3HY3A

Structure of human mthfs with 10-formyltetrahydrofolate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
198
structure length
196
Chain Sequence
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
total genus 67
structure length 196
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy3A00
1SBQA 1U3FA 1U3GA 3HY4A 3HY6A 1SOUA 2JCBA 1YDMA 3HY3A 1WKCA 2G40A 3HXTA
chains in the Genus database with same CATH superfamily
2E5WA 2P6UA 1YCGA 4HHEA 4DIFA 3IVAA 4WK0B 3GH1A 5FOUA 3INTA 2QM8A 2I34A 2Q0SA 5JD3A 2VK2A 3I04M 1Y80A 1MZVA 3NOOA 4A9AA 3CS3A 5JAIA 2X4IA 2NSHA 3LJKA 5B7PA 4TOIA 5EIOA 2Q4TA 2Z2IA 2R87A 2OFWA 3ENZA 3SFZA 4NBSA 2CLFB 1Z47A 3THWB 2INGX 3NRBA 3TH5A 3C3EA 5K4AA 1Q1AA 1QF9A 1X7ZB 2IZ7A 4WAUA 4FFSA 5FOVA 3KDSE 4Z1MD 3VHXA 3GB9A 5JS8A 2PU7A 1E2LA 2HF9A 4JT2A 4S3MA 2Q50A 4LC0A 4JL5A 1PSDA 3D5TA 4D0SA 2PKYX 1KFCB 4F9EA 5AVOA 1ZGJA 2PQMA 1NJFA 3I58A 4YECA 1TAHA 3H9BA 4JIGA 1NW7A 2XUPA 4RTKA 2VJMA 3CT6A 1KHHA 2YVKA 1HFEL 3I6MA 3PHLA 1EVJA 3Q41A 2MJLA 2OEPA 1V5FA 1VI6A 3QX7A 4OB6A 5C5EA 1ZOOA 2VPQA 3GAZA 5HJ2A 2CXSA 4B3DA 1N0UA 4IL5A 2D1TA 2X4DA 2B2XA 4JI1B 3QFTA 4IR7A 1XA3A 3H2KA 4UMFA 1YL5A 5JSYA 2FMTA 1PLKA 5DNVA 1T8PA 5CCDA 1HSZA 1KP3A 1ZCJA 2PKCA 2XUAA 3TGWA 3AY0A 3I52A 1H1LA 3BE4A 4UE2A 1YBMA 4OUKX 5HFAA 2V4MA 1QDUA 2VRNA 4M0MA 5IP5A 4BATA 1Z5PA 3IAS6 1GNLA 1OIVA 2JIOA 5FO1A 3VSCA 3CZ9A 3RR2A 1P1CA 3AJ9A 4CCSA 1XZIA 4FX2A 4U7DA 1BXRB 1CWUA 4D3YA 1A9SA 2B78A 2HCRA 2WWHA 3D2BA 3C6KA 1UKZA 4I9GA 3C5VA 3LRTA 4BP3A 4E11A 2OT3B 3CR7A 3N7TA 5I9SA 4Q4HA 4GL2A 1L5YA 2R9VA 1AX9A 5T4EA 3LOQA 1YKGA 2GILA 3RABA 2TMKA 4BRZA 5IM4A 5PGMA 4AP6A 3LIPA 1NVUQ 3KKQA 4UMVA 5EJ4A 3OO0A 3NI2A 5EHQA 4ZCRA 1X7HA 1CE8B 1ISGA 1XL1A 1JZTA 1LGYA 4NU5A 1KAQA 1UOOA 3O75A 2WIDA 5M29A 2W2VA 4HN9A 3ZVMA 1XRQA 2XYVA 3LBHA 3DO6A 3ZNNA 4F38A 1A7UA 5EKTA 2H1OA 3DL2A 3SIXA 1J7JA 5FI3A 3ENNA 3GT0A 4BP1A 1EK1A 5MN6A 4BNXA 2JJ1D 2PSHA 2Q6KA 2HJHA 3A4TA 2PJUA 2ZAYA 2JI7A 3OZXA 4FI3F 1M2OA 5ALHA 5DWVA 5F77A 4YMIA 3MUEA 4MUJA 2VQDA 1M34E 2CDNA 5G4LA 3UWOA 3EBOA 1DQYA 2V45A 3SE7A 3H3JA 1A4XA 1RFGE 4GECA 4IM7A 2PUHA 3PRJA 5KSYA 4R69A 3O7MA 4CQLA 4G5XA 1WG8A 2DFKB 3A2LA 4UTOA 1ESEA 3UMJA 2QLJA 1X1QA 2R751 3A6HA 4KR3A 3N1UA 2G67A 1SZPA 2VSYA 5E1DA 2ISCA 3R7DA 1EFCA 4IQGA 1C1XA 2FEAA 3B3JA 4QPPA 4UUPA 1QP8A 4R1TA 5JMTA 2OV3A 5K3FA 3WSWA 4E6PA 3ZWDA 4RK1A 2MYUA 5HMMA 3OZ7A 5J2UB 3LSTA 4DZTA 2BFEA 4IQFA 1JDTA 3E27A 2BGIA 1LK0A 4JR0A 4B3GA 3VI3B 1XEWY 3HYLA 4OXYA 3CR8A 1T6YA 3OMWA 4INPA 4RKRA 3IJEB 1FDWA 1XV5A 2PSJA 5EIAA 3DZCA 2O3JA 1F8GA 4N12A 1O1YA 3NV7A 3VNAA 5A4JA 1KZ7B 3N28A 2HLPA 1S2LA 3IAXA 1RR6A 2Y3IA 4HGYA 4TRNA 4IMPA 4XI9A 3NHPA 4ZEVA 2CWDA 2EL7A 3N2EA 3KT6A 1B0ZA 2H4JA 3QUTA 4H27A 4MIEA 1TCBA 3CJRA 5E4JA 2B99A 2WHYA 4OO3A 3BJIC 3ESBA 4HZUA 4TGLA 4YJ3F 1BCRB 1UBHS 1SNYA 2QWXA 4UEJA 3RFXA 2JIDA 3MC1A 5FAKA 5FFMA 2HCBA 4UNNA 5HF9A 2WJYA 3FUVA 4DSNA 4HRYA 3AESA 4BLOA 1W6UA 3ZDBA 1K5PA 2J4CA 4QBKA 2WYWA 3B8EA 4TWAA 1GN8A 1NJ5A 2PGAA 2A1UB 3HHEA 1OXKB 4J0GA 3NT5A 5CLGA 1EFUA 1RMYA 1S3GA 3EWIA 4YJ3B 5IAEA 1FFWA 2XYPA 3BCRA 4YQEA 1XIVA 3EEYA 4EIWA 5TMEA 2I76A 4AY5A 3TB4A 3VNBA 1SXJC 1Z8HA 4OU5A 3AI2A 1CUAA 4NMXB 5K4HA 3E6AA 5ABPA 1RWQA 1C9DB 4IUBS 3A4NA 3U1TA 3SE0A 2QUHA 2QBYB 4XIYA 3R6WA 5DH9A 4F5DA 3WGYA 5A3JA 4J4TA 4PSAA 4DJ5X 3IV9A 5AKGA 4JJ7A 1PDVA 3PXBA 5A06A 3GLGA 4ZVRA 3BXZA 2XJ9A 4R2XA 5CLIA 2OKGA 1HE4A 4G1MB 1F2UA 2IPXA 4UTVA 3CA8A 4XAQA 3GVPA 1EE9A 4CLOB 4MVJD 3SEFA 2NTEA 1U0HC 2FZVA 4HRAA 1NW8A 3O1LA 4Y7CA 3ROMA 3LQRA 1OIWA 3VR6D 4IDNA 4QKQA 4W9MC 3WE7A 4CF6A 4PX3A 4P7GA 3H19A 3CEJA 3VR5H 1RHQA 2CCGA 5CFOA 721PA 1GRCA 3KE8A 2G71A 3ZVRA 1YGPA 2H63A 1U11A 4OP2A 5HF8A 2ADFA 2LPMA 2VYNA 4KG7A 3QVJA 1T8UA 2DSTA 4XB2A 5DM60 4LE1A 4X6YA 4G1BA 3FTPA 3WKDA 3EODA 3ZI4A 3WIEA 2IOFA 2FZ4A 3P4UA 4C07A 4J1TA 1SQ6A 4MQFB 1PTJC 1WUHS 2XRYA 4UFOA 1C1DB 5I7RA 4FN4A 5BRAA 3LX5A 1KQGA 1WR8A 2VJBA 3UG6A 4CUJA 3AHEA 3K70C 1TQ2A 2PMBA 1IC6A 3KPUA 1H0RA 4ZIRB 3O9VA 4LZJA 3HSKA 1LU9A 4M8SA 2C77A 1E2FA 1V5WA 1VE7A 2V74B 3ILHA 4QYIB 2ZYAA 2IXAA 2XDQB 1ZA2A 4CN9A 4J43A 5I47A 5HK9A 2HBZA 2I1LA 4DZRA 2KW5A 4B9AA 3FF1A 2G17A 1V1RA 1U81A 1DBSA 3HU5A 3QI7A 3D6VA 2VHEA 5AK6A 3VZSA 3WGJA 2OV6A 4R40A 2VWHA 4MLPA 4O2LA 3M89A 5CVUA 3KKOA 1B6TA 3DULA 4KO8A 2Z6AA 6AT1A 4W9RA 4IIHA 2VIIA 3R1IA 4R7GA 4O4JA 2GHQA 3I1JA 4K6FA 1P44A 4E15A 1W93A 2MYTA 1V3UA 2OQIA 4L0QA 1YZUA 2YRFA 2Q1XA 5HJEA 5C32A 4LXYA 4OXIA 4MJ7A 1E79A 1EJBA 2ID8A 3FNEA 3L4BC 2D5BA 1Z0FA 4Q6WA 4BB6A 4YCSA 2GN9A 3FMPB 1EJ6A 2WMOB 4E2YA 2DCMA 2NZVG 3STVA 1EGHA 4N5NA 1O6CA 2Y71A 3LP8A 1RYHA 1FYVA 3OC0A 1L5GB 2EP7A 4CDGA 1U8TA 5FHRA 2BSQA 3H1AA 2XUOA 1D0VA 2Z04A 4YGYA 3QQPA 4JB3A 3F71A 3WNBA 1OV4A 2DMRA 3ZE2B 1I6WA 1SZJG 4C0WA 4NDZA 4RTMA 1B2RA 5DOZA 1OBVA 1HDZA 3WLHA 9ATCA 3QPWA 1NUQA 4GKBA 1KOGA 2A0YA 2D5CA 1D7OA 4MRRA 4DVJA 1MGOA 3VVBA 3CLRD 4FOTA 1Q1BA 3JWHA 1RSZA 2NYUA 1GZ4A 2MIIA 3G6KA 4J0FA 4J49A 4RZHA 1PL0A 3OQNA 3IQWA 3L7IA 1XE3A 3T1HB 2FX5A 3DE7X 4Q1EA 2Y0CA 3TZQA 3JW8A 4GBGA 3TLZA 1B3RA 