3HY3A

Structure of human mthfs with 10-formyltetrahydrofolate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
198
structure length
196
Chain Sequence
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
total genus 67
structure length 196
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy3A00
1U3FA 1U3GA 3HY3A 3HY6A 1YDMA 2G40A 2JCBA 3HY4A 3HXTA 1WKCA 1SOUA 1SBQA
chains in the Genus database with same CATH superfamily
2GEDA 4R1TA 3HO1A 5LLSA 1YCHA 3U7RA 5HILA 4E2YA 2W2KA 3TAXA 1NBMD 1W30A 4OMDA 2ZVPX 2YINC 1FDOA 4F1KA 1WBJB 5CT8A 3WFZA 1OV6A 1YC5A 4IBOA 1K5DA 2ZT6A 4RPIA 4FE7A 4DILA 1CQZA 1F8FA 1NVVR 1U1CA 2PH7A 2YQZA 4OBEA 4Q15A 4Z9XA 1N0IA 4EB0A 1ZUHA 5E6UA 5EIWA 3JQCA 4CV2A 1Z26A 2R5FA 1LB1B 1ODKA 3TM4A 4MW5A 3MTEA 3C45A 3KKKA 1Y48E 1M5UA 4H16A 1PU2A 1XJCA 4IGKA 2HQBA 5KTMA 2ZJYA 5HX7A 5LL6P 3QI7A 4GLLA 1B2LA 2BKXA 1ODCA 1TU4A 2BEJA 4WADA 4E13A 3NM6B 2SCUA 4Q4JA 4II3A 4FC7A 4O8ZA 2P6RA 1JAYA 1Z0SA 3FPSA 3I05A 3OMWA 4GZLA 4WEOA 2G9VA 4LX8A 3UKJA 3H42B 3HYSA 1G20A 5EMNA 3KS9A 2E0IA 3D1LA 1Q19A 1E6WA 1C3OB 1K6EA 1MNQA 1VCOA 3ZD7A 2ACKA 2XZDA 3HR4A 2GZ2A 1PVVA 3OZDA 1R3DA 2V7VA 2BMAA 5KC9A 1N0UA 5C31A 3INYA 5C3UA 5B12A 4MQUA 4FFDA 5TLSA 3A1DA 3L0SA 3R9KA 1ZGGA 3V1UA 3DVRX 3LCJA 1P1BA 2RKOA 4GP6A 3QJYA 2WHYA 2I6GA 4WCFA 5AT1A 1WA5A 1PWHA 3R5XA 5AVKA 1I6WA 2FMTA 1NRWA 1M34B 1XHLA 1QHIA 3GFVA 5K09A 4WESB 4JXZA 4BB5A 5JQGB 5K3OA 1TEVA 1WCXA 2XNSA 1ZJZA 2E4UA 3GCDA 4IWXA 4NCNA 2AMFA 1BQ3A 4UE6A 5AMXA 4MO9A 1R4MB 3UGQA 1P1KA 2R8OA 1GHTA 4MIKA 5IMSA 3CSSA 1H3NA 3JQDA 5GMOA 3G6WA 3GAMA 3PTAA 3GFTA 1K7FB 1ZZGA 4OQEA 3SZOA 1W9HA 4KWCA 3LX4A 3X0DA 3QQ5A 1CJKC 2GXUA 4Q18A 4KCGA 3F47A 1GV1A 5E6RA 4AYXA 3ZV3A 3F9RA 1FOEB 2C4WA 2O0MA 3HZOA 3I23A 3KC2A 1R4NA 4G5XA 4C4YA 2X1MA 1HE3A 5NLLA 3O4JA 5FTJA 5JZ9A 3ZJVA 3TVYA 3O47A 3WO1A 4YR7A 2ATCA 2LNDA 4JEHA 4KTVE 4W1QA 4WK0B 3D0RA 3O8LA 4DV2B 2L42A 2BEWA 3GMSA 3PV0A 1DBRA 2NG1A 5D1HA 2YJGA 4ZT2A 2HFKA 5K3FA 4L74A 4JLKA 4LOKA 3I0MA 4JJEA 2QKYA 2QJTA 1TQ2A 5P8WA 2B1GA 1QFMA 1TIBA 3ESDA 3FUTA 4OJKA 3X43A 5K4HA 1TTQB 3ZLTA 5K0ZA 3HQ4O 3SR4A 3GQVA 5HZKA 2JHFA 2H08A 2QN1A 2VSNA 5GZ3A 4G5SA 2GD6A 2DY1A 9GPBA 3HR7A 3PLAE 1T0JB 1DZ3A 3ND8A 2JARA 3I9V6 2YC2C 4IVNA 2E5FA 1B6SA 1EX6A 2VPTA 4POOA 4XARA 3W5CA 3QUTA 5DASA 4F3CA 3EEBA 3KZXA 3MERA 4RJTA 1GQOA 1WMEA 2GD1O 4PNZA 3OQNA 2VNAA 3AP3A 3FYUA 4F3NA 3BFPA 3RNOA 1A8HA 2BP7A 1XU7A 3BC1A 2ORVA 2W2OA 2W58A 1V3TA 4YMIA 2B4KA 5DIZA 2JK0A 4N76A 1N8NA 4YRZA 2Y27A 4IINA 1HT0A 1LF0A 2WYOA 4MKIA 3DBIA 3MCZA 5TB5A 4BMOB 3RJMA 1WEHA 3DE6X 1TM5E 4GKVA 4MUKA 1BXRB 3VR4H 3GLGE 1A9YA 5ALGA 2X8AA 1FSPA 1NV9A 2PJRA 4DMUB 4OGWA 4WASA 5AUOB 5T6MA 1PTJA 2J9GA 3L8GA 4IZIA 2XX3A 2PMEA 3T38A 1D4AA 1NYLA 3KTAB 3PZBA 4ODIA 1DWUA 1SU7A 1XD9A 4D97A 1KEVA 4AMZA 3M6IA 2AN3A 3UUEA 2AOXA 5F76A 3M81A 1VE9A 3PDHA 4N65A 3JQGA 2VQFB 1D07A 1T8TA 2OL4A 2XQIA 2D5CA 3JAKA 4JJ7A 4Y8VA 4NLLA 1MJ5A 4YAUA 1JG1A 3RVNA 1U9JA 5JECA 4PS1A 4IF4A 5KTTA 4GYJA 4V1CI 4WERA 1N6KA 4UHFA 4G0YA 3T7EA 3JD0A 1AHNA 3NT4A 3ZTTA 4NX2A 3WYBA 1HDYA 1WD5A 2RBGA 2AEJA 1Q0UA 2MHCA 2XGSA 3EF1A 4IJVA 5KNDA 2FB9A 5H82A 5EZYF 4G23A 4EI8A 4ZKDA 1DEHA 2IYWA 1YZGA 1FFCA 2QP4A 3VPAA 5JE8A 2VNSA 3RASA 4I2NA 1A88A 1JMKC 3EDCA 3LUFA 2CSUA 3WK7A 4D9BA 3UICA 1TX4B 3Q3CA 1E3TA 2DT5A 3D8TA 1E2QA 2OXRA 1L5FA 3G2OA 3JWIA 1C8KA 3ZK9A 4BE7B 2IDJA 1WOMA 4G56A 5HOQA 3OPYB 1KEUA 4MWSA 1K6JA 2VLIA 4MJ3A 2CV0A 1N6LA 1U0FA 4W5RA 4EUFA 4CM6A 3RS3A 2FE1A 4IXTA 4I3GA 1H0RA 1M0EA 4DKXA 1E1MA 3BEDA 3HBLA 5CP8A 5A1TA 8ABPA 5AW6A 2VAPA 1G1AA 5BN3B 4MRRA 4V0OA 5JS7A 3VH4A 3QE4A 2D2IA 4FSXA 4ZK2A 1HKUA 1XWIA 2GI4A 3M6VA 1C8LA 4LWOA 1BU8A 3R7WA 3W1WA 4P98A 5BUCA 5JUWA 4XM0A 2ZAMA 1E5LA 3K53A 1VMAA 4BGUA 5SZJA 3HCCA 3SXUB 5HBRA 3PPXA 3Q98A 2BL4A 3D64A 4RMGA 2E4VA 2VSXA 4QQNA 2I91A 3DKRA 3GRCA 2QMUA 3SLKA 4DCOA 2A9VA 2NACA 2YL2A 2HCFA 3H83A 5CDUA 2XOXA 2AOUB 3WB1A 1U8XX 2WG2A 1WY7A 2PKQO 3LHIA 1E64A 3RKRA 2AZ4A 2PQMA 5ALHA 4IV0A 5K9ZA 4YS6A 2BFEB 3KG2A 3FF4A 2EJBA 3CZ5A 3N28A 1Z7BA 2DCUA 2Q6IA 1NW7A 4DV6B 4L73A 1HH4A 4FEGA 4JQOA 3ZWWA 3MTJA 4ETNA 3C6MA 4V0LA 1ISPA 1VBFA 2Y1LA 1PG5A 1RTTA 3WZ2A 1C4KA 1DIBA 2BM1A 3DDUA 4EYQA 1KRWA 1NR5A 3C48A 2M32A 3QE3A 5DNUA 1H2WA 2Z2YA 3VDQA 4BJ5A 3VH3A 4M53A 5EJ2A 1DEXA 2NSJA 2NYUA 4C2BA 3BUSA 1GR0A 1U7PA 1VXOA 3ON5A 4II2A 3ZLBA 4D3DA 2B7CA 1UZLA 2AKAB 3AGPA 3S55A 4EMTA 4B87A 5E1BA 1RAEA 4WINA 5CB4A 4W63A 2YNMA 1D4OA 3DB1A 4S1TA 3IKTA 5CAEA 5T3YA 1N2CA 4Q3BA 1ZW6A 3KYIB 2SECE 4ESHA 3QSYA 2FWBA 1KKLA 1D4FA 2G82A 4L4YA 3DHWC 1Z75A 3QJ5A 1E5TA 2QNBA 4BX8A 1K8YB 4PSUA 4BASA 2B3DA 3T94A 4JEUA 1YRHA 4YNBA 3TLXA 5C18A 4YASA 3VVLA 5D85A 3KQVA 4HB4A 3ABIA 1QUEA 1EE1A 1DQPA 1K7XB 2JD0A 1S7CA 3C98A 4HH1A 4PSCA 3BB4A 4QATA 2NUTA 4JT8A 1ADBA 1T6YA 4K1XA 3M5CA 4V0ME 5FHRA 1MTZA 1A9QA 3CNQS 2GHTA 2PUTA 1KYVA 1OXBB 3GJ6A 3TRKA 3GPDG 1XGKA 2VP0A 5ARBA 1HETA 1OC2A 1PFKA 5KWEA 2HKIA 2NU9A 2PZBA 4D9FA 3VH1A 1CDDA 5IG2A 1O8CA 3EVZA 3K2QA 2XB8A 1MC4A 1YKGA 2A4MA 4HTFA 4BX3A 3I9OA 2CMFA 1P8JA 1C3OA 3QFCA 1YR2A 