3GA7A 4TUYB 2R47A 3N28A 5LZ2A 5GM2A 3FOZA 4J3FA 2FI1A 4OIMA 5DSXA 2HUNA 1FU8A 1ZXBA 3DL0A 4MKXA 4CT4B 1Z29A 3O21A 4B81A 4ZYTA 1W0KA 2VJYA 3G8BA 3PCTA 5IK2A 1QAMA 5BVHB 2CXSA 3D3WB 2Y05A 2ATIA 1CUYA 2D06A 2RJ3A 3K9NA 1AQLA 4NBTA 5EPOA 3TPFA 1AHIA 1BMDA 2ZJ2A 3H86A 1SUFA 2GPYA 2O8NA 2O4CA 4RGQA 4TLBA 3DBOB 5J43A 1DJMA 4O2BB 1H5UA 2YNMD 3IIJA 2J3JA 1BCRB 4PGGA 1BW9B 3RC7A 1XMJA 1RU3A 1YZTA 4YJFA 4DC1A 3ND7A 2MCFA 2Y1LA 3CCCA 4IDEA 2OBNA 5AJUA 4M9ZA 2Y77A 2G5CA 3DCYA 1GSOA 4YR7A 4PLZA 4RORA 1I80A 4XD7D 3BE6A 2RKBA 3V1TC 3KVYA 5PNTA 3K8QA 2O2YA 3MJVA 4F6RB 1P8AA 5E9WA 5BNTA 4X95A 2RAVA 4JQCA 1WOMA 4LBZA 2XQKA 4XGNA 2O8EA 1T6BY 4DCNA 5CDYA 3F67A 1OROA 1TU0A 3TM4A 2WWHA 1C5KA 1Q7RA 1TQ8A 3EEQA 5K4AA 7MDHA 1VDZA 4JSRA 4L4XA 4B3FX 4ZICA 1JHZA 1E5XA 3AR8A 1G6OA 2YBEA 3UG6A 4AECA 1P5JA 3N0WA 3V48A 5F2NA 2VNAA 2ECKA 3D6JA 4LXTA 1XZJA 1HMPA 1R6VA 3BF8A 2VTDA 1J99A 3DXZA 3FB1A 1UZNA 1UM8A 4OP1A 4ZI7A 3RYCB 1HUQA 1VIDA 4RAQA 4ZARA 5KSYA 2IYWA 5CD9A 5JJ5A 1FUUA 4XEHA 1ZG3A 3DAHA 1G59A 1CNEA 4HRAA 1HNNA 3IVAA 5EMMA 1MB4A 5CYPA 3VU3A 4I4LA 3P45A 4ITUA 3ZU5A 5K8IA 2ID9A 2QSYA 2XDQB 2NXNA 3GLIB 2PSDA 5D00A 2V55B 3P0JA 1F8FA 3IJPA 1N9KA 1A77A 4ZT7A 4U00A 2JIMA 3PV0A 4HAZA 4QDZA 5IYZA 3KHKA 1RQ2A 3DLHA 2XGMA 3LBYA 1FFYA 1NMXA 4M4SA 2HRRA 1F3OA 3PUHA 1ZI8A 3ZCVA 1MIOA 2R1TA 2WT8A 3TG2A 5DBIA 2PSSA 1N0WA 5ALGA 3O84A 4CLEA 2B78A 2LCFA 2IXDA 2RGEA 3K0KA 3L7YA 4ETIA 5KTMA 3WGLA 3K0FB 4D0LB 1VYVA 2VSOA 2Q4EA 1O77A 2XITA 3WKBA 1MGOA 1X9GA 2E6UX 3VPSA 4FHCA 5DB4A 3TNFA 2NXCA 3WWYA 2A9JA 2IS1A 4ITVA 4NPAA 5IMSA 1HH4A 4LS3A 3DYVA 3L84A 1U2SA 2B20A 1WZNA 4FFPA 1M72A 1K7FB 2D0OB 1RHUA 1TMOA 2HREA 2YHSA 2XH8A 3E9ZA 3L18A 4KQKA 1NP6A 3L5KA 3GNLA 1BWSA 1KPIA 3WMFA 3N05A 1UMBB 1XEWY 5TF0A 5ADWA 4AY2A 5FTWA 2R25B 3ZY2A 5JV5A 1AURA 3L7DA 3O82A 4I36A 5BRJA 4R9NA 3VYRB 3IXLA 5B3JA 2CN1A 3TW4A 2V9CA 1OT5A 1XTQA 2DLNA 3JYHA 2H1FA 3G1TA 3D4OA 3TFOA 1DRKA 4MWGA 3GFBA 3ZZNA 5BSKA 5JQGA 1DT5A 5IDQA 1TJ5A 2OAGA 1WDMA 5AW7A 1SQSA 5P8WA 