2GEJA 5GGYA 3S0JA 3RNOA 4DEVA 1ZAYA 2CF5A 4ZICA 1RWXA 2FN7A 3LC0A 2CHGA 3PXGA 3A1DA 4LOLA 3TZEA 1CJKC 4N9QA 3GEIA 1YA6A 1D6NA 4BEVA 1AJEA 4EY7A 4ENQA 5JAPA 2R4QA 1A69A 2HWKA 2XE6A 3NLLA 4X1OA 3DZ8A 5F73A 3RJ5A 3CZ5A 1I3NA 5G1OA 5AVRA 1PGQA 3IEMA 2EFHB 3ZWBA 4PZLA 5ETJA 3FTDA 3BCHA 3TTVA 2F3QA 4H08A 1AZWA 1IHOA 3T3EA 1OXVA 3R3YA 3NHMA 2ZRMA 3LBNA 3M9WA 4JU8A 4OQNA 5L7YA 3B52X 3HP4A 3HYSA 4IH1A 4LZPA 4BKMA 1U1EA 1ZNZA 3BH7A 3AM3A 3GI1A 5DYWA 1XPRA 4RS3A 2OBXA 2XVZA 4U0JA 2FHPA 4BNYA 1HNZB 1X77A 3WMEA 1ZNYA 2Q1WA 4M46A 1SBIA 2ZR8A 3NGXA 4JNKA 5GOZA 1GCGA 2EERA 3VAZA 1ZD4A 5ALRA 1NNEA 3P26A 4I1UA 3T99A 5AOAA 3EVDA 2WM8A 3GPCA 4IGIA 4ITVA 4U7FA 5J2TF 5E9WA 2ZYRA 3FDZA 3FHOA 3K8YA 4QJ4A 3OA0A 3FTQA 5F78A 3WFIA 3IRVA 2VT7A 1C7EA 4IBOA 1U0GA 4RD4A 5D51S 4Q9DA 3QRWA 2CNBA 3KQPA 5GV7A 3WGOA 2PS9A 2QL7A 3G5TA 1VPEA 4IXWA 2XGJA 2GXSA 5IAJA 3TCKA 3PBKA 3STTA 4BNIA 2V0GA 3PUYA 3QVSA 5CVCA 5KWJA 1V37A 2EARA 2P3QA 1HZZA 4ZEXA 3B5IA 4CNBA 3GRFA 1PDOA 4HATA 4Q01A 3DMTA 4JLNA 4NEGA 4OBWA 3T5CA 5BW6B 3LTEA 1S1MA 3GT7A 4ODIA 5JY1A 2V7VA 4JI5B 3L5OA 1X7ZA 1AQJA 4B3FX 4X1KB 4UXIA 1CUIA 1JAIA 4QZVA 3K2QA 3L0IB 2WHXA 1FLDA 3OF3A 4MSUA 1DKPA 2C5AA 4UXJA 3EEFA 2B8WA 1X80A 3ROKA 4GLBA 1VCNA 4G0NA 1NMEA 3H65A 4MV4A 2HQ1A 4G56A 3JQ9A 3C8DA 4ZDIA 2FKAA 3BA1A 3GG2A 4DL9A 5A9RA 1LVUA 4GBMA 4DY4A 4NIMA 5KYXB 2ZTLA 1U1FA 3AX6A 3DL7A 4Q7JB 3UM9A 1SUDA 1ZJWA 4AZVA 3AEKA 4FBLA 5F9HA 2PUJA 3RS2A 4ENRA 2A1IA 3I4CA 2R8RA 5GONB 3KOMA 4OQDA 1XCMA 3WDLA 5JCOC 2FETA 3BF7A 1M2VA 2V0NA 4NECA 4PGAA 4BV3A 3HB9A 4RX1A 4W1RA 2O0JA 4NCBA 5DOVA 2REXB 3V7WA 1JLRA 5DMXA 2FR8A 2ZJOA 2RGDA 4S1TA 3NC4A 4WLFA 4EYOA 3OJXA 1BDMA 2GETA 1SB8A 4RGQA 2YINC 4DC1A 4WXYB 2H5LA 2QTVB 4KCGA 1R6DA 1XMSA 1ZEMA 1E2NA 4EK9A 2PZ8A 2PV0A 4EY3A 1MJNA 5IM4F 1JSRA 4JX8A 1U3UA 3R0JA 5IG2A 3DS8A 3AVYA 4B47A 4J0JA 3L7OA 1YS6A 4WBNB 1OGIA 2Z4TA 5CIYA 2J07A 5DNYB 2VHJA 4DJEC 3ORSA 1IUOA 4I0WB 1QIMA 1W49A 1Z6QA 4JK3A 1TA0A 3S8EA 3THYA 3TPFA 1SO8A 5K51A 2WOOA 2VDNB 4HZIA 3K0CC 5IC5A 4HYEA 3GQBA 3IOMA 3PVZA 4DBLC 3LTNC 4B73A 4MWSA 3KVRA 4KSCA 3S2FA 2BKXA 3D6JA 4WNIA 2X2OA 1E5XA 1EQUA 4PRZA 1US8A 3UAVA 2GK7A 2XB2A 3Q7RA 3GUVA 1UQTA 2ZRQA 1ZCFA 3G1TA 4MRVA 1ODCA 4DQDA 1DZIA 3L7DA 3NVDA 3I1IA 4ER6A 2HT1A 1NYLA 2DP4E 2F4VB 4ZOQI 1EGQA 1NR1A 1U7XA 2BEUB 5FA8A 5IAGA 4FEAA 1EGVB 4YONB 1HNNA 1P0QA 1U2PA 4KEAA 5IKOA 2GEFA 4IRMA 3TINA 1CVIA 2F3TA 4BOYA 1QIEA 8ATCA 3Q8MA 4ZVUA 2VHYA 3STWA 5JSUA 4QNRA 2LDBA 5JH7A 4LBYA 4HOYA 3PZRA 3AF0A 4TKUA 3GGCA 2JIQA 5KB3A 5L7WA 3T1OA 3F9CA 4JKIA 5TNXA 4RV9A 1FXWF 3WYAA 1PV1A 3M8KA 1TECE 3A9WA 3W5IA 4Y8VA 2QR2A 1E8NA 3SWWA 3S2GA 4E94A 3K3PA 4H7KA 1OT5A 2Z2XA 4MVYA 4D8XA 4BU0A 3VJRA 1FFEA 2FZWA 1GO2A 1K3FA 2OC9A 2VTEA 4P81A 5DW0A 3OCCA 4RJ2A 4GKJB 1U2ZA 4UOEA 1PTJA 2RONA 1RIFA 2C4TA 2ILTA 3EIEA 2VTBA 3UUGA 4W82A 3RBAA 4O4HA 3ZW9A 3DOEA 1BNCA 3E7XA 5JSQA 3UT5A 4DYVA 3U49A 1YDFA 2RAVA 5KYWB 1LY1A 1WSDA 5GQSA 1NMYA 2PSFA 1UP6A 3FZYA 5KVQA 3VSDA 2K7FA 1IN6A 1Y8AA 2CXOA 5BW4A 2GPBA 5ECWA 1A9XA 2EFEB 3ACBA 1N6RA 2IDZA 1NMZA 3WWZA 3BZUA 4UUAA 2X1MA 1NDUA 1GSIA 2A57A 2H9IA 1XTBA 4DCJA 1T3ZA 2FG6C 3FM9A 3RTDA 1M73E 5CHYA 5CIWA 4MINA 5E38A 2VP3A 2ZQ5A 5FWXB 4PZPA 4XM1A 4EFLA 3QXCA 4O08A 2XMZA 4FDMA 3CPEA 2C97A 3AF1A 3Q88A 4HGRA 4HNGA 4NMMA 2EF1A 4BFUA 4LJLA 1CS4C 2I22A 4PC1A 1RYMA 4WKPA 3GLIB 1W2WB 4JB0A 3ZNPA 1RZUA 1IBRA 2SCUB 4YRIA 2PQ0A 2R6FA 3A4YA 4L72A 4YR9A 4D45A 1KFKB 3I01A 5AI4A 5C7YA 5SY6A 3X2FA 4YMUA 2OWDA 2BE9A 5B1DA 2CNLA 3WGMA 2QU8A 1I6LA 2ARKA 4K03A 2JA1A 1Y1LA 4AXBA 5I3ZA 5A5VA 4IDOA 4Q7EA 1KSJA 2CLIB 4Z3OA 1WZCA 2HC9A 5C31A 2LIVA 1AF4A 4A8JA 5JALA 4URVR 1ZAKA 2PJRA 4ZYVA 1VIYA 1SHLA 3MRXA 3GGPA 4V0LA 4OXXA 5KKAA 4L6IA 5CFRA 7AT1A 1F2TA 5FWYA 4BFVA 1L4BA 1UEIA 2QVZX 3JQAA 2JAWA 2SKEA 1XZBA 3G88A 4C4RA 1ECLA 3OMXA 4FFOA 4TLEA 3PIRA 3RYCB 4JI0B 2WOJA 1HTBA 1XTIA 1RACA 4EHJA 1UBLS 3UMCA 3F6PA 2AYYA 4M8KA 4DKJA 1FS6A 2Y1XA 5IT4A 3KT0A 1F0PA 1XN4A 2N3ZA 1V3QE 2XQJA 1GYPA 3TLYA 3OKAA 4XPIB 1GNVA 2QRMA 3HZOA 4IHJB 5CVTA 2XZOA 4L5BA 3UMBA 1WBBA 5JYCA 3LU1A 1THZA 1KYXA 4N0EA 1LDGA 3NPMA 5DXAA 3U56A 5JS7A 2IXBA 1XZDA 2FW1A 2QNIA 2RHJA 3UA3A 1QZUA 3CXRA 4RK5A 2PS3A 2C5LA 2AJBA 2RKOA 1JBKA 2BHRA 4W7IA 4OH7A 5HFNA 4BIIA 2IV3A 2RHBA 4DILA 2ANCA 1RXYA 1JDSA 1D2EA 2GRJA 2WFLA 2JIZD 5BW5A 5L6LB 2YX1A 1ISRA 3TR0A 4UEQA 4DHWA 3F7TA 4EFMA 1HSOA 3QV2A 3NWJA 2YV5A 4HD8A 1G8GA 1RXUA 2ATCA 2C8JA 4FMDF 3TI7A 4YT8A 3VOBA 2JG3A 2GJ8A 2AB0A 1YQTA 3RFCA 3ZK7A 1A50B 1XNRB 3A6DA 5D1HA 3L6DA 4KH0A 2WLTA 5JXHA 1VBMA 4JYPA 3BXPA 4M8IA 4RMHA 4ZTZB 4YRPA 3SM3A 3SXUA 2W2KB 1NJ2A 1K3UB 1KZHA 3LIIA 3LT0A 2RGAA 3SP1A 4B84A 1D6SA 2C03A 2RGXA 3BJZA 3RVBA 3G7UA 5BN3B 4TUYF 5ALUA 1O94A 4N5DA 1P77A 3CURA 3PT9A 1DO0A 3U6BA 4H77A 5IK2A 2OD7A 1IZ7A 1VKNA 1U2GA 2HHJA 2RH8A 3AHIA 3OHMA 4FGZA 4OJNA 4CQNA 2PH5A 3WISA 3EG9A 3SXJA 4IXNA 3IR7A 2DFVA 3ITKA 5JXGA 1OX6A 2JVKA 4YV7A 3FNRA 3SYMA 2QKYA 3TW0A 3TLBA 1VRCA 4GI7A 4MUIA 3C87A 5CH5A 1DJNA 2FW0A 2CJFA 3IE0A 1T4GA 4CZ2A 1FSZA 5LJLA 1E1DA 2B1JA 2B1QA 3MZ0A 