3HY3A

Structure of human mthfs with 10-formyltetrahydrofolate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
198
structure length
196
Chain Sequence
b'MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-formyltetrahydrofolate cyclo-ligase
publication title Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 67
structure length 196
sequence length 198
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 3hy3A00
1WKCA 3HY3A 2JCBA 1SOUA 2G40A 1YDMA 3HY4A 1U3FA 1SBQA 3HXTA 3HY6A 1U3GA
chains in the Genus database with same CATH superfamily
3G13A 1QPBA 3C0KA 4NOJA 2HL6A 2UVPA 4KIUA 1XWIA 1Z5GA 3RADC 5F5LA 1Z8NA 5DLPA 2O5EA 4ZV9A 1JSRA 4V2IA 3C5EA 1UCFA 5GOTA 4II7A 3CPHA 1GZVA 4XM0A 3G2NA 1ZIPA 4XUEA 2EXXA 1DNPA 3TE6A 2B1JA 2CB9A 2H57A 4W9MC 4BRUA 2HTFA 3LJKA 1KI9A 1S8NA 2CJFA 4C21A 3OU6A 1G16A 3O8QA 4ALJA 4NZ9A 4R1MA 3KKLA 3R7BA 1XLWA 1MA3A 2G70A 2GJ4A 1QF6A 5ER6A 4DY6A 5CW2A 4G63A 3BK1A 4KFUA 4BVKA 2C94A 2CHQA 2JEZA 4ID3A 4OQEA 4MUGA 2TMDA 4GLJA 4NFHA 3KBBA 5LZ4A 1WE2A 2QRPA 3H4VA 3ENKA 3Q0TA 4JA0A 1PL7A 2IUFA 4J1QA 4YTEA 2X23A 3KKQA 1SD2A 5KQPA 2D5IA 2X1HA 4DV1B 5BQXA 3TWOA 1WLYA 1Z0UA 2BFEB 3G9TA 3RYFB 3TSWA 1C7ZA 1VSUA 2QVZX 1Q7RA 5ITSA 1QR6A 3R9XA 2YV4A 2GPYA 2GD0A 2ISCA 3D8NA 1TZBA 3DP7A 1SVNA 2I71A 1XAJA 3ENZA 2QNBA 1XMSA 2AHRA 1VRVA 1DUSA 4II3A 3R2JA 4W9RA 4YCAA 4KYUA 1T4GA 3H2JA 3N07A 1JUDA 3PCRB 1EX7A 5IJ9A 2FFJA 4G26A 2XGGA 3TBHA 3KOYA 3L1HA 4RZXA 3Q7IA 4MHOA 3R5SA 3BRCA 3NIBA 4Z4CA 4ND6A 4YAEA 5HP4A 5TVKA 1C4OA 1X87A 1TYEB 1KDOA 4OGWA 3GLTA 4Y6LA 3WQHA 3Q7RA 2GBIA 1KZGB 1LI5A 1K7YA 4QOSA 2V9PA 4CM6A 4EYKA 2REXB 4H7HA 1ISFA 1UDRA 2WSSD 5EJFA 3SYKA 1BNCA 2GTPA 5ECWA 3ACDA 2MCFA 4M0KA 1XD2A 3OTHA 2Q7OE 3AJRA 3UT6A 3GK3A 3UT5B 3K05A 4US1R 4N47A 3EVNA 5FI5A 1JIKA 1AX9A 2ON6A 5DI3B 2IYYA 1XOIA 4E3ZA 4F6RB 2WTMA 2V97A 4PONA 5AO9A 4BNVA 4ZI5A 2AOXA 3MMPA 3LX8A 3ANYB 3IILA 3MWKA 4MMYB 1SVMA 4XGRA 3ZGLA 4QT4A 5J58A 2CJWA 2WQZA 4PCLA 4Z4GA 4C0HA 1FJXA 1NM5A 3IERA 1RM4A 1M1UA 1VDMA 1Z2OX 3ETNA 3UAOA 5JXJA 4XZ3A 4LY3A 5HPYB 5A3SA 1IIRA 1HTWA 3V4PB 2JDID 5JEDA 4PS0A 1PLJA 2AEJA 2BZSA 3SN6A 1BE0A 1B0AA 4MKRA 1I2AA 5B2ZA 1T91A 3RI3A 1Q0SA 3IT2A 3PSHA 1SELA 1T36B 1XZ8A 4FYWA 2BMVA 3HFSA 4BLQA 1C41A 3A6JA 3GFBA 5M3BA 5IVHA 5LIRA 1E20A 5BPFA 1QWSA 2AN4A 3EDYA 3WSWA 5F51A 5KNBA 3NU1A 1QHIA 1QOQB 4B3JA 3VR5H 2QRGA 5KWSA 3BMOA 2NZYA 1TADA 3LVRE 3MCWA 4JLWA 4PTYA 4RPJA 4UOQA 5TMBA 3REGA 1Z5WA 4QU8A 2ZDHA 2WB4A 1JHDA 4RMNA 4AULA 2WZCA 3JY6A 4IILA 4UHEA 4I81A 1K5HA 1QZTA 2VSXA 1UZUA 4LGYA 4FDTA 2Y05A 4D25A 4P3PA 2EJBA 5JLAA 3AZOA 3L4EA 3GJZA 4E5UA 5CNKA 4OKSA 3EGEA 3IRUA 3LT0A 2CMGA 2QL5A 5AM3A 2HCFA 3UMJA 3RR2A 3JWIA 4OKIA 3DE5X 5BW6B 4CM8A 2UU9B 1XXLA 4W4TA 1N3IA 2ZYGA 2I3BA 2C61A 4ISCA 4XIJA 4EF5A 4TTTS 3K9GA 3SC3A 3ANNA 2PLAA 3SXJA 3UPTA 3MD9A 1ZESA 2HIMA 3GGPA 4NU5A 4OI4A 4ESEA 5IXJA 3KKPA 4C5CA 2EFGA 3VPBA 4RSRA 1H6BA 4IQGA 3T1YB 1SKAA 4MW5A 1QS0A 3PD0A 2DZDA 4GECA 5AJHA 3KLOA 5JAMA 1EVYA 4KP7A 1IOZA 2AWNA 2BI4A 2MSEB 4EVSA 3UZUA 3BH6A 1QUFA 1COZA 4IEIA 2GK6A 2KWIA 1CQWA 4KQFA 4MYCA 2I7CA 4KSBA 1TZCA 1Y8RA 4N7BA 4NECA 4RS3A 4UTOA 1EAYA 5EKTA 5KYUB 1G2QA 2BFBA 1C81A 1TK2A 3ZEIA 2CV0A 3O75A 3CZQA 2W6QA 2HU5A 4FWBA 4LX0A 3RFTA 2HA0A 3A3NA 4UU8A 5FEMA 3SDSA 4B73A 1ST3A 4JUFA 1JR3A 3HVHA 1K7EB 2WNSA 5WRFA 2P62A 3NGLA 4TN5A 5JDCA 1NV9A 1RLOA 1WXQA 3UG6A 3KWFA 2VQFB 1NKVA 3FPJA 1XPOA 4TKVA 3N2YA 1NI4B 3W6PA 2I80A 1JFVA 1VSBA 1GDHA 1VHDA 2ZW9A 4XSVA 3ZHUA 4N3AA 1SC9A 3QE4A 5BQFA 2PT6A 3GG2A 2ONKA 4U6SA 1E99A 1RXEA 2MSKA 1QX4A 1FPMA 3NAZA 2EYUA 2ZJ6A 2GLUA 2XWSA 3JD3A 4HEA6 3A1FA 4MVXA 4MYTA 4XGIA 1RS0A 4TXLA 1FFWA 2H7YA 2PJDA 5K5EA 4WFIA 1AHNA 4BNNA 4FYJA 2C82A 2ZUSA 3FDJA 3H11B 4PPNA 2OHVA 1O97C 3OF3A 3NRJA 2ZIGA 3P9YA 4RETA 5DLEA 5BWLA 4EY8A 4F9EA 3G2KA 2Z58A 1K4YA 2IYVA 2QT1A 3FETA 2E0IA 2F64A 3MGGA 1GKYA 1Z07A 3IUEA 1TPYA 4H7DA 4MCJA 1VPTA 3W7BA 1HDIA 1XU9A 3ZWBA 1CUAA 1V11B 2HWKA 4P5PA 3R4VA 4YLGA 2A67A 4NZPA 3H3XA 2GPNA 3UV3A 1Y9AA 2C2OA 2FPIB 2G3YA 4OTZA 4MQ4A 1RCFA 1RMQA 2ZIFA 3F6PA 3NDRA 4B4KA 1C2YA 2O2EA 3I6ZA 3KR9A 4MGEA 1GU7A 1QC5A 2J4CA 4DZTA 3NXKA 1W5FA 5K3EA 5IAJA 2ZREA 3KTAA 3ZHYA 1NLFA 5F3DA 3HEAA 1N8NA 1CFZA 2X6RA 1ZGJA 1RRMA 2H5IA 3O8LA 5EXDA 1TRKA 2FZLA 2CHFA 2ALJA 1JMYA 1SQ0A 2I34A 3PIIA 5I8ZA 1MB0A 4BE7B 3B5EA 1OYYA 2VDOB 3ZGXA 3K0HA 4PX2A 1MVNA 5CYGA 4ZQBA 4OJMX 4TRRA 1XTRA 1O95D 3WGLA 4ZVTA 1ISRA 2OV8A 2WM3A 1CDDA 2F1KA 3RSOA 3QG5A 3U09A 4MQUA 3EIOA 1YHNA 1EAMA 2H7XA 2ZTHA 3EJ6A 3BD7A 4DB2A 5DM0A 1N2EA 4DSNA 1KMQA 3VRHA 5GM1A 2D2XA 3AHJA 3O1IC 4Z1OA 5TE9A 1PDVA 4MA5A 4UAVA 2V96A 2WLSA 3VR4D 4N49A 4Q7JB 1X1EA 3NAMA 2J3EA 1L0BA 1B0PA 1TYCA 3EXFA 4NCXA 2BWJA 2ORED 4DLUA 4O2BB 4QUGA 4ZO4A 4Z5XA 4BIIA 2JIMA 4OI1A 5ALPA 1TYBE 1R12A 3RAJA 4RTJA 1QHFA 3OZDA 4XCVA 1SGWA 2GF0A 1SNYA 2J5XA 4WZBB 3CURA 2DY1A 3LL4A 4YQYA 4YVFA 4UXJA 4K1LA 4Y6GB 2RAVA 2QRHA 3ZZ0A 5B2EA 3ZBQA 1KOJA 4GXNA 2EW2A 3CH4B 4Y3UA 1Z5PA 3ILHA 3NTLA 3ZBUA 2RCNA 3QI7A 4LBYA 3WGZA 4JBYA 5JBNA 1KSFX 3B7GA 3O7MA 1SEPA 3ZXIA 5IHPA 4ZQIA 3NOQA 