3K1JA 4TVBA 4AWAA 3FOZA 1D8AA 3KDPA 2PGLA 4YUVA 3JASA 2XA9A 4BKQA 3FPCA 1TC2A 2HI0A 3HB0A 3WRYC 4DLKA 2G07A 4ER5A 1RHMA 3EXEA 2QQ5A 3EZYA 4KQKA 3VR6H 3L7MA 4WFIA 2ET6A 2OAGA 3KQOA 4QLOA 1ZKDA 3EDOA 5E6SA 1N6HA 3L41A 3DBHB 2MSLA 1S3FA 2YVAA 3EW9A 4QICA 5T8KC 3FWHA 3VZPA 5DMXA 3G1WA 4PCAA 4Q4HA 5TXGA 2M6KA 3G8DA 4AZVA 5TPZD 3HADA 2Z95A 1YOVB 1RADA 2QD1A 4BHTA 1ADCA 4YXWD 1GA1A 2AX4A 3AESA 1HE8B 3MTGA 1BROA 1J70A 1DXQA 1ML4A 2ON6A 3NHUA 3F3KA 4EMUA 1PR1A 4E11A 1WIWA 4UBJA 2WTBA 2EZ9A 5IM4F 1RSZA 2E5WA 3DS8A 1BX1A 5DJ5A 3PPVA 3HKEB 2XRMA 4ZVRA 3NWJA 1M6VA 5PNTA 4I3FA 4R2MA 4LRWA 2JGAA 5AXDA 1G291 1P7YA 5ALRA 3WTCA 2B1JA 4MI1A 1EWVA 1GZUA 4JI2B 1CUYA 3CEJA 1KVUA 2GSWA 3AVTA 3IO5A 3AU8A 1UMCB 2WRZA 1GCGA 1V8PA 2CJWB 3S1AA 2V7UA 5C7IO 3CJRA 5DRTA 1PL0A 1N2SA 3KVYA 5KNCH 4YMHA 2KI5A 2BR5A 2IHKA 3KJZA 4TS1A 3K0FB 1VG9B 1LW7A 1VPDA 2O59A 3EGEA 4C2AA 3WGIA 1V7QA 1KDPA 2WUEA 1DC4A 2IYUA 3HJNA 3M3HA 2ZJZA 3FZEA 1TEXA 3SFTA 1U0EA 2JNWA 5EAIA 4EJ6A 4DMKA 3LG2A 5BSRA 4AUNA 4MIEA 4ZAFA 1EBUA 1TI7A 2Q3JA 2IBMA 3ZR4B 4ZVUA 3CU5A 2WAXA 1GPJA 3LTNC 4AJKA 2KMLA 2DKOA 4CIBA 4BU0A 4WBSA 2Z6QA 5KTNA 1E79D 4O2BA 3OQVA 2OLEA 2XT0A 3AKZA 3URKA 1KBZA 1QQBA 3GLFE 1AT1A 5FBVB 1DJMA 5AW0A 3A6DA 4NI5A 2FEMA 4LJLA 4YLGA 5TJ9A 3S2SA 1FDRA 1BEUB 4KFRA 2DKFA 1WF6A 4LYYA 4P5DA 5TMEA 5KVSA 4BO6A 1JR2A 1Y9EA 1R0CA 2EKLA 3AGQA 2ATIA 3C3AA 4KLNA 4J2HA 1QCYA 4R1UA 3V1MA 2FDCA 2B2XA 1CS0A 1UDAA 1VCNA 1J42A 3QG5A 4CUKA 3T1YB 3FPHA 2I34A 3CUYA 3CF4G 3IHTA 1C1HA 1CIVA 1UIRA 2EFDB 3ABOB 1T2EA 4UHDA 4YQEA 4RL6A 2OUIA 4DG8A 4O4LF 4TVSA 4ZAGA 4PO9A 1IVYA 1JKJB 1U8ZA 4IIGA 3MILA 4R1LA 4QPNA 3WG9A 4DS3A 1QP7A 4MDFA 1XNQB 1PV1A 4UHHA 2DUWA 1QLJA 3A6KA 1GRQA 3M5PA 1L1RA 4JBGA 4KSYA 4KACA 4CWAA 2Z2IA 3SSMA 2G80A 2I7XA 3OZUA 4IKEA 1RM0A 3JAKB 2Y1XA 1F2VA 2PR7A 3F6CA 3VVMA 4W5WA 3DKKA 5HE9A 2ZYVX 1EAMA 4QGSA 3HKDB 1ZSNA 5JANA 4GPBA 2Q9BA 4RXTA 3UB2A 4YAGA 1V1MA 1W49A 3SE7A 4B3CA 4F0JA 3ZVNA 4OQMA 3I6MA 1GGNA 1MO5A 2D5BA 4DSTA 2WWFA 1A8PA 2ZJ3A 5C7YA 4NF2A 4CLRB 1LPOA 4BNKA 4G0VA 5DX8A 4YJFB 2NXEA 1DC3A 2HNBA 2DG2A 1G21A 3QOXA 3QEMA 2X58A 3T5BA 4H7PA 4MTLA 3WYFA 4DLVA 1YRBA 5DNVA 3TCKA 3BXGA 2CJYA 4XDGA 2I6XA 3AONB 3ITKA 1N6RA 3AK4A 4R3UC 4TMZA 4ZT4A 5F7XA 3LQFA 4V24A 3UAWA 5BRAA 1U5BA 1C7ZA 1T36A 2L2QA 3JVDA 5LZ8A 5CA1F 3QLVA 1OFUA 1YO6A 4JVOA 1KSFX 5KOHA 4H7EA 4X71A 1HPLA 3WRXA 5K0GA 1KQPA 1WVMA 3LNTA 2ZI5A 2V45A 5B7NA 3CKLA 1F0YA 2H6EA 3UYLA 2IEGA 3MRXA 2WSSA 1T2NA 1RQGA 3AOEA 4CM4A 5A4KA 2AZMA 1GARA 3U39A 9LDBA 4KDFA 2NP6A 3PGLA 5IWCA 3QLTA 4PHHA 3TK1A 2JLBA 3IBFA 2Q0XA 3R7WB 2NVOA 4R6WA 2ZR8A 5JXGA 2AYZA 4CDGA 1RJEA 4ZWNA 2JGMA 5L7TA 2VDOB 4BN0A 3UZUA 3W8FA 5D3ZA 3OZEA 5LBIA 4DCCA 3EASA 3EWSA 4PFQA 1OLSA 1KXZA 1MA3A 2FPGB 4KRXA 2HYDA 1IHYA 2O7QA 1QDLB 1CFJA 3G3EA 1A5SB 4MZDA 4Y1GA 1V35A 1TYAE 1Q16A 2C4UA 3GARA 3MQ2A 3PWZA 4YJKA 4XYGA 5A5EA 4U9UA 3RKSA 1P6UA 5J4VA 5JAHA 2BJHA 2PKXA 2NT4A 5FOUA 2YN4A 1X1AA 3A1VA 3EIUA 4XM1A 3K96A 4M8NE 4BVEA 4CEJA 2PH5A 1DMSA 3K0CA 1W2WB 4UTZA 5KYVA 3P0FA 2GB4A 3ETEA 4IHJA 2BH2A 1M2NA 1BEZA 2R65A 4X5OA 1RZ3A 3EXFA 1AHPA 1A2QA 4ZAXA 1SHLA 2GO1A 5HF5A 3ZHCA 2IWRA 5AJVB 1KQOA 9ABPA 4XCXA 2WIDA 1TXGA 2BOVA 3LO5A 3OICA 1JJ7A 4H0CA 3BDAA 3C4QA 4PF1A 4PQRA 3D0QA 3TRIA 3CFYA 1ZZEA 2AQ8A 3UN1A 3QP9A 2Q7XA 2AHRA 2XH8A 1RVDA 4AWBA 5IHXA 3DZGA 1PGPA 3QU2A 2D62A 3OEHD 5CT5A 5CYGA 3P20A 4JP1A 2R7LA 3SHOA 1SFRA 4QOIA 5ERYA 2HSWA 2IZ5A 3PCRB 4G6ZA 4XD7D 3S6JA 4DZZA 2EARA 3F7TA 1UC9A 1RLIA 4FJ0A 4OQ4A 2HEIA 3HKCB 4MXDA 4RBNA 2E89A 4HADA 4PFKA 3FKSA 1W88B 3W77A 4X44A 4Y2RA 1P73A 2ZYSA 1E1DA 5EWMA 1ZCJA 1ZI9A 5H16A 2ZI7A 2BJWA 2FXVA 4W5JA 5AQ1A 3QX9A 4NV1A 2XUIA 5LQUA 1O08A 2CHGA 3EVAA 4LC9A 1TD1A 4KFUA 3W4JA 2IYYA 1XV5A 2B4AA 1DIGA 4MS3B 2VDKB 3DM9B 1RD4A 1FP1D 3G85A 4MQBA 1Q0QA 5C32A 1NLFA 1QO9A 421PA 4NAVA 1G2IA 3OOYA 5E8RA 3MGGA 4R9NA 4LK2A 1DV1A 4A8HA 2P67A 1SC3A 1TJ4A 4UPDA 1AGYA 1NHWA 2E6KA 4JS0A 4MAFA 3RSSA 3ZN2A 3SKVA 2VK4A 3I92A 2GNAA 4P5PA 1Z08A 4CMEC 5HCNA 2KB0A 3F0TA 4CMIB 1W5FA 1OH6A 2YASA 2WM3A 4IJMA 3JASB 3CC8A 1F6DA 3EMVA 1XDSA 3QVTA 1XJQA 1Z4IA 2I03A 1I7SB 1M7HA 3NBYC 4E6EA 2ICAA 5BMVA 3UOWA 4HK4A 3TW8B 3PUWA 3E7WA 3NRCA 3GLFB 1H22A 2QVXX 1OYVA 3AOGA 3KQYA 1YS9A 3H5AA 3L1IA 3CBQA 3GHYA 4PR0A 1XD2A 1OE0A 2J7PA 2Y66A 3K8ZA 7REQA 1KETA 3G68A 3V1LA 4FJ2A 3CLRD 3OPXA 1U0LA 5P21A 4EAQA 2HUNA 2B3TA 4UAVA 1E2LA 3H2IA 3PB3A 1H65A 4Q21A 2BSQA 4WOBA 2VHZA 3AESB 4FYVA 1Y4AE 1FNMA 1QTRA 4MYTA 1EBFA 3LTEA 2D7DA 5ESWA 1P5HA 3DAPA 4I8DA 3I64A 1DC6A 3AKEA 5FP0A 3RAGA 1QE5A 2WJ3A 2XDWA 3A36A 2QX7A 5FUVA 4CN8A 3C7CB 1XD8A 4RIEA 3JALB 3U7QB 2Z5FA 2Q6KA 1IJEA 1ZK0A 3MCTA 1BOFA 1LWNA 3R5SA 1T10A 2YWEA 1DKPA 4ISCA 4Y3UA 4EARA 4EITA 4L3WA 1PO7A 1FF9A 1S2NA 1WU7A 2ZR9A 4MP8A 2WWGA 4BIIA 1E3WB 2ZRNA 2WT9A 5BNZA 2E1RA 2XHZA 3Q9NA 1MPTA 8GPBA 3IPCA 3B85A 4BVLA 5IYZF 4L8VA 2FFQA 3BD8A 3EFOA 1XVVA 5LCXA 2AN4A 3WO0A 4IJKA 1C2TA 1BOOA 3KU1A 1VECA 3FA2A 1EFPA 3G0BA 1L9XA 3HU3A 2FEOA 3KYCB 4UMFA 1O95C 3CLUD 3GJSA 1DVRA 3QM1A 1NKSA 3OSUA 1PEYA 1E9FA 4FEAA 