4PONA 5DX8A 3IURA 5FWYB 4LJ4A 3UAXA 4CDRA 2C0QA 3H4VA 1OAKA 3MJDA 4O33A 1E6LA 2CKDA 4HRVA 1SK8A 5E4TA 5IDQA 3FB4A 4XDHA 2QJWA 5EHXA 3ZE1B 2QU7A 1KEPA 1TCCA 3B7GA 5DBHX 1BH6A 3TUZC 4R9VA 3D2AA 1SG6A 3GJ6A 1PT5A 4HQKA 3C0KA 3L7LA 4W9NC 5JROA 3SBXA 3ZIUA 1E5LA 2ZPAA 1BAPA 1KDTA 1EUDA 4UBIA 2OECA 3AIIA 3AUSA 3BOSA 5EXDA 3GLIA 3I92A 3IRUA 2Q0XA 5TARA 2CK3A 4QXRA 5JD5A 3K71B 4C6RA 3W04A 4JLBA 1KJNA 2VF4X 4N3CA 4ND8B 4YJKA 2GLTA 4CKYA 5EE3A 1K98A 2VF2A 3BMOB 3HFJA 3Q3GE 4D42A 5FPSA 2C88A 1DAGA 2CXUA 1HQDA 4HAVA 2CLOB 2H7YA 4RJKA 4WDQA 3REFA 1QO9A 2W6NA 1VGVA 1JR3A 2XKAA 1V4VA 3D9QX 2BSXA 1JLMA 1P9LA 2CEAA 3HDGA 5FI0B 2AZTA 4E3ZA 3DUFB 1WV0A 1ECJA 1MC5A 1U2GC 4C4AA 4Y1GA 4YJ2B 1FYFA 1RKBA 4M36A 2DFDA 2VOEA 2ODPA 2O8CB 1SBNE 2GYYA 2WWRA 2KBFA 1TYCA 3JAKB 4NWIA 3KT8A 3I3SR 1XROA 3W8NA 3I5YA 2B7LA 4B79A 4QATA 3ZJYA 4NJOA 2FSVC 2NO9A 1A8QA 1JR3D 2QP4A 3IELA 3KR1A 5A0FA 3RTEA 2V7GA 3AR4A 1DQNA 2MMCA 1U7HA 3AZQA 5B1SA 3JQBC 4PINA 3MINB 2W48A 1GG2A 3JSAA 1G38A 5M5BA 1YRWA 5KJFA 4M9CA 2VCYA 3TIXB 3AUXA 4MULA 3QBTA 4D0RA 3FYUB 1E1KA 4LECA 4CLEA 4D8UA 2UUBB 1ZK0A 2R62A 1MVNA 3PGXA 4CTMA 3CX8A 2I78A 3EXG1 2IPOA 1F4PA 1HYGA 3F3YA 4GOJA 1JMKC 1J7KA 2ZVQX 5T57A 3H9GA 5I7VA 2RBGA 3EE6A 4IEFB 3FCYA 3WZMA 5CA0A 4EPTA 5KSOA 4M9QA 3JQCA 2R97A 1NKSA 1UL1X 4CGZA 2D3WA 2G63A 2G9VA 2VHVA 2FR1A 1IPHA 1SQ5A 4QDXA 4ZCQA 2R1TB 4MHSA 3RG8A 2B8NA 3FFXA 3G7NA 3IIIA 3F4KA 4P82A 4U9UA 1YDEA 2CV1A 1XVIA 2OGSA 2Y1WA 3V6MA 1E7QA 4LJYA 4CF5A 4XWWA 1U9YA 2W58A 4IO1A 4ZRDA 1R4AA 2BGJA 4BE7B 1Q77A 4DQKA 1CUCA 3KV1A 2B20A 4GWGA 3W9UA 3ZBUA 3EGXA 4A26A 4F9GA 5G2OA 3N59A 2K6GA 3P0IA 2CW5A 1GRRA 3Q6MA 2WVJA 3VZCA 2HRRA 1X8KA 2UXDB 5HA5A 4W5WA 1JEYB 1LPMA 4GYJA 5F5NA 1X1SA 2HFJA 3BRWA 3G0IA 3CRW1 4MHTA 2G5PA 2R00C 1IH8A 4GKAA 2VUTA 2DYKA 1CEQA 3B5EA 4YVFA 3LLSA 3ZDYB 1VTKA 4TLAA 4MUFA 1PW5A 4KAXA 1EDBA 2W6IA 3N53A 4JJ8A 3DMRA 1ADFA 1DBPA 1R0XA 1I7LA 3EISA 1MA0A 3EGDA 3EXEB 2AFIE 3I30X 5HP4A 1H8HA 3VR1A 1M74A 3NCHA 3EASA 3PXUA 1NGSA 2OL4A 7MDHA 2IDJA 4AJJA 1BRMA 1X8LA 3FETA 1P2VA 4P22A 5AXCA 3CMMA 2XGSA 3OCZA 4K8OA 3SX2A 4CLHA 4E1VA 3ZPXA 4KZKA 4ME6A 3VKVA 5EKXA 4ZOCA 1NXXA 3KTDA 3S3TA 3A6FA 4AAYA 4YACA 1R66A 3GJQA 1MVOA 4NPAA 1SUCA 1WB4A 4EO4A 3T35A 2GN4A 2OB2A 5LDDC 3PC4A 1WOMA 1MC8A 2WF9A 3Q87B 3AVQA 3KCNA 1Y6FA 2WJIA 5JPDA 1PFWA 4C0XA 4ZHQA 2CEKA 2GVZC 2WWWA 2JLXA 4AWBA 4DM4A 3WMRA 3K30A 3DYIA 3OBIA 4AQDA 3PE4A 5JWHA 1MA3A 3ZYCA 2W2QA 5BT8A 2QM0A 2UKDA 2W8BA 1C0PA 4ZAFA 1XEXA 3HBNA 4ZMSA 3HCBA 5BURA 1T34A 2P4UA 2QN6A 3T1YB 4IDAA 4IZIA 2O1WA 1KK1A 4RPLA 1MW8X 3W7BA 1VE3A 1II8A 2ZXFA 3R0ZA 2PSEA 4Q9NA 1QIFA 5IARA 2PUTA 1M75A 1W7AA 1KP2A 1OA0A 4EKNB 7GPBA 1YE8A 2SBTA 4MUGA 4U7PB 2IZ6A 1DTWA 1I5EA 1S8NA 4R3UC 2PWAA 4RWZA 4DCUA 5A5EA 2IZ1A 3LYLA 4Z99A 2IS4A 3G2LA 1XZCA 1IBKB 1SB9A 1I4DD 4CMEA 1TVEA 5B2FA 3QJYA 1KKMA 1T9GS 5EESA 2VQ6A 3TUIC 1EA5A 3C6QA 2KHZA 5DI3B 2XTAA 4WFJA 2BJWA 4LHYA 4EKYA 5CVDA 1NE2A 2XQIA 4BLUA 3NH6A 2BJHA 2HA6A 4DCPA 2QRZA 4Z1OA 4MO9A 4BBZA 1JEJA 4N7BA 1IDOA 3HL4A 2C94A 2BM9A 2EJBA 1MEJA 2P79A 3EUAA 1XCJA 3GCWA 4G5GA 3GXOA 1E2UA 3LOPA 4QPJC 5FTKA 3IHTA 3NONA 1KERA 2D0PB 2ZRCA 3PLNA 1NA5A 3ZH9B 4S24A 4DNXA 1ECFA 1C4XA 1JLHA 2YWFA 1AO3A 3QVUA 1F1BA 4K2AA 4PRYA 1G5FA 4TLCA 3ZDXB 5FQNA 5HUHA 3CPJB 1TU0A 2AYXA 3Q3CA 4RHYA 2VK4A 2WU1A 4QU8A 1GTG1 4E4RA 4R0MA 4RZUA 1Z3IX 2ATXA 3SLGA 2QD4A 3TTSA 2ZUEA 2B9EA 2OLKA 4CQMD 1PR1A 3K9LA 1GR1A 1O95A 4IX9A 5B2ZA 1DOAA 3SYKA 3W9SA 4AWXA 4KO4S 4E5SA 2GXQA 4DT1A 4E4YA 4QVGA 2Q28A 4YRCA 3ISTA 2HRCA 3L92A 1D6MA 4PYNA 2JATA 4QU5A 3CUTA 2UDPA 1GKYA 4MQBA 4X6LA 3LCCA 1RTTA 3WKAA 1YS7A 5LMZA 4JYZA 1M72A 4GUDA 2JI8A 3PJRA 1WABA 1QC5B 2HYDA 1ZYUA 3HEMA 2IEAA 1UMDA 1OFVA 5FUWA 1FBNA 2VSOA 3OZBA 5KQPA 4JV5B 3RIGA 2RAFA 4QLBA 1SKQA 4DAOA 2WWTA 2BDUA 3D2CA 3IDQA 4HN4B 4ALIA 1WXHA 2MSWA 4LMRA 5JO9A 5L3ZA 2QRGA 4H0CA 5K0CA 3ICQB 4Q9IA 5I51A 2A1TS 1J5EB 4XPZA 4ZO6A 5AO9A 2PMEA 2JAQA 4EZIA 2QTTA 1YIDA 4Y9UA 4FB5A 4QAQA 4N5IX 4ZJZA 1COWD 4HKTA 3P97A 2YOGA 3U40A 2WR8A 3PFHA 4C7KA 3AG5A 4KXWA 3PEYA 4UHKA 2ZIZA 4MP8A 5IULC 2ES4A 2PS0A 3QE0A 4HDOB 4PCVA 2QX9A 1SHUX 4TTVA 1ZI9A 3BH6A 5I4IA 1WW2A 1ZO8A 3MPOA 4R1NA 1EK0A 7REQA 2XE8A 3K31A 2F1OA 5A2GA 3BDAA 3A10A 4B7XA 1K7YA 1CQIA 3TL3A 4KGZA 1IM5A 1PV4A 5BSGA 1AUVA 4KVZA 2X86A 5JZMA 1ABEA 1E2EA 5HTKA 2FPKA 1RP1A 2Q0QA 3C1TA 3CBQA 5FAXA 4XJXA 5C35A 5LP6B 2EZTA 1KVQA 2IXTA 4U2DA 4ZQHA 4JAVC 4MARA 2D2IA 4WQMA 2IV7A 3QE4A 2EBHX 4A36A 2WNIA 1LS6A 4BDTA 1QTIA 3L0OA 2O23A 1F0YA 3AIOA 1OCEA 1BDIA 2QTMA 5C8YF 1HNWB 4MQFA 1VG8A 4KXUA 1PVOA 1DBWA 1Z08A 3BGSA 3DTYA 4ANFA 2VPZA 1CZUA 3ZOKA 1ZVJA 2WIKA 3RSCA 1JG2A 1MB9A 2G09A 3VDMA 3HKEB 4EPRA 2BOVA 3IUMA 4KYVA 4REMA 4YDHB 4CDMA 2XPCA 3U5ZB 2O2CA 3KQUA 1HQKA 1NSFA 4X7RA 2KJQA 1TYDE 2JI9A 4M1MA 5IKMA 1XU4A 1GPJA 5DMHA 3TL6A 2C2BA 3H6GA 1PI3A 3AETA 3FLMA 4OQMA 3KPVA 3LQFA 4ESHA 5C1OA 2P35A 3RROA 1A8IA 2G80A 5C4IA 3UK2A 5KTRA 4ITUA 3PCRB 4QRIA 4Z5XA 1D1PA 2AKYA 4KP7A 4ZOEA 5LKAA 8ABPA 1OB2A 4YCCA 2WTXA 3EOAI 1ECPA 2JCGA 4FFVA 5FA6A 4E88A 