2QROA 5T8KC 4HRVA 4RC9A 3V34A 3NHWA 2E6UX 3K5HA 2VTVA 4MW7A 3CLRD 3DV0B 3K8OE 3ONDA 4YJ2F 5AVXA 5B7PA 3R0QA 4DC1A 2XXBA 3ZWWA 3UA4A 1JG7A 2ZFUA 4L7QA 5FX2A 4O4HF 5FTMA 1AGYA 2X4GA 4M60A 3U7GA 4G2TA 4OUDA 5IBCA 2BGNA 2NYAA 5LNK6 2R5FA 2NSLA 4QYIA 1GARA 3MCVA 4N18A 3M6AA 1QZUA 2VYVA 3N6XA 5AOAA 3DF9A 4CMCA 4KAFA 5FT9A 4UNPA 2ST1A 5COAA 1OHHA 2QPLA 2R3SA 5IXSA 4E12A 5HHTA 4QDOA 3BGDA 3BRQA 2FSFA 1R9GA 2PFGA 1JKJB 1FUUA 2DFNA 1SIBE 2WVAA 3GDHA 4K03A 1VL6A 1W4RA 2WVJA 3WISA 2XMGA 1QAQA 2LPMA 3ZW8A 3E8XA 4D57A 2RC5A 2OK8A 2XTZA 4TV8A 3HPQA 1LA2A 2OAP1 4JELA 3IAM1 2QM0A 3PNKA 1GPYA 3DB2A 4J1SA 4C6TA 1GG9A 3KHTA 2GRJA 2W2TA 3R40A 5I8WA 1RAAA 1XTUA 4A26A 1TCVA 2FG6C 3M81A 4HDMB 3P0FA 2IGTA 2YNMD 4FMCB 1IJBA 1WJGA 5FA6A 1Z0SA 4CLDA 1A82A 5CDSA 3EXIA 5CFZA 5EJ5A 4FHCA 2ISSD 4PYRA 2YHAA 2I8AA 4G5OA 4OMFG 4E70A 3H5OA 3OTIA 1M2HA 4FQ7A 1RYZA 2YXLA 5B58C 1N8KA 1P7ZA 1F4PA 2G7ZA 2OR3A 3GU3A 2QLNA 2C4UA 3AHCA 3GD5A 3P9PA 4JXXA 5DHUA 5GV7A 2SKEA 3O21A 3KFVA 2ZB4A 1LNSA 1OV4A 3OTWA 4HC4A 2UZAA 1IBRA 4NPCA 2H9IA 4NNJA 1FP2A 1JPUA 1KAGA 2DQZA 5JDIC 2FWMX 3BIXA 3DQZA 5J1SB 1THTA 2I2DA 5HE8A 3VGJA 4FYKA 3FNBA 4U7GA 1QYIA 2UYGA 4V2UA 5IK2D 2PVPA 3QEOA 1K86A 2GK7A 3WWCA 4Y2VA 4TWAA 4BQQA 2ZIXB 5IDWA 1R74A 3OC6A 2ATIA 1RYMA 3MTIA 2VP4A 2WP8J 4MH0R 5JMOA 1RBMA 1CXZA 4CEHA 4PXYA 1QK5A 2C54A 3PKZA 4ARZA 1I3MA 3N58A 3I8SA 5IFLA 2P3OA 3SQWA 2C2XA 3AUYA 3FCEA 4NJOA 4NV1A 3W3AD 4COOA 4YPVA 3COSA 2Y99A 3L43A 1U99A 4LNAA 3TZBA 1E6MA 1LVGA 2ID7A 2O8DB 5TPWA 5KNDD 2J3LA 2OWEA 3IBGA 3WMWA 2GPWA 2A9RA 4M1OA 3ANMA 3ONFA 2IHJA 1NONA 3IKLA 5E2BA 1VBNA 1A2KC 3VX4A 4OLFA 3WIUA 1I01A 2FVYA 2GT1A 3KQPA 2CK3D 4M0LA 5ARCA 3MEQA 3U1TA 1JLLA 3WP1B 1VKOA 4NJEB 1FNSA 3CVXA 2AHOA 3GFSA 4DRZA 1MTOA 2VYQA 4WECA 2Q2NA 3LHFA 3OM1A 4FYVA 4HWKA 4MV6A 2YHIB 4PHCA 3SKVA 2ZR7A 1J97A 3QOXA 1FTNA 3B8HA 4ARVA 4ZIRA 1F7VA 4B4VA 5KQSA 3JAMA 4EA9A 5JMTA 1EHIA 1S7CA 4G0PA 3H8WA 1JYSA 1AUXA 5TS3A 2CDBA 4Z7NB 2X0JA 2ID9A 1NQVA 1ZMBA 2YBDA 2CJYA 3H2HA 4ND8B 2UZ1A 3IUMA 4W5JA 1L8XA 3N5KA 3EODA 3ZXUB 3FAZA 4K9KA 2WRZA 3D8HA 3K4HA 4TUYA 4HUQA 2FW9A 3AFNA 3L07A 4LYJA 3RU3A 4AKTA 1YZVA 2CE2X 2QEQA 2W7TA 1O5OA 4AAYA 1ZITA 4RDCA 4B3SB 2R87A 4A82A 1QP0A 1GYRA 5L6MB 1QQ7A 3LS2A 4MP6A 4YCJA 1PAUA 2OWDA 2Q4RA 1ZVVA 1ZOPA 4FHDA 3LI2A 3LPCA 2D13A 3TJMA 1SHJA 1UODA 4EJ2A 1TYZA 3BIFA 4JSRA 4EVIA 1LSOA 3CH5A 4Z4EA 4XGNA 4JDUA 4CNBA 5LZ2A 4XH9B 3F6CA 3W79A 3QUSA 5CFOA 1CS4C 4OU5A 3U6KA 3L49A 3PC6A 4J3NA 3G1TA 3DL4A 3I53A 5CDGA 4RANA 2VJNA 1JIVA 3LWZA 2GN1A 3A25A 3DFFA 2RH5A 4GVXA 1TUGA 3T1OA 3E53A 2H0AA 4QASA 2I87A 3A1WA 4LY6A 2YL2A 1PR2A 3VNRA 4RV5A 2ROQA 4CV1A 3EIEA 4TKMA 1VP3A 1CS0A 1N2OA 2FDXA 4IIJF 2B8EA 3LQQA 3ZVRA 4H08A 5BSUA 1REQB 4UUQA 1THZA 3AK4A 3FSJX 3L92A 4FYHA 2HXSA 2J08A 1SFRA 2GA9A 2YWJA 2Q27A 2F3RA 1Q74A 2DGDA 4ZEVA 4YGYA 3MOSA 4PM4A 4UJ5A 1A5TA 3FTNA 3KPUA 3TCXB 1Y6GA 3OPYA 4LRYA 1CQIA 1QDUA 2D8MA 1LPPA 1YB2A 2ECPA 2H2AA 1PR4A 3DA8A 4GDMA 1XPUA 1UKZA 3IUYA 2PU5A 4N8DA 5CD1A 1V0JA 4Q34A 1ES9A 3EA5A 3DXZA 4L50A 4QJ3A 2HV9A 5LZ7A 1H85A 4RXTA 5EGNA 2EVWX 3OCYA 4ALNA 3MWFA 1KIFA 4KQMA 4AO8A 4DQDA 5IASA 3KHUA 4D6PA 1J56A 4N7MA 3E9MA 1QGZA 3AF1A 3R3HA 2CCKA 3WHLA 2JIZA 4L9RA 3WYAA 5A4JA 2J6HA 5MN4A 1BGVA 5K3FB 2L2QA 1AGNA 3QY0A 1HRDA 3O3CA 3CFYA 5BWOA 1WHTA 2JCGA 4G9EA 1CUZA 5FL7D 2DWQA 3I32A 4DSOA 1X38A 4QOIA 3EPJA 2QT0A 4WADA 3K70D 3ZOZA 1X2EA 1GSAA 1JR3E 3B6IA 5E1DA 4EW2A 5A3RA 1RWOA 4M1TA 2LP4Y 1KRXA 2XGSA 4KKXB 1NPDA 2R8BA 1ZDMA 3U3JA 1RNLA 2AEFA 2CLOB 3CUVA 3LV8A 1DO2A 4H77A 4ZVMA 4ZZ1A 4BY9E 3FVTA 2NZUG 3Q3GE 4NE2A 4UTZA 4F45A 4Q3KA 2FW8A 2YFQA 5JXWA 1WY7A 2FB9A 1X9IA 4EW1A 5AVWA 1GPMA 5EJ2A 5HBRA 2JGEA 1TTPB 3RT1A 5ICFA 1Q0TA 3WKEA 2COUA 4QXQA 4BJ1A 1U2DA 1CC1S 2VOEA 3EVCA 3GZNA 2CHVA 3EG5A 3ROQA 1EUYA 5CK5A 2GAIA 1E2GA 5FPQA 3JQCA 4MW2A 3TDNA 1RYNA 3ZIUA 4O63O 1G2OA 3ZCUA 3CPJB 3ICQB 2BEUA 2JFZA 4PHHA 5B30A 4KH0A 4L3OA 4HX9A 3OZVA 2YJGA 1J00A 4TTRA 4IKOA 3M1AA 4M9CA 5KB3A 3AG5A 3HCOA 3CMMA 3Q85A 5KSYA 1FJ2A 1WHSB 3MOGA 5AJWA 2OG2A 3C8MA 5LD2B 4BFTA 1FXSA 1AT1A 5JROA 3ZK9A 5KYWB 4GM4A 5A0TA 1UQTA 3NIDB 4R1NA 5EGSA 3ADPA 1QYRA 4BKUA 3K2BA 1YNOA 2E55A 1DIHA 1Y1PA 3CX4A 1GSHA 3IKJA 4HH4A 4MQEA 4MVJH 5CH8A 4BYMA 4BECA 3NNSA 1AN0A 1HQYE 4K9LA 1Y8QB 4JD5A 4KLCA 2CZGA 4NY1A 4Z7QB 2XB8A 1HKHA 3KALA 3AR7A 4NICA 2RJOA 4KV9A 3AV3A 1LFDB 1UZLA 2ZPAA 1T4CA 2DWOA 1I7DA 1DBIA 1YC2A 1C1HA 2QSJA 2XNDD 3OE7A 4ND7A 3BJRA 3D2CA 5E0KB 3UN1A 2XA1A 1N6IA 3JASA 1SHUX 1T3TA 4HFNA 2JL1A 4LOKA 4AECA 2BVNA 1ABBA 1OWLA 3WGMA 5IUNC 4FN4A 3QHPA 2PR7A 1U0TA 3O84A 2ZXEA 4MNTA 1PJZA 1E0JA 1J9ZA 3K53A 2MINB 4PSUA 1GLGA 1MB3A 3HNOA 1SC3A 1MN6A 3VDRA 4E5DA 5JSUA 2VF5X 3I6YA 3T3MB 1MC4A 4XJVA 1YS2X 4M8LA 3ZQ4A 3FM9A 2XWQA 3FYTA 3LXMA 3LZ6A 5ALVA 1XHEA 2X8JB 2QDXA 5C8XA 3LFHA 3IJ5A 1DAFA 1CERA 3QA3E 1OH7A 4F04A 1EX6A 2ZGVA 3TLXA 4CM1A 5K0NA 4V3BA 3U3XA 3HEBA 4OX9B 1RBZA 5K0JA 4LG1A 2Q5FA 3O47A 2NX2A 3I8XA 4BU1A 2XCLA 1CJTC 2HBYA 3G8AA 3OECA 3V1YA 2I1LA 4NYIR 3IB6A 4A0QA 3O2QB 3U1VA 4UULA 1I4WA 3GUHA 1P33A 2EKZA 2VDJA 1P45A 