2PWBA 2OB1A 1LS6A 1YVEI 2I1LA 1GGEA 1KNQA 4BMZA 1JTFA 5G1OA 3RAGA 1DJNA 1YR7A 3ILXA 5TDHA 1N1MA 1P2SA 5HJ7A 5B58C 3J81k 5SY6A 1DUVG 4QDUA 2VPQA 5BN5A 2C42A 2AMJA 3OZXA 2PRIA 2R6JA 4RCYA 1KBQA 2BBOA 2RDMA 3UB2A 3WLSA 4F4HA 4OY3A 1HDOA 3WBBA 3QW2A 4YRFA 3TTSA 5AW9A 3M6FA 4AZ0B 1G9SA 3H2JA 5A4KA 4G0UA 4MVJG 5BW5A 2II6A 5IZ4A 1KDRA 1BXGA 4PRYA 4XWGA 5D8DA 1QCCA 2X5OA 3OHPA 4I14A 4PWYA 4XQ9A 5AI0A 4R0MA 1XTJA 2BP7B 2GOYA 5H70A 1HXHA 5EE9A 5T8KC 3X0DA 2OEPA 1ZR4A 1FUYB 4HQNA 2FJUA 2X9VA 2WMDA 2FF5A 3NT2A 3P9ZA 4XUEA 3S0JA 2E21A 4BLUA 4YT5A 1A5ZA 2QY9A 3AF3A 2IS2A 3E0XA 2J41A 2ZKLA 1EXMA 2COUA 3M1IA 4DLKA 2PMDA 4AN1A 4S3MA 4GOND 4KOAA 4RF5A 5SICE 3SQWA 2EHDA 2WHYA 1ONOA 3AL3A 2V6FA 1P0PA 3GJTA 3QPAA 3ZXUB 2QUKA 4OXKA 3IMFA 2ZYGA 3T4EA 3AETA 5FO0A 1OTXA 2WT4A 4K28A 4ZHQB 1ECCA 2GX6A 1M34A 2B21A 3LXRA 4HDOB 3PL5A 2QLMA 6ABPA 3K1AB 1RC1A 2GCPA 4LJ5A 3EVEA 3ER6A 4OBWA 4YTEA 4FX5A 1USGA 1OC2A 4H15A 4Q93A 2BCJQ 1W5AA 4JP3A 2ZULA 5B6IA 5JPCA 3REOA 4FSXA 4PLFA 1K5GA 5KYUB 1JEEA 1DAMA 2JW5A 5I8ZA 4G89A 2I2CA 2IBMA 1OH6A 4JUBA 3LRTA 2OM6A 5KNCA 1RWMA 4TWZA 4ZQHA 3ZBPA 1CV2A 2A5FA 3FCCA 1NXTA 3EZLA 5CA0B 4DJFC 1NOIA 5BR1A 1NXOA 4J2TA 4Q1FA 3C6KA 3JTEA 1Y9ZA 2V6IA 3Q7SA 3SYLA 3DCNA 5K3AA 1MO2A 2L42A 1FP1D 1GUYA 2FHPA 2OFPA 1WVMA 2HD4A 2SCUA 3MBIA 3OU6A 1EZ1A 3LQYA 2NT3A 3LH5A 1VB3A 4F97A 1V3UA 2ZJ5A 4JNKA 1AZLA 3OZGA 4MV3A 5B2ZA 2YZKA 1KEVA 4JGIA 3DO6A 3UJ8A 4CKXA 1EGAA 5ICMA 5F52A 1F2TB 4DUPA 1WB5A 2K7ZA 3TWOA 1VLJA 1XFAA 1KQGA 1GL3A 3FOWA 3NW9A 3SVLA 4Z51A 3THWB 4KE8A 1LPAB 3RYFA 5A0TA 2YH2A 2IP1A 2JAPA 4MW2A 4PYOA 3EQZA 2G0NA 2JIZD 1GR1A 1O94C 2XA1A 4U0KA 1F14A 4G8DA 3SKVA 2OSVA 3ZH2A 2FJPA 3UFBA 6NULA 2QUIA 5DISB 3VAAA 4HDQB 3QZUA 5EIBD 1Q11A 1H69A 4BYGA 2CVHA 2VNSA 1J0EA 3AB7A 3H42B 2BMVA 2Z6VA 4RPIA 3DLTA 4NP6A 1WBBA 2C3YA 3L7CA 5FB3A 3N2ZB 2PEYA 1VPVA 3W4IA 3E8SA 3K6SA 4TM7A 4YMGA 3KOYA 2I4OA 2Q2QA 4BL5A 3KC2A 1PF7E 5MDHA 1XZIA 2NYUA 3ZKWA 2V4MA 3WL4A 3MXOA 3DZHA 3D43A 1A2BA 3E23A 3K8ZA 1EFRA 4MTCA 