1CQJA 1NN5A 4C3OB 4PW0A 5B58C 3C97A 2ZRPA 3IVXA 2QJFA 1UJNA 3LWBA 4QT4A 4A15A 2WICA 1FSPA 2H0QA 4I5DA 2ZWMA 5CR9A 4Z9AA 4CT4B 5FH9A 1E2IA 4MWTA 4BGEA 1TT5A 2GA9A 4R8MA 1K68A 4PAQA 4I4TB 4X61A 5TF4A 3W5SA 1WUJS 3ZS9A 1ISPA 3GRRA 1N6HA 4OJTA 5K1ZA 2XDWA 3F7OA 4QXPA 2ZLBA 1JPUA 3C3PA 5IH3A 1PR4A 3VPAA 2BF4A 3TIVA 1LRJA 2CJWA 2V9CA 5A4MS 3BWVA 2IEYA 5EOVA 5A7HA 1QUEA 4CJXA 2A9JA 3LE8A 3IMGA 1EVIA 1ULTA 2CL0X 4TWIA 3T9FA 5BSFA 2R1TA 3JQFA 4GPAA 3BZBA 1HY3A 4D8YA 2PR7A 1GWNA 2FRDC 4N40A 3LQ2A 1CG6A 2IYUA 3JTEA 1X39A 3ONEA 4L85A 4RYDA 4TMTA 3B7PA 1PNOA 3C7CB 3WR5A 5LYYA 1Z06A 1VRVA 2JFQA 1A9PA 1QRAA 4NBTA 2BUAA 3PPXA 3EIQA 1EFDN 3S29A 4XD7A 3K0EA 1M2KA 5JADA 3LF2A 3PNVA 1X70A 2XRFA 3MQ4A 3OLYA 2QNBA 4FONA 1DELA 2J46A 4RSGA 3K4PA 3I9MA 3KHSA 3TMAA 5TF0A 5K0FA 5E3IA 3QLTA 1H1TA 2JKZA 3GPDG 4V0RA 4YO8A 3GGJA 2ZUCA 2OP0A 3HVKA 4QT0A 1P4GA 3F46A 3CW8X 5SZJA 1GPWB 1T1EA 2ORIA 2OILA 1N3LA 2JRCA 3TR5A 5HUQA 1A71A 1XVVA 3THOA 2ZYWX 1AQUA 1Y7PA 2EEPA 4MLCA 4YR7A 2G28A 3RAPR 3F8WA 4TSFA 5LQNA 3KO8A 3WL3A 1IQPA 3ISVA 5B1HA 4KN5A 1IXZA 2PKQP 2I9PA 4EUNA 1EX9A 4LHWA 3F74A 5HDBB 2H6EA 5DGHA 1XDZA 2GBIA 4U1RA 1C1XB 1K9SA 2E1RA 4BNDA 3FOCA 2X3FA 4BQIA 1PGNA 4GZ6A 2BBTA 4D9FA 1R8JA 4CG2A 2QSYA 4K9NA 2O2ZA 3RUPA 5J4YA 1S01A 2WWYA 4C1NA 2C07A 2Y1CA 1TJ3A 1S2MA 1UWVA 1N1GA 2XNHA 1BO6A 1XELA 3LOUA 3V1KA 2DC1A 1XBTA 1FIUA 2A0UA 1X3LA 1IEWA 2WTBA 3JR3A 4TV9B 4RPGA 1KI1A 2HU7A 2COUA 4GMXA 3Q7IA 2FE4A 1W35A 3I6YA 1XMIA 4YJDA 3SXPA 1X7WB 4NBLA 4UAGA 4OXRA 1DEAA 1J42A 1V3VA 3CLUD 4ZDWA 4Z4CA 3ZK9A 5BR4A 2HBYA 4I6GA 2Q3LA 4HWOA 1Z8FA 3ZDDA 4WLNA 1A2OA 1GA1A 3OM8A 1V0JA 3PNSA 5CA1B 2GA8A 2Q27A 3G2MA 4TQ9A 3F96A 1NR7A 4ARSA 3CLRC 1ZUHA 3ESDA 4JVLA 3H1GA 4CMEC 1WW3A 2JLQA 1ZQ9A 5C53B 4PG4A 2BTEA 1M1UA 5TMDA 1MRNA 4FFDA 3VU0A 5F9MA 4Q7KA 2D5AA 2BFNA 1E1QA 3U16A 3ZC3A 2HIAA 2I65A 2Y76A 4GZMA 5EZYA 3UMRA 4F1WA 1ENZA 2X9LA 4B3BA 2DHEA 3P7MA 4II3A 1VKHA 3ASYA 4MDYA 4MWDA 5D5HA 1UPFA 1Q7TA 1QH8B 4MAFA 5FTJA 2JBWA 2JFBA 4WJKB 2KBEA 1RZRA 1GZ7A 3CRZA 1YZGA 3H5TA 1SA0A 1F38A 1DJQA 1N0IA 3FYUA 3GLKA 4HYQA 4JHLA 1Z6ZA 1VI5A 3JWEA 4FKZA 1RXIA 2OZVA 1K6MA 1SVWA 5ALGA 3WLFA 5A7FA 1OTXA 3NC1C 1T8SA 4ECEA 3N0XA 3QKRB 1WCYA 3ROGA 1YS1X 2BELA 3KJXA 5TQ2B 5KYTA 1ISIA 4DLLA 1AIPA 1N5KA 2GCNA 1XQXA 4FR0A 3A9SA 4JB2A 3ST7A 1H5QA 3FI9A 1AQLA 3WQSB 2WWXA 4BBJA 4ICIA 5FLKA 1GUDA 2CFSA 2OSBA 2X8AA 3CEMA 1DRVA 1L1FA 3HR4A 4F97A 1XZLA 3IJ5A 1FTSA 3KAPA 3MXTA 2MSCB 2OXEA 5F7ZA 4YPVA 2ZIWB 3GELA 4UQPA 1JKXA 4NNPA 1Y8QA 3OQBA 1L8OA 2OXTA 3GZNA 4M99A 2Z9BA 4NJMA 4KJZA 2GASA 1A7AA 4LJRA 3M2PA 1C0LA 4NOMA 4MS4B 4DLXA 4B4UA 1T4MA 4HDMA 1CUYA 5EJAA 5HBRA 3ABIA 1ONBA 1HYQA 3TW8B 2PWBA 1EVEA 5ELMA 3WYDA 4RZXA 2GBFA 3ZH2A 1OT3A 1YOVA 1RE1A 1ZCBA 2HEIA 1Z17A 2GDJA 5J4KA 3PUVA 4O1IA 3D64A 2HWWA 1RPJA 4TVBA 3M6IA 4N0PA 4CIBA 2FV8A 1QLJA 2IU3A 3DO5A 3GRYA 4OAPA 2DY1A 3C43A 1ZJ4A 1DQPA 3HWRA 5F3RA 4PX2A 2ZM5A 5AKKA 2P9ZA 4QDTA 3GK3A 5IZCC 1U3TA 4CCWA 2V1XA 3C39A 1FDRA 2NAPA 1OXXK 4Q9LA 3OU2A 4YJHB 5K3EA 1TM2A 3BM5A 5AVQA 2QTBA 1MMFB 1ZUNA 3CPSA 4L51A 3SSMA 3E5MA 2YS7A 4N39A 1E6EA 2I7XA 2HMYB 3NWEA 4IF4A 2Y2UA 4PNPA 4AJOA 1XQ6A 2OLJA 4DV5B 1E7YA 4Q16A 2VDWA 2B35A 1OXUA 4TYWA 1E98A 1MQ8B 1NKVA 3FNGA 5CPFA 5JCPA 4LNUA 4BUCA 3E1GA 1BMFA 1O9HA 2OYCA 4OYRA 1VMIA 5BO5A 4KKVA 2P4QA 1C2YA 3IAFA 3ZI7A 3MCTA 3OE5A 2AN4A 2OA0A 4NCKA 1FTWA 5D6NA 2F9MA 1GZSA 5ECDA 2WTNA 3NV9A 3QQ5A 1IVYA 2OFXA 2X0NA 5TLSA 1RWVA 6LDHA 3C3KA 5CB4B 5DGIA 2D1YA 4IGAA 1E3SA 1QV7A 2X1HA 3FRHA 2VFAA 3H2HA 3M1YA 3ML1A 3PJDA 3Q7QA 4CKBB 2DGDA 4LKOA 4OX9Y 2J48A 2PU5A 3OVMA 1E0AA 1BMFD 1BVRA 4K6OA 4FGWA 4IHJA 1GGEA 1CB0A 4DFDA 1MT0A 2H7CA 3M5CA 1A4IA 1GTZA 4DPMA 1UT6A 2WMNB 4RELA 4RO0A 1XTKA 3FJ1A 2RCYA 3PNKA 3CLHA 3TFWA 1PHRA 3NW9A 1T8WA 1ZGZA 1N6IA 3JU3A 4HPXB 4IUYA 4LMAA 9LDTA 1DRUA 2NTYC 1GTSA 4IUDS 3UMVA 1IN8A 1FQOA 1Y3HA 2BMEA 2WWIA 3PGJA 1EUCB 2YJNA 3A1EA 3DG9A 3RO7A 3WRYA 3M5WA 3DWEX 3PKZA 3FOEC 2JD0A 1ZVKA 3GX1A 4IY1A 4YALA 1DMRA 3EJ6A 4I66A 4HG2A 1IAQA 1E3LA 3JVVA 4NZZA 5F52A 1ZUNB 4TTSA 4DJFC 1J24A 1MRSA 3QFRA 2DBYA 1V1MB 1Q6YA 2GCOA 4R2KA 4ZVPA 6REQB 4PTYA 1TYBE 2ODEA 4D9CA 2QW0X 3OOHA 4YJHA 3QVMA 2CV0A 3IBSA 5IN5A 1USGA 3K0AB 2XAUA 3AUUA 2NAFA 3B6IA 1AUQA 3V4OA 3W6NA 1Q1NA 4EA7A 3DXZA 2BKEA 2AC7A 3QF7A 4PS1A 4C04A 1KK0A 5TEWA 2VEDA 3U4QA 3ER8A 2EX4A 1EB9A 1KZGB 1LF0A 1WZNA 4U2GA 1L4NA 1AGNA 1ORIA 2YR0A 2QLNA 4FOPA 4N9WA 4TKUB 4M22A 3RFVA 1OC2A 3CZCA 2VTKA 3IBCA 1C7ZA 1D9ZA 4Q21A 1GT6A 2XUHA 3A37A 5DXFA 4DLPA 5C7IO 4BEWA 4GAEA 4IOLA 5AHKA 4JI8B 4NX2A 1A9XB 3FIJA 2HJVA 4RE5A 2FGKA 1VBFA 4R3WA 4RPJA 4F4UA 4KHZA 4MS4A 4XTRA 2PY6A 1L7BA 3PUHA 4DLYA 3QOYA 1WQ3A 2P5UA 5F76A 1LX6A 4PEVA 1OWOA 3TLGA 1DJPA 1IBSA 1YDGA 2B25A 1XRJA 4NYJR 1H85A 1V7ZA 3A1NA 4PNHA 2WZCA 2YFQA 2RB4A 3K05A 5C8DA 1AMOA 1ZIYA 2J6BA 3LVFO 2C8KA 4E51A 2ZROA 1QZTA 1DG9A 3KDAA 3LGXA 2HPZA 4LBWA 2VCEA 4A4DA 1G64A 1U1DA 2I4IA 1HFJA 1ACMA 2FDRA 4DM3A 4ZARA 4EX6A 2FWBA 3T3IA 3DL0A 1AKNA 3WRYC 4NRDA 5EE1A 2ZS7A 1W52X 1KS2A 3R6DA 4CLXA 1XCPA 4P4SB 1OLXA 