4UFOA 3I9FA 3EIFA 4RKRA 5BO5A 3MJVA 1VHWA 4MI9A 4FGSA 1DKRA 1DBWA 4LNHA 5D1HA 3DFMA 3LLUA 5EIOA 2CYBA 2FP4A 3MK31 3DT8A 4OHOA 5LB4A 3VHXB 5C8YF 1UOEA 1EH5A 3D4LA 3PTZA 3X1WA 1HLFA 1D4FA 2R7NA 5L4NA 2GN8A 2C2MA 1CR4A 1D5WA 3CW2A 5DM60 2QR3A 2ZCVA 4LYEA 4FYIA 4ENTA 7YASA 3NNDA 1OXVA 1WF3A 2VEDA 1PYGA 2W6PA 1HT0A 1KFJB 2PT9A 3O9MA 5TGTA 2NU9B 5F5NA 1QHHA 2Q62A 3KLMX 5AK0A 5C7LO 1V39A 3CCFA 4HAZA 4C20A 1KGSA 2WG0A 5HCIA 5KO2A 1Q1BA 2PJRA 3O92A 3HA2A 3DZFA 1Q12A 3JYNA 4JASB 1H94A 4RABA 1E77A 1IMJA 3U17A 2X0DA 5LOVA 1KP2A 4DUGD 1JHOA 3GEDA 1POWA 4ISBA 2A30A 1W0JA 1O7JA 5TF0A 4U8HA 2N9UA 2ADMA 2P6OA 4LC0A 2JD2A 3WIEA 4CE6A 5A0VA 1XDWA 1IBLB 4GQAA 4LOLA 4LJAA 1I3OA 3RV3A 3UK6A 3HKCB 1QGYA 4G0OA 1RM3A 5GJWC 1W49A 5JY1A 4O4JA 1DRVA 2IZZA 4D9EA 1NJGA 2Z09A 3EIHA 3HXTA 3QW2A 3KLPX 2Z98A 4O02B 3P9SA 4X71A 5MFPA 4B9EA 2UXCB 1RYEA 2W71A 3OM0A 2B4AA 2IPXA 3BFVA 4DJFC 5BN3A 5G3YA 2XIJA 3LOUA 2VXBA 1KZ4A 3OPQA 2LZ0A 1FP4B 2XA9A 4IDGA 4OQ4A 1VL1A 4IKEA 4S2UA 1OJLA 1NT4A 2Y1GA 2K2WA 4CG0A 1ZH0A 2IEIA 4G67A 4BLRA 2IDJA 3S40A 4HVCA 1NZFA 1X7WA 2FDRA 4RAOA 2DFDA 3I4LA 3RKSA 2XOXA 1KY3A 4L51A 3TRKA 3HADA 5LDDC 3H13A 1JNXX 4AZ0A 1I7NA 4FLMA 3TXAA 1RAEA 4YAJA 1AM4D 2E9SA 3ENQA 3H0CA 4J7XA 5DGTA 2H2DA 2DKFA 4MUJA 3PQ8A 1UC4B 3SJBA 1IZYA 1ZGHA 1YHZA 3M1LA 2ZI5A 2H07A 3EISA 3Q5EA 4FI3F 4J49A 3KEGA 1V8OA 3GI1A 4MLZA 2R25B 4FR5A 1HETA 4X3OA 3PLNA 2Y0PA 1W93A 3AYZB 4RPKA 4D4LA 1UKAA 4ZJZA 4MCIA 1NC1A 1GNVA 2QU8A 2O3QA 2YWBA 3F8SA 4KXUA 3TLMA 2WQ7A 4X93A 3NO4A 3ER9A 4CCYA 2W2NA 2ZRCA 1V95A 2YKGA 1R6VA 1AV7A 1VHLA 5AHWA 4ZMSA 2D62A 1HE2A 1ORDA 3A6HA 4J6FA 3ICVA 1CUJA 2R6HA 1RJ9B 3AESB 4Q3NA 4WPGA 1JEYA 1Y3FE 1E3WA 3E1KA 1RE1A 1C80A 3E4CA 5E6RB 3UBTA 3THXB 3L6OO 1PZEA 3L6RA 5F23A 4AWAA 1FFDA 3HCFA 521PA 1UBJS 3W4KA 4CQMA 3SZLA 2BLLA 4DR1B 5FWXB 5L9AA 4HNHA 1H4QA 3VC1A 1YBFA 3I2FA 2F9FA 2QMYA 3AW8A 2FQ1A 4BGIA 4KQHA 5A4AA 1HLDA 3A3OA 3KJQA 3NPAA 1YC5A 3GNLA 1ZHFA 1K97A 2FH5B 3FRIA 4XB2A 4N5LA 3ANLA 4IVNA 3OQMA 1X2BA 1X7GA 2UYHA 3TSZA 1PDWA 2NNLD 3A36A 1M74A 4KOEC 2ZYAA 4AUKA 2H4JA 2NUTA 2OOKA 1NNLA 4UZEA 5LQJA 1E5TA 1FF9A 2WA1A 4RA9B 4V24A 4C4SA 5KS2A 4DIMA 1ZD2P 4H1HA 2E4XA 3E9YA 1OCEA 2X0FA 4MP3A 3ZKWA 2I55A 1L9KA 2JIBA 1A71A 2EZ9A 3HGTA 3LBHA 3WJAA 1K3FA 4A5SA 5BQPA 1KXJA 2Q3EA 1IRIA 3VOSA 4AWXA 3ZNQA 4LF9B 3ELBA 1XNHA 4MVJG 1VIMA 5FCDA 1ULAA 3ONVA 4Y8VA 1YRHA 4FJ1A 4R7TA 3UHPA 2GA8A 2IUSA 5GIOE 4XLLA 4O4IF 5KCZA 1KEUA 1T43A 4LXTA 1QGAA 1XWFA 3A4TA 2CUTA 4YO7A 3NGMA 4AG5A 1ZM2A 2XKKA 1PZHA 3OWHA 3FRJA 4QTZA 3QXHA 3UXEA 4A92A 3V48A 3CSDA 1C3EA 4PTLA 1WXIA 4IOLA 4ZRDA 1RHRA 1OGJA 1PW7A 1Z75A 3KCNA 2EFYA 2JJ1A 2NVUA 3HXQA 2ZM5A 1SUEA 3BXXA 1YVUA 5AKZA 3TLZA 4LBZA 1I10A 3M9LA 1SAYA 4WOJA 1JG2A 1XVLA 3DMHA 3KEQA 3K9HA 3K9CA 3OFND 4I2NA 3WIVA 3DDUA 2PT7A 5FD8A 1H22A 1G63A 4Q05A 1J0BA 2Q0HA 3DHYA 3I9V1 1M1NA 3G2QA 2I66A 4ZICA 3WNQA 3BHJA 4REMA 2QD4A 4KN9S 5DOVA 3MTDA 3H6HA 1QONA 1NTRA 2LBPA 3DPSA 4DDMA 1Z2EA 5JYDA 4OBBA 2V4UA 2XUIA 5EYPA 4LZLA 2BE9A 1KVQA 3G5AA 1XQVA 3B6ZA 4GL2A 4PZLA 1TZ2A 2RIPA 3WYFA 5HR5A 4GD3Q 3N8GA 4MJXA 5HQTA 1IMOA 2WWYA 2UV8A 4I4TA 1YJBA 1U3VA 4W1PA 4L3VA 3DYVA 3PGLA 1CP2A 2D2VA 2WJVA 4QHSA 3TTSA 4O6VA 4EHJA 4IPTA 1ZIOA 3HJUA 3NHKA 2WJYA 1R8YA 3H5VA 1CUIA 1SIOA 3KPYA 4MX8A 5L8VA 4MPPA 8ATCA 3TGLA 1EIWA 1KH1A 2WG2A 4TTVA 2GBLA 3WYNA 2PCLA 4TMWA 4W9NC 3UQYS 4UTPA 1PNOA 1WSWA 1MNAA 1U0LA 1YB5A 1KXZA 1P8JA 1IN7A 1RI1A 1N5IA 3HU3A 5AKHA 4EPXA 4EOGA 2Y68A 4F6CA 1FFBA 4E3WA 1LNZA 1XCJA 3AIIA 3X2SA 3V3KA 2I3AA 1SVWA 1PFQA 1YDMA 2EATA 4AQDA 3QLUC 3N2GA 2F8SA 4RH1A 4KWIA 3QUTA 3OSUA 3VZSA 4K6CA 6NULA 3IH5A 4PG7A 3HGMA 4B75A 5IUKC 1EGVB 1P4SA 4OJYA 1Y82A 2B0JA 4LSWA 4CF6A 3OG9A 4M0FA 2B69A 2RMKA 4I46A 4TQUS 3H16A 3NV9A 1Z2PX 1KKUA 1YZQA 2NACA 4FMDF 4JA2A 4TTAA 4UEOA 4PV7A 3EGDA 3DVAA 2A9QA 3UJBA 3S6JA 1GGJA 3ZHBA 3EZ6A 2X4IA 3MYYA 2OZVA 1E0AA 2A84A 4LRSB 4UAUA 3E18A 4O8CA 4AJEA 2HLNA 3SDZA 2BFCB 2VRNA 3W8FA 5AM1A 1NNUA 1B23P 1AD2A 3TLJA 1B7GO 2IOQA 2AGVA 2F59A 4ZOAA 3SK0A 1R18A 5AYVA 5C1IA 1RRGA 1T1GA 1WUYA 5ADWA 2DE0X 4IUCS 1LX6A 4REOA 1PUXA 1Q7CA 1X70A 3OU7A 4ZO8A 4EW3A 5H7XA 5LSAA 4DABA 2AJ8A 3HSSA 4IQFA 3B70A 4RD3A 3V6LA 4ENUA 1BXRA 5EY5B 3TYXA 4LJ4A 1GZ4A 3SICE 2Q4BA 3E9QA 1P4JA 3KQUA 4D97A 2H31A 4KLAA 4Q3AA 4XJSA 4H3SA 3B1YA 4O4LF 4AFNA 2AOTB 1C0LA 4NJMA 4X20B 4YN3A 4Z2AA 5LFAA 1YA6A 4H4EA 5EIAA 3NTUA 3A7DA 3Q12A 3T9BA 3ZTWA 3BE4A 3K6RA 4FN5A 3BMQB 4XUCA 4UTRA 1JFTA 3QITA 3WQSB 3KSDO 1M5TA 1RPZA 4E5PA 4EUFA 3C6KA 1BC5A 1DT3A 4LZOA 5TV2A 2FWJA 2OP0A 1QIJA 1GUAA 2XCTB 1N8SA 3CW9A 3BA6A 2P41A 4M8SA 1H2RS 4XDGA 4CMHA 4U7WA 5BWMA 3AHIA 3K96A 5CLQA 2IS1A 2WIDA 3T3EA 1STOA 4INOA 2LDXA 5KWVA 4PO9A 3H5IA 3MGCA 1PKEA 2O5VA 4NBLA 3LVFO 5IHXA 5ALKA 2B30A 3O3MB 4DA6A 4AJIA 4UM8B 3KNZA 1D1QA 4BEVA 3E5RA 3TW4A 1P0IA 2PKEA 5CEEA 2PPLA 5A71A 3OZUA 1MLDA 1Q84A 2F2TA 4HQFA 1OVGA 3BFXA 1VIYA 4GVLA 2V55B 1B1CA 1YULA 1E2UA 1F0YA 1IHOA 2ZAMA 1VHQA 4DBVO 3GH3A 2GJSA 3PXCX 1XKTA 4TKUA 4IDHA 4HSEA 4BUCA 1G4AE 2WKWA 5C5IA 5B6JA 2NLOA 1VI6A 2RB4A 3ZNOA 1OFVA 4GRAA 