4MYCA 3U1BA 3DJFA 4MCIA 1TDJA 3GJ4A 1V41E 1WV1A 4MB6A 1PHPA 4B7CA 1Z2OX 3G17A 5JSFA 2P62A 4BIIA 1UMDA 3NHKA 4FLMA 5IKOA 4YLGA 1KKUA 3ZXYA 1VFPA 4KNVA 1WL8A 4XIGS 1TRHA 4UEWA 5JXHA 1E3TA 3H05A 5JNUA 4P4SB 3BTVA 2PNJA 4ZRNA 1R27A 4RENA 3W9UA 3W34A 3PS9A 4D92A 1V1MB 3OEWA 1MP0A 1EXWA 4EVRA 4B76A 4Q6WA 1DPFA 3NH9A 4R9RA 5A3VA 2HLNA 2ZSFA 5JVDB 2HFJA 3HCOA 4FJ2A 4MW9A 2NTVA 1KA9H 1V8BA 2FWNA 4QXPA 5HZGA 4CFYA 1HE1C 4NCXA 3ZYZA 2O2JA 2QYTA 1TTPB 2A1TR 2JAHA 3T5DA 4BO5A 1POXA 5CM2Z 2YQ5A 5CFMA 2BH2A 3X1MA 1EU1A 1JKJB 3ST7A 1GU0A 3ZOZA 4F2WA 3PE4A 1T4DA 3BJMA 3O7WA 2CMKA 3TRFA 3R3JA 4QICA 4DXAA 1RFLA 1RNLA 3GMIA 1O0CA 1ENPA 4INPA 1KO5A 3KOOA 4OJYA 3KYCB 4WCFC 4F86A 1E1QD 2QN8A 4MVJF 1Z2DA 2P69A 2QTWB 1NBHA 1THMA 4ENVA 4FFSA 3LE8A 4RF4A 3V4FA 2ILVA 3EBPA 3H4VA 2IU0A 1JWLA 4F3TA 3VJMA 1UIMA 2EBHX 2DUWA 2IHTA 2A7XA 3JQPA 4PSAA 4K3UA 5B1HA 5B3AA 3UENA 4NL4H 3USCS 5E1OA 1N6PA 2R6CA 5FNVF 3DQQA 4CIDA 4C7OA 2VNKA 3KETA 1Y4DE 2HK7A 3L8FA 1A71A 4OF4A 4A5OA 3I52A 1GZSA 4JI0B 4K7JA 1ZNQO 4ILKA 4YDSA 3MWGA 4QPNA 2J4DA 2YTZA 2LD4A 1T9GS 4F91B 1FPMA 3DJYA 2YY7A 3CLSD 1GKIA 3JD0A 1OX6A 2CB9A 4FFBB 3CKLA 4FFLA 4GOXA 4KGXA 4X97A 4KIGA 3W2GA 3BXPA 1FW8A 3W7AA 2G4LA 4KKXB 1NZDA 4XPIB 4GEGA 4Z9BA 4ZU3A 3WMEA 3C97A 4UXHA 1KI6A 3MERA 5CGQB 1SVSA 1UJCA 1IOLA 4YCAA 4E32A 1MLDA 3EZ9A 4YMSA 1Y9JA 4PFJA 3QG1A 1PT8A 4ZAZA 1GAEO 1CIVA 1EUCA 1EPUA 5H7XA 2GPWA 2WNHA 5E1DA 4NCKA 1SCBA 4MQMA 5CVCA 1VLZA 4DQDA 1H3FA 3AFMA 1MT3A 1E2LA 2Q8PA 1GT6A 2H51A 2P2NA 2Y0BA 3AW8A 2W6QA 3WYCA 1EFLA 4FFNA 3LX4A 2Y2VA 4WBNB 3PSHA 2DQ4A 1X39A 1XKLA 4N9WA 3UF0A 2YN2A 2ZR9A 4H9GA 3DTTA 4K05A 2Z43A 3B85A 3KJGA 4Z4IA 1W4LA 2XQIA 3BSSA 3DKKA 4HDKA 3GRUA 4RHEA 1E4EA 1V6CA 4I1SA 1P74A 4PAOA 4QA9A 2C2OA 4QYXA 3BFKA 4D9BA 1EG7A 2CNLA 3UKOA 1EINA 3B3AA 2E5WA 3PF9A 2VK1A 4PC6A 3RSGA 1IM8A 3QX3A 3AR5A 1R88A 2WM9B 3IQXA 4B3IA 4BNUA 2ZJOA 1LX6A 4GPTA 4KQIA 4X93A 4AP9A 4IOLA 4R9SA 5DYIA 1YONA 4M0LA 1GPH1 1O0SA 1X7GA 4INJA 5K3CA 3ZXIA 4C3ZA 2W48A 1E4OA 2YWXA 3FBTA 