1A1SA 1REQA 3WQRA 5HZMA 4I1OA 4EA8A 4Z7JA 2XOKD 4H35A 1I33A 1EFKA 4D0LB 5ER6A 4NXMB 1F7UA 2GZRA 1M8FA 3ACCA 3OP1A 2HB6A 5KX5F 1WU8A 2B4YA 5KAPA 4KPYA 1Q19A 1T5LA 1JFFB 3QYJA 3AHJA 1PT8A 1BEUB 1RP7A 3I2GA 2R2AA 4TKLA 4F11A 1ZK3A 5BORA 2C83A 4X20B 1EVLA 1JJAA 3DV0B 4Q7MB 2QTRA 1TM4E 1XZQA 2BGKA 3QEBZ 3FWPA 4GOKA 4K86A 2DEUA 4Q05A 1SEPA 1WF3A 4DW8A 4JDUA 2AW3A 4C30A 3RBZA 2WTUA 4I6EA 4BVFA 2HRDA 3KZOA 4M4SA 4WK4B 5IRCD 5EHZA 4R31A 3EXFA 4UATA 1RHJA 4A23A 5TT1A 1E4YA 2Z95A 1JQBA 2BH9A 5E0KB 5L3SA 3KETA 3T7CA 4PPNA 1YRHA 4RTPA 1XYGA 4YHBA 3RM3A 2D06A 2I03A 4CM6A 1MJHA 4XRGA 4ZYYA 1DKOA 1JG4A 3B1XA 5EGNA 1COZA 5AIAA 5ALTA 4CYMA 4W7SA 5HZHA 4LBZA 3HCDA 2QLMA 2XTNA 1XXLA 1SH7A 4EY4A 2ACEA 4BMXA 2B4QA 1Q2XA 1QE0A 3A58B 1Q91A 2NUBA 2ODWA 1BA3A 4DR7B 1L7EA 1N4DA 1WULS 2Z30A 4FUQA 3FPAA 4RK6A 2RG1A 5B53A 1JDNA 4TZ6A 2MT9A 4BNDB 3DMFA 1P19A 5AKIA 1A4UA 1G98A 4LJKA 5H3LA 5I9IA 1SUWA 1CJTC 2HOQA 4HGNA 4OMDA 5DHFA 2JGEA 2WFMA 1UXOA 4L15A 5EYPA 4MQ4A 2MU1A 4KDFA 4BMCA 5ALFA 3JATA 5GMOA 4UARA 1USVA 3JYLA 4JXJA 3JARA 1DGQA 3VZBA 3RRJA 1JUDA 3LC7O 1ICIA 5JATA 2VA9A 4EHFA 3H1PA 3IQGX 4JFAA 2O06A 2C5FA 3PFNA 2OV1A 1AXRA 2RH4A 1RQPA 1IZ9A 4QVKA 4X45A 2I91A 4RVUA 1RPTA 1GAEO 1VKZA 3VZQA 1OBCA 4OQLA 3DFMA 4H6XA 5CM2Z 3RS8A 2IUSA 1TO2E 2MSDB 5LQSA 5CG1A 4JENA 4AY3A 2PRYA 4V1CA 1K7SN 3P5BA 1BFKA 1I5OA 2C00A 3KVVA 4EHAA 4IDEA 1YHNA 2DTEA 2I54A 2PPVA 4R9SA 2GVNA 5DHQA 3URKA 1CUSA 2XE4A 3ONDA 2OZPA 2I1WA 2WWFA 3FMGA 3R6GA 3CLSD 2Z43A 1OROA 2LCQA 3NHAA 3RWMB 1E2QA 4ZT7A 5CNIA 1FE8A 1TZCA 2VRCD 1MB3A 2X8WA 3EXIA 2H1SA 3N6RA 3AR6A 4LSWA 1J2TA 4LUCA 1C0EA 1YACA 2Z3VA 3AEXA 3EXIB 3N3BC 3OZCA 3D4NA 2XEDA 4GXTA 4P36A 1GUBA 1M2VB 3JALB 1HDRA 3QIAA 2A8YA 4FKMA 5JZSA 3WLKX 2H1FA 3UQZA 3L1JA 1IHXA 4ECAA 3KB2A 4WOPA 5KIAA 3U09A 2LDXA 1GUYA 3PNMA 5KSWB 4W5QA 3MIZA 2AOUB 1GJRA 3D6MA 1JVBA 5KMGA 4PO9A 1Y5RA 2FEWB 5KYXA 2HLDA 1VPVA 1ST3A 3MRTA 3LCMA 1NT2A 2HHCA 4KXMA 4P7JA 5ERYA 3RIYA 3SR0A 4U2BA 3WWEA 4YP5A 4QPNA 1I7QB 1A5BB 1IATA 5LB4A 1HXHA 3BMCA 1P33A 2BI4A 4M3NA 4OK6A 4BMOB 5D3MB 2ZUDA 1T15A 3JQ7A 5HS4A 4TKZA 5JR3A 3EHDA 4LXTA 3PXEA 1LSUA 3NR2A 1A2KC 4JJKA 3D0KA 2Z5LA 2J31A 4R54A 4MMXB 1OXMA 1BWRA 3MG9A 4UCQA 4BVJA 1BW9B 3MGAA 3RG2A 1VFPA 2TRSB 2J85A 3V9AA 4D26A 4CQMB 3C15C 4RQTA 5CLHA 3DFKA 2I3DA 4JVNA 1QU3A 3DAYA 4GGMX 4BO6A 4B3HA 1P74A 1RXWA 1CUVA 4RZ2A 1JAYA 2UZIR 3VKWA 5K9ZA 2ZT7A 3RBVA 3G0DA 3FOWA 1TMGE 1EG2A 2V59A 1U8AA 5FL7D 3K1TA 4KAFA 5B2EA 1KJ9A 6ADHA 4J2OA 3HUDA 3WBKA 3LP6A 4F1KA 1KFBB 3DZFA 1JQ5A 3JD0A 3IQHX 4PO3X 1DTEA 3AVOA 5JLJA 3BMNA 1O96B 4DV0B 1T9HA 1JLKA 2QZ9A 1GXSB 2CV2A 2WHRA 2PGOA 2HHHB 1UC9A 4Q1BA 3CU5A 1TX4B 3PJFA 3DOHA 1KMQA 4PPQA 3PCTA 4QYIA 3W2FA 3OJ0A 3BL6A 3KVNA 3GJ7A 4R8SA 1OFGA 4PXSA 2WD9A 3ZTYA 2R5WA 1MBZA 3N76A 1UFVA 2Y68A 3AM1A 1DAFA 4LK3A 1IM2A 4Y18A 2EDCA 4Y6OA 2SNIE 4BO2A 2ZBDA 1W29A 2ZYIA 3QLUA 1V26A 3TSZA 2AVNA 2QPTA 1FSFA 2WK1A 4CI0B 3SC2B 2ZE5A 4M8LA 3NHKA 3U4DA 1EWTA 2Q2QA 2ZIUB 3V55A 3HVIA 5T8KC 3M2TA 3WAJA 2WT8A 4EI2A 5IVPA 5T67A 3ANNA 1ZMBA 3TI9A 1VJCA 1VPTA 3OJLA 3X1YA 4BO7A 3U6KA 4DV7B 4BZPA 2VR1A 2IGBA 5KBYA 5JAHA 1WZIA 4R16A 5KSPA 2W2TA 2HXYA 1HZJA 4KE7A 3BK2A 1IULA 1P2GA 1GU7A 2GCIA 3ELUA 1ZA1A 4O4JB 4CMHA 4HGZA 1SPXA 3FGZA 5DNCA 2G1AA 2WUDA 5EA2A 2ET6A 4EZBA 3VPSA 2QTGA 4PPYA 1OLXB 4CLOA 3IT3A 3NVKI 1R8SA 3LDGA 3PVSA 4MV0A 5ALYA 1HE1C 2CFRA 3I3OA 1WNFA 3T94A 3BFVA 1RBQA 1Q7GA 1K6XA 1MO4A 3IDSA 4L73A 4XLTA 5CUQA 2KQUA 1BCSA 4OH1A 2Q45A 2QD5A 4FFBB 1L7AA 5I4KA 1BDBA 3I8XA 3KQKA 4NS4A 3VDNB 1WUIS 1ITZA 1KS9A 2XVMA 4JKYA 3ZHUA 3QMVA 3OE7D 3PUKA 4R2JA 1I94B 5TQ0B 4XQEA 2RIRA 3VSBA 4E08A 1CP2A 3OT5A 3L06A 3AF2A 4XD7D 4YFVA 2WMYA 7ADHA 2VTVA 3MRSA 3IMFA 1QRDA 3I34X 3MM4A 1VCIA 4FDVA 4JOBA 2OORA 1KDZA 1PWZA 4RA6A 4L2IA 3UMYA 1V35A 1E3WA 1GADO 2RJNA 4CTNA 4BJ3A 5H3HA 1NONA 3QMMA 3U9TA 4Y9DA 3ICVA 3IXQA 2PSSA 2QNRA 3AM5A 5EZ5A 5SICE 2CHQA 2QJOA 5LZ9A 2IH2A 3MCVA 4AIIA 1HZZC 1EBFA 1M33A 4Q9AA 1UDCA 2CLLB 1ZUIA 4PE5B 3SF8B 5FXMA 3QW2A 1V1RB 2CZCA 2EU8A 4YV2A 5B7QA 3S2EA 5JCXA 1VCOA 4GXQA 1F2UB 2Y1KA 5BVGB 2DWOA 1U8UA 5A0VA 1YZ3A 4W63A 1T2UA 1NOJA 4WZ6A 1DV2A 3IHLA 1GV1A 4KVGA 4E5YA 4QBGB 2EF0A 4KQ9A 4IUCS 4W8OA 4ZZ3A 4BX2A 3ND8A 2FPOA 4LXXA 5GVSA 1RPNA 4HH3C 2HMSA 4RNDB 5FEMA 4EHHA 2JGLA 4MV8A 2PX3A 1Z2AA 1KK2A 3NKFA 4QPCA 1W5EA 4NF2A 1WVIA 3AM4A 2BBWA 3O4IA 1MV5A 2I66A 2OK7A 5CYGA 1DE0A 3FOBA 2WVAA 2QM7A 3HABA 3KB8A 4ZC8A 2XMCA 3RVLA 5LMNB 2DQZA 3PRYA 1NVMB 4WW0A 1IU9A 2KE5A 4I3HA 5DI3A 1A9YA 2WYIA 4U2CA 2C8LA 1UF9A 1T9CA 1QX3A 4R3NA 1V9CA 4RKYA 5JSKA 1JG1A 5DHAA 1S02A 4YRRA 3M7IA 5C1BA 3ZCSA 3AVVA 4HQLA 4HTFA 2I6FA 4OHCA 1JIVA 1ZM4A 4J1NA 3V46A 2ATEA 5DNEA 4YHHB 4X7PA 3IT0A 3WNDA 2RH9B 2VF8A 3K0FA 5UKDA 4CG1A 1ZOPA 1R6TA 1Q84A 2AZ4A 3Q11A 3BE8A 3OM9A 3CX3A 1QGUA 4NP6A 2WRZA 5GM2A 2OC4A 2Y1DA 4CM9A 1P29A 2L82A 4N18A 1TW2A 1KWGA 1CZHA 2VNAA 1WCWA 3DA8A 2I62A 3S70A 2YYAA 3E61A 1C9JA 5ICFA 3EWSA 1T9GR 3L4BA 4F3TA 3N87A 3O47A 3Q1LA 5FOTA 3FUUA 1QHGA 4QOFA 4AWAA 1C50A 3HKCB 3UATA 4BAZA 4ZHQB 3BWBA 1Z2EA 