4N03A 4P7JA 3RBVA 4DYHA 2ZLBA 3HUEA 4R1SA 2G4LA 4GWGA 1NC3A 1BHO1 2E1PA 3M5PA 2FDCA 3H1FA 3RT7A 5B3JC 3BXOA 3JPWA 1ADGA 3WNBA 4JUDX 2YW9A 1VSVA 5FPPA 2R6AA 2NM0A 3EZFA 5FAXA 1BEUB 3KQQA 4GOJA 1KETA 4P38A 2O59A 2EKBA 3DD1A 3MWGA 3DPUA 1HH4A 1M2VB 3I09A 2AH5A 1LPBB 4DJDC 2GSWA 4BFWA 5HS4A 2I1VB 4QHYA 2OHOA 5EMHA 3HV2A 3A06A 1RRPA 3QTLA 4A2PA 2P5YA 1E1LA 4ZAFA 5KNCD 1MB9A 3C5HA 1SY7A 3MZ0A 5FYDA 4OEHA 3IAAA 3E9CA 4ZOLF 3RVMA 4F2WA 2Q41A 3X3HA 2GFQA 4IXTA 3SYRA 4M1YA 4GS5A 5SYAA 2JLRA 4D46A 1PWXA 4PWYA 1J99A 1JLHA 4LOJA 2R66A 4TV9B 4X6LA 4CKBA 4C7MA 1RU3A 2B3TA 4X1KB 4PN7A 4UMDA 5DYIA 1M8PA 2I6QA 4FMBB 4QXMA 2VT7A 3P19A 4IINA 1U7HA 3NBMA 3BBPA 2UXBB 5AVKA 4KN6A 2GYWA 2X7JA 2CLHB 4ZT6A 4K81B 4O1IA 3AI2A 3BT7A 6ADHA 2PMEA 4KR7A 2Y0DA 2XZLA 3GQBA 4MINA 1XMVA 2O05A 3V00A 4DVGA 3BL6A 1RI4A 3RVJA 2PUWA 3T15A 6REQA 1JVNA 5D3MB 1XRNA 3A0UA 4A2WA 5ALHA 2FPRA 1G60A 2BFFA 3JQ8B 4BNDA 4N01A 1RHMA 1BOFA 1C3LA 1YI8A 2JIOA 3PPYA 2OA0A 4WGGA 2C88A 1D07A 2GILA 2HU8A 1TU4A 2RK4A 2ZRPA 4MCAA 5U4XA 3UKJA 1EESA 2NUPB 4ICIA 1A4RA 2RJ3A 3A70A 3Q1LA 4YV2A 4GPTA 2CL7X 2DFVA 1JQJC 2WT8A 3IO5A 3P0JA 5A3VA 4EL0A 1UBUS 2PANA 3QVGB 5DP1A 3RLFA 1H1DA 2Z8YM 2Q9BA 1Q92A 2EFEB 4UBOA 2GCGA 1R5OA 3H86A 2HJVA 2IEDA 3D7RA 1JKIA 5DHRA 3AFHA 3AYXB 4E1AA 4UU1A 1GCAA 4UQPA 2VHUA 1OFTA 2YVKA 1IOWA 1ML3A 2ZWIA 5BT9A 4F4FA 1S3SA 1Q0HA 1CE8A 3ESXA 2F00A 1Y9ZA 1ZNZA 1TVKA 2XUDA 4MS1B 2QL9A 1EHCA 1U0FA 3UQZA 4FOTA 2ZJ8A 4H1VA 1IY2A 3ESAA 1VECA 1FDTA 2ODBA 4Q6BA 1I94B 3D4BA 5CXXA 5IVPA 4W1QA 3GFFA 1C9YA 2I6UA 5F1OA 3CTMA 3KEFA 3A28A 4RY0A 3EIXA 4O8ZA 5BXYA 2Q3CA 2RARA 4HYQA 4J4TA 5ECGC 1EGMB 2GNPA 3HVKA 1RC8A 3OQIB 4MHSA 3I2HA 2ZTMA 4Q9JA 3QVXA 1PDOA 2VH2A 5AW9A 2QWXA 1Z4NA 2IU3A 2UVQA 3DNMA 4IH1A 4TQ9A 5EJAA 3NBKA 3E7PA 2JLZA 5GONA 1M2EA 3CNLA 1L5YA 1JJBA 4P2BA 3K72B 4X7BA 1E8MA 3D64A 1WA5A 2OAEA 4QU5A 1ZMTA 1E5VA 2NXEA 3CKYA 2PK3A 3PUXA 4WKNA 4DT1B 5BUQA 1Z2NX 2QN3A 1ESEA 4YFYA 2O23A 3UV7A 3DHWC 2YZNA 3OUUA 5FEUA 4UTNA 4ZI7B 4BMPB 4U9HS 3PA8A 1OXMA 2VHCA 5KHAA 2BHTA 4QGFA 3PUKA 5IULC 1PBTA 1DV1A 5JZMA 4QTYA 1E1MA 3HCDA 3WLPA 1YKSA 1U81A 4U1RA 1W34A 3L02A 3X1YA 5K8JB 3PI7A 1FL9A 3RSLA 3U60B 2HEIA 1ZAYA 3MB5A 3AQ4A 3O2JA 5MGBA 3O4JA 2GEDA 3FW1A 2NUBA 1TKBA 1R8XA 2O0LA 5EZYB 3HDGA 1F6WA 3G2PA 3GBSA 2FMXA 1P2DA 1WKBA 3D54D 1KPGA 2AMVA 3LOQA 3OCCA 3ZXSA 3WYDA 4BWFB 3BXEA 3TRHA 1FMLA 1W96A 2H2FA 2WEKA 3F71A 4JC8A 2BDTA 3I05A 1ICEA 3AVYA 1RBQA 2ERYA 2BFOA 2C3UA 3PWKA 4WNAB 4OLAA 3I42A 3SSOA 2BY4A 4MVJD 1XK6A 3ZZUA 5F4ZA 1DBQA 3H9CA 5J2TA 4I08A 2P9FA 1KHTA 3T3PB 4DLWA 1MC8A 2WW8A 4OJNA 5FO0A 2J09A 3PV0A 2BKVA 1X86B 2VP3A 4QA9A 5EIFA 5CYOA 1CF4A 4E51A 5LLDA 4LCJA 5CLJA 3SP1A 3HA7A 3JQBA 1ZJ4A 3TRDA 1C1DA 5FFFA 5LD2C 1BFKA 2PH5A 1B0ZA 1JJVA 3P9IA 3QEMB 4TSFA 3UJPA 4MO2A 4AP9A 2KE5A 4IEEA 2LR0A 1SPXA 1A96A 4JLBA 5E8JA 3QFSA 1EXMA 3GNSA 2NPIA 4XSHA 5IH3A 3L4SO 4K3UA 3OBIA 4IWYA 2VT2A 3AETB 2XUJA 1TCBA 1MJ5A 3GMDA 3L7BA 4MMZB 5JWRA 3ABIA 3TR5A 3HU2A 5ECYA 3C1OA 4EG1A 2GSDA 4FDLA 3G0BA 3VNUA 1B8UA 2V5VA 3SR4A 2HRDA 3V1NA 1X9GA 3A4MA 4RIFA 3QE9Y 2X5NA 1BKYA 4N48A 1GGVA 1GTZA 5ALZA 4FX5A 3TXYA 4B85A 4CF5A 3TX6A 3TLGA 5IKMA 1WZNA 2GASA 2PIDA 2QTNA 3DM9B 4HQ6A 4MUYA 3SXUB 2R8EA 3C1AA 4DCOA 3L0CA 3V8MA 3WLOA 1SVLA 1PF7E 2GAFA 3W4IA 5FR2A 5B1SA 3BQNB 1ZLXA 4JR1A 2X9GA 1I4TD 1CW2B 1TQ6A 1VLZA 2ZI6A 3PRHA 3X1JA 1G5TA 5LQMA 1H42A 2PTGA 4BNIA 2AG0A 4EHBA 4G5SA 2C5AA 2HMAA 1QCZA 5SICE 1N9GA 2EBWA 1ISSA 3HRIA 3CX7A 1ZINA 3MC1A 4DW8A 1F5SA 3TINA 3LA8A 3OE1A 5AH0A 4U9IS 3PC4A 3LK7A 1SXIA 3DLPX 3EQZA 3VZBA 1CUDA 3DWIA 3LY7A 1Z06A 1E0SA 2K7ZA 1DC8A 2PLNA 4RDIA 3VV3A 1MJFA 3V46A 9LDBA 3QXJA 4DQXA 3ZPXA 1AKRA 1QTNA 2AEEA 2ZRQA 5IT5A 3HJBA 1JDTA 5FJIA 4Q1AA 1DBRA 1JU9A 3VSCA 4FFVA 1Q1AA 3L06A 2EX0A 3LTNC 2PTHA 3E35A 4QQFA 1GN9A 4OJTA 3SQDA 4F8EA 4BNUA 3F5DA 1XDDA 3FYDA 4L15A 1OLOA 1L1EA 1SU6A 2CXSA 2G83A 1G8KA 1KEWA 2O3UA 5EKXA 2QAGB 3EGXB 5LA6B 1JBQA 2GI4A 2XE4A 2HDWA 4QSHA 5EWLB 3D3WA 5KZMB 2P6MA 2VFAA 2AUNA 4F1JA 4X60A 5A6SA 2DCMA 1J8QA 3DLCA 4PZCA 3ZCPA 2XITA 1ZD5A 2PJZA 3F67A 2XWBF 4YUZA 1JFSA 1GA4A 1SQGA 1OC2A 3I0MA 2FN7A 2Y67A 2YY7A 4BX3A 1F14A 1H2BA 1Z0FA 1F1BA 2BP7A 2C31A 2VOJA 4P84A 4ALIA 3D3EA 2I5PO 4L85A 2M6SA 3PFFA 1A9XA 1RPTA 4PN3A 4KRGA 3UWSA 3F96A 3H9GA 1ZUHA 4IOMA 5CVUA 1GHTA 4KUGA 3LSTA 2Z2ZA 4ZJUA 2XOEA 3NJ8A 4HWRA 3B36A 2Z5VA 1XZLA 2BEVA 3BWXA 1ZUIA 4NU8X 2DWUA 1ISJA 1VDZA 2RFLA 3LY8A 3OD1A 3VO8A 3O03A 1WCV1 3FPSA 3ZTYA 1IPEA 4BO0A 3F7MA 1E3JA 2INGX 3AY3A 2AFHA 1OLUA 1IOVA 2B92A 3OHMA 2B5WA 1AVTA 2JFUA 3RYHB 2AMLA 4YRTA 2EAUA 1WB4A 3AHFA 1W2GA 3CH6A 2LW7A 2QTVB 1I4LD 1XD8A 2PSEA 2YWGA 3AVOA 3MG9A 3RRZA 3RYTC 2HJHA 1RM0A 3Q7QA 3HKEA 5FLXA 3B9RA 1V2GA 3VNBA 1QJCA 4NXNB 3VR2A 5J4KA 5CDHA 2M6RA 2BDUA 3CU5A 5EERA 3PF9A 3QVOA 4YPFA 5JNVA 2BFDA 2V7BA 3FH0A 1EXNA 4KBYA 1OSNA 3ND6A 4JJAA 3H5RA 3IPYA 3M6IA 4GWLA 2BV3A 3A1TA 1PLLA 3HBAA 3Q7EA 4RACA 1XFAA 2JGRA 2Q45A 4PR3A 3KZOA 4JLOA 5H59A 4MWBA 4PPQA 1R4MA 2OZLA 4FKZA 3A4IA 1CLEA 4EYQA 2OBXA 3VSBA 3AIKA 3ZDYB 4BLTA 1G4HA 2ZSBA 3VH1A 