3T35A 3ZBTA 4BZZA 3C0KA 3DB2A 3AB3A 2JGDA 2UAGA 1IIRA 3AUJB 3PNSA 4NR0A 3KPJA 2PUFA 4NMWA 3T5MA 1G5RA 3OFND 4G5HA 2ZG6A 1ZINA 4EG0A 2EV9A 2W2QA 1C9EA 3EHEA 3GUUA 5I8ZA 1GGKA 1THMA 2RC5A 4O1IA 3WGJA 4ER0A 1F48A 5IT5A 1PGOA 2DM6A 3BL8A 2GJAA 3LIIA 2Y1GA 2J5XA 5C5CA 1PEDA 4WY2A 3U4QB 1A8QA 1IZ8A 1XEWX 4U6SA 2G0NA 2WU8A 4OU5A 1XQVA 1L1EA 1Y3HA 2JIPA 4JI0B 1DJNA 2OD9A 3H6HA 4HNAA 3NYWA 4JASB 1Z3IX 4LQDA 3W3AA 1IWOA 1EMDA 2EKDA 1UDRA 3DTVD 1N7JA 5K0CA 1QTQA 4HAZA 1T9HA 4ZEXA 4Z9AA 1K5PA 1XMVA 3BTOA 4OQLA 3VKWA 4KXVA 3R4CA 2OYSA 2P78A 1JKJA 4QGGA 4URWR 2B0CA 2VF4X 2JVKA 1QO0A 4IH4A 2ZJ6A 2CXXA 5HUJA 3C7DB 3MGBA 3LA6A 3GJYA 3UVEA 4TYYA 4R7GA 4Y7CA 3W5IA 3T34A 3V4FA 4C0HA 2EJUA 4PC1A 3IBTA 3EUFA 1KZHA 4HEHA 1WDTA 4DSZA 1G20B 5B3JA 3ZWYA 1L5HB 1SVUA 2NPIA 4RLQA 4F3RA 2V7QD 5BSHA 3UPUA 1RJWA 4OP1A 4AULA 4E5DA 4MQLA 2EG5A 4UOEA 2UUBB 4AZTA 1O96B 5CVCA 4I8XA 2O0LA 1VP3A 1IJKA 1L8LA 4YV0A 1R0XA 1QFYA 2EXXA 2PL9A 4HQRA 3T9EA 2VDLB 1QFJA 5GZ1A 5JO0A 2I3AA 2H1HA 3CVYA 3PHJA 3FX2A 3SQDA 5HKKA 3OEHA 3FHCB 4YJHB 1XXLA 3KFXA 2O8CA 1U5BB 5FUBA 4P0QB 2RI0A 3R6GA 5D3MB 3GW8A 3K3PA 4AJNA 4YO7A 3OLXA 4ZEVA 4IMPA 5LQAA 4BQFA 3UBTA 1I7LA 1FE8A 3FNEA 2QX8A 1P4SA 1KBQA 1YR1A 1GNRA 2FH5B 1Z35A 2VQ6A 5AVXA 2XBLA 1WL8A 1NI4A 3DZHA 1O95A 1X8LA 2EWVA 1M1UA 2FX3A 2QJRA 3OEED 3L93A 2RBEA 4P86A 4PG7A 4UTOA 1GPH1 2R96A 2EP8A 1YQWA 1SURA 3M4JA 2V9PA 3DE3X 4L2IB 1V1MB 5HIIA 3SX0A 1HSOA 1OTHA 2VWQA 4TTPA 3NDRA 3IDZA 4D74A 5CA0B 5MN5A 3FZYA 3TKAA 8LDHA 2VG8A 4MKXA 2AN5A 2FW6A 4LC1A 2G4VA 2W22A 4EPYA 1A9RA 4YJ3B 1QAOA 1S3SA 1UM9A 3BSSA 3BMOB 4ZICA 4I8IA 1A97A 2Q45A 2NYRA 3AY0A 4K9SA 3FMFA 1R6AA 2PMBA 3GLIE 1AB6A 2J85A 2PT6A 4NBKA 5C35A 2UXBB 2Y68A 2FWMX 3UF0A 1U1EA 4H4EA 4LRUA 4DAOA 2X6TA 5A9SA 3M1IA 3VNRA 3U7JA 4OA5A 1BWSA 1H4SA 4TMTA 3A05A 4GZ5A 3ZU4A 2AG8A 1UBJS 4GPZA 3THRA 4RELA 5BT9A 1AQNA 4BC1A 4R1PA 4CCWA 1KK0A 3B8EA 2AHOA 3BXEA 3PC4A 4L9WA 4YYEA 2Y1KA 2OZPA 3C14C 3H5NA 4Z1MA 5DLYA 5EHIA 4RORA 4A0RA 1GUYA 3F98A 1MVOA 2N1BA 1RE0A 1IU9A 3WX0A 5MGBA 3PP8A 1TPYA 4LZNA 4J75A 2GN1A 1R12A 2HPAA 4IEIA 1WCWA 2Z2ZA 1BD4A 3OF2A 4U7HA 2CJXA 3QPAA 4JNCA 5AI6A 5AVUA 1SM4A 1H23A 2R60A 3L8ZA 5F21A 5ILOA 1ZD4A 1WUJS 2GYYA 1A27A 1KPIA 2QZPA 4ALIA 1OROA 1AS3A 3H9QA 1RQNA 4IEFB 4UOQA 5E7MA 2ZTMA 3C6QA 1K7SN 2O2YA 1D9ZA 1G55A 1IBRA 2G7MC 3KUCA 4I9NA 5JR3A 1ZRMA 3X1KA 4MV4A 4P4SB 3VGJA 1ECPA 1LUAA 4RNDB 1GPBA 3FKQA 3IHLA 3ZUPA 5EJFA 3Q2KA 4EGJA 2W6NA 5GVRA 1CPYA 2R1ZA 1QTIA 2A84A 3OOHA 3DJYA 2V9CA 4WNCA 5C4MA 5K2OA 3CYFA 1JYFA 1Z0IA 3UYKA 5KQLA 2PBZA 2ZYTX 5ESRA 4JYBA 2HQSA 3PXBA 1U31A 1W0CA 2ZSUA 3O1IC 3QA3E 4MUXA 5F1KA 3T5DA 3VAZA 1IXZA 1LTKA 3WQRA 4UVIA 4AXXA 3FHJA 1SCUB 2NQ2C 4A6EA 4AC9A 4XIFA 2AA3A 1IL0A 2APJA 4MYSA 3MGKA 1P3Y1 3CUWA 2I3BA 1YCFA 2IXFA 3GUHA 4TS4A 5B2ZA 4IVQA 3WK8A 3QF4B 5A5FA 3E0XA 1A50B 3A4YA 4OBXA 3FF1A 3TW8A 3CRMA 4BPBA 4HB0A 4TZTA 1A76A 2WZCA 1EUDA 3HKCA 2VRBA 4X62B 4D0RA 3CCFA 1U3UA 4G1MB 1W88A 4CF4A 3QELB 5LU8A 2AXPA 2PKQP 3GEHA 2C4KA 3BAZA 3ND9A 3JD1A 3AWDA 3OCUA 4UNNA 2WK1A 1RWBA 3CRVA 5ALDA 1XIVA 3GRKA 1XTBA 3ZWVA 1CP3A 1ZNZA 2RGBA 4TL7A 4BNYA 1IY2A 2Q3CA 3FGNA 3PX2A 4QXPA 5IC4A 4O4JB 2OVBA 2H1RA 2OQIA 1U2PA 3MGCA 4UXIA 5D7NA 4DA9A 4M0FA 4BMNA 1BMQA 1YFJA 1FNBA 1GGMA 2J87A 2V4ZA 3DKPA 3K15A 3N6RA 4I55B 1UJNA 1W52X 3EAFA 3HA3A 1XVUA 4WH0A 1LF5A 3FSEA 1YWGO 3C4JA 2GM4A 1ZN8A 2OHVA 5LOVA 2Z04A 1T5IA 3KXPA 3WLMA 1IB6A 2PS0A 1Y1PA 2AN1A 1B3BA 2XJ4A 3H2ZA 4LK3A 3RK0A 1P1IA 2CNKA 3IQWA 4FCVA 1B6TA 1ZIPA 2B4YA 3AQIA 2JFYA 3TWOA 2WV9A 4HMQA 1ZK2A 1K4MA 1G8GA 2B69A 1NMEA 2RHOA 1AKUA 1ENPA 2YOGA 4M0EA 4TT3D 4ZCLA 3W06A 3ZZMA 3O7MA 2PX6A 5EZ6B 1ECBA 1K89A 2Z3WA 4NV3A 3MVEA 1IG3A 5CYFA 4ZAWA 3MN1A 3V2IA 3AV3A 3FPBA 3PT5A 4LFBB 1BH6A 3GLGA 4LAFA 1GSIA 1C3VA 5CX4A 5I4BA 5HKKD 4O2AF 5YASA 2D06A 2IYEA 1AQ6A 3GJ8A 1ZH2A 1ZNQO 1C1DB 2Z2JA 3CLSD 4KXFB 3DVQX 4UNQA 4EYGA 1NUSA 3LHKA 3N2ZB 2O3UA 4PLZA 1O4WA 1ZI8A 2JGKA 3FSGA 3AUXA 3CX7A 2JGLA 3ISVA 2XE4A 4J9UE 4L50A 2HCJB 4CKYA 1EVZA 3EA4A 3ZNOA 3ZGZA 5CVVA 4YK7A 1ZESA 3U0VA 4LHZA 1L8AA 1QRAA 2VT3A 4HFRA 4RHTA 4XA8A 2JASA 3ZS9A 4KR2A 2BBOA 5I5GA 1A5AB 1R8JA 5FBKA 1EP2B 2FFHA 4RTQA 1E2DA 1YRWA 1MH1A 3E7FA 3UMGA 1HEIA 2BTQA 1L1FA 1ZY2A 1CETA 3RG8A 3GLSA 2I71A 1TM7E 4G2TA 1FJ2A 2VTDA 3NG1A 4PZCA 2YZ7A 5DK4A 5DOZA 2UZ4A 1HLDA 4C29A 5JH7F 2X9VA 2WZQA 4C01A 4ZHQF 3DMYA 4QHSA 3PYMA 1Q0PA 1QZTA 1ISGA 1DXYA 1NASA 3BORA 1OSNA 2IF0A 3N2IA 3FVWA 2PLNA 5IAKA 1KEKA 4J0GA 2J3KA 3PDIA 1VXRA 3QOYA 1A72A 1EXVA 3A4NA 4I99A 2EYQA 3ENKA 2I2CA 1KSJA 5JY1A 1NNUA 4PQYA 3GVPA 3L5KA 2AOTA 1AKYA 3E81A 1BS9A 2WIJA 2JATA 3OLCX 5K4AA 1LI4A 4BQOA 2OGZA 1QC5B 5E2BA 3U56A 1QOQB 1EINA 4GXTA 4HTFB 1J2YA 3ICOA 3TRHA 2F64A 3ZNQA 3ECSA 4F46A 3SQLA 4Z7NB 1D2HA 2DFPA 3ZC3A 2ZSEA 5KPDA 3HCRA 2BAGA 2C3PA 2WP8J 5IUKC 5A0TA 5KNDH 1XLVA 2FEAA 2QX9A 3L0YA 3OOJA 3R3JA 1D6JA 4G36A 4L8YA 2MSDB 4B9EA 5KKCA 3I52A 4GSLA 4QELA 3NTQA 4I1UA 2IUEA 4PAGA 1PR4A 2WTNA 5KX5A 5AWFC 4AD8A 1E9CA 4P0PB 4G8BA 1QQ5A 2Y92A 3ROTA 3DFZA 1KPGA 3HBJA 3WK5A 2O3TA 1VE7A 