5BN4B 1YNSA 2GZDA 3VFDA 1MJ5A 1MOPA 1PYOA 5CW2A 5J2UA 2C9ZA 4GYYA 2FEOA 4KSBA 1EXDA 5IAOA 2OVBA 3DZKA 1O6ZA 1RZRD 2AS0A 1F8UA 1T6NA 4PHFA 1I1QB 1DC3A 1IHUA 4XTCS 3I72A 4GR9A 4J4HA 3URMA 4J03A 4MRNA 3AP2A 1WDWB 4EG8A 1XZKA 4C43A 4GC5A 5E4FA 1VBNA 2C42A 3PJEA 5AVJA 3LNCA 3MT0A 4EF4A 1H6DA 4FYHA 2QUIA 4MR9A 4L9AA 5DBEX 5CLFA 1E89A 1JHRA 1HE2A 1TF7A 5SYAA 4QWWA 4TKVA 1CUDA 1E63A 2XNJA 4I46A 3EUFA 3WY9A 3A7DA 3HPQA 2Q9UA 5I8PA 2NV0A 1I3LA 2XUFA 5LZ4A 3ZLVA 2VPWA 1XTJA 1ZCZA 2RGEA 1M34B 5TS3A 3H5LA 1A3CA 4D9MA 3KHUA 5IW8A 1L7MA 1RYYA 3DKKA 3NM4A 2BCJQ 1YJCA 2GOYA 3ETJA 4J0EA 3O1HB 4N3AA 5JDIA 4PTZA 1QZ3A 4EUKA 3DLHA 2G0NA 4DDWA 2RD2A 1DS6A 1J90A 4GVLA 1ZUWA 2P2DA 3OJFA 4DOMA 1L7PA 5D6OA 2Z57A 4NFYA 1S0UA 4HNUA 1U1CA 5DHSA 1KBZA 4WKCA 4KBGA 4MDEA 1XSEA 1Z4IA 1Z9BA 1H94A 2C2YA 3EG5A 3U3KA 4X44A 5DGDA 3TQCA 4UNRA 1Z6YA 2DM6A 2CXHA 3JS5A 3BIXA 1XRMA 4E33A 3HE3A 4OHPA 2UAGA 3DM9B 5A4FS 1SQSA 1KOLA 2GJKA 4Y2GA 3ROEA 2GM9A 2XAAA 3ZZ0A 5AHOA 2NO7A 4EHDA 3FKSA 3A36A 1OZAA 2VT2A 1PZXA 1VLLA 3O8OB 4ENUA 4GM1A 1D4OA 1YVDA 4BWGA 4DJAA 4F5ZA 8MHTA 1O6GA 2AR7A 3COVA 3NAQA 3NETA 2EXXA 3SR3A 4PQYA 4AICA 1T5IA 3NDIA 2C4HA 5BSKA 2B7BA 3NX4A 5FWNA 3LA8A 1JA9A 2LKDA 3QG1A 2P2LA 3M3DA 1JR6A 4C0KA 2HL6A 2FW7A 3B78A 1K5DA 2R6AA 4AYXA 2PX4A 1AOXA 4EWLA 2CVFA 4NZMA 1W36B 4FLEA 4LVCA 4BE4A 1X1DA 2RGWA 2D4AA 2CVZA 4NAHA 1V9LA 4FTWA 1DB3A 5LZ2A 2A33A 1ILEA 1W47A 4KLNA 1OI2A 5CA0F 3MLBA 5T7BA 3GEBA 3C3WA 4TSFD 4HVLA 4F3NA 3A9UA 5LLTA 1M5UA 2VSXA 1R0LA 4IQ0A 2WEKA 3KOXA 2D1FA 5EP1A 2AOWA 3VHXB 5KU1A 5EKDA 3QBVA 1KYTA 3QPDA 1HO3A 3FHTA 4LZWA 3WAKA 3ZGZA 4OEHA 4JYAB 2OCIA 3E23A 1J00A 1EMDA 2FEPA 2H8GA 5K05A 1RJFA 3UHJA 1ODKA 5FLXA 2Z1DA 1IMJA 2Y1LA 4DR4B 2WFLB 5LOVB 2FPRA 2FPPB 2RHDA 1ZJYA 3VTKA 1XFAA 1KOJA 3WWCA 4C78A 2VNIA 1FSGA 4JVOA 4L50A 2IYRA 2Z83A 1I4EB 4RIIA 3DNMA 2FFAA 3KQYA 3NYRA 3DSRA 4EJ2A 1AM4D 3LZCA 1T0HB 1HQCA 2GAJA 2GKOA 2ZITA 4M7RA 3MJRA 4QGHA 3ZE7A 1BDHA 3EPHA 1ZN7A 3ZBPA 1ZGBA 2E48A 3DLCA 3M3HA 3R4CA 5EIFA 3AYZB 1ZM9A 2G9QA 3OZIA 10MHA 4GP7A 2DBVO 4K40A 3KYDA 1RAFA 1UFRA 3EVCA 3ICPA 3OCJA 3O92A 4MEAA 3EZFA 5GV8A 2R96A 3ZHBA 5JY6A 3PC6A 4Y2YA 5L45A 3E2IA 4I2NA 4WA8A 4Z4IA 4OI1A 2B4TO 1EINA 3K9FC 4MIKA 3HN7A 1SBTA 2E82A 1OW3B 3IIEA 2NUTA 3CGWA 3FPJA 4M21A 16PKA 1VJGA 3R3SA 4PG6A 4UKDA 5CX1B 1BC5A 3RS5A 4DLWA 1XZMA 1MQ9A 4Z4EA 3RKSA 3KOWA 3DOIA 1U2SA 4IIBA 3EMKA 5AH0A 3TTYA 3L0BA 2J0UA 5T4BA 1N2CE 4P93A 1OFTA 2FW6A 4R83A 4WCDA 2ORVA 2IOQA 3PKJA 1N77A 2Y66A 3ANLA 3OPXA 2VJQA 1SXIA 3SHWA 3ZHTA 1HT0A 2QENA 2RGUA 1YS2X 2NYVA 1XB2A 4RQBA 1C3JA 3BSWA 4GS5A 4ZQBA 4XJVA 3X44A 4C4XA 4HDKA 1AGXA 3WNQA 3BWCA 3GEHA 4NYIQ 4UVDA 2Q8PA 2FF5A 3Q4GA 1AE1A 3QLVA 4Y3UA 5A4KA 2O3RA 5B3AA 1W34A 1AKTA 1GDHA 4JI6B 2C7GA 3OLWA 4ERNA 1E9BA 4KC0A 5E6SB 1FDVA 3AOEA 1SUSA 1WXWA 1NZDA 1QHIA 5A6SA 2F6RA 1V9SA 1C9NA 5HOQA 2PT7A 5ADWA 1I1NA 4WV3A 1Q6ZA 4X3PA 2H92A 1U5AA 3K8QA 4TMWA 5E9QA 1N2OA 2CLSA 2IOFK 2JJ1A 1X9GA 3A70A 4HQNA 4A27A 3BC1A 1GDTA 4PZCA 1ADBA 3IP3A 2XGGA 4GSKA 4K6KA 4K3UA 1P9WA 3I2YX 1G1MA 5M3BA 4MKZA 2VZLA 4C7BA 1J0BA 3RWBA 1X1TA 2O2EA 1WXXA 1J2UA 4LRQA 4Z9XA 3CVWA 4K88A 4YUAA 1GKUB 4O4HB 1NC1A 1NW9B 2C9OA 3KQMA 2JLZA 2G4LA 5FD8A 5IBRA 1CJVC 2PVPA 1F0NA 4L8VA 2FK7A 3O3NB 4KXXA 2FI1A 3B2NA 3RHFA 3TW4A 4P3XA 4J7AA 2C99A 4OMFG 5F2OA 2X9QA 5FOWA 3DHYA 1TUBA 3EARA 3TTTA 4FFBA 2O0LA 2YMPA 5DLYA 1U8FO 2XMRA 2X3YA 3E4CA 1WU7A 4I99A 1EE2A 1CRPA 3WNZA 4OFZA 2F00A 4CCAA 3K9BA 1PG0A 4BVEA 2OY0A 4DQXA 3U4GA 1PN3A 4YWHA 3GFVA 4KXQA 3SNHA 2A35A 2D5LA 1AVTA 1DAIA 4CL3A 4UEOA 1PJCA 3PA6A 3NHYA 3C5HA 1TUIA 5JZBA 3U7GA 4F4IA 3O1IC 1Z75A 4BECA 2NTJA 2PL3A 4A3SA 5AKHA 3FXAA 4LS3A 4A0QA 5BMVA 3TPZA 1WA5A 2KWIA 4EVIA 3GFPA 1AU9A 1TPYA 5LQCA 3I9LA 1PX2A 1UXJA 4G24A 2D7JA 3U3RA 1VDMA 5BR1A 4AMGA 4CPDA 3ZW7A 1WP9A 1GA4A 3BCUA 4D41A 5AJWA 2BE7A 3MD9A 4OGKA 5TS2A 3N75A 1AC5A 3K72B 2G3YA 3RYFB 3EA5A 3TGPA 1Y3IA 5IKXA 3WWPA 1T2CA 2AE2A 3SK0A 4C9BA 1PDWA 2ZKIA 5KNBA 3L6RA 4KWIA 2CE2X 4C21A 5AYVA 4CI9A 2BDTA 4ZU6X 2AOTA 2CKMA 4HADA 1FVXA 3SC6A 3GLGB 2CFCA 2GD2A 3BWMA 1I51A 1V5IA 3SICE 1O6BA 5COAA 5KHLB 1JH9A 1E2GA 1VA5A 5MGNA 1W36D 4GQAA 3ZU2A 4JGIA 4ZJUA 5FLEX 4H4EA 1YJQA 5F1PA 4OG2A 3VR3D 2H9YA 3UENA 4OJKA 2OM6A 4DYHA 1UFKA 4PAWA 4HBZA 5F7OA 2ZS8A 3HGQA 1XZFA 3PA8A 3TKAA 1CQPA 2AC2A 5H5JA 2UUAB 4LQ4A 5C4MA 1OU4A 4KIUA 3BAZA 3R3VA 4ZTBA 4GBED 4JYMA 4BLRA 4ETNA 3RK1A 2VUIB 3G1UA 1J22A 4HDNA 5IJ0A 1XKTA 4B6OA 4O3FA 1NI5A 1T8YA 3LUGA 4FGKA 3WSVA 3OP4A 5AVWA 1P1IA 2CUTA 1AHIA 5JEEA 1V3TA 1CY2A 4FYVA 1UBOS 2DUNA 3BA6A 5IAKA 1U02A 1MXHA 3HUFA 2OZLB 1WB5A 3L1VA 5BQFA 4TL8A 3VOTA 1L1RA 4W5TA 1UZAA 3E70C 3T4XA 1FMCA 1N3BA 4PGGA 3SYLA 3AY6A 3PDWA 1RI4A 1X80B 2CHEA 1YOVB 2IXFA 5AW2A 2Q2NA 5CLLA 1MAHA 2P7IA 1LWNA 2PBFA 1FNMA 1P3JA 2R60A 5CDYA 2DECA 3PSHA 2IXEA 1E6UA 3MJCA 4LWZA 5JH7F 1E4VA 1HKHA 4MUEA 5JH7B 4C4SA 5LWQA 1YB6A 1XDSA 1ZH2A 3EXG2 5FPTA 5B3JC 1ONNA 1ZIOA 3JRNA 2YBEA 4L0MA 4XYGA 4XM0A 4ARCA 2HRQA 5EMJA 5DTJA 4P0QB 4V24A 4RABA 1QE5A 3QPUA 3VH2A 4MGIR 3S40A 1U94A 4BEJA 4I7EA 