5KOIA 3LC2O 1J5XA 1OBFO 4LXHA 5A62A 1FLNA 1GQYA 1L9XA 1Y48E 3NT4A 1E9BA 1Z16A 2CVOA 2E48A 3E48A 4FT4A 4MUEA 2EF0A 4WXMA 4PC1A 1O6ZA 3OWOA 1G59A 2OFWA 1M8GA 4QVIA 2VPYA 4XWTA 4NV0A 1TTTA 1UM9A 3BCUA 3AVVA 2PNFA 4XOIA 5K0BA 3R7LA 1IUOA 1VG8A 3HFRA 3OTGA 1Z7BA 2H4YA 4RL6A 3Q9LA 5DLQC 3EAQA 4DB4A 3AR2A 2I54A 1X7HA 4BBJA 1E7QA 1A1SA 1G5PA 4FR0A 4B3BA 1L5HB 3F78A 2O2CA 1W581 2R62A 2MTBA 3DV2A 3V80A 2VKQA 3VU8A 1PVDA 4OXQA 5J1TB 3G8CA 3H9UA 3BMNB 1UFRA 4P0TA 3VYSB 5BURA 1B93A 1FDIA 3GAAA 2KS6A 3MBIA 4CKEB 2GM4A 5LN1A 1PW5A 4OAQA 3WDSA 2C2WA 2SICE 5M2QA 5D7NA 1KEEA 3AR5A 4NLLA 1FQOA 3KAPA 3L7LA 5GZ3A 2JAUA 1H8EA 3SG0A 1KBOA 1UJNA 1UP6A 1Y6JA 7ABPA 3O5AA 2QSUA 4QRDA 3GFOA 4U7DA 2N42A 1HR0B 1C9DB 3CT4A 3MWJA 3Q7SA 4QXOA 3NJRA 4RSGA 2C4MA 4ZA2A 3U80A 1E1QD 4JJZA 4AROA 1NLZA 2JH3A 3L9WA 5E2IA 4Y7DA 5CHYA 3OMWA 1OF1A 5FBZA 1A76A 3UUEA 3VBEA 1UANA 1UUFA 3G0OA 5AI0A 4R41A 4YQZA 5E9JA 3UFXA 1Q6ZA 1R6BX 4M7WA 4EGFA 1ISMA 2EQBA 1ZC4A 4K05A 4GUDA 5CLLA 3QPWA 3Q3VA 4UMVA 1E5QA 3KOMA 2G1JA 4TUYB 1QQ6A 5DNCA 2R97A 4J2TA 4QDTA 3G0HA 1AKQA 4KAJA 3ZE8A 2AE1A 4QNRA 2IWRA 4NENB 5KWEA 3SWWA 4L5JA 4HAYA 2HMUA 1FUEA 3SZOA 3HDQA 2RGXA 1LS6A 1O0SA 3UW3A 4DNQA 3VR0A 1SVOA 2DLNA 1IBCA 1LLFA 1XZGA 3ND7A 3RWOA 4OATA 2FQYA 1FTSA 4WJKB 5LP1A 1RLUA 3QE3A 3F6SA 4H6XA 1XPRA 1WSDA 1K2VN 2MWMA 3LPAA 5K7SA 1XEXB 3PDIB 2J0VA 1UJCA 2ZRDA 2Z6AA 1NVEA 4LV8B 3K0CC 1DELA 4C4RA 1YQTA 3FTQA 1MQ8B 2VDQB 3LC1O 4NX2A 3AILA 3W0LB 2JVJA 1N1MA 2F1RA 4JLNA 1WDTA 5G40A 1TXGA 4CKCA 2WICA 1HT2E 1Z62A 1G3RA 2ZE8A 4JVNA 5DIZA 4GM1A 5J47A 3S8EA 2JH9A 5IYZB 5FJJA 4JLMA 1M2WA 2YWDA 2P2GA 2G1KA 4H0FA 2HQRA 1RHKA 3T7AA 3C7KA 1RQGA 2ZYSA 3BKXA 3N0XA 3TQRA 3ZE0B 3D6HA 3LHDA 3ZY2A 4FE3A 1E61A 5BVGB 4IO0A 3M6VA 5LYJA 2OHXA 3TQSA 2QLFA 1MO6A 2Q2OA 1KS9A 4EZBA 1UEIA 4HGZA 1K98A 2VQSA 3JYLA 2C3MA 3JVUA 4QFBA 2BBWA 4ZV7A 1VMIA 5P8WA 3UW1A 5FQNA 1O0CA 4KQGA 3NC4A 2ZEJA 1FW8A 1B43A 1NBMD 2CFCA 2V7PA 1AMNA 4WASA 5I6DA 4B9AA 3F74A 4AD8A 4BV3A 5HK8A 1G2PA 1FXWA 1Z47A 2K87A 3MJEA 4QUHA 4FNMA 3F7TA 4P7KA 1R6DA 2BMWA 1J07A 1KQ3A 2M9MA 4TMFA 3Q40A 4YP1A 1BJRE 2A88A 1V8DA 3EY9A 1N0IA 2Y2VA 2NT3A 3IIIA 2PS3A 4GQBA 4M8NE 1DEHA 4CJXA 2IZ5A 3NH9A 1YR9A 1WAMA 1Z26A 2QUAA 3AM4A 3UMRA 1F2UA 4F8YA 5FL3A 1T0PA 4KL8S 3UK2A 3KZMA 3AF4A 4DCUA 4ETNA 4UM9B 4XFDA 2Y9PB 1LC3A 2GHIA 5EZ6B 2YN0A 2RKOA 1SHTX 3GJXC 5CCDA 2QY9A 2IUYA 4DUZB 1YJ8A 3A6ZA 3GLHB 4P35A 5F7OA 3E4DA 2O6LA 4F4UA 3ZLTA 2R7LA 2FEOA 2D5LA 2QOEA 3WWDA 1AOXA 4EZEA 3E22A 4QLBA 4WNCA 4X5OA 3WNVA 4BNTA 2CF6A 3CLUD 5TC4A 2IXAA 3UWMA 4IH4A 2O0MA 3L3BA 4AN1A 3D6MA 3Q8WA 5L7YA 3WGKA 2D59A 2YBEA 3PWTA 2MSDB 4IMIB 4CLRA 3CIOA 2GCIA 3RC1A 1M1YA 1T9HA 4EQ6A 1S1CA 3NTXA 1YGYA 2WOOA 2QGFA 2GM9A 1Z7GA 2ZJYA 2AYYA 4DA0A 1QE3A 2HGZA 2TS1A 1N5LA 3GZNB 4V1CI 1BJKA 2PEZA 3C6XA 5TQ0A 3PXEA 4TS9A 4NDNE 1ENYA 2I7XA 3IVXA 4GVPA 4K6MA 1O94C 4MPTA 2XF2A 2OTCA 3PFIA 1T9DA 3ZJ5A 1NVVR 3NEAA 2HMYB 2P2LA 1FQKA 2X76A 5ADUS 3HH8A 3WLRA 2QF7A 4UOEA 1R9NA 1QRTA 3EDQA 3KKNA 3FLEA 3LLCA 4RD6A 3C8HA 3DBOB 1S9HA 3IHKA 2QD5A 3G5UA 3TL3A 3DOOA 4G0WA 1UMDB 1RQ7A 3S28A 5K05A 1W6UA 4G8CA 1V1MB 5AXBA 3EXEA 4EG4A 3D3NA 8MHTA 2PCJA 4W5TA 3CLSC 4KDCA 5JS7A 3ZYCA 1C8VB 1W48A 1BE6A 3LIIA 3F5FA 3RNOA 2A57A 1LBQA 1XKQA 2WWRA 3WXBA 1B8VA 2QP9X 2VPPA 3GFQA 4V03A 4Q4HA 3SX4A 3SHFA 1RPNA 1T4CB 4DL9A 1IAVA 1SG6A 2VT6A 5L95A 5HRUA 5CX4A 1GKIA 3AWDA 1AA9A 7MHTA 1SXHA 4ALKA 3U4GA 2QVYX 2VTBB 1GCIA 1TLFA 4ID9A 1U80A 5D1NA 1K3UB 1YS6A 2CDRA 4HAVA 2VNJA 4RH3A 5KKCA 3BM5A 1RRKA 3KKKA 1Y7IA 2RI6A 4IICA 4K40A 4PSKA 1DAPA 1KAOA 3A37A 3NBUA 4RZQA 1A7AA 1US8A 1JJIA 1V9CA 3PEEA 1RT9A 1RCUA 3UWOA 4AP6A 2FX5A 3IOEA 4FZRA 5BSGA 1M2JA 5DBEX 5IC6A 3PQCA 5BR4A 3RYCA 4KVFA 2ZCUA 1WUJS 1AZWA 3C41J 2IRWA 3R5JA 1ECFA 4JUCA 3VVLA 3OD5A 3DB1A 4ENWA 1VKZA 1RWWA 1C14A 2NYVA 1CY7A 2W2OA 2AQKA 2X7HA 2YS6A 1UPUA 2NWQA 3OFSA 1E4OA 4L9SA 4TTQA 3T1NA 5J3JA 1YCHA 1E7SA 1KRHA 2BGRA 1PEKE 1RDFA 1XEWX 2O3JA 4KBFA 4R9VA 4RPGA 1Y7HA 1QPGA 3KOUA 4UHDA 1M2OB 3F49S 5DGDA 2GK4A 3JALB 2WUGA 1V7QA 3P2MA 4CG2A 3AM1A 3CYFA 1KGDA 3KL4A 5DNVA 1Z3IX 3L0SA 4AN0A 1CZRA 3NVDA 5KMGB 1N57A 3OZCA 4QX6A 5FBQB 1IHUA 4OY3A 3TZCA 1YS9A 4TYWA 1H3EA 3EVDA 4O2BF 1O77A 1Y42X 1BWSA 1L4FA 3UGJA 1RRVA 5GMOA 2H2GA 2I2AA 3T5GA 3VKFA 3NG1A 4CUZA 1OTYA 3KVNA 4I9HA 4MK4A 5HZGA 4JBGA 1GPLA 2OG1A 3HHEA 1E96A 3PQEA 3IVAA 4WXYB 2BZ0A 2ABWA 3E0QA 3FROA 3BAFA 2BGMA 3NDPA 2C1ZA 4S0ZA 5CH5A 3K31A 4U5XA 5AKLA 2HLDA 2WI8A 3LO5A 4DLPA 1UADA 2BM0A 3PKJA 1J0CA 4AMUA 1FMCA 1IZ7A 2WIKA 3U3OA 1P5JA 2WD8A 3K9LA 3B38A 1W2WB 2QYOA 1J2RA 3R09A 4MR8B 5TPZD 2V6IA 3ZBPA 4BLPA 2WD7A 5JLJA 3H7IA 4YK7A 3KKEA 4KVAA 4BVLA 4Z99A 3THWA 2OCYC 5KJ1A 5LOVF 2G72A 2FWBA 4KIWA 3IUJA 3A6PC 1LTKA 4WY8A 3CE6A 3PFBA 2V7EA 3B3QA 1XVAA 4J0FA 3FDZA 3WRXC 4XRGA 2BDEA 3O7WA 4TN1A 1FY2A 2CB0A 3T7RA 2AFHE 3C5WP 1L6RA 1I8TA 4B3TB 1A8PA 1Q91A 4BATA 5KDOA 1PJQA 2DBQA 2IBMA 2WD9A 3LUPA 3OZAA 1SUAA 4S1VA 2AKYA 2C7OA 2AOVA 4IGIA 1SOMA 4UUPA 4WV3A 1VBMA 3FKJA 1Q1GA 1JYEA 1GT6A 3RKRA 1NYLA 1Q3TA 3FGNA 3ROFA 1LPSA 4EY7A 1QSGA 4WESB 