4MLCA 3L1UA 3W5CA 4GZ6A 4PPQA 4DREA 4ZVSA 4L95C 2AG0A 1N2XA 3PFIA 4HLQB 1UT5A 4NYMQ 4E3WA 3ZDEA 2CYAA 1X15A 4B17A 2ENWA 4DW8A 3A27A 3STHA 1A5SB 1SIBE 1M0WA 3NAZA 1S8OA 3TBHA 2XXBA 3DVQX 5KQSA 2ZYWX 3AM3A 3GDHA 5HW0A 2SECE 2AR0A 3GCDA 5KVVA 1MAHA 2YY6A 3FZYA 5BR7A 2RI6A 2EGGA 3IGFA 4LBWA 3LI2A 2XXJA 5DK4A 5IAGA 2BEWA 1IXYA 4IG9A 1TUBA 5I9SA 2XHZA 4ZC1A 4EO7A 4XQ0A 4YPFA 4CDMA 5EE5B 1C1DB 1DC3A 1NJ6A 1DX9A 3EDCA 3WRYC 4P0QB 1M1YA 2QLBA 4QBIA 6AT1A 2DH6A 2MINB 4QAJA 4X45A 3QLEA 4I3GA 4K40A 5CLHA 4EJ0A 1I30A 3HA5A 1M1XB 1W88B 2Z4RA 2GLUA 3LT2A 3QMPA 3V3TA 4C6TA 4Y2TA 5DYTA 3NALA 2BAGA 1BXZA 4BMVA 3V55A 4G1FA 1KEEA 4PX9A 1GRVA 3JQGA 2H5JA 3K2IA 1NLMA 2KYRA 3KKEA 3V8NA 4JBYA 1LBQA 1CJKC 3RIXA 4DZTA 5L53A 1PWXA 4DR6B 1C4OA 4AP5A 2Q4DA 3COZA 1HMYA 2QN1A 3L1VA 1NMQA 5CA1A 2JKVA 1HF3A 3LC1O 3SZLA 3PNOA 1NQOA 3OIFA 4QYWA 5FORA 4EJSB 5F1KA 1ZW6A 1G5TA 1V0JA 1HYGA 3LDUA 1DMRA 2DF8A 2EYUA 2HOQA 2HT6A 5CT9A 5BQOA 4QLBA 2PPLA 1R10A 3MZ0A 1G38A 3BXFA 1DQSA 2WZQA 4Y2XA 5IWCA 3QI2A 1G8KA 1Q50A 2QTHA 4RHCA 1Q92A 1OB5A 4HFJA 1NJ2A 1W94A 4K1XA 3IHWA 3I32A 1WXQA 2WMNB 3AL2A 3IULA 4XR9A 4XXHA 1RWVA 2PL9A 4CQNA 2IY9A 2O8FA 3GLFA 5BNZA 4P3YA 3NAGA 4D96A 1X74A 2N3ZA 4YJDA 4YJKA 1RYHA 4ZVKA 1I13A 1H94A 3A32A 1JR4A 4R2KA 2O3TA 3F6PA 3I0ZA 1G21E 4BZZA 1DEAA 1PRYA 3LY8A 4Y2SA 1GGHA 2ZS7A 1BE1A 4HDNB 2MJLA 4FXPA 2CUNA 2XMCA 3AIOA 3FLAA 1JYSA 3LC2O 4KLCA 2GTPA 4WXRA 5AKZA 5C80A 1ZP6A 1P72A 3KO8A 3CS3A 3VPFA 2UUAB 5EINA 4UVIA 2P2GA 2O2SA 4X92A 2R0QC 4EQ6A 5K4GA 3WKEA 2DPLA 5IF9A 1XXLA 3A1EA 5IX8A 4PCVA 4YCSA 3UAOA 4YRMA 4JHXA 1HTWA 1UJMA 4DDUA 1CY7A 1N3LA 2JFXA 4WCDA 5E9QA 2E87A 3CKMA 1CQZA 2M9MA 3E58A 4B80A 1UBSB 5ES4B 1KR5A 3NGXA 2Z56A 2Q3EA 4KCGA 4D9FA 5KYYB 1E2IA 2A8YA 1VPDA 2QE6A 2YMPA 4FR0A 4HY3A 4KUGA 3E9DA 1EEXB 1IYZA 3T7KA 3WLTA 5GZ1A 3UT0A 3TZKA 4DJJA 3D3NA 2VHWA 1RRFA 2CL6X 3OQ6A 5AKKA 4BE7B 4DMRA 1L4NA 3U9LA 2VCHA 3ODPA 1T8WA 4MO2A 4JT8A 4X1IA 2BDUA 3BEOA 2J33A 4M9UA 3RVOA 421PA 5J47A 3R77A 1NLUA 3O8DA 4JJ8A 