2QLBA 3WLSA 2JZOA 2GQ0A 5FI3A 3UWKA 1ZLYA 2XMBA 3IR6A 1TW2A 3ZZTA 2UZAA 3QWHA 4OHWA 1YS1X 3KDSE 4EFNA 4JLBA 2I54A 3PQ8A 1B00A 1ECCA 1XTIA 3P9RA 1AZLA 1CRZA 1SOAA 3LC7O 3NBZC 3PC6A 3QYJA 4LBZA 4MHSA 2BIFA 5A3QA 2QD4A 4YROA 4EY8A 3WBKA 2RGXA 4QVGA 3HXOA 4MR9B 2J6CA 5AM1A 1H6CA 2ODAA 3LH5A 1KGSA 3Q7TA 3UJHA 4PNEA 1ICEA 4YRDA 1RCTE 4K9DA 2WKPA 1E96A 1CP2A 3QVSA 1PGJA 4L95C 4M46A 4YMGA 3VPHA 4NCIA 1UWLA 4PPQA 5E0KB 5L40A 4ND8A 3C6XA 3ONEA 3QBEA 4U2DA 3WL7A 4CLXA 1JIJA 4JL6A 4CYMA 4A0SA 2J31A 4S2UA 1NJ8A 1UM9B 2I6UA 2XI4A 2ZB4A 3LYHA 5F35A 4R0MA 2NNWB 1MVLA 5CIWA 3SHTA 4BFWA 4B80A 3CURA 1BQEA 3P0HA 5CK5A 1RLJA 4TLDA 3NDPA 2GCOB 4MRMA 4URHA 4M0LA 2XRFA 2FQXA 3K0SA 1JLKA 3EH1A 3NDIA 3GLRA 1CZKA 1NBHA 4QXOA 1CUUA 1TT7A 4MVJI 4R1MA 1HYEA 2OV4A 3PDJA 3T9FA 4EECA 1K9VF 3LT0A 1I30A 1SHUX 5D3MA 5LP1A 2F43B 2FFAA 4YCNA 3A4IA 2FOIA 1XB2A 1MB3A 4MWDA 5B7QA 5JC1A 1RQRA 1HSZA 2MT9A 3H19A 3IVAA 2QL5A 3W2FA 4E94A 4IR7A 4IH1A 3N5CA 1X74A 4LY6A 3W2GA 1S8AA 1TA0A 3CH7A 5IJAA 1Y3AA 2QL9A 2Y76A 2Z4RA 1C9YA 1YZYA 3GRFA 4LYAA 3BCHA 1GZHB 2J4CA 1GAQA 2MU1A 4XEUA 4REQA 3IXQA 4FYHA 1T2VA 4ITUA 3TW0A 2A5LA 1JHMA 2FEXA 5SYNA 1PV4A 4OHZA 5J58A 2DQSA 3SBXA 5BR8B 2ZZMA 1U1FA 4GR4A 1QK4A 2HRRA 3IYLW 4CBVA 4IUDS 2P40A 2Q9AA 2BSAA 1TAUA 4KVFA 1OFVA 5EPEA 3B48A 4B85A 1J2RA 3D6TB 5BSTA 4Y6LA 2G6TA 3KR9A 4K8OA 1FTGA 4OMUA 2X4LA 1X3LA 2XEDA 1NVMB 2NGRA 2YW9A 1SQ6A 3IMFA 5DWQA 3SJ7A 5IKPA 4BRZA 3NHFA 1E32A 1G7CA 5DBIA 3VZQA 1U65A 3EGDA 4H0FA 3BAFA 2IY8A 2XUAA 4P33A 1E9BA 1GTMA 3AUAA 1YVDA 2WSLA 4CQMA 2XJ9A 1H1LB 4B2IA 4F4DA 1YFKA 1DBWA 4LWPA 4QYSA 1Y4ZA 2Q28A 3FW1A 3K2BA 3H0CA 5FBHA 3OZIA 3REOA 3RIXA 2EGUA 4RA6A 3D4OA 3I2FA 3LCMA 1JILA 5BNFA 2YVQA 5JZVA 1U63A 2QTGA 3FHOA 3HR8A 2QRJA 4E07A 1DS6A 1G20E 3IQDB 1H2BA 1JLLA 3LP5A 2X0RA 4IH9A 5J63A 1E7RA 3SVTA 3IA2A 2QDKA 4LYFA 5CK4A 3BD6A 4HF7A 3Q9SA 4BVJA 1C41A 2P9JA 2CHQA 1LK0A 1DB3A 1N2GA 3MS7A 4A27A 1CVLA 1NVBA 4B3DA 2V0NA 2Z3ZA 3K9HA 2C9MA 1O6CA 1ULBA 1F6WA 2BV3A 1QFSA 2FN4A 1QIMA 1Y6RA 3HDQA 2ZYHA 4Q9IA 1N6NA 3UXEA 2ZJ7A 4LCBA 3WHLA 2CJPA 5AXCA 5L3RA 5K01A 3GRAA 3FDXA 1O97D 5CCEA 4J7XA 2L17A 3O91A 1T8WA 4FR2A 1HBJA 1HT3A 5C4GB 1RJ9B 3A9UA 3H2KA 2ZI4A 1DKMA 1TVCA 3CEAA 3DWEX 1L5SA 1C7IA 4GI1A 2AYXA 5GIPE 2BHSA 1OZGA 3A26A 4RIIA 1XN1A 4WGGA 3PQ7A 1Y5LA 3LAWA 4D46A 2J0UA 1I3LA 5EUCA 1S1CA 2R44A 2BKEA 5AJWA 1ZIOA 5LDGA 5DOVA 1DQSA 3H5IA 5B1SA 4DYVA 4RULA 4CHTA 4OLBA 2AVNA 5AUNB 4ND1A 3UFXB 4JLJA 3GUYA 3L7JA 4CMBA 3FR7A 4ZQCB 2OGUA 2B7LA 2A5DA 4Y9TA 4DZRA 1RW4A 1SVIA 5BRJA 2XQGA 5JW6A 5EIOA 4P4LA 2Y0BA 1YDWA 2F6RA 4O02B 4KL8S 4A5SA 3L3BA 1H0SA 3BD7A 4NMXB 4HFJA 3Q15C 4TTRA 4CT4B 1NDQA 3IE1A 2BTEA 4IRUB 2AW5A 3SF8B 3HO6A 1FFBA 1TZJA 3K5PA 4FFRA 1APBA 5H3HA 3DUWA 1KBOA 4LF5B 4DB4A 1HQKA 3ZX4A 6Q21A 5JFGA 1ETHA 1ODSA 1ZXXA 3LLMA 2BR3A 1DG1G 4XDZA 1JAHA 1F1JA 1L8QA 3AMVA 4I36A 4BOYA 5JDIC 3TQTA 1U0RA 2OXTA 3SKYA 3IBCA 2QGNA 2QSZA 2VHUA 2X8BA 2C2YA 2QG6A 3A9VA 3LPLA 4OQQA 1GA6A 5FPQA 1NPDA 1CNFA 3INTA 3IEMA 1W5BA 2WJ4A 4AZ0A 3OQOA 2OGWA 2EEPA 2QMEA 4BUJA 2F59A 1J9EA 1GVNB 2HRCA 2FW9A 3FTQA 3EY4A 5C1PA 4MDEA 3A0UA 2I8AA 3B6ZA 2RJOA 1UK6A 3K0BA 2ERCA 3LK6A 2NVUA 2QPAA 1UBLS 4Y9DA 3WGQA 4FOPA 4AS3A 2RAPA 3ELUA 1NPYA 2XCQA 1CUSA 4K2AA 3R7NA 4XWGA 2J3JA 3CF2A 3I0NA 1K97A 4GWKA 5LC1A 4BC0A 4Y6SA 3WIEA 4F7DA 3DVAB 1XSEA 4BZQA 4ENQA 2OWEA 5KTPA 1M66A 3SBDA 1M2VA 3V00A 5CDHA 1Z38A 2W6OA 1SCIA 3KTDA 1NN5A 1A9PA 3LZDA 1JIQA 2F4VB 1UXIA 3BGWA 1QGAA 2G9NA 1V8DA 2IJGX 3U1TA 4DJFC 3D3JA 2EW8A 1E6LA 2WG0A 2NLOA 5IASA 2P1RA 3OURA 1U1IA 3NPAA 2H4HA 2BC9A 4HWTA 2P9YA 5JXWA 4JFAA 1A04A 3ZDXB 2I66A 3KDAA 2X8JB 3DWGA 3LT1A 5KJ6A 1JT2A 1X7XB 3A58B 3FUUA 1P62B 1SXPA 1IZ7A 1HK7A 1RKVA 2XMGA 3U81A 1V6CA 2CFSA 2ZQ5A 4HQLA 3FTDA 1LD3A 1OLXB 2OK8A 3DW3X 3NVAA 3VKVA 1Z7GA 5L6MB 3U61B 1VLMA 2P6OA 2W43A 3INNA 4M54A 3W4IA 3MM4A 3UEOA 1QDUA 5IUNC 4CV3A 1LPNA 2OHXA 1BYIA 4GFDA 4J1TA 2ZYIA 4JT2A 5F1PA 1NFFA 1W4LA 2A9RA 2NU8B 1X6VA 1EAYA 1N5MA 1KI8A 2XA2A 2OO7A 1QV6A 2JEYA 1KP9A 3SZUA 4NOMA 2J4DA 1BE8A 3AJDA 4TUYA 3WYDA 3R9WA 1PL6A 3S1LA 5JS2A 4EP1A 1JDBC 3QNWA 1JXQA 1AKRA 2G77B 1Y8QB 2XDQB 2I3GA 2XVXA 3DR3A 3F5MA 3LBHA 4FBMA 1GL6A 4Q3AA 4RL4A 3AW8A 5AHOA 4UW9A 4J2TA 4W6ZA 5JYBA 1U0SY 2QMHA 2M2IA 1U28A 2NZ8A 2PGIA 2WW8A 4KQ2A 4QT4A 4YRTA 2C88A 1SY7A 4ZRNA 4G8CA 1VL1A 2IX3A 2PPVA 2H1OA 1BGVA 3PQ2A 4RK0A 2QUKA 5EIEA 5IAOA 3QKWA 3OIWA 1KMNA 1YA6A 1V5IA 2HXSA 4MWEA 4M22A 4H7IA 5KBYA 3S2EA 2XCOA 2QE6A 2GKOA 3AFOA 4FOLA 4M0MA 1TTPB 1NJ1A 4MYHA 3DYVA 4MB2A 5FPTA 4HOYA 4CCYA 5CH3A 3WGNA 1R6DA 2ZS8A 2JFNA 5EZ5A 1AB5A 3IVRA 1FXWF 1OA0A 3U4MA 1NWHA 1EVJA 2WD9A 3OIDA 3UC5A 1YNOA 5SY4A 5HKOA 2IQIA 1JWBB 1XCPA 2OBLA 5BMVF 3T3GA 1SKAA 2X0KA 3CH5A 3EFOB 1DX4A 3NCTA 1OBOA 5KJEA 3LWZA 1E61A 4EZEA 3ANLA 1AIPA 1XDZA 2VAWA 1WPXA 3O8OA 2BGLA 4PLVA 5F9FA 1KAHA 1U0NA 3H9CA 3UBMA 4N3CA 3AUYA 1Y6GA 4H18A 4XOUA 4MQ4A 4B3RB 4MDYA 2D5LA 4CL0A 4V2UA 3O26A 4RSHA 1ZN7A 4GXQA 3IUBA 5DT2A 1CIJA 2HQRA 2W0SA 3B3GA 4YCJA 1NNEA 1BCSB 4F85A 5JXIA 1X77A 1P1FA 2H54A 3F74A 2LP4Y 