5EEHA 1Z17A 3FZYA 3PFWO 1UPBA 3OH8A 1P7WA 2CC2A 4YJ3A 4DHEA 3MYRA 2ZVJA 3Q15C 2IS2A 4G23A 4DEYA 4WLOA 1Y1TA 5EMKA 1UDBA 2RG1A 4IX1A 3TF5A 5GGXA 4TZ0A 1KAEA 2VQ6A 3FPAA 4FSXA 2RONA 3WHPA 2OE2A 2G36A 2HK7A 2YASA 2I4MA 1VP9A 9ATCA 1DI0A 1WB6A 4C0AC 4AQ7A 3M0EA 3EH1A 4B6EA 4RGQA 3ZQUA 5HKAA 1U1DA 2E18A 2BW0A 3MGBA 4FMCF 4OHZA 1SVKA 1G7TA 5KBYA 4ZANA 1W88B 4RW0A 3B2NA 2MOKA 3GAFA 2AQHA 3JATB 1NL3A 3LE8A 3SY8A 1EIZA 4UQOA 1KY4A 2JKYA 3QFTA 3C8UA 1CQPA 1LBHA 4O2AA 3FNGA 2BCEA 1RP7A 4MUAA 4D9KA 1YCGA 1EB8A 3ML1A 1IK6A 4IVPA 2VJPA 4DV4B 1T24A 4U8GA 3DJFA 1VYTA 1K6XA 5ICCA 5JQGF 5JZVA 4KV7A 3OIYA 4YV1A 1NTOA 2IPMA 1U2QA 5ILOA 2YFHA 4WEQA 3UMGA 4PC3A 4FE4A 2ZS7A 1PL0A 3BMCA 3GAZA 5KOJA 2CNBA 1PKXA 2R7AA 1G4UR 1R88A 2EZTA 2FYTA 4ZVLA 5K0CA 1ZNXA 2YZKA 2PKQO 2ZI7A 1WMBA 4HGYA 1NYTA 5FBWB 3SR3A 3UAWA 1OWMA 4NONA 1L4BA 2J0UB 1TUBA 1XLTA 2PXHA 5T5QA 1R7RA 1DG9A 3ZS9A 1IB6A 1GZ7A 2WUWE 4L8VA 4MJLA 3IMEA 3NHYA 3VC2A 1TAGA 3G7UA 3NUZA 2EP5A 2H3HA 2ONZA 3VM6A 1YIDA 1UMBB 4Q3EA 1RXIA 1M2FA 3LC7O 2VYNA 3ZKWB 1DX9A 1XNJA 3U40A 5FO1A 3L5OA 1Z18A 1SXJD 3QELA 4JP5A 3QVJA 3EW7A 1OKKA 4DIOA 1JSZA 1NFRA 2B99A 2Y66A 5AOCA 3WWPA 4YY3B 3KXKA 2NP6A 1PR6A 3RLIA 5FUBA 4BGVA 2GEVA 3CEPB 3L0OA 4IDNA 2BKXA 4B3IA 1U9YA 3QXSA 4E7OA 1XQWA 4HX2A 2GWRA 4GOND 4J75A 4TX1A 3L1JA 3ZJUA 2QQFA 1R0XA 3CV3A 4RTMA 2OHJA 4EY3A 3KOWA 4FS8A 3SBDA 4DWJA 4GRIA 3C4JA 2P2CA 2QVXX 2YC4C 1L5OA 1F8GA 1XMXA 2JD0A 4BWVA 5DN6D 1RFGE 5KIAA 4IZOA 1O8CA 3UICA 3TD6A 2QLLA 2PSSA 1FFXA 3MERA 3PIRA 1VE3A 1FP6A 2KQUA 3LAWA 5K6RA 1JI0A 2ZAYA 3CUTA 1NVUQ 2HN9A 1Z4KA 4HNUA 3DW3X 2EHJA 1DBSA 1GXSB 4UHHA 2PM8A 2DFTA 4OI2A 3ZH2A 2YOHA 2WP0A 1TL7C 1DARA 1Y9DA 3IQZA 2BBTA 3K0EA 1G9XA 4OHBA 3TPFA 2GF9A 1BMDA 2OBBA 3CO0S 2L17A 1QH8A 3M70A 4ZRNA 1IZZA 2EX1A 3MQFA 4DIKA 4RLFA 5EN4A 5E8RA 5BYKA 2OFOA 4KDRA 1VLLA 3RIEA 3DKPA 2QLMA 4N82A 3AX6A 5AIAA 5CFNA 3FCXA 1I7PA 4GSLA 1VG1A 2JLQA 4HLNA 3QXXA 4QODA 4AUMA 1CNMA 3E9EA 4XCQA 1KH3A 1EFRA 2HADA 2PVSA 3FSGA 4D8YA 1O2DA 1T13A 5TDHA 3EMBA 4UXHA 1TA4A 3BG5A 1Y9JA 2J4DA 3KKZA 4H3VA 5FV4A 1QPZA 1KAHA 3ETHA 1G19A 1U9IC 4LDZA 2WDPA 3WRVA 1QK3A 4C14A 3CMCO 4TMXA 4Y6RA 3WK7A 1WD5A 5FB3A 1MXFA 2ZAIA 3UBMA 2H5LA 3FDFA 4ESOA 5C1DA 5CCBA 1KERA 1IK4A 1M6EX 3LKZA 5E1MA 3PDUA 1K66A 4QUIA 2P4HX 3OKCA 4NNPA 1PJTA 2ZWAA 2VHTA 1KZHA 4DYVA 2QN1A 1ITZA 2NVOA 4RE6A 5HW0A 2XGMA 4YRQA 3C3WA 3UAXA 3ORQA 2OHIA 3EFEA 3UCXA 4EARA 1JDNA 3H17A 1GV0A 5AW8A 4MUBA 3PA6A 3ITNA 5IJ0B 3JR3A 3L0DA 5ECDA 2VHEA 4HPXB 3C3AA 1OLSA 1JG1A 5J40A 4EG5A 4Q3CA 2FLWA 2QAGC 4YRZA 2CMFA 2AKEA 2RHDA 4MQFA 2WTEA 1FRNA 4ZAYA 4GOKA 5EHZA 3NTVA 2B1GA 1RZVA 2ESRA 4ZI3A 1OZHA 4QBKA 4OQLA 3EZLA 5EZQA 1NVVQ 5I48A 4DNOA 2FA9A 4MRVA 3NHPA 3G9QA 5FNVB 3RYIA 4BQIA 3KSAC 1GPBA 3LDFA 3EC1A 3EARA 1FB5A 4NEHB 1DWPA 3VPXA 1QO0D 1CPYA 4HDCA 4OHWA 3UFBA 1O08A 3CEHA 3ZD7A 1BO6A 3FFXA 3RVPA 2L19A 4IRUB 4X84A 5GZ6A 1M1YE 1L5FA 2XTAA 2QTHA 3ZIAA 3B78A 1HE1C 2NZ8A 1IPHA 2IELA 4D45A 1EEHA 2O8CA 4HGQA 5FKJA 1BXRB 3GCZA 3HCWA 5IDVA 4YJGA 5DW3A 3LYHA 3V4LA 1IULA 2V6MA 4KNWA 4ZEWA 4ZFNA 3GIDA 3BWMA 1S2NA 1D4AA 3DULA 3EOZA 1FIUA 3R7NA 1W0KA 2R1ZA 3ECCA 3HACA 5M29A 2D1SA 4YRCA 1UK8A 4EIWA 3HO1A 1AKNA 1YR7A 1T2CA 4LCBA 4FIZA 1EVLA 1PK7A 4LHVA 2B1IA 2CLKB 4BO6A 4EHFA 4OMUA 1QAMA 2C9BA 2HBRA 4I6EA 3IIKA 1Q19A 3AY7A 1C30A 3BJMA 5CLHA 2ZZNA 3C3MA 3RVDA 3V2GA 3I5XA 1E3EA 1Q77A 1CF2O 1HE3A 2I2FA 3BKWA 4Q1EA 3WQBA 4FDVA 4L0CA 1DU4A 4ES6A 3DZIA 5LQNA 4W7IA 1MHPA 3GEIA 1T3GA 5E6SA 5H83A 5A3QA 4TT8A 3C5CA 3QSYA 1BMQA 1KU0A 1DC6A 1UOQA 2IHZA 1KDZA 4GSKA 4GOXA 3WGVA 1LW6E 1RLTA 2VA9A 3CWQA 3VVMA 3H42B 1WVGA 1ZCZA 1W46A 1XVTA 4WHMA 3ETJA 1T9GR 1NMZA 1AQIA 2C9ZA 2FI1A 2EFCB 1FRFS 2IIBA 2J32A 1CR1A 5CFQA 3R75A 1Z45A 4I1IA 2D0DA 2H17A 4AX4A 1H6DA 2XV1A 4XVCA 3VOAA 2HBZA 5JUWA 5DGCA 2FY8A 1GO2A 1N1EA 1BWRA 2F43A 5DSTA 1CEEA 2VQ3A 2VH1A 1Z36A 2XTJA 1UH5A 4GOOD 2P9CA 2H1CA 2Z30A 1PJ4A 3BTOA 3L40A 3KRTA 3MJHA 5K3SA 1TEZA 3HDHA 3ZE6A 2H1WA 3W5JA 1XRRA 1ZKMA 3FAKA 3TI7A 3QV2A 3U5ZB 3QUAA 1Z73A 1UPAA 2B8WA 2WVGA 3KEMA 3N3BC 5ITZA 1PNRA 4E07A 5ELMA 1NFFA 5A1JA 4FYXA 1KZ6A 1O58A 5AKJA 1B16A 1MABB 1FE8A 3P5SA 5SY4A 1FPQA 4IDQA 3K5PA 1ZGBA 4Q21A 3DLAA 2XRFA 3EG9A 4QYTA 2QM3A 3CRZA 1AJEA 1DKLA 3GRFA 2VUTA 4X45A 3WNZA 2O0HA 4H6PA 3GY0A 1BYUA 2VP0A 4UKDA 1CU1A 5DIFA 3KYJB 3OPXA 1W85B 1N5DA 2QX7A 2YRXA 1GGEA 3B51X 2G7MC 3H9QA 4DDKA 3QVMA 4DOMA 4E1BA 3DAOA 2OCAA 4DAEA 3U48A 1W5BA 1W4AA 1DJMA 5JQWA 3E23A 3PJFA 4BVJA 4GYYA 4M9ZA 5CHEA 4Q37A 4CKBB 4LQ4A 3H99A 3W34A 3SPXA 1UC9A 1NVDA 3LCMA 3STWA 3WS7A 3C6QA 1ACMA 1OBOA 2YY6A 2ZIEA 3AZQA 4KU4A 2D1QA 4LSZA 3QP9A 4IHQA 4XGQA 4HZIA 3ZLVA 3FNRA 1TAQA 4FGUA 4C01A 2AV6A 1KYZA 3P2EA 2JAWA 2JGNA 4OOEA 3RAEC 2DTEA 3E3NA 1EEXB 2NQ8A 1EZZA 4XD7D 5EMMA 3S29A 3V8VA 4B7AA 5BN5A 5JI2E 2B6NA 2AWOA 3I62A 1ILWA 4JN6B 4V3CA 1L5KA 2VCHA 3BE8A 3D8UA 1KPHA 3OJOA 4FYPA 4Z9AA 4HLQB 6REQB 2V65A 3TQHA 2FPLA 4ZT7A 5AIBA 3PPWA 4MITA 2HEGA 4RJLA 1FSZA 2Z1NA 3E2IA 1PVVA 2LDBA 2FN4A 3A1EA 4DZZA 3I34X 1UXOA 3DOEA 1AGXA 3PVZA 4M83A 4DCJA 3A9SA 4JBHA 5ILGA 