2R8XA 4U7HA 3PRJA 5DGIA 5U4XA 4CODB 1OI2A 2WKPA 1R6TA 1XA4A 3MRXA 1YZHA 1X70A 1Z4MA 4ZOLA 3AESA 1T0PA 1U98A 3PQCA 3QXHA 4TRNA 5JBIA 1J9EA 1KP3A 1TW3A 4YMLA 3P4YA 3C6QA 3PC3A 1LEHA 3K09C 3D59A 3FB4A 3IAFA 1CNFA 1G18A 4QNMA 2DHRA 2QZ9A 1EHYA 2GHQA 3W8NA 5TQ2A 1OIVA 1N4DA 4YFYA 1QR2A 2QZSA 1QJ4A 1OAOC 3QIAA 4X8OA 2F67A 1E7QA 1I7NA 2RGWA 1YMQA 1XIVA 1MW8X 1IXSB 1VJCA 2AFIA 4RZUA 4H7HA 2HSJA 1J25A 2F1RA 2X2EA 1WHTB 3FAZA 3K0CA 1D07A 1QRDA 3IILA 4AO6A 5BUSA 3VMMA 3KD3A 3WRWA 8AT1A 1C3OB 1TF5A 5F21A 3I9MA 4QEKA 4Q12A 1J8QA 1CZOA 4KMOA 3UBTA 1K7SN 3KKZA 1JP7A 3OA2A 3PKZA 4KQ9A 5C46F 4CUZA 4MWEA 4I1VA 2OHXA 2ZUUA 3WWDA 5E7QA 2HI0A 3JQAA 4LOJA 3UFXA 2ZU6A 2G28A 4TOIA 1VG1A 3PEVA 1K68A 3D8RA 5B6JA 5LMUB 2FUNB 1O94D 5LB2A 4RL4A 1M83A 2GKOA 3U6KA 1N25A 3X1ZA 4BQQA 1NYTA 4DVJA 5KC8A 1RHMA 1X94A 3B89A 1XTUA 2EP8A 4E6EA 3L5OA 1Q0TA 3HBMA 2BZ0A 4JT2A 4FZRA 1L5VA 1WKCA 1ZCJA 1DZ3A 3DDHA 2Q3HA 4MXDA 1E7SA 4OQFA 4BPRA 3CPEA 4ETNA 1PT6A 3FI9A 3CXUA 2AQIA 1PVOA 1JPJA 2P3LA 5K9ZA 3GI1A 5LDDC 3HSKA 3RSSA 4BGVA 1U8TA 4IVRA 4JQOA 1ZW1A 3DOFA 2VZ8A 1SOVA 1Y6FA 4M37A 4AROA 2VAVA 3EXHB 1GKUB 3RARA 5E9JA 2YWJA 3L49A 1SKYE 1M54A 1QB7A 3OWXA 4YMVA 2HBZA 1G16A 2MDTA 1QE0A 3EZ7A 5F12A 1NNEA 3FIUA 2EZUA 1L6RA 4RLHA 4AIRA 5JAIA 3GFPA 3HZHA 2EIHA 2J67A 1TO2E 2IPMA 3FYUB 2XD4A 2QVGA 1F4LA 4B31A 2IKSA 4ZOEA 1IN1A 3HDQA 4CHGA 4COOA 4HVLA 3A1FA 3KJFA 2VPZA 3AVPA 3CCBA 3RC3A 3P94A 4A0FA 3IHKA 4UMFA 2EEZA 3ADPA 5DYYA 1Z5PA 3CZ5A 4KI0A 3RUPA 2GN8A 1N3BA 2OCYC 4YAEA 4CM8A 1R3DA 4YECA 1FLVA 4W82A 5DGHA 5HX7A 1LDMA 1OH7A 5JS1A 4UULA 3H9EO 3VZDA 1ZK4A 1XPOA 1JEYA 1FYXA 1J90A 4U8HA 3E7XA 4W5HA 4AZWA 1FZTA 2WV7A 1LI4A 3SQXA 3QOWA 2ID8A 1MOZA 3DQZA 3F7OA 3GUUA 4IRMA 4K6GA 3EVDA 2VI5A 4IUBS 4PHTA 4QBGB 3URMA 1IY9A 1NM5C 1FX0B 1Z8HA 3Q6MA 1D8AA 2VLBA 1ULZA 3E27A 1XE3A 3IAUA 1C3JA 4HJRA 4BVAA 4PZ9A 1JB1A 3LT1A 4F5ZA 1LPBB 3SBDA 1A4RA 2Y68A 4KQ6A 3P2MA 4N1AA 1XYVA 1XMQB 3C1UA 2HA6A 4X20A 4O4HB 1P5FA 3L0ZA 3K0HA 2A9RA 2GHTA 3EW7A 4R2IA 4UBLA 