3ELBA 3Q72A 4JQZA 5F12A 2GK6A 3AJEA 3N74A 1PNVA 2B2CA 3EIOA 4LXIA 2XNCA 2FX2A 4YUXA 4OI0A 2R5NA 4MLPA 1K5HA 1I5RA 3VSAA 2Q27A 4RZIA 4UVEA 4X9XA 1O89A 2VF5X 2QRVB 2E2WA 2R86A 1UAGA 1LPSA 1OHHD 2ZSDA 4FSHA 4IIUA 3K0EA 1HMPA 4LECA 4WLVA 4NYMR 4YUZA 2D2EA 2KWIA 2MMCA 3COZA 4N5LA 1YDEA 3KEGA 5ADVA 4G2NA 2GJ8A 1DFGA 2O1XA 4KAFA 4XTCS 5ABPA 2PY6A 2JBWA 3EJWA 1S2IA 1G8SA 3B89A 1NC3A 1RAGA 2HMAA 3IEXA 1LBHA 1BHQ1 3ISTA 4RU1A 3DHVA 4X6UA 4H4DA 5TRTA 2CL0X 4M1SA 1XZBA 2GZAA 3P96A 5DU2A 1EIZA 2X2EA 3AHHA 2YOHA 4WN9B 1V11A 4YDHB 1NU8A 3TQFA 1UPTA 4GI3A 1ECGA 4E5PA 4FT2A 4TL8A 1GPYA 3CX3A 4AS1A 4EBFA 5JVDF 3QLEA 1RBQA 1QQ7A 5LP6C 2GHRA 3TSZA 3HN6A 1P31A 1YRQA 3DOHA 5AVSA 4FZVA 3TQSA 4CGZA 2YWGA 3Q3HA 1OGYA 5BXYA 5H59A 1FX1A 2NZYA 4REQB 3K9LA 3JZAA 1U7WA 2YS6A 3BXZA 5T57A 4EW1A 1RIFA 5CDFA 1WSAA 2D6FA 1O3YA 3PE4A 4RYDA 1OBCA 3CO0S 1E2FA 1RABA 4PXAA 2ZE8A 1Z82A 3NDJA 1LK5A 2R48A 4Z4IA 2JFBA 1HYGA 1GGHA 3PPWA 5ER6A 1QO0D 2RHCA 1IOWA 3U3KA 3F3SA 2HMTA 3OZSA 3HXMA 3TSYA 3VISA 5FFFA 3V4ZA 1D2CA 4Q93A 4NZMA 7ABPA 1JFFA 3QVVA 1IQPA 5AK6A 1V7CA 3BGOS 1G5PA 2PBFA 3FNBA 3IP9A 4I6GA 4POAA 3C70A 3PEUA 3IULA 4HKTA 4Y2YA 5CH5A 4OO3A 3Q40A 3IOYA 4JLSA 2GJ4A 3C6BA 1E9RA 1QDEA 1BDHA 1SKBA 3D3WA 2PIDA 3L4KA 2A78A 1XK6A 2OO5C 2WIFA 3BS4A 1COWA 3I37X 3I30X 4HJXA 4U2KA 4Y6QA 3ZY4A 1J99A 4IJ6A 5HZGA 1H9AA 4B6FA 2IP2A 3E7DA 3DFMA 2CLDX 3OHSX 2QZSA 3PPYA 4AO7A 4GLFA 4F21A 4PO1A 1UKBA 2WAOA 2AJTA 5EI5A 1JBKA 4E5VA 3SPXA 1BNCA 3RF7A 1VL2A 4WKNA 1OZFA 3TH5A 2IPOA 3JATB 5DZSA 4ARSA 4DYDA 3TLYA 1Z83A 2PGOA 3E9CA 4D25A 2DJIA 4J9VA 3JQBA 2GBFA 2NADA 4L4UA 3QXCA 2CNNA 2WWVD 2PRZA 1ZP6A 4QC2A 4GBGA 3RIMA 4Z0PA 3RS9A 2JLZA 1SRRA 2CDNA 1RZVA 1Y9JA 2DUJA 3O75A 3ZK8A 2C0QA 2O6LA 4LZAA 4YFYA 4RQUA 3ANTA 3RYHA 1G5FA 1QHSA 1ZAYA 1VHWA 1E79A 1EGQA 3OM1A 3UJ9A 1CEEA 1Q1NA 5C9ZA 1AURA 2C7QA 4J3JA 5GGXA 2Z3VA 1VZ2A 2WF5A 1JHQA 5CYOA 2E87A 1O95D 4NQZA 3LP6A 4LYDA 4W9NC 5CJPA 3RDPA 3RPEA 1W8IA 3WQSB 1QIFA 3GVHA 4QVKA 5DLPA 4C08A 1HNWB 2NTJA 1QZZA 2V7GA 3B5EA 5A4DA 3E53A 2VZ8A 2QGFA 5DX1A 5H80A 3EOAI 3FE2A 4CPDA 1SVWA 1TU0A 3DO5A 3DZBA 1O03A 1CZHA 5BW5A 3HJAA 4NOJA 5IZCC 3I42A 2X5JO 3QSGA 1Z68A 2H1WA 3UJPA 3N2KB 4C87A 2C2MA 5F23A 1X86B 1FVFA 3K70D 5F1YA 3PL1A 1CS4C 2ECOA 5JBIA 2P62A 4C7OB 2YXBA 1QH9A 2RGYA 2OOKA 3TPZA 4HS9A 3BMNB 1I2DA 4QEDA 5AKGA 4BQEA 1WXIA 2XCTB 1ZO8A 1V9SA 3IQIX 1U98A 5DYNA 3G2IA 2QXUA 4KR9A 2NPFA 3OQMA 1WZEA 4ENTA 1NJ2A 2ZIZA 3ECCA 4NSNA 1IAVA 4WK6A 4XGNA 3P0EA 3PJFA 4IXMA 5DF1A 3FRJA 5A7FA 3ZJUA 3VV3A 2FF5A 4ZCMA 4ALNA 1R5BA 4ZOCA 3NZEA 1KC3A 2R8YA 1CNMA 3V1YA 1GGEA 3TR0A 1GLNA 3IXMA 3BCSA 4F2WA 5BQ3A 2PCLA 1Q74A 2LGJA 2QAGC 3QTLA 3QVXA 3GAAA 4GWLA 5AW2A 5KVCA 2JAHA 3TGLA 4PPNA 5A04A 5J43A 3EEFA 1WXWA 4UULA 2XZOA 4D9EA 3ROKA 3QV2A 5IAAA 5IT4A 5T41A 4Z1MD 4B6QA 1K63A 1SNYA 1CRQA 4UAGA 2DFLA 5BR1A 4FP9A 3B38A 5JNWA 5DN9A 4JEIA 3KWJA 1IM8A 2GBCA 2IODA 2ZRAA 4F8YA 2BISA 3G7SA 2PCJA 3LKVA 1M6NA 4HBZA 6REQA 5FL7D 3B7PA 3BVPA 1Q92A 4U7GA 1VC2A 4R83A 2WIBA 4M8IA 3ZWQA 2NVBA 1R0RE 2IIQA 3EN0A 2GVZC 4PRKA 1E69A 2B9VA 3CLTD 4YRRA 2IZ0A 3ZQ6A 5B3JC 5CFZA 2QUHA 4HFNA 5LMUB 2JCGA 3N7UA 5DEIA 4M1YA 3RS8A 1VRVA 3EPPA 2FPOA 4UHJA 4YO8A 2PDAA 3TZLA 2XGGA 3L04A 1RFLA 4EPWA 1YZ3A 2VIIA 3BPSA 4FHCA 1SG6A 1V1RA 4LRSB 3E6AA 4XLTA 2GEBA 2KBEA 4PC3A 4U6NA 4LBWA 1VQ1A 2QL6A 1YUMA 4IFIA 5CDTA 1V5FA 3V2HA 2FMUA 3VOAA 4IG9A 1WXXA 2ZSIA 2GXSA 2YFKA 1F2UB 2IHVA 3BRQA 2PZ8A 4J0HA 3FBTA 4KNWA 3DUFA 5MGNA 1R9NA 5J9FA 2WE8A 2NN3C 3G17A 4JFRA 1RJFA 3E15A 2YYAA 4HVAA 5LA6A 5H83A 4UTNA 3DYIA 1EYZA 2X1VA 3NETA 4NJMB 3D7KA 5LP6F 1DKNA 4US0R 3C5VA 3UWOA 3W5BA 4IVRA 4FI3F 1MQ9A 3CLTC 3HG7A 3P9SA 4MK4A 5LOVB 2QBYA 2WVHA 1Q0HA 1G1MA 4QEZA 2J3LA 1GSOA 4C4RA 5HJ2A 2YDXA 3RUEA 4U3JA 1XDGA 2JW5A 2RK3A 4RHEA 2ZRPA 3D2CA 4X3OA 5CT9A 4NIMA 5C37A 3RM3A 3N0TA 4ENRA 3TNDA 2IOHA 4C4AA 4W8GA 5F7JA 3KR2A 3R7SA 1AY0A 1EDBA 5ERGB 3AEYA 5BUSA 2VUHB 4DLUA 5AVOA 5BUQA 2PAFA 4S1OA 1TM3E 3KO8A 1VKOA 1NP6A 3MMSA 3ND6A 4NYIQ 4TV9A 3A6EA 4MJ7A 1JE0A 4C0XA 1L7EA 4WFQA 5AI0A 1IOVA 4XVCA 2RKWA 1CXZA 1I36A 5C51B 5KJFA 3D8BA 3K9BA 4P3YA 4KN5A 3DLHA 3JQ9A 1J5XA 2X0IA 4H6PA 5BQ5A 1JHAA 4Z4CA 3AI3A 1XTKA 2FHPA 3L7IA 4M1WA 5I9IA 1Z6ZA 5HKAA 3FDIA 3H05A 5EJIA 2F1KA 1EA7A 3NXSA 4X7RA 5D7BA 1YR6A 2IYSA 3P9QA 4MHOA 3R0ZA 3LNCA 1PN3A 4DQ0A 2OHIA 1PDVA 2CZGA 2GEUA 5JZMA 4AKIA 1BRMA 1BX3A 1EWKA 2Z5LA 3DLTA 5LQCA 4Q3EA 1EDZA 4MYCA 3VC7A 1JEYB 3CG0A 3RIHA 1YE5A 1GV0A 1XROA 5ALJA 4D56A 3K0FA 4M9QA 1TD9A 4LMRA 1ZR2A 4JX8A 3RVMA 3WGUA 4ZZ3A 2PNFA 1E20A 2BZ0A 3EWAA 1G64A 4RY2A 2HZ7A 4NJEB 4DG5A 1KOGA 2LCIA 3GJ7A 2R6FA 2YFYA 1TMGE 4IIVA 2QLFA 4GBMA 1JPUA 3HYCA 4P36A 1Q7CA 2P4HX 5FLXA 2FF7A 2QQEA 2F17A 1FYEA 1NVDA 3AEQA 4UMDA 7AT1A 1ST3A 4L0QA 4BWGA 3VR3A 1WZNA 3T3IA 5CM8B 1UANA 3VRHA 5JQWA 3UKOA 4XD2A 1P2VA 3L77A 5J23A 2VWPA 2FMKA 4CKCA 3RD5A 3O1JC 3TTUA 1YS2X 4O2LA 5DXFA 3VZCA 2VC2B 2D8MA 3AH8A 4IP0A 1BE6A 1F5SA 3WGLA 1XF1A 1J2UA 2PJDA 4AJ4A 3TFWA 2AC4A 1HG1A 3H2HA 4M0PA 3SD7A 4A2CA 4DARA 5DN6D 2AFIE 2IX9A 3EXIB 3PCTA 1UZMA 