3KUDA 4FVTA 4EVRA 3DDCA 3EDOA 4ZRNA 2ORWA 3G1WA 4OP1A 5I7SA 1XNGA 5IF3A 1Q1GA 3AJ8A 4IVRA 4Z53A 1RBZA 5ICGA 1U8EA 4YRSA 1Z7WA 3WRVA 4FHGA 5ISMA 1KF0A 3VKHA 1J9ZA 1KJ8A 1KJJA 1PRYA 3FDZB 3MB8A 4PO1A 2DR2A 3FMFA 4Q3LA 2QTFA 4UNQA 2IOYA 4NVRA 4B4VA 5GJWC 4DSOA 1IZZA 1K8YB 3OT1A 2C9DA 3G2QA 3BIJA 4Q15A 4R2WA 2VPTA 4FHDA 5A3SA 4B6QA 5AVUA 3JARB 3EVGA 2A5GA 4L6AA 1P1FA 3KAJA 3B9RA 2WJJA 2BTQA 1WHSA 3JD1A 4WCVA 3AQIA 1FP6A 3JR7A 1VZ3A 1QRTA 2OTCA 4DUGA 1TVKA 4AG6A 4BQQA 1PG2A 5F2EA 4C4ZA 2JAXA 2LW7A 3BGVA 5BQ3A 3H6KA 3C8ZA 2XOKA 2YFKA 1E0SA 1TKRA 1OH7A 2P91A 4C7OA 2JIRA 2IEIA 4EVQA 4F2HA 4MRMB 2DVMA 2YXNA 4KU4A 3U7QA 1X0XA 4IFTA 5A4IS 4GGOA 2XUKA 1KI6A 3LUCA 4IKOA 3HCNA 3Q2KA 4H31A 4M0UA 3N6VA 2RG7A 4HX2A 5AK3A 2XKKA 4P7FA 4RD2A 1XTUA 1VPWA 3ULKA 3JQGB 2Q6OA 2IFTA 4WPGA 4XD2A 1TGVA 2WQ7A 1XEXB 5KOJB 4L74A 2HU5A 3O8BA 3ZQKA 1NJ8A 4F6RB 4ZYUA 3O8RA 2OQ2A 4Q9HA 4HP8A 2FFHA 2FB9A 4X1IB 4TV9A 1N2BA 5E0OA 2Q9AA 1UZUA 1T6XA 2QTZA 2BFFB 3LKBA 5KEIA 1KPHA 1U7DA 3GAFA 2ILVA 3EWNA 2O0MA 4DA9A 4ND1A 4AZ0A 3DFIA 4PGMA 4JT9A 4IJ6A 1H9BA 2OHVA 3ITEA 4OHZA 2D54A 3V1LA 4MRPA 1KEEA 3UBTA 1NRXA 1QX4A 3JWGA 4B9EA 4O0LA 4FD3A 1N2XA 3WRXC 3MJEA 2ERXA 4YGXB 5BOSA 3BKXA 3T9CA 5GZ3A 5DK6A 5KZMB 1D1TA 3WQHA 2Q5LA 1O95C 3INYA 2GF9A 3CF4A 4LRTB 1K3TA 2WNSA 3RUHA 1H0SA 2HUPA 4UAUA 1K92A 4Z9BA 4CFYA 4H4DA 2R4TA 2Q7XA 2WKWA 2QL9A 3CONA 3EXEA 3QTTA 5FRDA 3SLRA 3W7AA 1Z83A 3DOFA 1SU7A 2F1IA 3DEJA 1FS4A 2W6JD 5BN4A 4W6ZA 1FMLA 1T2EA 2YHBA 3EPPA 4PG8A 4YMTA 4W6QA 5BV0A 5ESXA 1LQTA 1NHGA 3IBTA 4KTTE 1L4FA 1N33B 1AZTA 1JDJA 3OZVA 1H1DA 1QHFA 4KGDA 4ROSA 5IJAA 1C5KA 5MN4A 3D3QA 3BJEA 5FEUA 3K5WA 3QLJA 1AO0A 2G1JA 3E9CA 3NTVA 4CLDA 2XB8A 1OKKA 3KXIA 3MCZA 3WLSA 3DT9A 1N1DA 4HB3A 2YWRA 1O5OA 1F60A 4GI5A 3IMCA 1QHSA 1NOIA 2QX6A 4B7UA 2PJZA 4CCYA 2IH5A 5CX4A 3OIFA 5K3AA 2AD5A 5HEKA 1TVCA 2GZ2A 3MWEB 2VYQA 3PQFA 4G2TA 4MWOA 4ENWA 1ECBA 4RVDA 3RS4A 2BONA 3GLHA 4LXUA 3ITNA 3W2HA 2WP8J 1DEOA 4P6VF 4PYJA 3VAYA 1E2BA 4AYTA 2D1QA 2ZJFA 4JSRA 4BU1A 4EI8A 4KN6A 4KOEC 3SSOA 2GXUA 2ZIXB 1MFZA 3E82A 4IS3A 2E4AA 3DXXA 1M83A 3FMIA 4INAA 4BTEA 3PYXA 1E9SA 4DMMA 3OWHA 1PKEA 3OPYI 1P4RA 4YP6A 1RABA 3DM5A 4CMAA 4ZPXA 4IW3B 4CKCA 4M1TA 3ELBA 2VH2A 3P94A 4HWKA 3F6EX 1QNLA 2EX0A 4WZAA 2F8SA 1JR4A 4A6EA 2AXQA 4TWBA 2JFGA 1X86B 5IFKA 4Y2QA 3DDSA 4IS2A 1JXAA 3SOPA 1UK9A 1CQJB 1U3FA 2QN8A 2JJQA 1V16A 5I01A 1CNFA 5J40A 3UB3A 4QELA 1KTVA 5BR8B 1EXMA 2X0JA 1FVOA 3V1TC 3ZU5A 4WN9B 3KWLA 1A8PA 1NNLA 1B26A 1JFLA 2QGNA 2XQFA 4PHCA 2WSLA 3TM5A 4ZK2A 3IVGA 3L8MA 5CG2A 2J0QA 1G6OA 2H1CA 2YFHA 3CZ4A 3PC3A 5AVSA 4I4TF 1T10A 3LFTA 2HWXA 3V9PA 1N7GA 1YAHA 2PRJA 2V7BA 4MUXA 1I5RA 1FJHA 1IVSA 1DCTA 4NCAA 2WJZB 3CINA 1EWVA 1BXGB 1QSGA 1YZLA 5M04A 3GUZA 3EZLA 2QRQA 4MYHA 4QUIA 3IQZA 3C5CA 5JG7A 1L4LA 5KNCD 3M6VA 1UINA 4GPEA 5AKZA 1Z82A 2ASEA 4P4UA 1DKLA 3L8DA 5F4BA 3HA7A 4CR8A 2QG6A 2ZB3A 1T35A 1EKXA 3KD3A 2Q6TA 4H15A 1B8UA 3SC2A 2B98A 2HLHA 1RAHA 3G2KA 1TVMA 3N6XA 4M9ZA 2IWRA 1QVRA 1Y7IA 2E4ZA 1R0BA 2JFVA 1KEKA 2UZ1B 3Q9UA 2JZCA 2Z56A 1G42A 4UUOA 2B4KA 3ABQB 4IAOA 5B1YA 2A14A 3DNPA 3UAZA 3HMQA 3HZRA 2OO5C 3AWDA 3IA7A 5J3JA 2JH8A 3HNPA 4LN1A 2VBCA 1O0CA 3GUCA 4PZAA 3ZQ6A 1YZKA 1CY1A 1PK9A 3KYCB 1PGPA 4Z3KA 3FOFC 3HJUA 2PMWB 3WIDA 1O96A 1NBOA 2KYRA 1BOOA 2WZDA 1E8DA 3NKVA 4OQZA 4JLDA 4PXYA 3RV3A 3FFBA 4B71A 1PWYE 1OGYA 2JBAA 2RHGB 2DUJA 3FUCA 4H1UA 1G2PA 1S7GA 4JBYA 2XMSA 4RDCA 5IVHA 4QOJA 4XWAA 3A9TA 4CWAA 4B3SB 2YJ5A 1U8YA 2RIPA 1N5RA 1LZKA 1Q50A 3A1FA 1CR6A 3ZD9A 2B8TA 5WRFA 4DMLA 4LF8B 2OBFA 2FOLA 2VAPA 2ZGVA 3BGIA 1T4CA 3FYCA 3JWJA 2V97A 5KQGA 4Z4FA 3FVWA 3WQBA 3H5NA 3RRNA 1BQ4A 3WMGA 3KSRA 4HTAA 2X6QA 3UJNA 5HKAA 4A6PA 4OFXA 1HLPA 3RAJA 5HIIA 3WGNA 1E61A 4CM5A 1VSQA 3PHHA 4LWQA 121PA 1S4MA 1DMSA 4GQIA 3FZEA 1U9JA 3VUEA 1SQGA 2DCUA 3NVMB 1PU2A 1OSNA 2XB4A 3GYBA 4RM3A 2PZFA 3CF0A 3TW6A 1V5GA 1GL3A 3TO5A 2FX2A 1FB5A 2UYQA 1NXPA 4LVNA 1WKCA 4O2AB 3Q8KA 4KUEA 5TVKA 3ZI0A 1NF8A 4TXLA 2A84A 2Q9CA 4FSXA 4H7DA 5D7NA 4RLFA 3KZKA 4FOSA 2JF0A 2I29A 3EGOA 3MWFA 4N01A 5CHEA 1G5IA 3PEFA 3SXUB 3ZX5A 1BMTA 3C14C 4PIVA 4UDYX 2QAGB 1TK3A 1YDHA 2GO1A 3O6VA 4JBWA 3ZQ4A 2H8KA 2J3HA 1QJ4A 2RFLA 3VQTA 3KJZA 3KIPA 3NHLA 4J6EA 4U7GA 2Z8YA 4ARZA 3B6MA 5B37A 3UCEA 1KBQA 5HS6A 5KCMA 2BM0A 3RS9A 2QQ5A 3EGIA 4R1OA 1NLMA 4LOKA 5FULA 2EHJA 1KSHA 4E1BA 1SU4A 3OWXA 5J1SB 2HZ7A 3C4QA 4L4XA 5AXDA 3QENA 5DJ5A 1EWKA 1GZ6A 2P0EA 2R5FA 4RV4A 5EERA 3PC7A 4LHZA 4J0DA 3RRFA 4BNKA 4BWVA 5ADUS 1A97A 2YVQA 3ZWQA 4FR5A 5J4LA 2IYXA 3HG7A 2YMLA 3ADKA 3N8DA 1JZSA 4HUQA 1KYWA 2VH5R 2YWGA 1H4VB 4MW7A 1YF3A 4PAMA 2JJ2D 4UM8B 4MR8B 1QFMA 1ODLA 1X7YB 1MC1A 2CBGA 3AIMA 3JPWA 4U8GA 2J0UB 1A5SB 1P7CA 2DU8A 4D3ZA 1L4HA 4FLMA 4YUVA 3WL4A 4BZXA 3WLJA 3WC4A 4ALJA 2OOSA 3LVRE 4UHHA 2FZKA 1SC6A 2QTHA 3K5IA 3QXHA 2XWSA 1AGPA 2PZKA 5LQKA 5K3DA 2DH6A 2JZNA 1RIIA 1HM5A 3G85A 4HAXA 4J07A 2ZAIA 4ZQEA 3D0QA 1HX7A 5B4UA 2A5LA 3A1UA 3L7AA 1OHHA 1ZNQO 3R7NA 1IJKA 5AVXA 4HH0A 4N54A 1UPBA 4FX5A 1V8OA 1PJ3A 1ND5A 2D5IA 1G5TA 4KLZA 4XB1A 3WOVA 2FVYA 1GGKA 3H83A 