4D6YA 4A16A 2XF8A 6PFKA 3RRJA 2DHDA 4YRRA 3I5YA 3UKDA 3ZY6A 3HI4A 2HM7A 3ZWQA 2A9JA 1J49A 5KNBH 1B6RA 1O4VA 1TJ5A 3BX1A 2F8TA 3DE4X 3PIDA 2EBFX 2IXFA 2O1EA 2XMZA 3UB4A 2CY0A 3RFXA 1MRNA 4IZHA 1D2GA 3II6X 1PJ2A 1KVRA 3JZFA 1KI6A 2VJLA 3DGEC 4JVSB 4D9IA 5EJ4A 3DBHA 4JR0A 1XYVA 1QTRA 1EFKA 4JLSA 5FORA 1PZXA 1I5RA 2H54A 1G8MA 5TLSA 2G71A 3VU3A 2EL9A 4I8DA 4YMGA 3SC6A 3OPVA 1MGOA 3COPA 3E3LA 2XYPA 4TXJA 7ADHA 2YV5A 2WHPB 2OOSA 1CY2A 2IKSA 3HN2A 3JRXA 1ESNA 3RT9A 3MWDA 1G3MA 5K0ZA 2HU7A 4S05A 1MBZA 2A94A 2C84A 4RKQA 5LP6A 1UBKS 2IEZA 4MUFA 8AT1A 1Q7EA 2XA2A 1K8RA 4I4CA 1MORA 3D6VA 4FDMA 4HQ0A 1E92A 1SBYA 1SUCA 2DQKA 3HDYA 1U0OC 3Q9NA 1K8ZB 2OZEA 2VS1A 3JQFA 5K99A 1ZD8A 3RS0A 2GKGA 5AW1A 3TFOA 3RUCA 1WSBA 3CRVA 4LHZA 2V6FA 1NW3A 1VFPA 1FTQA 1V5FA 2Q8NA 4GOLD 4LW8A 1DCKA 4NOMA 1HDYA 4HDQB 5HJ5A 3H1BA 1QCCA 4WXEA 3DCIA 3NVAA 1TCUA 2P9ZA 2VTDA 2YN2A 3A58B 4OLHA 5K2MA 1ZI6A 5CFPA 4JV5B 4HDRA 1UDCA 2FJ0A 1CJMA 1NQOA 1AUOA 2VDMB 3L7CA 4QYMA 2H59A 3HXPA 3FFBA 5AHOA 1YJ5A 3DO6A 1Y8AA 1XR3A 3IB3A 1U7DA 2H7CA 3OEEA 4TT3A 1U0GA 3WIOA 3LUAA 1L4MA 1FLVA 4WCVA 4AJHA 1G5QA 2J3MA 3C3PA 3GFVA 3R6DA 3ZGVA 2FW6A 2QL7A 3IQDB 2HRQA 4Q19A 4UEJA 5AT1A 1N0UA 2ORIA 4U2GA 5JFOA 2G28A 1TDJA 2W8BB 1ESMA 4NBWA 3VYRB 5JNRA 1ZC3A 4A5OA 2V74B 3LCJA 2ZT8A 5A9TA 1ZNWA 2GVDC 2OY0A 4IIDA 1DXYA 1TQHA 2Q7XA 4AJKA 3D0RA 5F7ZA 3N05A 3P9NA 2OGUA 1YI0A 1QVAA 1SUDA 4MWGA 5CP8A 1W35A 3GJ7A 1GNRA 2ZXFA 3B1XA 2GF2A 2E5WA 3D6JA 3LQRA 3LQYA 4FILA 4L4RA 4PHFA 4XYBA 1UXGA 1GQSA 3KG2A 1WB5A 3KZNA 4P4NA 2P90A 3QLVC 3ZD8A 3A2LA 2IOYA 2KBFA 4G01B 1G21B 1OXXK 3BHNA 4MB6A 4GHWA 2ZBGA 3WG9A 1Y8ZA 4YDHB 3ZHTA 1JV2B 2R8XA 4KYIB 5H3HA 4GEKA 4DG8A 5IZCA 4DCMA 3J80A 1WCYA 1Q0RA 2J3QA 4L08A 3L1KA 1V16B 3J81k 4B7ZA 3LU1A 3O1HB 4RHFA 1XQ9A 1YL5A 5LJLA 2CXRA 3DAYA 4HKTA 1E1RA 5CPFA 2HU2A 4ND5A 3QOWA 2XNJA 4KIJA 1U2ZA 3USZA 4X1YA 1QH1B 3HKDB 4X97A 3W9SA 1VA4A 2HA4A 2WYUA 4UNSA 2C03A 3R20A 3SZRA 3W5IA 5F98A 1JQLB 3AF3A 4JHLA 4YRLA 5KOHB 1T0BA 4OBWA 3MILA 3TEMA 1U6KA 4C04A 3MQ2A 4HRYA 3UGKA 1WXHA 4B7XA 4C78A 4QECA 4JEIA 4ASUA 1C3OB 4LWPA 3E3OA 3DEKA 1Z0IA 4DIFA 3SQLA 4JOSA 1TPZA 3CA8A 3U81A 2PH1A 2R7MA 3V9PA 1X74A 3OQ6A 4NKRA 5HUHA 4KXYA 1SB8A 3VPDA 5K3DA 3FMIA 2CLCX 1RVV1 2FLKA 2P9QA 3ELDA 3PEUA 4RH0A 4C7KA 1MEOA 1FSSA 4JLUA 3PDWA 5HFNA 1AZTA 5E4YA 1T8SA 4P31A 2IC5A 2X3FA 2GZAA 1W36B 3X44A 1ETHA 2A3NA 4E5MA 1KI2A 1GADO 1X1SA 2XOKA 4JQSA 1YXMA 5JYBA 1C9NA 4P98A 1V4VA 4TLCA 3TNYA 5HTKA 1XNQB 1SKQA 2QYTA 5KSZA 1QRDA 2GN4A 2NT4A 1XG5A 1F48A 1OX5A 3R3WA 4XQ9A 1YOVB 4M1ZA 1PU2A 1XTVA 2G06A 4ZAZA 4NATA 1PJLA 3VQTA 1ZZEA 3PL5A 2PS0A 1V1RB 3EYWA 4J0EA 4RXMA 3H9EO 5SZJA 5TEVA 3LF1A 4MO9A 3B9QA 4QPZA 5KYXB 2QE7A 4HDNA 1N5OX 4OO3A 4C7VA 3JQRA 3NS7A 3EZ7A 2QDKA 1J8DA 3EQ7A 4QFMA 1FOEB 5B6PA 1TO1E 3LQ4A 5LLSA 3VR6A 3AKZA 2B2XA 2WTAA 4IW3B 4R2WA 4R8VA 3S2FA 2DERA 3A6FA 3FVWA 4XVQA 2FW1A 4HOYA 3QTBA 1YRBA 4DDTA 4MV0A 2IH4A 1L7PA 1FUYB 1XGKA 1V5EA 1XTJA 2EBUA 2GUGA 4BNLA 3ET5A 3LUKA 5CEJA 2IE8A 4LVOA 1Q7TA 3D3WB 4KOAA 3GLGA 1MAAA 2J7PA 3CUEF 4KPUA 2DC1A 2DR2A 1TD1A 4LISA 1OFUX 2W2KB 4FWIB 2WM2A 2X2PA 4TMTA 1L4YA 3SF8A 4DRXB 4M1QA 3HVRA 1PFVA 3HCNA 4ZALA 2P4EA 1TE2A 2AKAB 1RQXA 3DEZA 1XLVA 3NHRA 1IEXA 3OBBA 4TM8A 1SC4A 3WLIA 4D4IA 1AKTA 1OREA 5DEIA 5AK3A 1YB1A 2VNHA 3UMMA 1JEQB 3KFLA 3OY2A 3JW8A 5AKKA 1WQ4A 4ZHQA 1N2BA 3WNCA 1JLSA 3B53X 4CN8A 1MT0A 3C3DA 2XQVA 3KUDA 1K5GA 3M4NA 4WRRA 4ZYWA 5IU6A 3FOEC 1XZFA 1BVHA 4LJRA 4DR2B 2P4QA 4M0CA 1AQUA 2ODPA 4M1SA 1WZEA 1RWNA 1OLUB 3EIUA 4HDKA 3ND9A 3WLMA 1A77A 2D0OB 1TLTA 1RPAA 2AC2A 4NIMA 5AHKA 3CVUA 4XB1A 3MM4A 2JLAA 1GYQA 3FVQA 3G59A 4A7PA 1WL8A 3RWMB 5LOVB 1SQ5A 4RIGA 1NI5A 3PFCA 2I7TA 3QHQA 4N7JA 4Y1RB 5SYMA 1IPFA 4OM7A 1D0SA 2AJTA 1OE0A 3M6LA 5EJMA 5HF8A 1FLAA 1ZSYA 1E1YA 3O31A 3IXLA 1M83A 3JSAA 1AURA 4UHJA 4D1YA 4D5GA 2F4NA 3WGGA 4IHAA 1HI9A 4YLEA 4LXYA 3VNSA 3DS8A 3FZGA 4ZOEA 3VOBA 5COQA 2Z0MA 3GC6A 1FU7A 3ORFA 5HGJA 2OM6A 1KQPA 2XB4A 5C8DA 1FVXA 2Z08A 4PYLA 2FK7A 1O6BA 1CR6A 2R79A 1IEQA 4A4DA 2WHQA 1DC4A 2P7HA 2QTAA 4CG3A 1DG1G 2PGJA 1NNI1 3ILYA 3T5BA 3ORHA 5IWCA 3NBAA 2H2HA 1RWXA 4TM7A 4CTJA 3ZX5A 3IOYA 3HLYA 1VE1A 3NJ4A 3MTJA 3E3MA 4A9AA 3PJEA 3R76A 4UASA 5IX8A 2FR0A 1SRQA 4OHMA 1UM9B 3EAFA 1BKSB 3NYWA 1NJ1A 4X92A 3WRYA 1FA9A 1GTMA 3TM5A 5T7BA 3ZWAA 1FMTA 1ZJ6A 3DUFA 3ESYA 4FFMA 1ZCJA 4MA0A 5DNUA 4EUSA 4NZMA 3QBTA 3ANXA 1EJ2A 1OFUA 4P82A 2ACKA 3KP1A 2J9XB 1IBMB 4PSDA 3VJRA 3VU0A 3EWAA 2O2ZA 3W2FA 3P0RA 3KKMA 2P6NA 4HNAA 5CUQA 4DR7B 4MI6A 4WLEA 3ZXXA 3K30A 1GNLA 2LD4A 4KQ9A 2VDWB 4ZVUA 2O4UX 2GAJA 2DPXA 4PG4A 1L5GB 4C0JA 5FH9A 1NQTA 4F0JA 2GPSA 3MWLA 3T7SA 2FMTA 4MWTA 5DX0A 1CDOA 4FR2A 3LY9A 1XD9A 4HLUC 4RZSA 4X6YA 1OI7A 1HSOA 2YMMA 3I2IA 4B76A 2NTNA 2WJJA 4MS4B 2C4TA 3B1JA 2ZSIA 3IT0A 3H1EA 3KU4A 4HXEB 2QRVA 3VR1A 3DR5A 4BOYA 1YDWA 3GV0A 3U3MA 9GPBA 5AVUA 2GFHA 1D04A 1GIAA 1WCWA 3KC2A 4BBAA 3HXOA 1KI7A 3M5CA 1NPYA 4GM0A 4NCNA 2P2DA 1E64A 3HQ4O 3HCRA 4J0IA 5KQLA 4M1EA 1H4TA 1CZHA 2AFRA 2VRCA 2IHKA 3GEHA 3NW9A 4JJ4A 4M9XA 4LHYA 2R4UA 1BCSA 4P8RA 2ZB8A 