2HHLA 4ISBA 4WWHA 3ZZUA 5E9WA 3ZDBA 3DHNA 1N5DA 2AF4C 4MW1A 4DQKA 5CB8A 3ZHVA 4YP1A 1YSCA 2NO9A 1JKMA 5IKEA 1WUTA 1EGHA 1SUDA 4MV1A 2A0FA 2H1VA 5EJMA 1O9HA 3DD1A 4Y0NA 1V95A 1PVDA 3DYBA 4EB6B 4UTPA 1EUYA 2ZE5A 3O74A 3WLEA 4U1RA 4QQKA 4HDNB 2W2VA 2VUUA 3UGJA 5LXTB 2MWMA 1A9OA 2HBYA 2HL6A 1OKKA 3C1TA 3CKYA 2IXGA 3F9IA 3Q2IA 3SDBA 5GV7A 1WPRA 1QO7A 4FYYA 2TRSB 4BGDA 4BO5A 1U0GA 1XA4A 3W7VA 3ZDRA 1TYZA 3CHYA 3HCAA 4FSDA 4N3AA 5IJZA 3ACCA 4L0DA 4P35A 3VNSA 4D0GA 1KI4A 4OHVA 2C4VA 3CXUA 1SKYE 2OY0A 3MB5A 3BJZA 2AMVA 4V3BA 1NXQA 3ZE6A 1E8NA 3EUWA 1PJ3A 3DXYA 4BPRA 4MUJA 4HB3A 2O8BB 3DDOA 1AOXA 3HWWA 1WR8A 1XTSA 3QK7A 3ROMA 3KQUA 3PEWA 4GQBA 4H4CA 3OJXA 2ZDGA 2QD3A 3HSKA 3PEEA 2I2AA 1Z36A 1PI3A 2QXYA 1C3XA 2FZKA 1JIVA 1YK1A 4KXWA 3TLEA 2AG6A 2ZQZA 1R4NB 2IHTA 5HR5A 4M1KA 3NVKI 1JFFB 3CE9A 1VI2A 4CG1A 2VQSA 2XR1A 3DFIA 3EXHA 1KAQA 4WZ6A 3ZE7A 5A02A 4NK5A 2PXAA 1CJTC 1V25A 3AO0B 4QUIA 1OC4A 4YJGB 4BB6A 3QUCA 1DUSA 1CJMA 1YMQA 2YHSA 2ZM6B 1O57A 3A6ZA 3D3WB 1VL6A 4LN1A 1HDGO 4RKWA 4OSOA 5KNBH 3NHRA 2RDMA 1I0IA 1PR2A 2FG6C 4LXQA 3WAGA 1V7ZA 2DPGA 4XWWA 3BN3A 2WWXA 3ZDAA 4A4DA 2UUOA 4OAQA 1EFCA 1SCDA 1YGPA 2CNWD 1E1RA 4NE2A 1UWCA 5FBZA 5KTYA 2IDMA 5EEGA 3TQIA 3UAVA 3A2LA 4ITVA 2YRXA 4K3VA 1EM8B 1DAKA 5MF6A 2PFKA 4EGQA 3LLSA 4DSUA 1YFLA 5K0JA 4ND4A 3CISA 1E18A 4XD7A 5CVUA 1U1GA 4EHLA 1PT9A 3BIJA 1TVKB 3I62A 3GIWA 4X6YA 3T7AA 5KYXA 4JB8A 3IB3A 1P6QA 3U37A 4KZPA 3OTHA 1KGDA 3ZKWB 3EZNA 3DL0A 4D3FA 2I2BA 4MOWA 4N3NA 2PA0A 5KOIA 3O8QA 1UT6A 3RWOA 4E46A 5A62A 5DBHX 1E2BA 2D1QA 3Q4GA 1M5RA 4U7DA 1G7TA 1LZKA 5DH9A 1BXRA 4TLCA 6REQB 4RYLA 1XPOA 1ABBA 4LRYA 2CXOA 3JYPA 4LDJA 3T52A 1F51E 2WIKA 3N2KA 1QRTA 4OXKA 4MR8A 2HREA 2ZTUA 1GZ4A 1OIXA 3SR0A 4CLDA 4X41A 4C5BA 1JI3A 3MWLA 1WUHS 1JIUA 3IR7A 5C52B 2YKGA 3F78A 2ZDHA 5JFTA 4AW9A 4LF4B 5EIHA 2FP4A 2WTUA 4BRSA 1IN6A 1MBZA 2B5WA 1E3JA 1QLHA 2VRNA 2FSVC 2ZIXB 4NZ9A 3CUTA 5ALLA 5CITA 3QWAA 1SXJC 5JG7A 1UJBA 2X40A 2GF9A 1G7SA 1NT2A 4RVDA 5EE0A 5BWBA 2BTQB 1JLMA 2C7GA 1NBMA 1E3MA 1WX1A 3EXHC 5HJ7A 5AKZA 1VE1A 4DIKA 3RV4A 2HLNA 2C5AA 2QTBA 1KYQA 3KTFA 4XFDA 3IX7A 1W35A 4JJAA 4QO7A 4EHIA 3MJDA 5LLDA 3FIJA 1NYRA 2KLBA 4PCLA 5FTKA 4YECA 1RMTA 1Z17A 3UJ7A 4JT9A 3WWOA 2JCXA 1RYFA 3A1CA 4YRKA 1IPEA 2Q41A 1N1MA 3DDNA 4X1KA 3X2EA 3DHEA 1XRQA 3MUFA 4G84A 1NW3A 4EYSA 4YCSA 5AW7A 3BMXA 4PV7A 5FTMA 5EPUA 3QBVA 1XTZA 1DUVG 1AKMA 1YXMA 2OO5A 1FFEA 1GKUB 2HM7A 2H1IA 2R87A 4FGSA 4B34A 4B7ZA 2VBGA 2GBPA 4LPSA 5EVCA 3UAZA 1YBHA 2CLSA 4P7GA 5ES4B 4L02A 4ZQHA 1G8FA 3G49A 5HP4A 1AE1A 3SQXA 1P2UA 4KO8A 2X1HA 3QXHA 4HJRA 4ZARA 4CKEA 1TO1E 1DC7A 5CBPA 3KALA 4K6OA 3ZWNA 1NU6A 2HU8A 4XE5A 4G4SO 3WZLA 4MEBA 4KVGA 1B8UA 1IN5A 4TPKA 3T5GA 4C1BA 3CJTA 1EHCA 4AF6A 5FOSA 1X0XA 1Z8HA 3QXGA 3ELDA 1NUQA 1U2EA 4RW0A 3ZW8A 1M1NA 2PH3A 3AC0A 3QF7A 4P84A 2BFAA 2PJUA 5K0SA 2BF7A 3BERA 2VP9A 4NMLA 4ZCSA 3SXUA 1S2OA 1P5FA 2VQ3A 5BW6B 4RPCA 1Z4NA 2H3EA 1YJCA 2W4MA 4NY1A 1MFPA 1EE9A 4FFSA 4HWRA 4UU1A 3U09A 3W5JA 3OJ0A 4BZWA 1KVTA 3MB8A 3BRWD 1TLTA 3FHTA 2Z1MA 3S40A 2J9ZB 5HEKA 1PKXA 5IRCD 3HA5A 1ZWLA 3E82A 4B8ZA 4BEVA 4DUGA 5DCUA 3TLCA 3WNQA 2W00A 2UZ1A 4ZC1A 5G1PA 3ZCTA 1HG0A 1DADA 1SCQA 2J5QA 1YA8A 3PC2A 3R0VA 2GZ1A 5CT4A 5DP2A 5EVJA 3UV6A 3HDGA 3VJRA 1EI9A 1T1GA 2Y8EA 3PNBA 3WWDA 3NOXA 2F1OA 2ZT5A 3DFKA 4IJQA 2XWQA 4YJ3F 1ZNXA 3U31A 4TRMA 4MUBA 3RK4A 2OVFA 4DIDA 2YWJA 1N6PA 4A0QA 4DQDA 3GLTA 1X7ZB 4QWWA 1GGFA 2W2LA 5KCMA 2BGUA 1M8KA 4YMSA 4N8SA 1GDHA 4FMBB 2BCJQ 5T8KA 3U48A 3P0RA 5KINB 4DXAA 4YXFA 2B6NA 3VJMA 1ZCZA 1NQXA 1ABEA 4RHCA 1TQ4A 5EQDA 2XHEA 3T1OA 1KOFA 1RYEA 4PVCA 4NCAA 2XA1A 3WWZA 3IR5A 3CGWA 1F0KA 3FTPA 3AEQB 1GQQA 3V7FA 2CBXA 1EP1B 3IAHA 2PRKA 3IAM6 5L51A 2LW7A 2QTVA 4MPPA 4ZCQA 3SNHA 3PWSA 4TWAA 4QU5A 3IVGA 1Q7TA 1U3WA 2VVTA 3U4AA 1ZD8A 2XUGA 5IKMA 2FEWB 3A14A 2W6QA 3A6LA 3C8UA 3DM5A 3OJEA 3LYUA 3BGDA 4LV8B 2ANCA 4NBWA 2AFVA 4EF6A 1DI0A 4KQHA 1EK0A 1TA4A 3KJIA 5CXSA 4L6CA 2LD4A 1SUFA 5JISA 1GPUA 3Q5GA 1QHNA 2OGTA 1WCIB 2AV6A 3GJZA 1IPFA 4J0IA 1FW8A 3GOHA 4MB0A 4LVCA 3TJZA 2OXFA 1IWBB 3GP5A 2GPNA 3IV6A 2LIPA 2ZUDA 1XAGA 1TOAA 2PBLA 4I19A 4WLUA 4DRYA 1HY3A 5ARDA 1KC1A 4AY5A 4ZYVA 1VI5A 4FFPA 4IZHA 2RGRA 2XGMA 3L5OA 2AKYA 2JDIA 3AEUA 3DDWA 3L6DA 3TO5A 3X3HA 3WIBA 1QB7A 4WFKA 2NOAA 4HWPA 3HSSA 4BNTA 3KB1A 1XP8A 1S4QA 4GO1A 1A96A 1ORHA 4IIEA 2JLYA 4L3VA 4WZZA 4O4HA 5KWJA 2OV1A 3CNHA 1TF5A 4L57A 4PHFA 5KWSA 1Y5NA 3Q7EA 4ML3A 5E6SB 5BVHB 1DTWB 4DHWA 4GKKB 4J91A 3DAYA 4RS3A 1IXRC 4YUYA 2AN9A 3VDMA 2XMPA 3V6MA 3W3AD 4BMPB 1VL0A 3HWRA 1S01A 3C3MA 2Q4TA 3ZNPA 3WNDA 1E2UA 4F86A 4JA2A 2F67A 4OXYA 5TEVA 5BXQC 1NXXA 2JKYA 4XLLA 3DL4A 4QPZA 3STHA 3WR5A 3X1DA 4CU5A 2YVLA 4KAJA 3QENA 2M6SA 3CM0A 2O8DA 5U4XA 2BFDB 1LRKA 2R6GA 3H0KA 4MITA 2OTCA 1MH9A 5HS6A 4V1CB 4RETA 4TMFA 1SUEA 4FMDF 4GYYA 4QFBA 5HFJA 1VKRA 1YBFA 2R8BA 3KWMA 2XYVA 1OFHA 3R3XA 4US1R 5IC6A 2Y1CA 2PFSA 5CM9C 4MHTA 2IEDA 1FX0B 3SU8A 4WHMA 1BCSA 4Z9BA 2HN9A 1KE2A 5L9AA 1KTIA 3EIEA 4HBGA 3SP1A 4LCEA 5HF6A 3DEZA 3HFJA 5CDGA 2QPTA 4ZU3A 1XPUA 1W76A 2JLCA 3F2IA 3STUA 1Q1AA 