5H02A 2YIDA 4HLDA 2V5VA 1WD7A 2XMDA 5CFPA 5IC4A 1D5CA 3MW8A 4QPDA 5F1YA 1Y37A 1G5QA 3HNRA 1LTQA 1XQYA 1GR0A 4DTCA 3GF4A 5T4HA 1Z38A 1V7PC 3DXFA 4IOMA 3NWOA 4J3FA 2OHHA 3AR3A 4FDUA 4IDQA 3PPYA 3OPVA 1D8AA 4OBBA 4A0SA 1QV6A 1W8DA 1CUHA 1X1BA 2BHSA 2XWQA 1GGJA 4OLBA 2AMFA 4YJGB 1LBQA 4DV3B 1UMCA 3VO1A 1SUIA 3KEMA 3WBBA 1SPBS 4WKNA 5E7MA 5JO0A 2ID9A 2PKWA 1XVUA 2CJYA 4G8JA 3H0CA 5DN9A 3K70D 4LTNA 3WGKA 5K6AC 1VLVA 4GQBA 4AP9A 3JQ8A 2CYCA 3HFGA 2OV8A 5LYJF 5B1EA 4LKRA 1HKUA 5HIKA 3ZBTA 4CF7A 2GVDC 3E3NA 1ENYA 1QWSA 2O8BB 3OZDA 1O94D 4ZU1X 1TF2A 4DMHA 4NBWA 5KYWA 4PICA 1M1NB 3QOFA 1ZSNA 1SKBA 3SC4A 1TYAE 4B2YA 4YRBA 4C6HA 2R8YA 1ZSVA 4DLZA 1CPYA 4A1OA 1BKSB 2HLNA 1OH6A 3DC2A 5EWMB 1KJYA 1W85B 2AR9A 4XQ0A 1UBRS 1SUFA 2O05A 3FLAA 3FNHA 5JJLA 1VE6A 3E22A 3F47A 3R6TA 3F9IA 4WX2B 1NQOA 2OYRA 1Q3KA 4Y6RA 3GIWA 3VX4A 4AKHA 4CF3A 4R98A 3WGGA 4EYSA 2OK8A 5CVJA 2IYVA 3M5DA 4BE9A 3CQ9A 1HMPA 4FZ5A 1E64A 1ZVMA 2ZT6A 3EFEA 4L5IA 1YZHA 3TIIA 3ORQA 3WB0A 3RAFC 1KRHA 2PWYA 2AC4A 2FE1A 5CFZA 1JVSA 3PF8A 5LZ7A 4PG5A 4DDTA 5FTLA 4YDRA 3WK5A 1E59A 2YZ2A 3ILYA 4DXDA 4L28A 4QJ3A 3PQ5A 1LX7A 3DEAA 2O7NA 3TLGB 3AR8A 3U31A 4COOA 3ELYA 3A0RB 3B1ZA 3KHTA 4P4GA 4QU0A 3BAFA 5EE5B 4ZKDA 1P0FA 4M0CA 1NW3A 3M0EA 4KNYA 1OWMA 1L2TA 1UOEA 3C6XA 4UULA 4OFWA 3UK7A 3TEFA 1R8YA 2CK3D 4BMSA 2QUZA 5JCJD 1ULSA 3WL6A 2R6CA 2JB9A 4U2KA 1V4NA 4NZOA 3ZGOA 2MSLA 2UVPA 2FX3A 3HJBA 3FNQA 3W05A 1ZH6A 4GL4A 5IC6A 4RJTA 3FPCA 4ZMRA 3SZUA 1HK7A 1RJEA 4MXDA 3CH7A 2FWJA 4AG5A 3K2EA 3IDOA 1Z62A 3S6JA 5BUQA 1EFHA 3ZD8A 1I0LA 1TOAA 3MINA 2KI5A 3QXGA 4D97A 3QGMA 1C7RA 3BSSA 1J23A 2GPJA 4MB2A 1E96A 2B2NA 3ASUA 1H2XA 2VYVD 4HGQA 2H48A 4B46A 1MIOB 1K08A 4LIPD 2VJCA 1KIFA 3W7VA 4C29A 1LNSA 3BFPA 2ZYVX 3IEXA 2FZ5A 4D6XA 2CNNA 3RVOA 2J0SA 4TT3A 1DHTA 2HREA 2QS9A 4JJEA 2PKRA 1WUKS 3ANTA 3OUTA 2JLVA 1DG3A 5E8RA 2PLRA 4OA8A 2RGGA 1M2GA 4P7KA 5JARA 1G2IA 1S8FA 2VZ0A 3OLVA 4L27A 2IUUA 5JZ9A 3PCXA 3T5MA 5FR2A 3WGVA 1SQ0A 2XOXA 3IGFA 1NVGA 2GSWA 2XYHA 4GRAA 1EK2A 1IJEA 5HVNA 2WKQA 2YS6A 3I6IA 3NTOA 4DV6B 3WGIA 2OWEA 1T0BA 1JFRA 2BM8A 3DWGA 1AS3A 3OM1A 1PZFA 4BP8A 2GD1O 3OH8A 1NL3A 2GBGA 4EB8A 3WIOA 5IKEA 2ZRHA 3D8BA 3F1KA 4MYRA 4U8HA 4EYKA 1VGQA 5KNBD 1T5SA 2B30A 4ZV9A 3LXMA 3RASA 1I2AA 2CB0A 1QOZA 4V3BA 1ZH8A 4DRXA 5BWBA 4RAOA 3T7IA 2YWDA 4YLEA 1DSSG 1UUFA 4PC3A 4MR8A 1GQ2A 4Q3AA 3AI3A 4RCVA 1VPDA 2WF8A 2FYTA 4U7TB 4NCNA 4XSHA 1NI4A 1GTVA 2EWVA 2GT1A 3MQFA 4XDZA 3T9BA 2QUAA 1WKVA 2YH2A 3VR3A 3EDCA 4HTFB 3USCS 2FWMX 3IAM6 1WSWA 3DWFA 4D8TA 3HVRA 1BVYF 3I9FA 3WADA 2YHSA 3LZDA 1VB3A 2R7AA 2VP6A 1MTOA 2RB5A 2WTMA 1FPMA 3AJEA 3NM6B 3PGVA 4FGSA 4QOSA 1VP3A 1Y3CE 4PC2A 3PE6A 5I9MA 1OVMA 1JKFA 2GUGA 3L6UA 4QULA 1QS0A 5DE3A 4XQ9A 3GCZA 4JEUA 1E18A 1FP4B 3LHIA 3H1TA 1ZOLA 4AJPA 1P1JA 3NFYA 4HDAA 3ZCVA 4EJ0A 3GZTB 1NZJA 4X95A 5CTJA 2FK8A 2V58A 3NOXA 2EKBA 3OJEA 4AB1A 3B8HA 1E2PA 1D4ZA 1Z0AA 3VZPA 2E5LB 4NFLA 5EL0A 2B7CA 1DINA 5F51A 3CVXA 4AZSA 2XTMA 4BFXA 2FPSA 4JITA 4MB0A 4ZT4A 3V7YA 2N75A 1ULZA 2VHZA 4GICA 2XD4A 1XXHA 2NPFA 4B1FA 4LRYA 3FR7A 3H9JA 4KRGA 4G3XA 4EHIA 3GEPA 1R00A 2P1RA 3ZOZA 5JNWA 1RRCA 3ADDA 3CNOA 3K2BA 1H8HD 2D6FA 4PLPA 4C3VA 3KLOA 5JC8A 3U4MA 1CLEA 2PAFA 3GDOA 1OYYA 1C0KA 2UZ1A 3SEQA 1TC2A 1IM8A 1DVRA 4AC9A 3GRCA 5KYNA 3E8MA 1HQYE 5JSHA 1A82A 1C2TA 1GPDG 4JEIA 1ZD8A 5YASA 2QXUA 4XVRA 4B85A 2R79A 2VF7A 4D80A 1Z73A 3RQSA 3CNEA 4HDRA 2XT0A 1LH0A 4E5VA 4QX6A 1ZINA 1VJ5A 4CM8A 3KS9A 1L5SA 2GKSA 2VK1A 1VRWA 4MQ5A 3VVLA 2WQ6A 4MA4A 1TF5A 2CDAA 5A02A 2C7BA 4HX9A 3UMGA 2QTCA 2ZYTX 3GZNB 4HFMA 4NJMB 3W2GA 1I80A 5CPBA 5HQTA 4D9KA 1JYFA 1Y42X 1B43A 4KMRA 4ZVOA 1V7CA 4WOBA 2UUOA 3REOA 4FGJA 1INLA 3KZXA 4ZAWA 4LMBA 4ZEMA 5K3OA 3G0BA 3CH4B 4QWMA 2LD4A 1WUYA 4C5BA 2Y8EA 1X7DA 5BP7A 4DC0A 3M4YA 2VDVE 4GOMD 1YQDA 2IIPA 3AYXB 1TQ6A 3UW1A 2RMKA 2ZJBA 3K0FB 4LVOA 2JD1A 1J0CA 3GJ8A 4TYNA 5FYDA 4KWHA 4UBOA 1CQZA 5F33A 3SJCA 2AJDA 4I4LA 4RPHA 5JQGB 3KSUA 2N1MA 3SHOA 4DM7A 1AUPA 2CVOA 2PVSA 3OUUA 4KYUA 3ZWMA 3DP9A 3M6XA 3LA6A 1IZYA 3EGVA 1U9CA 4KNVA 4TXHA 1W4BA 5CGZA 5D8DA 2F48A 5TMPA 1R6VA 4WCFA 2IY9A 1ODJA 1A9ZA 1TJ5A 1JHMA 3PFFA 5H9VA 3JRXA 5K2MA 3PHGA 5ARDA 2H4HA 2VT3A 1USKA 2C2OA 1OPRA 2WTAA 4YTEA 4W5RA 3VC7A 2DHRA 1C3XA 2QD2A 3V2IA 4C0HA 4EY6A 2J3KA 3I12A 1MAVA 1TYEB 3E9RA 3HV0A 2KPOA 4JASB 4RQUA 2JBAB 4G5HA 4OKSA 3U3XA 3JYQA 3P71T 1A98A 3DBOB 1B42A 5CVEA 1NQVA 4JP1A 1G8SA 2FVXA 3ASVA 2ONKA 3V3KA 3WQQA 1PYDA 1VI2A 2X0FA 2IW3A 3U4CA 3ZN2A 1RXEA 3FSJX 5DNDA 1OFUA 1XRLA 1FDIA 3TGLA 4F84A 3FN4A 4B3RB 3EEBA 3N2ZB 4NULA 3UANA 3UUFA 1XQWA 2YYYA 5K3CA 5FCDA 1N6LA 2AIRA 2YWXA 4EJSA 3UGTA 2R6DA 2OPBA 3TKLA 2PEZA 4WEQA 4DDKA 3WA7A 4OHUA 3LI2A 3A6KA 1D2HA 4UAVA 2QI9C 3KSDO 1NC3A 3V8QA 1FQWA 4GZ3A 3CO5A 3PTLA 1CJMA 4I6JA 5H82A 4AMZA 4IKPA 4D81A 3V2HA 4TYMA 4DA8A 4TVOA 4EUSA 5K0SA 1P1RA 2WWVD 4ER5A 3T95A 4YAOA 3EQ2A 3KZ1E 3WJ2A 1A9TA 4G0YA 3ON5A 4Q37A 5HILA 2P9FA 1KR5A 3TNLA 5JYDA 1E0DA 1Z0KA 2O0HA 3RC2A 2OKCA 1OJLA 2EYUA 2WA1A 1XLWA 1C7QA 2Q3HA 4E31A 4LSGA 3I9KA 3PTAA 2J09A 1JKIA 3BFJA 2G36A 3N58A