1HC7A 2D1RA 2FETA 3OU7A 2X6TA 4G84A 4XQCA 1OLUB 1QGED 1ECFA 1DJLA 2VDKB 2FHSA 2ABWA 3CEJA 3MIIA 2OO5C 4X6UA 2Q9BA 3MYYA 3HVIA 4OQMA 4YVFA 1ZR2A 4JBGA 2ZSHA 1X6VA 3EBOA 1TA0A 4X1YA 7AT1A 1O8CA 3K9FC 1RWKA 3FLEA 1U2RA 1V1JA 4ZVOA 4CCSA 1V25A 3OH8A 5CVVA 3UMRA 4WXYB 4Y6LA 1JDUA 4PGHA 5D86A 3QPWA 1E9VA 4PF1A 1OC4A 2G1KA 1GDHA 3I9FA 3QUQA 1QHEA 2IYZA 4KH1A 3GB9A 4YJHB 5F64A 4EKGA 1DQYA 2ZZMA 2EKQA 1WQ3A 2X1LA 1FBTA 3IT3A 4JQZA 2QXYA 4AQDA 1R3UA 2V7EA 1WCWA 4U5XA 1BGVA 2WKWA 2I67A 3BWYA 3OJXA 2H4FA 2X41A 4I1RA 1UPAA 3VX4A 2HLPA 1AMNA 1KVRA 1G2OA 3WHPA 2ZE7A 1SFRA 1C9KA 4Q9IA 2AT1A 1WNFA 4G85A 2VJNA 1T4CB 3UV3A 1Z0IA 2GNOA 4GL2A 1MGPA 4RW0A 4CVNA 4HO1X 5I3CA 2ICAA 3TQIA 5EZYA 1AN0A 3VPCA 4RV5A 3R3WA 1P2BA 5AJWA 2VYND 1V7CA 2DFLA 2DJIA 1NA5A 1M66A 2WG0A 2A3NA 4IHJA 3ZV6A 4B7XA 3CWQA 1EGQA 4US1R 4CN9A 3F4KA 1EP1B 5KYXB 2Z5FA 4MUAA 5F7OA 1D2MA 4MP8A 2W7TA 2H5IA 3KQYA 4HPWA 2QN6A 1FFXA 2HEGA 2BT4A 1C7EA 2XMZA 4JI4B 3PEUA 3FDXA 4C0WA 1CB0A 1T2DA 4JNCA 1Z6QA 5FBRB 1QO0A 2HXSA 2I3AA 2JD1A 2A92A 4WE3A 5HF8A 1CY6A 4J29A 3PE3A 2HLHA 4G8CA 4GOLD 3HFJA 4W8HA 2HWYA 3ZE7A 4IJVA 4CG2A 2DFPA 2JIPA 3A2NA 3HKEB 2ZWAA 3R74A 5AQ1A 1VXOA 3MWEA 3BRQA 4ZT6A 1VIVA 1TZ2A 1OUMA 3GUHA 3Q0TA 3NYWA 4KQMA 1AC5A 1IIRA 2B8WA 1ITZA 2D1FA 2PZEA 3PFBA 2GHRA 2ZCVA 1EVJA 4C08A 3HV2A 2V58A 1Y6GA 2Q7DA 3R8FA 4YJGB 1H1TA 3Q9SA 5LIPA 1QNFA 1KP9A 1JJFA 2GVDC 4HQOA 3DUWA 2J1LA 4AMZA 3SVTA 4Q4JB 3OCVA 2QA5A 3LO5A 3TK1A 4W8GA 3WZ2A 5JWHA 2VQSA 5DM70 4O4JA 5FA5A 1HEYA 1Z8NA 4J9VA 3M33A 1NBMD 3OT1A 1Z16A 1KL7A 5F23A 1QVZA 2HNBA 2QDKA 1WMSA 3PDHA 4UVHA 3L05A 1Q0SA 3QTTA 1XDGA 4LOHA 2YYSA 1GAWA 4P5DA 1HQKA 1EP9A 4X1KA 5DNDA 2GDZA 5HIKA 2KLBA 4D8VA 3G23A 1SPBS 4F60A 3LVRE 4TS3A 3V8MA 5JSKA 3VC2A 4CLRA 4TZKA 1IJEA 4RVNA 1L5FA 4IQ0A 1POWA 1Q83A 3GFFA 3G2LA 4L4ZA 3AUXA 1SAYA 4V02A 1H8HD 1FOEB 1PR3A 1UXIA 2A86A 3I6BA 4OHMA 4RVFA 5FPSA 5K0TA 5KOJB 4ZEWA 2EFHB 4K9MA 3V00A 4BP8A 3WRXA 1VLQA 2GD1O 4GOKA 3STVA 2V7QD 3B2QA 2OK8A 2JLZA 3JWPA 3U9SA 5LCXA 