1RDFA 1USIA 3IKMB 1IY0A 2DYKA 4GI7A 4D96A 5HQTA 1J8VA 1JQAA 3K35A 4H6XA 2WINI 3BWVA 1DGQA 4NZOA 4G86A 5FA6A 4ZCTA 1LRJA 1LBQA 2VTEA 3K9NA 3M33A 5LIRA 1HKHA 4GZMA 1SQ5A 3ZTYA 5K6AA 3TTSA 3EIFA 5JC8A 2IPLA 3RUFA 4WOPA 4LHWA 1SK9A 3SDSA 2JHGA 2QJFA 4MCJA 4E15A 4J6FA 2NAFA 1MABA 4HEQA 5J4HA 2HA5A 2ZJOA 5KYXB 1QOZA 2P9GA 1DHRA 1D1TA 3RFTA 2QT0A 3FWZA 1TAHA 4G9BA 5KTSA 3IQZA 1JEEA 1GTJ1 1BZYA 2VATA 3RTDA 5COBA 3WJ7A 2NO7A 1M1XB 4QFDA 3TOZA 3AF1A 2GF0A 5B3KA 1VRCA 2P6PA 4PHGA 1UBTS 5D6NA 1RZRD 2MTBA 4FYPA 3GRUA 1IZYA 1M8JA 2WJHA 3LWBA 4L4SA 2I7DA 1H8HD 5T6BA 2ODBA 3VO2A 1DQZA 2PWBA 3KV1A 1XVTA 3UK6A 5KDOA 5FXMA 1YDFA 3LKDA 1JPJA 4I0WB 4U7JA 5FBWB 4DADA 1KI6A 4EY7A 4KH1A 4F4FA 3RBZA 4TLBA 2A3NA 4B44A 4NENA 1EU1A 2KS6A 1YL6A 3VTAA 3U9SA 3ORQA 1KYWA 1GPNA 4MGYR 5D5PA 3E5MA 1XOIA 3KXKA 3ONDA 3SHFA 3T41A 4GP9A 3VR5A 3QPDA 4QTZA 2JDID 4IWNA 1Y81A 5TQ2B 3ZXYA 1C0PA 2R84A 4IMIB 4QA9A 1R9MA 2RB5A 3HYRA 4TQ9A 3VHLB 4IGIA 1BGWA 2D4HA 3UPDA 3GQBB 3MJFA 4EJSC 4F3KA 3PJRA 4AJLA 2HK8A 1P44A 1TVKA 3DEYX 4H27A 3SOPA 3W9BA 4QPDA 1SJ9A 1GNTA 3KVOA 1PTJC 3NHJA 3PYLA 4Q01A 3ZOKA 5CA1B 3DSRA 4H15A 1KI9A 4Q7EA 4GGMX 5CFNA 1XCLA 1O5TA 2BHTA 1A1SA 3MWEA 3T7SA 1QU2A 1DDIA 1FLDA 2RGCA 3LW7A 1KU6A 3DLAA 4MW9A 4PZAA 1Y7HA 5G2OA 3BMCB 2GAOA 3X2SA 1E4EB 1QRUA 3IERA 2VZEA 5IK2A 2HX1A 2OWDA 3U44B 1BFUA 2QN9A 1Z25A 3GI1A 2FMIA 4J3NA 4C22A 1XYGA 5BSMA 3AY6A 1MD9A 6PFKA 4BVKA 2G5CA 1XKTA 4MYDA 3ZKAA 1M2EA 1HUQA 1MO3A 5E9AA 4MR8B 1J6UA 5K4GA 3CVUA 1MLDA 1SVMA 1UDBA 2VKTA 4RDXA 3GO4A 1GPKA 4E5UA 3DV0A 3R3VA 1J0BA 3RYIA 1W7AA 2OBYA 4F5YA 1Y42X 2EF0A 1F3LA 1DXOA 1FA9A 1N3IA 2ID7A 4ZP1A 1FXUA 4X1IA 5IXYA 1E0SA 1Z16A 2WNIA 2AFHE 4IL5A 5HIKA 2PUBA 4AF8A 1YIDA 4ZCPA 3LQKA 3ZWAA 3GP8A 4DPKA 4HP8A 3P9XA 4BATA 2C96A 2CJFA 4O4LB 2BEVB 2JLRA 1T29A 3KE8A 3RT7A 1U8EA 4N8EA 1WV0A 1Q0LA 3CRRA 4HQNA 2KM1A 1JSCA 1QIKA 2G0AA 3G9XA 1YE3A 4HWSA 4G3XA 3ZIAA 1TA9A 1ZITA 1MO4A 2QMYA 2OAP1 4YP0A 3WAJA 2XRZA 3OMLA 1RYYA 1B1AA 1YHZA 3DBLB 4PYOA 1E0AA 5JSYA 1Y3FE 4HUQA 3AL3A 5G4KB 1XCOA 2QAGB 2HJSA 4FS8A 5HRCA 1FUUA 1K8XB 4JLAA 3WLQA 2I1LA 3EFHA 4MO2A 2B99A 3L46A 3ID6C 1FK8A 4EY4A 4ZI7A 1F4LA 5JWHA 2W8BB 2MYUA 1FDSA 1N6OA 3KAPA 3MHPA 4N5MA 3C3WA 4DCGA 1ZQ1A 2Y9MB 3QPCA 4I08A 3B6MA 1JAXA 4JY7A 5DI3A 3TR6A 4Z1OA 2HUPA 2FPUA 3IJEB 5IJWA 1GN8A 4MS4B 3UK1A 4W99A 1YAJA 1FDUA 3K8QA 4OVKA 4KRGA 2HMVA 3EWIA 4KN6A 4KIJA 1JG4A 3P4XA 4UZEA 5IEJA 2ZJFA 5KHAA 3BT7A 1L7MA 3L1VA 1K7EB 2PUGA 1USGA 4HEA6 4KDCA 4ND2A 5DE3A 3KX2A 3IIEA 3KUDA 5B2FA 3QIVA 5ALFA 1X1EA 4LHVA 3JQ7B 4OHFA 5K0EA 1UBHS 4QAJA 4D7AA 1QSGA 5DULA 1SKQA 3DDZX 2R6HA 3I6QA 5E7QA 4JI5B 3TIVA 1DOZA 1VJ1A 1XLTC 2QIPA 3EF0A 5LB2A 3JQAB 5AKLA 1SBIA 2FUG6 2WIAA 2PZAA 3OC6A 4FM9A 1K66A 2R7AA 4OKSA 4YPFA 4RY9A 2QRVA 4FCWA 3HDVA 3JD4A 3EPHA 3DC2A 2HC9A 2ONCA 4RTPA 1HR0B 3GJTA 3ZE0B 1EM6A 3RV3A 4M37A 1MIOB 1Q95A 3UXYA 2HWKA 2ZRLA 3GJ5A 3II6X 4TLLB 2ODWA 3COYA 4W9RA 1J00A 1EFKA 1Z33A 2HRZA 4BVBA 2BONA 3TOCA 2QMOA 1MDBA 2PUHA 5DKFA 4GMXA 1TRKA 1KIFA 3FNGA 2QJOA 2DUNA 2FZEA 4GZ6A 5FX2A 1A7JA 1L5NA 3I9MA 1EVEA 2AOTB 2H5EA 2RH8A 4JJFA 2H2IA 2HHAA 4O4HB 3X1JA 3HJUA 4JP5A 4RPKA 2JC3A 5C81A 5KU1A 4HXEB 4UASA 3AVXA 4L6IA 3E9RA 1PDOA 1GD1O 3G2JA 4HZGA 5TDHA 3R3HA 1YRLA 3REFA 5JD6A 5JAZA 1AA6A 3IAS1 2CW5A 3WB2A 4QXAA 5LMZA 4P4UA 2DQYA 1H0HA 4CRWB 1W36B 1UKVY 4H3KB 4OSPA 4PRLA 4RC9A 3CH4B 3E18A 3FD8A 3T3DA 3KJHA 3NTOA 4ERNA 2AR0A 4KR6A 2B8NA 3CG4A 1MPXA 1FP6A 3D31A 3FTCA 2GD0A 1ZC3A 3ZE1B 4AZ3A 3ICQB 4ETMA 1ISJA 1OAKA 1ZHHA 3NB0A 4L51A 5ALNA 3OTGA 2BH9A 4NU8X 1ZM3A 1HYQA 4UC0A 2A1TR 1U94A 3SG0A 5BVGB 1Q14A 1YL7A 2OKGA 2VDUE 3JZMA 2P1DA 4B2YA 2VO1A 2V7WA 3U5TA 3NP9A 3MPOA 4XTRA 1C81A 3KL2A 4MLZA 3ENQA 4D3YA 3HBAA 4EB8A 2BTOA 2BELA 4AKEA 3P94A 3L6OO 2VNIA 3ITDA 4U7TB 4LYGA 1PR0A 1FDTA 2WWYA 4FI3C 1LDBA 2BDTA 1AK1A 1W0KA 1M34A 2J48A 3IDAA 3NS7A 3PVSA 5D5HA 3U9TA 3C41J 4WOJA 1T9GR 2CNWA 4WXMA 1K6MA 1UOOA 3SNKA 1WXGA 3HABA 2CHUA 4AYTA 4BU1A 4WGFA 3QE9Y 1ULAA 3ZGOA 4I6EA 4QUEA 8ADHA 2UZIR 1P3DA 1QXSA 2ZVJA 2ZUEA 3BWMA 2VK2A 3H1BA 4DEYA 3TBHA 2DPXA 5DNDA 1VIYA 2ZSJA 3RYHB 4KR0A 2R0QC 3K71B 3HKBB 2YJ3A 3GGCA 2O8DB 3AWIA 2PQ2A 5JEEA 4INZA 3HHPA 3RYCA 4M60A 2ILTA 3CTPA 3R24A 4G5OA 4K81B 3EBOA 3TQRA 4AJPA 4Z4HA 4GLJA 3RTAA 4KGVA 5LDHA 2WHEA 4GC5A 3LUAA 1AF7A 3EGVA 2PRJA 3WB0A 1I2CA 3FCAA 5KNBD 1XNRB 2F4NA 5H8WA 5IEBA 1CVIA 1NYQA 3LDAA 1YGYA 2HNAA 1NXTA 3VU9B 3ANMA 4WX2B 5EY5B 3R2JA 1T3GA 3DQZA 3AHCA 3B78A 1H42A 1KDVA 3K9WA 3R7FA 5KNCA 1GFSA 2R68A 4HYQA 4BEBA 4YDRA 5FV4A 2C8KA 5IW8A 2FLWA 1R0LA 1OHHA 3HJTA 3GA5A 4PZPA 1K88A 1ZM4A 4JLUA 3WL6A 4ZV9A 3BRWA 4KV9A 4EPXA 4OJTA 3L4JA 2VDPB 4HR7A 1VSUA 3RF6A 2ZRBA 2NX2A 1Z2OX 4PLCA 3V9AA 1QH8A 3D6VA 3SBOA 1EX7A 1E2JA 4D8YA 1JR3A 3ER9A 1SAYA 3UGKA 1YH3A 3Q7PA 2Y3IA 4KE6A 5IDXA 2XUKA 5KNBA 2ZRKA 3NASA 1LQ2A 1XA0A 2GCNA 2GNOA 4RA6B 4S12A 4M86A 3RJ5A 5DM70 1JHXA 4NJOA 1LS6A 4FZRA 4OQZA 2H3HA 1GYPA 1AN0A 3H65A 5ICFA 5M5BA 3HV0A 1O97C 3QXXA 4R8VA 5TJHA 2PZGA 2JJ8A 2Q1YA 5EEHA 3Q41A 2AH5A 4GI2A 5K0LA 1TL7C 3GLQA 3WV4A 