1Z37A 4ZPXA 5BUSA 5IEJA 1RQLA 1GPJA 1Y98A 1Z9BA 2DQSA 3AHDA 3CJRA 3GCGA 1Y1SA 1XPJA 2B4RO 5JCOA 3DBLB 5CTJA 1KMIY 3TFQA 5KQGA 1GL7A 3E3AA 1ESCA 5D6OA 1KVSA 2ACEA 2A9KA 5NULA 2BMAA 1PT8A 4OP2A 4OHKA 2FF7A 3B48A 3DLHA 5AM0A 3K7EA 4QJBA 4KMOA 2P9GA 5GJBA 1DRJA 3GHYA 1Z39A 5KYYB 3AIMA 5EESA 3ZDFA 4KMMA 1ZISA 4OH7A 4W99A 3CLHA 4LYDA 2Z4SA 4HQRA 2O54A 4HXFB 4OHXA 1CVRA 3VZCA 2YH2A 4JT9A 2XJ9A 1XIVA 3ESDA 1T3LA 1MR3F 2HQSA 5PNTA 3V7NA 1SC1A 4OJQA 1CX9B 1QKKA 5KX5A 1R2QA 1TF2A 1KQNA 1BMFD 2VHZA 2HDNB 2W6ID 3FTDA 2OPHA 3SCZA 3RUFA 3DAPA 4ZZ2A 1N6PA 2F67A 3L4JA 3WBBA 5EWMB 1YWGO 5FFMA 3N8NA 1U0EA 2XWJI 1P72A 4EGAA 1EGQA 1VHTA 2ZRIA 3AP3A 1S8AA 4LQCA 2WIFA 3GDFA 4UPEA 1NSYA 3PQ7A 3K70B 1IG3A 3F7OA 4AY3A 4EZIA 1GQQA 4LC9A 2O8BA 2EZUA 3RSGA 3BGWA 2WF7A 5JH7B 3CJTA 3TTUA 3TLKA 4RF5A 4EMBA 3NHZA 2O20A 5DBFA 4F12A 4WBNB 2OD2A 4U6NA 5B3KA 2VG8A 2D74A 5LM3A 4GI5A 2GZRA 2QRLA 3F3YA 4HTFA 3RS4A 2VDKB 4B43A 4DBZA 1KF0A 1JQDA 2PVCA 4HS9A 2CKMA 2OCDA 1ADBA 1MVOA 3JX9A 1IXRC 4GMXA 5JAQA 3CWZA 3HJGA 3SKXA 3GP5A 4H4CA 5M34A 4RTNA 1BW9A 3B82A 1PQ4A 2M98A 1LU9A 2QTGA 3OY7A 4WEOA 3A1VA 3ZV5A 4AKEA 5K8TA 2V9CA 5ISMA 1DMSA 4KFRA 1MIOB 2JARA 2BFPA 3DLTA 2AW3A 2ZWOA 3KYIB 1II8A 3IJEB 5FWAA 4XX0A 4BL5A 3DBRA 4Q15A 3GXBA 4EM6A 1RTTA 3BICA 4E2XA 5BR1A 3FCOA 1RPJA 3RVQA 4BGUA 2G8NA 2LGJA 1O94D 3G7SA 3IBCA 3PC3A 4BNWA 1YONA 4E2WA 1IIBA 1RCTE 2IQ5A 4H18A 1X7ZA 2Q1WA 2R6DA 4JLAA 3RUDA 3U4AA 4NXMB 3OA2A 3LWNA 1IQ0A 1XYGA 2FUNB 2G4VA 3W3ZB 4ZI7F 3IS3A 1AGPA 3THSA 2BTEA 1UBTS 3ICOA 4DA8A 2O2YA 1UJ2A 2ZI9A 2XXAB 3L8FA 4G1BA 2NZJA 1LV8A 1BH6A 3GPCA 3SOPA 3WFZA 5I9LA 3UO8B 1G7SA 2QY6A 1GEGA 1I33A 1HG1A 4Q7EA 1Q11A 1UEJA 1D2NA 1N9ZA 1KE1A 3UT0A 2RH9B 4QOGA 1QQAA 2AX3A 4CMIA 2FX3A 2ZJ5A 3AU8A 1DWOA 4YR9A 3C7CB 4WCFA 5EZYF 4W5HA 2G8LA 3PD7A 2ZUWA 1NJSA 3VKGA 1VFNA 4Z4HA 2ZRLA 3D8TA 1XN1A 4QELA 1Q95A 5FUXA 5TS2A 1OXTA 4NV3A 4U0JA 1R4ZA 5CGZA 4HEQA 3OA0A 1PIWA 2YUIA 5EEGA 4JGBA 1S2LA 1LD3A 1HDXA 1NKTA 4ZVKA 2RHLA 4IGKA 3JZAA 4RU1A 3C74A 4D3XA 4DIDA 5K01A 4RHYA 3UCFA 4ZWNA 2Q50A 1X8JA 1C3JA 1KI4A 2RGYA 3WDLA 4DMLA 5I7WA 3PJDA 3T3OA 5IVKA 3L18A 5LZ9A 2JEOA 1ZN9A 1ARZA 2PG3A 3HN7A 3EXEB 3LGSA 4KGVA 1W19A 3NMUF 4HN9A 4KQ1A 5EQDA 1KJYA 1OZFA 2GNAA 2ILVA 1JXQA 4GSYA 4G81A 3T0GA 1NF8A 5F3RA 4Z4IA 2FN3A 5AWFC 4Y2HA 3UNXA 3IV7A 3DXXA 4LVCA 5GADl 4UOZA 3PGJA 3ZV3A 4LXGA 5DTIA 2O0KA 3WMXA 1U1EA 1L4KA 1MV8A 3A6EA 5KKNB 4JP8A 2ZOSA 2H51A 1SQFA 4KAXA 3FGPA 3VR4A 3TUJC 3VV2A 2ZJ7A 3R5XA 1NUUA 4P3YA 3Q0EA 4Q1FA 4KNVA 5K0EA 4RO0A 3DZHA 3I9KA 1OIXA 5DW0A 3TZKA 4B6SA 4YV7A 4HB4A 2VPIA 3IUSA 3OO1A 4ON9A 4C7BA 1MC1A 2ZSDA 4CZ2A 2YFKA 2R6JA 3DMTA 4TROA 1UAAA 4BC0A 5DPMA 1M5UA 2XKAA 1T8RA 2W5UA 1CY4A 1F51E 4OQPA 1WB9A 3NR2A 4IHJB 3OFVA 1WZ2A 5DWDA 1H9AA 1US8B 2OQ2A 5CGQB 4K1XA 2OZKA 3LPDA 3KAQA 3DGFC 4ZCQA 5A02A 5M7EA 2NVWA 2VJCA 1XTTA 3RUPA 4FFLA 3CRQA 4PHTA 2GZHA 3LX6A 4N39A 2DUWA 1KDPA 4KGXA 1FU8A 1DEKA 1QYWA 3GJ5A 3TIFA 3O26A 3AEKA 1CWUA 1NVXQ 1UBSB 2JHGA 2VEOA 2WZBA 4NMXB 5E7IA 3WQQA 2HZ7A 3D0KA 3M82A 4KZPA 1L7OA 1T1EA 1OH8A 4P32A 2Z1DA 4DM4A 3N75A 4C4ZA 1H1LB 2OZPA 1KDTA 2PD6A 3MLEA 5GIPE 2C5LA 3BVPA 2J6BA 4CLOA 3DE6X 3TAHA 3BZBA 5IDQA 1GPWB 3L7KA 3O4HA 5JI3E 1E9RA 1E5XA 1O96A 1J25A 3UA3A 5CXSA 3GGOA 4FLEA 4IXNA 4MROA 4G9BA 3OT1B 3TE7A 4GC9A 4MS3A 3RK0A 1JLKA 1WBBA 1L5MA 1L5VA 2RGDA 5F2OA 4W5RA 2JKZA 1XTBA 2MMCA 3GLGE 1E60A 2EIXA 2F3SA 4OHPA 2OYRA 3ZUPA 2FZCA 3TCNA 1ZMXA 2XBUA 3GLQA 1Z6YA 3LZDA 4H7PA 3X0DA 4AUNA 3IX7A 2HHJA 5KNBD 2I4TA 3FYUB 1K9VF 2HYIC 3H1TA 1VB5A 4E5SA 2QN8A 4RSHA 1D0VA 1OAOA 2Y0EA 3VMFA 4G1VA 3N0VA 3OX2A 3D6FA 1GAQA 4P92A 4MYUA 1YV9A 2FPOA 3L7JA 3PL1A 4UCQA 2BF7A 5AD1A 3KLBA 2V0NA 4M89A 2GRUA 1IQPA 4NEQA 3CIFA 2FR8A 3H4IA 5LA6F 1X1CA 3O8RA 5C18A 2IZ6A 3E9ZA 3W9UA 4PLPA 1WS6A 4V1CA 1S01A 5J4YA 3S4YA 1T1SA 3MRSA 3IELA 3LP6A 2Q6LA 3PQ6A 3ZW9A 2J9GA 3NC0C 4HJXA 4CMJA 5DJ5A 1VL2A 5FBVB 2G40A 4ATNA 3STHA 5ETJA 2ZRGA 3QX9A 4XM2A 3U44A 2P27A 3EXHA 3DL0A 3KT3A 5K2OA 2QZSA 1N7IA 3ZI7A 1OBVA 1YH3A 2XCRB 2Q1YA 2X6TA 2AC4A 1RKUA 5GY7A 2NQ2C 2AJLI 2X40A 2ZBQA 1KO7A 4MTCA 5AKGA 5JAZA 1E89A 1ZVKA 3DOUA 4FNAA 3MELA 4RZ2A 1JIJA 3NEYA 4RPLA 5ALTA 3ZQ6A 1OBHA 2XY4A 3ZDEA 1I30A 2BN4A 4LMPA 1FZTA 3QKRA 4MGYR 1D9XA 2AF3C 4ABTA 2Y9MB 1JTVA 4S35A 2VLIA 2Z2KA 3HP7A 2D7DA 1C3XA 1P7PA 2RK3A 4U2CA 2O14A 4UBKA 4X65B 1EVEA 1YZHA 3CR7A 1QHXA 2HB6A 3GYGA 4BWYA 5DNWA 4M3NA 3OLWA 2AG5A 2JJMA 2JAXA 2MSWA 3GG9A 3DQQA 3RUEA 3SBOA 2KYRA 5LQAA 5BR7A 2XYRA 5A04A 3N8IA 1WMSA 1U3DA 2RHRA 4EA8A 1E2EA 1NLMA 3COVA 3GN1A 1YE8A 3DMGA 3JQAB 1MVLA 2AI1A 2JLBA 2OXFA 5KNDA 1E2QA 1U2GA 3Q9UA 5AK5A 3JVEA 4A8TA 1YGPA 4J0JA 4MUKA 3INTA 4H0CA 4N5MA 4G37A 3EB9A 1GQOA 3BZUA 1MFPA 2P0YA 2OFPA 1VKNA 4IDDA 4OA8A 4MUXA 1U28A 5H02A 1IY8A 1JMKC 3KSMA 5BRNA 1UR5A 1CQJA 1T25A 3SC2B 4URVR 1F7UA 3NYRA 1T5LA 3KXLA 1D8AA 1GPH1 4J90A 5FV7A 2G76A 4NZOA 5J5CA 1SO8A 4WOPA 2NV6A 1A5AB 1GU1A 3GMIA 4JDPA 721PA 3TUZC 1NJ8A 1NW5A 2B37A 1ISIA 3G9XA 4G8BA 3FSEA 3ZU5A 3PJRA 4QATA 4QGBA 2FW0A 3HKBA 3MTAA 1GFWA 3ISTA 2GUWA 3CR3C 4QL3A 3RBZA 1V3UA