4B6EA 1GAQA 4CMHA 5DWQA 1DXQA 2B94A 3M83A 3LU1A 3L6DA 2C54A 4D3DA 3FYDA 4UDXX 5H82A 3MHPA 3O4GA 1U5BB 4MDYA 3IEVA 1Z2EA 4XIFA 1CX9B 4UTXA 4C0BA 1MH9A 4C3VA 3NAQA 3HL0A 5HDQA 4JOSA 2PLAA 2J9FA 2XT6A 3GZ4A 2FPIA 3TCNA 3MJEA 2XPCA 2H5EA 3VNSA 4K46A 3RTEA 4Q34A 4RKQA 3VDMA 2WIJA 5IAEA 1V37A 2NTYC 1VSTA 1K7XB 4F6CA 1Y82A 3HM9A 1Z6GA 3HYCA 2C88A 3KAQA 3NEPX 1SHZA 3ZCRA 2GPTA 3UC5A 2A2ZA 3DE6X 2FW1A 3ICVA 2O52A 5TE9A 2EJTA 1P19A 3B3JA 1EE2A 2HPAA 3MGCA 5DO9A 3JS5A 1JHRA 1YA6A 4X7MA 2D13A 2ZR0A 3MUNA 5JDIA 2ERCA 2F3RA 4JJGA 2GPSA 4XGRA 3K0BA 3C48A 3KQPA 3HBLA 4K6MA 4IF4A 4E46A 4OX9Y 1JSCA 2GZ1A 2K6GA 2XI4A 2ROQA 2Z2YA 4RQUA 4YREA 1P1JA 1T3ZA 2X0EA 1MU0A 3DMTA 3JAKA 3FYTA 3QRWA 4MR9B 1AHNA 3HO6A 4K9SA 4TXHA 3TBKA 4NJOA 3P19A 1UKZA 1XHFA 5T6BA 1A8PA 3DDNA 3GLRA 3L0BA 1PSZA 3CGGA 3QVMA 2C84A 2VJQA 1QIGA 3MWKA 2O07A 4IF6A 3SDBA 3MW8A 3FJ1A 4HXFB 4LJLA 4LNUA 5IDWA 2ZXFA 4KBGA 4WSOA 3QUSA 5JNTA 4JI8B 4MKZA 2W11A 4L7VA 2NM0A 3ANXA 3IPAA 4KV9A 1VKOA 3PZRA 5CJ2A 3VVCA 4II7A 4DDTA 1W25A 2AOUA 4Q0MA 4YJ2F 1C29B 1J8DA 1L5ZA 4ZODA 1VG8A 4L8GA 2J3QA 4IM7A 4A92A 3OD1A 1E5TA 3NRBA 4NFSA 1F8UA 2X13A 5IU6A 4W5TA 3R3XA 2D4HA 2W93A 2BFPA 3AOGA 3I0NA 3VA7A 4NOMA 2J9ZB 1ULBA 4MQFB 2AEJA 4Z86A 4MDFA 1O4VA 1XWWA 2VC2B 2GAIA 2EL7A 4L9RA 1SBZA 2MMCA 3A0RB 5CNKA 5DLDA 5KSZA 1QS0A 2H52A 1C9MA 1Q57A 6LDHA 5IC6A 4FWIB 1R6BX 3ZWKA 5M34A 1KJJA 1BO6A 4Q7KA 3GH1A 4W1QA 3CUEF 4LFCB 3LX5A 4TYWA 3EXIB 4AS1A 1FQJA 1SC1A 4BQOA 4KQXA 3GNTA 4FDAA 2Q5JA 2CWWA 4FOLA 1KAEA 3PGMA 1B1AA 1ISPA 3COWA 1FSZA 4DLSA 3K1JA 4CKBA 5BYJA 3PFFA 4WVFA 4CF5A 4B2PA 1U28C 1MZPA 1Q7EA 2YWRA 4QUDA 1SKBA 5IKMA 4UREA 2KLHA 2NGRA 2Y1KA 2V7XA 5LP6C 4R8KA 3QU5A 1UKEA 3L7NA 3M6VA 3F8TA 2BZSA 4F8EA 5LSAA 4AD8A 1UT8A 3Q15C 2V98A 5L3SB 4YMTA 2X19A 3N3AC 4ASUD 1DAPA 3EDMA 2BE7A 3NNSA 4PO1A 2HHAA 1NHGA 4YP9A 1R0BA 2XYQA 1ESMA 3KEMA 4HLUA 4KUEA 3HUUA 5CVDA 4Z4HA 2UXDB 1XXHB 1PEYA 1I94B 3KDAA 3TB6A 2FEKA 3BGOS 5KJEA 1G2QA 2B2NA 2X2OA 1YV9A 1YRHA 3LTEA 1PUJA 4UBJA 3VR6A 4AURA 