4WI1A 3H7IA 4XGQA 1NHGA 2FWIA 5I9NA 2YY6A 2ASEA 4RS4A 3P97A 4RJJA 4LHYA 2Q1UA 4XDYA 3EG5A 3FOWA 1MW8X 5LSAA 4K88A 3GYGA 1XZFA 5JNSA 1LLDA 4QHTA 4GE3A 1N5IA 2VP3A 1VRWA 1MC1A 2FXIA 3EBLA 2Y77A 4MP3A 4NMMA 3WQBA 4DNPA 4D8TA 1SU6A 3IAAA 3ED1A 4QKQA 1V47A 3BXFA 1N5RA 2ZUVA 3M6FA 4L2IA 4N0QA 4OIFA 1J0CA 1XU4A 4B17A 5AVZA 4EKYA 2FSGA 1L7BA 3LE8A 4TWJA 3FZNA 5ITVA 2HPZA 3QLJA 1AGNA 1E2GA 2WKQA 4KPUB 3LUGA 1VJ5A 3R4VA 4PSAA 2G9RA 4R3NA 2VAMA 3PTZA 1UCFA 3BMCA 3C8MA 4KN9S 2C9DA 2XOKA 3JW8A 1LGYA 3L0OA 4FVTA 5TIIA 4ZT3A 2HF9A 3UNXA 4B31A 4MW7A 4X7BA 3U62A 4B6OA 2ID8A 3Q3EA 1NKTA 2GGSA 2JEZA 1DTSA 4R4JA 3RVPA 4C5AA 5BR7A 4HYYA 4QULA 4BECA 4N48A 4M0DA 4WLEA 1FW6A 3FHLA 1SPBS 2D8AA 2RHMA 5HNKA 3FCEA 2F8LA 2WEKA 2EP5A 3FETA 2ZBDA 5BMVB 3OESA 4D8UA 4UD2A 4DDUA 1RI3A 3E9DA 5K6AC 3AF6A 2F3SA 2C77A 5FV7A 1LQTA 4PSKA 3WHPA 1RWMA 4C3OB 1A71A 4F60A 5AHWA 2AFIA 3HCWA 1IDOA 2W2LD 4XCQA 5KYTA 5MDHA 4PXYA 3JAMA 4EW6A 2PZLA 4U2EA 4Q05A 4UATA 5CVJA 2CBGA 2O5CA 1S8NA 3EULA 1E0DA 3MXOA 2GHQA 2REXB 2A33A 3QU4A 2FV8A 4I50A 4QNMA 2XT9A 3TB4A 4C4ZA 2C98A 4X20B 1V9CA 4ER7A 4ZFNA 2VUTA 1GT91 3DPSA 3IPXA 3IT1A 2JI4A 2VR1A 4JIGA 1BKDR 2WKSA 3NLLA 3F7OA 3G2KA 2OQRA 4XVQA 4EMSA 3SCZA 3F3YA 1TJ3A 1DSSG 3A9CA 4PXSA 1SZJG 4A23A 4EX7A 1US8B 2DERA 5H5JA 2QAJA 5AJYA 3SWWA 5IF9A 1U1DA 4ZXPA 2RC6A 3ONFA 4G0ZA 1JG7A 4AN4A 2JIZD 1KSHA 4Q34A 1OUMA 1ZGHA 1Z6PA 1RTKA 3GB9A 3PUVA 2G17A 5C8YA 1T5TA 4GM4A 5B1EA 2DULA 2R66A 1L5YA 1WEKA 1SOVA 1Z7WA 2UYQA 3A9RA 3CS3A 4NTZA 3VR6D 3A7EA 1GAXA 1XQ1A 3LI2A 4YYZA 2CCKA 2JGNA 1TC1A 2J33A 3D6UA 1CY0A 1SBHA 4DGSA 1R0BA 4D5EA 3C6YA 1QHHB 3MEQA 1P7CA 4RTRA 4FQ8A 2O2DA 1WMAA 3OZRA 1L5VA 2VOJA 4KI0A 1RRGA 4QNRA 4RIGA 3ZDFA 1SCKA 1NYTA 3K6JA 1TUBB 2AS0A 3HBMA 4DLAA 4B3TB 3FCYA 5TPWB 4YV7A 4GYWA 4Q4AA 3DZCA 1JRLA 2X7JA 4BB0A 3N6XA 4C6TB 3HCDA 2ZBGA 1VE5A 1RYNA 4NS4A 1THZA 3ZU5A 5FOWA 1NX9A 1X7XA 2WUFA 3FVQA 2R79A 5FYDA 3V7WA 1QHEA 1UPUA 4DM3A 4ETWA 1P3JA 4QUKA 3WVNA 3S81A 4UM5A 3QHQA 1Y8RA 3BQMB 5A03A 2X6RA 1VPWA 3IBGA 3K6RA 2G7ZA 5IXJA 1HNXB 2P69A 3ORYA 1XELA 1XL0A 1PFWA 1QR2A 3KQQA 4HRAA 5DW0A 1BCRB 5BYJA 4PRYA 1OI2A 3CZ4A 3QYFA 1OWPA 3AHFA 4AIRA 4EB3A 4WD3A 4KPEC 1M1NB 3ZWXA 1YULA 2HU2A 5MFPA 3GA0A 1C29B 1RHQA 1V6SA 1RWPA 1SC9A 4AZ3B 1R5NA 4D9JA 3IMEA 3VZBA 3GG2A 4K2HA 2HEGA 2DY0A 1B15A 3FLAA 2XT6A 3QV1A 3CEHA 2VJNA 3VOSA 2AD5A 4JLWA 3IDFA 2JPDA 1JJBA 3AR3A 1YQEA 2V8BA 5ADHA 1Z5NA 1C0LA 3CCCA 3GROA 5JMPA 4PYNA 1Q84A 2VPXA 2IZZA 3O9MA 1AV7A 1JX6A 1T2AA 2PEZA 2CY0A 1DX6A 1XQ9A 1SK8A 4BO1A 4YJDA 2HA6A 3DZIA 4FDVA 3C1UA 2PVSA 4M9CA 5TSDA 5DYWA 3TLMA 1FNSA 4BLWA 3QXSA 1D2AA 1VGVA 5T4BA 4RVFA 1OXMA 3T4EA 5A7GA 3OZAA 2A0KA 5BSWA 2X9NA 1DFIA 2V6IA 1KWKA 2YWHA 3VYTB 4Q4HB 1IXSB 1BYUA 5BSFA 1Q0ZA 2CVPA 3LPNA 3OQIA 3OZBA 4ZQGA 4AY4A 1G9TA 5AP9A 2JJQA 3B7WA 4DUPA 1C1DA 3IL2A 1HFEL 1X94A 3NWPA 4IIJA 1DBIA 4YJ2A 5KKNB 4A15A 1M2OA 4K8RB 2IU3A 2Y05A 4G26A 1P4GA 3DVLA 4YXWA 5KC8A 5LD2C 1IIBA 4MUHA 3MRSA 3IIMA 5G40A 5I4KA 3CB2A 1NONA 3RUAA 2K5UA 1N5OX 1NQTA 3A0RB 2NUBA 2AVDA 1U3GA 4GNKA 2CV2A 1XFDA 1BJTA 3GFBA 3QITA 2NO4A 1UPAA 4FMPA 1QHYA 5E8JA 2C9ZA 4N5NA 4PM4A 4IIYA 4X1OA 5LJIA 1XEAA 5EFZA 4HLDA 2QUIA 4RKEA 2ODQA 1QX4A 2FDRA 4YALA 5I3CA 2ZBEA 1X8XA 1MR3F 1BN7A 4B3BA 5I8WA 4TKZA 2ZIFA 4LZWA 4MVYA 2NZVG 3RKUA 3UQYS 1VSQA 2X42A 2XGJA 2IVZA 2Z2XA 4FDAA 3PR2B 1VHDA 3QUBA 4CLHA 4RK6A 3MWYW 5AW9A 8OHMA 6YASA 1LVHA 4P7JA 1T6NA 4YUWA 3EUEA 2ZXUA 1T2CA 2V6JA 4P81A 3EXG2 3DQQA 4HX9A 4R31A 1U7UA 4JC5A 4AQ7A 5LYJF 1WCIA 2P7IA 2YBDA 3ZDEA 3IVXA 2IW1A 2VJMA 1MJNA 1X7YB 1FMTA 2Q0SA 3IEKA 4L8GA 4RD4A 1RRCA 3I6ZA 5C5DA 2CCJA 1TGVA 4R0VA 3UXMA 5SV2A 4BWVA 3HKBA 4H31A 4DWVA 3WYCA 3DWFA 4CQLA 1B0PA 3EUAA 3F46A 3JD2A 3DNFA 5JHGB 3FPLA 4GIBA 2QRPA 4D6PA 3ZV4A 4BQPA 4YMTA 4DC0A 2Q4DA 1N3YA 2NZ2A 2V6FA 4ZOLA 1E63A 1SRQA 3ZY5A 1ZUNA 1Z0ZA 2G1KA 3KKZA 5AD1A 3EWNA 4L4ZA 5EJ7A 5JNRA 5KOYA 3TUIC 2EX1A 3ZI4A 3MMPA 1IHPA 4P7FA 2QS9A 1RWWA 4BFCA 4R9SA 1T8SA 2R8RA 2XBUA 5LB4A 1XRRA 4QPJC 5IJ9A 4ER3A 1W5EA 1R27A 2WPDD 3IP8A 3QBDA 5KNLA 4RMNA 2H59A 2FZCA 3GGSA 5AIBA 3MIZA 1ACJA 1G6KA 2BFBA 4L5CA 5BY2A 1UMBA 1L3IA 2VDWB 4IHQA 5FWXA 4KQ1A 3UG7A 4Z3KA 4ZDIA 5K0BA 2Z30A 4HS4A 4Y30A 4B3SB 1NUPA 2QTWB 3MIIA 3HB4X 3ZWPA 4RLFA 2F8TA 1ZXLA 3T3NA 3NMUF 2IRWA 1DE0A 2V03A 3AI7A 1ISHA 3FPAA 4EO9A 4IXDA 4NCXA 3RWBA 3KHSA 3BJMA 4NG5A 4EHAA 5LWHA 3CO5A 1ID8A 1KMQA 4HPJB 1KVSA 4QBFA 3VNAA 1OH5A 1NJGA 1VMEA 1ZDMA 4LJ7A 1MKYA 5IS2A 2ZYWX 1BMFA 3BULA 3WE7A 3I53A 4MA5A 3BDVA 1SC1A 3GPIA 3KQTA 3PWKA 5LYYA 3IJRA 4DMFA 4ARVA 4KLZA 3C3XA 3OZCA 4PQFA 3L0ZA 4RH1A 2PT5A 4HSEA 5HPYB 4JLPA 4M55A 2FQ1A 3HDTA 2GXQA 4MULA 4X91A 1G21E 4FUTA 1W1WA 3KAQA 3MOGA 4NBUA 3ST7A 2R7KA 1MGOA 1XZHA 2G63A 3EPRA 4URZR 3I1FA 1V41E 4DLRA 2W83A 3COSA 3VYWA 3X1XA 4C7JA 1L5OA 1PT8A 3LGXA 5JBNA 3C87A 3MYRA 3V42A 3GR6A 4JC0A 2A1IA 4MAAA 4Y2HA 5JD3A 4DDVA 3D4BA 2Q21A 2DWQA 2VJQA 4N7RA 1MABB 3B1JA 3KKQA 1V7PC 5T3UA 4HH4A 4MIOA 4MQEB 1A0OA 1I4EB 2JJMA 3BE8A 2ZIXA 4CKBB 1PAUA 1XYVA 2VZ9A 4DRXA 1Z56C 2NV2B 2RB4A 2NNLD 2FJPA