5J4VA 3CVUA 1EFKA 2KE5A 3I2JA 3DLCA 3ETEA 3F5SA 2XD9A 3PJGA 3ZWAA 5KU7A 2H65A 3H8SA 4DV0B 2Q41A 4XRGA 3KPWA 1GUZA 1QAQA 3OF5A 4ALNA 1NY6A 2F9FA 3RU9A 3ZHRA 4DMMA 3N58A 1SQGA 1MJGA 5KNCH 3W1EA 2CJWA 4M8LA 5CCDA 3JD4A 3OIYA 4BO8A 3I73A 1H2WA 1QRSA 1R00A 1X0VA 3DB2A 5JYDA 2X2PA 3ZW8A 5L4LA 4F9GA 3L79A 1SU7A 2BZ1A 4OI0A 1GFWA 4YBZA 1HE2A 1O97C 3JZMA 4MV0A 3S99A 3IYLW 1NQ5A 3P96A 4FYHA 5AOCA 3W5BA 1CFJA 2XUJA 1XAHA 4B79A 5GAJA 1FK8A 2B36A 4PLCA 3TIGA 4BCCA 5HJEA 4M36A 1UEXC 4XM2A 5DTQA 5IAAA 4Q4HA 2IXBA 3JCZA 4LHYA 4PWZA 1QLWA 2QJFA 4L72A 2PSFA 5FPHA 2ASEA 1GQRA 3PWZA 5DYWA 3OJFA 1OYYA 2OHFA 3U37A 1N8SA 2FPLA 4NFHA 4UHDA 5ILGA 2RGNC 5DI9A 2P8SA 4UAJA 1Y3AA 4LRYA 3ORRA 3HFGA 2P9CA 3PHIA 4EUHA 4U02A 1SVMA 5A6SA 1ABBA 4N6NA 5IFKA 1XQ9A 3PICA 2OQRA 3RSLA 3ZVKA 4P3OA 3IUBA 4JP8A 2FFRA 3V8QA 4CDGA 4XX1A 1DRWA 1RXEA 5FTJA 5K51A 2NG1A 3AP3A 1UXKA 3GGGA 1R8QA 1HOXA 4L07A 4BFWA 1EK2A 4J3JA 3M9WA 3QKWA 2ZI5A 1BXRB 4I5FA 4RJJA 4D45A 3PIRA 3TXAA 1YUNA 4RCZA 3B6KA 3WLAA 5FTNA 4DA9A 3ET4A 1G5RA 3H2SA 4U7FA 2VHZA 3WQBA 4Z7QB 1FVFA 1RI5A 1WW3A 3BSWA 5FNVB 3PUIA 3JZIA 4UE6A 5DLQC 2DU8A 2O3JA 2RGRA 2XDYA 5I4KA 4LF4B 2AHRA 1D7OA 2R4TA 1ODJA 3IE2A 3IIKA 4UUPA 4IXNA 2FV8A 4RETA 1QF9A 4LYFA 1XDWA 3NV7A 3AUFA 3ITKA 1EK5A 1S7CA 5BR4A 2VYVD 1X38A 3TI7A 1A7KA 2YASA 4FWTA 1WB9A 2VHQA 3TSCA 1MC1A 4NBSA 5EP1A 1HDYA 2P0YA 2Q7OE 1XVUA 4N3AA 1TL7C 4NRDA 3VTAA 1FNSA 4D4KA 3AXSA 1V8PA 2FN4A 3KNZA 2H1OA 1XZEA 3RIGA 1E59A 1OWOA 1F9AA 2AFHA 1MQAA 1CRQA 2VT2A 4RD2A 4YQYA 5K6AA 1EESA 2RI1A 1Z2AA 2JHGA 1H93A 1Z7GA 2OD7A 3A70A 1A3CA 3LPCA 1QANA 4BLWA 3U09A 4AAYA 5KQRA 3O4VA 1WHSA 4F5DA 4E33A 3AVYA 1LLCA 5A4JA 3ZWPA 5EHZA 5K0BA 3INTA 4QPJC 2HJGA 1DB3A 2HJ9A 1DJPA 2QEQA 3PX3A 1XO1A 4HNAB 4OO3A 4PYKA 2QB5A 3SICE 5BURA 5KQPA 1YIAA 1ZGHA 2O3SA 2XRMA 2WFZA 3IQZA 3IBTA 2AN4A 4GLBA 4WLNA 2FAXA 1TQ4A 5BQ3A 1GCIA 3I30X 5GIOE 4OFWA 3KYDA 1RYFA 1WM1A 5DM1A 3BB3A 3IQEA 2WP0A 4J94A 4RUKA 1I2MA 4M83A 2JCXA 1JBQA 3CF4A 3JQCA 1O95C 2XUZA 4X71A 1ECPA<